2IPAA

Solution structure of trx-arsc complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
104
structure length
104
Chain Sequence
MAIVKATDQSFSAETSEGVVLADFWAPWCGPSKMIAPVLEELDQEMGDKLKIVKIDVDENQETAGKYGVMSIPTLLVLKDGEVVETSVGFKPKEALQELVNKHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport/oxidoreductase
molecule keywords Thioredoxin
publication title Conformational fluctuations coupled to the thiol-disulfide transfer between thioredoxin and arsenate reductase in Bacillus subtilis.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 31
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2006-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2ipaA00
3UOMA 1M99A 2R6KA 4CW9A 1EEJA 3QFBC 2MZCA 1Z6MA 2XPDA 1XWKA 2GQKA 3ZVJD 2FWHA 4OCFA 3F6DA 5HR1A 1CQGA 1F9MA 3NOFA 2HFDA 2YWNA 3IXRA 2XBIA 4HU9A 5CNWA 4ZL7A 5KN1A 1THXA 5G5EA 2VL9A 2C0DA 2BMXA 1LU4A 3DYRA 2OADA 4DSRA 2CVKA 3FR6A 4I97A 1KEBA 3UIWA 2AJQB 3HY2A 3GA4A 2VCWA 1PSQA 4MZCA 2C0FA 3WT2A 3UMAA 3FZ9A 1SL1B 4TVEA 4ZBBA 1PD21 5J5NA 3L9SA 4DSSA 3VWXA 3KH7A 4HQZA 1B4PA 2P0GA 2J23A 4X43A 5ECQB 1UVZA 3GH6A 3PR8A 2H70A 3FZAA 4GQCA 4AJ6A 1XW6A 3FZ4A 4IKHA 2IMKA 1BEDA 3LORA 3D21A 1SKSB 1QQ2A 5COHA 5IMCA 5G2ZA 3H79A 1A8YA 1I9DA 4TOPA 3TKSC 5EVOA 5CRGA 5EL8A 4NHWA 2WDUA 3GIXA 3LQ7A 4MZBA 1YF0A 3ZL5A 2LRTA 3DVWA 2TRCP 1EV9A 5CYYA 4V1Ag 1ZCPA 4OCEA 3W6GA 2EIOA 1U3AA 2I81A 2KUCA 3KZQA 1MDIA 2GZZA 4GF0A 3TJJA 5LCZA 1EOHA 3UBLA 1JZDA 3D0ZA 2I9HA 3I6AA 3RBTA 4MH3A 3ZYWA 2L5LA 3RPNA 2M46A 3CTGA 2O89A 1NHOA 1VF2A 1WJKA 3EMPA 3L4NA 1YEXA 1EEMA 7GSSA 4JRRA 5D9TA 4FYBA 19GSA 2NDOA 4WETA 2P5RA 2X64A 2CVDA 2YWOA 1TK8B 2B5YA 1F3AA 3E9JB 3OR5A 1KNGA 4N11A 5KN0A 4KGIA 2H0IA 5J4UA 2E0QA 1TW9A 1TRVA 4KDXA 5AIVA 1K0DA 3TUEA 4HI7A 3VPTA 5H5SA 3JCML 3ZFLA 4IQ1A 3E0UA 4Z7XA 1SL0B 4WR5A 6GSYA 4MPGA 2LNTA 3GH9A 4MMMA 1Z7PA 3UBKA 1PKZA 2A2SA 3CSJA 3VPQA 3EU3A 4MZWA 2H71A 3KTLA 4TN8A 1WMJA 2ON5A 4OO5A 1S3DA 4H86A 2CQ9A 2HSHA 4Q5NA 4DEJA 2HRNA 5DAKB 1VF4A 3KD0A 1FB0A 2B6MA 3KP8A 3ZMKA 5A5KA 2OACA 4OMVA 3J7Yb 3GYKA 4MPFA 3IR4A 4MF6A 5DCHA 2K8VA 2AB6A 1Q4JA 2OE0A 2GZPA 5HQPA 4HS1A 3IDVA 4TXOA 1THOA 1GSSA 1TRSA 4LMVA 5J41A 3LGCA 4AJ8A 3PH9A 2B1KA 3KXOA 4O92A 2H6YA 3F4RA 3VK9A 2AAWA 3TKRA 5IPGA 4K0GA 4AGSA 2JADA 2V2GA 1XWCA 3CMIA 4GXZA 2QGVA 3EINA 4E8HA 2OKAA 4HOJA 1RW1A 4CDOA 2EIQA 3D4TA 5ECNB 3HHVA 1TU8A 3IAM2 8GSSA 1HNCA 3TRXA 4PNFA 2H8LA 1K3OA 2LJKA 3DWVA 9GSSA 3RPPA 4N30A 2LV3A 4PQ1A 1QXHA 1A23A 2H76A 4TXVA 4TR3A 4YQVA 2HXKA 4K0NA 1BX9A 5L71A 2A2RA 1V9WA 1E2YA 4TW5A 4EO3A 1MTCA 3HD5A 2VCTA 4RI7A 3GTUB 2H6ZA 4TRXA 4OD7A 2MMAA 1HNBA 3LJRA 2PMTA 2M80A 1O81A 1SJIA 1ZYEA 2CZ2A 4F0BA 3GMFA 4F03A 1GNEA 5ECLB 2KOKA 3DMLA 4EDZA 4MJAA 5F8BA 3HJMA 1XFLA 3RHBA 3GFKA 1XVQA 1JZWA 3IAS2 5A4VA 2HSYA 2GLRA 3TJBA 4K9ZA 2DJ0A 4IHUA 1Z6NA 2LQQA 3KH9A 4PX1A 4G19A 3HVXA 3GN3A 5DVBA 1J08A 3GKXA 1NSWA 1OC9B 2IFQB 1GTUA 4YQMA 1B9YC 2HLSA 2L6CA 1TKDB 1XCCA 1M2BA 1UN2A 2TRXA 5CRWA 1DSBA 4MF7A 2N5AA 4L8EA 2FNOA 2XPEA 3GX0A 2IMIA 4PXOA 5ECMB 4BVYA 1HNAA 2NBSA 5J3RA 1RK4A 4ZIJA 5DJMA 3MSZA 1ON4A 4MK3A 4EUYA 3H93A 3LFLA 1ERTA 1FVKA 1TI3A 2H74A 2H1BA 1PKWA 1W4VA 1XWGA 3F8UA 1ZL9A 5GSTA 2RUEA 4MJCA 5KN2A 2WULA 2I3YA 3DIEA 3IRAA 2B3SA 1RQMA 2DJ2A 5HR0A 2FUG2 2A4VA 1G6YA 3VWVA 4BL7A 1XVWA 4NAXA 4JE1A 1R26A 4I6XA 1T4ZA 1SJZA 3DRNA 2PBJA 1S3CA 3EYTA 3D4MA 5D9XA 1TU7A 4KDYA 4LA1A 1GSFA 4OWYA 5DQYA 3GURA 1TJDA 5C00A 1XOBA 3HZ8A 6GSUA 4XS4A 2YV9A 2YZHA 4ML6A 3ZMLA 4ECJA 5A4UA 2FLSA 1J0FA 3Q74A 3HVSA 4O32A 5IQYA 5DDLA 4WBRD 4V2NA 2X8GA 2E7PA 1R5AA 4HQSA 1VF3A 1A2MA 1NM3A 3FR3A 3R2QA 4D73A 4KUNA 4WXTA 3DKSA 4GSSA 4J57E 5DAKA 2JSYA 2EIRA 1V40A 2GSQA 4TR0A 3GX8A 1JZRA 2DJKA 1K3YA 2PWJA 3ERFA 2GSRA 1Z3EA 2WS2A 2HNLA 3FR9A 4HJ2A 3ISOA 2H6XA 11GSA 3KEBA 5ABRA 2C3NA 1GULA 5CO3A 1F3BA 1KBNA 1SJ6A 2MYGA 3UEMA 1X5CA 4LLRA 3U6VA 2C0EA 4OO4A 3LWAA 1SK2A 5B6MA 5IO0A 2K9FA 4E8EA 4EE0A 1GSEA 1DE1A 5E4WA 2LRNA 2KP1A 4PQIA 2FD3A 2LRCA 1OYJA 2KHPA 3CTFA 5G1KA 4KE3A 5D96A 4J2FA 4QQ7A 1QUWA 5D9WA 3KGKA 2C8UA 3O3TA 4XS6A 4L0UA 3GV1A 3S9FA 2QSIA 4WF5A 4WEYA 3GKMA 4RQRA 3UL3A 1ERWA 2DLXA 1AAZA 3QMXA 3EE2A 3RHCA 1Z9HA 2AUVA 3P8WA 3GTUA 4HUAA 2FA4A 5G5FA 2OJLA 3BBYA 3CSIA 4KSMA 1GUMA 4WBJA 1ML6A 2JSZA 1ABAA 3WYWA 4AF2A 2C1YA 4ULXA 3C1SA 2OE3A 1TTZA 4RQXA 1YZXA 3QFAC 2IMDA 2YJHA 1URMA 5ECOB 1XOAA 2YOIA 5IOWA 1H75A 2GT6A 4CHSA 1ERUA 3HJOA 3LYKA 2CA8A 2BJXA 2LNSA 4MP4A 2VLVA 4MCUA 2P5QA 2WGRA 2L4CA 5JCGA 2DJ3A 5J9BA 1K0BA 2O8VB 5HR3A 2MMOA 3MAKA 4GTUA 1OC9A 2IFQA 2IMEA 3F9UA 2VM1A 2EC4A 3L9VA 5LD0A 3KMOA 4IJ3A 1X5DA 1BYEA 3MDKA 1DE2A 3M9KA 1JHBA 3UVHA 2IL3A 5JWOB 2OA7A 1PX7A 5G31A 1XXUA 1FVJA 2V32A 2IMFA 1T3BA 2H30A 5G1LA 2OE1A 1R4WA 4JR6A 3HCZA 3KM6A 3IC4A 5B8BA 4Q5RA 1SENA 3FZ5A 4FYCA 4EKZA 4WKWA 1IYIA 2HI7A 5B8AA 4KDUA 3VLNA 4XRAA 4I5QA 2DC5A 2PN8A 3QAWA 3QOUA 1V57A 5ECSA 2FA8A 3DXBA 3ZZXA 1DBYA 5H5RA 4XIHA 2E2GA 1TXXA 2CAIA 4G9HA 3F63A 6GSTA 2H1AA 1B8XA 4JEDA 2XHFA 4DSQA 1OKDA 3HXSA 1VGLA 2C4JA 1T1VA 2L6DA 4LMWA 4OFMA 4IW9A 2VUPA 3NIVA 3RAZA 3I9V2 4DVCA 1C72A 2F3MA 1U87A 3F4TA 1YKCA 5JWQB 3M1GA 3VFIA 1V2AA 1WIKA 5FWGA 1N2AA 3QDNA 1SD9A 1JFUA 4XS4B 1YQ1A 4HZ2A 1U88A 2HZFA 3GSTA 3TGZA 4HEA2 1KTEA 4KNDA 2J9HA 4KX4A 4L5OA 1YY7A 1BQ7A 2CX4A 2Z9SA 5HFKA 4ML1A 2FWFA 4PNGA 3P90A 2YCDA 4D73B 2FGXA 3N9JA 5IMZA 4XS1A 3UARA 3ZFBA 2DIZA 2F8FA 2V6KA 4BA7A 1SD8A 4O5RA 4GSNA 1OC8A 1PX6A 2E2MA 1GUKA 1JLVA 3BJ5A 3F3RA 3EC3A 2VM2A 3DD3A 4I2UA 2GDRA 2PPTA 2M72A 1EGOA 3KTBA 3L78A 4RUVA 1I5GA 3TJKA 3VWUA 2C3TA 2VCQA 1O8XA 2H0GA 2LKUA 1YF1A 3TKQA 5ELAA 2N5BA 1AUCA 3WGEA 3KCMA 1J9BA 3LEFA 2I1UA 4GWRA 4MJBA 2KP2A 4HZ4A 4HU7A 4K7OA 2YNXA 3Q19A 1GNWA 3KJYA 4JU5A 1UC7A 1SKRB 3IOSA 3VWWA 4PURA 1QFNA 3BCIA 1A2LA 3CXGA 3FHKA 3G7IA 2LJAA 3GSSA 4GQFA 2CX3A 1GWCA 4ILFA 10GSA 3GHAA 2VOCA 2D2ZA 3FRCA 2GQLA 1A2JA 3QCPA 3ZREA 2IWTA 5CREA 3KIJA 2REMA 4IELA 2K8SA 1GSDA 3IE3A 3WGXA 3CYNA 3VI5A 3ME7A 2BTOT 4KAEA 2WZ9A 12GSA 3HJPA 2MBTA 3HA9A 4PUFC 4FIWA 1OKTA 3IBHA 4JBBA 2IPAA 3US3A 4TKYA 1FG4A 3O6TA 2LSTA 3CRUA 3D22A 3HDCA 4EDYA 1M2DA 5EPFA 4ZL9A 17GSA 3WT1A 3W8JA 3WD6A 2NVLA 3Q18A 4TR4A 2FHEA 1EZKA 1V98A 2JL4A 4YQUA 1MEKA 1ZZYA 1MDKA 4YH2A 1GH2A 4L5LA 1E6BA 4JR4A 2O7KA 3I43A 1WWJA 2GZYA 1ZOFA 3FKFA 1HQOA 4BVXA 1LJRA 1O7UA 3RDWA 1O6JA 5JCWA 4RI6A 2PGTA 2RM6A 2MMZA 1M2AA 5CRHA 1GTBA 2LQOA 1X9SB 1USBA 1ZMAA 2JACA 4NV5A 3O76A 4MA9A 3M0FA 2GSTA 3BD2A 1X5EA 1SYXA 3QR6A 4LL1B 1UA5A 4P3YB 1GUHA 3A2WA 1Y25A 1K0CA 3ED3A 1GSQA 1OVNA 5LNKe 3TRQA 4BWSA 3EWLA 1FO5A 1GSYA 4NWYA 3EVIA 5D73A 4IS0A 1Y6EA 4KCAA 2L5OA 2HYXA 4FH8A 2F51A 3TDGA 1U6TA 3KP9A 1K0OA 5IIZA 2G0FA 2ZUPA 2L59A 4Q5QA 3TKSE 1OE8A 2CV4A 1OAZA 4IBPA 2GQMA 4XRDA 3SBCA 2WCIA 2H75A 4ECCA 2V1MA 4K1FA 1NW2A 4XTSA 5JWRB 1YDKA 4FO5A 1R5PA 5FHIA 1VRSD 1B4QA 3TOUA 2WRTA 2NPBA 3L0HA 1Z5YE 1ACVA 1GTAA 2JZSA 4ZBDA 5IMFA 2R3XA 3ZLPA 3FYGA 3EMXA 1HD2A 5AN1A 2R4VA 2TIRA 2ALBA 4HJMA 1FHEA 3EURA 3C71A 4POMA 3QPMA 5IM9A 1K0MA 1SK1A 5IMDA 1O85A 5DCGA 2R2JA 1QGVA 1TI1A 1S3AA 3L9UA 3VURA 1R7HA 4J56E 3I69A 2R37A 3F3QA 3HKRA 1XZOA 2O85A 2OBIA 2YANA 5ELGA 3G9BA 5D9VA 4KCEA 2GGTA 2RIIA 1AIUA 3C7MA 3LYPA 5GAPD 6GSSA 2LEGA 4N0ZA 4NXIA 1B9XC 1MDJA 4TR1B 3A3TA 3F6FA 2VD1A 4ZBAA 1LBKA 1PQNA 3GUSA 3BCKA 4GCIA 3TKPA 1PGTA 4BWQA 3Q6OA 2GVPA 2RLIA 4ECBA 1B48A 5HFIA 3FK8A 5D93A 5AGYA 5IO2A 4POBA 3C73A 5AIXA 1AQVA 1PA3A 3MWHA 3HVVA 1WOUA 1O8WA 2DMMA 1PL2A 4IVFA 4V2LA 1SKWB 2HT9A 4YAVA 4N10A 5IPHA 5IOXA 3ERWA 5HR2A 1F2EA 2GS3A 5ECPB 4IJIA 1EOGA 3TOTA 2WB9A 4WR4A 3UVTA 4ZXGA 1XW9A 1BJXA 5INYA 5F07A 2YWIA 4GSTA 2C3QA 5ID2B 2VO4A 2X8CA 1XPVA 3KMNA 5J9CA 22GSA 2FWEA 2L4QA 3ME8A 1M7TA 1G0TA 4X0XA 1GLPA 2JU5A 1G7EA 2K6VA 2CVBA 2VD0A 2CZ3A 4MJEA 1EWXA 3FY7A 6GSXA 4ISDA 1PN9A 5AISA 1DUGA 1NHYA 3FW2A 1WP0A 5GZZB 4ZL8A 4ZB6A 1T8EB 2MBSA 6GSWA 4MDCA 4PUAA 2DSAA 3DGQA 2HZEB 1N8JA 4GLTA 2LTKA 3GKNA 1GTIA 16GSA 2IJYA 2QKEA 4POLA 4K7NA 1U3IA 2H72A 5HFGA 3C8EA 1WPIA 1M9BA 1X0RA 2KLXA 3VI7A 1K0AA 1HYUA 2B7JA 4F2IA 2LUSA 1AC1A 3N5OA 1OC3A 4PQHA 3GRXA 1TRUA 5FT3A 3NZNA 4IQAA 3D6IA 1T00A 3IK7A 4AJ7A 5JCUA 2AYTA 2DIYA 2WJUA 2YPMA 4EVMA 3A2XA 4JZQA 1EGRA 4KH7A 3QAVA 5A4WA 2MMNA 1MD4A 5ECRB 2H19A 5F05A 1W89A 3LSZA 3P2AA 3G7JA 5B6NA 1XWAA 4F9ZA 1AQWA 6GSVA 2DJ1A 3HZ4A 1M0UA 1Q98A 2P31A 3PINA 3E3EA 3M8NA 4BPYA 3LXZA 3CSHA 1ST9A 1BAYA 2FY6A 2VLUA 1FAAA 4EF0A 3LG6A 3D5JA 3U5RE 1V58A 5G30A 4IP6A 2C80A 5F0GA 4WF4A 3GL3A 2DBCA 1H4OA 4G2EA 1SU9A 1EP7A 4IN0A 2RM5A 4N0VA 2B7KA 1OE7A 1VF1A 3M9JA 4ACSA 2PUKC 3P7XA 3HYPA 5KEJA 2XC2A 3IHQA 5C04A 4MH2A 4HDEA 3UJ1A 3APSA 4IP1A 4GRFA 3IA1A 3QD9A 4EL1A 3C1RA 3TRPA 5ECHB 1TOFA 1AQXA 3G7YA 2VL2A 13GSA 5ECKB 2YN1A 3J7Yk 4O7HA 5DALB 1O73A 2FWGA 4OFTA 4XHMA 4TR1A 1ILOA 1CQHA 1GRXA 2H01A 1PRXA 4I8BA 1XIYA 1G6WA 1T7PB 2VCXA 4KB3A 2JZRA 3TJFA 2JZTA 2HE3A 4NMUA 2PVQA 1A8LA 4MLYA 5ENUA 5GSSA 5B7CA 3ZITA 4K2DA 3W8SA 3GKKA 2V41A 2YWMA 3APQA 2VAFA 2PERA 2PU9C 3H1NA 3IV4A 3FEUA 2HRFA 1FW1A 3A2VA 2C0GA 2X99A 1T4YA 3LXTA 4NHZA 3H8QA 2V6OA 2H1DA 3ERGA 2N5FA 4PGTA 1PL1A 3TCOA 4K7IA 2B1LA 2ZNMA 4V1Ap 2GSSA 1TK5B 2R5GA 1AXDA 1ERVA 2GTUA 2L57A 1ZYQB 3F0IA 4FYUA 5H5QA 5ID2A 3QAGA 2VIMA 1SL2B 3A5WA 4V2MA 4DSSB 3BOAA 3TJGA 1GSUA 4NPBA 3H4KA 1X9WB 2YV7A 1JLWA 4NV2A 2NTOA 1PMTA 3APOA 2DMLA 4IGJA 4OFNA 1F37A 1FB6A 1GL8A 4ZILA 5KN3A 1A0RP 5F06A 1ZGNA 4ZB9A 2VL3A 1QMVA 4POKA 3TKSA 4KW6A 4EC0A 1BG5A 2HZEA 2YZUA 2AHEA 5CRDA 3TB2A 1SYRA 4QL9A 1X9MB 2CT6A 2F9SA 2F8AA 4KA0A 2XBQA 5GAND 3SWLA 2PVOC 3EU4A 2LS5A 2DJJA 2H1GA 5CAXA 2ON7A 4F82A 2RUFA 2B5XA 2AV4A 4G10A 4ECIA 2IN3A 2QC7A 2VCZA 5DJLA 1AW9A 5DBQA 3ZTLA 2K18A 2WFCA 1YJ6A 2VCVA 3GL5A 4KSOA 1F6MC 2CAQA 3ZVJA 4X1UA 1QK8A 4L0WA 4MF5A 5D8IA 4EXJA 1Z7RA 2VLTA 2FCHA 1TK0B 2ZCTA 1TDIA 4K8MA 2H73A 3AY8A 1A24A 1GP1A 4MABA 3V1WA 5EY6A 1FOVA 3ZRDA 4I2TA 4ID0A 3UAPA 1XWBA 1K0NA 2IIYA 2O87A 5E59A 1JZOA 4LL4B 5ECIB 2LJRA 2YP6A 5DQSA 1GLQA 3M3MA 1YKAA 3GNJA 3WGDA 4ZB8A 3IK9A 3F4SA 1XW5A 3CBUA 1G7OA 3IPZA 2X8HA 2G2QA 1YEPA 1WE0A 2B5EA 3K8NA 4K6XA 1TP9A 1EP8A 1M9AA 4Q5FA 3MNGA 1A0FA 1K3LA 2I4AA 1WRYA 4QL7A 1SK0A 2VL2C 4F0CA 18GSA 2ES7A 5CP1A 3CRTA 3PGTA 3ZIVA 3DEXA 14GSA 1MD3A 4YAPA 4TXOB 5IMAA 1XBSA 1TRWA 5DALA 3ZIJA 4XCSA 2GT5A 2YJ7A 3DVXA 1IYHA 1EV4A 20GSA 2H66A 2OBKA 5IMVA 2H0HA
