2IPAA

Solution structure of trx-arsc complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
104
structure length
104
Chain Sequence
b'MAIVKATDQSFSAETSEGVVLADFWAPWCGPSKMIAPVLEELDQEMGDKLKIVKIDVDENQETAGKYGVMSIPTLLVLKDGEVVETSVGFKPKEALQELVNKHL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thioredoxin
publication title Conformational fluctuations coupled to the thiol-disulfide transfer between thioredoxin and arsenate reductase in Bacillus subtilis.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Electron transport/oxidoreductase
total genus 31
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2006-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2ipaA00
5FWGA 4PNFA 5HR3A 3L4NA 12GSA 1ERWA 3RBTA 4IKHA 2VL3A 4TR1B 3MAKA 1FO5A 3I43A 2H0IA 4EDZA 4HZ4A 1GULA 5CNWA 3DVWA 1ZMAA 3BOAA 1TW9A 4K1FA 5GAND 1OC9A 1ZYQB 1WMJA 1SJ6A 1V9WA 1GLPA 1N8JA 3EMPA 3GH6A 1XWBA 5HR2A 1ABAA 5C04A 2P5QA 3ZITA 4XIHA 3ME7A 1ZZYA 5D93A 4GF0A 1GL8A 1ZOFA 3DWVA 3F8UA 4YQUA 3ZL5A 2F3MA 4WR5A 17GSA 4MF7A 2H71A 2JZTA 2BTOT 3FKFA 5G30A 1R5AA 4I5QA 1YEXA 4OCFA 1GNEA 1JZDA 5HR0A 2HLSA 4PQHA 2KP2A 5D9WA 1O81A 3R2QA 3K8NA 1HNCA 2DJJA 3W8JA 4PQIA 3VWWA 1VF2A 3TRPA 3HVXA 2FCHA 1TJDA 4L5OA 2HRNA 4N11A 3C1RA 3HHVA 5F05A 4X1UA 2REMA 3CSHA 2WGRA 3WT1A 3UEMA 5HQPA 1T7PB 1ERTA 1YKCA 4V2NA 4POLA 3EE2A 2PERA 3VURA 5EPFA 2GZYA 5GSSA 1NW2A 2IMEA 4OMVA 2VL9A 1RQMA 2CZ3A 2O7KA 1GSDA 3CSIA 4NAXA 2HI7A 2VIMA 4CHSA 5IQYA 5IOWA 5J3RA 4L0WA 2YCDA 4DSSB 3M9JA 4GQFA 1VF4A 2H73A 5FT3A 2CVKA 1BEDA 1QK8A 3DMLA 3QFAC 5G5FA 3ED3A 2KHPA 2LNTA 4KDXA 1O6JA 4K6XA 4KA0A 4IGJA 1F3BA 1GTBA 3GURA 3FRCA 1FG4A 5JCWA 4V2MA 5CAXA 2GGTA 2RLIA 1BAYA 3KP9A 3W8SA 1UC7A 2GLRA 4ZL7A 2XPDA 4GSTA 4MLYA 1GH2A 2MMNA 3WGEA 1K3YA 1EWXA 3H79A 3U5RE 2XBIA 2P5RA 1VRSD 3I69A 2WCIA 1B4PA 2R37A 3D22A 1SKWB 2DC5A 4K0GA 2LNSA 5DDLA 2JACA 1H4OA 4WETA 2JL4A 3PGTA 1R5PA 4YAPA 4HZ2A 3D21A 4OFMA 4TXOB 4Q5FA 2H1BA 4Q5NA 3IK7A 2OE1A 3MSZA 1PN9A 2YWNA 6GSVA 5ECSA 4AJ7A 2DSAA 3TOTA 5DAKB 5IPHA 2DJKA 3ZZXA 3QR6A 2KLXA 3LQ7A 2DLXA 2I3YA 3DKSA 4BVYA 5HFGA 1J08A 3F4SA 1EV4A 3CTGA 1O8WA 1YZXA 3A2WA 1PRXA 3UARA 5D9TA 1I5GA 2H76A 2J23A 4ID0A 1EOGA 2G2QA 1W89A 3GV1A 1XBSA 1TK0B 1G0TA 3Q74A 3DEXA 4J56E 3UJ1A 4ML6A 3C7MA 3KCMA 4HQZA 1FOVA 3EMXA 1PKWA 5J41A 3D4TA 3DXBA 4POKA 1SK2A 1DBYA 5IMDA 4LMVA 3ZVJD 3UL3A 2ZNMA 2GVPA 2L4QA 4FH8A 1GSQA 1QXHA 3ZMKA 4O32A 2YPMA 5ECLB 5EVOA 1O8XA 4IP6A 3S9FA 3KJYA 5CO3A 1PKZA 4WEYA 3ZFBA 2H0HA 4D73B 2GQMA 5ECHB 4GCIA 5ELGA 2JSZA 1WJKA 2FWHA 3QD9A 3JCML 1A0FA 2VD0A 4TVEA 4HDEA 1N2AA 2VL2C 2IFQB 3RAZA 3KH9A 4P3YB 2FUG2 2BJXA 5CYYA 3OR5A 2V6OA 2L4CA 3BCKA 1G7EA 1AQVA 1XWKA 2FNOA 5F8BA 3TKSC 1CQGA 2WJUA 5A4UA 2OKAA 5B7CA 3ERGA 2RUEA 4K7IA 1SL2B 5F06A 3FHKA 2GSTA 2LV3A 5A4WA 2H1GA 4I2UA 3HDCA 4XRDA 2VCZA 2E2GA 1EOHA 2HZFA 3G7IA 4TR4A 2HZEA 4E8HA 3FZAA 3KMNA 3P90A 3HVVA 1K3LA 2F8FA 1TP9A 5DQYA 4AJ6A 3ZREA 5IM9A 5IO2A 3GHAA 4MJEA 3EU3A 3VLNA 3WD6A 1JZWA 3A3TA 4XCSA 4PXOA 1OKDA 2VLTA 2B5YA 3LG6A 2JSYA 4HQSA 4DEJA 3PINA 4MF6A 5ENUA 1MD4A 3M8NA 4KB3A 2VO4A 3MNGA 2C8UA 4G10A 2G0FA 1BQ7A 2KP1A 3QOUA 6GSXA 5IIZA 4V1Ag 2NTOA 2OE0A 3CSJA 3QDNA 1UN2A 5ECKB 2HSHA 2H30A 1V98A 3H93A 5KN3A 1MDJA 1Q98A 1LBKA 1NHOA 1WRYA 1BX9A 1TRSA 1Z6NA 1B4QA 5G2ZA 1E6BA 3BJ5A 3GRXA 3D0ZA 1S3CA 1SJIA 5LCZA 1U3AA 2B1KA 4F03A 2GS3A 2P0GA 2PGTA 3VK9A 1Z9HA 1AQXA 3ISOA 4PQ1A 3HVSA 5ECNB 1WPIA 3FW2A 3A5WA 4KSOA 4Q5QA 3F9UA 4TOPA 3DYRA 4ZB6A 5IMAA 1T00A 4RUVA 2OBKA 5HFIA 1OE7A 3G9BA 2LKUA 2K8SA 3FZ5A 2KUCA 1HYUA 4PGTA 1GUKA 4K2DA 16GSA 2GT5A 3CXGA 2L6CA 2E7PA 4YAVA 5J4UA 2WDUA 2IIYA 1V57A 3LYPA 1XWAA 3GUSA 2XPEA 4GXZA 3G7YA 1ST9A 3IXRA 2R5GA 1ILOA 3VI5A 2LTKA 1AC1A 1GSEA 3IAM2 1GSYA 3FZ4A 3V1WA 3GL3A 1F2EA 2FWEA 2PVOC 1X0RA 2XHFA 3KH7A 5ABRA 3H4KA 1FHEA 2L5OA 3A2VA 1F3AA 3HY2A 1G6YA 3LEFA 4KNDA 4TN8A 3IRAA 3M1GA 5FHIA 1GSFA 3SBCA 3FR9A 1M0UA 1XVWA 1X9MB 2R3XA 1SENA 1YQ1A 2HE3A 2TRXA 1YEPA 5DVBA 3TGZA 4DSQA 3DVXA 4ILFA 1M9BA 3SWLA 5B8BA 3APSA 4MA9A 1O7UA 2X99A 4KAEA 2GQLA 4JEDA 3F3RA 2WS2A 2YZUA 1QQ2A 3FZ9A 4KUNA 5E4WA 2YV9A 20GSA 2IMKA 2H66A 1PX7A 4EL1A 2FD3A 2IMDA 3VWXA 2OA7A 2K8VA 2H74A 2NVLA 2I9HA 2DJ1A 3AY8A 4G2EA 3ZIJA 1SKRB 4JZQA 3BD2A 3F0IA 1KTEA 2V2GA 2ES7A 4GTUA 1FVJA 5B6NA 1TKDB 3WT2A 1ERVA 2B5XA 1GTUA 1K3OA 1B48A 11GSA 5IOXA 4MZCA 3TKPA 1MDKA 1DE2A 2WULA 2TIRA 3KTBA 2YZHA 5DCHA 5E59A 2AB6A 4BWSA 4OFNA 1J9BA 1OC9B 1BG5A 3EC3A 3EVIA 2B1LA 1Y6EA 4G19A 2M80A 1ZL9A 2C3QA 3NOFA 8GSSA 4WKWA 1PA3A 1WIKA 3LFLA 4OCEA 5CRDA 3IR4A 1EGRA 2H0GA 14GSA 4KE3A 1BYEA 4MABA 2GQKA 4O5RA 5G1KA 1SKSB 3F63A 2M72A 1RK4A 1PGTA 1IYIA 3ZTLA 3LORA 1MEKA 2VCWA 2D2ZA 3TKSE 2FA8A 1FVKA 1MTCA 2K9FA 3TB2A 2MMOA 3IDVA 1IYHA 1EGOA 2F8AA 2EIOA 3NZNA 2CAIA 2B7JA 1LJRA 2A4VA 3LSZA 4IP1A 3GYKA 1SK1A 4WBRD 4MJAA 1U88A 4ZBBA 1QMVA 1TXXA 3LJRA 3RPPA 4LL4B 1X9SB 4HU9A 3P7XA 5H5SA 4GSSA 1ML6A 3VWVA 4GQCA 2I4AA 5D9XA 1K0OA 4IS0A 4MP4A 2WFCA 3ME8A 1HD2A 3L0HA 3FK8A 3GTUA 2LS5A 1Y25A 3TJBA 3UIWA 4EKZA 6GSYA 2ZUPA 4GSNA 1SD9A 2VOCA 1O85A 3QCPA 4PX1A 1DSBA 1TRUA 1Z7RA 5DCGA 2XBQA 2QGVA 4MDCA 1NSWA 4BWQA 5GAPD 3EWLA 2CZ2A 2OE3A 2H72A 5DJMA 2P31A 1XW5A 4F0BA 1A23A 3GNJA 3QAVA 3GKMA 2R2JA 4L5LA 4MPGA 5GZZB 2VLUA 1EEJA 2HSYA 5A5KA 3TUEA 4JU5A 3O3TA 4ZILA 4N0ZA 1AUCA 2C4JA 3TKRA 3E3EA 4MMMA 2V32A 1HQOA 1V2AA 4Z7XA 1F37A 2O89A 4IBPA 2RM5A 3WGDA 4QQ7A 1XPVA 2B5EA 5DJLA 3VI7A 1H75A 1THXA 1OAZA 4X43A 4ZL9A 3UOMA 1SL1B 1GTAA 2PWJA 19GSA 2CV4A 2HNLA 1SD8A 1YDKA 4BA7A 2X8CA 1V58A 5CRWA 1TK5B 1T1VA 9GSSA 3KIJA 2GSQA 4MH3A 3P8WA 4KDUA 1FAAA 2A2SA 3ZYWA 1SYRA 2CX3A 3GMFA 1ZYEA 1SYXA 1FB0A 4V2LA 1B8XA 3HYPA 4LL1B 4BL7A 2YANA 2LEGA 4EVMA 1EP7A 4J57E 4EE0A 1O73A 5EL8A 2OACA 4KCEA 4IQ1A 2R6KA 3IK9A 5C00A 1XXUA 3WGXA 2VL2A 1Z7PA 1QGVA 2ON7A 4XS1A 3TJKA 3CYNA 2Z9SA 3ZRDA 2RM6A 4WR4A 3VPTA 2LRTA 3UVTA 1T4YA 2HFDA 5JWQB 3GFKA 1M99A 3TKSA 1EV9A 6GSTA 1JZRA 3KGKA 2H6XA 1URMA 2L6DA 2C0GA 3TCOA 3U6VA 2XC2A 2JU5A 4X0XA 2LJRA 2OBIA 5ECIB 1TK8B 1T4ZA 3IV4A 4Q5RA 2LJAA 4K8MA 1M2BA 3M3MA 4DVCA 1GSSA 4LMWA 3HKRA 2CQ9A 5DALA 1MD3A 4ZBAA 3FR6A 4K0NA 2DJ3A 22GSA 1PQNA 5AIXA 4ECBA 5EY6A 2B3SA 1Q4JA 2H70A 2VCTA 3VPQA 4ECCA 1F6MC 4PNGA 5JCGA 2GT6A 2L5LA 1KEBA 2PN8A 2IMFA 3LYKA 1DUGA 3PR8A 4V1Ap 1NM3A 1USBA 3RHBA 1DE1A 13GSA 1K0DA 2H6YA 3TRQA 3GH9A 3C71A 1OYJA 2QSIA 2V41A 5ECOB 4I6XA 1LU4A 1YJ6A 1VF3A 4WBJA 2HZEB 5ECQB 2R4VA 3KMOA 1YKAA 2KOKA 1Z6MA 6GSWA 10GSA 2WB9A 2ON5A 2JADA 1XVQA 2LQOA 1JHBA 4FYUA 5ECRB 5AIVA 4JBBA 1XW6A 4ACSA 2C3NA 3Q19A 1PL2A 4ISDA 3IHQA 1PMTA 4XTSA 2CAQA 3ERWA 2K18A 3M0FA 2CVDA 1ZCPA 3P2AA 3UMAA 2H1AA 2VCXA 3RPNA 5ECPB 4HJMA 4POBA 1GUHA 2YJHA 1K0MA 2IMIA 3CTFA 1GNWA 4CDOA 4KX4A 4TR1A 3L9VA 4OFTA 4K9ZA 2V6KA 2GSRA 3I6AA 4IHUA 5ID2A 3GN3A 5DBQA 2IWTA 3GL5A 3FYGA 3D6IA 1XCCA 1JLWA 7GSSA 2C0FA 3GX0A 1OVNA 1MDIA 4MH2A 4I8BA 5JWOB 2F51A 2TRCP 3J7Yk 4O7HA 1S3DA 2PVQA 4WF4A 3IBHA 3CRTA 5KN2A 1K0CA 1QFNA 2O87A 5CREA 4ZB9A 4CW9A 5INYA 1R26A 1XZOA 3VWUA 1WWJA 3F6DA 3N9JA 5IO0A 4L0UA 4ZXGA 6GSUA 4TXVA 3IPZA 2YP6A 1YF1A 2E2MA 4GWRA 2EIQA 2CA8A 3W6GA 1GUMA 4GLTA 2YWMA 2C0DA 3BCIA 3TDGA 2DJ2A 4F2IA 3LWAA 3EURA 5G31A 2N5FA 3J7Yb 3D5JA 5CRHA 2AV4A 3TJGA 3BBYA 1M2AA 5D8IA 2IJYA 4TR3A 1JZOA 2HXKA 4XS6A 4KCAA 5ID2B 4FIWA 5IMFA 2LUSA 2EIRA 1A8LA 4H86A 1PX6A 2X8HA 3GKKA 1YY7A 3DRNA 1U3IA 2M46A 2C1YA 2CVBA 3WYWA 3GX8A 1W4VA 3IA1A 5IMCA 2GZZA 1U87A 3LXZA 5AN1A 4J2FA 5CRGA 4MPFA 3VFIA 4ML1A 5DQSA 1HNAA 1KNGA 4EUYA 1XWGA 2MMAA 1JLVA 4NPBA 4E8EA 4F0CA 1WP0A 4KGIA 2AJQB 1XFLA 5B8AA 2NBSA 3HCZA 3N5OA 3KTLA 2F9SA 5JCUA 1M2DA 3LXTA 5LD0A 4DSSA 1K0NA 4MF5A 4EO3A 4DSRA 3I9V2 4HOJA 3G7JA 4XHMA 5COHA 4PUFC 3GKNA 2QC7A 1TU7A 1XOAA 1T3BA 2YWIA 3HZ4A 2GZPA 2YWOA 3NIVA 4EDYA 2CT6A 4KSMA 4OO5A 4JE1A 3L9UA 5J5NA 4KH7A 2MBSA 1AW9A 1SL0B 5L71A 2WRTA 2YNXA 4IELA 18GSA 2DJ0A 3ZFLA 6GSSA 1FB6A 3C73A 4RI6A 1SK0A 2E0QA 3L78A 3UAPA 2H6ZA 2RUFA 2GTUA 4ZL8A 1AAZA 3KEBA 1X5CA 2HYXA 4FYBA 1A2MA 2N5AA 3CBUA 2B6MA 2C0EA 1WOUA 2EC4A 4TXOA 3US3A 5H5RA 1AXDA 3D4MA 4MJCA 2NDOA 5IMVA 3KZQA 1THOA 2PPTA 2MYGA 3PH9A 1XOBA 3QPMA 4EF0A 4MZWA 5DAKA 3F4TA 4KDYA 4XS4A 1WE0A 1X5EA 2DIZA 5JWRB 3UBLA 4ULXA 1GRXA 4POMA 2O85A 3HD5A 4TRXA 1NHYA 2FA4A 3CRUA 3QFBC 3RHCA 3QAGA 3F6FA 1ACVA 2WZ9A 1Z5YE 3HZ8A 2J9HA 1HNBA 1SJZA 4BPYA 1K0AA 3L9SA 1JFUA 3DGQA 4HU7A 1J0FA 1M7TA 5AGYA 1EP8A 3DD3A 1OE8A 1CQHA 2HT9A 2FHEA 4AF2A 2FWGA 2JZRA 3TOUA 2X64A 4IVFA 2YOIA 2C80A 4NHWA 2LSTA 4HEA2 4XRAA 3QAWA 3GSSA 2C3TA 2VM2A 5IMZA 4D73A 2O8VB 5ELAA 4GRFA 3O6TA 2YN1A 3E9JB 2AAWA 3DIEA 3EYTA 4I97A 2IFQA 4XS4B 4MJBA 2LRCA 2VUPA 3O76A 2FGXA 1OC3A 1TI1A 5HR1A 3RDWA 2NPBA 2HRFA 3H1NA 2LJKA 3IE3A 4RI7A 5D96A 1TU8A 4OWYA 3GTUB 1UA5A 2VAFA 1T8EB 5D73A 1VGLA 1A24A 1S3AA 2H1DA 1A2LA 3F4RA 3FR3A 4F82A 2H19A 4NMUA 5F07A 5KN1A 2DMLA 3KM6A 2DIYA 4PUAA 4NV5A 2VCVA 1PSQA 3GIXA 4ECIA 4EXJA 2MZCA 4HUAA 5H5QA 1QUWA 2B7KA 3TKQA 2V1MA 1GLQA 1X5DA 1Z3EA 2OJLA 4AGSA 4NHZA 1G7OA 3F3QA 3UVHA 4I2TA 2QKEA 4BVXA 4MCUA 2K6VA 1KBNA 3UBKA 1E2YA 5LNKe 2A2RA 3HJPA 3HA9A 5KN0A 4KW6A 1GP1A 1UVZA 4N30A 1AQWA 3TJJA 1A8YA 3ZMLA 2IPAA 3KP8A 5B6MA 1RW1A 3FEUA 5J9BA 2CX4A 4EC0A 2L59A 4OD7A 1PD21 2H8LA 3Q6OA 4MK3A 5GSTA 1SU9A 3C8EA 2FWFA 5AISA 3IOSA 2LQQA 2DMMA 3GKXA 2RIIA 1K0BA 1GWCA 3Q18A 2GDRA 2VD1A 1TDIA 1C72A 4N0VA 4ZB8A 1EEMA 1M9AA 4IN0A 5CP1A 4HJ2A 5J9CA 3TJFA 2YV7A 5A4VA 2FLSA 3MDKA 5F0GA 2FY6A 1F9MA 4WXTA 2GSSA 1TRWA 1PL1A 1ZGNA 5IPGA 4IJ3A 2YJ7A 1AIUA 3ZVJA 2IL3A 4PURA 3APQA 3LGCA 4ECJA 1OC8A 3GA4A 4YH2A 1A2JA 4IW9A 3HJMA 4RQRA 3KXOA 4NV2A 1U6TA 3ZLPA 1B9XC 2OADA 2PU9C 4QL9A 4TW5A 1B9YC 4OO4A 1A0RP 1ON4A 3GSTA 3MWHA 4O92A 3EU4A 1OKTA 1TOFA 1X9WB 5G5EA 4L8EA 3QMXA 4G9HA 3H8QA 3FY7A 2ALBA 2X8GA 1FW1A 2LRNA 3ERFA 3IC4A 4TR0A 3KD0A 4JR6A 4QL7A 4AJ8A 2AUVA 4JR4A 4JRRA 1XW9A 1R7HA 4IJIA 2N5BA 4YQMA 2MMZA 5DALB 4HI7A 1EZKA 3IAS2 5ECMB 4NWYA 2PBJA 3HXSA 4HS1A 2H75A 4TKYA 4LLRA 1YF0A 3EINA 4WF5A 3C1SA 2I81A 4F9ZA 1ERUA 4K7OA 4RQXA 4MZBA 4K7NA 2VCQA 1XIYA 5HFKA 2DBCA 2BMXA 1TI3A 4FO5A 4NXIA 1TTZA 3CMIA 5KEJA 4ZIJA 4YQVA 1GTIA 2PUKC 1GSUA 4FYCA 1R4WA 2ZCTA 1TRVA 1BJXA 3A2XA 2VLVA 1VF1A 2JZSA 5G1LA 4IQAA 3ZIVA 2PMTA 2L57A 3M9KA 2I1UA 1V40A 2IN3A 3APOA 1G6WA 5D9VA 2MBTA 3E0UA 2VM1A 2AYTA 4N10A 2H01A 2AHEA 1XWCA 1I9DA 3HJOA 4LA1A 4ZBDA 3TRXA
