3ZITA

Crystal structure of the thioredoxin-like protein bc3987 mutant t8a
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
74
structure length
74
Chain Sequence
KIEVYAQPDCPPCVIVKEFLKHNNVAYEEFDVKKDAAARNRLLYDYDSYSTPTVVIDGEVVAGFQIEKLQQLLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords THIOREDOXIN
publication title Tuning of Thioredoxin Redox Properties by Intramolecular Hydrogen Bonds.
pubmed doi rcsb
source organism Bacillus cereus
total genus 22
structure length 74
sequence length 74
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00462 Glutaredoxin Glutaredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3zitA00
3CYNA 1V9WA 5J41A 3E0UA 4JZQA 2M46A 4HZ2A 4O92A 4RUVA 1XWCA 3GX8A 3H4KA 3NZNA 2P5RA 4MABA 4IN0A 5J4UA 3L78A 3M9KA 3ZTLA 4GLTA 3TRPA 1S3CA 18GSA 3H1NA 4IVFA 5AGYA 4XIHA 2HE3A 3HA9A 5GZZB 5F8BA 1F9MA 1Z7RA 3UBLA 4GTUA 4Q5RA 2R5GA 4IELA 4MA9A 4JU5A 4ILFA 3IRAA 1SJ6A 5D9TA 5HFIA 4OFMA 3DVXA 2DJ0A 4P3YB 1V2AA 1XWAA 4K8MA 1KBNA 2AV4A 3KEBA 1M2DA 2KUCA 4KCAA 3O76A 4NWYA 1XXUA 2WFCA 3F0IA 1ML6A 5DAKB 5F07A 1B9XC 5ID2B 2LTKA 3IBHA 4IJ3A 3A3TA 4ZL7A 3I69A 4HJMA 4WF4A 1SKRB 3UL3A 1Z3EA 1EEMA 2YNXA 4WKWA 3EMXA 1QXHA 3GA4A 1YF0A 1ZOFA 2H6ZA 1GRXA 1TW9A 2JADA 2JSZA 4RI7A 4CW9A 5D9XA 4TR1B 4YQVA 2C3TA 4IP6A 4POMA 5CAXA 2HZEA 3IDVA 1UVZA 4D73B 3P8WA 1O81A 3G9BA 1K0AA 4X43A 1WE0A 5G1KA 4IQAA 3ISOA 3UVHA 7GSSA 4ULXA 2CZ3A 3MNGA 5DQSA 3DD3A 1GLQA 3QR6A 4IQ1A 4IHUA 4RI6A 5JWRB 1V58A 3KTLA 1URMA 2GDRA 4XRDA 3FK8A 1A2JA 3TKRA 2HNLA 2VCZA 4IW9A 2IMKA 4WETA 2YV7A 2YZUA 2E2GA 4GXZA 4IGJA 1NHYA 2DJ2A 3F6DA 2H01A 2QKEA 3FY7A 5ENUA 3GSSA 4KCEA 2VM2A 3I6AA 5KN3A 1AAZA 4N10A 2IFQA 3LSZA 2KP1A 4K7IA 3DIEA 2JACA 2FGXA 3F6FA 2P31A 4L0UA 20GSA 2GQLA 3CTFA 3JCML 1ERVA 4NMUA 3ZZXA 1GULA 1TJDA 4ID0A 2H1BA 3GKNA 4KUNA 3C8EA 3K8NA 1A8LA 1Z6MA 2HYXA 3D0ZA 2HZEB 4XHMA 2I81A 1N8JA 2OKAA 2OE1A 3TJBA 1ZYQB 3ZITA 4PXOA 2H1GA 2FWHA 3A2VA 4I5QA 5B6NA 3M9JA 5ECQB 2H6XA 5F0GA 1GSFA 1OAZA 1GSUA 3IXRA 2DJ1A 2VAFA 1M2BA 5EPFA 1BYEA 5C04A 4AGSA 4WR5A 2VCWA 1PMTA 4F2IA 5DVBA 2C80A 3GHAA 1JZDA 3L9SA 2H0HA 1X5CA 3U5RE 2GQKA 2L5LA 3HKRA 2VL9A 3A2WA 2CT6A 4XS6A 2RM5A 1R4WA 2ON7A 1Y6EA 5IOXA 1PGTA 3GV1A 3O3TA 1SL1B 2O8VB 1GLPA 2LSTA 2XC2A 3D5JA 3IHQA 5JCUA 3L9UA 4ZL9A 2JSYA 2V1MA 5HR3A 1YDKA 2VIMA 2H74A 3GSTA 3UIWA 4MP4A 1MD3A 4EF0A 4CHSA 1YF1A 4HDEA 3KP8A 3R2QA 2IMEA 2P0GA 2VD0A 1WWJA 4TW5A 2FLSA 2CZ2A 4HQZA 4OCEA 2I1UA 4MPGA 1NM3A 1U3IA 2ES7A 1GH2A 4DVCA 4J2FA 4O7HA 4ECIA 3Q18A 1E6BA 1MD4A 3EVIA 5F06A 2DMMA 1RQMA 4K0GA 4ZBDA 2AUVA 1TK0B 3G7IA 5C00A 3J7Yk 2NTOA 1LU4A 4H86A 2DC5A 4Q5FA 5GAND 3CTGA 4KAEA 1ZL9A 1JLVA 3SBCA 2OA7A 3CSIA 5J9BA 4FYUA 3F8UA 2B6MA 4L5OA 2G0FA 2GGTA 2L59A 4TXOA 3RDWA 3BBYA 4YAPA 1UN2A 2LQQA 5ECIB 4OFNA 1FVKA 1FOVA 1T1VA 1TTZA 5KN2A 1ZGNA 2GT6A 3EINA 5ECLB 3RBTA 2QSIA 1T7PB 2E2MA 3HZ8A 4IJIA 3KMOA 1G7OA 1KEBA 5HR0A 2TIRA 1EGRA 3ZIJA 1V40A 3ZLPA 2PVOC 3TKSA 2K8SA 2L6DA 3P7XA 1OC9A 3KH7A 1O6JA 4HUAA 1H75A 5IOWA 1CQGA 2N5FA 2MBSA 2YPMA 3ZFBA 3W8JA 1EP7A 3LFLA 2VD1A 4XS4A 2J23A 3BOAA 2B5YA 5ECHB 5IMFA 1T3BA 4PNGA 4KDUA 1EOGA 2DLXA 2C0DA 4LA1A 3CRTA 2WCIA 4ZBBA 1THXA 1QFNA 1DSBA 1TRWA 2DMLA 5AISA 4OMVA 3WGXA 1TRSA 2OE3A 4ZL8A 1Q98A 1CQHA 3KM6A 2IMFA 12GSA 1XPVA 1RK4A 2MBTA 1UC7A 3TKPA 4TRXA 2GSQA 3KXOA 2EIOA 5CP1A 2EIRA 3LEFA 1AW9A 4N11A 3FZ9A 5ECOB 4DSRA 1JFUA 4TXOB 2JZSA 2DBCA 5DJLA 2JL4A 1FVJA 2VLUA 6GSXA 4K0NA 3A2XA 5CRHA 3QFBC 13GSA 5FT3A 5G1LA 3EU4A 2YZHA 1GSYA 4ZBAA 3EC3A 1GUHA 3FEUA 3UOMA 2NPBA 1Z6NA 2H19A 2H0GA 1HQOA 1YZXA 1JLWA 3GKXA 2FWFA 5HQPA 4EDZA 1XCCA 1JZWA 2V32A 2IL3A 1ERTA 3ZVJA 5HFKA 4K1FA 1VGLA 1ERUA 1TXXA 4POLA 1MDKA 3FZ5A 4MPFA 4X0XA 5D8IA 3TRQA 2A2RA 1QUWA 1XW9A 2CX4A 4JEDA 2KHPA 4IP1A 2GS3A 3HD5A 2CQ9A 2CX3A 2L5OA 3P90A 1A2MA 2M72A 4TR0A 5EY6A 4FO5A 2DJKA 3IAS2 2WJUA 1EOHA 2OBKA 2VCQA 2PGTA 1A8YA 4AJ7A 22GSA 1ZCPA 2WULA 2DJJA 3GKMA 2R6KA 5ABRA 1SKSB 3KTBA 4GSSA 1Q4JA 1OC8A 3E9JB 4EE0A 2C8UA 2JZRA 2OE0A 4MF7A 2IIYA 1GUMA 5DCGA 3IOSA 2VM1A 1G7EA 3ZYWA 2C0FA 2B7JA 3FKFA 5CRWA 2O7KA 1YJ6A 2VCTA 3VI5A 3HDCA 2XPDA 1O8XA 3HVSA 1EEJA 1GNEA 3C7MA 2FHEA 1FAAA 2VL3A 8GSSA 1W4VA 1F3BA 5IM9A 2AHEA 2B5XA 2DJ3A 4NV2A 4TXVA 3G7YA 1XWKA 1X5DA 1FG4A 5LNKe 2C3NA 2PMTA 3APQA 3CXGA 1SKWB 2YOIA 4PQHA 3TJKA 2CVBA 3TOTA 4TVEA 4ZXGA 5D9WA 2PBJA 3D22A 1BG5A 4AJ8A 2CV4A 4OO4A 5F05A 2C0EA 1M0UA 3PR8A 3RHBA 4HQSA 1XVWA 3Q6OA 3ZMLA 3IK7A 2H72A 3D21A 5DQYA 1HYUA 1Z5YE 3BCIA 4HS1A 1XFLA 2C1YA 2XBQA 3GL3A 3VFIA 5B6MA 2R3XA 4OWYA 5E4WA 1K0BA 4K6XA 2FUG2 4I6XA 4YAVA 4XS1A 3VWWA 1YQ1A 1R7HA 3I43A 4N0ZA 4GF0A 1PA3A 1MTCA 3MWHA 4POBA 2H1DA 3MDKA 2K8VA 3KCMA 4TOPA 3TUEA 1B9YC 1EZKA 4G2EA 3GH6A 4BWSA 1MDJA 2X8HA 1XVQA 4OD7A 2FWEA 5DJMA 3WYWA 1Y25A 1K0DA 3EU3A 5ELGA 5FWGA 1OKTA 3FYGA 2H0IA 1X0RA 4YQUA 3UVTA 5GSSA 5CREA 3LORA 1SYXA 3UEMA 3VWXA 2V41A 3MSZA 5B8BA 4BA7A 4GQFA 1VF1A 5H5SA 2CAQA 2LUSA 3LQ7A 4NPBA 5KN0A 4FYBA 2P5QA 2ON5A 4J56E 2YV9A 1LBKA 1U88A 3GYKA 3WT2A 4N0VA 4V1Ap 4GWRA 2NBSA 3ZRDA 3CMIA 1GL8A 1NSWA 1JZRA 1TDIA 2CVDA 3FR9A 3F4TA 5AN1A 2LV3A 3GFKA 1GSQA 2TRXA 2VLVA 3GMFA 2LNTA 1OKDA 1QMVA 2GZZA 1PQNA 1AIUA 1N2AA 2HI7A 3TJGA 3QAWA 2IFQB 2VL2A 1O85A 1AQXA 1R5PA 1DE2A 1SU9A 2VO4A 3MAKA 3PINA 3CRUA 2LS5A 1VF2A 3D4MA 2B3SA 3RPPA 4BL7A 3IAM2 3QCPA 1DBYA 2L4CA 3ZFLA 2KOKA 4ZB8A 1QQ2A 5CNWA 5B8AA 3EMPA 4LMWA 2HXKA 2GQMA 1GP1A 4QL7A 3V1WA 5CO3A 4WBJA 1M7TA 4PURA 4WBRD 4EO3A 2LJKA 2HT9A 2K9FA 1SJZA 1TP9A 3UJ1A 3P2AA 2B5EA 4F0BA 1SK1A 3PH9A 1T00A 2AJQB 4YH2A 2B1LA 1TOFA 2JU5A 2HRFA 4MK3A 3RPNA 3VWVA 2L6CA 4JR4A 3BD2A 1M99A 1GTAA 1F2EA 5A4VA 1X9SB 1M9AA 3UARA 1USBA 1TKDB 2WB9A 3UMAA 4KSMA 3HZ4A 3LJRA 2MMZA 1PSQA 1U3AA 4G10A 3NOFA 2YJHA 2VCXA 1WMJA 5LCZA 5DBQA 4POKA 1XBSA 2YWOA 3C1RA 4YQMA 4MDCA 1T8EB 5ECSA 11GSA 4BWQA 1B8XA 1XIYA 3GIXA 4AF2A 2H1AA 3GH9A 1OC3A 1PL2A 1Z7PA 2TRCP 2H30A 2G2QA 2ZCTA 1GTBA 3RHCA 1O8WA 3ERWA 1W89A 2PVQA 1MDIA 2RM6A 1V57A 4K2DA 3OR5A 4AJ6A 5IMZA 2R4VA 2IWTA 16GSA 10GSA 4DSSA 2R2JA 3F4SA 2LJAA 2OBIA 2GT5A 4BPYA 1BX9A 2LRCA 3RAZA 2HRNA 4ECJA 1B48A 1PKZA 1OE8A 3A5WA 3GX0A 5JCGA 5ECKB 1AC1A 2X99A 5JWOB 3VPTA 3TKSC 5G5FA 3IA1A 3N9JA 4JBBA 2H70A 3LYPA 2H71A 1X5EA 1O7UA 3LG6A 4GSNA 1SYRA 4KA0A 2C3QA 3C1SA 1QGVA 1BAYA 3TCOA 3HCZA 4PQIA 2HLSA 4EDYA 3QOUA 1IYHA 4LL1B 3ME8A 1PX6A 3US3A 2E7PA 1F3AA 4ACSA 4HEA2 5H5RA 2N5BA 3HJOA 1K0NA 4HZ4A 3FHKA 3SWLA 5DALA 3M8NA 1SD8A 5G30A 4JE1A 2LRNA 3VK9A 2KLXA 3F63A 4NV5A 1PL1A 3HHVA 1J08A 2PN8A 2LRTA 2WS2A 3GL5A 4LMVA 3EYTA 5HR2A 2MMAA 3APSA 1VF4A 1EV4A 3GRXA 1NHOA 3F9UA 2C4JA 2LNSA 2FA8A 2DIZA 1B4PA 2X8CA 1OC9B 4V2MA 1A0FA 2ZNMA 3GTUA 1JZOA 1XW5A 4KB3A 4DSSB 2VLTA 2JZTA 4XS4B 5A4WA 1AQWA 2I4AA 3BCKA 1HD2A 2PPTA 2V6KA 3ERGA 1WRYA 2BJXA 5A4UA 2AAWA 2XPEA 6GSVA 3I9V2 4I97A 2ZUPA 4KH7A 4NHZA 1AXDA 2O87A 1ILOA 1ZMAA 1HNCA 1EGOA 2PUKC 1ZZYA 5CRDA 2N5AA 4F9ZA 1A2LA 4O32A 3TJFA 5IQYA 4Z7XA 4L8EA 4EVMA 4HI7A 4L0WA 3ED3A 1ACVA 4EKZA 2FA4A 4MF5A 3DEXA 4TR1A 1R26A 3LWAA 1T4ZA 2AYTA 3ZIVA 4V2LA 2LEGA 3D4TA 1VF3A 4MJEA 1EWXA 4D73A 3G7JA 1J9BA 2XHFA 4F82A 5G31A 3LGCA 1ZYEA 3DYRA 3TGZA 2AB6A 3GUSA 3GURA 2GVPA 5DALB 2YP6A 1A23A 3QD9A 2MMOA 2MMNA 3L0HA 1BEDA 1GSSA 2LKUA 3PGTA 4MF6A 1SK0A 2HZFA 4KGIA 4MMMA 4ZB9A 3TOUA 4RQXA 1XWGA 2H8LA 3O6TA 2F3MA 2FWGA 1C72A 1SJIA 3ZVJD 2IN3A 1AQVA 2IMDA 1SL0B 1U6TA 2IJYA 2RLIA 4MH3A 1TK8B 3VI7A 4EXJA 4ML1A 3CSHA 1ON4A 4QQ7A 2C0GA 5D93A 4GSTA 3GTUB 1XOAA 2MYGA 5HR1A 3L4NA 3KP9A 4NAXA 2YANA 1ABAA 4FYCA 3W8SA 3IK9A 2BMXA 1MEKA 2J9HA 1K0CA 4FH8A 2K18A 6GSSA 3KJYA 4MJAA 6GSTA 5D9VA 1FB6A 4L5LA 4CDOA 4PNFA 2F8FA 2YWNA 5IO2A 3KD0A 5FHIA 5IMDA 1YKCA 4JRRA 5AIXA 4I2TA 1F37A 4PGTA 4F03A 4KDXA 9GSSA 2CVKA 1G6WA 3HYPA 3J7Yb 1G0TA 4K7NA 5E59A 5ECMB 3ERFA 2DIYA 5KN1A 3ZREA 1M2AA 1YKAA 2EIQA 1OE7A 2YWMA 4MZCA 4XTSA 2H66A 1HNBA 3EE2A 4PUAA 2KP2A 2WRTA 3E3EA 3FR6A 1JHBA 2GZPA 2VUPA 3QMXA 3VWUA 2F9SA 4TR4A 2I3YA 3TDGA 2LQOA 1I9DA 5GAPD 2RUFA 3HVXA 5J5NA 3WT1A 3KZQA 4I8BA 4E8EA 1DUGA 3HJMA 4ML6A 4V2NA 3KH9A 5JCWA 1EV9A 3IC4A 4KE3A 3VPQA 1TRUA 3C73A 2YWIA 3GN3A 1G6YA 1K3LA 5H5QA 3TKQA 1GWCA 3DXBA 3QPMA 3NIVA 2A4VA 5ECRB 2R37A 4QL9A 1SL2B 1FO5A 3AY8A 4HU7A 1J0FA 5HFGA 4TN8A 4WR4A 4BVYA 5EVOA 1O73A 1K0OA 2H75A 4DSQA 1XWBA 3WD6A 1GSEA 4HOJA 4MJCA 1FB0A 1PRXA 3HVVA 3HXSA 1OVNA 4ECCA 2FD3A 4JR6A 5IMAA 3DVWA 3TKSE 5D96A 1M9BA 3CSJA 4V1Ag 6GSWA 1V98A 3FZAA 4EUYA 4KDYA 3LXZA 2H73A 2MZCA 1R5AA 1XW6A 3QDNA 3WGEA 4J57E 3TRXA 1WPIA 2NDOA 4KNDA 1WP0A 1AUCA 3H93A 2YJ7A 2RUEA 5GSTA 5JWQB 3VLNA 2ALBA 1SD9A 19GSA 3KMNA 4PX1A 5IMVA 5ECNB 2HFDA 1IYIA 4IBPA 17GSA 3EWLA 1PX7A 3ZMKA 1YEXA 2NVLA 3F3QA 2QGVA 2OACA 4OFTA 4IS0A 4WF5A 5EL8A 2K6VA 4G9HA 4MCUA 5IPHA 1PKWA 3L9VA 2XBIA 4KW6A 3DMLA 2GSTA 2VL2C 3APOA 1I5GA 2L57A 1FW1A 4MZWA 4ZB6A 5A5KA 1GUKA 2GZYA 3F3RA 2H76A 2FCHA 1YEPA 2WDUA 2WZ9A 2IMIA 1TI3A 1WJKA 2M80A 3N5OA 4E8HA 1KNGA 2B7KA 3GNJA 1DE1A 3DWVA 1TU7A 3C71A 2EC4A 2VOCA 3UAPA 4G19A 1TK5B 2GSSA 3IV4A 2HSHA 2H6YA 4GQCA 2YN1A 4ISDA 5J9CA 3M1GA 4EL1A 2L4QA 3UBKA 4IKHA 1THOA 3ZL5A 2IPAA 3IPZA 1XOBA 3FW2A 2F8AA 4EC0A 4OCFA 2O89A 1T4YA 2REMA 4ZIJA 1XZOA 3CBUA 3TJJA 1TU8A 5AIVA 1EP8A 5J3RA 2V2GA 3KGKA 1FHEA 1GNWA 1S3AA 4MLYA 2A2SA 1E2YA 5G5EA 5CYYA 1TRVA 1X9WB 1ERWA 2GLRA 5ECPB 3F4RA 3IE3A 5LD0A 1Z9HA 3H79A 5IMCA 1A24A 1RW1A 2D2ZA 2O85A 4N30A 4X1UA 4NHWA 4WXTA 3QAVA 4KX4A 1LJRA 2VCVA 6GSUA 1F6MC 1WOUA 3HY2A 4HU9A 3HJPA 14GSA 4K7OA 2BTOT 4BVXA 2FY6A 5IPGA 2CA8A 4PQ1A 3TB2A 3FZ4A 3DKSA 4K9ZA 2X8GA 1PN9A 1UA5A 1HNAA 3D6IA 5ELAA 4HJ2A 4F0CA 2I9HA 1VRSD 6GSYA 2CAIA 5B7CA 1K3OA 1BJXA 1WIKA 4I2UA 1X9MB 4O5RA 3W6GA 2Z9SA 4WEYA 3Q74A 3M3MA 2GTUA 3H8QA 4LL4B 4MZBA 1U87A 3GKKA 3LYKA 1B4QA 4GRFA 1ST9A 4OO5A 3M0FA 2YCDA 5IIZA 1A0RP 1BQ7A 5CRGA 5G2ZA 1NW2A 1SENA 3ME7A 5IO0A 4Q5QA 3S9FA 5DCHA 3FRCA 5L71A 2PU9C 2OADA 5DDLA 3DGQA 4KSOA 3WGDA 4MJBA 3Q19A 1OYJA 3VURA 3QAGA 2X64A 1KTEA 1TI1A 4Q5NA 1QK8A 1S3DA 4XRAA 2V6OA 2OJLA 4TKYA 1SK2A 3U6VA 3IR4A 4ECBA 3LXTA 2E0QA 4DEJA 2WGRA 2RIIA 3QFAC 1K3YA 1GSDA 4ZILA 5D73A 4RQRA 4XCSA 4GCIA 2F51A 2B1KA 2LJRA 2GSRA 5DAKA 5ID2A 3DRNA 4NXIA 2FNOA 4TR3A 2QC7A 2PWJA 4PUFC 1YY7A 4LLRA 1K0MA 1GTUA 1H4OA 2PERA 5KEJA 4MH2A 2DSAA 3BJ5A 4FIWA 5COHA 1GTIA 3FR3A 2HSYA 3KIJA 1PD21 3EURA 5INYA