chains in the Genus database with same CATH superfamily
3UOMA 1M99A 2R6KA 4CW9A 1EEJA 3QFBC 2MZCA 1Z6MA 2XPDA 1XWKA 2GQKA 3ZVJD 2FWHA 4OCFA 3F6DA 5HR1A 1CQGA 1F9MA 3NOFA 2HFDA 2YWNA 3IXRA 2XBIA 4HU9A 5CNWA 4ZL7A 5KN1A 1THXA 5G5EA 2VL9A 2C0DA 2BMXA 1LU4A 3DYRA 2OADA 4DSRA 2CVKA 3FR6A 4I97A 1KEBA 3UIWA 2AJQB 3HY2A 3GA4A 2VCWA 1PSQA 4MZCA 2C0FA 3WT2A 3UMAA 3FZ9A 1SL1B 4TVEA 4ZBBA 1PD21 5J5NA 3L9SA 4DSSA 3VWXA 3KH7A 4HQZA 1B4PA 2P0GA 2J23A 4X43A 5ECQB 1UVZA 3GH6A 3PR8A 2H70A 3FZAA 4GQCA 4AJ6A 1XW6A 3FZ4A 4IKHA 2IMKA 1BEDA 4CY8A 3LORA 3D21A 1SKSB 1QQ2A 5COHA 5IMCA 5G2ZA 3H79A 1A8YA 1I9DA 4TOPA 3TKSC 5EVOA 5CRGA 5EL8A 4NHWA 2WDUA 3GIXA 3LQ7A 4MZBA 1YF0A 3ZL5A 2LRTA 3DVWA 2TRCP 1EV9A 2HRAA 4V1Ag 5CYYA 1ZCPA 4OCEA 3W6GA 2EIOA 1U3AA 2I81A 2KUCA 3KZQA 1MDIA 2GZZA 4GF0A 3TJJA 5LCZA 1EOHA 3UBLA 1JZDA 3D0ZA 2I9HA 3I6AA 3RBTA 4MH3A 1S3RA 4BVYB 3ZYWA 2L5LA 3RPNA 2M46A 3CTGA 2O89A 1NHOA 1VF2A 1WJKA 3EMPA 3L4NA 1YEXA 1EEMA 7GSSA 4JRRA 5D9TA 4FYBA 19GSA 2NDOA 4WETA 2P5RA 2X64A 2CVDA 3A5IA 2YWOA 1TK8B 2B5YA 4BL7B 1F3AA 3E9JB 3OR5A 1KNGA 4N11A 5KN0A 5KOXA 4KGIA 2H0IA 5J4UA 2QA2A 2E0QA 1TW9A 1TRVA 4KDXA 5AIVA 1K0DA 3FMWA 3TUEA 4HI7A 3VPTA 5H5SA 3JCML 3ZFLA 4IQ1A 3E0UA 4Z7XA 1SL0B 4WR5A 6GSYA 4MPGA 4Z2TA 2LNTA 3GH9A 4MMMA 1Z7PA 3UBKA 1PKZA 2A2SA 3CSJA 3VPQA 3EU3A 4MZWA 2H71A 3KTLA 4TN8A 1WMJA 2ON5A 4OO5A 1S3DA 2A4HA 4H86A 2CQ9A 2HSHA 4Q5NA 4DEJA 2HRNA 5DAKB 1VF4A 3KD0A 1FB0A 2B6MA 3KP8A 3ZMKA 5A5KA 2OACA 4OMVA 3HVNA 3J7Yb 3GYKA 4MPFA 3IR4A 4MF6A 5DCHA 2K8VA 4USSA 2AB6A 1Q4JA 2OE0A 2GZPA 5HQPA 4HS1A 3IDVA 4TXOA 1THOA 1GSSA 1TRSA 4LMVA 5J41A 3LGCA 4AJ8A 3PH9A 2B1KA 3KXOA 4O92A 2H6YA 3F4RA 3VK9A 2AAWA 3TKRA 3CQFA 5IPGA 4K0GA 4AGSA 2JADA 2R0CA 2V2GA 1XWCA 4MNNA 3CMIA 4GXZA 2QGVA 3EINA 4E8HA 2OKAA 4HOJA 1RW1A 4CDOA 2EIQA 3D4TA 3HHVA 1TU8A 3IAM2 5ECNB 8GSSA 1HNCA 3TRXA 4PNFA 2H8LA 1K3OA 2LJKA 3DWVA 9GSSA 3RPPA 4N30A 2X49A 2LV3A 4PQ1A 1QXHA 1A23A 2H76A 4TXVA 4TR3A 4YQVA 2HXKA 4K0NA 1BX9A 5L71A 2A2RA 1V9WA 1E2YA 4TW5A 4EO3A 1MTCA 3HD5A 2VCTA 4RI7A 3GTUB 2H6ZA 4TRXA 4OD7A 2MMAA 1HNBA 3LJRA 2PMTA 2M80A 1O81A 1SJIA 1ZYEA 2CZ2A 4F0BA 3GMFA 4F03A 1GNEA 5ECLB 2KOKA 3DMLA 4EDZA 4MJAA 5F8BA 3HJMA 1XFLA 3RHBA 3GFKA 1XVQA 1JZWA 3IAS2 5A4VA 2HSYA 2GLRA 3TJBA 4K9ZA 2DJ0A 4IHUA 1Z6NA 2LQQA 3KH9A 4PX1A 4G19A 3HVXA 1PN0A 2UZ8A 3GN3A 5DVBA 1J08A 3GKXA 1NSWA 1OC9B 2IFQB 1GTUA 4YQMA 1B9YC 2HLSA 2L6CA 1TKDB 1XCCA 1M2BA 2R0PA 1UN2A 2TRXA 5CRWA 1DSBA 4MF7A 2N5AA 4L8EA 2FNOA 2XPEA 3GX0A 2IMIA 4PXOA 5ECMB 4BVYA 1HNAA 2NBSA 2R0GA 5J3RA 1RK4A 4ZIJA 5DJMA 3MSZA 1ON4A 4MK3A 4EUYA 3H93A 3LFLA 1ERTA 1FVKA 1TI3A 2H74A 2H1BA 1PKWA 1W4VA 1XWGA 3F8UA 1ZL9A 5GSTA 2RUEA 4MJCA 5KN2A 2WULA 2I3YA 3DIEA 3IRAA 2B3SA 1RQMA 2DJ2A 5HR0A 2FUG2 2A4VA 1G6YA 1M3IA 3VWVA 4BL7A 1XVWA 4NAXA 4JE1A 1R26A 4G0LA 4I6XA 1T4ZA 1SJZA 2QA1A 3DRNA 2PBJA 1S3CA 3EYTA 3D4MA 5D9XA 1TU7A 4KDYA 4LA1A 1GSFA 4OWYA 4PTSA 5DQYA 3GURA 1TJDA 5C00A 1XOBA 3HZ8A 6GSUA 4XS4A 2YV9A 2YZHA 4ML6A 3ZMLA 4ECJA 5A4UA 2FLSA 1J0FA 3Q74A 3HVSA 4O32A 5IQYA 5DDLA 4WBRD 4V2NA 2X8GA 2E7PA 3EPTA 1R5AA 4HQSA 1VF3A 1A2MA 1NM3A 3FR3A 3R2QA 4D73A 4KUNA 4WXTA 3DKSA 4GSSA 4J57E 5DAKA 2JSYA 2EIRA 1V40A 2GSQA 4TR0A 3GX8A 1JZRA 2DJKA 1K3YA 2PWJA 3ERFA 2GSRA 1Z3EA 2WS2A 2HNLA 3FR9A 2A2PA 4HJ2A 3ISOA 2H6XA 11GSA 3KEBA 5ABRA 2C3NA 1GULA 5CO3A 1F3BA 1KBNA 1SJ6A 2MYGA 3UEMA 1X5CA 4LLRA 3U6VA 2C0EA 4OO4A 3LWAA 1SK2A 4O5UA 5B6MA 4HSCX 5IO0A 2K9FA 4E8EA 4EE0A 1GSEA 1DE1A 5E4WA 2LRNA 2KP1A 4PQIA 2FD3A 2LRCA 1OYJA 2KHPA 3CTFA 5G1KA 4KE3A 1PFOA 5D96A 4J2FA 4QQ7A 1QUWA 5D9WA 3KGKA 2C8UA 3O3TA 4XS6A 4L0UA 3GV1A 3S9FA 3IC8A 2QSIA 4WF5A 4WEYA 3GKMA 4RQRA 3UL3A 1ERWA 2DLXA 1AAZA 3QMXA 3EE2A 3RHCA 1Z9HA 2AUVA 3P8WA 3GTUA 4HUAA 2FA4A 5G5FA 2OJLA 3BBYA 3CSIA 4KSMA 1GUMA 4WBJA 1ML6A 2JSZA 1ABAA 3WYWA 4AF2A 2C1YA 4ULXA 3C1SA 2OE3A 1TTZA 4RQXA 4Z2RA 1YZXA 3QFAC 2IMDA 2YJHA 1URMA 5ECOB 1XOAA 2YOIA 5IOWA 1ZYNA 1H75A 4G0KA 2GT6A 4CHSA 1ERUA 3HJOA 3LYKA 2CA8A 2BJXA 2LNSA 4MP4A 2VLVA 4MCUA 2P5QA 2WGRA 2L4CA 5JCGA 2DJ3A 5J9BA 1K0BA 2O8VB 5HR3A 2MMOA 3MAKA 4GTUA 1OC9A 2IFQA 2IMEA 3F9UA 2VM1A 2EC4A 3L9VA 5LD0A 3KMOA 4IJ3A 1X5DA 1BYEA 3MDKA 1DE2A 3R3EA 3M9KA 1JHBA 3UVHA 4G0IA 2IL3A 5JWOB 2OA7A 1PX7A 5G31A 4BVXB 1XXUA 1FVJA 2V32A 2IMFA 1T3BA 2H30A 5G1LA 2OE1A 1R4WA 4JR6A 3HCZA 3KM6A 3IC4A 5B8BA 4Q5RA 1SENA 3FZ5A 4FYCA 4EKZA 4WKWA 1IYIA 2HI7A 4K2XA 5B8AA 4KDUA 3VLNA 4XRAA 4I5QA 2DC5A 2PN8A 3QAWA 3QOUA 1V57A 5ECSA 2FA8A 3DXBA 3ZZXA 1DBYA 5H5RA 4XIHA 2E2GA 1TXXA 2CAIA 4G9HA 3F63A 6GSTA 2H1AA 1B8XA 4JEDA 2XHFA 4DSQA 1OKDA 3HXSA 1VGLA 2C4JA 1T1VA 2L6DA 4LMWA 1FOHA 4OFMA 4IW9A 2VUPA 3NIVA 3RAZA 3I9V2 4DVCA 1C72A 2F3MA 1U87A 3F4TA 1YKCA 5JWQB 3M1GA 3VFIA 1V2AA 1WIKA 5FWGA 1N2AA 3QDNA 1SD9A 1JFUA 4XS4B 1YQ1A 4HZ2A 1U88A 2HZFA 3GSTA 3TGZA 4HEA2 1KTEA 4KNDA 2J9HA 4KX4A 4L5OA 1YY7A 1BQ7A 2CX4A 2Z9SA 5HFKA 4ML1A 2FWFA 4PNGA 3P90A 2YCDA 4D73B 2FGXA 3N9JA 5IMZA 4XS1A 3UARA 3ZFBA 2DIZA 2F8FA 2V6KA 4BA7A 1SD8A 4O5RA 4GSNA 1OC8A 1PX6A 2E2MA 1GUKA 1JLVA 3BJ5A 3F3RA 3EC3A 2VM2A 3DD3A 4I2UA 2GDRA 2HSMA 2PPTA 2M72A 1EGOA 3KTBA 3L78A 4RUVA 1I5GA 3TJKA 3VWUA 2C3TA 2VCQA 1O8XA 2H0GA 2LKUA 1YF1A 3TKQA 5ELAA 2N5BA 1AUCA 3WGEA 3KCMA 1J9BA 4CY6A 3LEFA 2I1UA 4GWRA 4MJBA 2KP2A 4HZ4A 4HU7A 4K7OA 2YNXA 3Q19A 1GNWA 3KJYA 4JU5A 1UC7A 1SKRB 3IOSA 3VWWA 4PURA 1QFNA 3BCIA 1A2LA 3CXGA 3FHKA 3G7IA 2LJAA 3GSSA 4GQFA 2CX3A 1GWCA 4ILFA 10GSA 3GHAA 2VOCA 2D2ZA 3FRCA 2GQLA 1A2JA 3QCPA 3ZREA 2IWTA 5CREA 3KIJA 2REMA 4IELA 2K8SA 1GSDA 3IE3A 3WGXA 3CYNA 3VI5A 3ME7A 2BTOT 4KAEA 2WZ9A 12GSA 3HJPA 2MBTA 3HA9A 4PUFC 4FIWA 1OKTA 3IBHA 4JBBA 2IPAA 3US3A 4TKYA 1FG4A 3O6TA 2LSTA 3CRUA 3D22A 3HDCA 4EDYA 1M2DA 5EPFA 4ZL9A 17GSA 3WT1A 3W8JA 3WD6A 2NVLA 3Q18A 4TR4A 2FHEA 1EZKA 1V98A 2JL4A 4YQUA 1MEKA 1ZZYA 1MDKA 4YH2A 1GH2A 4L5LA 1E6BA 4JR4A 2O7KA 3I43A 1WWJA 2GZYA 1ZOFA 3FKFA 1HQOA 4BVXA 1LJRA 1O7UA 3RDWA 1O6JA 5JCWA 4RI6A 2PGTA 2RM6A 2MMZA 1M2AA 5CRHA 1GTBA 2LQOA 1X9SB 1USBA 1ZMAA 2JACA 4NV5A 3O76A 4MA9A 3M0FA 2GSTA 3BD2A 1X5EA 1SYXA 3QR6A 4LL1B 1UA5A 4P3YB 1GUHA 3A2WA 1Y25A 1K0CA 3ED3A 1GSQA 1OVNA 5LNKe 3TRQA 4BWSA 3EWLA 1FO5A 1GSYA 4NWYA 3EVIA 5D73A 4IS0A 1Y6EA 4KCAA 2L5OA 2HYXA 4Z2UA 4FH8A 2F51A 3TDGA 1U6TA 3KP9A 1K0OA 5IIZA 2G0FA 2ZUPA 2L59A 4Q5QA 3TKSE 1OE8A 2CV4A 1OAZA 4IBPA 2GQMA 4XRDA 3SBCA 2WCIA 2H75A 4ECCA 2V1MA 4K1FA 1NW2A 4XTSA 5JWRB 1YDKA 4FO5A 1R5PA 5FHIA 1VRSD 1B4QA 3TOUA 2WRTA 2NPBA 3L0HA 1Z5YE 1ACVA 1GTAA 2JZSA 4ZBDA 5IMFA 2R3XA 3ZLPA 3FYGA 3EMXA 1HD2A 5AN1A 2R4VA 2TIRA 2ALBA 4HJMA 1FHEA 3EURA 3C71A 4POMA 3QPMA 5IM9A 1K0MA 1SK1A 5IMDA 1O85A 5DCGA 4BIKA 2R2JA 1QGVA 1TI1A 1S3AA 3L9UA 3VURA 1R7HA 4J56E 3I69A 2R37A 3F3QA 3HKRA 1XZOA 2O85A 2OBIA 2YANA 5ELGA 3G9BA 5D9VA 4KCEA 2GGTA 2RIIA 1AIUA 3C7MA 3LYPA 3MIXA 4YKGA 5GAPD 6GSSA 2LEGA 4N0ZA 4NXIA 1B9XC 4TR1B 1MDJA 3A3TA 3F6FA 2VD1A 4ZBAA 1LBKA 1PQNA 3IHGA 3GUSA 3BCKA 4GCIA 3TKPA 1PGTA 4BWQA 4EIQA 3Q6OA 2GVPA 2RLIA 4ECBA 1B48A 5HFIA 3FK8A 5D93A 2DKIA 5AGYA 5IO2A 4POBA 3C73A 5AIXA 1AQVA 1PA3A 3MWHA 3HVVA 1WOUA 1O8WA 2DMMA 1PL2A 4IVFA 4V2LA 1SKWB 2HT9A 4YAVA 4N10A 5IPHA 5IOXA 3ERWA 5HR2A 1F2EA 2GS3A 5ECPB 4IJIA 1EOGA 3TOTA 2WB9A 4WR4A 2HRKA 3UVTA 4ZXGA 1XW9A 1BJXA 5INYA 5F07A 2YWIA 4GSTA 2C3QA 5ID2B 2VO4A 2X8CA 1XPVA 3KMNA 5J9CA 22GSA 1ZYPA 2FWEA 2L4QA 3ME8A 4K5SA 1M7TA 1G0TA 4X0XA 3LW9A 1GLPA 2JU5A 1G7EA 2K6VA 2CVBA 2VD0A 2CZ3A 4MJEA 1EWXA 4EIPA 3FY7A 6GSXA 4ISDA 1PN9A 5AISA 1DUGA 1NHYA 3FW2A 1WP0A 5GZZB 4ZL8A 4ZB6A 1T8EB 2MBSA 6GSWA 4MDCA 4PUAA 2DSAA 3DGQA 2HZEB 1N8JA 4GLTA 2LTKA 3GKNA 1GTIA 16GSA 2IJYA 2QKEA 4POLA 4K7NA 1U3IA 2H72A 5HFGA 3C8EA 5KOWA 1WPIA 1M9BA 1X0RA 4X4JA 2KLXA 3VI7A 1K0AA 1HYUA 2B7JA 4F2IA 2LUSA 1AC1A 4ICYA 3N5OA 1OC3A 4PQHA 3GRXA 1TRUA 5FT3A 3NZNA 4IQAA 3D6IA 2DKHA 1T00A 3IK7A 5BRTA 4AJ7A 5JCUA 2AYTA 2DIYA 2WJUA 2YPMA 4EVMA 3A2XA 4JZQA 1EGRA 4KH7A 3QAVA 5A4WA 2MMNA 1MD4A 5ECRB 2H19A 5F05A 1W89A 3LSZA 3P2AA 3G7JA 5B6NA 1XWAA 4F9ZA 1AQWA 6GSVA 2DJ1A 3HZ4A 1M0UA 1Q98A 2P31A 3PINA 3E3EA 3M8NA 4BPYA 3LXZA 3CSHA 1ST9A 1BAYA 5BMUA 2FY6A 2VLUA 1FAAA 4EF0A 3LG6A 3D5JA 3U5RE 1V58A 5G30A 4IP6A 2C80A 5F0GA 4WF4A 3GL3A 2DBCA 1H4OA 4G2EA 1SU9A 1EP7A 4IN0A 2RM5A 4N0VA 2B7KA 1OE7A 1VF1A 3M9JA 4ACSA 2PUKC 3P7XA 3HYPA 5KEJA 2XC2A 3IHQA 5C04A 4MH2A 4HDEA 3UJ1A 3APSA 4IP1A 4GRFA 3IA1A 3QD9A 4EL1A 3C1RA 3TRPA 5ECHB 1TOFA 1AQXA 3G7YA 2VL2A 13GSA 5ECKB 2YN1A 3J7Yk 4O7HA 5DALB 1O73A 2FWGA 4OFTA 