chains in the Genus database with same CATH superfamily
5FWGA 4PNFA 5HR3A 3L4NA 12GSA 1ERWA 3RBTA 4IKHA 2VL3A 4TR1B 3MAKA 1FO5A 3I43A 2H0IA 4EDZA 4HZ4A 1GULA 5CNWA 3DVWA 1ZMAA 3BOAA 1TW9A 4K1FA 5GAND 1OC9A 1ZYQB 1WMJA 1SJ6A 1V9WA 1GLPA 1N8JA 3EMPA 3GH6A 1XWBA 5HR2A 1ABAA 5C04A 2P5QA 3ZITA 4XIHA 3ME7A 1ZZYA 5D93A 4GF0A 1GL8A 1ZOFA 3DWVA 3F8UA 4YQUA 4YKGA 3ZL5A 2F3MA 4WR5A 17GSA 4MF7A 2H71A 2JZTA 2BTOT 3FKFA 5G30A 1R5AA 4I5QA 1YEXA 4OCFA 1GNEA 1JZDA 1PN0A 4HSCX 5HR0A 2HLSA 4PQHA 2KP2A 5D9WA 1O81A 3R2QA 3K8NA 1HNCA 2DJJA 3W8JA 4PQIA 3VWWA 1VF2A 3TRPA 3HVXA 2FCHA 1TJDA 4L5OA 2HRNA 4N11A 3C1RA 3HHVA 5F05A 4X1UA 2REMA 3CSHA 2WGRA 4G0IA 3WT1A 3UEMA 5HQPA 1T7PB 1ERTA 1YKCA 4V2NA 4POLA 3EE2A 2PERA 3VURA 5EPFA 2GZYA 5GSSA 1NW2A 2IMEA 4OMVA 2VL9A 1RQMA 2CZ3A 2O7KA 1GSDA 3CSIA 4NAXA 2HI7A 2VIMA 4CHSA 5IQYA 5IOWA 5J3RA 4L0WA 2YCDA 4DSSB 3M9JA 4GQFA 1VF4A 2H73A 5FT3A 2CVKA 1BEDA 1QK8A 3DMLA 3QFAC 4MNNA 5G5FA 3ED3A 2KHPA 2LNTA 4KDXA 1O6JA 4K6XA 4KA0A 4IGJA 1F3BA 1GTBA 3GURA 3FRCA 1FG4A 5JCWA 4V2MA 5CAXA 2GGTA 2RLIA 1BAYA 3KP9A 3W8SA 1UC7A 2GLRA 4ZL7A 2XPDA 4GSTA 4MLYA 1GH2A 2MMNA 3WGEA 1K3YA 1EWXA 4K5RA 3H79A 3U5RE 2XBIA 4O5QA 2P5RA 1VRSD 1ZYNA 3I69A 2WCIA 1B4PA 2R37A 3D22A 1SKWB 2DC5A 4K0GA 2LNSA 5DDLA 2JACA 1H4OA 4WETA 2JL4A 3PGTA 1R5PA 4YAPA 4HZ2A 3D21A 4OFMA 4TXOB 4Q5FA 2H1BA 4Q5NA 3IK7A 2OE1A 3MSZA 1PN9A 2YWNA 6GSVA 5ECSA 4AJ7A 2DSAA 3TOTA 5DAKB 5IPHA 2DJKA 3ZZXA 3QR6A 2KLXA 3LQ7A 2DLXA 2I3YA 3DKSA 4BVYA 5HFGA 1J08A 3F4SA 1EV4A 3CTGA 1O8WA 1YZXA 3A2WA 1PRXA 3UARA 5D9TA 1I5GA 2H76A 2J23A 4ID0A 1EOGA 2G2QA 1XG8A 1W89A 3GV1A 1XBSA 1TK0B 1G0TA 3Q74A 3DEXA 4J56E 3UJ1A 4ML6A 3C7MA 3KCMA 4HQZA 1FOVA 3EMXA 1PKWA 5J41A 3D4TA 3DXBA 4POKA 1SK2A 1DBYA 5IMDA 4LMVA 3ZVJD 3UL3A 2ZNMA 2GVPA 2L4QA 4FH8A 1GSQA 2R0PA 1QXHA 3ZMKA 4O32A 2YPMA 5ECLB 5EVOA 1O8XA 4IP6A 3S9FA 3KJYA 5CO3A 1PKZA 4WEYA 3ZFBA 2H0HA 4D73B 2GQMA 5ECHB 4GCIA 5ELGA 2JSZA 1WJKA 2FWHA 3QD9A 3JCML 1A0FA 2VD0A 4TVEA 4HDEA 1N2AA 2VL2C 2IFQB 2R0CA 3RAZA 3KH9A 4P3YB 2FUG2 2BJXA 5CYYA 3OR5A 2V6OA 2L4CA 3BCKA 1G7EA 1AQVA 1XWKA 2FNOA 5F8BA 3TKSC 1CQGA 2WJUA 5A4UA 2OKAA 5B7CA 3ERGA 2RUEA 4K7IA 1SL2B 5F06A 3FHKA 2GSTA 2LV3A 5A4WA 2H1GA 4I2UA 3HDCA 4XRDA 2VCZA 2E2GA 1EOHA 2HZFA 3G7IA 4TR4A 2HZEA 4E8HA 3FZAA 3KMNA 3P90A 3HVVA 1K3LA 2F8FA 1TP9A 5DQYA 4AJ6A 3ZREA 4BVXB 5IM9A 5IO2A 3GHAA 4MJEA 3EU3A 3VLNA 3WD6A 1JZWA 3A3TA 4XCSA 4PXOA 1OKDA 2VLTA 2B5YA 3LG6A 2JSYA 4HQSA 4DEJA 4O5UA 5KOXA 3PINA 4MF6A 5ENUA 1MD4A 3M8NA 4KB3A 2VO4A 3MNGA 2C8UA 4G10A 2G0FA 1BQ7A 2KP1A 3QOUA 6GSXA 5IIZA 4V1Ag 2NTOA 2OE0A 2X4AA 3CSJA 3QDNA 1UN2A 5ECKB 2HSHA 2H30A 1V98A 3H93A 5KN3A 1MDJA 1Q98A 1M3JA 1LBKA 1NHOA 1WRYA 1BX9A 1TRSA 1Z6NA 1B4QA 5G2ZA 1E6BA 3BJ5A 3GRXA 3D0ZA 1S3CA 2HRAA 1SJIA 5LCZA 1U3AA 2B1KA 4F03A 2GS3A 2P0GA 2PGTA 3VK9A 1Z9HA 1AQXA 3ISOA 4PQ1A 3HVSA 5ECNB 1WPIA 3FW2A 3A5WA 4KSOA 4Q5QA 3F9UA 4TOPA 3DYRA 4ZB6A 5IMAA 1T00A 4RUVA 2OBKA 5HFIA 1OE7A 3G9BA 2LKUA 2K8SA 3FZ5A 2KUCA 1HYUA 4PGTA 1GUKA 4K2DA 16GSA 2GT5A 3CXGA 2L6CA 2E7PA 4YAVA 5J4UA 2WDUA 2IIYA 1V57A 3LYPA 1XWAA 3GUSA 2XPEA 4GXZA 3G7YA 1ST9A 3IXRA 2R5GA 1ILOA 4Z2UA 3VI5A 2LTKA 1AC1A 1GSEA 3IAM2 1GSYA 3FZ4A 3V1WA 3GL3A 1F2EA 2FWEA 2PVOC 1X0RA 2XHFA 3KH7A 5ABRA 3H4KA 1FHEA 2L5OA 3A2VA 3PPUA 1F3AA 3HY2A 1G6YA 3LEFA 4KNDA 4TN8A 3IRAA 2UZ8A 3M1GA 5FHIA 1GSFA 3SBCA 3FR9A 4EIQA 1M0UA 1XVWA 1X9MB 2R3XA 1SENA 1YQ1A 2DKHA 2HE3A 2TRXA 1YEPA 5DVBA 3TGZA 4DSQA 2QA2A 3DVXA 4G0LA 4ILFA 1M9BA 3SWLA 5B8BA 3APSA 4MA9A 1O7UA 2X99A 4KAEA 2GQLA 4JEDA 3F3RA 2WS2A 2YZUA 1QQ2A 3FZ9A 4KUNA 5E4WA 2YV9A 20GSA 2IMKA 2H66A 1PX7A 4EL1A 2FD3A 2IMDA 3VWXA 2OA7A 2K8VA 2H74A 2NVLA 2I9HA 2DJ1A 3AY8A 4G2EA 3ZIJA 1SKRB 4JZQA 3BD2A 3F0IA 1KTEA 2V2GA 2ES7A 4GTUA 1FVJA 5B6NA 1TKDB 3WT2A 1ERVA 2B5XA 1GTUA 4USSA 1K3OA 1B48A 11GSA 5IOXA 4MZCA 3TKPA 1MDKA 1DE2A 2WULA 2TIRA 3KTBA 2YZHA 5DCHA 5E59A 2AB6A 3R3EA 4BWSA 4OFNA 1J9BA 1OC9B 1BG5A 3EC3A 3EVIA 2B1LA 1Y6EA 4G19A 2M80A 1ZL9A 2C3QA 3NOFA 8GSSA 4WKWA 1PA3A 1WIKA 3LFLA 4OCEA 5CRDA 3IR4A 1ZYPA 1EGRA 2H0GA 14GSA 4KE3A 1BYEA 4MABA 2GQKA 4O5RA 5G1KA 1SKSB 3F63A 2M72A 1RK4A 1PGTA 1IYIA 3ZTLA 3LORA 1MEKA 2VCWA 2D2ZA 3IC8A 3TKSE 2FA8A 1FVKA 1MTCA 2K9FA 3TB2A 2MMOA 3IDVA 1IYHA 1EGOA 2F8AA 2EIOA 3NZNA 2CAIA 2B7JA 1LJRA 2A4VA 3LSZA 4IP1A 3GYKA 1SK1A 4WBRD 4MJAA 1U88A 2HSMA 4ZBBA 1QMVA 1TXXA 3LJRA 2QA1A 3RPPA 4LL4B 1X9SB 4HU9A 3P7XA 5KOWA 5H5SA 4GSSA 1ML6A 3VWVA 4GQCA 2I4AA 5D9XA 1K0OA 4IS0A 4MP4A 2WFCA 3ME8A 1HD2A 3L0HA 3FK8A 3GTUA 2LS5A 1Y25A 3TJBA 3UIWA 4EKZA 6GSYA 2ZUPA 4GSNA 1SD9A 2VOCA 4Z2RA 1O85A 3QCPA 4PX1A 1DSBA 4A5PA 1TRUA 1M3IA 2HRKA 1Z7RA 5DCGA 2XBQA 2QGVA 4MDCA 1NSWA 4BWQA 5GAPD 3EWLA 2CZ2A 2OE3A 2H72A 5DJMA 2P31A 4X4JA 1XW5A 4F0BA 1A23A 3GNJA 3QAVA 3GKMA 2R2JA 4L5LA 4MPGA 5GZZB 2VLUA 1EEJA 2HSYA 5A5KA 3TUEA 4JU5A 3O3TA 4ZILA 4N0ZA 1AUCA 2C4JA 3TKRA 3E3EA 4MMMA 2V32A 1HQOA 1V2AA 4Z7XA 1F37A 2O89A 4IBPA 2RM5A 3WGDA 4QQ7A 1XPVA 2B5EA 5DJLA 3VI7A 1H75A 1THXA 1OAZA 4X43A 4ZL9A 3UOMA 1SL1B 1GTAA 2PWJA 19GSA 2CV4A 2HNLA 1SD8A 1YDKA 4BA7A 2X8CA 1V58A 5CRWA 1TK5B 1T1VA 9GSSA 3KIJA 2GSQA 4MH3A 3P8WA 4KDUA 3EPTA 1FAAA 2A2SA 3ZYWA 1SYRA 2CX3A 3GMFA 1ZYEA 1SYXA 1FB0A 4V2LA 1B8XA 3HYPA 4LL1B 4K2XA 4BL7A 4BVYB 2YANA 2LEGA 4EVMA 1EP7A 4J57E 4Z2TA 4EE0A 1O73A 5EL8A 2OACA 4KCEA 4IQ1A 2R6KA 3IK9A 5C00A 1XXUA 3WGXA 2VL2A 1Z7PA 1QGVA 2ON7A 4XS1A 3TJKA 3CYNA 2Z9SA 3ZRDA 2RM6A 4WR4A 3VPTA 2LRTA 3UVTA 1T4YA 2HFDA 5JWQB 2A2PA 3GFKA 1M99A 3TKSA 1EV9A 6GSTA 1JZRA 3KGKA 2H6XA 1URMA 2L6DA 2C0GA 3TCOA 3U6VA 2XC2A 2JU5A 4X0XA 2LJRA 2OBIA 5ECIB 1TK8B 1T4ZA 3IV4A 4Q5RA 2LJAA 4K8MA 1M2BA 3M3MA 4DVCA 1GSSA 4LMWA 3HKRA 4YKFA 2CQ9A 5BRTA 5DALA 1MD3A 4ZBAA 3FR6A 4K0NA 2DJ3A 22GSA 1PQNA 5AIXA 4ECBA 5EY6A 3CQFA 2B3SA 1Q4JA 2H70A 2VCTA 3VPQA 4ECCA 1F6MC 4PNGA 5JCGA 2GT6A 2L5LA 1KEBA 2PN8A 2IMFA 3LYKA 1DUGA 3PR8A 4G0KA 4V1Ap 1NM3A 1USBA 3RHBA 1DE1A 13GSA 1K0DA 2H6YA 3TRQA 3GH9A 3C71A 1OYJA 2QSIA 2V41A 5ECOB 4I6XA 1LU4A 1YJ6A 1VF3A 4WBJA 2HZEB 5ECQB 2R4VA 3KMOA 1YKAA 2KOKA 1Z6MA 6GSWA 10GSA 2WB9A 2ON5A 2JADA 1XVQA 2LQOA 1JHBA 4FYUA 5ECRB 5AIVA 4JBBA 1XW6A 4ACSA 2C3NA 3Q19A 1PL2A 4ISDA 3IHQA 1PMTA 4XTSA 2CAQA 2X49A 3ERWA 2K18A 3M0FA 2CVDA 1ZCPA 3P2AA 3UMAA 2H1AA 2VCXA 3RPNA 5ECPB 4HJMA 4POBA 1GUHA 2YJHA 2R0GA 1K0MA 2IMIA 3CTFA 1GNWA 4CDOA 4KX4A 4TR1A 3L9VA 4OFTA 4K9ZA 2V6KA 2GSRA 3I6AA 4IHUA 5ID2A 3GN3A 5DBQA 2IWTA 3GL5A 3FYGA 3D6IA 1XCCA 1JLWA 7GSSA 2C0FA 3GX0A 1OVNA 1MDIA 4MH2A 4I8BA 3LW9A 5JWOB 2F51A 2TRCP 3J7Yk 4O7HA 1S3DA 2PVQA 4WF4A 3IBHA 3CRTA 5KN2A 4EIPA 1K0CA 1QFNA 2O87A 5CREA 4ZB9A 4CW9A 5INYA 1R26A 1XZOA 3VWUA 1WWJA 3F6DA 3N9JA 5IO0A 4L0UA 4ZXGA 6GSUA 4TXVA 3IPZA 2YP6A 1YF1A 2E2MA 4GWRA 2EIQA 2CA8A 3W6GA 1GUMA 4GLTA 2YWMA 2C0DA 3BCIA 3TDGA 2DJ2A 4F2IA 3LWAA 3EURA 5G31A 2N5FA 3J7Yb 3D5JA 5CRHA 2AV4A 3TJGA 4CY6A 3BBYA 1M2AA 5D8IA 2IJYA 4TR3A 1JZOA 2HXKA 4XS6A 4BIKA 4KCAA 5ID2B 4FIWA 5IMFA 2LUSA 2EIRA 1A8LA 4H86A 1PX6A 2X8HA 3GKKA 1YY7A 3DRNA 1U3IA 2M46A 2C1YA 2CVBA 3WYWA 3GX8A 1W4VA 3IA1A 5IMCA 2GZZA 1U87A 3LXZA 5AN1A 4J2FA 5CRGA 4MPFA 3VFIA 4ML1A 5DQSA 1HNAA 1KNGA 4EUYA 1XWGA 2MMAA 1JLVA 4NPBA 4E8EA 4F0CA 1WP0A 4KGIA 2AJQB 1XFLA 5B8AA 2NBSA 3HCZA 3N5OA 3KTLA 2F9SA 5JCUA 1M2DA 3LXTA 5LD0A 4DSSA 1K0NA 4MF5A 4EO3A 4DSRA 3I9V2 4HOJA 3G7JA 4XHMA 5COHA 4PUFC 3GKNA 3FMWA 2QC7A 1TU7A 1XOAA 1T3BA 2YWIA 3HZ4A 2GZPA 2YWOA 3NIVA 4EDYA 2CT6A 4KSMA 4OO5A 4JE1A 3L9UA 5J5NA 4KH7A 2MBSA 1AW9A 1SL0B 5L71A 2WRTA 2YNXA 4IELA 18GSA 3MIXA 2DJ0A 3ZFLA 6GSSA 1FB6A 3C73A 4RI6A 1SK0A 2E0QA 3L78A 3UAPA 2H6ZA 2RUFA 2GTUA 4ZL8A 1AAZA 3KEBA 1X5CA 2HYXA 4FYBA 1A2MA 2N5AA 3CBUA 2B6MA 2A4HA 2C0EA 1WOUA 2EC4A 4TXOA 3US3A 5H5RA 1AXDA 3D4MA 4MJCA 2NDOA 5IMVA 3KZQA 1THOA 2PPTA 2MYGA 3PH9A 1XOBA 3QPMA 4EF0A 4MZWA 3A5IA 5DAKA 3F4TA 4KDYA 4XS4A 1WE0A 1X5EA 2DIZA 5JWRB 3MYDA 3UBLA 4ULXA 1GRXA 4POMA 2O85A 3HD5A 4TRXA 1NHYA 2FA4A 3CRUA 3QFBC 3RHCA 3QAGA 3F6FA 1ACVA 2WZ9A 1Z5YE 3HZ8A 2J9HA 1HNBA 1SJZA 4BPYA 4KF9A 1K0AA 3L9SA 1JFUA 3DGQA 4HU7A 1J0FA 1M7TA 5AGYA 1EP8A 3DD3A 1OE8A 1CQHA 2HT9A 2FHEA 4AF2A 2FWGA 2JZRA 3TOUA 2X64A 4IVFA 2YOIA 2C80A 4NHWA 2LSTA 4HEA2 4XRAA 3QAWA 3GSSA 2C3TA 2VM2A 5IMZA 4D73A 2O8VB 5ELAA 4K5SA 4GRFA 3O6TA 2YN1A 3E9JB 2AAWA 3DIEA 3EYTA 4I97A 2IFQA 4XS4B 4MJBA 2LRCA 2VUPA 3O76A 2FGXA 1OC3A 1TI1A 5HR1A 3RDWA 4ICYA 2NPBA 2HRFA 3H1NA 2LJKA 3IE3A 4RI7A 5D96A 1TU8A 4OWYA 3GTUB 1UA5A 2VAFA 1T8EB 5D73A 