chains in the Genus database with same CATH superfamily
3CYNA 1V9WA 5J41A 3E0UA 4JZQA 2M46A 4HZ2A 4O92A 4RUVA 1XWCA 3GX8A 3H4KA 3NZNA 2P5RA 4MABA 4IN0A 5J4UA 3L78A 3M9KA 3ZTLA 4GLTA 3TRPA 1S3CA 18GSA 3H1NA 4IVFA 5AGYA 4XIHA 2HE3A 3HA9A 5GZZB 5F8BA 1F9MA 1Z7RA 3UBLA 4GTUA 4Q5RA 2R5GA 4IELA 4MA9A 4JU5A 4ILFA 3IRAA 1SJ6A 5D9TA 5HFIA 4OFMA 3DVXA 2DJ0A 4P3YB 1V2AA 1XWAA 4K8MA 1KBNA 2AV4A 3KEBA 1M2DA 2KUCA 4KCAA 3O76A 4NWYA 1XXUA 1M3JA 2WFCA 3F0IA 1ML6A 5DAKB 5F07A 1B9XC 5ID2B 2LTKA 3IBHA 4IJ3A 3A3TA 4ZL7A 3I69A 4HJMA 4WF4A 1SKRB 3FMWA 3UL3A 1Z3EA 1EEMA 2YNXA 3HVNA 4WKWA 3EMXA 1QXHA 3GA4A 1YF0A 1ZOFA 2H6ZA 1GRXA 1TW9A 2JADA 2JSZA 4RI7A 4CW9A 5D9XA 4TR1B 4YQVA 2C3TA 4IP6A 4POMA 5CAXA 2HZEA 3IDVA 1UVZA 4D73B 3P8WA 1O81A 3G9BA 1K0AA 1ZYPA 4X43A 1WE0A 5G1KA 4IQAA 3ISOA 3UVHA 7GSSA 4ULXA 2CZ3A 3MNGA 5DQSA 3DD3A 1GLQA 3QR6A 4IQ1A 4IHUA 4RI6A 5JWRB 1V58A 3KTLA 1URMA 2GDRA 4XRDA 3FK8A 1A2JA 3TKRA 2HNLA 2VCZA 4IW9A 2IMKA 4WETA 2YV7A 2YZUA 2E2GA 4GXZA 4IGJA 1NHYA 2DJ2A 3F6DA 2H01A 4ICYA 2QKEA 3FY7A 5ENUA 4HSCX 3GSSA 4KCEA 2VM2A 3I6AA 5KN3A 1AAZA 4N10A 2IFQA 3LSZA 2KP1A 4K7IA 3DIEA 2JACA 2DKHA 2FGXA 3F6FA 2P31A 4L0UA 20GSA 2GQLA 3CTFA 3JCML 1ERVA 4NMUA 3ZZXA 1GULA 1TJDA 4ID0A 2H1BA 3GKNA 4KUNA 3C8EA 3K8NA 1A8LA 1Z6MA 2HYXA 3D0ZA 2HZEB 4XHMA 2I81A 1N8JA 2OKAA 2OE1A 3TJBA 1ZYQB 3ZITA 4PXOA 2H1GA 2FWHA 3A2VA 4I5QA 5B6NA 3M9JA 5ECQB 2H6XA 5F0GA 1GSFA 1OAZA 1GSUA 3IXRA 2DJ1A 2VAFA 1M2BA 5EPFA 1BYEA 5C04A 4AGSA 4WR5A 2VCWA 1PMTA 4F2IA 5DVBA 5BMUA 2C80A 3GHAA 1JZDA 3L9SA 2H0HA 1X5CA 3U5RE 2GQKA 2L5LA 3HKRA 2VL9A 3A2WA 2X4AA 2CT6A 4XS6A 2RM5A 1R4WA 2ON7A 1Y6EA 5IOXA 1PGTA 3GV1A 3O3TA 1SL1B 2O8VB 1GLPA 2LSTA 2XC2A 3D5JA 3IHQA 5JCUA 3L9UA 4ZL9A 2JSYA 2V1MA 5HR3A 1YDKA 2VIMA 2H74A 3EPTA 3GSTA 3UIWA 4MP4A 1MD3A 4EF0A 4CHSA 1YF1A 4HDEA 3KP8A 3R2QA 2IMEA 2P0GA 2VD0A 1WWJA 4TW5A 2FLSA 2CZ2A 4HQZA 4OCEA 2I1UA 4MPGA 1NM3A 1U3IA 2ES7A 1GH2A 4DVCA 4J2FA 4O7HA 4ECIA 2UZ8A 2QA1A 3Q18A 1E6BA 1MD4A 3EVIA 5F06A 2DMMA 1RQMA 4K0GA 4ZBDA 2AUVA 1TK0B 3G7IA 5C00A 3J7Yk 2NTOA 1LU4A 4H86A 2DC5A 4Q5FA 5GAND 3CTGA 4KAEA 1ZL9A 1JLVA 3SBCA 2OA7A 3CSIA 5J9BA 4G0KA 4FYUA 3F8UA 3IC8A 2B6MA 4L5OA 2G0FA 2GGTA 2L59A 4TXOA 3RDWA 3BBYA 4YAPA 1UN2A 2LQQA 2DKIA 5ECIB 4OFNA 1FVKA 1FOVA 1T1VA 1TTZA 5KN2A 1ZGNA 2GT6A 3EINA 5ECLB 3RBTA 2QSIA 1T7PB 2E2MA 3HZ8A 4IJIA 3KMOA 1G7OA 1KEBA 5HR0A 2TIRA 1EGRA 3ZIJA 1V40A 3ZLPA 2PVOC 3TKSA 2K8SA 2L6DA 3P7XA 1OC9A 3KH7A 1O6JA 4HUAA 1H75A 5IOWA 1CQGA 2N5FA 2MBSA 2YPMA 3ZFBA 3W8JA 1EP7A 3LFLA 2VD1A 4XS4A 2J23A 3BOAA 2B5YA 5ECHB 5IMFA 1T3BA 4PNGA 4KDUA 1EOGA 2DLXA 2C0DA 4LA1A 3CRTA 2WCIA 4ZBBA 1THXA 1QFNA 1DSBA 1TRWA 2DMLA 5AISA 4OMVA 3WGXA 1TRSA 2OE3A 4ZL8A 1Q98A 1CQHA 3KM6A 2IMFA 12GSA 1XPVA 1RK4A 2MBTA 1UC7A 3TKPA 4TRXA 5BRTA 2GSQA 3KXOA 2EIOA 5CP1A 2EIRA 3LEFA 1AW9A 4N11A 3FZ9A 5ECOB 4DSRA 1JFUA 4TXOB 2JZSA 2DBCA 5DJLA 2JL4A 1FVJA 2VLUA 6GSXA 4K0NA 3A2XA 5CRHA 3QFBC 13GSA 5FT3A 5G1LA 3EU4A 2YZHA 1GSYA 4ZBAA 3EC3A 1GUHA 3FEUA 3UOMA 2NPBA 1Z6NA 2X49A 2H19A 2H0GA 1HQOA 1YZXA 1JLWA 3GKXA 2FWFA 5HQPA 4EDZA 1XCCA 1JZWA 2V32A 2IL3A 1ERTA 3ZVJA 5HFKA 4K1FA 1VGLA 1ERUA 1TXXA 4POLA 1MDKA 3FZ5A 4MPFA 4X0XA 5D8IA 3TRQA 2A2RA 1QUWA 1XW9A 2CX4A 4JEDA 2KHPA 4IP1A 2GS3A 3HD5A 2CQ9A 2CX3A 2L5OA 3P90A 1A2MA 2M72A 4TR0A 5EY6A 4FO5A 2DJKA 3IAS2 2WJUA 1EOHA 2OBKA 2VCQA 2PGTA 1A8YA 4AJ7A 22GSA 1ZCPA 2WULA 2DJJA 3GKMA 2R6KA 5ABRA 1SKSB 3KTBA 4GSSA 1Q4JA 1OC8A 3E9JB 3MYDA 4EE0A 2C8UA 2JZRA 2OE0A 4MF7A 2IIYA 1GUMA 5DCGA 3IOSA 2VM1A 1G7EA 3ZYWA 2C0FA 2B7JA 3FKFA 5CRWA 2O7KA 1YJ6A 2VCTA 3VI5A 3HDCA 2XPDA 1O8XA 3HVSA 1EEJA 1GNEA 3C7MA 2FHEA 1FAAA 2VL3A 8GSSA 1W4VA 1F3BA 5IM9A 2AHEA 2B5XA 2DJ3A 4NV2A 4TXVA 4EIQA 3G7YA 1XWKA 1X5DA 1FG4A 5LNKe 2C3NA 2PMTA 3APQA 3CXGA 1SKWB 2YOIA 4PQHA 3TJKA 2CVBA 4PTSA 3TOTA 4TVEA 4ZXGA 5D9WA 2PBJA 3D22A 1BG5A 4AJ8A 2CV4A 4OO4A 5F05A 2C0EA 1M0UA 3PR8A 3RHBA 4HQSA 1XVWA 3Q6OA 3ZMLA 3IK7A 2H72A 3D21A 5DQYA 1HYUA 1Z5YE 3BCIA 4HS1A 1XFLA 2C1YA 2XBQA 3GL3A 3VFIA 5B6MA 2R3XA 4OWYA 5E4WA 1K0BA 4K6XA 2FUG2 4I6XA 4YAVA 4XS1A 3VWWA 1YQ1A 1R7HA 3I43A 4N0ZA 4GF0A 1PA3A 1MTCA 3MWHA 4POBA 4YKGA 2H1DA 3MDKA 2K8VA 3KCMA 4TOPA 3TUEA 1B9YC 1EZKA 4G2EA 3GH6A 4BWSA 1MDJA 2X8HA 1XVQA 4OD7A 2FWEA 5DJMA 3LW9A 3WYWA 1Y25A 1K0DA 3EU3A 5ELGA 5FWGA 1OKTA 3FYGA 2H0IA 1X0RA 4YQUA 3UVTA 5GSSA 5CREA 3LORA 1SYXA 3UEMA 3VWXA 2V41A 3MSZA 5B8BA 2R0CA 4FQUA 4BA7A 4GQFA 1VF1A 5H5SA 2CAQA 2LUSA 3LQ7A 4NPBA 5KN0A 4FYBA 2P5QA 2ON5A 4J56E 2YV9A 1LBKA 1U88A 3GYKA 3WT2A 4N0VA 4V1Ap 4GWRA 2NBSA 3ZRDA 3CMIA 1GL8A 1NSWA 1JZRA 1TDIA 2CVDA 3FR9A 3F4TA 3PPUA 5AN1A 2LV3A 3GFKA 1GSQA 2TRXA 2VLVA 3GMFA 2LNTA 1OKDA 1QMVA 2GZZA 1PQNA 1AIUA 1N2AA 2HI7A 3TJGA 3QAWA 3A5IA 2IFQB 2VL2A 1O85A 1S3RA 1AQXA 1R5PA 1DE2A 1SU9A 2VO4A 3MAKA 3PINA 3CRUA 2LS5A 1VF2A 3D4MA 2B3SA 3RPPA 4BL7A 3IAM2 3QCPA 1DBYA 2QA2A 2L4CA 3ZFLA 2KOKA 4ZB8A 1QQ2A 5CNWA 4K2XA 5B8AA 3EMPA 4LMWA 2HXKA 2GQMA 1GP1A 4QL7A 3V1WA 5CO3A 4WBJA 1M7TA 4PURA 4WBRD 4EO3A 2LJKA 2HT9A 2K9FA 1SJZA 1TP9A 3UJ1A 3P2AA 2B5EA 4F0BA 1SK1A 3PH9A 1T00A 2AJQB 4YH2A 2B1LA 1TOFA 2JU5A 2HRFA 4MK3A 3RPNA 3VWVA 2L6CA 4JR4A 3BD2A 1M99A 1GTAA 4K5RA 1F2EA 5A4VA 1M3IA 4Z2TA 1X9SB 1M9AA 3UARA 1USBA 1TKDB 2WB9A 3UMAA 4KSMA 3HZ4A 3LJRA 2MMZA 1PSQA 1U3AA 4G10A 4O5UA 3NOFA 2YJHA 2VCXA 1WMJA 5LCZA 5DBQA 4POKA 1XBSA 2YWOA 3C1RA 4YQMA 4MDCA 1T8EB 5ECSA 11GSA 4BWQA 1B8XA 1XIYA 3GIXA 4AF2A 2H1AA 3GH9A 1OC3A 1PL2A 1Z7PA 2TRCP 2H30A 2G2QA 2ZCTA 1GTBA 3RHCA 1O8WA 3ERWA 1W89A 2PVQA 1MDIA 2RM6A 1V57A 4K2DA 3OR5A 4AJ6A 5IMZA 2R4VA 2IWTA 16GSA 10GSA 4DSSA 2R2JA 3F4SA 2LJAA 2OBIA 2GT5A 4BPYA 1BX9A 2LRCA 3RAZA 2HRNA 4ECJA 1B48A 1PKZA 1OE8A 3A5WA 3GX0A 5JCGA 5ECKB 1AC1A 2X99A 5JWOB 3VPTA 3TKSC 5G5FA 3IA1A 3N9JA 4JBBA 2H70A 3LYPA 2H71A 1X5EA 1O7UA 3LG6A 4GSNA 1SYRA 4KA0A 2C3QA 3C1SA 1QGVA 1BAYA 3TCOA 3HCZA 4PQIA 2HLSA 4EDYA 3QOUA 2A4HA 1IYHA 4LL1B 3ME8A 1PX6A 3US3A 2E7PA 1F3AA 4ACSA 4HEA2 5H5RA 2N5BA 3HJOA 1K0NA 4HZ4A 3FHKA 3SWLA 5DALA 3M8NA 1SD8A 4G0IA 5G30A 4JE1A 2LRNA 3VK9A 2KLXA 3F63A 4NV5A 1PL1A 3HHVA 1J08A 2PN8A 2LRTA 2WS2A 3GL5A 4LMVA 3EYTA 5HR2A 2MMAA 3APSA 1VF4A 1EV4A 3GRXA 1NHOA 3F9UA 2C4JA 2LNSA 2FA8A 2DIZA 1B4PA 2X8CA 1OC9B 4V2MA 1A0FA 2ZNMA 3GTUA 1JZOA 1XW5A 4KB3A 4DSSB 2VLTA 2JZTA 4XS4B 5A4WA 1AQWA 2I4AA 3BCKA 1HD2A 4O5QA 2PPTA 2V6KA 3ERGA 4CY8A 1WRYA 2BJXA 5A4UA 2AAWA 2XPEA 6GSVA 3I9V2 4I97A 3R3EA 2ZUPA 4KH7A 4NHZA 1AXDA 2O87A 1ILOA 1ZMAA 1HNCA 1EGOA 2PUKC 1ZZYA 5CRDA 2N5AA 4F9ZA 1A2LA 4O32A 3TJFA 5IQYA 4Z7XA 4L8EA 4EVMA 4HI7A 4L0WA 2A2PA 3ED3A 1ACVA 4EKZA 2FA4A 4MF5A 3DEXA 4TR1A 1R26A 3LWAA 4MNNA 1T4ZA 2AYTA 3ZIVA 4V2LA 2LEGA 3D4TA 1VF3A 4MJEA 1EWXA 4D73A 3G7JA 1J9BA 2XHFA 4F82A 5G31A 3LGCA 1ZYEA 2HRAA 3DYRA 3TGZA 2AB6A 3GUSA 3GURA 2GVPA 5DALB 2YP6A 1A23A 1XG8A 3QD9A 2MMOA 2MMNA 3L0HA 1BEDA 1GSSA 2LKUA 3PGTA 4MF6A 1SK0A 2HZFA 4KGIA 4MMMA 4ZB9A 3TOUA 4RQXA 1XWGA 2H8LA 3O6TA 2F3MA 2FWGA 1C72A 1SJIA 3ZVJD 2IN3A 1AQVA 2IMDA 1SL0B 1U6TA 2IJYA 2RLIA 4MH3A 1TK8B 3VI7A 4EXJA 4ML1A 3CSHA 1ON4A 4QQ7A 2C0GA 5D93A 4GSTA 3GTUB 1XOAA 2MYGA 5HR1A 3L4NA 3KP9A 4NAXA 2YANA 1ABAA 4FYCA 3W8SA 3IK9A 2BMXA 1MEKA 2J9HA 2HRKA 1K0CA 4FH8A 2K18A 6GSSA 3KJYA 4MJAA 6GSTA 5D9VA 1FB6A 4L5LA 2R0PA 4CDOA 4PNFA 2F8FA 1ZYNA 2YWNA 5IO2A 3KD0A 5FHIA 5IMDA 1YKCA 1PFOA 4JRRA 5AIXA 4I2TA 1F37A 2HSMA 4PGTA 4F03A 4KDXA 9GSSA 2CVKA 1G6WA 3HYPA 3J7Yb 1G0TA 4K7NA 5E59A 5ECMB 3ERFA 2DIYA 5KN1A 3ZREA 1M2AA 1YKAA 2EIQA 1OE7A 2YWMA 4MZCA 4XTSA 2H66A 1HNBA 3EE2A 4PUAA 2KP2A 2WRTA 3E3EA 3FR6A 1JHBA 2GZPA 2VUPA 3QMXA 3VWUA 3MIXA 2F9SA 4TR4A 2I3YA 3TDGA 2LQOA 1I9DA 5GAPD 2RUFA 3HVXA 5J5NA 3WT1A 3KZQA 4I8BA 4E8EA 1DUGA 3HJMA 4ML6A 4V2NA 3KH9A 5JCWA 1EV9A 3IC4A 4KE3A 3VPQA 1TRUA 3C73A 2YWIA 3GN3A 1G6YA 1K3LA 5H5QA 3TKQA 1GWCA 3DXBA 3QPMA 3NIVA 2A4VA 5ECRB 2R37A 4QL9A 1SL2B 1FO5A 3AY8A 4HU7A 1J0FA 5HFGA 4TN8A 4WR4A 4BVYA 5EVOA 1O73A 4KF9A 1K0OA 2H75A 4DSQA 1XWBA 3WD6A 1GSEA 4HOJA 4MJCA 1FB0A 1PRXA 3HVVA 3HXSA 1OVNA 4ECCA 2FD3A 4JR6A 5IMAA 3DVWA 3TKSE 5D96A 4EIPA 1M9BA 3CSJA 4V1Ag 6GSWA 1V98A 3FZAA 4EUYA 4KDYA 3LXZA 2H73A 2MZCA 1R5AA 1XW6A 3QDNA 4CY6A 3WGEA 4J57E 