4XHMA 4TR1A 1ILOA 1CQHA 1GRXA 2H01A 1PRXA 4I8BA 1XIYA 1G6WA 1T7PB 2VCXA 4KB3A 2JZRA 3TJFA 2JZTA 2HE3A 4NMUA 2PVQA 1A8LA 4MLYA 5ENUA 5GSSA 5B7CA 3ZITA 4K2DA 3W8SA 3GKKA 2V41A 2YWMA 3APQA 2VAFA 2PERA 2PU9C 3H1NA 3IV4A 3FEUA 2HRFA 1FW1A 4K5RA 3A2VA 2C0GA 2X99A 1T4YA 3LXTA 4NHZA 3H8QA 2V6OA 2H1DA 3ERGA 2N5FA 4PGTA 1PL1A 3TCOA 4K7IA 2B1LA 2ZNMA 4V1Ap 2GSSA 1TK5B 2R5GA 1AXDA 1ERVA 2GTUA 2L57A 1ZYQB 4FQUA 3F0IA 4FYUA 5H5QA 5ID2A 3QAGA 2VIMA 1SL2B 3A5WA 4V2MA 4DSSB 3BOAA 3TJGA 1GSUA 4NPBA 3H4KA 1X9WB 2YV7A 1JLWA 4NV2A 2NTOA 1PMTA 3APOA 2DMLA 4IGJA 4OFNA 1F37A 1FB6A 1GL8A 4ZILA 5KN3A 1A0RP 5F06A 3MYDA 1ZGNA 4ZB9A 2VL3A 1QMVA 4POKA 3TKSA 4KW6A 4EC0A 1BG5A 2HZEA 2YZUA 2AHEA 5CRDA 3TB2A 1SYRA 4QL9A 1X9MB 2CT6A 2F9SA 2F8AA 4KA0A 2XBQA 5GAND 3SWLA 2PVOC 3EU4A 2LS5A 2DJJA 2H1GA 5CAXA 2ON7A 4F82A 2RUFA 2B5XA 2AV4A 4G10A 4ECIA 2IN3A 2QC7A 2VCZA 5DJLA 1AW9A 5DBQA 3ZTLA 2K18A 4A5PA 2X4AA 2WFCA 1YJ6A 2VCVA 3GL5A 4KSOA 1F6MC 2CAQA 3ZVJA 4X1UA 1QK8A 4L0WA 4MF5A 5D8IA 4EXJA 1Z7RA 2VLTA 2FCHA 1TK0B 2ZCTA 1TDIA 4K8MA 2H73A 3AY8A 1A24A 1GP1A 4MABA 3V1WA 5EY6A 1FOVA 3ZRDA 4I2TA 4ID0A 3UAPA 1XWBA 1K0NA 4YKFA 2IIYA 2O87A 5E59A 1JZOA 4LL4B 5ECIB 2LJRA 2YP6A 5DQSA 1GLQA 3M3MA 1YKAA 3GNJA 3WGDA 4ZB8A 3IK9A 3F4SA 1XW5A 3CBUA 1G7OA 3IPZA 2X8HA 4KF9A 2G2QA 1YEPA 1WE0A 2B5EA 3K8NA 4K6XA 1TP9A 1M3JA 1EP8A 1M9AA 1XG8A 4Q5FA 3MNGA 1A0FA 1K3LA 2I4AA 1WRYA 4QL7A 1SK0A 2VL2C 4F0CA 18GSA 2ES7A 5CP1A 3CRTA 3PGTA 3ZIVA 3DEXA 14GSA 1MD3A 3PPUA 4YAPA 4TXOB 5IMAA 1XBSA 1TRWA 5DALA 3ZIJA 4XCSA 2GT5A 2YJ7A 4O5QA 3DVXA 1IYHA 1EV4A 20GSA 2H66A 2OBKA 5IMVA 2H0HA
chains in the Genus database with same CATH topology
3UOMA 1M99A 2R6KA 4CW9A 1EEJA 3QFBC 2MZCA 1Z6MA 2XPDA 1XWKA 2GQKA 3ZVJD 2FWHA 4OCFA 3F6DA 5HR1A 1CQGA 1F9MA 3NOFA 2HFDA 2YWNA 3IXRA 2XBIA 4HU9A 5CNWA 4ZL7A 5KN1A 1THXA 5G5EA 2VL9A 2C0DA 2BMXA 1LU4A 3DYRA 2OADA 4DSRA 2CVKA 3FR6A 4I97A 1KEBA 3UIWA 2AJQB 3HY2A 3GA4A 2VCWA 1PSQA 4MZCA 2C0FA 3WT2A 3UMAA 3FZ9A 1SL1B 4TVEA 4ZBBA 1PD21 5J5NA 3L9SA 4DSSA 3VWXA 3KH7A 4HQZA 1B4PA 2P0GA 2J23A 4X43A 5ECQB 1UVZA 3GH6A 3PR8A 2H70A 3FZAA 4GQCA 4AJ6A 1XW6A 3FZ4A 4IKHA 2IMKA 1BEDA 4CY8A 3LORA 3D21A 1SKSB 1QQ2A 5COHA 5IMCA 5G2ZA 3H79A 1A8YA 1I9DA 4TOPA 3TKSC 5EVOA 5CRGA 5EL8A 4NHWA 2WDUA 3GIXA 3LQ7A 4MZBA 1YF0A 3ZL5A 2LRTA 3DVWA 2TRCP 1EV9A 2HRAA 4V1Ag 5CYYA 1ZCPA 4OCEA 3W6GA 2EIOA 1U3AA 2I81A 2KUCA 3KZQA 1MDIA 2GZZA 4GF0A 3TJJA 5LCZA 1EOHA 3UBLA 1JZDA 3D0ZA 2I9HA 3I6AA 3RBTA 4MH3A 4BVYB 3ZYWA 2L5LA 3RPNA 2M46A 3CTGA 2O89A 1NHOA 1VF2A 1WJKA 3EMPA 3L4NA 1YEXA 1EEMA 7GSSA 4JRRA 5D9TA 4FYBA 19GSA 2NDOA 4WETA 2P5RA 2X64A 2CVDA 3A5IA 2YWOA 1TK8B 2B5YA 4BL7B 1F3AA 3E9JB 3OR5A 1KNGA 4N11A 5KN0A 5KOXA 4KGIA 2H0IA 5J4UA 2QA2A 2E0QA 1TW9A 1TRVA 4KDXA 5AIVA 1K0DA 3FMWA 3TUEA 4HI7A 3VPTA 5H5SA 3JCML 3ZFLA 4IQ1A 3E0UA 4Z7XA 1SL0B 4WR5A 6GSYA 4MPGA 4Z2TA 2LNTA 3GH9A 4MMMA 1Z7PA 3UBKA 1PKZA 2A2SA 3CSJA 3VPQA 3EU3A 4MZWA 2H71A 3KTLA 4TN8A 1WMJA 2ON5A 4OO5A 1S3DA 2A4HA 4H86A 2CQ9A 2HSHA 4Q5NA 4DEJA 2HRNA 5DAKB 1VF4A 3KD0A 1FB0A 2B6MA 3KP8A 3ZMKA 5A5KA 2OACA 4OMVA 3J7Yb 3GYKA 4MPFA 3IR4A 4MF6A 5DCHA 2K8VA 4USSA 2AB6A 1Q4JA 2OE0A 2GZPA 5HQPA 4HS1A 3IDVA 4TXOA 1THOA 1GSSA 1TRSA 4LMVA 5J41A 3LGCA 4AJ8A 3PH9A 2B1KA 3KXOA 4O92A 2H6YA 3F4RA 3VK9A 2AAWA 3TKRA 5IPGA 4K0GA 4AGSA 2JADA 2R0CA 2V2GA 1XWCA 4MNNA 3CMIA 4GXZA 2QGVA 3EINA 4E8HA 2OKAA 4HOJA 1RW1A 4CDOA 2EIQA 3D4TA 3HHVA 1TU8A 3IAM2 5ECNB 8GSSA 1HNCA 3TRXA 4PNFA 2H8LA 1K3OA 2LJKA 3DWVA 9GSSA 3RPPA 4N30A 2X49A 2LV3A 4PQ1A 1QXHA 1A23A 2H76A 4TXVA 4TR3A 4YQVA 2HXKA 4K0NA 1BX9A 5L71A 2A2RA 1V9WA 1E2YA 4TW5A 4EO3A 1MTCA 3HD5A 2VCTA 4RI7A 3GTUB 2H6ZA 4TRXA 4OD7A 2MMAA 1HNBA 3LJRA 2PMTA 2M80A 1O81A 1SJIA 1ZYEA 2CZ2A 4F0BA 3GMFA 4F03A 1GNEA 5ECLB 2KOKA 3DMLA 4EDZA 4MJAA 5F8BA 3HJMA 1XFLA 3RHBA 3GFKA 1XVQA 1JZWA 3IAS2 5A4VA 2HSYA 2GLRA 3TJBA 4K9ZA 2DJ0A 4IHUA 1Z6NA 2LQQA 3KH9A 4PX1A 4G19A 3HVXA 1PN0A 2UZ8A 3GN3A 5DVBA 1J08A 3GKXA 1NSWA 1OC9B 2IFQB 1GTUA 4YQMA 1B9YC 2HLSA 2L6CA 1TKDB 1XCCA 1M2BA 2R0PA 1UN2A 2TRXA 5CRWA 1DSBA 4MF7A 2N5AA 4L8EA 2FNOA 2XPEA 3GX0A 2IMIA 4PXOA 5ECMB 4BVYA 1HNAA 2NBSA 2R0GA 5J3RA 1RK4A 4ZIJA 5DJMA 3MSZA 1ON4A 4MK3A 4EUYA 3H93A 3LFLA 1ERTA 1FVKA 1TI3A 2H74A 2H1BA 1PKWA 1W4VA 1XWGA 3F8UA 1ZL9A 5GSTA 2RUEA 4MJCA 5KN2A 2WULA 2I3YA 3DIEA 3IRAA 2B3SA 1RQMA 2DJ2A 5HR0A 2FUG2 2A4VA 1G6YA 3VWVA 4BL7A 1XVWA 4NAXA 4JE1A 1R26A 4G0LA 4I6XA 1T4ZA 1SJZA 2QA1A 3DRNA 2PBJA 1S3CA 3EYTA 3D4MA 5D9XA 1TU7A 4KDYA 4LA1A 1GSFA 4OWYA 4PTSA 5DQYA 3GURA 1TJDA 5C00A 1XOBA 3HZ8A 6GSUA 4XS4A 2YV9A 2YZHA 4ML6A 3ZMLA 4ECJA 5A4UA 2FLSA 1J0FA 3Q74A 3HVSA 4O32A 5IQYA 5DDLA 4WBRD 4V2NA 2X8GA 2E7PA 3EPTA 1R5AA 4HQSA 1VF3A 1A2MA 1NM3A 3FR3A 3R2QA 4D73A 4KUNA 4WXTA 3DKSA 4GSSA 4J57E 5DAKA 2JSYA 2EIRA 1V40A 2GSQA 4TR0A 3GX8A 1JZRA 2DJKA 1K3YA 2PWJA 3ERFA 2GSRA 1Z3EA 2WS2A 2HNLA 3FR9A 2A2PA 4HJ2A 3ISOA 2H6XA 11GSA 3KEBA 5ABRA 2C3NA 1GULA 5CO3A 1F3BA 1KBNA 1SJ6A 2MYGA 3UEMA 1X5CA 4LLRA 3U6VA 2C0EA 4OO4A 3LWAA 1SK2A 4O5UA 5B6MA 5IO0A 2K9FA 4E8EA 4EE0A 1GSEA 1DE1A 5E4WA 2LRNA 2KP1A 4PQIA 2FD3A 2LRCA 1OYJA 2KHPA 3CTFA 5G1KA 4KE3A 5D96A 4J2FA 4QQ7A 1QUWA 5D9WA 3KGKA 2C8UA 3O3TA 4XS6A 4L0UA 3GV1A 3S9FA 3IC8A 2QSIA 4WF5A 4WEYA 3GKMA 4RQRA 3UL3A 1ERWA 2DLXA 1AAZA 3QMXA 3EE2A 3RHCA 1Z9HA 2AUVA 3P8WA 3GTUA 4HUAA 2FA4A 5G5FA 2OJLA 3BBYA 3CSIA 4KSMA 1GUMA 4WBJA 1ML6A 2JSZA 1ABAA 3WYWA 4AF2A 2C1YA 4ULXA 3C1SA 2OE3A 1TTZA 4RQXA 4Z2RA 1YZXA 3QFAC 2IMDA 2YJHA 1URMA 5ECOB 1XOAA 2YOIA 5IOWA 1ZYNA 1H75A 4G0KA 2GT6A 4CHSA 1ERUA 3HJOA 3LYKA 2CA8A 2BJXA 2LNSA 4MP4A 2VLVA 4MCUA 2P5QA 2WGRA 2L4CA 5JCGA 2DJ3A 5J9BA 1K0BA 2O8VB 5HR3A 2MMOA 3MAKA 4GTUA 1OC9A 2IFQA 2IMEA 3F9UA 2VM1A 2EC4A 3L9VA 5LD0A 3KMOA 4IJ3A 1X5DA 1BYEA 3MDKA 1DE2A 3R3EA 3M9KA 1JHBA 3UVHA 4G0IA 2IL3A 5JWOB 2OA7A 1PX7A 5G31A 4BVXB 1XXUA 1FVJA 2V32A 2IMFA 1T3BA 2H30A 5G1LA 2OE1A 1R4WA 4JR6A 3HCZA 3KM6A 3IC4A 5B8BA 4Q5RA 1SENA 3FZ5A 4FYCA 4EKZA 4WKWA 1IYIA 2HI7A 4K2XA 5B8AA 4KDUA 3VLNA 4XRAA 4I5QA 2DC5A 2PN8A 3QAWA 3QOUA 1V57A 5ECSA 2FA8A 3DXBA 3ZZXA 1DBYA 5H5RA 4XIHA 2E2GA 1TXXA 2CAIA 4G9HA 3F63A 6GSTA 2H1AA 1B8XA 4JEDA 2XHFA 4DSQA 1OKDA 3HXSA 1VGLA 2C4JA 1T1VA 2L6DA 4LMWA 1FOHA 4OFMA 4IW9A 2VUPA 3NIVA 3RAZA 3I9V2 4DVCA 1C72A 2F3MA 1U87A 3F4TA 1YKCA 5JWQB 3M1GA 3VFIA 1V2AA 1WIKA 5FWGA 1N2AA 3QDNA 1SD9A 1JFUA 4XS4B 1YQ1A 4HZ2A 1U88A 2HZFA 3GSTA 3TGZA 4HEA2 1KTEA 4KNDA 2J9HA 4KX4A 4L5OA 1YY7A 1BQ7A 2CX4A 2Z9SA 5HFKA 4ML1A 2FWFA 4PNGA 3P90A 2YCDA 4D73B 2FGXA 3N9JA 5IMZA 4XS1A 3UARA 3ZFBA 2DIZA 2F8FA 2V6KA 4BA7A 1SD8A 4O5RA 4GSNA 1OC8A 1PX6A 2E2MA 1GUKA 1JLVA 3BJ5A 3F3RA 3EC3A 2VM2A 3DD3A 4I2UA 2GDRA 2HSMA 2PPTA 2M72A 1EGOA 3KTBA 3L78A 4RUVA 1I5GA 3TJKA 3VWUA 2C3TA 2VCQA 1O8XA 2H0GA 2LKUA 1YF1A 3TKQA 5ELAA 2N5BA 1AUCA 3WGEA 3KCMA 1J9BA 4CY6A 3LEFA 2I1UA 4GWRA 4MJBA 2KP2A 4HZ4A 4HU7A 4K7OA 2YNXA 3Q19A 1GNWA 3KJYA 4JU5A 1UC7A 1SKRB 3IOSA 3VWWA 4PURA 1QFNA 3BCIA 1A2LA 3CXGA 3FHKA 3G7IA 2LJAA 3GSSA 4GQFA 2CX3A 1GWCA 4ILFA 10GSA 3GHAA 2VOCA 2D2ZA 3FRCA 2GQLA 1A2JA 3QCPA 3ZREA 2IWTA 5CREA 3KIJA 2REMA 4IELA 2K8SA 1GSDA 3IE3A 3WGXA 3CYNA 3VI5A 3ME7A 2BTOT 4KAEA 2WZ9A 12GSA 3HJPA 2MBTA 3HA9A 4PUFC 4FIWA 1OKTA 3IBHA 4JBBA 2IPAA 3US3A 4TKYA 1FG4A 3O6TA 2LSTA 3CRUA 3D22A 3HDCA 4EDYA 1M2DA 5EPFA 4ZL9A 17GSA 3WT1A 3W8JA 3WD6A 2NVLA 3Q18A 4TR4A 2FHEA 1EZKA 1V98A 2JL4A 4YQUA 1MEKA 1ZZYA 1MDKA 4YH2A 1GH2A 4L5LA 1E6BA 4JR4A 2O7KA 3I43A 1WWJA 2GZYA 1ZOFA 3FKFA 1HQOA 4BVXA 1LJRA 1O7UA 3RDWA 1O6JA 5JCWA 4RI6A 2PGTA 2RM6A 2MMZA 1M2AA 5CRHA 1GTBA 2LQOA 1X9SB 1USBA 1ZMAA 2JACA 4NV5A 3O76A 4MA9A 3M0FA 2GSTA 3BD2A 1X5EA 1SYXA 3QR6A 4LL1B 1UA5A 4P3YB 1GUHA 3A2WA 1Y25A 1K0CA 3ED3A 1GSQA 1OVNA 5LNKe 3TRQA 4BWSA 3EWLA 1FO5A 1GSYA 4NWYA 3EVIA 5D73A 4IS0A 1Y6EA 4KCAA 2L5OA 2HYXA 4Z2UA 4FH8A 2F51A 3TDGA 1U6TA 3KP9A 1K0OA 5IIZA 2G0FA 2ZUPA 2L59A 4Q5QA 3TKSE 1OE8A 2CV4A 1OAZA 4IBPA 2GQMA 4XRDA 3SBCA 2WCIA 2H75A 4ECCA 2V1MA 4K1FA 1NW2A 4XTSA 5JWRB 1YDKA 4FO5A 1R5PA 5FHIA 1VRSD 1B4QA 3TOUA 2WRTA 2NPBA 3L0HA 1Z5YE 1ACVA 1GTAA 2JZSA 4ZBDA 5IMFA 2R3XA 3ZLPA 3FYGA 3EMXA 1HD2A 5AN1A 2R4VA 2TIRA 2ALBA 4HJMA 1FHEA 3EURA 3C71A 4POMA 3QPMA 5IM9A 1K0MA 1SK1A 5IMDA 1O85A 5DCGA 2R2JA 1QGVA 1TI1A 1S3AA 3L9UA 3VURA 1R7HA 4J56E 3I69A 2R37A 3F3QA 3HKRA 1XZOA 2O85A 2OBIA 2YANA 5ELGA 3G9BA 5D9VA 4KCEA 2GGTA 2RIIA 1AIUA 3C7MA 3LYPA 3MIXA 4YKGA 5GAPD 6GSSA 2LEGA 4N0ZA 4NXIA 1B9XC 4TR1B 1MDJA 3A3TA 3F6FA 2VD1A 4ZBAA 1LBKA 1PQNA 3IHGA 3GUSA 3BCKA 4GCIA 3TKPA 1PGTA 4BWQA 4EIQA 3Q6OA 2GVPA 2RLIA 4ECBA 1B48A 5HFIA 3FK8A 5D93A 2DKIA 5AGYA 5IO2A 4POBA 3C73A 5AIXA 1AQVA 1PA3A 3MWHA 3HVVA 1WOUA 1O8WA 2DMMA 1PL2A 4IVFA 4V2LA 1SKWB 2HT9A 4YAVA 4N10A 5IPHA 5IOXA 3ERWA 5HR2A 1F2EA 2GS3A 5ECPB 4IJIA 1EOGA 3TOTA 2WB9A 4WR4A 2HRKA 3UVTA 4ZXGA 1XW9A 1BJXA 5INYA 5F07A 2YWIA 4GSTA 2C3QA 5ID2B 2VO4A 2X8CA 1XPVA 3KMNA 5J9CA 22GSA 1ZYPA 2FWEA 2L4QA 3ME8A 4K5SA 1M7TA 1G0TA 4X0XA 3LW9A 1GLPA 2JU5A 1G7EA 2K6VA 2CVBA 2VD0A 2CZ3A 4MJEA 1EWXA 4EIPA 3FY7A 6GSXA 4ISDA 1PN9A 5AISA 1DUGA 1NHYA 3FW2A 1WP0A 5GZZB 4ZL8A 4ZB6A 1T8EB 2MBSA 6GSWA 4MDCA 4PUAA 2DSAA 3DGQA 2HZEB 1N8JA 4GLTA 2LTKA 3GKNA 1GTIA 16GSA 2IJYA 2QKEA 4POLA 4K7NA 1U3IA 2H72A 5HFGA 3C8EA 5KOWA 1WPIA 1M9BA 1X0RA 4X4JA 2KLXA 3VI7A 1K0AA 1HYUA 2B7JA 4F2IA 2LUSA 1AC1A 4ICYA 3N5OA 1OC3A 4PQHA 3GRXA 1TRUA 5FT3A 3NZNA 4IQAA 