1VGLA 1A24A 1S3AA 2H1DA 1A2LA 3F4RA 3FR3A 4F82A 2H19A 4NMUA 5F07A 5KN1A 2DMLA 3KM6A 2DIYA 4PUAA 4NV5A 2VCVA 1PSQA 3GIXA 4ECIA 4EXJA 2MZCA 4HUAA 5H5QA 1QUWA 2B7KA 3TKQA 2V1MA 1GLQA 1X5DA 1Z3EA 2OJLA 4AGSA 4NHZA 1S3RA 1G7OA 3F3QA 3UVHA 4I2TA 2QKEA 4BVXA 4MCUA 2K6VA 1KBNA 3UBKA 1E2YA 5LNKe 2A2RA 3HJPA 3HA9A 5KN0A 4KW6A 1GP1A 1UVZA 4N30A 1AQWA 3TJJA 1A8YA 3ZMLA 2IPAA 3KP8A 5B6MA 5BMUA 1RW1A 3FEUA 5J9BA 2CX4A 4EC0A 2L59A 4OD7A 1PD21 2H8LA 3Q6OA 4MK3A 5GSTA 1SU9A 1FOHA 3C8EA 2FWFA 5AISA 3IOSA 2LQQA 2DMMA 3GKXA 2RIIA 1K0BA 1GWCA 3Q18A 2GDRA 2VD1A 1TDIA 1C72A 4N0VA 4ZB8A 1EEMA 1M9AA 4IN0A 5CP1A 4HJ2A 1PFOA 5J9CA 3TJFA 2YV7A 5A4VA 2FLSA 3MDKA 5F0GA 2FY6A 1F9MA 4WXTA 2GSSA 1TRWA 1PL1A 1ZGNA 5IPGA 4BL7B 4IJ3A 2YJ7A 1AIUA 3ZVJA 2IL3A 4PURA 3APQA 3LGCA 4ECJA 1OC8A 3GA4A 4YH2A 1A2JA 4IW9A 3HJMA 4RQRA 3KXOA 4NV2A 1U6TA 3ZLPA 1B9XC 2OADA 2PU9C 4QL9A 4TW5A 1B9YC 4OO4A 1A0RP 1ON4A 3GSTA 2DKIA 4CY8A 3MWHA 4PTSA 4O92A 3EU4A 1OKTA 1TOFA 1X9WB 5G5EA 4L8EA 3QMXA 4G9HA 3H8QA 3FY7A 2ALBA 2X8GA 1FW1A 2LRNA 3ERFA 3IC4A 4TR0A 3KD0A 4JR6A 4QL7A 4AJ8A 2AUVA 4JR4A 4JRRA 1XW9A 1R7HA 4IJIA 2N5BA 4YQMA 2MMZA 5DALB 4HI7A 1EZKA 3IAS2 3IHGA 4FQUA 5ECMB 4NWYA 2PBJA 3HXSA 4HS1A 2H75A 4TKYA 4LLRA 1YF0A 3EINA 4WF5A 3C1SA 2I81A 4F9ZA 1ERUA 4K7OA 4RQXA 4MZBA 4K7NA 2VCQA 1XIYA 5HFKA 2DBCA 2BMXA 1TI3A 4FO5A 4NXIA 1TTZA 3CMIA 5KEJA 4ZIJA 4YQVA 1GTIA 2PUKC 1GSUA 4FYCA 1R4WA 2ZCTA 1TRVA 1BJXA 3A2XA 2VLVA 1VF1A 2JZSA 5G1LA 4IQAA 3ZIVA 2PMTA 2L57A 3M9KA 2I1UA 1V40A 2IN3A 3APOA 1G6WA 5D9VA 2MBTA 3HVNA 3E0UA 2VM1A 2AYTA 4N10A 2H01A 2AHEA 1XWCA 1I9DA 3HJOA 4LA1A 4ZBDA 3TRXA
chains in the Genus database with same CATH topology
5FWGA 4PNFA 5HR3A 3L4NA 12GSA 1ERWA 3RBTA 4IKHA 2VL3A 4TR1B 3MAKA 1FO5A 3I43A 2H0IA 4EDZA 4HZ4A 1GULA 5CNWA 3DVWA 1ZMAA 3BOAA 1TW9A 4K1FA 5GAND 1OC9A 1ZYQB 1WMJA 1SJ6A 1V9WA 1GLPA 1N8JA 3EMPA 3GH6A 1XWBA 5HR2A 1ABAA 5C04A 2P5QA 3ZITA 4XIHA 3ME7A 1ZZYA 5D93A 4GF0A 1GL8A 1ZOFA 3DWVA 3F8UA 4YQUA 4YKGA 3ZL5A 2F3MA 4WR5A 17GSA 4MF7A 2H71A 2JZTA 2BTOT 3FKFA 5G30A 1R5AA 4I5QA 1YEXA 4OCFA 1GNEA 1JZDA 1PN0A 5HR0A 2HLSA 4PQHA 2KP2A 5D9WA 1O81A 3R2QA 3K8NA 1HNCA 2DJJA 3W8JA 4PQIA 3VWWA 1VF2A 3TRPA 3HVXA 2FCHA 1TJDA 4L5OA 2HRNA 4N11A 3C1RA 3HHVA 5F05A 4X1UA 2REMA 3CSHA 2WGRA 4G0IA 3WT1A 3UEMA 5HQPA 1T7PB 1ERTA 1YKCA 4V2NA 4POLA 3EE2A 2PERA 3VURA 5EPFA 2GZYA 5GSSA 1NW2A 2IMEA 4OMVA 2VL9A 1RQMA 2CZ3A 2O7KA 1GSDA 3CSIA 4NAXA 2HI7A 2VIMA 4CHSA 5IQYA 5IOWA 5J3RA 4L0WA 2YCDA 4DSSB 3M9JA 4GQFA 1VF4A 2H73A 5FT3A 2CVKA 1BEDA 1QK8A 3DMLA 3QFAC 4MNNA 5G5FA 3ED3A 2KHPA 2LNTA 4KDXA 1O6JA 4K6XA 4KA0A 4IGJA 1F3BA 1GTBA 3GURA 3FRCA 1FG4A 5JCWA 4V2MA 5CAXA 2GGTA 2RLIA 1BAYA 3KP9A 3W8SA 1UC7A 2GLRA 4ZL7A 2XPDA 4GSTA 4MLYA 1GH2A 2MMNA 3WGEA 1K3YA 1EWXA 4K5RA 3H79A 3U5RE 2XBIA 4O5QA 2P5RA 1VRSD 1ZYNA 3I69A 2WCIA 1B4PA 2R37A 3D22A 1SKWB 2DC5A 4K0GA 2LNSA 5DDLA 2JACA 1H4OA 4WETA 2JL4A 3PGTA 1R5PA 4YAPA 4HZ2A 3D21A 4OFMA 4TXOB 4Q5FA 2H1BA 4Q5NA 3IK7A 2OE1A 3MSZA 1PN9A 2YWNA 6GSVA 5ECSA 4AJ7A 2DSAA 3TOTA 5DAKB 5IPHA 2DJKA 3ZZXA 3QR6A 2KLXA 3LQ7A 2DLXA 2I3YA 3DKSA 4BVYA 5HFGA 1J08A 3F4SA 1EV4A 3CTGA 1O8WA 1YZXA 3A2WA 1PRXA 3UARA 5D9TA 1I5GA 2H76A 2J23A 4ID0A 1EOGA 2G2QA 1W89A 3GV1A 1XBSA 1TK0B 1G0TA 3Q74A 3DEXA 4J56E 3UJ1A 4ML6A 3C7MA 3KCMA 4HQZA 1FOVA 3EMXA 1PKWA 5J41A 3D4TA 3DXBA 4POKA 1SK2A 1DBYA 5IMDA 4LMVA 3ZVJD 3UL3A 2ZNMA 2GVPA 2L4QA 4FH8A 1GSQA 2R0PA 1QXHA 3ZMKA 4O32A 2YPMA 5ECLB 5EVOA 1O8XA 4IP6A 3S9FA 3KJYA 5CO3A 1PKZA 4WEYA 3ZFBA 2H0HA 4D73B 2GQMA 5ECHB 4GCIA 5ELGA 2JSZA 1WJKA 2FWHA 3QD9A 3JCML 1A0FA 2VD0A 4TVEA 4HDEA 1N2AA 2VL2C 2IFQB 2R0CA 3RAZA 3KH9A 4P3YB 2FUG2 2BJXA 5CYYA 3OR5A 2V6OA 2L4CA 3BCKA 1G7EA 1AQVA 1XWKA 2FNOA 5F8BA 3TKSC 1CQGA 2WJUA 5A4UA 2OKAA 5B7CA 3ERGA 2RUEA 4K7IA 1SL2B 5F06A 3FHKA 2GSTA 2LV3A 5A4WA 2H1GA 4I2UA 3HDCA 4XRDA 2VCZA 2E2GA 1EOHA 2HZFA 3G7IA 4TR4A 2HZEA 4E8HA 3FZAA 3KMNA 3P90A 3HVVA 1K3LA 2F8FA 1TP9A 5DQYA 4AJ6A 3ZREA 4BVXB 5IM9A 5IO2A 3GHAA 4MJEA 3EU3A 3VLNA 3WD6A 1JZWA 3A3TA 4XCSA 4PXOA 1OKDA 2VLTA 2B5YA 3LG6A 2JSYA 4HQSA 4DEJA 4O5UA 5KOXA 3PINA 4MF6A 5ENUA 1MD4A 3M8NA 4KB3A 2VO4A 3MNGA 2C8UA 4G10A 2G0FA 1BQ7A 2KP1A 3QOUA 6GSXA 5IIZA 4V1Ag 2NTOA 2OE0A 2X4AA 3CSJA 3QDNA 1UN2A 5ECKB 2HSHA 2H30A 1V98A 3H93A 5KN3A 1MDJA 1Q98A 1LBKA 1NHOA 1WRYA 1BX9A 1TRSA 1Z6NA 1B4QA 5G2ZA 1E6BA 3BJ5A 3GRXA 3D0ZA 1S3CA 2HRAA 1SJIA 5LCZA 1U3AA 2B1KA 4F03A 2GS3A 2P0GA 2PGTA 3VK9A 1Z9HA 1AQXA 3ISOA 4PQ1A 3HVSA 5ECNB 1WPIA 3FW2A 3A5WA 4KSOA 4Q5QA 3F9UA 4TOPA 3DYRA 4ZB6A 5IMAA 1T00A 4RUVA 2OBKA 5HFIA 1OE7A 3G9BA 2LKUA 2K8SA 3FZ5A 2KUCA 1HYUA 4PGTA 1GUKA 4K2DA 16GSA 2GT5A 3CXGA 2L6CA 2E7PA 4YAVA 5J4UA 2WDUA 2IIYA 1V57A 3LYPA 1XWAA 3GUSA 2XPEA 4GXZA 3G7YA 1ST9A 3IXRA 2R5GA 1ILOA 4Z2UA 3VI5A 2LTKA 1AC1A 1GSEA 3IAM2 1GSYA 3FZ4A 3V1WA 3GL3A 1F2EA 2FWEA 2PVOC 1X0RA 2XHFA 3KH7A 5ABRA 3H4KA 1FHEA 2L5OA 3A2VA 3PPUA 1F3AA 3HY2A 1G6YA 3LEFA 4KNDA 4TN8A 3IRAA 2UZ8A 3M1GA 5FHIA 1GSFA 3SBCA 3FR9A 4EIQA 1M0UA 1XVWA 1X9MB 2R3XA 1SENA 1YQ1A 2DKHA 2HE3A 2TRXA 1YEPA 5DVBA 3TGZA 4DSQA 2QA2A 3DVXA 4G0LA 4ILFA 1M9BA 3SWLA 5B8BA 3APSA 4MA9A 1O7UA 2X99A 4KAEA 2GQLA 4JEDA 3F3RA 2WS2A 2YZUA 1QQ2A 3FZ9A 4KUNA 5E4WA 2YV9A 20GSA 2IMKA 2H66A 1PX7A 4EL1A 2FD3A 2IMDA 3VWXA 2OA7A 2K8VA 2H74A 2NVLA 2I9HA 2DJ1A 3AY8A 4G2EA 3ZIJA 1SKRB 4JZQA 3BD2A 3F0IA 1KTEA 2V2GA 2ES7A 4GTUA 1FVJA 5B6NA 1TKDB 3WT2A 1ERVA 2B5XA 1GTUA 4USSA 1K3OA 1B48A 11GSA 5IOXA 4MZCA 3TKPA 1MDKA 1DE2A 2WULA 2TIRA 3KTBA 2YZHA 5DCHA 5E59A 2AB6A 3R3EA 4BWSA 4OFNA 1J9BA 1OC9B 1BG5A 3EC3A 3EVIA 2B1LA 1Y6EA 4G19A 2M80A 1ZL9A 2C3QA 3NOFA 8GSSA 4WKWA 1PA3A 1WIKA 3LFLA 4OCEA 5CRDA 3IR4A 1ZYPA 1EGRA 2H0GA 14GSA 4KE3A 1BYEA 4MABA 2GQKA 4O5RA 5G1KA 1SKSB 3F63A 2M72A 1RK4A 1PGTA 1IYIA 3ZTLA 3LORA 1MEKA 2VCWA 2D2ZA 3IC8A 3TKSE 2FA8A 1FVKA 1MTCA 2K9FA 3TB2A 2MMOA 3IDVA 1IYHA 1EGOA 2F8AA 2EIOA 3NZNA 2CAIA 2B7JA 1LJRA 2A4VA 3LSZA 4IP1A 3GYKA 1SK1A 4WBRD 4MJAA 1U88A 2HSMA 4ZBBA 1QMVA 1TXXA 3LJRA 2QA1A 3RPPA 4LL4B 1X9SB 4HU9A 3P7XA 5KOWA 5H5SA 4GSSA 1ML6A 3VWVA 4GQCA 2I4AA 5D9XA 1K0OA 4IS0A 4MP4A 2WFCA 3ME8A 1HD2A 3L0HA 3FK8A 3GTUA 2LS5A 1Y25A 3TJBA 3UIWA 4EKZA 6GSYA 2ZUPA 4GSNA 1SD9A 2VOCA 4Z2RA 1O85A 3QCPA 4PX1A 1DSBA 4A5PA 1TRUA 2HRKA 1Z7RA 5DCGA 2XBQA 2QGVA 4MDCA 1NSWA 4BWQA 5GAPD 3EWLA 2CZ2A 2OE3A 2H72A 5DJMA 2P31A 4X4JA 1XW5A 4F0BA 1A23A 3GNJA 3QAVA 3GKMA 2R2JA 4L5LA 4MPGA 5GZZB 2VLUA 1EEJA 2HSYA 5A5KA 3TUEA 4JU5A 3O3TA 4ZILA 4N0ZA 1AUCA 2C4JA 3TKRA 3E3EA 4MMMA 2V32A 1HQOA 1V2AA 4Z7XA 1F37A 2O89A 4IBPA 2RM5A 3WGDA 4QQ7A 1XPVA 2B5EA 5DJLA 3VI7A 1H75A 1THXA 1OAZA 4X43A 4ZL9A 3UOMA 1SL1B 1GTAA 2PWJA 19GSA 2CV4A 2HNLA 1SD8A 1YDKA 4BA7A 2X8CA 1V58A 5CRWA 1TK5B 1T1VA 9GSSA 3KIJA 2GSQA 4MH3A 3P8WA 4KDUA 3EPTA 1FAAA 2A2SA 3ZYWA 1SYRA 2CX3A 3GMFA 1ZYEA 1SYXA 1FB0A 4V2LA 1B8XA 3HYPA 4LL1B 4K2XA 4BL7A 4BVYB 2YANA 2LEGA 4EVMA 1EP7A 4J57E 4Z2TA 4EE0A 1O73A 5EL8A 2OACA 4KCEA 4IQ1A 2R6KA 3IK9A 5C00A 1XXUA 3WGXA 2VL2A 1Z7PA 1QGVA 2ON7A 4XS1A 3TJKA 3CYNA 2Z9SA 3ZRDA 2RM6A 4WR4A 3VPTA 2LRTA 3UVTA 1T4YA 2HFDA 5JWQB 2A2PA 3GFKA 1M99A 3TKSA 1EV9A 6GSTA 1JZRA 3KGKA 2H6XA 1URMA 2L6DA 2C0GA 3TCOA 3U6VA 2XC2A 2JU5A 4X0XA 2LJRA 2OBIA 5ECIB 1TK8B 1T4ZA 3IV4A 4Q5RA 2LJAA 4K8MA 1M2BA 3M3MA 4DVCA 1GSSA 4LMWA 3HKRA 4YKFA 2CQ9A 5BRTA 5DALA 1MD3A 4ZBAA 3FR6A 4K0NA 2DJ3A 22GSA 1PQNA 5AIXA 4ECBA 5EY6A 2B3SA 1Q4JA 2H70A 2VCTA 3VPQA 4ECCA 1F6MC 4PNGA 5JCGA 2GT6A 2L5LA 1KEBA 2PN8A 2IMFA 3LYKA 1DUGA 3PR8A 4G0KA 4V1Ap 1NM3A 1USBA 3RHBA 1DE1A 13GSA 1K0DA 2H6YA 3TRQA 3GH9A 3C71A 1OYJA 2QSIA 2V41A 5ECOB 4I6XA 1LU4A 1YJ6A 1VF3A 4WBJA 2HZEB 5ECQB 2R4VA 3KMOA 1YKAA 2KOKA 1Z6MA 6GSWA 10GSA 2WB9A 2ON5A 2JADA 1XVQA 2LQOA 1JHBA 4FYUA 5ECRB 5AIVA 4JBBA 1XW6A 4ACSA 2C3NA 3Q19A 1PL2A 4ISDA 3IHQA 1PMTA 4XTSA 2CAQA 2X49A 3ERWA 2K18A 3M0FA 2CVDA 1ZCPA 3P2AA 3UMAA 2H1AA 2VCXA 3RPNA 5ECPB 4HJMA 4POBA 1GUHA 2YJHA 2R0GA 1K0MA 2IMIA 3CTFA 1GNWA 4CDOA 4KX4A 4TR1A 3L9VA 4OFTA 4K9ZA 2V6KA 2GSRA 3I6AA 4IHUA 5ID2A 3GN3A 5DBQA 2IWTA 3GL5A 3FYGA 3D6IA 1XCCA 1JLWA 7GSSA 2C0FA 3GX0A 1OVNA 1MDIA 4MH2A 4I8BA 3LW9A 5JWOB 2F51A 2TRCP 3J7Yk 4O7HA 1S3DA 2PVQA 4WF4A 3IBHA 3CRTA 5KN2A 4EIPA 1K0CA 1QFNA 2O87A 5CREA 4ZB9A 4CW9A 5INYA 1R26A 1XZOA 3VWUA 1WWJA 3F6DA 3N9JA 5IO0A 4L0UA 4ZXGA 6GSUA 4TXVA 3IPZA 2YP6A 1YF1A 2E2MA 4GWRA 2EIQA 2CA8A 3W6GA 1GUMA 4GLTA 2YWMA 2C0DA 3BCIA 3TDGA 2DJ2A 4F2IA 3LWAA 3EURA 5G31A 2N5FA 3J7Yb 3D5JA 5CRHA 2AV4A 3TJGA 4CY6A 3BBYA 1M2AA 5D8IA 2IJYA 4TR3A 1JZOA 2HXKA 4XS6A 4KCAA 5ID2B 4FIWA 5IMFA 2LUSA 2EIRA 1A8LA 4H86A 1PX6A 2X8HA 3GKKA 1YY7A 3DRNA 1U3IA 2M46A 2C1YA 2CVBA 3WYWA 3GX8A 1W4VA 3IA1A 5IMCA 2GZZA 1U87A 3LXZA 5AN1A 4J2FA 5CRGA 4MPFA 3VFIA 4ML1A 5DQSA 1HNAA 1KNGA 4EUYA 1XWGA 2MMAA 1JLVA 4NPBA 4E8EA 4F0CA 1WP0A 4KGIA 2AJQB 1XFLA 5B8AA 2NBSA 3HCZA 3N5OA 3KTLA 2F9SA 5JCUA 1M2DA 3LXTA 5LD0A 4DSSA 1K0NA 4MF5A 4EO3A 4DSRA 3I9V2 4HOJA 3G7JA 4XHMA 5COHA 4PUFC 3GKNA 3FMWA 2QC7A 1TU7A 1XOAA 1T3BA 2YWIA 3HZ4A 2GZPA 2YWOA 3NIVA 4EDYA 2CT6A 4KSMA 4OO5A 4JE1A 3L9UA 5J5NA 4KH7A 2MBSA 1AW9A 1SL0B 5L71A 2WRTA 2YNXA 4IELA 18GSA 3MIXA 2DJ0A 3ZFLA 6GSSA 1FB6A 3C73A 4RI6A 1SK0A 2E0QA 3L78A 3UAPA 2H6ZA 2RUFA 2GTUA 4ZL8A 1AAZA 3KEBA 1X5CA 2HYXA 4FYBA 1A2MA 2N5AA 3CBUA 2B6MA 2A4HA 2C0EA 1WOUA 2EC4A 4TXOA 3US3A 5H5RA 1AXDA 3D4MA 4MJCA 2NDOA 5IMVA 3KZQA 1THOA 2PPTA 2MYGA 3PH9A 1XOBA 