3TRXA 1WPIA 2NDOA 4KNDA 1WP0A 1AUCA 3H93A 2YJ7A 2RUEA 5GSTA 5JWQB 3VLNA 2ALBA 1SD9A 19GSA 3KMNA 4PX1A 5IMVA 5ECNB 2HFDA 1IYIA 4IBPA 17GSA 3CQFA 1PX7A 3EWLA 1YEXA 3ZMKA 2NVLA 3F3QA 2QGVA 4G0LA 2OACA 4OFTA 4IS0A 4WF5A 5EL8A 2K6VA 4G9HA 4MCUA 5IPHA 1PKWA 3L9VA 2R0GA 2XBIA 4KW6A 3DMLA 4BVYB 2GSTA 2VL2C 3APOA 1I5GA 2L57A 1FW1A 4MZWA 4ZB6A 5A5KA 1GUKA 2GZYA 3F3RA 2H76A 2FCHA 1YEPA 2WDUA 2WZ9A 3IHGA 2IMIA 1TI3A 1WJKA 2M80A 3N5OA 4E8HA 1KNGA 2B7KA 3GNJA 1DE1A 3DWVA 1TU7A 3C71A 2EC4A 2VOCA 3UAPA 4G19A 4Z2UA 4X4JA 1TK5B 2GSSA 3IV4A 2HSHA 2H6YA 4GQCA 2YN1A 4ISDA 5J9CA 3M1GA 4EL1A 2L4QA 3UBKA 4IKHA 1THOA 3ZL5A 2IPAA 3IPZA 1XOBA 3FW2A 1PN0A 2F8AA 4EC0A 4OCFA 2O89A 1T4YA 2REMA 4K5SA 4ZIJA 1XZOA 3CBUA 3TJJA 1TU8A 4Z2RA 5AIVA 1EP8A 5J3RA 2V2GA 3KGKA 1FHEA 1GNWA 1S3AA 4MLYA 2A2SA 1E2YA 5G5EA 4BL7B 5CYYA 1TRVA 1X9WB 1ERWA 2GLRA 5ECPB 3F4RA 3IE3A 5LD0A 1Z9HA 5KOWA 3H79A 5IMCA 1FOHA 1A24A 1RW1A 2D2ZA 4USSA 2O85A 4N30A 4X1UA 4NHWA 4WXTA 3QAVA 4KX4A 1LJRA 2VCVA 6GSUA 1F6MC 1WOUA 3HY2A 4HU9A 3HJPA 14GSA 4K7OA 2BTOT 4BVXA 2FY6A 5IPGA 2CA8A 4YKFA 4PQ1A 3TB2A 3FZ4A 3DKSA 4K9ZA 2X8GA 1PN9A 1UA5A 1HNAA 3D6IA 5ELAA 4HJ2A 4F0CA 2I9HA 1VRSD 6GSYA 2CAIA 5B7CA 1K3OA 1BJXA 1WIKA 4I2UA 1X9MB 4O5RA 3W6GA 2Z9SA 4WEYA 3Q74A 3M3MA 2GTUA 3H8QA 4LL4B 4MZBA 1U87A 4BIKA 3GKKA 3LYKA 1B4QA 4GRFA 1ST9A 4OO5A 3M0FA 2YCDA 5IIZA 1A0RP 1BQ7A 5CRGA 5G2ZA 1NW2A 1SENA 3ME7A 5IO0A 4Q5QA 3S9FA 5DCHA 3FRCA 5L71A 2PU9C 2OADA 5DDLA 3DGQA 4KSOA 3WGDA 4MJBA 3Q19A 1OYJA 3VURA 3QAGA 2X64A 1KTEA 1TI1A 4Q5NA 1QK8A 1S3DA 4XRAA 2V6OA 2OJLA 4TKYA 1SK2A 3U6VA 3IR4A 4ECBA 3LXTA 2E0QA 4DEJA 2WGRA 4A5PA 2RIIA 3QFAC 4BVXB 1K3YA 1GSDA 4ZILA 5D73A 4RQRA 4XCSA 4GCIA 2F51A 2B1KA 2LJRA 2GSRA 5DAKA 5ID2A 3DRNA 4NXIA 2FNOA 5KOXA 4TR3A 2QC7A 2PWJA 4PUFC 1YY7A 4LLRA 1K0MA 1GTUA 1H4OA 2PERA 5KEJA 4MH2A 2DSAA 3BJ5A 4FIWA 5COHA 1GTIA 3FR3A 2HSYA 3KIJA 1PD21 3EURA 5INYA
chains in the Genus database with same CATH topology
3CYNA 1V9WA 5J41A 3E0UA 4JZQA 2M46A 4HZ2A 4O92A 4RUVA 1XWCA 3GX8A 3H4KA 3NZNA 2P5RA 4MABA 4IN0A 5J4UA 3L78A 3M9KA 3ZTLA 4GLTA 3TRPA 1S3CA 18GSA 3H1NA 4IVFA 5AGYA 4XIHA 2HE3A 3HA9A 5GZZB 5F8BA 1F9MA 1Z7RA 3UBLA 4GTUA 4Q5RA 2R5GA 4IELA 4MA9A 4JU5A 4ILFA 3IRAA 1SJ6A 5D9TA 5HFIA 4OFMA 3DVXA 2DJ0A 4P3YB 1V2AA 1XWAA 4K8MA 1KBNA 2AV4A 3KEBA 1M2DA 2KUCA 4KCAA 3O76A 4NWYA 1XXUA 2WFCA 3F0IA 1ML6A 5DAKB 5F07A 1B9XC 5ID2B 2LTKA 3IBHA 4IJ3A 3A3TA 4ZL7A 3I69A 4HJMA 4WF4A 1SKRB 3FMWA 3UL3A 1Z3EA 1EEMA 2YNXA 4WKWA 3EMXA 1QXHA 3GA4A 1YF0A 1ZOFA 2H6ZA 1GRXA 1TW9A 2JADA 2JSZA 4RI7A 4CW9A 5D9XA 4TR1B 4YQVA 2C3TA 4IP6A 4POMA 5CAXA 2HZEA 3IDVA 1UVZA 4D73B 3P8WA 1O81A 3G9BA 1K0AA 1ZYPA 4X43A 1WE0A 5G1KA 4IQAA 3ISOA 3UVHA 7GSSA 4ULXA 2CZ3A 3MNGA 5DQSA 3DD3A 1GLQA 3QR6A 4IQ1A 4IHUA 4RI6A 5JWRB 1V58A 3KTLA 1URMA 2GDRA 4XRDA 3FK8A 1A2JA 3TKRA 2HNLA 2VCZA 4IW9A 2IMKA 4WETA 2YV7A 2YZUA 2E2GA 4GXZA 4IGJA 1NHYA 2DJ2A 3F6DA 2H01A 4ICYA 2QKEA 3FY7A 5ENUA 3GSSA 4KCEA 2VM2A 3I6AA 5KN3A 1AAZA 4N10A 2IFQA 3LSZA 2KP1A 4K7IA 3DIEA 2JACA 2DKHA 2FGXA 3F6FA 2P31A 4L0UA 20GSA 2GQLA 3CTFA 3JCML 1ERVA 4NMUA 3ZZXA 1GULA 1TJDA 4ID0A 2H1BA 3GKNA 4KUNA 3C8EA 3K8NA 1A8LA 1Z6MA 2HYXA 3D0ZA 2HZEB 4XHMA 2I81A 1N8JA 2OKAA 2OE1A 3TJBA 1ZYQB 3ZITA 4PXOA 2H1GA 2FWHA 3A2VA 4I5QA 5B6NA 3M9JA 5ECQB 2H6XA 5F0GA 1GSFA 1OAZA 1GSUA 3IXRA 2DJ1A 2VAFA 1M2BA 5EPFA 1BYEA 5C04A 4AGSA 4WR5A 2VCWA 1PMTA 4F2IA 5DVBA 5BMUA 2C80A 3GHAA 1JZDA 3L9SA 2H0HA 1X5CA 3U5RE 2GQKA 2L5LA 3HKRA 2VL9A 3A2WA 2X4AA 2CT6A 4XS6A 2RM5A 1R4WA 2ON7A 1Y6EA 5IOXA 1PGTA 3GV1A 3O3TA 1SL1B 2O8VB 1GLPA 2LSTA 2XC2A 3D5JA 3IHQA 5JCUA 3L9UA 4ZL9A 2JSYA 2V1MA 5HR3A 1YDKA 2VIMA 2H74A 3EPTA 3GSTA 3UIWA 4MP4A 1MD3A 4EF0A 4CHSA 1YF1A 4HDEA 3KP8A 3R2QA 2IMEA 2P0GA 2VD0A 1WWJA 4TW5A 2FLSA 2CZ2A 4HQZA 4OCEA 2I1UA 4MPGA 1NM3A 1U3IA 2ES7A 1GH2A 4DVCA 4J2FA 4O7HA 4ECIA 2UZ8A 2QA1A 3Q18A 1E6BA 1MD4A 3EVIA 5F06A 2DMMA 1RQMA 4K0GA 4ZBDA 2AUVA 1TK0B 3G7IA 5C00A 3J7Yk 2NTOA 1LU4A 4H86A 2DC5A 4Q5FA 5GAND 3CTGA 4KAEA 1ZL9A 1JLVA 3SBCA 2OA7A 3CSIA 5J9BA 4G0KA 4FYUA 3F8UA 3IC8A 2B6MA 4L5OA 2G0FA 2GGTA 2L59A 4TXOA 3RDWA 3BBYA 4YAPA 1UN2A 2LQQA 2DKIA 5ECIB 4OFNA 1FVKA 1FOVA 1T1VA 1TTZA 5KN2A 1ZGNA 2GT6A 3EINA 5ECLB 3RBTA 2QSIA 1T7PB 2E2MA 3HZ8A 4IJIA 3KMOA 1G7OA 1KEBA 5HR0A 2TIRA 1EGRA 3ZIJA 1V40A 3ZLPA 2PVOC 3TKSA 2K8SA 2L6DA 3P7XA 1OC9A 3KH7A 1O6JA 4HUAA 1H75A 5IOWA 1CQGA 2N5FA 2MBSA 2YPMA 3ZFBA 3W8JA 1EP7A 3LFLA 2VD1A 4XS4A 2J23A 3BOAA 2B5YA 5ECHB 5IMFA 1T3BA 4PNGA 4KDUA 1EOGA 2DLXA 2C0DA 4LA1A 3CRTA 2WCIA 4ZBBA 1THXA 1QFNA 1DSBA 1TRWA 2DMLA 5AISA 4OMVA 3WGXA 1TRSA 2OE3A 4ZL8A 1Q98A 1CQHA 3KM6A 2IMFA 12GSA 1XPVA 1RK4A 2MBTA 1UC7A 3TKPA 4TRXA 5BRTA 2GSQA 3KXOA 2EIOA 5CP1A 2EIRA 3LEFA 1AW9A 4N11A 3FZ9A 5ECOB 4DSRA 1JFUA 4TXOB 2JZSA 2DBCA 5DJLA 2JL4A 1FVJA 2VLUA 6GSXA 4K0NA 3A2XA 5CRHA 3QFBC 13GSA 5FT3A 5G1LA 3EU4A 2YZHA 1GSYA 4ZBAA 3EC3A 1GUHA 3FEUA 3UOMA 2NPBA 1Z6NA 2X49A 2H19A 2H0GA 1HQOA 1YZXA 1JLWA 3GKXA 2FWFA 5HQPA 4EDZA 1XCCA 1JZWA 2V32A 2IL3A 1ERTA 3ZVJA 5HFKA 4K1FA 1VGLA 1ERUA 1TXXA 4POLA 1MDKA 3FZ5A 4MPFA 4X0XA 5D8IA 3TRQA 2A2RA 1QUWA 1XW9A 2CX4A 4JEDA 2KHPA 4IP1A 2GS3A 3HD5A 2CQ9A 2CX3A 2L5OA 3P90A 1A2MA 2M72A 4TR0A 5EY6A 4FO5A 2DJKA 3IAS2 2WJUA 1EOHA 2OBKA 2VCQA 2PGTA 1A8YA 4AJ7A 22GSA 1ZCPA 2WULA 2DJJA 3GKMA 2R6KA 5ABRA 1SKSB 3KTBA 4GSSA 1Q4JA 1OC8A 3E9JB 3MYDA 4EE0A 2C8UA 2JZRA 2OE0A 4MF7A 2IIYA 1GUMA 5DCGA 3IOSA 2VM1A 1G7EA 3ZYWA 2C0FA 2B7JA 3FKFA 5CRWA 2O7KA 1YJ6A 2VCTA 3VI5A 3HDCA 2XPDA 1O8XA 3HVSA 1EEJA 1GNEA 3C7MA 2FHEA 1FAAA 2VL3A 8GSSA 1W4VA 1F3BA 5IM9A 2AHEA 2B5XA 2DJ3A 4NV2A 4TXVA 4EIQA 3G7YA 1XWKA 1X5DA 1FG4A 5LNKe 2C3NA 2PMTA 3APQA 3CXGA 1SKWB 2YOIA 4PQHA 3TJKA 2CVBA 4PTSA 3TOTA 4TVEA 4ZXGA 5D9WA 2PBJA 3D22A 1BG5A 4AJ8A 2CV4A 4OO4A 5F05A 2C0EA 1M0UA 3PR8A 3RHBA 4HQSA 1XVWA 3Q6OA 3ZMLA 3IK7A 2H72A 3D21A 5DQYA 1HYUA 1Z5YE 3BCIA 4HS1A 1XFLA 2C1YA 2XBQA 3GL3A 3VFIA 5B6MA 2R3XA 4OWYA 5E4WA 1K0BA 4K6XA 2FUG2 4I6XA 4YAVA 4XS1A 3VWWA 1YQ1A 1R7HA 3I43A 4N0ZA 4GF0A 1PA3A 1MTCA 3MWHA 4POBA 4YKGA 2H1DA 3MDKA 2K8VA 3KCMA 4TOPA 3TUEA 1B9YC 1EZKA 4G2EA 3GH6A 4BWSA 1MDJA 2X8HA 1XVQA 4OD7A 2FWEA 5DJMA 3LW9A 3WYWA 1Y25A 1K0DA 3EU3A 5ELGA 5FWGA 1OKTA 3FYGA 2H0IA 1X0RA 4YQUA 3UVTA 5GSSA 5CREA 3LORA 1SYXA 3UEMA 3VWXA 2V41A 3MSZA 5B8BA 2R0CA 4FQUA 4BA7A 4GQFA 1VF1A 5H5SA 2CAQA 2LUSA 3LQ7A 4NPBA 5KN0A 4FYBA 2P5QA 2ON5A 4J56E 2YV9A 1LBKA 1U88A 3GYKA 3WT2A 4N0VA 4V1Ap 4GWRA 2NBSA 3ZRDA 3CMIA 1GL8A 1NSWA 1JZRA 1TDIA 2CVDA 3FR9A 3F4TA 3PPUA 5AN1A 2LV3A 3GFKA 1GSQA 2TRXA 2VLVA 3GMFA 2LNTA 1OKDA 1QMVA 2GZZA 1PQNA 1AIUA 1N2AA 2HI7A 3TJGA 3QAWA 3A5IA 2IFQB 2VL2A 1O85A 1AQXA 1R5PA 1DE2A 1SU9A 2VO4A 3MAKA 3PINA 3CRUA 2LS5A 1VF2A 3D4MA 2B3SA 3RPPA 4BL7A 3IAM2 3QCPA 1DBYA 2QA2A 2L4CA 3ZFLA 2KOKA 4ZB8A 1QQ2A 5CNWA 4K2XA 5B8AA 3EMPA 4LMWA 2HXKA 2GQMA 1GP1A 4QL7A 3V1WA 5CO3A 4WBJA 1M7TA 4PURA 4WBRD 4EO3A 2LJKA 2HT9A 2K9FA 1SJZA 1TP9A 3UJ1A 3P2AA 2B5EA 4F0BA 1SK1A 3PH9A 1T00A 2AJQB 4YH2A 2B1LA 1TOFA 2JU5A 2HRFA 4MK3A 3RPNA 3VWVA 2L6CA 4JR4A 3BD2A 1M99A 1GTAA 4K5RA 1F2EA 5A4VA 4Z2TA 1X9SB 1M9AA 3UARA 1USBA 1TKDB 2WB9A 3UMAA 4KSMA 3HZ4A 3LJRA 2MMZA 1PSQA 1U3AA 4G10A 4O5UA 3NOFA 2YJHA 2VCXA 1WMJA 5LCZA 5DBQA 4POKA 1XBSA 2YWOA 3C1RA 4YQMA 4MDCA 1T8EB 5ECSA 11GSA 4BWQA 1B8XA 1XIYA 3GIXA 4AF2A 2H1AA 3GH9A 1OC3A 1PL2A 1Z7PA 2TRCP 2H30A 2G2QA 2ZCTA 1GTBA 3RHCA 1O8WA 3ERWA 1W89A 2PVQA 1MDIA 2RM6A 1V57A 4K2DA 3OR5A 4AJ6A 5IMZA 2R4VA 2IWTA 16GSA 10GSA 4DSSA 2R2JA 3F4SA 2LJAA 2OBIA 2GT5A 4BPYA 1BX9A 2LRCA 3RAZA 2HRNA 4ECJA 1B48A 1PKZA 1OE8A 3A5WA 3GX0A 5JCGA 5ECKB 1AC1A 2X99A 5JWOB 3VPTA 3TKSC 5G5FA 3IA1A 3N9JA 4JBBA 2H70A 3LYPA 2H71A 1X5EA 1O7UA 3LG6A 4GSNA 1SYRA 4KA0A 2C3QA 3C1SA 1QGVA 1BAYA 3TCOA 3HCZA 4PQIA 2HLSA 4EDYA 3QOUA 2A4HA 1IYHA 4LL1B 3ME8A 1PX6A 3US3A 2E7PA 1F3AA 4ACSA 4HEA2 5H5RA 2N5BA 3HJOA 1K0NA 4HZ4A 3FHKA 3SWLA 5DALA 3M8NA 1SD8A 4G0IA 5G30A 4JE1A 2LRNA 3VK9A 2KLXA 3F63A 4NV5A 1PL1A 3HHVA 1J08A 2PN8A 2LRTA 2WS2A 3GL5A 4LMVA 3EYTA 5HR2A 2MMAA 3APSA 1VF4A 1EV4A 3GRXA 1NHOA 3F9UA 2C4JA 2LNSA 2FA8A 2DIZA 1B4PA 2X8CA 1OC9B 4V2MA 1A0FA 2ZNMA 3GTUA 1JZOA 1XW5A 4KB3A 4DSSB 2VLTA 2JZTA 4XS4B 5A4WA 1AQWA 2I4AA 3BCKA 1HD2A 4O5QA 2PPTA 2V6KA 3ERGA 4CY8A 1WRYA 2BJXA 5A4UA 2AAWA 2XPEA 6GSVA 3I9V2 4I97A 3R3EA 2ZUPA 4KH7A 4NHZA 1AXDA 2O87A 1ILOA 1ZMAA 1HNCA 1EGOA 2PUKC 1ZZYA 5CRDA 2N5AA 4F9ZA 1A2LA 4O32A 3TJFA 5IQYA 4Z7XA 4L8EA 4EVMA 4HI7A 4L0WA 2A2PA 3ED3A 1ACVA 4EKZA 2FA4A 4MF5A 3DEXA 4TR1A 1R26A 3LWAA 4MNNA 1T4ZA 2AYTA 3ZIVA 4V2LA 2LEGA 3D4TA 1VF3A 4MJEA 1EWXA 4D73A 3G7JA 1J9BA 2XHFA 4F82A 5G31A 3LGCA 1ZYEA 2HRAA 3DYRA 3TGZA 2AB6A 3GUSA 3GURA 2GVPA 5DALB 2YP6A 1A23A 3QD9A 2MMOA 2MMNA 3L0HA 1BEDA 1GSSA 2LKUA 3PGTA 4MF6A 1SK0A 2HZFA 4KGIA 4MMMA 4ZB9A 3TOUA 4RQXA 1XWGA 2H8LA 3O6TA 2F3MA 2FWGA 1C72A 1SJIA 3ZVJD 2IN3A 1AQVA 2IMDA 1SL0B 1U6TA 2IJYA 2RLIA 4MH3A 1TK8B 3VI7A 4EXJA 4ML1A 3CSHA 1ON4A 4QQ7A 2C0GA 5D93A 4GSTA 3GTUB 1XOAA 2MYGA 5HR1A 3L4NA 3KP9A 4NAXA 2YANA 1ABAA 4FYCA 3W8SA 3IK9A 2BMXA 1MEKA 2J9HA 2HRKA 1K0CA 4FH8A 2K18A 6GSSA 3KJYA 4MJAA 6GSTA 5D9VA 1FB6A 4L5LA 2R0PA 4CDOA 4PNFA 2F8FA 1ZYNA 2YWNA 5IO2A 3KD0A 5FHIA 5IMDA 1YKCA 4JRRA 5AIXA 