3D6IA 2DKHA 1T00A 3IK7A 5BRTA 4AJ7A 5JCUA 2AYTA 2DIYA 2WJUA 2YPMA 4EVMA 3A2XA 4JZQA 1EGRA 4KH7A 3QAVA 5A4WA 2MMNA 1MD4A 5ECRB 2H19A 5F05A 1W89A 3LSZA 3P2AA 3G7JA 5B6NA 1XWAA 4F9ZA 1AQWA 6GSVA 2DJ1A 3HZ4A 1M0UA 1Q98A 2P31A 3PINA 3E3EA 3M8NA 4BPYA 3LXZA 3CSHA 1ST9A 1BAYA 5BMUA 2FY6A 2VLUA 1FAAA 4EF0A 3LG6A 3D5JA 3U5RE 1V58A 5G30A 4IP6A 2C80A 5F0GA 4WF4A 3GL3A 2DBCA 1H4OA 4G2EA 1SU9A 1EP7A 4IN0A 2RM5A 4N0VA 2B7KA 1OE7A 1VF1A 3M9JA 4ACSA 2PUKC 3P7XA 3HYPA 5KEJA 2XC2A 3IHQA 5C04A 4MH2A 4HDEA 3UJ1A 3APSA 4IP1A 4GRFA 3IA1A 3QD9A 4EL1A 3C1RA 3TRPA 5ECHB 1TOFA 1AQXA 3G7YA 2VL2A 13GSA 5ECKB 2YN1A 3J7Yk 4O7HA 5DALB 1O73A 2FWGA 4OFTA 4XHMA 4TR1A 1ILOA 1CQHA 1GRXA 2H01A 1PRXA 4I8BA 1XIYA 1G6WA 1T7PB 2VCXA 4KB3A 2JZRA 3TJFA 2JZTA 2HE3A 4NMUA 2PVQA 1A8LA 4MLYA 5ENUA 5GSSA 5B7CA 3ZITA 4K2DA 3W8SA 3GKKA 2V41A 2YWMA 3APQA 2VAFA 2PERA 2PU9C 3H1NA 3IV4A 3FEUA 2HRFA 1FW1A 4K5RA 3A2VA 2C0GA 2X99A 1T4YA 3LXTA 4NHZA 3H8QA 2V6OA 2H1DA 3ERGA 2N5FA 4PGTA 1PL1A 3TCOA 4K7IA 2B1LA 2ZNMA 4V1Ap 2GSSA 1TK5B 2R5GA 1AXDA 1ERVA 2GTUA 2L57A 1ZYQB 4FQUA 3F0IA 4FYUA 5H5QA 5ID2A 3QAGA 2VIMA 1SL2B 3A5WA 4V2MA 4DSSB 3BOAA 3TJGA 1GSUA 4NPBA 3H4KA 1X9WB 2YV7A 1JLWA 4NV2A 2NTOA 1PMTA 3APOA 2DMLA 4IGJA 4OFNA 1F37A 1FB6A 1GL8A 4ZILA 5KN3A 1A0RP 5F06A 3MYDA 1ZGNA 4ZB9A 2VL3A 1QMVA 4POKA 3TKSA 4KW6A 4EC0A 1BG5A 2HZEA 2YZUA 2AHEA 5CRDA 3TB2A 1SYRA 4QL9A 1X9MB 2CT6A 2F9SA 2F8AA 4KA0A 2XBQA 5GAND 3SWLA 2PVOC 3EU4A 2LS5A 2DJJA 2H1GA 5CAXA 2ON7A 4F82A 2RUFA 2B5XA 2AV4A 4G10A 4ECIA 2IN3A 2QC7A 2VCZA 5DJLA 1AW9A 5DBQA 3ZTLA 2K18A 4A5PA 2X4AA 2WFCA 1YJ6A 2VCVA 3GL5A 4KSOA 1F6MC 2CAQA 3ZVJA 4X1UA 1QK8A 4L0WA 4MF5A 5D8IA 4EXJA 1Z7RA 2VLTA 2FCHA 1TK0B 2ZCTA 1TDIA 4K8MA 2H73A 3AY8A 1A24A 1GP1A 4MABA 3V1WA 5EY6A 1FOVA 3ZRDA 4I2TA 4ID0A 3UAPA 1XWBA 1K0NA 4YKFA 2IIYA 2O87A 5E59A 1JZOA 4LL4B 5ECIB 2LJRA 2YP6A 5DQSA 1GLQA 3M3MA 1YKAA 3GNJA 3WGDA 4ZB8A 3IK9A 3F4SA 1XW5A 3CBUA 1G7OA 3IPZA 2X8HA 4KF9A 2G2QA 1YEPA 1WE0A 2B5EA 3K8NA 4K6XA 1TP9A 1EP8A 1M9AA 4Q5FA 3MNGA 1A0FA 1K3LA 2I4AA 1WRYA 4QL7A 1SK0A 2VL2C 4F0CA 18GSA 2ES7A 5CP1A 3CRTA 3PGTA 3ZIVA 3DEXA 14GSA 1MD3A 3PPUA 4YAPA 4TXOB 5IMAA 1XBSA 1TRWA 5DALA 3ZIJA 4XCSA 2GT5A 2YJ7A 4O5QA 3DVXA 1IYHA 1EV4A 20GSA 2H66A 2OBKA 5IMVA 2H0HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UOM A;  1M99 A;  2R6K A;  4CW9 A;  1EEJ A;  3QFB C;  2MZC A;  1Z6M A;  2XPD A;  1XWK A;  2GQK A;  3ZVJ D;  2FWH A;  4OCF A;  3F6D A;  5HR1 A;  1CQG A;  1F9M A;  3NOF A;  2HFD A;  2YWN A;  3IXR A;  2XBI A;  4HU9 A;  5CNW A;  4ZL7 A;  5KN1 A;  1THX A;  5G5E A;  2VL9 A;  2C0D A;  2BMX A;  1LU4 A;  3DYR A;  2OAD A;  4DSR A;  2CVK A;  3FR6 A;  4I97 A;  1KEB A;  3UIW A;  2AJQ B;  3HY2 A;  3GA4 A;  2VCW A;  1PSQ A;  4MZC A;  2C0F A;  3WT2 A;  3UMA A;  3FZ9 A;  1SL1 B;  4TVE A;  4ZBB A;  1PD2 1;  5J5N A;  3L9S A;  4DSS A;  3VWX A;  3KH7 A;  4HQZ A;  1B4P A;  2P0G A;  2J23 A;  4X43 A;  5ECQ B;  1UVZ A;  3GH6 A;  3PR8 A;  2H70 A;  3FZA A;  4GQC A;  4AJ6 A;  1XW6 A;  3FZ4 A;  4IKH A;  2IMK A;  1BED A;  3LOR A;  3D21 A;  1SKS B;  1QQ2 A;  5COH A;  5IMC A;  5G2Z A;  3H79 A;  1A8Y A;  1I9D A;  4TOP A;  3TKS C;  5EVO A;  5CRG A;  5EL8 A;  4NHW A;  2WDU A;  3GIX A;  3LQ7 A;  4MZB A;  1YF0 A;  3ZL5 A;  2LRT A;  3DVW A;  2TRC P;  1EV9 A;  5CYY A;  4V1A g;  1ZCP A;  4OCE A;  3W6G A;  2EIO A;  1U3A A;  2I81 A;  2KUC A;  3KZQ A;  1MDI A;  2GZZ A;  4GF0 A;  3TJJ A;  5LCZ A;  1EOH A;  3UBL A;  1JZD A;  3D0Z A;  2I9H A;  3I6A A;  3RBT A;  4MH3 A;  3ZYW A;  2L5L A;  3RPN A;  2M46 A;  3CTG A;  2O89 A;  1NHO A;  1VF2 A;  1WJK A;  3EMP A;  3L4N A;  1YEX A;  1EEM A;  7GSS A;  4JRR A;  5D9T A;  4FYB A;  19GS A;  2NDO A;  4WET A;  2P5R A;  2X64 A;  2CVD A;  2YWO A;  1TK8 B;  2B5Y A;  1F3A A;  3E9J B;  3OR5 A;  1KNG A;  4N11 A;  5KN0 A;  4KGI A;  2H0I A;  5J4U A;  2E0Q A;  1TW9 A;  1TRV A;  4KDX A;  5AIV A;  1K0D A;  3TUE A;  4HI7 A;  3VPT A;  5H5S A;  3JCM L;  3ZFL A;  4IQ1 A;  3E0U A;  4Z7X A;  1SL0 B;  4WR5 A;  6GSY A;  4MPG A;  2LNT A;  3GH9 A;  4MMM A;  1Z7P A;  3UBK A;  1PKZ A;  2A2S A;  3CSJ A;  3VPQ A;  3EU3 A;  4MZW A;  2H71 A;  3KTL A;  4TN8 A;  1WMJ A;  2ON5 A;  4OO5 A;  1S3D A;  4H86 A;  2CQ9 A;  2HSH A;  4Q5N A;  4DEJ A;  2HRN A;  5DAK B;  1VF4 A;  3KD0 A;  1FB0 A;  2B6M A;  3KP8 A;  3ZMK A;  5A5K A;  2OAC A;  4OMV A;  3J7Y b;  3GYK A;  4MPF A;  3IR4 A;  4MF6 A;  5DCH A;  2K8V A;  2AB6 A;  1Q4J A;  2OE0 A;  2GZP A;  5HQP A;  4HS1 A;  3IDV A;  4TXO A;  1THO A;  1GSS A;  1TRS A;  4LMV A;  5J41 A;  3LGC A;  4AJ8 A;  3PH9 A;  2B1K A;  3KXO A;  4O92 A;  2H6Y A;  3F4R A;  3VK9 A;  2AAW A;  3TKR A;  5IPG A;  4K0G A;  4AGS A;  2JAD A;  2V2G A;  1XWC A;  3CMI A;  4GXZ A;  2QGV A;  3EIN A;  4E8H A;  2OKA A;  4HOJ A;  1RW1 A;  4CDO A;  2EIQ A;  3D4T A;  5ECN B;  3HHV A;  1TU8 A;  3IAM 2;  8GSS A;  1HNC A;  3TRX A;  4PNF A;  2H8L A;  1K3O A;  2LJK A;  3DWV A;  9GSS A;  3RPP A;  4N30 A;  2LV3 A;  4PQ1 A;  1QXH A;  1A23 A;  2H76 A;  4TXV A;  4TR3 A;  4YQV A;  2HXK A;  4K0N A;  1BX9 A;  5L71 A;  2A2R A;  1V9W A;  1E2Y A;  4TW5 A;  4EO3 A;  1MTC A;  3HD5 A;  2VCT A;  4RI7 A;  3GTU B;  2H6Z A;  4TRX A;  4OD7 A;  2MMA A;  1HNB A;  3LJR A;  2PMT A;  2M80 A;  1O81 A;  1SJI A;  1ZYE A;  2CZ2 A;  4F0B A;  3GMF A;  4F03 A;  1GNE A;  5ECL B;  2KOK A;  3DML A;  4EDZ A;  4MJA A;  5F8B A;  3HJM A;  1XFL A;  3RHB A;  3GFK A;  1XVQ A;  1JZW A;  3IAS 2;  5A4V A;  2HSY A;  2GLR A;  3TJB A;  4K9Z A;  2DJ0 A;  4IHU A;  1Z6N A;  2LQQ A;  3KH9 A;  4PX1 A;  4G19 A;  3HVX A;  3GN3 A;  5DVB A;  1J08 A;  3GKX A;  1NSW A;  1OC9 B;  2IFQ B;  1GTU A;  4YQM A;  1B9Y C;  2HLS A;  2L6C A;  1TKD B;  1XCC A;  1M2B A;  1UN2 A;  2TRX A;  5CRW A;  1DSB A;  4MF7 A;  2N5A A;  4L8E A;  2FNO A;  2XPE A;  3GX0 A;  2IMI A;  4PXO A;  5ECM B;  4BVY A;  1HNA A;  2NBS A;  5J3R A;  1RK4 A;  4ZIJ A;  5DJM A;  3MSZ A;  1ON4 A;  4MK3 A;  4EUY A;  3H93 A;  3LFL A;  1ERT A;  1FVK A;  1TI3 A;  2H74 A;  2H1B A;  1PKW A;  1W4V A;  1XWG A;  3F8U A;  1ZL9 A;  5GST A;  2RUE A;  4MJC A;  5KN2 A;  2WUL A;  2I3Y A;  3DIE A;  3IRA A;  2B3S A;  1RQM A;  2DJ2 A;  5HR0 A;  2FUG 2;  2A4V A;  1G6Y A;  3VWV A;  4BL7 A;  1XVW A;  4NAX A;  4JE1 A;  1R26 A;  4I6X A;  1T4Z A;  1SJZ A;  3DRN A;  2PBJ A;  1S3C A;  3EYT A;  3D4M A;  5D9X A;  1TU7 A;  4KDY A;  4LA1 A;  1GSF A;  4OWY A;  5DQY A;  3GUR A;  1TJD A;  5C00 A;  1XOB A;  3HZ8 A;  6GSU A;  4XS4 A;  2YV9 A;  2YZH A;  4ML6 A;  3ZML A;  4ECJ A;  5A4U A;  2FLS A;  1J0F A;  3Q74 A;  3HVS A;  4O32 A;  5IQY A;  5DDL A;  4WBR D;  4V2N A;  2X8G A;  2E7P A;  1R5A A;  4HQS A;  1VF3 A;  1A2M A;  1NM3 A;  3FR3 A;  3R2Q A;  4D73 A;  4KUN A;  4WXT A;  3DKS A;  4GSS A;  4J57 E;  5DAK A;  2JSY A;  2EIR A;  1V40 A;  2GSQ A;  4TR0 A;  3GX8 A;  1JZR A;  2DJK A;  1K3Y A;  2PWJ A;  3ERF A;  2GSR A;  1Z3E A;  2WS2 A;  2HNL A;  3FR9 A;  4HJ2 A;  3ISO A;  2H6X A;  11GS A;  3KEB A;  5ABR A;  2C3N A;  1GUL A;  5CO3 A;  1F3B A;  1KBN A;  1SJ6 A;  2MYG A;  3UEM A;  1X5C A;  4LLR A;  3U6V A;  2C0E A;  4OO4 A;  3LWA A;  1SK2 A;  5B6M A;  5IO0 A;  2K9F A;  4E8E A;  4EE0 A;  1GSE A;  1DE1 A;  5E4W A;  2LRN A;  2KP1 A;  4PQI A;  2FD3 A;  2LRC A;  1OYJ A;  2KHP A;  3CTF A;  5G1K A;  4KE3 A;  5D96 A;  4J2F A;  4QQ7 A;  1QUW A;  5D9W A;  3KGK A;  2C8U A;  3O3T A;  4XS6 A;  4L0U A;  3GV1 A;  3S9F A;  2QSI A;  4WF5 A;  4WEY A;  3GKM A;  4RQR A;  3UL3 A;  1ERW A;  2DLX A;  1AAZ A;  3QMX A;  3EE2 A;  3RHC A;  1Z9H A;  2AUV A;  3P8W A;  3GTU A;  4HUA A;  2FA4 A;  5G5F A;  2OJL A;  3BBY A;  3CSI A;  4KSM A;  1GUM A;  4WBJ A;  1ML6 A;  2JSZ A;  1ABA A;  3WYW A;  4AF2 A;  2C1Y A;  4ULX A;  3C1S A;  2OE3 A;  1TTZ A;  4RQX A;  1YZX A;  3QFA C;  2IMD A;  2YJH A;  1URM A;  5ECO B;  1XOA A;  2YOI A;  5IOW A;  1H75 A;  2GT6 A;  4CHS A;  1ERU A;  3HJO A;  3LYK A;  2CA8 A;  2BJX A;  2LNS A;  4MP4 A;  2VLV A;  4MCU A;  2P5Q A;  2WGR A;  2L4C A;  5JCG A;  2DJ3 A;  5J9B A;  1K0B A;  2O8V B;  5HR3 A;  2MMO A;  3MAK A;  4GTU A;  1OC9 A;  2IFQ A;  2IME A;  3F9U A;  2VM1 A;  2EC4 A;  3L9V A;  5LD0 A;  3KMO A;  4IJ3 A;  1X5D A;  1BYE A;  3MDK A;  1DE2 A;  3M9K A;  1JHB A;  3UVH A;  2IL3 A;  5JWO B;  2OA7 A;  1PX7 A;  5G31 A;  1XXU A;  1FVJ A;  2V32 A;  2IMF A;  1T3B A;  2H30 A;  5G1L A;  2OE1 A;  1R4W A;  4JR6 A;  3HCZ A;  3KM6 A;  3IC4 A;  5B8B A;  4Q5R A;  1SEN A;  3FZ5 A;  4FYC A;  4EKZ A;  4WKW A;  1IYI A;  2HI7 A;  5B8A A;  4KDU A;  3VLN A;  4XRA A;  4I5Q A;  2DC5 A;  2PN8 A;  3QAW A;  3QOU A;  1V57 A;  5ECS A;  2FA8 A;  3DXB A;  3ZZX A;  1DBY A;  5H5R A;  4XIH A;  2E2G A;  1TXX A;  2CAI A;  4G9H A;  3F63 A;  6GST A;  2H1A A;  1B8X A;  4JED A;  2XHF A;  4DSQ A;  1OKD A;  3HXS A;  1VGL A;  2C4J A;  1T1V A;  2L6D A;  4LMW A;  4OFM A;  4IW9 A;  2VUP A;  3NIV A;  3RAZ A;  3I9V 2;  4DVC A;  1C72 A;  2F3M A;  1U87 A;  3F4T A;  1YKC A;  5JWQ B;  3M1G A;  3VFI A;  1V2A A;  1WIK A;  5FWG A;  1N2A A;  3QDN A;  1SD9 A;  1JFU A;  4XS4 B;  1YQ1 A;  4HZ2 A;  1U88 A;  2HZF A;  3GST A;  3TGZ A;  4HEA 2;  1KTE A;  4KND A;  2J9H A;  4KX4 A;  4L5O A;  1YY7 A;  1BQ7 A;  2CX4 A;  2Z9S A;  5HFK A;  4ML1 A;  2FWF A;  4PNG A;  3P90 A;  2YCD A;  4D73 B;  2FGX A;  3N9J A;  5IMZ A;  4XS1 A;  3UAR A;  3ZFB A;  2DIZ A;  2F8F A;  2V6K A;  4BA7 A;  1SD8 