3QPMA 4EF0A 4MZWA 3A5IA 5DAKA 3F4TA 4KDYA 4XS4A 1WE0A 1X5EA 2DIZA 5JWRB 3MYDA 3UBLA 4ULXA 1GRXA 4POMA 2O85A 3HD5A 4TRXA 1NHYA 2FA4A 3CRUA 3QFBC 3RHCA 3QAGA 3F6FA 1ACVA 2WZ9A 1Z5YE 3HZ8A 2J9HA 1HNBA 1SJZA 4BPYA 4KF9A 1K0AA 3L9SA 1JFUA 3DGQA 4HU7A 1J0FA 1M7TA 5AGYA 1EP8A 3DD3A 1OE8A 1CQHA 2HT9A 2FHEA 4AF2A 2FWGA 2JZRA 3TOUA 2X64A 4IVFA 2YOIA 2C80A 4NHWA 2LSTA 4HEA2 4XRAA 3QAWA 3GSSA 2C3TA 2VM2A 5IMZA 4D73A 2O8VB 5ELAA 4K5SA 4GRFA 3O6TA 2YN1A 3E9JB 2AAWA 3DIEA 3EYTA 4I97A 2IFQA 4XS4B 4MJBA 2LRCA 2VUPA 3O76A 2FGXA 1OC3A 1TI1A 5HR1A 3RDWA 4ICYA 2NPBA 2HRFA 3H1NA 2LJKA 3IE3A 4RI7A 5D96A 1TU8A 4OWYA 3GTUB 1UA5A 2VAFA 1T8EB 5D73A 1VGLA 1A24A 1S3AA 2H1DA 1A2LA 3F4RA 3FR3A 4F82A 2H19A 4NMUA 5F07A 5KN1A 2DMLA 3KM6A 2DIYA 4PUAA 4NV5A 2VCVA 1PSQA 3GIXA 4ECIA 4EXJA 2MZCA 4HUAA 5H5QA 1QUWA 2B7KA 3TKQA 2V1MA 1GLQA 1X5DA 1Z3EA 2OJLA 4AGSA 4NHZA 1G7OA 3F3QA 3UVHA 4I2TA 2QKEA 4BVXA 4MCUA 2K6VA 1KBNA 3UBKA 1E2YA 5LNKe 2A2RA 3HJPA 3HA9A 5KN0A 4KW6A 1GP1A 1UVZA 4N30A 1AQWA 3TJJA 1A8YA 3ZMLA 2IPAA 3KP8A 5B6MA 5BMUA 1RW1A 3FEUA 5J9BA 2CX4A 4EC0A 2L59A 4OD7A 1PD21 2H8LA 3Q6OA 4MK3A 5GSTA 1SU9A 1FOHA 3C8EA 2FWFA 5AISA 3IOSA 2LQQA 2DMMA 3GKXA 2RIIA 1K0BA 1GWCA 3Q18A 2GDRA 2VD1A 1TDIA 1C72A 4N0VA 4ZB8A 1EEMA 1M9AA 4IN0A 5CP1A 4HJ2A 5J9CA 3TJFA 2YV7A 5A4VA 2FLSA 3MDKA 5F0GA 2FY6A 1F9MA 4WXTA 2GSSA 1TRWA 1PL1A 1ZGNA 5IPGA 4BL7B 4IJ3A 2YJ7A 1AIUA 3ZVJA 2IL3A 4PURA 3APQA 3LGCA 4ECJA 1OC8A 3GA4A 4YH2A 1A2JA 4IW9A 3HJMA 4RQRA 3KXOA 4NV2A 1U6TA 3ZLPA 1B9XC 2OADA 2PU9C 4QL9A 4TW5A 1B9YC 4OO4A 1A0RP 1ON4A 3GSTA 2DKIA 4CY8A 3MWHA 4PTSA 4O92A 3EU4A 1OKTA 1TOFA 1X9WB 5G5EA 4L8EA 3QMXA 4G9HA 3H8QA 3FY7A 2ALBA 2X8GA 1FW1A 2LRNA 3ERFA 3IC4A 4TR0A 3KD0A 4JR6A 4QL7A 4AJ8A 2AUVA 4JR4A 4JRRA 1XW9A 1R7HA 4IJIA 2N5BA 4YQMA 2MMZA 5DALB 4HI7A 1EZKA 3IAS2 3IHGA 4FQUA 5ECMB 4NWYA 2PBJA 3HXSA 4HS1A 2H75A 4TKYA 4LLRA 1YF0A 3EINA 4WF5A 3C1SA 2I81A 4F9ZA 1ERUA 4K7OA 4RQXA 4MZBA 4K7NA 2VCQA 1XIYA 5HFKA 2DBCA 2BMXA 1TI3A 4FO5A 4NXIA 1TTZA 3CMIA 5KEJA 4ZIJA 4YQVA 1GTIA 2PUKC 1GSUA 4FYCA 1R4WA 2ZCTA 1TRVA 1BJXA 3A2XA 2VLVA 1VF1A 2JZSA 5G1LA 4IQAA 3ZIVA 2PMTA 2L57A 3M9KA 2I1UA 1V40A 2IN3A 3APOA 1G6WA 5D9VA 2MBTA 3E0UA 2VM1A 2AYTA 4N10A 2H01A 2AHEA 1XWCA 1I9DA 3HJOA 4LA1A 4ZBDA 3TRXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FWG A;  4PNF A;  5HR3 A;  3L4N A;  12GS A;  1ERW A;  3RBT A;  4IKH A;  2VL3 A;  4TR1 B;  3MAK A;  1FO5 A;  3I43 A;  2H0I A;  4EDZ A;  4HZ4 A;  1GUL A;  5CNW A;  3DVW A;  1ZMA A;  3BOA A;  1TW9 A;  4K1F A;  5GAN D;  1OC9 A;  1ZYQ B;  1WMJ A;  1SJ6 A;  1V9W A;  1GLP A;  1N8J A;  3EMP A;  3GH6 A;  1XWB A;  5HR2 A;  1ABA A;  5C04 A;  2P5Q A;  3ZIT A;  4XIH A;  3ME7 A;  1ZZY A;  5D93 A;  4GF0 A;  1GL8 A;  1ZOF A;  3DWV A;  3F8U A;  4YQU A;  3ZL5 A;  2F3M A;  4WR5 A;  17GS A;  4MF7 A;  2H71 A;  2JZT A;  2BTO T;  3FKF A;  5G30 A;  1R5A A;  4I5Q A;  1YEX A;  4OCF A;  1GNE A;  1JZD A;  5HR0 A;  2HLS A;  4PQH A;  2KP2 A;  5D9W A;  1O81 A;  3R2Q A;  3K8N A;  1HNC A;  2DJJ A;  3W8J A;  4PQI A;  3VWW A;  1VF2 A;  3TRP A;  3HVX A;  2FCH A;  1TJD A;  4L5O A;  2HRN A;  4N11 A;  3C1R A;  3HHV A;  5F05 A;  4X1U A;  2REM A;  3CSH A;  2WGR A;  3WT1 A;  3UEM A;  5HQP A;  1T7P B;  1ERT A;  1YKC A;  4V2N A;  4POL A;  3EE2 A;  2PER A;  3VUR A;  5EPF A;  2GZY A;  5GSS A;  1NW2 A;  2IME A;  4OMV A;  2VL9 A;  1RQM A;  2CZ3 A;  2O7K A;  1GSD A;  3CSI A;  4NAX A;  2HI7 A;  2VIM A;  4CHS A;  5IQY A;  5IOW A;  5J3R A;  4L0W A;  2YCD A;  4DSS B;  3M9J A;  4GQF A;  1VF4 A;  2H73 A;  5FT3 A;  2CVK A;  1BED A;  1QK8 A;  3DML A;  3QFA C;  5G5F A;  3ED3 A;  2KHP A;  2LNT A;  4KDX A;  1O6J A;  4K6X A;  4KA0 A;  4IGJ A;  1F3B A;  1GTB A;  3GUR A;  3FRC A;  1FG4 A;  5JCW A;  4V2M A;  5CAX A;  2GGT A;  2RLI A;  1BAY A;  3KP9 A;  3W8S A;  1UC7 A;  2GLR A;  4ZL7 A;  2XPD A;  4GST A;  4MLY A;  1GH2 A;  2MMN A;  3WGE A;  1K3Y A;  1EWX A;  3H79 A;  3U5R E;  2XBI A;  2P5R A;  1VRS D;  3I69 A;  2WCI A;  1B4P A;  2R37 A;  3D22 A;  1SKW B;  2DC5 A;  4K0G A;  2LNS A;  5DDL A;  2JAC A;  1H4O A;  4WET A;  2JL4 A;  3PGT A;  1R5P A;  4YAP A;  4HZ2 A;  3D21 A;  4OFM A;  4TXO B;  4Q5F A;  2H1B A;  4Q5N A;  3IK7 A;  2OE1 A;  3MSZ A;  1PN9 A;  2YWN A;  6GSV A;  5ECS A;  4AJ7 A;  2DSA A;  3TOT A;  5DAK B;  5IPH A;  2DJK A;  3ZZX A;  3QR6 A;  2KLX A;  3LQ7 A;  2DLX A;  2I3Y A;  3DKS A;  4BVY A;  5HFG A;  1J08 A;  3F4S A;  1EV4 A;  3CTG A;  1O8W A;  1YZX A;  3A2W A;  1PRX A;  3UAR A;  5D9T A;  1I5G A;  2H76 A;  2J23 A;  4ID0 A;  1EOG A;  2G2Q A;  1W89 A;  3GV1 A;  1XBS A;  1TK0 B;  1G0T A;  3Q74 A;  3DEX A;  4J56 E;  3UJ1 A;  4ML6 A;  3C7M A;  3KCM A;  4HQZ A;  1FOV A;  3EMX A;  1PKW A;  5J41 A;  3D4T A;  3DXB A;  4POK A;  1SK2 A;  1DBY A;  5IMD A;  4LMV A;  3ZVJ D;  3UL3 A;  2ZNM A;  2GVP A;  2L4Q A;  4FH8 A;  1GSQ A;  1QXH A;  3ZMK A;  4O32 A;  2YPM A;  5ECL B;  5EVO A;  1O8X A;  4IP6 A;  3S9F A;  3KJY A;  5CO3 A;  1PKZ A;  4WEY A;  3ZFB A;  2H0H A;  4D73 B;  2GQM A;  5ECH B;  4GCI A;  5ELG A;  2JSZ A;  1WJK A;  2FWH A;  3QD9 A;  3JCM L;  1A0F A;  2VD0 A;  4TVE A;  4HDE A;  1N2A A;  2VL2 C;  2IFQ B;  3RAZ A;  3KH9 A;  4P3Y B;  2FUG 2;  2BJX A;  5CYY A;  3OR5 A;  2V6O A;  2L4C A;  3BCK A;  1G7E A;  1AQV A;  1XWK A;  2FNO A;  5F8B A;  3TKS C;  1CQG A;  2WJU A;  5A4U A;  2OKA A;  5B7C A;  3ERG A;  2RUE A;  4K7I A;  1SL2 B;  5F06 A;  3FHK A;  2GST A;  2LV3 A;  5A4W A;  2H1G A;  4I2U A;  3HDC A;  4XRD A;  2VCZ A;  2E2G A;  1EOH A;  2HZF A;  3G7I A;  4TR4 A;  2HZE A;  4E8H A;  3FZA A;  3KMN A;  3P90 A;  3HVV A;  1K3L A;  2F8F A;  1TP9 A;  5DQY A;  4AJ6 A;  3ZRE A;  5IM9 A;  5IO2 A;  3GHA A;  4MJE A;  3EU3 A;  3VLN A;  3WD6 A;  1JZW A;  3A3T A;  4XCS A;  4PXO A;  1OKD A;  2VLT A;  2B5Y A;  3LG6 A;  2JSY A;  4HQS A;  4DEJ A;  3PIN A;  4MF6 A;  5ENU A;  1MD4 A;  3M8N A;  4KB3 A;  2VO4 A;  3MNG A;  2C8U A;  4G10 A;  2G0F A;  1BQ7 A;  2KP1 A;  3QOU A;  6GSX A;  5IIZ A;  4V1A g;  2NTO A;  2OE0 A;  3CSJ A;  3QDN A;  1UN2 A;  5ECK B;  2HSH A;  2H30 A;  1V98 A;  3H93 A;  5KN3 A;  1MDJ A;  1Q98 A;  1LBK A;  1NHO A;  1WRY A;  1BX9 A;  1TRS A;  1Z6N A;  1B4Q A;  5G2Z A;  1E6B A;  3BJ5 A;  3GRX A;  3D0Z A;  1S3C A;  1SJI A;  5LCZ A;  1U3A A;  2B1K A;  4F03 A;  2GS3 A;  2P0G A;  2PGT A;  3VK9 A;  1Z9H A;  1AQX A;  3ISO A;  4PQ1 A;  3HVS A;  5ECN B;  1WPI A;  3FW2 A;  3A5W A;  4KSO A;  4Q5Q A;  3F9U A;  4TOP A;  3DYR A;  4ZB6 A;  5IMA A;  1T00 A;  4RUV A;  2OBK A;  5HFI A;  1OE7 A;  3G9B A;  2LKU A;  2K8S A;  3FZ5 A;  2KUC A;  1HYU A;  4PGT A;  1GUK A;  4K2D A;  16GS A;  2GT5 A;  3CXG A;  2L6C A;  2E7P A;  4YAV A;  5J4U A;  2WDU A;  2IIY A;  1V57 A;  3LYP A;  1XWA A;  3GUS A;  2XPE A;  4GXZ A;  3G7Y A;  1ST9 A;  3IXR A;  2R5G A;  1ILO A;  3VI5 A;  2LTK A;  1AC1 A;  1GSE A;  3IAM 2;  1GSY A;  3FZ4 A;  3V1W A;  3GL3 A;  1F2E A;  2FWE A;  2PVO C;  1X0R A;  2XHF A;  3KH7 A;  5ABR A;  3H4K A;  1FHE A;  2L5O A;  3A2V A;  1F3A A;  3HY2 A;  1G6Y A;  3LEF A;  4KND A;  4TN8 A;  3IRA A;  3M1G A;  5FHI A;  1GSF A;  3SBC A;  3FR9 A;  1M0U A;  1XVW A;  1X9M B;  2R3X A;  1SEN A;  1YQ1 A;  2HE3 A;  2TRX A;  1YEP A;  5DVB A;  3TGZ A;  4DSQ A;  3DVX A;  4ILF A;  1M9B A;  3SWL A;  5B8B A;  3APS A;  4MA9 A;  1O7U A;  2X99 A;  4KAE A;  2GQL A;  4JED A;  3F3R A;  2WS2 A;  2YZU A;  1QQ2 A;  3FZ9 A;  4KUN A;  5E4W A;  2YV9 A;  20GS A;  2IMK A;  2H66 A;  1PX7 A;  4EL1 A;  2FD3 A;  2IMD A;  3VWX A;  2OA7 A;  2K8V A;  2H74 A;  2NVL A;  2I9H A;  2DJ1 A;  3AY8 A;  4G2E A;  3ZIJ A;  1SKR B;  4JZQ A;  3BD2 A;  3F0I A;  1KTE A;  2V2G A;  2ES7 A;  4GTU A;  1FVJ A;  5B6N A;  1TKD B;  3WT2 A;  1ERV A;  2B5X A;  1GTU A;  1K3O A;  1B48 A;  11GS A;  5IOX A;  4MZC A;  3TKP A;  1MDK A;  1DE2 A;  2WUL A;  2TIR A;  3KTB A;  2YZH A;  5DCH A;  5E59 A;  2AB6 A;  4BWS A;  4OFN A;  1J9B A;  1OC9 B;  1BG5 A;  3EC3 A;  3EVI A;  2B1L A;  1Y6E A;  4G19 A;  2M80 A;  1ZL9 A;  2C3Q A;  3NOF A;  8GSS A;  4WKW A;  1PA3 A;  1WIK A;  3LFL A;  4OCE A;  5CRD A;  3IR4 A;  1EGR A;  2H0G A;  14GS A;  4KE3 A;  1BYE A;  4MAB A;  2GQK A;  4O5R A;  5G1K A;  1SKS B;  3F63 A;  2M72 A;  1RK4 A;  1PGT A;  1IYI A;  3ZTL A;  3LOR A;  1MEK A;  2VCW A;  2D2Z A;  3TKS E;  2FA8 A;  1FVK A;  1MTC A;  2K9F A;  3TB2 A;  2MMO A;  3IDV A;  1IYH A;  1EGO A;  2F8A A;  2EIO A;  3NZN A;  2CAI A;  2B7J A;  1LJR A;  2A4V A;  3LSZ A;  4IP1 A;  3GYK A;  1SK1 A;  4WBR D;  4MJA A;  1U88 A;  4ZBB A;  1QMV A;  1TXX A;  3LJR A;  3RPP A;  4LL4 B;  1X9S B;  4HU9 A;  3P7X A;  5H5S A;  4GSS A;  1ML6 A;  3VWV A;  4GQC A;  2I4A A;  5D9X A;  1K0O A;  4IS0 A;  4MP4 A;  2WFC A;  3ME8 A;  1HD2 A;  3L0H A;  3FK8 A;  3GTU A;  2LS5 A;  1Y25 A;  3TJB A;  3UIW A;  4EKZ A;  6GSY A;  2ZUP A;  4GSN A;  1SD9 A;  2VOC A;  1O85 A;  3QCP A;  4PX1 A;  1DSB A;  1TRU A;  1Z7R A;  5DCG A;  2XBQ A;  2QGV A;  4MDC A;  1NSW A;  4BWQ A;  5GAP D;  3EWL A;  2CZ2 A;  2OE3 A;  2H72 A;  5DJM A;  2P31 A;  1XW5 A;  4F0B A;  1A23 A;  3GNJ A;  3QAV A;  3GKM A;  2R2J A;  4L5L A;  4MPG A;  5GZZ B;  2VLU A;  1EEJ A;  2HSY A;  5A5K A;  3TUE A;  4JU5 A;  3O3T A;  4ZIL A;  4N0Z A;  1AUC A;  2C4J A;  3TKR A;  3E3E A;  4MMM A;  2V32 A;  1HQO A;  1V2A A;  4Z7X A;  1F37 A;  2O89 A;  4IBP A;  2RM5 A;  3WGD A;  4QQ7 A;  1XPV A;  2B5E A;  