4I2TA 1F37A 2HSMA 4PGTA 4F03A 4KDXA 9GSSA 2CVKA 1G6WA 3HYPA 3J7Yb 1G0TA 4K7NA 5E59A 5ECMB 3ERFA 2DIYA 5KN1A 3ZREA 1M2AA 1YKAA 2EIQA 1OE7A 2YWMA 4MZCA 4XTSA 2H66A 1HNBA 3EE2A 4PUAA 2KP2A 2WRTA 3E3EA 3FR6A 1JHBA 2GZPA 2VUPA 3QMXA 3VWUA 3MIXA 2F9SA 4TR4A 2I3YA 3TDGA 2LQOA 1I9DA 5GAPD 2RUFA 3HVXA 5J5NA 3WT1A 3KZQA 4I8BA 4E8EA 1DUGA 3HJMA 4ML6A 4V2NA 3KH9A 5JCWA 1EV9A 3IC4A 4KE3A 3VPQA 1TRUA 3C73A 2YWIA 3GN3A 1G6YA 1K3LA 5H5QA 3TKQA 1GWCA 3DXBA 3QPMA 3NIVA 2A4VA 5ECRB 2R37A 4QL9A 1SL2B 1FO5A 3AY8A 4HU7A 1J0FA 5HFGA 4TN8A 4WR4A 4BVYA 5EVOA 1O73A 4KF9A 1K0OA 2H75A 4DSQA 1XWBA 3WD6A 1GSEA 4HOJA 4MJCA 1FB0A 1PRXA 3HVVA 3HXSA 1OVNA 4ECCA 2FD3A 4JR6A 5IMAA 3DVWA 3TKSE 5D96A 4EIPA 1M9BA 3CSJA 4V1Ag 6GSWA 1V98A 3FZAA 4EUYA 4KDYA 3LXZA 2H73A 2MZCA 1R5AA 1XW6A 3QDNA 4CY6A 3WGEA 4J57E 3TRXA 1WPIA 2NDOA 4KNDA 1WP0A 1AUCA 3H93A 2YJ7A 2RUEA 5GSTA 5JWQB 3VLNA 2ALBA 1SD9A 19GSA 3KMNA 4PX1A 5IMVA 5ECNB 2HFDA 1IYIA 4IBPA 17GSA 3EWLA 1PX7A 3ZMKA 1YEXA 2NVLA 3F3QA 2QGVA 4G0LA 2OACA 4OFTA 4IS0A 4WF5A 5EL8A 2K6VA 4G9HA 4MCUA 5IPHA 1PKWA 3L9VA 2R0GA 2XBIA 4KW6A 3DMLA 4BVYB 2GSTA 2VL2C 3APOA 1I5GA 2L57A 1FW1A 4MZWA 4ZB6A 5A5KA 1GUKA 2GZYA 3F3RA 2H76A 2FCHA 1YEPA 2WDUA 2WZ9A 3IHGA 2IMIA 1TI3A 1WJKA 2M80A 3N5OA 4E8HA 1KNGA 2B7KA 3GNJA 1DE1A 3DWVA 1TU7A 3C71A 2EC4A 2VOCA 3UAPA 4G19A 4Z2UA 4X4JA 1TK5B 2GSSA 3IV4A 2HSHA 2H6YA 4GQCA 2YN1A 4ISDA 5J9CA 3M1GA 4EL1A 2L4QA 3UBKA 4IKHA 1THOA 3ZL5A 2IPAA 3IPZA 1XOBA 3FW2A 1PN0A 2F8AA 4EC0A 4OCFA 2O89A 1T4YA 2REMA 4K5SA 4ZIJA 1XZOA 3CBUA 3TJJA 1TU8A 4Z2RA 5AIVA 1EP8A 5J3RA 2V2GA 3KGKA 1FHEA 1GNWA 1S3AA 4MLYA 2A2SA 1E2YA 5G5EA 4BL7B 5CYYA 1TRVA 1X9WB 1ERWA 2GLRA 5ECPB 3F4RA 3IE3A 5LD0A 1Z9HA 5KOWA 3H79A 5IMCA 1FOHA 1A24A 1RW1A 2D2ZA 4USSA 2O85A 4N30A 4X1UA 4NHWA 4WXTA 3QAVA 4KX4A 1LJRA 2VCVA 6GSUA 1F6MC 1WOUA 3HY2A 4HU9A 3HJPA 14GSA 4K7OA 2BTOT 4BVXA 2FY6A 5IPGA 2CA8A 4YKFA 4PQ1A 3TB2A 3FZ4A 3DKSA 4K9ZA 2X8GA 1PN9A 1UA5A 1HNAA 3D6IA 5ELAA 4HJ2A 4F0CA 2I9HA 1VRSD 6GSYA 2CAIA 5B7CA 1K3OA 1BJXA 1WIKA 4I2UA 1X9MB 4O5RA 3W6GA 2Z9SA 4WEYA 3Q74A 3M3MA 2GTUA 3H8QA 4LL4B 4MZBA 1U87A 3GKKA 3LYKA 1B4QA 4GRFA 1ST9A 4OO5A 3M0FA 2YCDA 5IIZA 1A0RP 1BQ7A 5CRGA 5G2ZA 1NW2A 1SENA 3ME7A 5IO0A 4Q5QA 3S9FA 5DCHA 3FRCA 5L71A 2PU9C 2OADA 5DDLA 3DGQA 4KSOA 3WGDA 4MJBA 3Q19A 1OYJA 3VURA 3QAGA 2X64A 1KTEA 1TI1A 4Q5NA 1QK8A 1S3DA 4XRAA 2V6OA 2OJLA 4TKYA 1SK2A 3U6VA 3IR4A 4ECBA 3LXTA 2E0QA 4DEJA 2WGRA 4A5PA 2RIIA 3QFAC 4BVXB 1K3YA 1GSDA 4ZILA 5D73A 4RQRA 4XCSA 4GCIA 2F51A 2B1KA 2LJRA 2GSRA 5DAKA 5ID2A 3DRNA 4NXIA 2FNOA 5KOXA 4TR3A 2QC7A 2PWJA 4PUFC 1YY7A 4LLRA 1K0MA 1GTUA 1H4OA 2PERA 5KEJA 4MH2A 2DSAA 3BJ5A 4FIWA 5COHA 1GTIA 3FR3A 2HSYA 3KIJA 1PD21 3EURA 5INYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CYN A;  1V9W A;  5J41 A;  3E0U A;  4JZQ A;  2M46 A;  4HZ2 A;  4O92 A;  4RUV A;  1XWC A;  3GX8 A;  3H4K A;  3NZN A;  2P5R A;  4MAB A;  4IN0 A;  5J4U A;  3L78 A;  3M9K A;  3ZTL A;  4GLT A;  3TRP A;  1S3C A;  18GS A;  3H1N A;  4IVF A;  5AGY A;  4XIH A;  2HE3 A;  3HA9 A;  5GZZ B;  5F8B A;  1F9M A;  1Z7R A;  3UBL A;  4GTU A;  4Q5R A;  2R5G A;  4IEL A;  4MA9 A;  4JU5 A;  4ILF A;  3IRA A;  1SJ6 A;  5D9T A;  5HFI A;  4OFM A;  3DVX A;  2DJ0 A;  4P3Y B;  1V2A A;  1XWA A;  4K8M A;  1KBN A;  2AV4 A;  3KEB A;  1M2D A;  2KUC A;  4KCA A;  3O76 A;  4NWY A;  1XXU A;  2WFC A;  3F0I A;  1ML6 A;  5DAK B;  5F07 A;  1B9X C;  5ID2 B;  2LTK A;  3IBH A;  4IJ3 A;  3A3T A;  4ZL7 A;  3I69 A;  4HJM A;  4WF4 A;  1SKR B;  3UL3 A;  1Z3E A;  1EEM A;  2YNX A;  4WKW A;  3EMX A;  1QXH A;  3GA4 A;  1YF0 A;  1ZOF A;  2H6Z A;  1GRX A;  1TW9 A;  2JAD A;  2JSZ A;  4RI7 A;  4CW9 A;  5D9X A;  4TR1 B;  4YQV A;  2C3T A;  4IP6 A;  4POM A;  5CAX A;  2HZE A;  3IDV A;  1UVZ A;  4D73 B;  3P8W A;  1O81 A;  3G9B A;  1K0A A;  4X43 A;  1WE0 A;  5G1K A;  4IQA A;  3ISO A;  3UVH A;  7GSS A;  4ULX A;  2CZ3 A;  3MNG A;  5DQS A;  3DD3 A;  1GLQ A;  3QR6 A;  4IQ1 A;  4IHU A;  4RI6 A;  5JWR B;  1V58 A;  3KTL A;  1URM A;  2GDR A;  4XRD A;  3FK8 A;  1A2J A;  3TKR A;  2HNL A;  2VCZ A;  4IW9 A;  2IMK A;  4WET A;  2YV7 A;  2YZU A;  2E2G A;  4GXZ A;  4IGJ A;  1NHY A;  2DJ2 A;  3F6D A;  2H01 A;  2QKE A;  3FY7 A;  5ENU A;  3GSS A;  4KCE A;  2VM2 A;  3I6A A;  5KN3 A;  1AAZ A;  4N10 A;  2IFQ A;  3LSZ A;  2KP1 A;  4K7I A;  3DIE A;  2JAC A;  2FGX A;  3F6F A;  2P31 A;  4L0U A;  20GS A;  2GQL A;  3CTF A;  3JCM L;  1ERV A;  4NMU A;  3ZZX A;  1GUL A;  1TJD A;  4ID0 A;  2H1B A;  3GKN A;  4KUN A;  3C8E A;  3K8N A;  1A8L A;  1Z6M A;  2HYX A;  3D0Z A;  2HZE B;  4XHM A;  2I81 A;  1N8J A;  2OKA A;  2OE1 A;  3TJB A;  1ZYQ B;  3ZIT A;  4PXO A;  2H1G A;  2FWH A;  3A2V A;  4I5Q A;  5B6N A;  3M9J A;  5ECQ B;  2H6X A;  5F0G A;  1GSF A;  1OAZ A;  1GSU A;  3IXR A;  2DJ1 A;  2VAF A;  1M2B A;  5EPF A;  1BYE A;  5C04 A;  4AGS A;  4WR5 A;  2VCW A;  1PMT A;  4F2I A;  5DVB A;  2C80 A;  3GHA A;  1JZD A;  3L9S A;  2H0H A;  1X5C A;  3U5R E;  2GQK A;  2L5L A;  3HKR A;  2VL9 A;  3A2W A;  2CT6 A;  4XS6 A;  2RM5 A;  1R4W A;  2ON7 A;  1Y6E A;  5IOX A;  1PGT A;  3GV1 A;  3O3T A;  1SL1 B;  2O8V B;  1GLP A;  2LST A;  2XC2 A;  3D5J A;  3IHQ A;  5JCU A;  3L9U A;  4ZL9 A;  2JSY A;  2V1M A;  5HR3 A;  1YDK A;  2VIM A;  2H74 A;  3GST A;  3UIW A;  4MP4 A;  1MD3 A;  4EF0 A;  4CHS A;  1YF1 A;  4HDE A;  3KP8 A;  3R2Q A;  2IME A;  2P0G A;  2VD0 A;  1WWJ A;  4TW5 A;  2FLS A;  2CZ2 A;  4HQZ A;  4OCE A;  2I1U A;  4MPG A;  1NM3 A;  1U3I A;  2ES7 A;  1GH2 A;  4DVC A;  4J2F A;  4O7H A;  4ECI A;  3Q18 A;  1E6B A;  1MD4 A;  3EVI A;  5F06 A;  2DMM A;  1RQM A;  4K0G A;  4ZBD A;  2AUV A;  1TK0 B;  3G7I A;  5C00 A;  3J7Y k;  2NTO A;  1LU4 A;  4H86 A;  2DC5 A;  4Q5F A;  5GAN D;  3CTG A;  4KAE A;  1ZL9 A;  1JLV A;  3SBC A;  2OA7 A;  3CSI A;  5J9B A;  4FYU A;  3F8U A;  2B6M A;  4L5O A;  2G0F A;  2GGT A;  2L59 A;  4TXO A;  3RDW A;  3BBY A;  4YAP A;  1UN2 A;  2LQQ A;  5ECI B;  4OFN A;  1FVK A;  1FOV A;  1T1V A;  1TTZ A;  5KN2 A;  1ZGN A;  2GT6 A;  3EIN A;  5ECL B;  3RBT A;  2QSI A;  1T7P B;  2E2M A;  3HZ8 A;  4IJI A;  3KMO A;  1G7O A;  1KEB A;  5HR0 A;  2TIR A;  1EGR A;  3ZIJ A;  1V40 A;  3ZLP A;  2PVO C;  3TKS A;  2K8S A;  2L6D A;  3P7X A;  1OC9 A;  3KH7 A;  1O6J A;  4HUA A;  1H75 A;  5IOW A;  1CQG A;  2N5F A;  2MBS A;  2YPM A;  3ZFB A;  3W8J A;  1EP7 A;  3LFL A;  2VD1 A;  4XS4 A;  2J23 A;  3BOA A;  2B5Y A;  5ECH B;  5IMF A;  1T3B A;  4PNG A;  4KDU A;  1EOG A;  2DLX A;  2C0D A;  4LA1 A;  3CRT A;  2WCI A;  4ZBB A;  1THX A;  1QFN A;  1DSB A;  1TRW A;  2DML A;  5AIS A;  4OMV A;  3WGX A;  1TRS A;  2OE3 A;  4ZL8 A;  1Q98 A;  1CQH A;  3KM6 A;  2IMF A;  12GS A;  1XPV A;  1RK4 A;  2MBT A;  1UC7 A;  3TKP A;  4TRX A;  2GSQ A;  3KXO A;  2EIO A;  5CP1 A;  2EIR A;  3LEF A;  1AW9 A;  4N11 A;  3FZ9 A;  5ECO B;  4DSR A;  1JFU A;  4TXO B;  2JZS A;  2DBC A;  5DJL A;  2JL4 A;  1FVJ A;  2VLU A;  6GSX A;  4K0N A;  3A2X A;  5CRH A;  3QFB C;  13GS A;  5FT3 A;  5G1L A;  3EU4 A;  2YZH A;  1GSY A;  4ZBA A;  3EC3 A;  1GUH A;  3FEU A;  3UOM A;  2NPB A;  1Z6N A;  2H19 A;  2H0G A;  1HQO A;  1YZX A;  1JLW A;  3GKX A;  2FWF A;  5HQP A;  4EDZ A;  1XCC A;  1JZW A;  2V32 A;  2IL3 A;  1ERT A;  3ZVJ A;  5HFK A;  4K1F A;  1VGL A;  1ERU A;  1TXX A;  4POL A;  1MDK A;  3FZ5 A;  4MPF A;  4X0X A;  5D8I A;  3TRQ A;  2A2R A;  1QUW A;  1XW9 A;  2CX4 A;  4JED A;  2KHP A;  4IP1 A;  2GS3 A;  3HD5 A;  2CQ9 A;  2CX3 A;  2L5O A;  3P90 A;  1A2M A;  2M72 A;  4TR0 A;  5EY6 A;  4FO5 A;  2DJK A;  3IAS 2;  2WJU A;  1EOH A;  2OBK A;  2VCQ A;  2PGT A;  1A8Y A;  4AJ7 A;  22GS A;  1ZCP A;  2WUL A;  2DJJ A;  3GKM A;  2R6K A;  5ABR A;  1SKS B;  3KTB A;  4GSS A;  1Q4J A;  1OC8 A;  3E9J B;  4EE0 A;  2C8U A;  2JZR A;  2OE0 A;  4MF7 A;  2IIY A;  1GUM A;  5DCG A;  3IOS A;  2VM1 A;  1G7E A;  3ZYW A;  2C0F A;  2B7J A;  3FKF A;  5CRW A;  2O7K A;  1YJ6 A;  2VCT A;  3VI5 A;  3HDC A;  2XPD A;  1O8X A;  3HVS A;  1EEJ A;  1GNE A;  3C7M A;  2FHE A;  1FAA A;  2VL3 A;  8GSS A;  1W4V A;  1F3B A;  5IM9 A;  2AHE A;  2B5X A;  2DJ3 A;  4NV2 A;  4TXV A;  3G7Y A;  1XWK A;  1X5D A;  1FG4 A;  5LNK e;  2C3N A;  2PMT A;  3APQ A;  3CXG A;  1SKW B;  2YOI A;  4PQH A;  3TJK A;  2CVB A;  3TOT A;  4TVE A;  4ZXG A;  5D9W A;  2PBJ A;  3D22 A;  1BG5 A;  4AJ8 A;  2CV4 A;  4OO4 A;  5F05 A;  2C0E A;  1M0U A;  3PR8 A;  3RHB A;  4HQS A;  1XVW A;  3Q6O A;  3ZML A;  3IK7 A;  2H72 A;  3D21 A;  5DQY A;  1HYU A;  1Z5Y E;  3BCI A;  4HS1 A;  1XFL A;  2C1Y A;  2XBQ A;  3GL3 A;  3VFI A;  5B6M A;  2R3X A;  4OWY A;  5E4W A;  1K0B A;  4K6X A;  2FUG 2;  4I6X A;  4YAV A;  4XS1 A;  3VWW A;  1YQ1 A;  1R7H A;  3I43 A;  4N0Z A;  4GF0 A;  1PA3 A;  1MTC A;  3MWH A;  4POB A;  2H1D A;  3MDK A;  2K8V A;  3KCM A;  4TOP A;  3TUE A;  1B9Y C;  1EZK A;  4G2E A;  3GH6 A;  4BWS A;  1MDJ A;  2X8H A;  1XVQ A;  4OD7 A;  2FWE A;  5DJM A;  3WYW A;  1Y25 A;  1K0D A;  3EU3 A;  5ELG A;  5FWG A;  1OKT A;  3FYG A;  2H0I A;  1X0R A;  4YQU A;  3UVT A;  5GSS A;  5CRE A;  3LOR A;  1SYX A;  3UEM A;  3VWX A;  2V41 A;  3MSZ A;  5B8B A;  4BA7 A;  4GQF A;  1VF1 A;  5H5S A;  2CAQ A;  2LUS A;  3LQ7 A;  4NPB A;  5KN0 A;  4FYB A;  2P5Q