A;  4O5R A;  4GSN A;  1OC8 A;  1PX6 A;  2E2M A;  1GUK A;  1JLV A;  3BJ5 A;  3F3R A;  3EC3 A;  2VM2 A;  3DD3 A;  4I2U A;  2GDR A;  2PPT A;  2M72 A;  1EGO A;  3KTB A;  3L78 A;  4RUV A;  1I5G A;  3TJK A;  3VWU A;  2C3T A;  2VCQ A;  1O8X A;  2H0G A;  2LKU A;  1YF1 A;  3TKQ A;  5ELA A;  2N5B A;  1AUC A;  3WGE A;  3KCM A;  1J9B A;  3LEF A;  2I1U A;  4GWR A;  4MJB A;  2KP2 A;  4HZ4 A;  4HU7 A;  4K7O A;  2YNX A;  3Q19 A;  1GNW A;  3KJY A;  4JU5 A;  1UC7 A;  1SKR B;  3IOS A;  3VWW A;  4PUR A;  1QFN A;  3BCI A;  1A2L A;  3CXG A;  3FHK A;  3G7I A;  2LJA A;  3GSS A;  4GQF A;  2CX3 A;  1GWC A;  4ILF A;  10GS A;  3GHA A;  2VOC A;  2D2Z A;  3FRC A;  2GQL A;  1A2J A;  3QCP A;  3ZRE A;  2IWT A;  5CRE A;  3KIJ A;  2REM A;  4IEL A;  2K8S A;  1GSD A;  3IE3 A;  3WGX A;  3CYN A;  3VI5 A;  3ME7 A;  2BTO T;  4KAE A;  2WZ9 A;  12GS A;  3HJP A;  2MBT A;  3HA9 A;  4PUF C;  4FIW A;  1OKT A;  3IBH A;  4JBB A;  2IPA A;  3US3 A;  4TKY A;  1FG4 A;  3O6T A;  2LST A;  3CRU A;  3D22 A;  3HDC A;  4EDY A;  1M2D A;  5EPF A;  4ZL9 A;  17GS A;  3WT1 A;  3W8J A;  3WD6 A;  2NVL A;  3Q18 A;  4TR4 A;  2FHE A;  1EZK A;  1V98 A;  2JL4 A;  4YQU A;  1MEK A;  1ZZY A;  1MDK A;  4YH2 A;  1GH2 A;  4L5L A;  1E6B A;  4JR4 A;  2O7K A;  3I43 A;  1WWJ A;  2GZY A;  1ZOF A;  3FKF A;  1HQO A;  4BVX A;  1LJR A;  1O7U A;  3RDW A;  1O6J A;  5JCW A;  4RI6 A;  2PGT A;  2RM6 A;  2MMZ A;  1M2A A;  5CRH A;  1GTB A;  2LQO A;  1X9S B;  1USB A;  1ZMA A;  2JAC A;  4NV5 A;  3O76 A;  4MA9 A;  3M0F A;  2GST A;  3BD2 A;  1X5E A;  1SYX A;  3QR6 A;  4LL1 B;  1UA5 A;  4P3Y B;  1GUH A;  3A2W A;  1Y25 A;  1K0C A;  3ED3 A;  1GSQ A;  1OVN A;  5LNK e;  3TRQ A;  4BWS A;  3EWL A;  1FO5 A;  1GSY A;  4NWY A;  3EVI A;  5D73 A;  4IS0 A;  1Y6E A;  4KCA A;  2L5O A;  2HYX A;  4FH8 A;  2F51 A;  3TDG A;  1U6T A;  3KP9 A;  1K0O A;  5IIZ A;  2G0F A;  2ZUP A;  2L59 A;  4Q5Q A;  3TKS E;  1OE8 A;  2CV4 A;  1OAZ A;  4IBP A;  2GQM A;  4XRD A;  3SBC A;  2WCI A;  2H75 A;  4ECC A;  2V1M A;  4K1F A;  1NW2 A;  4XTS A;  5JWR B;  1YDK A;  4FO5 A;  1R5P A;  5FHI A;  1VRS D;  1B4Q A;  3TOU A;  2WRT A;  2NPB A;  3L0H A;  1Z5Y E;  1ACV A;  1GTA A;  2JZS A;  4ZBD A;  5IMF A;  2R3X A;  3ZLP A;  3FYG A;  3EMX A;  1HD2 A;  5AN1 A;  2R4V A;  2TIR A;  2ALB A;  4HJM A;  1FHE A;  3EUR A;  3C71 A;  4POM A;  3QPM A;  5IM9 A;  1K0M A;  1SK1 A;  5IMD A;  1O85 A;  5DCG A;  2R2J A;  1QGV A;  1TI1 A;  1S3A A;  3L9U A;  3VUR A;  1R7H A;  4J56 E;  3I69 A;  2R37 A;  3F3Q A;  3HKR A;  1XZO A;  2O85 A;  2OBI A;  2YAN A;  5ELG A;  3G9B A;  5D9V A;  4KCE A;  2GGT A;  2RII A;  1AIU A;  3C7M A;  3LYP A;  5GAP D;  6GSS A;  2LEG A;  4N0Z A;  4NXI A;  1B9X C;  1MDJ A;  4TR1 B;  3A3T A;  3F6F A;  2VD1 A;  4ZBA A;  1LBK A;  1PQN A;  3GUS A;  3BCK A;  4GCI A;  3TKP A;  1PGT A;  4BWQ A;  3Q6O A;  2GVP A;  2RLI A;  4ECB A;  1B48 A;  5HFI A;  3FK8 A;  5D93 A;  5AGY A;  5IO2 A;  4POB A;  3C73 A;  5AIX A;  1AQV A;  1PA3 A;  3MWH A;  3HVV A;  1WOU A;  1O8W A;  2DMM A;  1PL2 A;  4IVF A;  4V2L A;  1SKW B;  2HT9 A;  4YAV A;  4N10 A;  5IPH A;  5IOX A;  3ERW A;  5HR2 A;  1F2E A;  2GS3 A;  5ECP B;  4IJI A;  1EOG A;  3TOT A;  2WB9 A;  4WR4 A;  3UVT A;  4ZXG A;  1XW9 A;  1BJX A;  5INY A;  5F07 A;  2YWI A;  4GST A;  2C3Q A;  5ID2 B;  2VO4 A;  2X8C A;  1XPV A;  3KMN A;  5J9C A;  22GS A;  2FWE A;  2L4Q A;  3ME8 A;  1M7T A;  1G0T A;  4X0X A;  1GLP A;  2JU5 A;  1G7E A;  2K6V A;  2CVB A;  2VD0 A;  2CZ3 A;  4MJE A;  1EWX A;  3FY7 A;  6GSX A;  4ISD A;  1PN9 A;  5AIS A;  1DUG A;  1NHY A;  3FW2 A;  1WP0 A;  5GZZ B;  4ZL8 A;  4ZB6 A;  1T8E B;  2MBS A;  6GSW A;  4MDC A;  4PUA A;  2DSA A;  3DGQ A;  2HZE B;  1N8J A;  4GLT A;  2LTK A;  3GKN A;  1GTI A;  16GS A;  2IJY A;  2QKE A;  4POL A;  4K7N A;  1U3I A;  2H72 A;  5HFG A;  3C8E A;  1WPI A;  1M9B A;  1X0R A;  2KLX A;  3VI7 A;  1K0A A;  1HYU A;  2B7J A;  4F2I A;  2LUS A;  1AC1 A;  3N5O A;  1OC3 A;  4PQH A;  3GRX A;  1TRU A;  5FT3 A;  3NZN A;  4IQA A;  3D6I A;  1T00 A;  3IK7 A;  4AJ7 A;  5JCU A;  2AYT A;  2DIY A;  2WJU A;  2YPM A;  4EVM A;  3A2X A;  4JZQ A;  1EGR A;  4KH7 A;  3QAV A;  5A4W A;  2MMN A;  1MD4 A;  5ECR B;  2H19 A;  5F05 A;  1W89 A;  3LSZ A;  3P2A A;  3G7J A;  5B6N A;  1XWA A;  4F9Z A;  1AQW A;  6GSV A;  2DJ1 A;  3HZ4 A;  1M0U A;  1Q98 A;  2P31 A;  3PIN A;  3E3E A;  3M8N A;  4BPY A;  3LXZ A;  3CSH A;  1ST9 A;  1BAY A;  2FY6 A;  2VLU A;  1FAA A;  4EF0 A;  3LG6 A;  3D5J A;  3U5R E;  1V58 A;  5G30 A;  4IP6 A;  2C80 A;  5F0G A;  4WF4 A;  3GL3 A;  2DBC A;  1H4O A;  4G2E A;  1SU9 A;  1EP7 A;  4IN0 A;  2RM5 A;  4N0V A;  2B7K A;  1OE7 A;  1VF1 A;  3M9J A;  4ACS A;  2PUK C;  3P7X A;  3HYP A;  5KEJ A;  2XC2 A;  3IHQ A;  5C04 A;  4MH2 A;  4HDE A;  3UJ1 A;  3APS A;  4IP1 A;  4GRF A;  3IA1 A;  3QD9 A;  4EL1 A;  3C1R A;  3TRP A;  5ECH B;  1TOF A;  1AQX A;  3G7Y A;  2VL2 A;  13GS A;  5ECK B;  2YN1 A;  3J7Y k;  4O7H A;  5DAL B;  1O73 A;  2FWG A;  4OFT A;  4XHM A;  4TR1 A;  1ILO A;  1CQH A;  1GRX A;  2H01 A;  1PRX A;  4I8B A;  1XIY A;  1G6W A;  1T7P B;  2VCX A;  4KB3 A;  2JZR A;  3TJF A;  2JZT A;  2HE3 A;  4NMU A;  2PVQ A;  1A8L A;  4MLY A;  5ENU A;  5GSS A;  5B7C A;  3ZIT A;  4K2D A;  3W8S A;  3GKK A;  2V41 A;  2YWM A;  3APQ A;  2VAF A;  2PER A;  2PU9 C;  3H1N A;  3IV4 A;  3FEU A;  2HRF A;  1FW1 A;  3A2V A;  2C0G A;  2X99 A;  1T4Y A;  3LXT A;  4NHZ A;  3H8Q A;  2V6O A;  2H1D A;  3ERG A;  2N5F A;  4PGT A;  1PL1 A;  3TCO A;  4K7I A;  2B1L A;  2ZNM A;  4V1A p;  2GSS A;  1TK5 B;  2R5G A;  1AXD A;  1ERV A;  2GTU A;  2L57 A;  1ZYQ B;  3F0I A;  4FYU A;  5H5Q A;  5ID2 A;  3QAG A;  2VIM A;  1SL2 B;  3A5W A;  4V2M A;  4DSS B;  3BOA A;  3TJG A;  1GSU A;  4NPB A;  3H4K A;  1X9W B;  2YV7 A;  1JLW A;  4NV2 A;  2NTO A;  1PMT A;  3APO A;  2DML A;  4IGJ A;  4OFN A;  1F37 A;  1FB6 A;  1GL8 A;  4ZIL A;  5KN3 A;  1A0R P;  5F06 A;  1ZGN A;  4ZB9 A;  2VL3 A;  1QMV A;  4POK A;  3TKS A;  4KW6 A;  4EC0 A;  1BG5 A;  2HZE A;  2YZU A;  2AHE A;  5CRD A;  3TB2 A;  1SYR A;  4QL9 A;  1X9M B;  2CT6 A;  2F9S A;  2F8A A;  4KA0 A;  2XBQ A;  5GAN D;  3SWL A;  2PVO C;  3EU4 A;  2LS5 A;  2DJJ A;  2H1G A;  5CAX A;  2ON7 A;  4F82 A;  2RUF A;  2B5X A;  2AV4 A;  4G10 A;  4ECI A;  2IN3 A;  2QC7 A;  2VCZ A;  5DJL A;  1AW9 A;  5DBQ A;  3ZTL A;  2K18 A;  2WFC A;  1YJ6 A;  2VCV A;  3GL5 A;  4KSO A;  1F6M C;  2CAQ A;  3ZVJ A;  4X1U A;  1QK8 A;  4L0W A;  4MF5 A;  5D8I A;  4EXJ A;  1Z7R A;  2VLT A;  2FCH A;  1TK0 B;  2ZCT A;  1TDI A;  4K8M A;  2H73 A;  3AY8 A;  1A24 A;  1GP1 A;  4MAB A;  3V1W A;  5EY6 A;  1FOV A;  3ZRD A;  4I2T A;  4ID0 A;  3UAP A;  1XWB A;  1K0N A;  2IIY A;  2O87 A;  5E59 A;  1JZO A;  4LL4 B;  5ECI B;  2LJR A;  2YP6 A;  5DQS A;  1GLQ A;  3M3M A;  1YKA A;  3GNJ A;  3WGD A;  4ZB8 A;  3IK9 A;  3F4S A;  1XW5 A;  3CBU A;  1G7O A;  3IPZ A;  2X8H A;  2G2Q A;  1YEP A;  1WE0 A;  2B5E A;  3K8N A;  4K6X A;  1TP9 A;  1EP8 A;  1M9A A;  4Q5F A;  3MNG A;  1A0F A;  1K3L A;  2I4A A;  1WRY A;  4QL7 A;  1SK0 A;  2VL2 C;  4F0C A;  18GS A;  2ES7 A;  5CP1 A;  3CRT A;  3PGT A;  3ZIV A;  3DEX A;  14GS A;  1MD3 A;  4YAP A;  4TXO B;  5IMA A;  1XBS A;  1TRW A;  5DAL A;  3ZIJ A;  4XCS A;  2GT5 A;  2YJ7 A;  3DVX A;  1IYH A;  1EV4 A;  20GS A;  2H66 A;  2OBK A;  5IMV A;  2H0H A; 
#chains in the Genus database with same CATH topology
 3UOM A;  1M99 A;  2R6K A;  4CW9 A;  1EEJ A;  3QFB C;  2MZC A;  1Z6M A;  2XPD A;  1XWK A;  2GQK A;  3ZVJ D;  2FWH A;  4OCF A;  3F6D A;  5HR1 A;  1CQG A;  1F9M A;  3NOF A;  2HFD A;  2YWN A;  3IXR A;  2XBI A;  4HU9 A;  5CNW A;  4ZL7 A;  5KN1 A;  1THX A;  5G5E A;  2VL9 A;  2C0D A;  2BMX A;  1LU4 A;  3DYR A;  2OAD A;  4DSR A;  2CVK A;  3FR6 A;  4I97 A;  1KEB A;  3UIW A;  2AJQ B;  3HY2 A;  3GA4 A;  2VCW A;  1PSQ A;  4MZC A;  2C0F A;  3WT2 A;  3UMA A;  3FZ9 A;  1SL1 B;  4TVE A;  4ZBB A;  1PD2 1;  5J5N A;  3L9S A;  4DSS A;  3VWX A;  3KH7 A;  4HQZ A;  1B4P A;  2P0G A;  2J23 A;  4X43 A;  5ECQ B;  1UVZ A;  3GH6 A;  3PR8 A;  2H70 A;  3FZA A;  4GQC A;  4AJ6 A;  1XW6 A;  3FZ4 A;  4IKH A;  2IMK A;  1BED A;  4CY8 A;  3LOR A;  3D21 A;  1SKS B;  1QQ2 A;  5COH A;  5IMC A;  5G2Z A;  3H79 A;  1A8Y A;  1I9D A;  4TOP A;  3TKS C;  5EVO A;  5CRG A;  5EL8 A;  4NHW A;  2WDU A;  3GIX A;  3LQ7 A;  4MZB A;  1YF0 A;  3ZL5 A;  2LRT A;  3DVW A;  2TRC P;  1EV9 A;  2HRA A;  4V1A g;  5CYY A;  1ZCP A;  4OCE A;  3W6G A;  2EIO A;  1U3A A;  2I81 A;  2KUC A;  3KZQ A;  1MDI A;  2GZZ A;  4GF0 A;  3TJJ A;  5LCZ A;  1EOH A;  3UBL A;  1JZD A;  3D0Z A;  2I9H A;  3I6A A;  3RBT A;  4MH3 A;  1S3R A;  4BVY B;  3ZYW A;  2L5L A;  3RPN A;  2M46 A;  3CTG A;  2O89 A;  1NHO A;  1VF2 A;  1WJK A;  3EMP A;  3L4N A;  1YEX A;  1EEM A;  7GSS A;  4JRR A;  5D9T A;  4FYB A;  19GS A;  2NDO A;  4WET A;  2P5R A;  2X64 A;  2CVD A;  3A5I A;  2YWO A;  1TK8 B;  2B5Y A;  4BL7 B;  1F3A A;  3E9J B;  3OR5 A;  1KNG A;  4N11 A;  5KN0 A;  5KOX A;  4KGI A;  2H0I A;  5J4U A;  2QA2 A;  2E0Q A;  1TW9 A;  1TRV A;  4KDX A;  5AIV A;  1K0D A;  3FMW A;  3TUE A;  4HI7 A;  3VPT A;  5H5S A;  3JCM L;  3ZFL A;  4IQ1 A;  3E0U A;  4Z7X A;  1SL0 B;  4WR5 A;  6GSY A;  4MPG A;  4Z2T A;  2LNT A;  3GH9 A;  4MMM A;  1Z7P A;  3UBK A;  1PKZ A;  2A2S A;  3CSJ A;  3VPQ A;  3EU3 A;  4MZW A;  2H71 A;  3KTL A;  4TN8 A;  1WMJ A;  2ON5 A;  4OO5 A;  