5DJL A;  3VI7 A;  1H75 A;  1THX A;  1OAZ A;  4X43 A;  4ZL9 A;  3UOM A;  1SL1 B;  1GTA A;  2PWJ A;  19GS A;  2CV4 A;  2HNL A;  1SD8 A;  1YDK A;  4BA7 A;  2X8C A;  1V58 A;  5CRW A;  1TK5 B;  1T1V A;  9GSS A;  3KIJ A;  2GSQ A;  4MH3 A;  3P8W A;  4KDU A;  1FAA A;  2A2S A;  3ZYW A;  1SYR A;  2CX3 A;  3GMF A;  1ZYE A;  1SYX A;  1FB0 A;  4V2L A;  1B8X A;  3HYP A;  4LL1 B;  4BL7 A;  2YAN A;  2LEG A;  4EVM A;  1EP7 A;  4J57 E;  4EE0 A;  1O73 A;  5EL8 A;  2OAC A;  4KCE A;  4IQ1 A;  2R6K A;  3IK9 A;  5C00 A;  1XXU A;  3WGX A;  2VL2 A;  1Z7P A;  1QGV A;  2ON7 A;  4XS1 A;  3TJK A;  3CYN A;  2Z9S A;  3ZRD A;  2RM6 A;  4WR4 A;  3VPT A;  2LRT A;  3UVT A;  1T4Y A;  2HFD A;  5JWQ B;  3GFK A;  1M99 A;  3TKS A;  1EV9 A;  6GST A;  1JZR A;  3KGK A;  2H6X A;  1URM A;  2L6D A;  2C0G A;  3TCO A;  3U6V A;  2XC2 A;  2JU5 A;  4X0X A;  2LJR A;  2OBI A;  5ECI B;  1TK8 B;  1T4Z A;  3IV4 A;  4Q5R A;  2LJA A;  4K8M A;  1M2B A;  3M3M A;  4DVC A;  1GSS A;  4LMW A;  3HKR A;  2CQ9 A;  5DAL A;  1MD3 A;  4ZBA A;  3FR6 A;  4K0N A;  2DJ3 A;  22GS A;  1PQN A;  5AIX A;  4ECB A;  5EY6 A;  2B3S A;  1Q4J A;  2H70 A;  2VCT A;  3VPQ A;  4ECC A;  1F6M C;  4PNG A;  5JCG A;  2GT6 A;  2L5L A;  1KEB A;  2PN8 A;  2IMF A;  3LYK A;  1DUG A;  3PR8 A;  4V1A p;  1NM3 A;  1USB A;  3RHB A;  1DE1 A;  13GS A;  1K0D A;  2H6Y A;  3TRQ A;  3GH9 A;  3C71 A;  1OYJ A;  2QSI A;  2V41 A;  5ECO B;  4I6X A;  1LU4 A;  1YJ6 A;  1VF3 A;  4WBJ A;  2HZE B;  5ECQ B;  2R4V A;  3KMO A;  1YKA A;  2KOK A;  1Z6M A;  6GSW A;  10GS A;  2WB9 A;  2ON5 A;  2JAD A;  1XVQ A;  2LQO A;  1JHB A;  4FYU A;  5ECR B;  5AIV A;  4JBB A;  1XW6 A;  4ACS A;  2C3N A;  3Q19 A;  1PL2 A;  4ISD A;  3IHQ A;  1PMT A;  4XTS A;  2CAQ A;  3ERW A;  2K18 A;  3M0F A;  2CVD A;  1ZCP A;  3P2A A;  3UMA A;  2H1A A;  2VCX A;  3RPN A;  5ECP B;  4HJM A;  4POB A;  1GUH A;  2YJH A;  1K0M A;  2IMI A;  3CTF A;  1GNW A;  4CDO A;  4KX4 A;  4TR1 A;  3L9V A;  4OFT A;  4K9Z A;  2V6K A;  2GSR A;  3I6A A;  4IHU A;  5ID2 A;  3GN3 A;  5DBQ A;  2IWT A;  3GL5 A;  3FYG A;  3D6I A;  1XCC A;  1JLW A;  7GSS A;  2C0F A;  3GX0 A;  1OVN A;  1MDI A;  4MH2 A;  4I8B A;  5JWO B;  2F51 A;  2TRC P;  3J7Y k;  4O7H A;  1S3D A;  2PVQ A;  4WF4 A;  3IBH A;  3CRT A;  5KN2 A;  1K0C A;  1QFN A;  2O87 A;  5CRE A;  4ZB9 A;  4CW9 A;  5INY A;  1R26 A;  1XZO A;  3VWU A;  1WWJ A;  3F6D A;  3N9J A;  5IO0 A;  4L0U A;  4ZXG A;  6GSU A;  4TXV A;  3IPZ A;  2YP6 A;  1YF1 A;  2E2M A;  4GWR A;  2EIQ A;  2CA8 A;  3W6G A;  1GUM A;  4GLT A;  2YWM A;  2C0D A;  3BCI A;  3TDG A;  2DJ2 A;  4F2I A;  3LWA A;  3EUR A;  5G31 A;  2N5F A;  3J7Y b;  3D5J A;  5CRH A;  2AV4 A;  3TJG A;  3BBY A;  1M2A A;  5D8I A;  2IJY A;  4TR3 A;  1JZO A;  2HXK A;  4XS6 A;  4KCA A;  5ID2 B;  4FIW A;  5IMF A;  2LUS A;  2EIR A;  1A8L A;  4H86 A;  1PX6 A;  2X8H A;  3GKK A;  1YY7 A;  3DRN A;  1U3I A;  2M46 A;  2C1Y A;  2CVB A;  3WYW A;  3GX8 A;  1W4V A;  3IA1 A;  5IMC A;  2GZZ A;  1U87 A;  3LXZ A;  5AN1 A;  4J2F A;  5CRG A;  4MPF A;  3VFI A;  4ML1 A;  5DQS A;  1HNA A;  1KNG A;  4EUY A;  1XWG A;  2MMA A;  1JLV A;  4NPB A;  4E8E A;  4F0C A;  1WP0 A;  4KGI A;  2AJQ B;  1XFL A;  5B8A A;  2NBS A;  3HCZ A;  3N5O A;  3KTL A;  2F9S A;  5JCU A;  1M2D A;  3LXT A;  5LD0 A;  4DSS A;  1K0N A;  4MF5 A;  4EO3 A;  4DSR A;  3I9V 2;  4HOJ A;  3G7J A;  4XHM A;  5COH A;  4PUF C;  3GKN A;  2QC7 A;  1TU7 A;  1XOA A;  1T3B A;  2YWI A;  3HZ4 A;  2GZP A;  2YWO A;  3NIV A;  4EDY A;  2CT6 A;  4KSM A;  4OO5 A;  4JE1 A;  3L9U A;  5J5N A;  4KH7 A;  2MBS A;  1AW9 A;  1SL0 B;  5L71 A;  2WRT A;  2YNX A;  4IEL A;  18GS A;  2DJ0 A;  3ZFL A;  6GSS A;  1FB6 A;  3C73 A;  4RI6 A;  1SK0 A;  2E0Q A;  3L78 A;  3UAP A;  2H6Z A;  2RUF A;  2GTU A;  4ZL8 A;  1AAZ A;  3KEB A;  1X5C A;  2HYX A;  4FYB A;  1A2M A;  2N5A A;  3CBU A;  2B6M A;  2C0E A;  1WOU A;  2EC4 A;  4TXO A;  3US3 A;  5H5R A;  1AXD A;  3D4M A;  4MJC A;  2NDO A;  5IMV A;  3KZQ A;  1THO A;  2PPT A;  2MYG A;  3PH9 A;  1XOB A;  3QPM A;  4EF0 A;  4MZW A;  5DAK A;  3F4T A;  4KDY A;  4XS4 A;  1WE0 A;  1X5E A;  2DIZ A;  5JWR B;  3UBL A;  4ULX A;  1GRX A;  4POM A;  2O85 A;  3HD5 A;  4TRX A;  1NHY A;  2FA4 A;  3CRU A;  3QFB C;  3RHC A;  3QAG A;  3F6F A;  1ACV A;  2WZ9 A;  1Z5Y E;  3HZ8 A;  2J9H A;  1HNB A;  1SJZ A;  4BPY A;  1K0A A;  3L9S A;  1JFU A;  3DGQ A;  4HU7 A;  1J0F A;  1M7T A;  5AGY A;  1EP8 A;  3DD3 A;  1OE8 A;  1CQH A;  2HT9 A;  2FHE A;  4AF2 A;  2FWG A;  2JZR A;  3TOU A;  2X64 A;  4IVF A;  2YOI A;  2C80 A;  4NHW A;  2LST A;  4HEA 2;  4XRA A;  3QAW A;  3GSS A;  2C3T A;  2VM2 A;  5IMZ A;  4D73 A;  2O8V B;  5ELA A;  4GRF A;  3O6T A;  2YN1 A;  3E9J B;  2AAW A;  3DIE A;  3EYT A;  4I97 A;  2IFQ A;  4XS4 B;  4MJB A;  2LRC A;  2VUP A;  3O76 A;  2FGX A;  1OC3 A;  1TI1 A;  5HR1 A;  3RDW A;  2NPB A;  2HRF A;  3H1N A;  2LJK A;  3IE3 A;  4RI7 A;  5D96 A;  1TU8 A;  4OWY A;  3GTU B;  1UA5 A;  2VAF A;  1T8E B;  5D73 A;  1VGL A;  1A24 A;  1S3A A;  2H1D A;  1A2L A;  3F4R A;  3FR3 A;  4F82 A;  2H19 A;  4NMU A;  5F07 A;  5KN1 A;  2DML A;  3KM6 A;  2DIY A;  4PUA A;  4NV5 A;  2VCV A;  1PSQ A;  3GIX A;  4ECI A;  4EXJ A;  2MZC A;  4HUA A;  5H5Q A;  1QUW A;  2B7K A;  3TKQ A;  2V1M A;  1GLQ A;  1X5D A;  1Z3E A;  2OJL A;  4AGS A;  4NHZ A;  1G7O A;  3F3Q A;  3UVH A;  4I2T A;  2QKE A;  4BVX A;  4MCU A;  2K6V A;  1KBN A;  3UBK A;  1E2Y A;  5LNK e;  2A2R A;  3HJP A;  3HA9 A;  5KN0 A;  4KW6 A;  1GP1 A;  1UVZ A;  4N30 A;  1AQW A;  3TJJ A;  1A8Y A;  3ZML A;  2IPA A;  3KP8 A;  5B6M A;  1RW1 A;  3FEU A;  5J9B A;  2CX4 A;  4EC0 A;  2L59 A;  4OD7 A;  1PD2 1;  2H8L A;  3Q6O A;  4MK3 A;  5GST A;  1SU9 A;  3C8E A;  2FWF A;  5AIS A;  3IOS A;  2LQQ A;  2DMM A;  3GKX A;  2RII A;  1K0B A;  1GWC A;  3Q18 A;  2GDR A;  2VD1 A;  1TDI A;  1C72 A;  4N0V A;  4ZB8 A;  1EEM A;  1M9A A;  4IN0 A;  5CP1 A;  4HJ2 A;  5J9C A;  3TJF A;  2YV7 A;  5A4V A;  2FLS A;  3MDK A;  5F0G A;  2FY6 A;  1F9M A;  4WXT A;  2GSS A;  1TRW A;  1PL1 A;  1ZGN A;  5IPG A;  4IJ3 A;  2YJ7 A;  1AIU A;  3ZVJ A;  2IL3 A;  4PUR A;  3APQ A;  3LGC A;  4ECJ A;  1OC8 A;  3GA4 A;  4YH2 A;  1A2J A;  4IW9 A;  3HJM A;  4RQR A;  3KXO A;  4NV2 A;  1U6T A;  3ZLP A;  1B9X C;  2OAD A;  2PU9 C;  4QL9 A;  4TW5 A;  1B9Y C;  4OO4 A;  1A0R P;  1ON4 A;  3GST A;  3MWH A;  4O92 A;  3EU4 A;  1OKT A;  1TOF A;  1X9W B;  5G5E A;  4L8E A;  3QMX A;  4G9H A;  3H8Q A;  3FY7 A;  2ALB A;  2X8G A;  1FW1 A;  2LRN A;  3ERF A;  3IC4 A;  4TR0 A;  3KD0 A;  4JR6 A;  4QL7 A;  4AJ8 A;  2AUV A;  4JR4 A;  4JRR A;  1XW9 A;  1R7H A;  4IJI A;  2N5B A;  4YQM A;  2MMZ A;  5DAL B;  4HI7 A;  1EZK A;  3IAS 2;  5ECM B;  4NWY A;  2PBJ A;  3HXS A;  4HS1 A;  2H75 A;  4TKY A;  4LLR A;  1YF0 A;  3EIN A;  4WF5 A;  3C1S A;  2I81 A;  4F9Z A;  1ERU A;  4K7O A;  4RQX A;  4MZB A;  4K7N A;  2VCQ A;  1XIY A;  5HFK A;  2DBC A;  2BMX A;  1TI3 A;  4FO5 A;  4NXI A;  1TTZ A;  3CMI A;  5KEJ A;  4ZIJ A;  4YQV A;  1GTI A;  2PUK C;  1GSU A;  4FYC A;  1R4W A;  2ZCT A;  1TRV A;  1BJX A;  3A2X A;  2VLV A;  1VF1 A;  2JZS A;  5G1L A;  4IQA A;  3ZIV A;  2PMT A;  2L57 A;  3M9K A;  2I1U A;  1V40 A;  2IN3 A;  3APO A;  1G6W A;  5D9V A;  2MBT A;  3E0U A;  2VM1 A;  2AYT A;  4N10 A;  2H01 A;  2AHE A;  1XWC A;  1I9D A;  3HJO A;  4LA1 A;  4ZBD A;  3TRX A; 
#chains in the Genus database with same CATH topology
 5FWG A;  4PNF A;  5HR3 A;  3L4N A;  12GS A;  1ERW A;  3RBT A;  4IKH A;  2VL3 A;  4TR1 B;  3MAK A;  1FO5 A;  3I43 A;  2H0I A;  4EDZ A;  4HZ4 A;  1GUL A;  5CNW A;  3DVW A;  1ZMA A;  3BOA A;  1TW9 A;  4K1F A;  5GAN D;  1OC9 A;  1ZYQ B;  1WMJ A;  1SJ6 A;  1V9W A;  1GLP A;  1N8J A;  3EMP A;  3GH6 A;  1XWB A;  5HR2 A;  1ABA A;  5C04 A;  2P5Q A;  3ZIT A;  4XIH A;  3ME7 A;  1ZZY A;  5D93 A;  4GF0 A;  1GL8 A;  1ZOF A;  3DWV A;  3F8U A;  4YQU A;  4YKG A;  3ZL5 A;  2F3M A;  4WR5 A;  17GS A;  4MF7 A;  2H71 A;  2JZT A;  2BTO T;  3FKF A;  5G30 A;  1R5A A;  4I5Q A;  1YEX A;  4OCF A;  1GNE A;  1JZD A;  1PN0 A;  4HSC X;  5HR0 A;  2HLS A;  4PQH A;  2KP2 A;  5D9W A;  1O81 A;  3R2Q A;  3K8N A;  1HNC A;  2DJJ A;  3W8J A;  4PQI A;  3VWW A;  1VF2 A;  3TRP A;  3HVX A;  2FCH A;  1TJD A;  4L5O A;  2HRN A;  4N11 A;  3C1R A;  3HHV A;  5F05 A;  4X1U A;  2REM A;  3CSH A;  2WGR A;  4G0I A;  3WT1 A;  3UEM A;  5HQP A;  1T7P B;  1ERT A;  1YKC A;  4V2N A;  4POL A;  3EE2 A;  2PER A;  3VUR A;  5EPF A;  2GZY A;  5GSS A;  1NW2 A;  2IME A;  4OMV A;  2VL9 A;  1RQM A;  2CZ3 A;  2O7K A;  1GSD A;  3CSI A;  4NAX A;  2HI7 A;  2VIM A;  4CHS A;  5IQY A;  5IOW A;  5J3R A;  4L0W A;  2YCD A;  4DSS B;  3M9J A;  4GQF A;  1VF4 A;  2H73 A;  5FT3 A;  2CVK A;  1BED A;  1QK8 A;  3DML A;  3QFA C;  4MNN A;  5G5F A;  3ED3 A;  2KHP A;  2LNT A;  4KDX A;  1O6J A;  4K6X A;  4KA0 A;  4IGJ A;  1F3B A;  1GTB A;  3GUR A;  3FRC A;  1FG4 A;  5JCW A;  4V2M A;  5CAX A;  2GGT A;  2RLI A;  1BAY A;  3KP9 A;  3W8S A;  1UC7 A;  2GLR A;  4ZL7 A;  2XPD A;  4GST A;  4MLY A;  1GH2 A;  2MMN A;  3WGE A;  1K3Y A;  1EWX A;  4K5R A;  3H79 A;  3U5R E;  2XBI A;  4O5Q A;  2P5R A;  1VRS D;  1ZYN A;  3I69 A;  2WCI A;  1B4P A;  2R37 A;  3D22 A;  1SKW B;  2DC5 A;  4K0G A;  2LNS A;  5DDL A;  2JAC A;  1H4O A;  4WET A;  2JL4 A;  3PGT A;  1R5P A;  4YAP A;  4HZ2 A;  3D21 A;  4OFM A;  4TXO B;  4Q5F A;  2H1B A;  4Q5N A;  3IK7 A;  2OE1 