A;  2ON5 A;  4J56 E;  2YV9 A;  1LBK A;  1U88 A;  3GYK A;  3WT2 A;  4N0V A;  4V1A p;  4GWR A;  2NBS A;  3ZRD A;  3CMI A;  1GL8 A;  1NSW A;  1JZR A;  1TDI A;  2CVD A;  3FR9 A;  3F4T A;  5AN1 A;  2LV3 A;  3GFK A;  1GSQ A;  2TRX A;  2VLV A;  3GMF A;  2LNT A;  1OKD A;  1QMV A;  2GZZ A;  1PQN A;  1AIU A;  1N2A A;  2HI7 A;  3TJG A;  3QAW A;  2IFQ B;  2VL2 A;  1O85 A;  1AQX A;  1R5P A;  1DE2 A;  1SU9 A;  2VO4 A;  3MAK A;  3PIN A;  3CRU A;  2LS5 A;  1VF2 A;  3D4M A;  2B3S A;  3RPP A;  4BL7 A;  3IAM 2;  3QCP A;  1DBY A;  2L4C A;  3ZFL A;  2KOK A;  4ZB8 A;  1QQ2 A;  5CNW A;  5B8A A;  3EMP A;  4LMW A;  2HXK A;  2GQM A;  1GP1 A;  4QL7 A;  3V1W A;  5CO3 A;  4WBJ A;  1M7T A;  4PUR A;  4WBR D;  4EO3 A;  2LJK A;  2HT9 A;  2K9F A;  1SJZ A;  1TP9 A;  3UJ1 A;  3P2A A;  2B5E A;  4F0B A;  1SK1 A;  3PH9 A;  1T00 A;  2AJQ B;  4YH2 A;  2B1L A;  1TOF A;  2JU5 A;  2HRF A;  4MK3 A;  3RPN A;  3VWV A;  2L6C A;  4JR4 A;  3BD2 A;  1M99 A;  1GTA A;  1F2E A;  5A4V A;  1X9S B;  1M9A A;  3UAR A;  1USB A;  1TKD B;  2WB9 A;  3UMA A;  4KSM A;  3HZ4 A;  3LJR A;  2MMZ A;  1PSQ A;  1U3A A;  4G10 A;  3NOF A;  2YJH A;  2VCX A;  1WMJ A;  5LCZ A;  5DBQ A;  4POK A;  1XBS A;  2YWO A;  3C1R A;  4YQM A;  4MDC A;  1T8E B;  5ECS A;  11GS A;  4BWQ A;  1B8X A;  1XIY A;  3GIX A;  4AF2 A;  2H1A A;  3GH9 A;  1OC3 A;  1PL2 A;  1Z7P A;  2TRC P;  2H30 A;  2G2Q A;  2ZCT A;  1GTB A;  3RHC A;  1O8W A;  3ERW A;  1W89 A;  2PVQ A;  1MDI A;  2RM6 A;  1V57 A;  4K2D A;  3OR5 A;  4AJ6 A;  5IMZ A;  2R4V A;  2IWT A;  16GS A;  10GS A;  4DSS A;  2R2J A;  3F4S A;  2LJA A;  2OBI A;  2GT5 A;  4BPY A;  1BX9 A;  2LRC A;  3RAZ A;  2HRN A;  4ECJ A;  1B48 A;  1PKZ A;  1OE8 A;  3A5W A;  3GX0 A;  5JCG A;  5ECK B;  1AC1 A;  2X99 A;  5JWO B;  3VPT A;  3TKS C;  5G5F A;  3IA1 A;  3N9J A;  4JBB A;  2H70 A;  3LYP A;  2H71 A;  1X5E A;  1O7U A;  3LG6 A;  4GSN A;  1SYR A;  4KA0 A;  2C3Q A;  3C1S A;  1QGV A;  1BAY A;  3TCO A;  3HCZ A;  4PQI A;  2HLS A;  4EDY A;  3QOU A;  1IYH A;  4LL1 B;  3ME8 A;  1PX6 A;  3US3 A;  2E7P A;  1F3A A;  4ACS A;  4HEA 2;  5H5R A;  2N5B A;  3HJO A;  1K0N A;  4HZ4 A;  3FHK A;  3SWL A;  5DAL A;  3M8N A;  1SD8 A;  5G30 A;  4JE1 A;  2LRN A;  3VK9 A;  2KLX A;  3F63 A;  4NV5 A;  1PL1 A;  3HHV A;  1J08 A;  2PN8 A;  2LRT A;  2WS2 A;  3GL5 A;  4LMV A;  3EYT A;  5HR2 A;  2MMA A;  3APS A;  1VF4 A;  1EV4 A;  3GRX A;  1NHO A;  3F9U A;  2C4J A;  2LNS A;  2FA8 A;  2DIZ A;  1B4P A;  2X8C A;  1OC9 B;  4V2M A;  1A0F A;  2ZNM A;  3GTU A;  1JZO A;  1XW5 A;  4KB3 A;  4DSS B;  2VLT A;  2JZT A;  4XS4 B;  5A4W A;  1AQW A;  2I4A A;  3BCK A;  1HD2 A;  2PPT A;  2V6K A;  3ERG A;  1WRY A;  2BJX A;  5A4U A;  2AAW A;  2XPE A;  6GSV A;  3I9V 2;  4I97 A;  2ZUP A;  4KH7 A;  4NHZ A;  1AXD A;  2O87 A;  1ILO A;  1ZMA A;  1HNC A;  1EGO A;  2PUK C;  1ZZY A;  5CRD A;  2N5A A;  4F9Z A;  1A2L A;  4O32 A;  3TJF A;  5IQY A;  4Z7X A;  4L8E A;  4EVM A;  4HI7 A;  4L0W A;  3ED3 A;  1ACV A;  4EKZ A;  2FA4 A;  4MF5 A;  3DEX A;  4TR1 A;  1R26 A;  3LWA A;  1T4Z A;  2AYT A;  3ZIV A;  4V2L A;  2LEG A;  3D4T A;  1VF3 A;  4MJE A;  1EWX A;  4D73 A;  3G7J A;  1J9B A;  2XHF A;  4F82 A;  5G31 A;  3LGC A;  1ZYE A;  3DYR A;  3TGZ A;  2AB6 A;  3GUS A;  3GUR A;  2GVP A;  5DAL B;  2YP6 A;  1A23 A;  3QD9 A;  2MMO A;  2MMN A;  3L0H A;  1BED A;  1GSS A;  2LKU A;  3PGT A;  4MF6 A;  1SK0 A;  2HZF A;  4KGI A;  4MMM A;  4ZB9 A;  3TOU A;  4RQX A;  1XWG A;  2H8L A;  3O6T A;  2F3M A;  2FWG A;  1C72 A;  1SJI A;  3ZVJ D;  2IN3 A;  1AQV A;  2IMD A;  1SL0 B;  1U6T A;  2IJY A;  2RLI A;  4MH3 A;  1TK8 B;  3VI7 A;  4EXJ A;  4ML1 A;  3CSH A;  1ON4 A;  4QQ7 A;  2C0G A;  5D93 A;  4GST A;  3GTU B;  1XOA A;  2MYG A;  5HR1 A;  3L4N A;  3KP9 A;  4NAX A;  2YAN A;  1ABA A;  4FYC A;  3W8S A;  3IK9 A;  2BMX A;  1MEK A;  2J9H A;  1K0C A;  4FH8 A;  2K18 A;  6GSS A;  3KJY A;  4MJA A;  6GST A;  5D9V A;  1FB6 A;  4L5L A;  4CDO A;  4PNF A;  2F8F A;  2YWN A;  5IO2 A;  3KD0 A;  5FHI A;  5IMD A;  1YKC A;  4JRR A;  5AIX A;  4I2T A;  1F37 A;  4PGT A;  4F03 A;  4KDX A;  9GSS A;  2CVK A;  1G6W A;  3HYP A;  3J7Y b;  1G0T A;  4K7N A;  5E59 A;  5ECM B;  3ERF A;  2DIY A;  5KN1 A;  3ZRE A;  1M2A A;  1YKA A;  2EIQ A;  1OE7 A;  2YWM A;  4MZC A;  4XTS A;  2H66 A;  1HNB A;  3EE2 A;  4PUA A;  2KP2 A;  2WRT A;  3E3E A;  3FR6 A;  1JHB A;  2GZP A;  2VUP A;  3QMX A;  3VWU A;  2F9S A;  4TR4 A;  2I3Y A;  3TDG A;  2LQO A;  1I9D A;  5GAP D;  2RUF A;  3HVX A;  5J5N A;  3WT1 A;  3KZQ A;  4I8B A;  4E8E A;  1DUG A;  3HJM A;  4ML6 A;  4V2N A;  3KH9 A;  5JCW A;  1EV9 A;  3IC4 A;  4KE3 A;  3VPQ A;  1TRU A;  3C73 A;  2YWI A;  3GN3 A;  1G6Y A;  1K3L A;  5H5Q A;  3TKQ A;  1GWC A;  3DXB A;  3QPM A;  3NIV A;  2A4V A;  5ECR B;  2R37 A;  4QL9 A;  1SL2 B;  1FO5 A;  3AY8 A;  4HU7 A;  1J0F A;  5HFG A;  4TN8 A;  4WR4 A;  4BVY A;  5EVO A;  1O73 A;  1K0O A;  2H75 A;  4DSQ A;  1XWB A;  3WD6 A;  1GSE A;  4HOJ A;  4MJC A;  1FB0 A;  1PRX A;  3HVV A;  3HXS A;  1OVN A;  4ECC A;  2FD3 A;  4JR6 A;  5IMA A;  3DVW A;  3TKS E;  5D96 A;  1M9B A;  3CSJ A;  4V1A g;  6GSW A;  1V98 A;  3FZA A;  4EUY A;  4KDY A;  3LXZ A;  2H73 A;  2MZC A;  1R5A A;  1XW6 A;  3QDN A;  3WGE A;  4J57 E;  3TRX A;  1WPI A;  2NDO A;  4KND A;  1WP0 A;  1AUC A;  3H93 A;  2YJ7 A;  2RUE A;  5GST A;  5JWQ B;  3VLN A;  2ALB A;  1SD9 A;  19GS A;  3KMN A;  4PX1 A;  5IMV A;  5ECN B;  2HFD A;  1IYI A;  4IBP A;  17GS A;  3EWL A;  1PX7 A;  3ZMK A;  1YEX A;  2NVL A;  3F3Q A;  2QGV A;  2OAC A;  4OFT A;  4IS0 A;  4WF5 A;  5EL8 A;  2K6V A;  4G9H A;  4MCU A;  5IPH A;  1PKW A;  3L9V A;  2XBI A;  4KW6 A;  3DML A;  2GST A;  2VL2 C;  3APO A;  1I5G A;  2L57 A;  1FW1 A;  4MZW A;  4ZB6 A;  5A5K A;  1GUK A;  2GZY A;  3F3R A;  2H76 A;  2FCH A;  1YEP A;  2WDU A;  2WZ9 A;  2IMI A;  1TI3 A;  1WJK A;  2M80 A;  3N5O A;  4E8H A;  1KNG A;  2B7K A;  3GNJ A;  1DE1 A;  3DWV A;  1TU7 A;  3C71 A;  2EC4 A;  2VOC A;  3UAP A;  4G19 A;  1TK5 B;  2GSS A;  3IV4 A;  2HSH A;  2H6Y A;  4GQC A;  2YN1 A;  4ISD A;  5J9C A;  3M1G A;  4EL1 A;  2L4Q A;  3UBK A;  4IKH A;  1THO A;  3ZL5 A;  2IPA A;  3IPZ A;  1XOB A;  3FW2 A;  2F8A A;  4EC0 A;  4OCF A;  2O89 A;  1T4Y A;  2REM A;  4ZIJ A;  1XZO A;  3CBU A;  3TJJ A;  1TU8 A;  5AIV A;  1EP8 A;  5J3R A;  2V2G A;  3KGK A;  1FHE A;  1GNW A;  1S3A A;  4MLY A;  2A2S A;  1E2Y A;  5G5E A;  5CYY A;  1TRV A;  1X9W B;  1ERW A;  2GLR A;  5ECP B;  3F4R A;  3IE3 A;  5LD0 A;  1Z9H A;  3H79 A;  5IMC A;  1A24 A;  1RW1 A;  2D2Z A;  2O85 A;  4N30 A;  4X1U A;  4NHW A;  4WXT A;  3QAV A;  4KX4 A;  1LJR A;  2VCV A;  6GSU A;  1F6M C;  1WOU A;  3HY2 A;  4HU9 A;  3HJP A;  14GS A;  4K7O A;  2BTO T;  4BVX A;  2FY6 A;  5IPG A;  2CA8 A;  4PQ1 A;  3TB2 A;  3FZ4 A;  3DKS A;  4K9Z A;  2X8G A;  1PN9 A;  1UA5 A;  1HNA A;  3D6I A;  5ELA A;  4HJ2 A;  4F0C A;  2I9H A;  1VRS D;  6GSY A;  2CAI A;  5B7C A;  1K3O A;  1BJX A;  1WIK A;  4I2U A;  1X9M B;  4O5R A;  3W6G A;  2Z9S A;  4WEY A;  3Q74 A;  3M3M A;  2GTU A;  3H8Q A;  4LL4 B;  4MZB A;  1U87 A;  3GKK A;  3LYK A;  1B4Q A;  4GRF A;  1ST9 A;  4OO5 A;  3M0F A;  2YCD A;  5IIZ A;  1A0R P;  1BQ7 A;  5CRG A;  5G2Z A;  1NW2 A;  1SEN A;  3ME7 A;  5IO0 A;  4Q5Q A;  3S9F A;  5DCH A;  3FRC A;  5L71 A;  2PU9 C;  2OAD A;  5DDL A;  3DGQ A;  4KSO A;  3WGD A;  4MJB A;  3Q19 A;  1OYJ A;  3VUR A;  3QAG A;  2X64 A;  1KTE A;  1TI1 A;  4Q5N A;  1QK8 A;  1S3D A;  4XRA A;  2V6O A;  2OJL A;  4TKY A;  1SK2 A;  3U6V A;  3IR4 A;  4ECB A;  3LXT A;  2E0Q A;  4DEJ A;  2WGR A;  2RII A;  3QFA C;  1K3Y A;  1GSD A;  4ZIL A;  5D73 A;  4RQR A;  4XCS A;  4GCI A;  2F51 A;  2B1K A;  2LJR A;  2GSR A;  5DAK A;  5ID2 A;  3DRN A;  4NXI A;  2FNO A;  4TR3 A;  2QC7 A;  2PWJ A;  4PUF C;  1YY7 A;  4LLR A;  1K0M A;  1GTU A;  1H4O A;  2PER A;  5KEJ A;  4MH2 A;  2DSA A;  3BJ5 A;  4FIW A;  5COH A;  1GTI A;  3FR3 A;  2HSY A;  3KIJ A;  1PD2 1;  3EUR A;  5INY A; 
#chains in the Genus database with same CATH topology