1S3D A;  2A4H A;  4H86 A;  2CQ9 A;  2HSH A;  4Q5N A;  4DEJ A;  2HRN A;  5DAK B;  1VF4 A;  3KD0 A;  1FB0 A;  2B6M A;  3KP8 A;  3ZMK A;  5A5K A;  2OAC A;  4OMV A;  3HVN A;  3J7Y b;  3GYK A;  4MPF A;  3IR4 A;  4MF6 A;  5DCH A;  2K8V A;  4USS A;  2AB6 A;  1Q4J A;  2OE0 A;  2GZP A;  5HQP A;  4HS1 A;  3IDV A;  4TXO A;  1THO A;  1GSS A;  1TRS A;  4LMV A;  5J41 A;  3LGC A;  4AJ8 A;  3PH9 A;  2B1K A;  3KXO A;  4O92 A;  2H6Y A;  3F4R A;  3VK9 A;  2AAW A;  3TKR A;  3CQF A;  5IPG A;  4K0G A;  4AGS A;  2JAD A;  2R0C A;  2V2G A;  1XWC A;  4MNN A;  3CMI A;  4GXZ A;  2QGV A;  3EIN A;  4E8H A;  2OKA A;  4HOJ A;  1RW1 A;  4CDO A;  2EIQ A;  3D4T A;  3HHV A;  1TU8 A;  3IAM 2;  5ECN B;  8GSS A;  1HNC A;  3TRX A;  4PNF A;  2H8L A;  1K3O A;  2LJK A;  3DWV A;  9GSS A;  3RPP A;  4N30 A;  2X49 A;  2LV3 A;  4PQ1 A;  1QXH A;  1A23 A;  2H76 A;  4TXV A;  4TR3 A;  4YQV A;  2HXK A;  4K0N A;  1BX9 A;  5L71 A;  2A2R A;  1V9W A;  1E2Y A;  4TW5 A;  4EO3 A;  1MTC A;  3HD5 A;  2VCT A;  4RI7 A;  3GTU B;  2H6Z A;  4TRX A;  4OD7 A;  2MMA A;  1HNB A;  3LJR A;  2PMT A;  2M80 A;  1O81 A;  1SJI A;  1ZYE A;  2CZ2 A;  4F0B A;  3GMF A;  4F03 A;  1GNE A;  5ECL B;  2KOK A;  3DML A;  4EDZ A;  4MJA A;  5F8B A;  3HJM A;  1XFL A;  3RHB A;  3GFK A;  1XVQ A;  1JZW A;  3IAS 2;  5A4V A;  2HSY A;  2GLR A;  3TJB A;  4K9Z A;  2DJ0 A;  4IHU A;  1Z6N A;  2LQQ A;  3KH9 A;  4PX1 A;  4G19 A;  3HVX A;  1PN0 A;  2UZ8 A;  3GN3 A;  5DVB A;  1J08 A;  3GKX A;  1NSW A;  1OC9 B;  2IFQ B;  1GTU A;  4YQM A;  1B9Y C;  2HLS A;  2L6C A;  1TKD B;  1XCC A;  1M2B A;  2R0P A;  1UN2 A;  2TRX A;  5CRW A;  1DSB A;  4MF7 A;  2N5A A;  4L8E A;  2FNO A;  2XPE A;  3GX0 A;  2IMI A;  4PXO A;  5ECM B;  4BVY A;  1HNA A;  2NBS A;  2R0G A;  5J3R A;  1RK4 A;  4ZIJ A;  5DJM A;  3MSZ A;  1ON4 A;  4MK3 A;  4EUY A;  3H93 A;  3LFL A;  1ERT A;  1FVK A;  1TI3 A;  2H74 A;  2H1B A;  1PKW A;  1W4V A;  1XWG A;  3F8U A;  1ZL9 A;  5GST A;  2RUE A;  4MJC A;  5KN2 A;  2WUL A;  2I3Y A;  3DIE A;  3IRA A;  2B3S A;  1RQM A;  2DJ2 A;  5HR0 A;  2FUG 2;  2A4V A;  1G6Y A;  1M3I A;  3VWV A;  4BL7 A;  1XVW A;  4NAX A;  4JE1 A;  1R26 A;  4G0L A;  4I6X A;  1T4Z A;  1SJZ A;  2QA1 A;  3DRN A;  2PBJ A;  1S3C A;  3EYT A;  3D4M A;  5D9X A;  1TU7 A;  4KDY A;  4LA1 A;  1GSF A;  4OWY A;  4PTS A;  5DQY A;  3GUR A;  1TJD A;  5C00 A;  1XOB A;  3HZ8 A;  6GSU A;  4XS4 A;  2YV9 A;  2YZH A;  4ML6 A;  3ZML A;  4ECJ A;  5A4U A;  2FLS A;  1J0F A;  3Q74 A;  3HVS A;  4O32 A;  5IQY A;  5DDL A;  4WBR D;  4V2N A;  2X8G A;  2E7P A;  3EPT A;  1R5A A;  4HQS A;  1VF3 A;  1A2M A;  1NM3 A;  3FR3 A;  3R2Q A;  4D73 A;  4KUN A;  4WXT A;  3DKS A;  4GSS A;  4J57 E;  5DAK A;  2JSY A;  2EIR A;  1V40 A;  2GSQ A;  4TR0 A;  3GX8 A;  1JZR A;  2DJK A;  1K3Y A;  2PWJ A;  3ERF A;  2GSR A;  1Z3E A;  2WS2 A;  2HNL A;  3FR9 A;  2A2P A;  4HJ2 A;  3ISO A;  2H6X A;  11GS A;  3KEB A;  5ABR A;  2C3N A;  1GUL A;  5CO3 A;  1F3B A;  1KBN A;  1SJ6 A;  2MYG A;  3UEM A;  1X5C A;  4LLR A;  3U6V A;  2C0E A;  4OO4 A;  3LWA A;  1SK2 A;  4O5U A;  5B6M A;  4HSC X;  5IO0 A;  2K9F A;  4E8E A;  4EE0 A;  1GSE A;  1DE1 A;  5E4W A;  2LRN A;  2KP1 A;  4PQI A;  2FD3 A;  2LRC A;  1OYJ A;  2KHP A;  3CTF A;  5G1K A;  4KE3 A;  1PFO A;  5D96 A;  4J2F A;  4QQ7 A;  1QUW A;  5D9W A;  3KGK A;  2C8U A;  3O3T A;  4XS6 A;  4L0U A;  3GV1 A;  3S9F A;  3IC8 A;  2QSI A;  4WF5 A;  4WEY A;  3GKM A;  4RQR A;  3UL3 A;  1ERW A;  2DLX A;  1AAZ A;  3QMX A;  3EE2 A;  3RHC A;  1Z9H A;  2AUV A;  3P8W A;  3GTU A;  4HUA A;  2FA4 A;  5G5F A;  2OJL A;  3BBY A;  3CSI A;  4KSM A;  1GUM A;  4WBJ A;  1ML6 A;  2JSZ A;  1ABA A;  3WYW A;  4AF2 A;  2C1Y A;  4ULX A;  3C1S A;  2OE3 A;  1TTZ A;  4RQX A;  4Z2R A;  1YZX A;  3QFA C;  2IMD A;  2YJH A;  1URM A;  5ECO B;  1XOA A;  2YOI A;  5IOW A;  1ZYN A;  1H75 A;  4G0K A;  2GT6 A;  4CHS A;  1ERU A;  3HJO A;  3LYK A;  2CA8 A;  2BJX A;  2LNS A;  4MP4 A;  2VLV A;  4MCU A;  2P5Q A;  2WGR A;  2L4C A;  5JCG A;  2DJ3 A;  5J9B A;  1K0B A;  2O8V B;  5HR3 A;  2MMO A;  3MAK A;  4GTU A;  1OC9 A;  2IFQ A;  2IME A;  3F9U A;  2VM1 A;  2EC4 A;  3L9V A;  5LD0 A;  3KMO A;  4IJ3 A;  1X5D A;  1BYE A;  3MDK A;  1DE2 A;  3R3E A;  3M9K A;  1JHB A;  3UVH A;  4G0I A;  2IL3 A;  5JWO B;  2OA7 A;  1PX7 A;  5G31 A;  4BVX B;  1XXU A;  1FVJ A;  2V32 A;  2IMF A;  1T3B A;  2H30 A;  5G1L A;  2OE1 A;  1R4W A;  4JR6 A;  3HCZ A;  3KM6 A;  3IC4 A;  5B8B A;  4Q5R A;  1SEN A;  3FZ5 A;  4FYC A;  4EKZ A;  4WKW A;  1IYI A;  2HI7 A;  4K2X A;  5B8A A;  4KDU A;  3VLN A;  4XRA A;  4I5Q A;  2DC5 A;  2PN8 A;  3QAW A;  3QOU A;  1V57 A;  5ECS A;  2FA8 A;  3DXB A;  3ZZX A;  1DBY A;  5H5R A;  4XIH A;  2E2G A;  1TXX A;  2CAI A;  4G9H A;  3F63 A;  6GST A;  2H1A A;  1B8X A;  4JED A;  2XHF A;  4DSQ A;  1OKD A;  3HXS A;  1VGL A;  2C4J A;  1T1V A;  2L6D A;  4LMW A;  1FOH A;  4OFM A;  4IW9 A;  2VUP A;  3NIV A;  3RAZ A;  3I9V 2;  4DVC A;  1C72 A;  2F3M A;  1U87 A;  3F4T A;  1YKC A;  5JWQ B;  3M1G A;  3VFI A;  1V2A A;  1WIK A;  5FWG A;  1N2A A;  3QDN A;  1SD9 A;  1JFU A;  4XS4 B;  1YQ1 A;  4HZ2 A;  1U88 A;  2HZF A;  3GST A;  3TGZ A;  4HEA 2;  1KTE A;  4KND A;  2J9H A;  4KX4 A;  4L5O A;  1YY7 A;  1BQ7 A;  2CX4 A;  2Z9S A;  5HFK A;  4ML1 A;  2FWF A;  4PNG A;  3P90 A;  2YCD A;  4D73 B;  2FGX A;  3N9J A;  5IMZ A;  4XS1 A;  3UAR A;  3ZFB A;  2DIZ A;  2F8F A;  2V6K A;  4BA7 A;  1SD8 A;  4O5R A;  4GSN A;  1OC8 A;  1PX6 A;  2E2M A;  1GUK A;  1JLV A;  3BJ5 A;  3F3R A;  3EC3 A;  2VM2 A;  3DD3 A;  4I2U A;  2GDR A;  2HSM A;  2PPT A;  2M72 A;  1EGO A;  3KTB A;  3L78 A;  4RUV A;  1I5G A;  3TJK A;  3VWU A;  2C3T A;  2VCQ A;  1O8X A;  2H0G A;  2LKU A;  1YF1 A;  3TKQ A;  5ELA A;  2N5B A;  1AUC A;  3WGE A;  3KCM A;  1J9B A;  4CY6 A;  3LEF A;  2I1U A;  4GWR A;  4MJB A;  2KP2 A;  4HZ4 A;  4HU7 A;  4K7O A;  2YNX A;  3Q19 A;  1GNW A;  3KJY A;  4JU5 A;  1UC7 A;  1SKR B;  3IOS A;  3VWW A;  4PUR A;  1QFN A;  3BCI A;  1A2L A;  3CXG A;  3FHK A;  3G7I A;  2LJA A;  3GSS A;  4GQF A;  2CX3 A;  1GWC A;  4ILF A;  10GS A;  3GHA A;  2VOC A;  2D2Z A;  3FRC A;  2GQL A;  1A2J A;  3QCP A;  3ZRE A;  2IWT A;  5CRE A;  3KIJ A;  2REM A;  4IEL A;  2K8S A;  1GSD A;  3IE3 A;  3WGX A;  3CYN A;  3VI5 A;  3ME7 A;  2BTO T;  4KAE A;  2WZ9 A;  12GS A;  3HJP A;  2MBT A;  3HA9 A;  4PUF C;  4FIW A;  1OKT A;  3IBH A;  4JBB A;  2IPA A;  3US3 A;  4TKY A;  1FG4 A;  3O6T A;  2LST A;  3CRU A;  3D22 A;  3HDC A;  4EDY A;  1M2D A;  5EPF A;  4ZL9 A;  17GS A;  3WT1 A;  3W8J A;  3WD6 A;  2NVL A;  3Q18 A;  4TR4 A;  2FHE A;  1EZK A;  1V98 A;  2JL4 A;  4YQU A;  1MEK A;  1ZZY A;  1MDK A;  4YH2 A;  1GH2 A;  4L5L A;  1E6B A;  4JR4 A;  2O7K A;  3I43 A;  1WWJ A;  2GZY A;  1ZOF A;  3FKF A;  1HQO A;  4BVX A;  1LJR A;  1O7U A;  3RDW A;  1O6J A;  5JCW A;  4RI6 A;  2PGT A;  2RM6 A;  2MMZ A;  1M2A A;  5CRH A;  1GTB A;  2LQO A;  1X9S B;  1USB A;  1ZMA A;  2JAC A;  4NV5 A;  3O76 A;  4MA9 A;  3M0F A;  2GST A;  3BD2 A;  1X5E A;  1SYX A;  3QR6 A;  4LL1 B;  1UA5 A;  4P3Y B;  1GUH A;  3A2W A;  1Y25 A;  1K0C A;  3ED3 A;  1GSQ A;  1OVN A;  5LNK e;  3TRQ A;  4BWS A;  3EWL A;  1FO5 A;  1GSY A;  4NWY A;  3EVI A;  5D73 A;  4IS0 A;  1Y6E A;  4KCA A;  2L5O A;  2HYX A;  4Z2U A;  4FH8 A;  2F51 A;  3TDG A;  1U6T A;  3KP9 A;  1K0O A;  5IIZ A;  2G0F A;  2ZUP A;  2L59 A;  4Q5Q A;  3TKS E;  1OE8 A;  2CV4 A;  1OAZ A;  4IBP A;  2GQM A;  4XRD A;  3SBC A;  2WCI A;  2H75 A;  4ECC A;  2V1M A;  4K1F A;  1NW2 A;  4XTS A;  5JWR B;  1YDK A;  4FO5 A;  1R5P A;  5FHI A;  1VRS D;  1B4Q A;  3TOU A;  2WRT A;  2NPB A;  3L0H A;  1Z5Y E;  1ACV A;  1GTA A;  2JZS A;  4ZBD A;  5IMF A;  2R3X A;  3ZLP A;  3FYG A;  3EMX A;  1HD2 A;  5AN1 A;  2R4V A;  2TIR A;  2ALB A;  4HJM A;  1FHE A;  3EUR A;  3C71 A;  4POM A;  3QPM A;  5IM9 A;  1K0M A;  1SK1 A;  5IMD A;  1O85 A;  5DCG A;  4BIK A;  2R2J A;  1QGV A;  1TI1 A;  1S3A A;  3L9U A;  3VUR A;  1R7H A;  4J56 E;  3I69 A;  2R37 A;  3F3Q A;  3HKR A;  1XZO A;  2O85 A;  2OBI A;  2YAN A;  5ELG A;  3G9B A;  5D9V A;  4KCE A;  2GGT A;  2RII A;  1AIU A;  3C7M A;  3LYP A;  3MIX A;  4YKG A;  5GAP D;  6GSS A;  2LEG A;  4N0Z A;  4NXI A;  1B9X C;  4TR1 B;  1MDJ A;  3A3T A;  3F6F A;  2VD1 A;  4ZBA A;  1LBK A;  1PQN A;  3IHG A;  3GUS A;  3BCK A;  4GCI A;  3TKP A;  1PGT A;  4BWQ A;  4EIQ A;  3Q6O A;  2GVP A;  2RLI A;  4ECB A;  1B48 A;  5HFI A;  3FK8 A;  5D93 A;  2DKI A;  5AGY A;  5IO2 A;  4POB A;  3C73 A;  5AIX A;  1AQV A;  1PA3 A;  3MWH A;  3HVV A;  1WOU A;  1O8W A;  2DMM A;  1PL2 A;  4IVF A;  4V2L A;  1SKW B;  2HT9 A;  4YAV A;  4N10 A;  5IPH A;  5IOX A;  3ERW A;  5HR2 A;  1F2E A;  2GS3 A;  5ECP B;  4IJI A;  1EOG A;  3TOT A;  2WB9 A;  4WR4 A;  2HRK A;  3UVT A;  4ZXG A;  1XW9 A;  1BJX A;  5INY A;  5F07 A;  2YWI A;  4GST A;  2C3Q A;  5ID2 B;  2VO4 A;  2X8C A;  1XPV A;  3KMN A;  5J9C A;  22GS A;  1ZYP A;  2FWE A;  2L4Q A;  3ME8 A;  4K5S A;  1M7T A;  1G0T A;  4X0X A;  3LW9 A;  1GLP A;  2JU5 A;  1G7E A;  2K6V A;  2CVB A;  2VD0 A;  2CZ3 A;  4MJE A;  1EWX A;  4EIP A;  3FY7 A;  6GSX A;  4ISD A;  1PN9 A;  5AIS A;  1DUG A;  1NHY A;  3FW2 A;  1WP0 A;  5GZZ B;  4ZL8 A;  4ZB6 A;  1T8E B;  2MBS A;  6GSW A;  4MDC A;  4PUA A;  2DSA A;  3DGQ A;  2HZE B;  1N8J A;  4GLT A;  2LTK A;  3GKN A;  1GTI A;  16GS A;  2IJY A;  2QKE A;  4POL A;  4K7N A;  1U3I