A;  3MSZ A;  1PN9 A;  2YWN A;  6GSV A;  5ECS A;  4AJ7 A;  2DSA A;  3TOT A;  5DAK B;  5IPH A;  2DJK A;  3ZZX A;  3QR6 A;  2KLX A;  3LQ7 A;  2DLX A;  2I3Y A;  3DKS A;  4BVY A;  5HFG A;  1J08 A;  3F4S A;  1EV4 A;  3CTG A;  1O8W A;  1YZX A;  3A2W A;  1PRX A;  3UAR A;  5D9T A;  1I5G A;  2H76 A;  2J23 A;  4ID0 A;  1EOG A;  2G2Q A;  1XG8 A;  1W89 A;  3GV1 A;  1XBS A;  1TK0 B;  1G0T A;  3Q74 A;  3DEX A;  4J56 E;  3UJ1 A;  4ML6 A;  3C7M A;  3KCM A;  4HQZ A;  1FOV A;  3EMX A;  1PKW A;  5J41 A;  3D4T A;  3DXB A;  4POK A;  1SK2 A;  1DBY A;  5IMD A;  4LMV A;  3ZVJ D;  3UL3 A;  2ZNM A;  2GVP A;  2L4Q A;  4FH8 A;  1GSQ A;  2R0P A;  1QXH A;  3ZMK A;  4O32 A;  2YPM A;  5ECL B;  5EVO A;  1O8X A;  4IP6 A;  3S9F A;  3KJY A;  5CO3 A;  1PKZ A;  4WEY A;  3ZFB A;  2H0H A;  4D73 B;  2GQM A;  5ECH B;  4GCI A;  5ELG A;  2JSZ A;  1WJK A;  2FWH A;  3QD9 A;  3JCM L;  1A0F A;  2VD0 A;  4TVE A;  4HDE A;  1N2A A;  2VL2 C;  2IFQ B;  2R0C A;  3RAZ A;  3KH9 A;  4P3Y B;  2FUG 2;  2BJX A;  5CYY A;  3OR5 A;  2V6O A;  2L4C A;  3BCK A;  1G7E A;  1AQV A;  1XWK A;  2FNO A;  5F8B A;  3TKS C;  1CQG A;  2WJU A;  5A4U A;  2OKA A;  5B7C A;  3ERG A;  2RUE A;  4K7I A;  1SL2 B;  5F06 A;  3FHK A;  2GST A;  2LV3 A;  5A4W A;  2H1G A;  4I2U A;  3HDC A;  4XRD A;  2VCZ A;  2E2G A;  1EOH A;  2HZF A;  3G7I A;  4TR4 A;  2HZE A;  4E8H A;  3FZA A;  3KMN A;  3P90 A;  3HVV A;  1K3L A;  2F8F A;  1TP9 A;  5DQY A;  4AJ6 A;  3ZRE A;  4BVX B;  5IM9 A;  5IO2 A;  3GHA A;  4MJE A;  3EU3 A;  3VLN A;  3WD6 A;  1JZW A;  3A3T A;  4XCS A;  4PXO A;  1OKD A;  2VLT A;  2B5Y A;  3LG6 A;  2JSY A;  4HQS A;  4DEJ A;  4O5U A;  5KOX A;  3PIN A;  4MF6 A;  5ENU A;  1MD4 A;  3M8N A;  4KB3 A;  2VO4 A;  3MNG A;  2C8U A;  4G10 A;  2G0F A;  1BQ7 A;  2KP1 A;  3QOU A;  6GSX A;  5IIZ A;  4V1A g;  2NTO A;  2OE0 A;  2X4A A;  3CSJ A;  3QDN A;  1UN2 A;  5ECK B;  2HSH A;  2H30 A;  1V98 A;  3H93 A;  5KN3 A;  1MDJ A;  1Q98 A;  1M3J A;  1LBK A;  1NHO A;  1WRY A;  1BX9 A;  1TRS A;  1Z6N A;  1B4Q A;  5G2Z A;  1E6B A;  3BJ5 A;  3GRX A;  3D0Z A;  1S3C A;  2HRA A;  1SJI A;  5LCZ A;  1U3A A;  2B1K A;  4F03 A;  2GS3 A;  2P0G A;  2PGT A;  3VK9 A;  1Z9H A;  1AQX A;  3ISO A;  4PQ1 A;  3HVS A;  5ECN B;  1WPI A;  3FW2 A;  3A5W A;  4KSO A;  4Q5Q A;  3F9U A;  4TOP A;  3DYR A;  4ZB6 A;  5IMA A;  1T00 A;  4RUV A;  2OBK A;  5HFI A;  1OE7 A;  3G9B A;  2LKU A;  2K8S A;  3FZ5 A;  2KUC A;  1HYU A;  4PGT A;  1GUK A;  4K2D A;  16GS A;  2GT5 A;  3CXG A;  2L6C A;  2E7P A;  4YAV A;  5J4U A;  2WDU A;  2IIY A;  1V57 A;  3LYP A;  1XWA A;  3GUS A;  2XPE A;  4GXZ A;  3G7Y A;  1ST9 A;  3IXR A;  2R5G A;  1ILO A;  4Z2U A;  3VI5 A;  2LTK A;  1AC1 A;  1GSE A;  3IAM 2;  1GSY A;  3FZ4 A;  3V1W A;  3GL3 A;  1F2E A;  2FWE A;  2PVO C;  1X0R A;  2XHF A;  3KH7 A;  5ABR A;  3H4K A;  1FHE A;  2L5O A;  3A2V A;  3PPU A;  1F3A A;  3HY2 A;  1G6Y A;  3LEF A;  4KND A;  4TN8 A;  3IRA A;  2UZ8 A;  3M1G A;  5FHI A;  1GSF A;  3SBC A;  3FR9 A;  4EIQ A;  1M0U A;  1XVW A;  1X9M B;  2R3X A;  1SEN A;  1YQ1 A;  2DKH A;  2HE3 A;  2TRX A;  1YEP A;  5DVB A;  3TGZ A;  4DSQ A;  2QA2 A;  3DVX A;  4G0L A;  4ILF A;  1M9B A;  3SWL A;  5B8B A;  3APS A;  4MA9 A;  1O7U A;  2X99 A;  4KAE A;  2GQL A;  4JED A;  3F3R A;  2WS2 A;  2YZU A;  1QQ2 A;  3FZ9 A;  4KUN A;  5E4W A;  2YV9 A;  20GS A;  2IMK A;  2H66 A;  1PX7 A;  4EL1 A;  2FD3 A;  2IMD A;  3VWX A;  2OA7 A;  2K8V A;  2H74 A;  2NVL A;  2I9H A;  2DJ1 A;  3AY8 A;  4G2E A;  3ZIJ A;  1SKR B;  4JZQ A;  3BD2 A;  3F0I A;  1KTE A;  2V2G A;  2ES7 A;  4GTU A;  1FVJ A;  5B6N A;  1TKD B;  3WT2 A;  1ERV A;  2B5X A;  1GTU A;  4USS A;  1K3O A;  1B48 A;  11GS A;  5IOX A;  4MZC A;  3TKP A;  1MDK A;  1DE2 A;  2WUL A;  2TIR A;  3KTB A;  2YZH A;  5DCH A;  5E59 A;  2AB6 A;  3R3E A;  4BWS A;  4OFN A;  1J9B A;  1OC9 B;  1BG5 A;  3EC3 A;  3EVI A;  2B1L A;  1Y6E A;  4G19 A;  2M80 A;  1ZL9 A;  2C3Q A;  3NOF A;  8GSS A;  4WKW A;  1PA3 A;  1WIK A;  3LFL A;  4OCE A;  5CRD A;  3IR4 A;  1ZYP A;  1EGR A;  2H0G A;  14GS A;  4KE3 A;  1BYE A;  4MAB A;  2GQK A;  4O5R A;  5G1K A;  1SKS B;  3F63 A;  2M72 A;  1RK4 A;  1PGT A;  1IYI A;  3ZTL A;  3LOR A;  1MEK A;  2VCW A;  2D2Z A;  3IC8 A;  3TKS E;  2FA8 A;  1FVK A;  1MTC A;  2K9F A;  3TB2 A;  2MMO A;  3IDV A;  1IYH A;  1EGO A;  2F8A A;  2EIO A;  3NZN A;  2CAI A;  2B7J A;  1LJR A;  2A4V A;  3LSZ A;  4IP1 A;  3GYK A;  1SK1 A;  4WBR D;  4MJA A;  1U88 A;  2HSM A;  4ZBB A;  1QMV A;  1TXX A;  3LJR A;  2QA1 A;  3RPP A;  4LL4 B;  1X9S B;  4HU9 A;  3P7X A;  5KOW A;  5H5S A;  4GSS A;  1ML6 A;  3VWV A;  4GQC A;  2I4A A;  5D9X A;  1K0O A;  4IS0 A;  4MP4 A;  2WFC A;  3ME8 A;  1HD2 A;  3L0H A;  3FK8 A;  3GTU A;  2LS5 A;  1Y25 A;  3TJB A;  3UIW A;  4EKZ A;  6GSY A;  2ZUP A;  4GSN A;  1SD9 A;  2VOC A;  4Z2R A;  1O85 A;  3QCP A;  4PX1 A;  1DSB A;  4A5P A;  1TRU A;  1M3I A;  2HRK A;  1Z7R A;  5DCG A;  2XBQ A;  2QGV A;  4MDC A;  1NSW A;  4BWQ A;  5GAP D;  3EWL A;  2CZ2 A;  2OE3 A;  2H72 A;  5DJM A;  2P31 A;  4X4J A;  1XW5 A;  4F0B A;  1A23 A;  3GNJ A;  3QAV A;  3GKM A;  2R2J A;  4L5L A;  4MPG A;  5GZZ B;  2VLU A;  1EEJ A;  2HSY A;  5A5K A;  3TUE A;  4JU5 A;  3O3T A;  4ZIL A;  4N0Z A;  1AUC A;  2C4J A;  3TKR A;  3E3E A;  4MMM A;  2V32 A;  1HQO A;  1V2A A;  4Z7X A;  1F37 A;  2O89 A;  4IBP A;  2RM5 A;  3WGD A;  4QQ7 A;  1XPV A;  2B5E A;  5DJL A;  3VI7 A;  1H75 A;  1THX A;  1OAZ A;  4X43 A;  4ZL9 A;  3UOM A;  1SL1 B;  1GTA A;  2PWJ A;  19GS A;  2CV4 A;  2HNL A;  1SD8 A;  1YDK A;  4BA7 A;  2X8C A;  1V58 A;  5CRW A;  1TK5 B;  1T1V A;  9GSS A;  3KIJ A;  2GSQ A;  4MH3 A;  3P8W A;  4KDU A;  3EPT A;  1FAA A;  2A2S A;  3ZYW A;  1SYR A;  2CX3 A;  3GMF A;  1ZYE A;  1SYX A;  1FB0 A;  4V2L A;  1B8X A;  3HYP A;  4LL1 B;  4K2X A;  4BL7 A;  4BVY B;  2YAN A;  2LEG A;  4EVM A;  1EP7 A;  4J57 E;  4Z2T A;  4EE0 A;  1O73 A;  5EL8 A;  2OAC A;  4KCE A;  4IQ1 A;  2R6K A;  3IK9 A;  5C00 A;  1XXU A;  3WGX A;  2VL2 A;  1Z7P A;  1QGV A;  2ON7 A;  4XS1 A;  3TJK A;  3CYN A;  2Z9S A;  3ZRD A;  2RM6 A;  4WR4 A;  3VPT A;  2LRT A;  3UVT A;  1T4Y A;  2HFD A;  5JWQ B;  2A2P A;  3GFK A;  1M99 A;  3TKS A;  1EV9 A;  6GST A;  1JZR A;  3KGK A;  2H6X A;  1URM A;  2L6D A;  2C0G A;  3TCO A;  3U6V A;  2XC2 A;  2JU5 A;  4X0X A;  2LJR A;  2OBI A;  5ECI B;  1TK8 B;  1T4Z A;  3IV4 A;  4Q5R A;  2LJA A;  4K8M A;  1M2B A;  3M3M A;  4DVC A;  1GSS A;  4LMW A;  3HKR A;  4YKF A;  2CQ9 A;  5BRT A;  5DAL A;  1MD3 A;  4ZBA A;  3FR6 A;  4K0N A;  2DJ3 A;  22GS A;  1PQN A;  5AIX A;  4ECB A;  5EY6 A;  3CQF A;  2B3S A;  1Q4J A;  2H70 A;  2VCT A;  3VPQ A;  4ECC A;  1F6M C;  4PNG A;  5JCG A;  2GT6 A;  2L5L A;  1KEB A;  2PN8 A;  2IMF A;  3LYK A;  1DUG A;  3PR8 A;  4G0K A;  4V1A p;  1NM3 A;  1USB A;  3RHB A;  1DE1 A;  13GS A;  1K0D A;  2H6Y A;  3TRQ A;  3GH9 A;  3C71 A;  1OYJ A;  2QSI A;  2V41 A;  5ECO B;  4I6X A;  1LU4 A;  1YJ6 A;  1VF3 A;  4WBJ A;  2HZE B;  5ECQ B;  2R4V A;  3KMO A;  1YKA A;  2KOK A;  1Z6M A;  6GSW A;  10GS A;  2WB9 A;  2ON5 A;  2JAD A;  1XVQ A;  2LQO A;  1JHB A;  4FYU A;  5ECR B;  5AIV A;  4JBB A;  1XW6 A;  4ACS A;  2C3N A;  3Q19 A;  1PL2 A;  4ISD A;  3IHQ A;  1PMT A;  4XTS A;  2CAQ A;  2X49 A;  3ERW A;  2K18 A;  3M0F A;  2CVD A;  1ZCP A;  3P2A A;  3UMA A;  2H1A A;  2VCX A;  3RPN A;  5ECP B;  4HJM A;  4POB A;  1GUH A;  2YJH A;  2R0G A;  1K0M A;  2IMI A;  3CTF A;  1GNW A;  4CDO A;  4KX4 A;  4TR1 A;  3L9V A;  4OFT A;  4K9Z A;  2V6K A;  2GSR A;  3I6A A;  4IHU A;  5ID2 A;  3GN3 A;  5DBQ A;  2IWT A;  3GL5 A;  3FYG A;  3D6I A;  1XCC A;  1JLW A;  7GSS A;  2C0F A;  3GX0 A;  1OVN A;  1MDI A;  4MH2 A;  4I8B A;  3LW9 A;  5JWO B;  2F51 A;  2TRC P;  3J7Y k;  4O7H A;  1S3D A;  2PVQ A;  4WF4 A;  3IBH A;  3CRT A;  5KN2 A;  4EIP A;  1K0C A;  1QFN A;  2O87 A;  5CRE A;  4ZB9 A;  4CW9 A;  5INY A;  1R26 A;  1XZO A;  3VWU A;  1WWJ A;  3F6D A;  3N9J A;  5IO0 A;  4L0U A;  4ZXG A;  6GSU A;  4TXV A;  3IPZ A;  2YP6 A;  1YF1 A;  2E2M A;  4GWR A;  2EIQ A;  2CA8 A;  3W6G A;  1GUM A;  4GLT A;  2YWM A;  2C0D A;  3BCI A;  3TDG A;  2DJ2 A;  4F2I A;  3LWA A;  3EUR A;  5G31 A;  2N5F A;  3J7Y b;  3D5J A;  5CRH A;  2AV4 A;  3TJG A;  4CY6 A;  3BBY A;  1M2A A;  5D8I A;  2IJY A;  4TR3 A;  1JZO A;  2HXK A;  4XS6 A;  4BIK A;  4KCA A;  5ID2 B;  4FIW A;  5IMF A;  2LUS A;  2EIR A;  1A8L A;  4H86 A;  1PX6 A;  2X8H A;  3GKK A;  1YY7 A;  3DRN A;  1U3I A;  2M46 A;  2C1Y A;  2CVB A;  3WYW A;  3GX8 A;  1W4V A;  3IA1 A;  5IMC A;  2GZZ A;  1U87 A;  3LXZ A;  5AN1 A;  4J2F A;  5CRG A;  4MPF A;  3VFI A;  4ML1 A;  5DQS A;  1HNA A;  1KNG A;  4EUY A;  1XWG A;  2MMA A;  1JLV A;  4NPB A;  4E8E A;  4F0C A;  1WP0 A;  4KGI A;  2AJQ B;  1XFL A;  5B8A A;  2NBS A;  3HCZ A;  3N5O A;  3KTL A;  2F9S A;  5JCU A;  1M2D A;  3LXT A;  5LD0 A;  4DSS A;  1K0N A;  4MF5 A;  4EO3 A;  4DSR A;  3I9V 2;  4HOJ A;  3G7J A;  4XHM A;  5COH A;  4PUF C;  3GKN A;  3FMW A;  2QC7 A;  1TU7 A;  1XOA A;  1T3B A;  2YWI A;  3HZ4 A;  2GZP A;  2YWO A;  3NIV A;  4EDY A;  2CT6 A;  4KSM A;  4OO5 A;  4JE1 A;  3L9U A;  5J5N A;  4KH7 A;  2MBS A;  1AW9 A;  1SL0 B;  5L71 A;  2WRT A;  2YNX A;  4IEL A;  18GS A;  3MIX A;  2DJ0 A;  3ZFL A;  6GSS A;  1FB6 A;  3C73 A;  4RI6 A;  1SK0 A;  2E0Q A;  3L78 A;  3UAP A;  2H6Z A;  2RUF A;  2GTU A;  4ZL8 A;  1AAZ A;  3KEB A;  1X5C A;  2HYX