 3CYN A;  1V9W A;  5J41 A;  3E0U A;  4JZQ A;  2M46 A;  4HZ2 A;  4O92 A;  4RUV A;  1XWC A;  3GX8 A;  3H4K A;  3NZN A;  2P5R A;  4MAB A;  4IN0 A;  5J4U A;  3L78 A;  3M9K A;  3ZTL A;  4GLT A;  3TRP A;  1S3C A;  18GS A;  3H1N A;  4IVF A;  5AGY A;  4XIH A;  2HE3 A;  3HA9 A;  5GZZ B;  5F8B A;  1F9M A;  1Z7R A;  3UBL A;  4GTU A;  4Q5R A;  2R5G A;  4IEL A;  4MA9 A;  4JU5 A;  4ILF A;  3IRA A;  1SJ6 A;  5D9T A;  5HFI A;  4OFM A;  3DVX A;  2DJ0 A;  4P3Y B;  1V2A A;  1XWA A;  4K8M A;  1KBN A;  2AV4 A;  3KEB A;  1M2D A;  2KUC A;  4KCA A;  3O76 A;  4NWY A;  1XXU A;  1M3J A;  2WFC A;  3F0I A;  1ML6 A;  5DAK B;  5F07 A;  1B9X C;  5ID2 B;  2LTK A;  3IBH A;  4IJ3 A;  3A3T A;  4ZL7 A;  3I69 A;  4HJM A;  4WF4 A;  1SKR B;  3FMW A;  3UL3 A;  1Z3E A;  1EEM A;  2YNX A;  3HVN A;  4WKW A;  3EMX A;  1QXH A;  3GA4 A;  1YF0 A;  1ZOF A;  2H6Z A;  1GRX A;  1TW9 A;  2JAD A;  2JSZ A;  4RI7 A;  4CW9 A;  5D9X A;  4TR1 B;  4YQV A;  2C3T A;  4IP6 A;  4POM A;  5CAX A;  2HZE A;  3IDV A;  1UVZ A;  4D73 B;  3P8W A;  1O81 A;  3G9B A;  1K0A A;  1ZYP A;  4X43 A;  1WE0 A;  5G1K A;  4IQA A;  3ISO A;  3UVH A;  7GSS A;  4ULX A;  2CZ3 A;  3MNG A;  5DQS A;  3DD3 A;  1GLQ A;  3QR6 A;  4IQ1 A;  4IHU A;  4RI6 A;  5JWR B;  1V58 A;  3KTL A;  1URM A;  2GDR A;  4XRD A;  3FK8 A;  1A2J A;  3TKR A;  2HNL A;  2VCZ A;  4IW9 A;  2IMK A;  4WET A;  2YV7 A;  2YZU A;  2E2G A;  4GXZ A;  4IGJ A;  1NHY A;  2DJ2 A;  3F6D A;  2H01 A;  4ICY A;  2QKE A;  3FY7 A;  5ENU A;  4HSC X;  3GSS A;  4KCE A;  2VM2 A;  3I6A A;  5KN3 A;  1AAZ A;  4N10 A;  2IFQ A;  3LSZ A;  2KP1 A;  4K7I A;  3DIE A;  2JAC A;  2DKH A;  2FGX A;  3F6F A;  2P31 A;  4L0U A;  20GS A;  2GQL A;  3CTF A;  3JCM L;  1ERV A;  4NMU A;  3ZZX A;  1GUL A;  1TJD A;  4ID0 A;  2H1B A;  3GKN A;  4KUN A;  3C8E A;  3K8N A;  1A8L A;  1Z6M A;  2HYX A;  3D0Z A;  2HZE B;  4XHM A;  2I81 A;  1N8J A;  2OKA A;  2OE1 A;  3TJB A;  1ZYQ B;  3ZIT A;  4PXO A;  2H1G A;  2FWH A;  3A2V A;  4I5Q A;  5B6N A;  3M9J A;  5ECQ B;  2H6X A;  5F0G A;  1GSF A;  1OAZ A;  1GSU A;  3IXR A;  2DJ1 A;  2VAF A;  1M2B A;  5EPF A;  1BYE A;  5C04 A;  4AGS A;  4WR5 A;  2VCW A;  1PMT A;  4F2I A;  5DVB A;  5BMU A;  2C80 A;  3GHA A;  1JZD A;  3L9S A;  2H0H A;  1X5C A;  3U5R E;  2GQK A;  2L5L A;  3HKR A;  2VL9 A;  3A2W A;  2X4A A;  2CT6 A;  4XS6 A;  2RM5 A;  1R4W A;  2ON7 A;  1Y6E A;  5IOX A;  1PGT A;  3GV1 A;  3O3T A;  1SL1 B;  2O8V B;  1GLP A;  2LST A;  2XC2 A;  3D5J A;  3IHQ A;  5JCU A;  3L9U A;  4ZL9 A;  2JSY A;  2V1M A;  5HR3 A;  1YDK A;  2VIM A;  2H74 A;  3EPT A;  3GST A;  3UIW A;  4MP4 A;  1MD3 A;  4EF0 A;  4CHS A;  1YF1 A;  4HDE A;  3KP8 A;  3R2Q A;  2IME A;  2P0G A;  2VD0 A;  1WWJ A;  4TW5 A;  2FLS A;  2CZ2 A;  4HQZ A;  4OCE A;  2I1U A;  4MPG A;  1NM3 A;  1U3I A;  2ES7 A;  1GH2 A;  4DVC A;  4J2F A;  4O7H A;  4ECI A;  2UZ8 A;  2QA1 A;  3Q18 A;  1E6B A;  1MD4 A;  3EVI A;  5F06 A;  2DMM A;  1RQM A;  4K0G A;  4ZBD A;  2AUV A;  1TK0 B;  3G7I A;  5C00 A;  3J7Y k;  2NTO A;  1LU4 A;  4H86 A;  2DC5 A;  4Q5F A;  5GAN D;  3CTG A;  4KAE A;  1ZL9 A;  1JLV A;  3SBC A;  2OA7 A;  3CSI A;  5J9B A;  4G0K A;  4FYU A;  3F8U A;  3IC8 A;  2B6M A;  4L5O A;  2G0F A;  2GGT A;  2L59 A;  4TXO A;  3RDW A;  3BBY A;  4YAP A;  1UN2 A;  2LQQ A;  2DKI A;  5ECI B;  4OFN A;  1FVK A;  1FOV A;  1T1V A;  1TTZ A;  5KN2 A;  1ZGN A;  2GT6 A;  3EIN A;  5ECL B;  3RBT A;  2QSI A;  1T7P B;  2E2M A;  3HZ8 A;  4IJI A;  3KMO A;  1G7O A;  1KEB A;  5HR0 A;  2TIR A;  1EGR A;  3ZIJ A;  1V40 A;  3ZLP A;  2PVO C;  3TKS A;  2K8S A;  2L6D A;  3P7X A;  1OC9 A;  3KH7 A;  1O6J A;  4HUA A;  1H75 A;  5IOW A;  1CQG A;  2N5F A;  2MBS A;  2YPM A;  3ZFB A;  3W8J A;  1EP7 A;  3LFL A;  2VD1 A;  4XS4 A;  2J23 A;  3BOA A;  2B5Y A;  5ECH B;  5IMF A;  1T3B A;  4PNG A;  4KDU A;  1EOG A;  2DLX A;  2C0D A;  4LA1 A;  3CRT A;  2WCI A;  4ZBB A;  1THX A;  1QFN A;  1DSB A;  1TRW A;  2DML A;  5AIS A;  4OMV A;  3WGX A;  1TRS A;  2OE3 A;  4ZL8 A;  1Q98 A;  1CQH A;  3KM6 A;  2IMF A;  12GS A;  1XPV A;  1RK4 A;  2MBT A;  1UC7 A;  3TKP A;  4TRX A;  5BRT A;  2GSQ A;  3KXO A;  2EIO A;  5CP1 A;  2EIR A;  3LEF A;  1AW9 A;  4N11 A;  3FZ9 A;  5ECO B;  4DSR A;  1JFU A;  4TXO B;  2JZS A;  2DBC A;  5DJL A;  2JL4 A;  1FVJ A;  2VLU A;  6GSX A;  4K0N A;  3A2X A;  5CRH A;  3QFB C;  13GS A;  5FT3 A;  5G1L A;  3EU4 A;  2YZH A;  1GSY A;  4ZBA A;  3EC3 A;  1GUH A;  3FEU A;  3UOM A;  2NPB A;  1Z6N A;  2X49 A;  2H19 A;  2H0G A;  1HQO A;  1YZX A;  1JLW A;  3GKX A;  2FWF A;  5HQP A;  4EDZ A;  1XCC A;  1JZW A;  2V32 A;  2IL3 A;  1ERT A;  3ZVJ A;  5HFK A;  4K1F A;  1VGL A;  1ERU A;  1TXX A;  4POL A;  1MDK A;  3FZ5 A;  4MPF A;  4X0X A;  5D8I A;  3TRQ A;  2A2R A;  1QUW A;  1XW9 A;  2CX4 A;  4JED A;  2KHP A;  4IP1 A;  2GS3 A;  3HD5 A;  2CQ9 A;  2CX3 A;  2L5O A;  3P90 A;  1A2M A;  2M72 A;  4TR0 A;  5EY6 A;  4FO5 A;  2DJK A;  3IAS 2;  2WJU A;  1EOH A;  2OBK A;  2VCQ A;  2PGT A;  1A8Y A;  4AJ7 A;  22GS A;  1ZCP A;  2WUL A;  2DJJ A;  3GKM A;  2R6K A;  5ABR A;  1SKS B;  3KTB A;  4GSS A;  1Q4J A;  1OC8 A;  3E9J B;  3MYD A;  4EE0 A;  2C8U A;  2JZR A;  2OE0 A;  4MF7 A;  2IIY A;  1GUM A;  5DCG A;  3IOS A;  2VM1 A;  1G7E A;  3ZYW A;  2C0F A;  2B7J A;  3FKF A;  5CRW A;  2O7K A;  1YJ6 A;  2VCT A;  3VI5 A;  3HDC A;  2XPD A;  1O8X A;  3HVS A;  1EEJ A;  1GNE A;  3C7M A;  2FHE A;  1FAA A;  2VL3 A;  8GSS A;  1W4V A;  1F3B A;  5IM9 A;  2AHE A;  2B5X A;  2DJ3 A;  4NV2 A;  4TXV A;  4EIQ A;  3G7Y A;  1XWK A;  1X5D A;  1FG4 A;  5LNK e;  2C3N A;  2PMT A;  3APQ A;  3CXG A;  1SKW B;  2YOI A;  4PQH A;  3TJK A;  2CVB A;  4PTS A;  3TOT A;  4TVE A;  4ZXG A;  5D9W A;  2PBJ A;  3D22 A;  1BG5 A;  4AJ8 A;  2CV4 A;  4OO4 A;  5F05 A;  2C0E A;  1M0U A;  3PR8 A;  3RHB A;  4HQS A;  1XVW A;  3Q6O A;  3ZML A;  3IK7 A;  2H72 A;  3D21 A;  5DQY A;  1HYU A;  1Z5Y E;  3BCI A;  4HS1 A;  1XFL A;  2C1Y A;  2XBQ A;  3GL3 A;  3VFI A;  5B6M A;  2R3X A;  4OWY A;  5E4W A;  1K0B A;  4K6X A;  2FUG 2;  4I6X A;  4YAV A;  4XS1 A;  3VWW A;  1YQ1 A;  1R7H A;  3I43 A;  4N0Z A;  4GF0 A;  1PA3 A;  1MTC A;  3MWH A;  4POB A;  4YKG A;  2H1D A;  3MDK A;  2K8V A;  3KCM A;  4TOP A;  3TUE A;  1B9Y C;  1EZK A;  4G2E A;  3GH6 A;  4BWS A;  1MDJ A;  2X8H A;  1XVQ A;  4OD7 A;  2FWE A;  5DJM A;  3LW9 A;  3WYW A;  1Y25 A;  1K0D A;  3EU3 A;  5ELG A;  5FWG A;  1OKT A;  3FYG A;  2H0I A;  1X0R A;  4YQU A;  3UVT A;  5GSS A;  5CRE A;  3LOR A;  1SYX A;  3UEM A;  3VWX A;  2V41 A;  3MSZ A;  5B8B A;  2R0C A;  4FQU A;  4BA7 A;  4GQF A;  1VF1 A;  5H5S A;  2CAQ A;  2LUS A;  3LQ7 A;  4NPB A;  5KN0 A;  4FYB A;  2P5Q A;  2ON5 A;  4J56 E;  2YV9 A;  1LBK A;  1U88 A;  3GYK A;  3WT2 A;  4N0V A;  4V1A p;  4GWR A;  2NBS A;  3ZRD A;  3CMI A;  1GL8 A;  1NSW A;  1JZR A;  1TDI A;  2CVD A;  3FR9 A;  3F4T A;  3PPU A;  5AN1 A;  2LV3 A;  3GFK A;  1GSQ A;  2TRX A;  2VLV A;  3GMF A;  2LNT A;  1OKD A;  1QMV A;  2GZZ A;  1PQN A;  1AIU A;  1N2A A;  2HI7 A;  3TJG A;  3QAW A;  3A5I A;  2IFQ B;  2VL2 A;  1O85 A;  1S3R A;  1AQX A;  1R5P A;  1DE2 A;  1SU9 A;  2VO4 A;  3MAK A;  3PIN A;  3CRU A;  2LS5 A;  1VF2 A;  3D4M A;  2B3S A;  3RPP A;  4BL7 A;  3IAM 2;  3QCP A;  1DBY A;  2QA2 A;  2L4C A;  3ZFL A;  2KOK A;  4ZB8 A;  1QQ2 A;  5CNW A;  4K2X A;  5B8A A;  3EMP A;  4LMW A;  2HXK A;  2GQM A;  1GP1 A;  4QL7 A;  3V1W A;  5CO3 A;  4WBJ A;  1M7T A;  4PUR A;  4WBR D;  4EO3 A;  2LJK A;  2HT9 A;  2K9F A;  1SJZ A;  1TP9 A;  3UJ1 A;  3P2A A;  2B5E A;  4F0B A;  1SK1 A;  3PH9 A;  1T00 A;  2AJQ B;  4YH2 A;  2B1L A;  1TOF A;  2JU5 A;  2HRF A;  4MK3 A;  3RPN A;  3VWV A;  2L6C A;  4JR4 A;  3BD2 A;  1M99 A;  1GTA A;  4K5R A;  1F2E A;  5A4V A;  1M3I A;  4Z2T A;  1X9S B;  1M9A A;  3UAR A;  1USB A;  1TKD B;  2WB9 A;  3UMA A;  4KSM A;  3HZ4 A;  3LJR A;  2MMZ A;  1PSQ A;  1U3A A;  4G10 A;  4O5U A;  3NOF A;  2YJH A;  2VCX A;  1WMJ A;  5LCZ A;  5DBQ A;  4POK A;  1XBS A;  2YWO A;  3C1R A;  4YQM A;  4MDC A;  1T8E B;  5ECS A;  11GS A;  4BWQ A;  1B8X A;  1XIY A;  3GIX A;  4AF2 A;  2H1A A;  3GH9 A;  1OC3 A;  1PL2 A;  1Z7P A;  2TRC P;  2H30 A;  2G2Q A;  2ZCT A;  1GTB A;  3RHC A;  1O8W A;  3ERW A;  1W89 A;  2PVQ A;  1MDI A;  2RM6 A;  1V57 A;  4K2D A;  3OR5 A;  4AJ6 A;  5IMZ A;  2R4V A;  2IWT A;  16GS A;  10GS A;  4DSS A;  2R2J A;  3F4S A;  2LJA A;  2OBI A;  2GT5 A;  4BPY A;  1BX9 A;  2LRC A;  3RAZ A;  2HRN A;  4ECJ A;  1B48 A;  1PKZ A;  1OE8 A;  3A5W A;  3GX0 A;  5JCG A;  5ECK B;  1AC1 A;  2X99 A;  5JWO B;  3VPT A;  3TKS C;  5G5F A;  3IA1 A;  3N9J A;  4JBB A;  2H70 A;  3LYP A;  2H71 A;  1X5E A;  1O7U A;  3LG6 A;  4GSN A;  1SYR A;  4KA0 A;  2C3Q A;  3C1S A;  1QGV A;  1BAY A;  3TCO A;  3HCZ A;  4PQI A;  2HLS A;  4EDY A;  3QOU A;  2A4H A;  1IYH A;  4LL1 B;  3ME8 A;  1PX6 A;  3US3 A;  2E7P A;  1F3A A;  4ACS A;  4HEA 2;  5H5R A;  2N5B A;  3HJO A;  1K0N A;  4HZ4 A;  3FHK A;  3SWL A;  5DAL A;  3M8N A;  1SD8 A;  4G0I A;  5G30 A;  4JE1 A;  2LRN A;  3VK9 A;  2KLX A;  3F63 A;  4NV5 A;  1PL1 A;  3HHV A;  1J08 A;  2PN8 A;  2LRT A;  2WS2 A;  3GL5 A;  4LMV A;  3EYT A;  5HR2 A;  2MMA A;  3APS A;  1VF4 A;  1EV4 A;  3GRX A;  1NHO A;  3F9U A;  2C4J A;  2LNS A;  2FA8 A;  2DIZ A;  1B4P A;  2X8C A;  1OC9 B;  4V2M A;  1A0F A;  2ZNM A;  3GTU A;  1JZO A;  1XW5 A;  4KB3 A;  4DSS B;  2VLT A;  2JZT A;  4XS4 B;  5A4W A;  1AQW A;  2I4A A;  3BCK A;  1HD2 A;  4O5Q A;  2PPT A;  2V6K A;  3ERG A;  4CY8 A;  1WRY A;  2BJX A;  5A4U A;  2AAW A;  2XPE A;  6GSV A;  3I9V 2;  4I97 A;  3R3E A;  2ZUP A;  4KH7 A;  4NHZ A;  1AXD A;  2O87 A;  1ILO A;  1ZMA A;  1HNC A;  1EGO A;  2PUK C;  1ZZY A;  5CRD A;  2N5A A;  4F9Z A;  1A2L A;  4O32 A;  3TJF A;  5IQY A;  4Z7X A;  4L8E A;  4EVM A;  4HI7 A;  4L0W A;  2A2P A;  3ED3 A;  1ACV A;  4EKZ A;  2FA4 A;  4MF5 A;  3DEX A;  4TR1 A;  1R26 A;  3LWA A;  4MNN A;  1T4Z A;  2AYT A;  3ZIV A;  4V2L A;  2LEG A;  3D4T A;  1VF3 A;  4MJE A;  1EWX A;  4D73 A;  3G7J A;  1J9B A;  2XHF A;  4F82 A;  5G31 A;  3LGC A;  1ZYE A;  2HRA A;  3DYR A;  3TGZ A;  2AB6 A;  3GUS A;  3GUR A;  2GVP A;  5DAL B;  2YP6 A;  1A23 A;  1XG8 A;  3QD9 A;  2MMO A;  2MMN A;  3L0H A;  1BED A;  1GSS A;  2LKU A;  3PGT A;  4MF6 A;  1SK0 A;  2HZF A;  4KGI A;  4MMM A;  4ZB9 A;  3TOU A;  4RQX A;  1XWG A;  2H8L A;  3O6T A;  2F3M A;  2FWG A;  1C72 A;  1SJI A;  3ZVJ D;  2IN3 A;  1AQV A;  2IMD A;  1SL0 B;  1U6T A;  