A;  2H72 A;  5HFG A;  3C8E A;  5KOW A;  1WPI A;  1M9B A;  1X0R A;  4X4J A;  2KLX A;  3VI7 A;  1K0A A;  1HYU A;  2B7J A;  4F2I A;  2LUS A;  1AC1 A;  4ICY A;  3N5O A;  1OC3 A;  4PQH A;  3GRX A;  1TRU A;  5FT3 A;  3NZN A;  4IQA A;  3D6I A;  2DKH A;  1T00 A;  3IK7 A;  5BRT A;  4AJ7 A;  5JCU A;  2AYT A;  2DIY A;  2WJU A;  2YPM A;  4EVM A;  3A2X A;  4JZQ A;  1EGR A;  4KH7 A;  3QAV A;  5A4W A;  2MMN A;  1MD4 A;  5ECR B;  2H19 A;  5F05 A;  1W89 A;  3LSZ A;  3P2A A;  3G7J A;  5B6N A;  1XWA A;  4F9Z A;  1AQW A;  6GSV A;  2DJ1 A;  3HZ4 A;  1M0U A;  1Q98 A;  2P31 A;  3PIN A;  3E3E A;  3M8N A;  4BPY A;  3LXZ A;  3CSH A;  1ST9 A;  1BAY A;  5BMU A;  2FY6 A;  2VLU A;  1FAA A;  4EF0 A;  3LG6 A;  3D5J A;  3U5R E;  1V58 A;  5G30 A;  4IP6 A;  2C80 A;  5F0G A;  4WF4 A;  3GL3 A;  2DBC A;  1H4O A;  4G2E A;  1SU9 A;  1EP7 A;  4IN0 A;  2RM5 A;  4N0V A;  2B7K A;  1OE7 A;  1VF1 A;  3M9J A;  4ACS A;  2PUK C;  3P7X A;  3HYP A;  5KEJ A;  2XC2 A;  3IHQ A;  5C04 A;  4MH2 A;  4HDE A;  3UJ1 A;  3APS A;  4IP1 A;  4GRF A;  3IA1 A;  3QD9 A;  4EL1 A;  3C1R A;  3TRP A;  5ECH B;  1TOF A;  1AQX A;  3G7Y A;  2VL2 A;  13GS A;  5ECK B;  2YN1 A;  3J7Y k;  4O7H A;  5DAL B;  1O73 A;  2FWG A;  4OFT A;  4XHM A;  4TR1 A;  1ILO A;  1CQH A;  1GRX A;  2H01 A;  1PRX A;  4I8B A;  1XIY A;  1G6W A;  1T7P B;  2VCX A;  4KB3 A;  2JZR A;  3TJF A;  2JZT A;  2HE3 A;  4NMU A;  2PVQ A;  1A8L A;  4MLY A;  5ENU A;  5GSS A;  5B7C A;  3ZIT A;  4K2D A;  3W8S A;  3GKK A;  2V41 A;  2YWM A;  3APQ A;  2VAF A;  2PER A;  2PU9 C;  3H1N A;  3IV4 A;  3FEU A;  2HRF A;  1FW1 A;  4K5R A;  3A2V A;  2C0G A;  2X99 A;  1T4Y A;  3LXT A;  4NHZ A;  3H8Q A;  2V6O A;  2H1D A;  3ERG A;  2N5F A;  4PGT A;  1PL1 A;  3TCO A;  4K7I A;  2B1L A;  2ZNM A;  4V1A p;  2GSS A;  1TK5 B;  2R5G A;  1AXD A;  1ERV A;  2GTU A;  2L57 A;  1ZYQ B;  4FQU A;  3F0I A;  4FYU A;  5H5Q A;  5ID2 A;  3QAG A;  2VIM A;  1SL2 B;  3A5W A;  4V2M A;  4DSS B;  3BOA A;  3TJG A;  1GSU A;  4NPB A;  3H4K A;  1X9W B;  2YV7 A;  1JLW A;  4NV2 A;  2NTO A;  1PMT A;  3APO A;  2DML A;  4IGJ A;  4OFN A;  1F37 A;  1FB6 A;  1GL8 A;  4ZIL A;  5KN3 A;  1A0R P;  5F06 A;  3MYD A;  1ZGN A;  4ZB9 A;  2VL3 A;  1QMV A;  4POK A;  3TKS A;  4KW6 A;  4EC0 A;  1BG5 A;  2HZE A;  2YZU A;  2AHE A;  5CRD A;  3TB2 A;  1SYR A;  4QL9 A;  1X9M B;  2CT6 A;  2F9S A;  2F8A A;  4KA0 A;  2XBQ A;  5GAN D;  3SWL A;  2PVO C;  3EU4 A;  2LS5 A;  2DJJ A;  2H1G A;  5CAX A;  2ON7 A;  4F82 A;  2RUF A;  2B5X A;  2AV4 A;  4G10 A;  4ECI A;  2IN3 A;  2QC7 A;  2VCZ A;  5DJL A;  1AW9 A;  5DBQ A;  3ZTL A;  2K18 A;  4A5P A;  2X4A A;  2WFC A;  1YJ6 A;  2VCV A;  3GL5 A;  4KSO A;  1F6M C;  2CAQ A;  3ZVJ A;  4X1U A;  1QK8 A;  4L0W A;  4MF5 A;  5D8I A;  4EXJ A;  1Z7R A;  2VLT A;  2FCH A;  1TK0 B;  2ZCT A;  1TDI A;  4K8M A;  2H73 A;  3AY8 A;  1A24 A;  1GP1 A;  4MAB A;  3V1W A;  5EY6 A;  1FOV A;  3ZRD A;  4I2T A;  4ID0 A;  3UAP A;  1XWB A;  1K0N A;  4YKF A;  2IIY A;  2O87 A;  5E59 A;  1JZO A;  4LL4 B;  5ECI B;  2LJR A;  2YP6 A;  5DQS A;  1GLQ A;  3M3M A;  1YKA A;  3GNJ A;  3WGD A;  4ZB8 A;  3IK9 A;  3F4S A;  1XW5 A;  3CBU A;  1G7O A;  3IPZ A;  2X8H A;  4KF9 A;  2G2Q A;  1YEP A;  1WE0 A;  2B5E A;  3K8N A;  4K6X A;  1TP9 A;  1M3J A;  1EP8 A;  1M9A A;  1XG8 A;  4Q5F A;  3MNG A;  1A0F A;  1K3L A;  2I4A A;  1WRY A;  4QL7 A;  1SK0 A;  2VL2 C;  4F0C A;  18GS A;  2ES7 A;  5CP1 A;  3CRT A;  3PGT A;  3ZIV A;  3DEX A;  14GS A;  1MD3 A;  3PPU A;  4YAP A;  4TXO B;  5IMA A;  1XBS A;  1TRW A;  5DAL A;  3ZIJ A;  4XCS A;  2GT5 A;  2YJ7 A;  4O5Q A;  3DVX A;  1IYH A;  1EV4 A;  20GS A;  2H66 A;  2OBK A;  5IMV A;  2H0H A; 
#chains in the Genus database with same CATH homology
 3UOM A;  1M99 A;  2R6K A;  4CW9 A;  1EEJ A;  3QFB C;  2MZC A;  1Z6M A;  2XPD A;  1XWK A;  2GQK A;  3ZVJ D;  2FWH A;  4OCF A;  3F6D A;  5HR1 A;  1CQG A;  1F9M A;  3NOF A;  2HFD A;  2YWN A;  3IXR A;  2XBI A;  4HU9 A;  5CNW A;  4ZL7 A;  5KN1 A;  1THX A;  5G5E A;  2VL9 A;  2C0D A;  2BMX A;  1LU4 A;  3DYR A;  2OAD A;  4DSR A;  2CVK A;  3FR6 A;  4I97 A;  1KEB A;  3UIW A;  2AJQ B;  3HY2 A;  3GA4 A;  2VCW A;  1PSQ A;  4MZC A;  2C0F A;  3WT2 A;  3UMA A;  3FZ9 A;  1SL1 B;  4TVE A;  4ZBB A;  1PD2 1;  5J5N A;  3L9S A;  4DSS A;  3VWX A;  3KH7 A;  4HQZ A;  1B4P A;  2P0G A;  2J23 A;  4X43 A;  5ECQ B;  1UVZ A;  3GH6 A;  3PR8 A;  2H70 A;  3FZA A;  4GQC A;  4AJ6 A;  1XW6 A;  3FZ4 A;  4IKH A;  2IMK A;  1BED A;  4CY8 A;  3LOR A;  3D21 A;  1SKS B;  1QQ2 A;  5COH A;  5IMC A;  5G2Z A;  3H79 A;  1A8Y A;  1I9D A;  4TOP A;  3TKS C;  5EVO A;  5CRG A;  5EL8 A;  4NHW A;  2WDU A;  3GIX A;  3LQ7 A;  4MZB A;  1YF0 A;  3ZL5 A;  2LRT A;  3DVW A;  2TRC P;  1EV9 A;  2HRA A;  4V1A g;  5CYY A;  1ZCP A;  4OCE A;  3W6G A;  2EIO A;  1U3A A;  2I81 A;  2KUC A;  3KZQ A;  1MDI A;  2GZZ A;  4GF0 A;  3TJJ A;  5LCZ A;  1EOH A;  3UBL A;  1JZD A;  3D0Z A;  2I9H A;  3I6A A;  3RBT A;  4MH3 A;  4BVY B;  3ZYW A;  2L5L A;  3RPN A;  2M46 A;  3CTG A;  2O89 A;  1NHO A;  1VF2 A;  1WJK A;  3EMP A;  3L4N A;  1YEX A;  1EEM A;  7GSS A;  4JRR A;  5D9T A;  4FYB A;  19GS A;  2NDO A;  4WET A;  2P5R A;  2X64 A;  2CVD A;  3A5I A;  2YWO A;  1TK8 B;  2B5Y A;  4BL7 B;  1F3A A;  3E9J B;  3OR5 A;  1KNG A;  4N11 A;  5KN0 A;  5KOX A;  4KGI A;  2H0I A;  5J4U A;  2QA2 A;  2E0Q A;  1TW9 A;  1TRV A;  4KDX A;  5AIV A;  1K0D A;  3FMW A;  3TUE A;  4HI7 A;  3VPT A;  5H5S A;  3JCM L;  3ZFL A;  4IQ1 A;  3E0U A;  4Z7X A;  1SL0 B;  4WR5 A;  6GSY A;  4MPG A;  4Z2T A;  2LNT A;  3GH9 A;  4MMM A;  1Z7P A;  3UBK A;  1PKZ A;  2A2S A;  3CSJ A;  3VPQ A;  3EU3 A;  4MZW A;  2H71 A;  3KTL A;  4TN8 A;  1WMJ A;  2ON5 A;  4OO5 A;  1S3D A;  2A4H A;  4H86 A;  2CQ9 A;  2HSH A;  4Q5N A;  4DEJ A;  2HRN A;  5DAK B;  1VF4 A;  3KD0 A;  1FB0 A;  2B6M A;  3KP8 A;  3ZMK A;  5A5K A;  2OAC A;  4OMV A;  3J7Y b;  3GYK A;  4MPF A;  3IR4 A;  4MF6 A;  5DCH A;  2K8V A;  4USS A;  2AB6 A;  1Q4J A;  2OE0 A;  2GZP A;  5HQP A;  4HS1 A;  3IDV A;  4TXO A;  1THO A;  1GSS A;  1TRS A;  4LMV A;  5J41 A;  3LGC A;  4AJ8 A;  3PH9 A;  2B1K A;  3KXO A;  4O92 A;  2H6Y A;  3F4R A;  3VK9 A;  2AAW A;  3TKR A;  5IPG A;  4K0G A;  4AGS A;  2JAD A;  2R0C A;  2V2G A;  1XWC A;  4MNN A;  3CMI A;  4GXZ A;  2QGV A;  3EIN A;  4E8H A;  2OKA A;  4HOJ A;  1RW1 A;  4CDO A;  2EIQ A;  3D4T A;  3HHV A;  1TU8 A;  3IAM 2;  5ECN B;  8GSS A;  1HNC A;  3TRX A;  4PNF A;  2H8L A;  1K3O A;  2LJK A;  3DWV A;  9GSS A;  3RPP A;  4N30 A;  2X49 A;  2LV3 A;  4PQ1 A;  1QXH A;  1A23 A;  2H76 A;  4TXV A;  4TR3 A;  4YQV A;  2HXK A;  4K0N A;  1BX9 A;  5L71 A;  2A2R A;  1V9W A;  1E2Y A;  4TW5 A;  4EO3 A;  1MTC A;  3HD5 A;  2VCT A;  4RI7 A;  3GTU B;  2H6Z A;  4TRX A;  4OD7 A;  2MMA A;  1HNB A;  3LJR A;  2PMT A;  2M80 A;  1O81 A;  1SJI A;  1ZYE A;  2CZ2 A;  4F0B A;  3GMF A;  4F03 A;  1GNE A;  5ECL B;  2KOK A;  3DML A;  4EDZ A;  4MJA A;  5F8B A;  3HJM A;  1XFL A;  3RHB A;  3GFK A;  1XVQ A;  1JZW A;  3IAS 2;  5A4V A;  2HSY A;  2GLR A;  3TJB A;  4K9Z A;  2DJ0 A;  4IHU A;  1Z6N A;  2LQQ A;  3KH9 A;  4PX1 A;  4G19 A;  3HVX A;  1PN0 A;  2UZ8 A;  3GN3 A;  5DVB A;  1J08 A;  3GKX A;  1NSW A;  1OC9 B;  2IFQ B;  1GTU A;  4YQM A;  1B9Y C;  2HLS A;  2L6C A;  1TKD B;  1XCC A;  1M2B A;  2R0P A;  1UN2 A;  2TRX A;  5CRW A;  1DSB A;  4MF7 A;  2N5A A;  4L8E A;  2FNO A;  2XPE A;  3GX0 A;  2IMI A;  4PXO A;  5ECM B;  4BVY A;  1HNA A;  2NBS A;  2R0G A;  5J3R A;  1RK4 A;  4ZIJ A;  5DJM A;  3MSZ A;  1ON4 A;  4MK3 A;  4EUY A;  3H93 A;  3LFL A;  1ERT A;  1FVK A;  1TI3 A;  2H74 A;  2H1B A;  1PKW A;  1W4V A;  1XWG A;  3F8U A;  1ZL9 A;  5GST A;  2RUE A;  4MJC A;  5KN2 A;  2WUL A;  2I3Y A;  3DIE A;  3IRA A;  2B3S A;  1RQM A;  2DJ2 A;  5HR0 A;  2FUG 2;  2A4V A;  1G6Y A;  3VWV A;  4BL7 A;  1XVW A;  4NAX A;  4JE1 A;  1R26 A;  4G0L A;  4I6X A;  1T4Z A;  1SJZ A;  2QA1 A;  3DRN A;  2PBJ A;  1S3C A;  3EYT A;  3D4M A;  5D9X A;  1TU7 A;  4KDY A;  4LA1 A;  1GSF A;  4OWY A;  4PTS A;  5DQY A;  3GUR A;  1TJD A;  5C00 A;  1XOB A;  3HZ8 A;  6GSU A;  4XS4 A;  2YV9 A;  2YZH A;  4ML6 A;  3ZML A;  4ECJ A;  5A4U A;  2FLS A;  1J0F A;  3Q74 A;  3HVS A;  4O32 A;  5IQY A;  5DDL A;  4WBR D;  4V2N A;  2X8G A;  2E7P A;  3EPT A;  1R5A A;  4HQS A;  1VF3 A;  1A2M A;  1NM3 A;  3FR3 A;  3R2Q A;  4D73 A;  4KUN A;  4WXT A;  3DKS A;  4GSS A;  4J57 E;  5DAK A;  2JSY A;  2EIR A;  1V40 A;  2GSQ A;  4TR0 A;  3GX8 A;  1JZR A;  2DJK A;  1K3Y A;  2PWJ A;  3ERF A;  2GSR A;  1Z3E A;  2WS2 A;  2HNL A;  3FR9 A;  2A2P A;  4HJ2 A;  3ISO A;  2H6X A;  11GS A;  3KEB A;  5ABR A;  2C3N A;  1GUL A;  5CO3 A;  1F3B A;  1KBN A;  1SJ6 A;  2MYG A;  3UEM A;  1X5C A;  4LLR A;  3U6V A;  2C0E A;  4OO4 A;  3LWA A;  1SK2 A;  4O5U A;  5B6M A;  5IO0 A;  2K9F A;  4E8E A;  4EE0 A;  1GSE A;  1DE1 A;  5E4W A;  2LRN A;  2KP1 A;  4PQI A;  2FD3 A;  2LRC A;  1OYJ A;  2KHP A;  3CTF A;  5G1K A;  4KE3 A;  5D96 A;  4J2F A;  4QQ7 A;  1QUW A;  5D9W A;  3KGK A;  2C8U A;  3O3T A;  4XS6 A;  4L0U A;  3GV1 A;  3S9F A;  3IC8 A;  2QSI A;  4WF5 A;  4WEY A;  3GKM A;  4RQR A;  3UL3 A;  1ERW A;  2DLX A;  1AAZ A;  3QMX A;  3EE2 A;  3RHC A;  1Z9H A;  2AUV A;  3P8W A;  3GTU A;  4HUA A;  2FA4 A;  5G5F A;  2OJL A;  3BBY A;  3CSI A;  4KSM A;  1GUM A;  4WBJ A;  1ML6 A;  2JSZ A;  1ABA A;  3WYW A;  4AF2 A;  2C1Y A;  4ULX A;  