A;  4FYB A;  1A2M A;  2N5A A;  3CBU A;  2B6M A;  2A4H A;  2C0E A;  1WOU A;  2EC4 A;  4TXO A;  3US3 A;  5H5R A;  1AXD A;  3D4M A;  4MJC A;  2NDO A;  5IMV A;  3KZQ A;  1THO A;  2PPT A;  2MYG A;  3PH9 A;  1XOB A;  3QPM A;  4EF0 A;  4MZW A;  3A5I A;  5DAK A;  3F4T A;  4KDY A;  4XS4 A;  1WE0 A;  1X5E A;  2DIZ A;  5JWR B;  3MYD A;  3UBL A;  4ULX A;  1GRX A;  4POM A;  2O85 A;  3HD5 A;  4TRX A;  1NHY A;  2FA4 A;  3CRU A;  3QFB C;  3RHC A;  3QAG A;  3F6F A;  1ACV A;  2WZ9 A;  1Z5Y E;  3HZ8 A;  2J9H A;  1HNB A;  1SJZ A;  4BPY A;  4KF9 A;  1K0A A;  3L9S A;  1JFU A;  3DGQ A;  4HU7 A;  1J0F A;  1M7T A;  5AGY A;  1EP8 A;  3DD3 A;  1OE8 A;  1CQH A;  2HT9 A;  2FHE A;  4AF2 A;  2FWG A;  2JZR A;  3TOU A;  2X64 A;  4IVF A;  2YOI A;  2C80 A;  4NHW A;  2LST A;  4HEA 2;  4XRA A;  3QAW A;  3GSS A;  2C3T A;  2VM2 A;  5IMZ A;  4D73 A;  2O8V B;  5ELA A;  4K5S A;  4GRF A;  3O6T A;  2YN1 A;  3E9J B;  2AAW A;  3DIE A;  3EYT A;  4I97 A;  2IFQ A;  4XS4 B;  4MJB A;  2LRC A;  2VUP A;  3O76 A;  2FGX A;  1OC3 A;  1TI1 A;  5HR1 A;  3RDW A;  4ICY A;  2NPB A;  2HRF A;  3H1N A;  2LJK A;  3IE3 A;  4RI7 A;  5D96 A;  1TU8 A;  4OWY A;  3GTU B;  1UA5 A;  2VAF A;  1T8E B;  5D73 A;  1VGL A;  1A24 A;  1S3A A;  2H1D A;  1A2L A;  3F4R A;  3FR3 A;  4F82 A;  2H19 A;  4NMU A;  5F07 A;  5KN1 A;  2DML A;  3KM6 A;  2DIY A;  4PUA A;  4NV5 A;  2VCV A;  1PSQ A;  3GIX A;  4ECI A;  4EXJ A;  2MZC A;  4HUA A;  5H5Q A;  1QUW A;  2B7K A;  3TKQ A;  2V1M A;  1GLQ A;  1X5D A;  1Z3E A;  2OJL A;  4AGS A;  4NHZ A;  1S3R A;  1G7O A;  3F3Q A;  3UVH A;  4I2T A;  2QKE A;  4BVX A;  4MCU A;  2K6V A;  1KBN A;  3UBK A;  1E2Y A;  5LNK e;  2A2R A;  3HJP A;  3HA9 A;  5KN0 A;  4KW6 A;  1GP1 A;  1UVZ A;  4N30 A;  1AQW A;  3TJJ A;  1A8Y A;  3ZML A;  2IPA A;  3KP8 A;  5B6M A;  5BMU A;  1RW1 A;  3FEU A;  5J9B A;  2CX4 A;  4EC0 A;  2L59 A;  4OD7 A;  1PD2 1;  2H8L A;  3Q6O A;  4MK3 A;  5GST A;  1SU9 A;  1FOH A;  3C8E A;  2FWF A;  5AIS A;  3IOS A;  2LQQ A;  2DMM A;  3GKX A;  2RII A;  1K0B A;  1GWC A;  3Q18 A;  2GDR A;  2VD1 A;  1TDI A;  1C72 A;  4N0V A;  4ZB8 A;  1EEM A;  1M9A A;  4IN0 A;  5CP1 A;  4HJ2 A;  1PFO A;  5J9C A;  3TJF A;  2YV7 A;  5A4V A;  2FLS A;  3MDK A;  5F0G A;  2FY6 A;  1F9M A;  4WXT A;  2GSS A;  1TRW A;  1PL1 A;  1ZGN A;  5IPG A;  4BL7 B;  4IJ3 A;  2YJ7 A;  1AIU A;  3ZVJ A;  2IL3 A;  4PUR A;  3APQ A;  3LGC A;  4ECJ A;  1OC8 A;  3GA4 A;  4YH2 A;  1A2J A;  4IW9 A;  3HJM A;  4RQR A;  3KXO A;  4NV2 A;  1U6T A;  3ZLP A;  1B9X C;  2OAD A;  2PU9 C;  4QL9 A;  4TW5 A;  1B9Y C;  4OO4 A;  1A0R P;  1ON4 A;  3GST A;  2DKI A;  4CY8 A;  3MWH A;  4PTS A;  4O92 A;  3EU4 A;  1OKT A;  1TOF A;  1X9W B;  5G5E A;  4L8E A;  3QMX A;  4G9H A;  3H8Q A;  3FY7 A;  2ALB A;  2X8G A;  1FW1 A;  2LRN A;  3ERF A;  3IC4 A;  4TR0 A;  3KD0 A;  4JR6 A;  4QL7 A;  4AJ8 A;  2AUV A;  4JR4 A;  4JRR A;  1XW9 A;  1R7H A;  4IJI A;  2N5B A;  4YQM A;  2MMZ A;  5DAL B;  4HI7 A;  1EZK A;  3IAS 2;  3IHG A;  4FQU A;  5ECM B;  4NWY A;  2PBJ A;  3HXS A;  4HS1 A;  2H75 A;  4TKY A;  4LLR A;  1YF0 A;  3EIN A;  4WF5 A;  3C1S A;  2I81 A;  4F9Z A;  1ERU A;  4K7O A;  4RQX A;  4MZB A;  4K7N A;  2VCQ A;  1XIY A;  5HFK A;  2DBC A;  2BMX A;  1TI3 A;  4FO5 A;  4NXI A;  1TTZ A;  3CMI A;  5KEJ A;  4ZIJ A;  4YQV A;  1GTI A;  2PUK C;  1GSU A;  4FYC A;  1R4W A;  2ZCT A;  1TRV A;  1BJX A;  3A2X A;  2VLV A;  1VF1 A;  2JZS A;  5G1L A;  4IQA A;  3ZIV A;  2PMT A;  2L57 A;  3M9K A;  2I1U A;  1V40 A;  2IN3 A;  3APO A;  1G6W A;  5D9V A;  2MBT A;  3HVN A;  3E0U A;  2VM1 A;  2AYT A;  4N10 A;  2H01 A;  2AHE A;  1XWC A;  1I9D A;  3HJO A;  4LA1 A;  4ZBD A;  3TRX A; 
#chains in the Genus database with same CATH homology
 5FWG A;  4PNF A;  5HR3 A;  3L4N A;  12GS A;  1ERW A;  3RBT A;  4IKH A;  2VL3 A;  4TR1 B;  3MAK A;  1FO5 A;  3I43 A;  2H0I A;  4EDZ A;  4HZ4 A;  1GUL A;  5CNW A;  3DVW A;  1ZMA A;  3BOA A;  1TW9 A;  4K1F A;  5GAN D;  1OC9 A;  1ZYQ B;  1WMJ A;  1SJ6 A;  1V9W A;  1GLP A;  1N8J A;  3EMP A;  3GH6 A;  1XWB A;  5HR2 A;  1ABA A;  5C04 A;  2P5Q A;  3ZIT A;  4XIH A;  3ME7 A;  1ZZY A;  5D93 A;  4GF0 A;  1GL8 A;  1ZOF A;  3DWV A;  3F8U A;  4YQU A;  4YKG A;  3ZL5 A;  2F3M A;  4WR5 A;  17GS A;  4MF7 A;  2H71 A;  2JZT A;  2BTO T;  3FKF A;  5G30 A;  1R5A A;  4I5Q A;  1YEX A;  4OCF A;  1GNE A;  1JZD A;  1PN0 A;  5HR0 A;  2HLS A;  4PQH A;  2KP2 A;  5D9W A;  1O81 A;  3R2Q A;  3K8N A;  1HNC A;  2DJJ A;  3W8J A;  4PQI A;  3VWW A;  1VF2 A;  3TRP A;  3HVX A;  2FCH A;  1TJD A;  4L5O A;  2HRN A;  4N11 A;  3C1R A;  3HHV A;  5F05 A;  4X1U A;  2REM A;  3CSH A;  2WGR A;  4G0I A;  3WT1 A;  3UEM A;  5HQP A;  1T7P B;  1ERT A;  1YKC A;  4V2N A;  4POL A;  3EE2 A;  2PER A;  3VUR A;  5EPF A;  2GZY A;  5GSS A;  1NW2 A;  2IME A;  4OMV A;  2VL9 A;  1RQM A;  2CZ3 A;  2O7K A;  1GSD A;  3CSI A;  4NAX A;  2HI7 A;  2VIM A;  4CHS A;  5IQY A;  5IOW A;  5J3R A;  4L0W A;  2YCD A;  4DSS B;  3M9J A;  4GQF A;  1VF4 A;  2H73 A;  5FT3 A;  2CVK A;  1BED A;  1QK8 A;  3DML A;  3QFA C;  4MNN A;  5G5F A;  3ED3 A;  2KHP A;  2LNT A;  4KDX A;  1O6J A;  4K6X A;  4KA0 A;  4IGJ A;  1F3B A;  1GTB A;  3GUR A;  3FRC A;  1FG4 A;  5JCW A;  4V2M A;  5CAX A;  2GGT A;  2RLI A;  1BAY A;  3KP9 A;  3W8S A;  1UC7 A;  2GLR A;  4ZL7 A;  2XPD A;  4GST A;  4MLY A;  1GH2 A;  2MMN A;  3WGE A;  1K3Y A;  1EWX A;  4K5R A;  3H79 A;  3U5R E;  2XBI A;  4O5Q A;  2P5R A;  1VRS D;  1ZYN A;  3I69 A;  2WCI A;  1B4P A;  2R37 A;  3D22 A;  1SKW B;  2DC5 A;  4K0G A;  2LNS A;  5DDL A;  2JAC A;  1H4O A;  4WET A;  2JL4 A;  3PGT A;  1R5P A;  4YAP A;  4HZ2 A;  3D21 A;  4OFM A;  4TXO B;  4Q5F A;  2H1B A;  4Q5N A;  3IK7 A;  2OE1 A;  3MSZ A;  1PN9 A;  2YWN A;  6GSV A;  5ECS A;  4AJ7 A;  2DSA A;  3TOT A;  5DAK B;  5IPH A;  2DJK A;  3ZZX A;  3QR6 A;  2KLX A;  3LQ7 A;  2DLX A;  2I3Y A;  3DKS A;  4BVY A;  5HFG A;  1J08 A;  3F4S A;  1EV4 A;  3CTG A;  1O8W A;  1YZX A;  3A2W A;  1PRX A;  3UAR A;  5D9T A;  1I5G A;  2H76 A;  2J23 A;  4ID0 A;  1EOG A;  2G2Q A;  1W89 A;  3GV1 A;  1XBS A;  1TK0 B;  1G0T A;  3Q74 A;  3DEX A;  4J56 E;  3UJ1 A;  4ML6 A;  3C7M A;  3KCM A;  4HQZ A;  1FOV A;  3EMX A;  1PKW A;  5J41 A;  3D4T A;  3DXB A;  4POK A;  1SK2 A;  1DBY A;  5IMD A;  4LMV A;  3ZVJ D;  3UL3 A;  2ZNM A;  2GVP A;  2L4Q A;  4FH8 A;  1GSQ A;  2R0P A;  1QXH A;  3ZMK A;  4O32 A;  2YPM A;  5ECL B;  5EVO A;  1O8X A;  4IP6 A;  3S9F A;  3KJY A;  5CO3 A;  1PKZ A;  4WEY A;  3ZFB A;  2H0H A;  4D73 B;  2GQM A;  5ECH B;  4GCI A;  5ELG A;  2JSZ A;  1WJK A;  2FWH A;  3QD9 A;  3JCM L;  1A0F A;  2VD0 A;  4TVE A;  4HDE A;  1N2A A;  2VL2 C;  2IFQ B;  2R0C A;  3RAZ A;  3KH9 A;  4P3Y B;  2FUG 2;  2BJX A;  5CYY A;  3OR5 A;  2V6O A;  2L4C A;  3BCK A;  1G7E A;  1AQV A;  1XWK A;  2FNO A;  5F8B A;  3TKS C;  1CQG A;  2WJU A;  5A4U A;  2OKA A;  5B7C A;  3ERG A;  2RUE A;  4K7I A;  1SL2 B;  5F06 A;  3FHK A;  2GST A;  2LV3 A;  5A4W A;  2H1G A;  4I2U A;  3HDC A;  4XRD A;  2VCZ A;  2E2G A;  1EOH A;  2HZF A;  3G7I A;  4TR4 A;  2HZE A;  4E8H A;  3FZA A;  3KMN A;  3P90 A;  3HVV A;  1K3L A;  2F8F A;  1TP9 A;  5DQY A;  4AJ6 A;  3ZRE A;  4BVX B;  5IM9 A;  5IO2 A;  3GHA A;  4MJE A;  3EU3 A;  3VLN A;  3WD6 A;  1JZW A;  3A3T A;  4XCS A;  4PXO A;  1OKD A;  2VLT A;  2B5Y A;  3LG6 A;  2JSY A;  4HQS A;  4DEJ A;  4O5U A;  5KOX A;  3PIN A;  4MF6 A;  5ENU A;  1MD4 A;  3M8N A;  4KB3 A;  2VO4 A;  3MNG A;  2C8U A;  4G10 A;  2G0F A;  1BQ7 A;  2KP1 A;  3QOU A;  6GSX A;  5IIZ A;  4V1A g;  2NTO A;  2OE0 A;  2X4A A;  3CSJ A;  3QDN A;  1UN2 A;  5ECK B;  2HSH A;  2H30 A;  1V98 A;  3H93 A;  5KN3 A;  1MDJ A;  1Q98 A;  1LBK A;  1NHO A;  1WRY A;  1BX9 A;  1TRS A;  1Z6N A;  1B4Q A;  5G2Z A;  1E6B A;  3BJ5 A;  3GRX A;  3D0Z A;  1S3C A;  2HRA A;  1SJI A;  5LCZ A;  1U3A A;  2B1K A;  4F03 A;  2GS3 A;  2P0G A;  2PGT A;  3VK9 A;  1Z9H A;  1AQX A;  3ISO A;  4PQ1 A;  3HVS A;  5ECN B;  1WPI A;  3FW2 A;  3A5W A;  4KSO A;  4Q5Q A;  3F9U A;  4TOP A;  3DYR A;  4ZB6 A;  5IMA A;  1T00 A;  4RUV A;  2OBK A;  5HFI A;  1OE7 A;  3G9B A;  2LKU A;  2K8S A;  3FZ5 A;  2KUC A;  1HYU A;  4PGT A;  1GUK A;  4K2D A;  16GS A;  2GT5 A;  3CXG A;  2L6C A;  2E7P A;  4YAV A;  5J4U A;  2WDU A;  2IIY A;  1V57 A;  3LYP A;  1XWA A;  3GUS A;  2XPE A;  4GXZ A;  3G7Y A;  1ST9 A;  3IXR A;  2R5G A;  1ILO A;  4Z2U A;  3VI5 A;  2LTK A;  1AC1 A;  1GSE A;  3IAM 2;  1GSY A;  3FZ4 A;  3V1W A;  3GL3 A;  1F2E A;  2FWE A;  2PVO C;  1X0R A;  2XHF A;  3KH7 A;  5ABR A;  3H4K A;  1FHE A;  2L5O A;  3A2V A;  3PPU A;  1F3A A;  3HY2 A;  1G6Y A;  3LEF A;  4KND A;  4TN8 A;  3IRA A;  2UZ8 A;  3M1G A;  5FHI A;  1GSF A;  3SBC A;  3FR9 A;  4EIQ A;  1M0U A;  1XVW A;  1X9M B;  2R3X A;  1SEN A;  1YQ1 A;  2DKH A;  2HE3 A;  2TRX A;  1YEP A;  5DVB A;  3TGZ A;  4DSQ A;  2QA2 A;  3DVX A;  4G0L A;  4ILF A;  1M9B A;  3SWL A;  5B8B A;  3APS A;  4MA9 A;  1O7U A;  2X99 A;  4KAE A;  2GQL A;  4JED A;  3F3R A;  2WS2 A;  2YZU A;  1QQ2 A;  3FZ9 A;  4KUN A;  5E4W A;  2YV9 A;  20GS A;  2IMK A;  2H66 A;  1PX7 A;  4EL1 A;  2FD3 A;  2IMD A;  3VWX A;  2OA7 A;  2K8V A;  2H74 A;  2NVL A;  2I9H A;  2DJ1 A;  3AY8 A;  4G2E A;  3ZIJ A;  1SKR B;  4JZQ A;  3BD2 A;  3F0I A;  1KTE A;  2V2G A;  2ES7 A;  4GTU A;  1FVJ A;  5B6N A;  1TKD B;  3WT2 A;  1ERV A;  2B5X A;  1GTU A;  4USS A;  1K3O A;  1B48 A;  