2IJY A;  2RLI A;  4MH3 A;  1TK8 B;  3VI7 A;  4EXJ A;  4ML1 A;  3CSH A;  1ON4 A;  4QQ7 A;  2C0G A;  5D93 A;  4GST A;  3GTU B;  1XOA A;  2MYG A;  5HR1 A;  3L4N A;  3KP9 A;  4NAX A;  2YAN A;  1ABA A;  4FYC A;  3W8S A;  3IK9 A;  2BMX A;  1MEK A;  2J9H A;  2HRK A;  1K0C A;  4FH8 A;  2K18 A;  6GSS A;  3KJY A;  4MJA A;  6GST A;  5D9V A;  1FB6 A;  4L5L A;  2R0P A;  4CDO A;  4PNF A;  2F8F A;  1ZYN A;  2YWN A;  5IO2 A;  3KD0 A;  5FHI A;  5IMD A;  1YKC A;  1PFO A;  4JRR A;  5AIX A;  4I2T A;  1F37 A;  2HSM A;  4PGT A;  4F03 A;  4KDX A;  9GSS A;  2CVK A;  1G6W A;  3HYP A;  3J7Y b;  1G0T A;  4K7N A;  5E59 A;  5ECM B;  3ERF A;  2DIY A;  5KN1 A;  3ZRE A;  1M2A A;  1YKA A;  2EIQ A;  1OE7 A;  2YWM A;  4MZC A;  4XTS A;  2H66 A;  1HNB A;  3EE2 A;  4PUA A;  2KP2 A;  2WRT A;  3E3E A;  3FR6 A;  1JHB A;  2GZP A;  2VUP A;  3QMX A;  3VWU A;  3MIX A;  2F9S A;  4TR4 A;  2I3Y A;  3TDG A;  2LQO A;  1I9D A;  5GAP D;  2RUF A;  3HVX A;  5J5N A;  3WT1 A;  3KZQ A;  4I8B A;  4E8E A;  1DUG A;  3HJM A;  4ML6 A;  4V2N A;  3KH9 A;  5JCW A;  1EV9 A;  3IC4 A;  4KE3 A;  3VPQ A;  1TRU A;  3C73 A;  2YWI A;  3GN3 A;  1G6Y A;  1K3L A;  5H5Q A;  3TKQ A;  1GWC A;  3DXB A;  3QPM A;  3NIV A;  2A4V A;  5ECR B;  2R37 A;  4QL9 A;  1SL2 B;  1FO5 A;  3AY8 A;  4HU7 A;  1J0F A;  5HFG A;  4TN8 A;  4WR4 A;  4BVY A;  5EVO A;  1O73 A;  4KF9 A;  1K0O A;  2H75 A;  4DSQ A;  1XWB A;  3WD6 A;  1GSE A;  4HOJ A;  4MJC A;  1FB0 A;  1PRX A;  3HVV A;  3HXS A;  1OVN A;  4ECC A;  2FD3 A;  4JR6 A;  5IMA A;  3DVW A;  3TKS E;  5D96 A;  4EIP A;  1M9B A;  3CSJ A;  4V1A g;  6GSW A;  1V98 A;  3FZA A;  4EUY A;  4KDY A;  3LXZ A;  2H73 A;  2MZC A;  1R5A A;  1XW6 A;  3QDN A;  4CY6 A;  3WGE A;  4J57 E;  3TRX A;  1WPI A;  2NDO A;  4KND A;  1WP0 A;  1AUC A;  3H93 A;  2YJ7 A;  2RUE A;  5GST A;  5JWQ B;  3VLN A;  2ALB A;  1SD9 A;  19GS A;  3KMN A;  4PX1 A;  5IMV A;  5ECN B;  2HFD A;  1IYI A;  4IBP A;  17GS A;  3CQF A;  1PX7 A;  3EWL A;  1YEX A;  3ZMK A;  2NVL A;  3F3Q A;  2QGV A;  4G0L A;  2OAC A;  4OFT A;  4IS0 A;  4WF5 A;  5EL8 A;  2K6V A;  4G9H A;  4MCU A;  5IPH A;  1PKW A;  3L9V A;  2R0G A;  2XBI A;  4KW6 A;  3DML A;  4BVY B;  2GST A;  2VL2 C;  3APO A;  1I5G A;  2L57 A;  1FW1 A;  4MZW A;  4ZB6 A;  5A5K A;  1GUK A;  2GZY A;  3F3R A;  2H76 A;  2FCH A;  1YEP A;  2WDU A;  2WZ9 A;  3IHG A;  2IMI A;  1TI3 A;  1WJK A;  2M80 A;  3N5O A;  4E8H A;  1KNG A;  2B7K A;  3GNJ A;  1DE1 A;  3DWV A;  1TU7 A;  3C71 A;  2EC4 A;  2VOC A;  3UAP A;  4G19 A;  4Z2U A;  4X4J A;  1TK5 B;  2GSS A;  3IV4 A;  2HSH A;  2H6Y A;  4GQC A;  2YN1 A;  4ISD A;  5J9C A;  3M1G A;  4EL1 A;  2L4Q A;  3UBK A;  4IKH A;  1THO A;  3ZL5 A;  2IPA A;  3IPZ A;  1XOB A;  3FW2 A;  1PN0 A;  2F8A A;  4EC0 A;  4OCF A;  2O89 A;  1T4Y A;  2REM A;  4K5S A;  4ZIJ A;  1XZO A;  3CBU A;  3TJJ A;  1TU8 A;  4Z2R A;  5AIV A;  1EP8 A;  5J3R A;  2V2G A;  3KGK A;  1FHE A;  1GNW A;  1S3A A;  4MLY A;  2A2S A;  1E2Y A;  5G5E A;  4BL7 B;  5CYY A;  1TRV A;  1X9W B;  1ERW A;  2GLR A;  5ECP B;  3F4R A;  3IE3 A;  5LD0 A;  1Z9H A;  5KOW A;  3H79 A;  5IMC A;  1FOH A;  1A24 A;  1RW1 A;  2D2Z A;  4USS A;  2O85 A;  4N30 A;  4X1U A;  4NHW A;  4WXT A;  3QAV A;  4KX4 A;  1LJR A;  2VCV A;  6GSU A;  1F6M C;  1WOU A;  3HY2 A;  4HU9 A;  3HJP A;  14GS A;  4K7O A;  2BTO T;  4BVX A;  2FY6 A;  5IPG A;  2CA8 A;  4YKF A;  4PQ1 A;  3TB2 A;  3FZ4 A;  3DKS A;  4K9Z A;  2X8G A;  1PN9 A;  1UA5 A;  1HNA A;  3D6I A;  5ELA A;  4HJ2 A;  4F0C A;  2I9H A;  1VRS D;  6GSY A;  2CAI A;  5B7C A;  1K3O A;  1BJX A;  1WIK A;  4I2U A;  1X9M B;  4O5R A;  3W6G A;  2Z9S A;  4WEY A;  3Q74 A;  3M3M A;  2GTU A;  3H8Q A;  4LL4 B;  4MZB A;  1U87 A;  4BIK A;  3GKK A;  3LYK A;  1B4Q A;  4GRF A;  1ST9 A;  4OO5 A;  3M0F A;  2YCD A;  5IIZ A;  1A0R P;  1BQ7 A;  5CRG A;  5G2Z A;  1NW2 A;  1SEN A;  3ME7 A;  5IO0 A;  4Q5Q A;  3S9F A;  5DCH A;  3FRC A;  5L71 A;  2PU9 C;  2OAD A;  5DDL A;  3DGQ A;  4KSO A;  3WGD A;  4MJB A;  3Q19 A;  1OYJ A;  3VUR A;  3QAG A;  2X64 A;  1KTE A;  1TI1 A;  4Q5N A;  1QK8 A;  1S3D A;  4XRA A;  2V6O A;  2OJL A;  4TKY A;  1SK2 A;  3U6V A;  3IR4 A;  4ECB A;  3LXT A;  2E0Q A;  4DEJ A;  2WGR A;  4A5P A;  2RII A;  3QFA C;  4BVX B;  1K3Y A;  1GSD A;  4ZIL A;  5D73 A;  4RQR A;  4XCS A;  4GCI A;  2F51 A;  2B1K A;  2LJR A;  2GSR A;  5DAK A;  5ID2 A;  3DRN A;  4NXI A;  2FNO A;  5KOX A;  4TR3 A;  2QC7 A;  2PWJ A;  4PUF C;  1YY7 A;  4LLR A;  1K0M A;  1GTU A;  1H4O A;  2PER A;  5KEJ A;  4MH2 A;  2DSA A;  3BJ5 A;  4FIW A;  5COH A;  1GTI A;  3FR3 A;  2HSY A;  3KIJ A;  1PD2 1;  3EUR A;  5INY A; 
#chains in the Genus database with same CATH homology
 3CYN A;  1V9W A;  5J41 A;  3E0U A;  4JZQ A;  2M46 A;  4HZ2 A;  4O92 A;  4RUV A;  1XWC A;  3GX8 A;  3H4K A;  3NZN A;  2P5R A;  4MAB A;  4IN0 A;  5J4U A;  3L78 A;  3M9K A;  3ZTL A;  4GLT A;  3TRP A;  1S3C A;  18GS A;  3H1N A;  4IVF A;  5AGY A;  4XIH A;  2HE3 A;  3HA9 A;  5GZZ B;  5F8B A;  1F9M A;  1Z7R A;  3UBL A;  4GTU A;  4Q5R A;  2R5G A;  4IEL A;  4MA9 A;  4JU5 A;  4ILF A;  3IRA A;  1SJ6 A;  5D9T A;  5HFI A;  4OFM A;  3DVX A;  2DJ0 A;  4P3Y B;  1V2A A;  1XWA A;  4K8M A;  1KBN A;  2AV4 A;  3KEB A;  1M2D A;  2KUC A;  4KCA A;  3O76 A;  4NWY A;  1XXU A;  2WFC A;  3F0I A;  1ML6 A;  5DAK B;  5F07 A;  1B9X C;  5ID2 B;  2LTK A;  3IBH A;  4IJ3 A;  3A3T A;  4ZL7 A;  3I69 A;  4HJM A;  4WF4 A;  1SKR B;  3FMW A;  3UL3 A;  1Z3E A;  1EEM A;  2YNX A;  4WKW A;  3EMX A;  1QXH A;  3GA4 A;  1YF0 A;  1ZOF A;  2H6Z A;  1GRX A;  1TW9 A;  2JAD A;  2JSZ A;  4RI7 A;  4CW9 A;  5D9X A;  4TR1 B;  4YQV A;  2C3T A;  4IP6 A;  4POM A;  5CAX A;  2HZE A;  3IDV A;  1UVZ A;  4D73 B;  3P8W A;  1O81 A;  3G9B A;  1K0A A;  1ZYP A;  4X43 A;  1WE0 A;  5G1K A;  4IQA A;  3ISO A;  3UVH A;  7GSS A;  4ULX A;  2CZ3 A;  3MNG A;  5DQS A;  3DD3 A;  1GLQ A;  3QR6 A;  4IQ1 A;  4IHU A;  4RI6 A;  5JWR B;  1V58 A;  3KTL A;  1URM A;  2GDR A;  4XRD A;  3FK8 A;  1A2J A;  3TKR A;  2HNL A;  2VCZ A;  4IW9 A;  2IMK A;  4WET A;  2YV7 A;  2YZU A;  2E2G A;  4GXZ A;  4IGJ A;  1NHY A;  2DJ2 A;  3F6D A;  2H01 A;  4ICY A;  2QKE A;  3FY7 A;  5ENU A;  3GSS A;  4KCE A;  2VM2 A;  3I6A A;  5KN3 A;  1AAZ A;  4N10 A;  2IFQ A;  3LSZ A;  2KP1 A;  4K7I A;  3DIE A;  2JAC A;  2DKH A;  2FGX A;  3F6F A;  2P31 A;  4L0U A;  20GS A;  2GQL A;  3CTF A;  3JCM L;  1ERV A;  4NMU A;  3ZZX A;  1GUL A;  1TJD A;  4ID0 A;  2H1B A;  3GKN A;  4KUN A;  3C8E A;  3K8N A;  1A8L A;  1Z6M A;  2HYX A;  3D0Z A;  2HZE B;  4XHM A;  2I81 A;  1N8J A;  2OKA A;  2OE1 A;  3TJB A;  1ZYQ B;  3ZIT A;  4PXO A;  2H1G A;  2FWH A;  3A2V A;  4I5Q A;  5B6N A;  3M9J A;  5ECQ B;  2H6X A;  5F0G A;  1GSF A;  1OAZ A;  1GSU A;  3IXR A;  2DJ1 A;  2VAF A;  1M2B A;  5EPF A;  1BYE A;  5C04 A;  4AGS A;  4WR5 A;  2VCW A;  1PMT A;  4F2I A;  5DVB A;  5BMU A;  2C80 A;  3GHA A;  1JZD A;  3L9S A;  2H0H A;  1X5C A;  3U5R E;  2GQK A;  2L5L A;  3HKR A;  2VL9 A;  3A2W A;  2X4A A;  2CT6 A;  4XS6 A;  2RM5 A;  1R4W A;  2ON7 A;  1Y6E A;  5IOX A;  1PGT A;  3GV1 A;  3O3T A;  1SL1 B;  2O8V B;  1GLP A;  2LST A;  2XC2 A;  3D5J A;  3IHQ A;  5JCU A;  3L9U A;  4ZL9 A;  2JSY A;  2V1M A;  5HR3 A;  1YDK A;  2VIM A;  2H74 A;  3EPT A;  3GST A;  3UIW A;  4MP4 A;  1MD3 A;  4EF0 A;  4CHS A;  1YF1 A;  4HDE A;  3KP8 A;  3R2Q A;  2IME A;  2P0G A;  2VD0 A;  1WWJ A;  4TW5 A;  2FLS A;  2CZ2 A;  4HQZ A;  4OCE A;  2I1U A;  4MPG A;  1NM3 A;  1U3I A;  2ES7 A;  1GH2 A;  4DVC A;  4J2F A;  4O7H A;  4ECI A;  2UZ8 A;  2QA1 A;  3Q18 A;  1E6B A;  1MD4 A;  3EVI A;  5F06 A;  2DMM A;  1RQM A;  4K0G A;  4ZBD A;  2AUV A;  1TK0 B;  3G7I A;  5C00 A;  3J7Y k;  2NTO A;  1LU4 A;  4H86 A;  2DC5 A;  4Q5F A;  5GAN D;  3CTG A;  4KAE A;  1ZL9 A;  1JLV A;  3SBC A;  2OA7 A;  3CSI A;  5J9B A;  4G0K A;  4FYU A;  3F8U A;  3IC8 A;  2B6M A;  4L5O A;  2G0F A;  2GGT A;  2L59 A;  4TXO A;  3RDW A;  3BBY A;  4YAP A;  1UN2 A;  2LQQ A;  2DKI A;  5ECI B;  4OFN A;  1FVK A;  1FOV A;  1T1V A;  1TTZ A;  5KN2 A;  1ZGN A;  2GT6 A;  3EIN A;  5ECL B;  3RBT A;  2QSI A;  1T7P B;  2E2M A;  3HZ8 A;  4IJI A;  3KMO A;  1G7O A;  1KEB A;  5HR0 A;  2TIR A;  1EGR A;  3ZIJ A;  1V40 A;  3ZLP A;  2PVO C;  3TKS A;  2K8S A;  2L6D A;  3P7X A;  1OC9 A;  3KH7 A;  1O6J A;  4HUA A;  1H75 A;  5IOW A;  1CQG A;  2N5F A;  2MBS A;  2YPM A;  3ZFB A;  3W8J A;  1EP7 A;  3LFL A;  2VD1 A;  4XS4 A;  2J23 A;  3BOA A;  2B5Y A;  5ECH B;  5IMF A;  1T3B A;  4PNG A;  4KDU A;  1EOG A;  2DLX A;  2C0D A;  4LA1 A;  3CRT A;  2WCI A;  4ZBB A;  1THX A;  1QFN A;  1DSB A;  1TRW A;  2DML A;  5AIS A;  4OMV A;  3WGX A;  1TRS A;  2OE3 A;  4ZL8 A;  1Q98 A;  1CQH A;  3KM6 A;  2IMF A;  12GS A;  1XPV A;  1RK4 A;  2MBT A;  1UC7 A;  3TKP A;  4TRX A;  5BRT A;  2GSQ A;  3KXO A;  2EIO A;  5CP1 A;  2EIR A;  3LEF A;  1AW9 A;  4N11 A;  3FZ9 A;  5ECO B;  4DSR A;  1JFU A;  4TXO B;  2JZS A;  2DBC A;  5DJL A;  2JL4 A;  1FVJ A;  2VLU A;  6GSX A;  4K0N A;  3A2X A;  5CRH A;  3QFB C;  13GS A;  5FT3 A;  5G1L A;  3EU4 A;  2YZH A;  1GSY A;  4ZBA A;  3EC3 A;  1GUH A;  3FEU A;  3UOM A;  2NPB A;  1Z6N A;  2X49 A;  2H19 A;  2H0G A;  1HQO A;  1YZX A;  1JLW A;  3GKX A;  2FWF A;  5HQP