3C1S A;  2OE3 A;  1TTZ A;  4RQX A;  4Z2R A;  1YZX A;  3QFA C;  2IMD A;  2YJH A;  1URM A;  5ECO B;  1XOA A;  2YOI A;  5IOW A;  1ZYN A;  1H75 A;  4G0K A;  2GT6 A;  4CHS A;  1ERU A;  3HJO A;  3LYK A;  2CA8 A;  2BJX A;  2LNS A;  4MP4 A;  2VLV A;  4MCU A;  2P5Q A;  2WGR A;  2L4C A;  5JCG A;  2DJ3 A;  5J9B A;  1K0B A;  2O8V B;  5HR3 A;  2MMO A;  3MAK A;  4GTU A;  1OC9 A;  2IFQ A;  2IME A;  3F9U A;  2VM1 A;  2EC4 A;  3L9V A;  5LD0 A;  3KMO A;  4IJ3 A;  1X5D A;  1BYE A;  3MDK A;  1DE2 A;  3R3E A;  3M9K A;  1JHB A;  3UVH A;  4G0I A;  2IL3 A;  5JWO B;  2OA7 A;  1PX7 A;  5G31 A;  4BVX B;  1XXU A;  1FVJ A;  2V32 A;  2IMF A;  1T3B A;  2H30 A;  5G1L A;  2OE1 A;  1R4W A;  4JR6 A;  3HCZ A;  3KM6 A;  3IC4 A;  5B8B A;  4Q5R A;  1SEN A;  3FZ5 A;  4FYC A;  4EKZ A;  4WKW A;  1IYI A;  2HI7 A;  4K2X A;  5B8A A;  4KDU A;  3VLN A;  4XRA A;  4I5Q A;  2DC5 A;  2PN8 A;  3QAW A;  3QOU A;  1V57 A;  5ECS A;  2FA8 A;  3DXB A;  3ZZX A;  1DBY A;  5H5R A;  4XIH A;  2E2G A;  1TXX A;  2CAI A;  4G9H A;  3F63 A;  6GST A;  2H1A A;  1B8X A;  4JED A;  2XHF A;  4DSQ A;  1OKD A;  3HXS A;  1VGL A;  2C4J A;  1T1V A;  2L6D A;  4LMW A;  1FOH A;  4OFM A;  4IW9 A;  2VUP A;  3NIV A;  3RAZ A;  3I9V 2;  4DVC A;  1C72 A;  2F3M A;  1U87 A;  3F4T A;  1YKC A;  5JWQ B;  3M1G A;  3VFI A;  1V2A A;  1WIK A;  5FWG A;  1N2A A;  3QDN A;  1SD9 A;  1JFU A;  4XS4 B;  1YQ1 A;  4HZ2 A;  1U88 A;  2HZF A;  3GST A;  3TGZ A;  4HEA 2;  1KTE A;  4KND A;  2J9H A;  4KX4 A;  4L5O A;  1YY7 A;  1BQ7 A;  2CX4 A;  2Z9S A;  5HFK A;  4ML1 A;  2FWF A;  4PNG A;  3P90 A;  2YCD A;  4D73 B;  2FGX A;  3N9J A;  5IMZ A;  4XS1 A;  3UAR A;  3ZFB A;  2DIZ A;  2F8F A;  2V6K A;  4BA7 A;  1SD8 A;  4O5R A;  4GSN A;  1OC8 A;  1PX6 A;  2E2M A;  1GUK A;  1JLV A;  3BJ5 A;  3F3R A;  3EC3 A;  2VM2 A;  3DD3 A;  4I2U A;  2GDR A;  2HSM A;  2PPT A;  2M72 A;  1EGO A;  3KTB A;  3L78 A;  4RUV A;  1I5G A;  3TJK A;  3VWU A;  2C3T A;  2VCQ A;  1O8X A;  2H0G A;  2LKU A;  1YF1 A;  3TKQ A;  5ELA A;  2N5B A;  1AUC A;  3WGE A;  3KCM A;  1J9B A;  4CY6 A;  3LEF A;  2I1U A;  4GWR A;  4MJB A;  2KP2 A;  4HZ4 A;  4HU7 A;  4K7O A;  2YNX A;  3Q19 A;  1GNW A;  3KJY A;  4JU5 A;  1UC7 A;  1SKR B;  3IOS A;  3VWW A;  4PUR A;  1QFN A;  3BCI A;  1A2L A;  3CXG A;  3FHK A;  3G7I A;  2LJA A;  3GSS A;  4GQF A;  2CX3 A;  1GWC A;  4ILF A;  10GS A;  3GHA A;  2VOC A;  2D2Z A;  3FRC A;  2GQL A;  1A2J A;  3QCP A;  3ZRE A;  2IWT A;  5CRE A;  3KIJ A;  2REM A;  4IEL A;  2K8S A;  1GSD A;  3IE3 A;  3WGX A;  3CYN A;  3VI5 A;  3ME7 A;  2BTO T;  4KAE A;  2WZ9 A;  12GS A;  3HJP A;  2MBT A;  3HA9 A;  4PUF C;  4FIW A;  1OKT A;  3IBH A;  4JBB A;  2IPA A;  3US3 A;  4TKY A;  1FG4 A;  3O6T A;  2LST A;  3CRU A;  3D22 A;  3HDC A;  4EDY A;  1M2D A;  5EPF A;  4ZL9 A;  17GS A;  3WT1 A;  3W8J A;  3WD6 A;  2NVL A;  3Q18 A;  4TR4 A;  2FHE A;  1EZK A;  1V98 A;  2JL4 A;  4YQU A;  1MEK A;  1ZZY A;  1MDK A;  4YH2 A;  1GH2 A;  4L5L A;  1E6B A;  4JR4 A;  2O7K A;  3I43 A;  1WWJ A;  2GZY A;  1ZOF A;  3FKF A;  1HQO A;  4BVX A;  1LJR A;  1O7U A;  3RDW A;  1O6J A;  5JCW A;  4RI6 A;  2PGT A;  2RM6 A;  2MMZ A;  1M2A A;  5CRH A;  1GTB A;  2LQO A;  1X9S B;  1USB A;  1ZMA A;  2JAC A;  4NV5 A;  3O76 A;  4MA9 A;  3M0F A;  2GST A;  3BD2 A;  1X5E A;  1SYX A;  3QR6 A;  4LL1 B;  1UA5 A;  4P3Y B;  1GUH A;  3A2W A;  1Y25 A;  1K0C A;  3ED3 A;  1GSQ A;  1OVN A;  5LNK e;  3TRQ A;  4BWS A;  3EWL A;  1FO5 A;  1GSY A;  4NWY A;  3EVI A;  5D73 A;  4IS0 A;  1Y6E A;  4KCA A;  2L5O A;  2HYX A;  4Z2U A;  4FH8 A;  2F51 A;  3TDG A;  1U6T A;  3KP9 A;  1K0O A;  5IIZ A;  2G0F A;  2ZUP A;  2L59 A;  4Q5Q A;  3TKS E;  1OE8 A;  2CV4 A;  1OAZ A;  4IBP A;  2GQM A;  4XRD A;  3SBC A;  2WCI A;  2H75 A;  4ECC A;  2V1M A;  4K1F A;  1NW2 A;  4XTS A;  5JWR B;  1YDK A;  4FO5 A;  1R5P A;  5FHI A;  1VRS D;  1B4Q A;  3TOU A;  2WRT A;  2NPB A;  3L0H A;  1Z5Y E;  1ACV A;  1GTA A;  2JZS A;  4ZBD A;  5IMF A;  2R3X A;  3ZLP A;  3FYG A;  3EMX A;  1HD2 A;  5AN1 A;  2R4V A;  2TIR A;  2ALB A;  4HJM A;  1FHE A;  3EUR A;  3C71 A;  4POM A;  3QPM A;  5IM9 A;  1K0M A;  1SK1 A;  5IMD A;  1O85 A;  5DCG A;  2R2J A;  1QGV A;  1TI1 A;  1S3A A;  3L9U A;  3VUR A;  1R7H A;  4J56 E;  3I69 A;  2R37 A;  3F3Q A;  3HKR A;  1XZO A;  2O85 A;  2OBI A;  2YAN A;  5ELG A;  3G9B A;  5D9V A;  4KCE A;  2GGT A;  2RII A;  1AIU A;  3C7M A;  3LYP A;  3MIX A;  4YKG A;  5GAP D;  6GSS A;  2LEG A;  4N0Z A;  4NXI A;  1B9X C;  4TR1 B;  1MDJ A;  3A3T A;  3F6F A;  2VD1 A;  4ZBA A;  1LBK A;  1PQN A;  3IHG A;  3GUS A;  3BCK A;  4GCI A;  3TKP A;  1PGT A;  4BWQ A;  4EIQ A;  3Q6O A;  2GVP A;  2RLI A;  4ECB A;  1B48 A;  5HFI A;  3FK8 A;  5D93 A;  2DKI A;  5AGY A;  5IO2 A;  4POB A;  3C73 A;  5AIX A;  1AQV A;  1PA3 A;  3MWH A;  3HVV A;  1WOU A;  1O8W A;  2DMM A;  1PL2 A;  4IVF A;  4V2L A;  1SKW B;  2HT9 A;  4YAV A;  4N10 A;  5IPH A;  5IOX A;  3ERW A;  5HR2 A;  1F2E A;  2GS3 A;  5ECP B;  4IJI A;  1EOG A;  3TOT A;  2WB9 A;  4WR4 A;  2HRK A;  3UVT A;  4ZXG A;  1XW9 A;  1BJX A;  5INY A;  5F07 A;  2YWI A;  4GST A;  2C3Q A;  5ID2 B;  2VO4 A;  2X8C A;  1XPV A;  3KMN A;  5J9C A;  22GS A;  1ZYP A;  2FWE A;  2L4Q A;  3ME8 A;  4K5S A;  1M7T A;  1G0T A;  4X0X A;  3LW9 A;  1GLP A;  2JU5 A;  1G7E A;  2K6V A;  2CVB A;  2VD0 A;  2CZ3 A;  4MJE A;  1EWX A;  4EIP A;  3FY7 A;  6GSX A;  4ISD A;  1PN9 A;  5AIS A;  1DUG A;  1NHY A;  3FW2 A;  1WP0 A;  5GZZ B;  4ZL8 A;  4ZB6 A;  1T8E B;  2MBS A;  6GSW A;  4MDC A;  4PUA A;  2DSA A;  3DGQ A;  2HZE B;  1N8J A;  4GLT A;  2LTK A;  3GKN A;  1GTI A;  16GS A;  2IJY A;  2QKE A;  4POL A;  4K7N A;  1U3I A;  2H72 A;  5HFG A;  3C8E A;  5KOW A;  1WPI A;  1M9B A;  1X0R A;  4X4J A;  2KLX A;  3VI7 A;  1K0A A;  1HYU A;  2B7J A;  4F2I A;  2LUS A;  1AC1 A;  4ICY A;  3N5O A;  1OC3 A;  4PQH A;  3GRX A;  1TRU A;  5FT3 A;  3NZN A;  4IQA A;  3D6I A;  2DKH A;  1T00 A;  3IK7 A;  5BRT A;  4AJ7 A;  5JCU A;  2AYT A;  2DIY A;  2WJU A;  2YPM A;  4EVM A;  3A2X A;  4JZQ A;  1EGR A;  4KH7 A;  3QAV A;  5A4W A;  2MMN A;  1MD4 A;  5ECR B;  2H19 A;  5F05 A;  1W89 A;  3LSZ A;  3P2A A;  3G7J A;  5B6N A;  1XWA A;  4F9Z A;  1AQW A;  6GSV A;  2DJ1 A;  3HZ4 A;  1M0U A;  1Q98 A;  2P31 A;  3PIN A;  3E3E A;  3M8N A;  4BPY A;  3LXZ A;  3CSH A;  1ST9 A;  1BAY A;  5BMU A;  2FY6 A;  2VLU A;  1FAA A;  4EF0 A;  3LG6 A;  3D5J A;  3U5R E;  1V58 A;  5G30 A;  4IP6 A;  2C80 A;  5F0G A;  4WF4 A;  3GL3 A;  2DBC A;  1H4O A;  4G2E A;  1SU9 A;  1EP7 A;  4IN0 A;  2RM5 A;  4N0V A;  2B7K A;  1OE7 A;  1VF1 A;  3M9J A;  4ACS A;  2PUK C;  3P7X A;  3HYP A;  5KEJ A;  2XC2 A;  3IHQ A;  5C04 A;  4MH2 A;  4HDE A;  3UJ1 A;  3APS A;  4IP1 A;  4GRF A;  3IA1 A;  3QD9 A;  4EL1 A;  3C1R A;  3TRP A;  5ECH B;  1TOF A;  1AQX A;  3G7Y A;  2VL2 A;  13GS A;  5ECK B;  2YN1 A;  3J7Y k;  4O7H A;  5DAL B;  1O73 A;  2FWG A;  4OFT A;  4XHM A;  4TR1 A;  1ILO A;  1CQH A;  1GRX A;  2H01 A;  1PRX A;  4I8B A;  1XIY A;  1G6W A;  1T7P B;  2VCX A;  4KB3 A;  2JZR A;  3TJF A;  2JZT A;  2HE3 A;  4NMU A;  2PVQ A;  1A8L A;  4MLY A;  5ENU A;  5GSS A;  5B7C A;  3ZIT A;  4K2D A;  3W8S A;  3GKK A;  2V41 A;  2YWM A;  3APQ A;  2VAF A;  2PER A;  2PU9 C;  3H1N A;  3IV4 A;  3FEU A;  2HRF A;  1FW1 A;  4K5R A;  3A2V A;  2C0G A;  2X99 A;  1T4Y A;  3LXT A;  4NHZ A;  3H8Q A;  2V6O A;  2H1D A;  3ERG A;  2N5F A;  4PGT A;  1PL1 A;  3TCO A;  4K7I A;  2B1L A;  2ZNM A;  4V1A p;  2GSS A;  1TK5 B;  2R5G A;  1AXD A;  1ERV A;  2GTU A;  2L57 A;  1ZYQ B;  4FQU A;  3F0I A;  4FYU A;  5H5Q A;  5ID2 A;  3QAG A;  2VIM A;  1SL2 B;  3A5W A;  4V2M A;  4DSS B;  3BOA A;  3TJG A;  1GSU A;  4NPB A;  3H4K A;  1X9W B;  2YV7 A;  1JLW A;  4NV2 A;  2NTO A;  1PMT A;  3APO A;  2DML A;  4IGJ A;  4OFN A;  1F37 A;  1FB6 A;  1GL8 A;  4ZIL A;  5KN3 A;  1A0R P;  5F06 A;  3MYD A;  1ZGN A;  4ZB9 A;  2VL3 A;  1QMV A;  4POK A;  3TKS A;  4KW6 A;  4EC0 A;  1BG5 A;  2HZE A;  2YZU A;  2AHE A;  5CRD A;  3TB2 A;  1SYR A;  4QL9 A;  1X9M B;  2CT6 A;  2F9S A;  2F8A A;  4KA0 A;  2XBQ A;  5GAN D;  3SWL A;  2PVO C;  3EU4 A;  2LS5 A;  2DJJ A;  2H1G A;  5CAX A;  2ON7 A;  4F82 A;  2RUF A;  2B5X A;  2AV4 A;  4G10 A;  4ECI A;  2IN3 A;  2QC7 A;  2VCZ A;  5DJL A;  1AW9 A;  5DBQ A;  3ZTL A;  2K18 A;  4A5P A;  2X4A A;  2WFC A;  1YJ6 A;  2VCV A;  3GL5 A;  4KSO A;  1F6M C;  2CAQ A;  3ZVJ A;  4X1U A;  1QK8 A;  4L0W A;  4MF5 A;  5D8I A;  4EXJ A;  1Z7R A;  2VLT A;  2FCH A;  1TK0 B;  2ZCT A;  1TDI A;  4K8M A;  2H73 A;  3AY8 A;  1A24 A;  1GP1 A;  4MAB A;  3V1W A;  5EY6 A;  1FOV A;  3ZRD A;  4I2T A;  4ID0 A;  3UAP A;  1XWB A;  1K0N A;  4YKF A;  2IIY A;  2O87 A;  5E59 A;  1JZO A;  4LL4 B;  5ECI B;  2LJR A;  2YP6 A;  5DQS A;  1GLQ A;  3M3M A;  1YKA A;  3GNJ A;  3WGD A;  4ZB8 A;  3IK9 A;  3F4S A;  1XW5 A;  3CBU A;  1G7O A;  3IPZ A;  2X8H A;  4KF9 A;  2G2Q A;  1YEP A;  1WE0 A;  2B5E A;  3K8N A;  4K6X A;  1TP9 A;  1EP8 A;  1M9A A;  4Q5F A;  3MNG A;  1A0F A;  1K3L A;  2I4A A;  1WRY A;  4QL7 A;  1SK0 A;  2VL2 C;  4F0C A;  18GS A;  2ES7 A;  5CP1 A;  3CRT A;  3PGT A;  3ZIV A;  3DEX A;  14GS A;  1MD3 A;  3PPU A;  4YAP A;  4TXO B;  5IMA A;  1XBS A;  1TRW A;  5DAL A;  3ZIJ A;  4XCS A;  2GT5 A;  2YJ7 A;  4O5Q A;  3DVX A;  1IYH A;  1EV4 A;  20GS A;  2H66 A;  2OBK A;  5IMV A;  2H0H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...