11GS A;  5IOX A;  4MZC A;  3TKP A;  1MDK A;  1DE2 A;  2WUL A;  2TIR A;  3KTB A;  2YZH A;  5DCH A;  5E59 A;  2AB6 A;  3R3E A;  4BWS A;  4OFN A;  1J9B A;  1OC9 B;  1BG5 A;  3EC3 A;  3EVI A;  2B1L A;  1Y6E A;  4G19 A;  2M80 A;  1ZL9 A;  2C3Q A;  3NOF A;  8GSS A;  4WKW A;  1PA3 A;  1WIK A;  3LFL A;  4OCE A;  5CRD A;  3IR4 A;  1ZYP A;  1EGR A;  2H0G A;  14GS A;  4KE3 A;  1BYE A;  4MAB A;  2GQK A;  4O5R A;  5G1K A;  1SKS B;  3F63 A;  2M72 A;  1RK4 A;  1PGT A;  1IYI A;  3ZTL A;  3LOR A;  1MEK A;  2VCW A;  2D2Z A;  3IC8 A;  3TKS E;  2FA8 A;  1FVK A;  1MTC A;  2K9F A;  3TB2 A;  2MMO A;  3IDV A;  1IYH A;  1EGO A;  2F8A A;  2EIO A;  3NZN A;  2CAI A;  2B7J A;  1LJR A;  2A4V A;  3LSZ A;  4IP1 A;  3GYK A;  1SK1 A;  4WBR D;  4MJA A;  1U88 A;  2HSM A;  4ZBB A;  1QMV A;  1TXX A;  3LJR A;  2QA1 A;  3RPP A;  4LL4 B;  1X9S B;  4HU9 A;  3P7X A;  5KOW A;  5H5S A;  4GSS A;  1ML6 A;  3VWV A;  4GQC A;  2I4A A;  5D9X A;  1K0O A;  4IS0 A;  4MP4 A;  2WFC A;  3ME8 A;  1HD2 A;  3L0H A;  3FK8 A;  3GTU A;  2LS5 A;  1Y25 A;  3TJB A;  3UIW A;  4EKZ A;  6GSY A;  2ZUP A;  4GSN A;  1SD9 A;  2VOC A;  4Z2R A;  1O85 A;  3QCP A;  4PX1 A;  1DSB A;  4A5P A;  1TRU A;  2HRK A;  1Z7R A;  5DCG A;  2XBQ A;  2QGV A;  4MDC A;  1NSW A;  4BWQ A;  5GAP D;  3EWL A;  2CZ2 A;  2OE3 A;  2H72 A;  5DJM A;  2P31 A;  4X4J A;  1XW5 A;  4F0B A;  1A23 A;  3GNJ A;  3QAV A;  3GKM A;  2R2J A;  4L5L A;  4MPG A;  5GZZ B;  2VLU A;  1EEJ A;  2HSY A;  5A5K A;  3TUE A;  4JU5 A;  3O3T A;  4ZIL A;  4N0Z A;  1AUC A;  2C4J A;  3TKR A;  3E3E A;  4MMM A;  2V32 A;  1HQO A;  1V2A A;  4Z7X A;  1F37 A;  2O89 A;  4IBP A;  2RM5 A;  3WGD A;  4QQ7 A;  1XPV A;  2B5E A;  5DJL A;  3VI7 A;  1H75 A;  1THX A;  1OAZ A;  4X43 A;  4ZL9 A;  3UOM A;  1SL1 B;  1GTA A;  2PWJ A;  19GS A;  2CV4 A;  2HNL A;  1SD8 A;  1YDK A;  4BA7 A;  2X8C A;  1V58 A;  5CRW A;  1TK5 B;  1T1V A;  9GSS A;  3KIJ A;  2GSQ A;  4MH3 A;  3P8W A;  4KDU A;  3EPT A;  1FAA A;  2A2S A;  3ZYW A;  1SYR A;  2CX3 A;  3GMF A;  1ZYE A;  1SYX A;  1FB0 A;  4V2L A;  1B8X A;  3HYP A;  4LL1 B;  4K2X A;  4BL7 A;  4BVY B;  2YAN A;  2LEG A;  4EVM A;  1EP7 A;  4J57 E;  4Z2T A;  4EE0 A;  1O73 A;  5EL8 A;  2OAC A;  4KCE A;  4IQ1 A;  2R6K A;  3IK9 A;  5C00 A;  1XXU A;  3WGX A;  2VL2 A;  1Z7P A;  1QGV A;  2ON7 A;  4XS1 A;  3TJK A;  3CYN A;  2Z9S A;  3ZRD A;  2RM6 A;  4WR4 A;  3VPT A;  2LRT A;  3UVT A;  1T4Y A;  2HFD A;  5JWQ B;  2A2P A;  3GFK A;  1M99 A;  3TKS A;  1EV9 A;  6GST A;  1JZR A;  3KGK A;  2H6X A;  1URM A;  2L6D A;  2C0G A;  3TCO A;  3U6V A;  2XC2 A;  2JU5 A;  4X0X A;  2LJR A;  2OBI A;  5ECI B;  1TK8 B;  1T4Z A;  3IV4 A;  4Q5R A;  2LJA A;  4K8M A;  1M2B A;  3M3M A;  4DVC A;  1GSS A;  4LMW A;  3HKR A;  4YKF A;  2CQ9 A;  5BRT A;  5DAL A;  1MD3 A;  4ZBA A;  3FR6 A;  4K0N A;  2DJ3 A;  22GS A;  1PQN A;  5AIX A;  4ECB A;  5EY6 A;  2B3S A;  1Q4J A;  2H70 A;  2VCT A;  3VPQ A;  4ECC A;  1F6M C;  4PNG A;  5JCG A;  2GT6 A;  2L5L A;  1KEB A;  2PN8 A;  2IMF A;  3LYK A;  1DUG A;  3PR8 A;  4G0K A;  4V1A p;  1NM3 A;  1USB A;  3RHB A;  1DE1 A;  13GS A;  1K0D A;  2H6Y A;  3TRQ A;  3GH9 A;  3C71 A;  1OYJ A;  2QSI A;  2V41 A;  5ECO B;  4I6X A;  1LU4 A;  1YJ6 A;  1VF3 A;  4WBJ A;  2HZE B;  5ECQ B;  2R4V A;  3KMO A;  1YKA A;  2KOK A;  1Z6M A;  6GSW A;  10GS A;  2WB9 A;  2ON5 A;  2JAD A;  1XVQ A;  2LQO A;  1JHB A;  4FYU A;  5ECR B;  5AIV A;  4JBB A;  1XW6 A;  4ACS A;  2C3N A;  3Q19 A;  1PL2 A;  4ISD A;  3IHQ A;  1PMT A;  4XTS A;  2CAQ A;  2X49 A;  3ERW A;  2K18 A;  3M0F A;  2CVD A;  1ZCP A;  3P2A A;  3UMA A;  2H1A A;  2VCX A;  3RPN A;  5ECP B;  4HJM A;  4POB A;  1GUH A;  2YJH A;  2R0G A;  1K0M A;  2IMI A;  3CTF A;  1GNW A;  4CDO A;  4KX4 A;  4TR1 A;  3L9V A;  4OFT A;  4K9Z A;  2V6K A;  2GSR A;  3I6A A;  4IHU A;  5ID2 A;  3GN3 A;  5DBQ A;  2IWT A;  3GL5 A;  3FYG A;  3D6I A;  1XCC A;  1JLW A;  7GSS A;  2C0F A;  3GX0 A;  1OVN A;  1MDI A;  4MH2 A;  4I8B A;  3LW9 A;  5JWO B;  2F51 A;  2TRC P;  3J7Y k;  4O7H A;  1S3D A;  2PVQ A;  4WF4 A;  3IBH A;  3CRT A;  5KN2 A;  4EIP A;  1K0C A;  1QFN A;  2O87 A;  5CRE A;  4ZB9 A;  4CW9 A;  5INY A;  1R26 A;  1XZO A;  3VWU A;  1WWJ A;  3F6D A;  3N9J A;  5IO0 A;  4L0U A;  4ZXG A;  6GSU A;  4TXV A;  3IPZ A;  2YP6 A;  1YF1 A;  2E2M A;  4GWR A;  2EIQ A;  2CA8 A;  3W6G A;  1GUM A;  4GLT A;  2YWM A;  2C0D A;  3BCI A;  3TDG A;  2DJ2 A;  4F2I A;  3LWA A;  3EUR A;  5G31 A;  2N5F A;  3J7Y b;  3D5J A;  5CRH A;  2AV4 A;  3TJG A;  4CY6 A;  3BBY A;  1M2A A;  5D8I A;  2IJY A;  4TR3 A;  1JZO A;  2HXK A;  4XS6 A;  4KCA A;  5ID2 B;  4FIW A;  5IMF A;  2LUS A;  2EIR A;  1A8L A;  4H86 A;  1PX6 A;  2X8H A;  3GKK A;  1YY7 A;  3DRN A;  1U3I A;  2M46 A;  2C1Y A;  2CVB A;  3WYW A;  3GX8 A;  1W4V A;  3IA1 A;  5IMC A;  2GZZ A;  1U87 A;  3LXZ A;  5AN1 A;  4J2F A;  5CRG A;  4MPF A;  3VFI A;  4ML1 A;  5DQS A;  1HNA A;  1KNG A;  4EUY A;  1XWG A;  2MMA A;  1JLV A;  4NPB A;  4E8E A;  4F0C A;  1WP0 A;  4KGI A;  2AJQ B;  1XFL A;  5B8A A;  2NBS A;  3HCZ A;  3N5O A;  3KTL A;  2F9S A;  5JCU A;  1M2D A;  3LXT A;  5LD0 A;  4DSS A;  1K0N A;  4MF5 A;  4EO3 A;  4DSR A;  3I9V 2;  4HOJ A;  3G7J A;  4XHM A;  5COH A;  4PUF C;  3GKN A;  3FMW A;  2QC7 A;  1TU7 A;  1XOA A;  1T3B A;  2YWI A;  3HZ4 A;  2GZP A;  2YWO A;  3NIV A;  4EDY A;  2CT6 A;  4KSM A;  4OO5 A;  4JE1 A;  3L9U A;  5J5N A;  4KH7 A;  2MBS A;  1AW9 A;  1SL0 B;  5L71 A;  2WRT A;  2YNX A;  4IEL A;  18GS A;  3MIX A;  2DJ0 A;  3ZFL A;  6GSS A;  1FB6 A;  3C73 A;  4RI6 A;  1SK0 A;  2E0Q A;  3L78 A;  3UAP A;  2H6Z A;  2RUF A;  2GTU A;  4ZL8 A;  1AAZ A;  3KEB A;  1X5C A;  2HYX A;  4FYB A;  1A2M A;  2N5A A;  3CBU A;  2B6M A;  2A4H A;  2C0E A;  1WOU A;  2EC4 A;  4TXO A;  3US3 A;  5H5R A;  1AXD A;  3D4M A;  4MJC A;  2NDO A;  5IMV A;  3KZQ A;  1THO A;  2PPT A;  2MYG A;  3PH9 A;  1XOB A;  3QPM A;  4EF0 A;  4MZW A;  3A5I A;  5DAK A;  3F4T A;  4KDY A;  4XS4 A;  1WE0 A;  1X5E A;  2DIZ A;  5JWR B;  3MYD A;  3UBL A;  4ULX A;  1GRX A;  4POM A;  2O85 A;  3HD5 A;  4TRX A;  1NHY A;  2FA4 A;  3CRU A;  3QFB C;  3RHC A;  3QAG A;  3F6F A;  1ACV A;  2WZ9 A;  1Z5Y E;  3HZ8 A;  2J9H A;  1HNB A;  1SJZ A;  4BPY A;  4KF9 A;  1K0A A;  3L9S A;  1JFU A;  3DGQ A;  4HU7 A;  1J0F A;  1M7T A;  5AGY A;  1EP8 A;  3DD3 A;  1OE8 A;  1CQH A;  2HT9 A;  2FHE A;  4AF2 A;  2FWG A;  2JZR A;  3TOU A;  2X64 A;  4IVF A;  2YOI A;  2C80 A;  4NHW A;  2LST A;  4HEA 2;  4XRA A;  3QAW A;  3GSS A;  2C3T A;  2VM2 A;  5IMZ A;  4D73 A;  2O8V B;  5ELA A;  4K5S A;  4GRF A;  3O6T A;  2YN1 A;  3E9J B;  2AAW A;  3DIE A;  3EYT A;  4I97 A;  2IFQ A;  4XS4 B;  4MJB A;  2LRC A;  2VUP A;  3O76 A;  2FGX A;  1OC3 A;  1TI1 A;  5HR1 A;  3RDW A;  4ICY A;  2NPB A;  2HRF A;  3H1N A;  2LJK A;  3IE3 A;  4RI7 A;  5D96 A;  1TU8 A;  4OWY A;  3GTU B;  1UA5 A;  2VAF A;  1T8E B;  5D73 A;  1VGL A;  1A24 A;  1S3A A;  2H1D A;  1A2L A;  3F4R A;  3FR3 A;  4F82 A;  2H19 A;  4NMU A;  5F07 A;  5KN1 A;  2DML A;  3KM6 A;  2DIY A;  4PUA A;  4NV5 A;  2VCV A;  1PSQ A;  3GIX A;  4ECI A;  4EXJ A;  2MZC A;  4HUA A;  5H5Q A;  1QUW A;  2B7K A;  3TKQ A;  2V1M A;  1GLQ A;  1X5D A;  1Z3E A;  2OJL A;  4AGS A;  4NHZ A;  1G7O A;  3F3Q A;  3UVH A;  4I2T A;  2QKE A;  4BVX A;  4MCU A;  2K6V A;  1KBN A;  3UBK A;  1E2Y A;  5LNK e;  2A2R A;  3HJP A;  3HA9 A;  5KN0 A;  4KW6 A;  1GP1 A;  1UVZ A;  4N30 A;  1AQW A;  3TJJ A;  1A8Y A;  3ZML A;  2IPA A;  3KP8 A;  5B6M A;  5BMU A;  1RW1 A;  3FEU A;  5J9B A;  2CX4 A;  4EC0 A;  2L59 A;  4OD7 A;  1PD2 1;  2H8L A;  3Q6O A;  4MK3 A;  5GST A;  1SU9 A;  1FOH A;  3C8E A;  2FWF A;  5AIS A;  3IOS A;  2LQQ A;  2DMM A;  3GKX A;  2RII A;  1K0B A;  1GWC A;  3Q18 A;  2GDR A;  2VD1 A;  1TDI A;  1C72 A;  4N0V A;  4ZB8 A;  1EEM A;  1M9A A;  4IN0 A;  5CP1 A;  4HJ2 A;  5J9C A;  3TJF A;  2YV7 A;  5A4V A;  2FLS A;  3MDK A;  5F0G A;  2FY6 A;  1F9M A;  4WXT A;  2GSS A;  1TRW A;  1PL1 A;  1ZGN A;  5IPG A;  4BL7 B;  4IJ3 A;  2YJ7 A;  1AIU A;  3ZVJ A;  2IL3 A;  4PUR A;  3APQ A;  3LGC A;  4ECJ A;  1OC8 A;  3GA4 A;  4YH2 A;  1A2J A;  4IW9 A;  3HJM A;  4RQR A;  3KXO A;  4NV2 A;  1U6T A;  3ZLP A;  1B9X C;  2OAD A;  2PU9 C;  4QL9 A;  4TW5 A;  1B9Y C;  4OO4 A;  1A0R P;  1ON4 A;  3GST A;  2DKI A;  4CY8 A;  3MWH A;  4PTS A;  4O92 A;  3EU4 A;  1OKT A;  1TOF A;  1X9W B;  5G5E A;  4L8E A;  3QMX A;  4G9H A;  3H8Q A;  3FY7 A;  2ALB A;  2X8G A;  1FW1 A;  2LRN A;  3ERF A;  3IC4 A;  4TR0 A;  3KD0 A;  4JR6 A;  4QL7 A;  4AJ8 A;  2AUV A;  4JR4 A;  4JRR A;  1XW9 A;  1R7H A;  4IJI A;  2N5B A;  4YQM A;  2MMZ A;  5DAL B;  4HI7 A;  1EZK A;  3IAS 2;  3IHG A;  4FQU A;  5ECM B;  4NWY A;  2PBJ A;  3HXS A;  4HS1 A;  2H75 A;  4TKY A;  4LLR A;  1YF0 A;  3EIN A;  4WF5 A;  3C1S A;  2I81 A;  4F9Z A;  1ERU A;  4K7O A;  4RQX A;  4MZB A;  4K7N A;  2VCQ A;  1XIY A;  5HFK A;  2DBC A;  2BMX A;  1TI3 A;  4FO5 A;  4NXI A;  1TTZ A;  3CMI A;  5KEJ A;  4ZIJ A;  4YQV A;  1GTI A;  2PUK C;  1GSU A;  4FYC A;  1R4W A;  2ZCT A;  1TRV A;  1BJX A;  3A2X A;  2VLV A;  1VF1 A;  2JZS A;  5G1L A;  4IQA A;  3ZIV A;  2PMT A;  2L57 A;  3M9K A;  2I1U A;  1V40 A;  2IN3 A;  3APO A;  1G6W A;  5D9V A;  2MBT A;  3E0U A;  2VM1 A;  2AYT A;  4N10 A;  2H01 A;  2AHE A;  1XWC A;  1I9D A;  3HJO A;  4LA1 A;  4ZBD A;  3TRX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...