A;  4EDZ A;  1XCC A;  1JZW A;  2V32 A;  2IL3 A;  1ERT A;  3ZVJ A;  5HFK A;  4K1F A;  1VGL A;  1ERU A;  1TXX A;  4POL A;  1MDK A;  3FZ5 A;  4MPF A;  4X0X A;  5D8I A;  3TRQ A;  2A2R A;  1QUW A;  1XW9 A;  2CX4 A;  4JED A;  2KHP A;  4IP1 A;  2GS3 A;  3HD5 A;  2CQ9 A;  2CX3 A;  2L5O A;  3P90 A;  1A2M A;  2M72 A;  4TR0 A;  5EY6 A;  4FO5 A;  2DJK A;  3IAS 2;  2WJU A;  1EOH A;  2OBK A;  2VCQ A;  2PGT A;  1A8Y A;  4AJ7 A;  22GS A;  1ZCP A;  2WUL A;  2DJJ A;  3GKM A;  2R6K A;  5ABR A;  1SKS B;  3KTB A;  4GSS A;  1Q4J A;  1OC8 A;  3E9J B;  3MYD A;  4EE0 A;  2C8U A;  2JZR A;  2OE0 A;  4MF7 A;  2IIY A;  1GUM A;  5DCG A;  3IOS A;  2VM1 A;  1G7E A;  3ZYW A;  2C0F A;  2B7J A;  3FKF A;  5CRW A;  2O7K A;  1YJ6 A;  2VCT A;  3VI5 A;  3HDC A;  2XPD A;  1O8X A;  3HVS A;  1EEJ A;  1GNE A;  3C7M A;  2FHE A;  1FAA A;  2VL3 A;  8GSS A;  1W4V A;  1F3B A;  5IM9 A;  2AHE A;  2B5X A;  2DJ3 A;  4NV2 A;  4TXV A;  4EIQ A;  3G7Y A;  1XWK A;  1X5D A;  1FG4 A;  5LNK e;  2C3N A;  2PMT A;  3APQ A;  3CXG A;  1SKW B;  2YOI A;  4PQH A;  3TJK A;  2CVB A;  4PTS A;  3TOT A;  4TVE A;  4ZXG A;  5D9W A;  2PBJ A;  3D22 A;  1BG5 A;  4AJ8 A;  2CV4 A;  4OO4 A;  5F05 A;  2C0E A;  1M0U A;  3PR8 A;  3RHB A;  4HQS A;  1XVW A;  3Q6O A;  3ZML A;  3IK7 A;  2H72 A;  3D21 A;  5DQY A;  1HYU A;  1Z5Y E;  3BCI A;  4HS1 A;  1XFL A;  2C1Y A;  2XBQ A;  3GL3 A;  3VFI A;  5B6M A;  2R3X A;  4OWY A;  5E4W A;  1K0B A;  4K6X A;  2FUG 2;  4I6X A;  4YAV A;  4XS1 A;  3VWW A;  1YQ1 A;  1R7H A;  3I43 A;  4N0Z A;  4GF0 A;  1PA3 A;  1MTC A;  3MWH A;  4POB A;  4YKG A;  2H1D A;  3MDK A;  2K8V A;  3KCM A;  4TOP A;  3TUE A;  1B9Y C;  1EZK A;  4G2E A;  3GH6 A;  4BWS A;  1MDJ A;  2X8H A;  1XVQ A;  4OD7 A;  2FWE A;  5DJM A;  3LW9 A;  3WYW A;  1Y25 A;  1K0D A;  3EU3 A;  5ELG A;  5FWG A;  1OKT A;  3FYG A;  2H0I A;  1X0R A;  4YQU A;  3UVT A;  5GSS A;  5CRE A;  3LOR A;  1SYX A;  3UEM A;  3VWX A;  2V41 A;  3MSZ A;  5B8B A;  2R0C A;  4FQU A;  4BA7 A;  4GQF A;  1VF1 A;  5H5S A;  2CAQ A;  2LUS A;  3LQ7 A;  4NPB A;  5KN0 A;  4FYB A;  2P5Q A;  2ON5 A;  4J56 E;  2YV9 A;  1LBK A;  1U88 A;  3GYK A;  3WT2 A;  4N0V A;  4V1A p;  4GWR A;  2NBS A;  3ZRD A;  3CMI A;  1GL8 A;  1NSW A;  1JZR A;  1TDI A;  2CVD A;  3FR9 A;  3F4T A;  3PPU A;  5AN1 A;  2LV3 A;  3GFK A;  1GSQ A;  2TRX A;  2VLV A;  3GMF A;  2LNT A;  1OKD A;  1QMV A;  2GZZ A;  1PQN A;  1AIU A;  1N2A A;  2HI7 A;  3TJG A;  3QAW A;  3A5I A;  2IFQ B;  2VL2 A;  1O85 A;  1AQX A;  1R5P A;  1DE2 A;  1SU9 A;  2VO4 A;  3MAK A;  3PIN A;  3CRU A;  2LS5 A;  1VF2 A;  3D4M A;  2B3S A;  3RPP A;  4BL7 A;  3IAM 2;  3QCP A;  1DBY A;  2QA2 A;  2L4C A;  3ZFL A;  2KOK A;  4ZB8 A;  1QQ2 A;  5CNW A;  4K2X A;  5B8A A;  3EMP A;  4LMW A;  2HXK A;  2GQM A;  1GP1 A;  4QL7 A;  3V1W A;  5CO3 A;  4WBJ A;  1M7T A;  4PUR A;  4WBR D;  4EO3 A;  2LJK A;  2HT9 A;  2K9F A;  1SJZ A;  1TP9 A;  3UJ1 A;  3P2A A;  2B5E A;  4F0B A;  1SK1 A;  3PH9 A;  1T00 A;  2AJQ B;  4YH2 A;  2B1L A;  1TOF A;  2JU5 A;  2HRF A;  4MK3 A;  3RPN A;  3VWV A;  2L6C A;  4JR4 A;  3BD2 A;  1M99 A;  1GTA A;  4K5R A;  1F2E A;  5A4V A;  4Z2T A;  1X9S B;  1M9A A;  3UAR A;  1USB A;  1TKD B;  2WB9 A;  3UMA A;  4KSM A;  3HZ4 A;  3LJR A;  2MMZ A;  1PSQ A;  1U3A A;  4G10 A;  4O5U A;  3NOF A;  2YJH A;  2VCX A;  1WMJ A;  5LCZ A;  5DBQ A;  4POK A;  1XBS A;  2YWO A;  3C1R A;  4YQM A;  4MDC A;  1T8E B;  5ECS A;  11GS A;  4BWQ A;  1B8X A;  1XIY A;  3GIX A;  4AF2 A;  2H1A A;  3GH9 A;  1OC3 A;  1PL2 A;  1Z7P A;  2TRC P;  2H30 A;  2G2Q A;  2ZCT A;  1GTB A;  3RHC A;  1O8W A;  3ERW A;  1W89 A;  2PVQ A;  1MDI A;  2RM6 A;  1V57 A;  4K2D A;  3OR5 A;  4AJ6 A;  5IMZ A;  2R4V A;  2IWT A;  16GS A;  10GS A;  4DSS A;  2R2J A;  3F4S A;  2LJA A;  2OBI A;  2GT5 A;  4BPY A;  1BX9 A;  2LRC A;  3RAZ A;  2HRN A;  4ECJ A;  1B48 A;  1PKZ A;  1OE8 A;  3A5W A;  3GX0 A;  5JCG A;  5ECK B;  1AC1 A;  2X99 A;  5JWO B;  3VPT A;  3TKS C;  5G5F A;  3IA1 A;  3N9J A;  4JBB A;  2H70 A;  3LYP A;  2H71 A;  1X5E A;  1O7U A;  3LG6 A;  4GSN A;  1SYR A;  4KA0 A;  2C3Q A;  3C1S A;  1QGV A;  1BAY A;  3TCO A;  3HCZ A;  4PQI A;  2HLS A;  4EDY A;  3QOU A;  2A4H A;  1IYH A;  4LL1 B;  3ME8 A;  1PX6 A;  3US3 A;  2E7P A;  1F3A A;  4ACS A;  4HEA 2;  5H5R A;  2N5B A;  3HJO A;  1K0N A;  4HZ4 A;  3FHK A;  3SWL A;  5DAL A;  3M8N A;  1SD8 A;  4G0I A;  5G30 A;  4JE1 A;  2LRN A;  3VK9 A;  2KLX A;  3F63 A;  4NV5 A;  1PL1 A;  3HHV A;  1J08 A;  2PN8 A;  2LRT A;  2WS2 A;  3GL5 A;  4LMV A;  3EYT A;  5HR2 A;  2MMA A;  3APS A;  1VF4 A;  1EV4 A;  3GRX A;  1NHO A;  3F9U A;  2C4J A;  2LNS A;  2FA8 A;  2DIZ A;  1B4P A;  2X8C A;  1OC9 B;  4V2M A;  1A0F A;  2ZNM A;  3GTU A;  1JZO A;  1XW5 A;  4KB3 A;  4DSS B;  2VLT A;  2JZT A;  4XS4 B;  5A4W A;  1AQW A;  2I4A A;  3BCK A;  1HD2 A;  4O5Q A;  2PPT A;  2V6K A;  3ERG A;  4CY8 A;  1WRY A;  2BJX A;  5A4U A;  2AAW A;  2XPE A;  6GSV A;  3I9V 2;  4I97 A;  3R3E A;  2ZUP A;  4KH7 A;  4NHZ A;  1AXD A;  2O87 A;  1ILO A;  1ZMA A;  1HNC A;  1EGO A;  2PUK C;  1ZZY A;  5CRD A;  2N5A A;  4F9Z A;  1A2L A;  4O32 A;  3TJF A;  5IQY A;  4Z7X A;  4L8E A;  4EVM A;  4HI7 A;  4L0W A;  2A2P A;  3ED3 A;  1ACV A;  4EKZ A;  2FA4 A;  4MF5 A;  3DEX A;  4TR1 A;  1R26 A;  3LWA A;  4MNN A;  1T4Z A;  2AYT A;  3ZIV A;  4V2L A;  2LEG A;  3D4T A;  1VF3 A;  4MJE A;  1EWX A;  4D73 A;  3G7J A;  1J9B A;  2XHF A;  4F82 A;  5G31 A;  3LGC A;  1ZYE A;  2HRA A;  3DYR A;  3TGZ A;  2AB6 A;  3GUS A;  3GUR A;  2GVP A;  5DAL B;  2YP6 A;  1A23 A;  3QD9 A;  2MMO A;  2MMN A;  3L0H A;  1BED A;  1GSS A;  2LKU A;  3PGT A;  4MF6 A;  1SK0 A;  2HZF A;  4KGI A;  4MMM A;  4ZB9 A;  3TOU A;  4RQX A;  1XWG A;  2H8L A;  3O6T A;  2F3M A;  2FWG A;  1C72 A;  1SJI A;  3ZVJ D;  2IN3 A;  1AQV A;  2IMD A;  1SL0 B;  1U6T A;  2IJY A;  2RLI A;  4MH3 A;  1TK8 B;  3VI7 A;  4EXJ A;  4ML1 A;  3CSH A;  1ON4 A;  4QQ7 A;  2C0G A;  5D93 A;  4GST A;  3GTU B;  1XOA A;  2MYG A;  5HR1 A;  3L4N A;  3KP9 A;  4NAX A;  2YAN A;  1ABA A;  4FYC A;  3W8S A;  3IK9 A;  2BMX A;  1MEK A;  2J9H A;  2HRK A;  1K0C A;  4FH8 A;  2K18 A;  6GSS A;  3KJY A;  4MJA A;  6GST A;  5D9V A;  1FB6 A;  4L5L A;  2R0P A;  4CDO A;  4PNF A;  2F8F A;  1ZYN A;  2YWN A;  5IO2 A;  3KD0 A;  5FHI A;  5IMD A;  1YKC A;  4JRR A;  5AIX A;  4I2T A;  1F37 A;  2HSM A;  4PGT A;  4F03 A;  4KDX A;  9GSS A;  2CVK A;  1G6W A;  3HYP A;  3J7Y b;  1G0T A;  4K7N A;  5E59 A;  5ECM B;  3ERF A;  2DIY A;  5KN1 A;  3ZRE A;  1M2A A;  1YKA A;  2EIQ A;  1OE7 A;  2YWM A;  4MZC A;  4XTS A;  2H66 A;  1HNB A;  3EE2 A;  4PUA A;  2KP2 A;  2WRT A;  3E3E A;  3FR6 A;  1JHB A;  2GZP A;  2VUP A;  3QMX A;  3VWU A;  3MIX A;  2F9S A;  4TR4 A;  2I3Y A;  3TDG A;  2LQO A;  1I9D A;  5GAP D;  2RUF A;  3HVX A;  5J5N A;  3WT1 A;  3KZQ A;  4I8B A;  4E8E A;  1DUG A;  3HJM A;  4ML6 A;  4V2N A;  3KH9 A;  5JCW A;  1EV9 A;  3IC4 A;  4KE3 A;  3VPQ A;  1TRU A;  3C73 A;  2YWI A;  3GN3 A;  1G6Y A;  1K3L A;  5H5Q A;  3TKQ A;  1GWC A;  3DXB A;  3QPM A;  3NIV A;  2A4V A;  5ECR B;  2R37 A;  4QL9 A;  1SL2 B;  1FO5 A;  3AY8 A;  4HU7 A;  1J0F A;  5HFG A;  4TN8 A;  4WR4 A;  4BVY A;  5EVO A;  1O73 A;  4KF9 A;  1K0O A;  2H75 A;  4DSQ A;  1XWB A;  3WD6 A;  1GSE A;  4HOJ A;  4MJC A;  1FB0 A;  1PRX A;  3HVV A;  3HXS A;  1OVN A;  4ECC A;  2FD3 A;  4JR6 A;  5IMA A;  3DVW A;  3TKS E;  5D96 A;  4EIP A;  1M9B A;  3CSJ A;  4V1A g;  6GSW A;  1V98 A;  3FZA A;  4EUY A;  4KDY A;  3LXZ A;  2H73 A;  2MZC A;  1R5A A;  1XW6 A;  3QDN A;  4CY6 A;  3WGE A;  4J57 E;  3TRX A;  1WPI A;  2NDO A;  4KND A;  1WP0 A;  1AUC A;  3H93 A;  2YJ7 A;  2RUE A;  5GST A;  5JWQ B;  3VLN A;  2ALB A;  1SD9 A;  19GS A;  3KMN A;  4PX1 A;  5IMV A;  5ECN B;  2HFD A;  1IYI A;  4IBP A;  17GS A;  3EWL A;  1PX7 A;  3ZMK A;  1YEX A;  2NVL A;  3F3Q A;  2QGV A;  4G0L A;  2OAC A;  4OFT A;  4IS0 A;  4WF5 A;  5EL8 A;  2K6V A;  4G9H A;  4MCU A;  5IPH A;  1PKW A;  3L9V A;  2R0G A;  2XBI A;  4KW6 A;  3DML A;  4BVY B;  2GST A;  2VL2 C;  3APO A;  1I5G A;  2L57 A;  1FW1 A;  4MZW A;  4ZB6 A;  5A5K A;  1GUK A;  2GZY A;  3F3R A;  2H76 A;  2FCH A;  1YEP A;  2WDU A;  2WZ9 A;  3IHG A;  2IMI A;  1TI3 A;  1WJK A;  2M80 A;  3N5O A;  4E8H A;  1KNG A;  2B7K A;  3GNJ A;  1DE1 A;  3DWV A;  1TU7 A;  3C71 A;  2EC4 A;  2VOC A;  3UAP A;  4G19 A;  4Z2U A;  4X4J A;  1TK5 B;  2GSS A;  3IV4 A;  2HSH A;  2H6Y A;  4GQC A;  2YN1 A;  4ISD A;  5J9C A;  3M1G A;  4EL1 A;  2L4Q A;  3UBK A;  4IKH A;  1THO A;  3ZL5 A;  2IPA A;  3IPZ A;  1XOB A;  3FW2 A;  1PN0 A;  2F8A A;  4EC0 A;  4OCF A;  2O89 A;  1T4Y A;  2REM A;  4K5S A;  4ZIJ A;  1XZO A;  3CBU A;  3TJJ A;  1TU8 A;  4Z2R A;  5AIV A;  1EP8 A;  5J3R A;  2V2G A;  3KGK A;  1FHE A;  1GNW A;  1S3A A;  4MLY A;  2A2S A;  1E2Y A;  5G5E A;  4BL7 B;  5CYY A;  1TRV A;  1X9W B;  1ERW A;  2GLR A;  5ECP B;  3F4R A;  3IE3 A;  5LD0 A;  1Z9H A;  5KOW A;  3H79 A;  5IMC A;  1FOH A;  1A24 A;  1RW1 A;  2D2Z A;  4USS A;  2O85 A;  4N30 A;  4X1U A;  4NHW A;  4WXT A;  3QAV A;  4KX4 A;  1LJR A;  2VCV A;  6GSU A;  1F6M C;  1WOU A;  3HY2 A;  4HU9 A;  3HJP A;  14GS A;  4K7O A;  2BTO T;  4BVX A;  2FY6 A;  5IPG A;  2CA8 A;  4YKF A;  4PQ1 A;  3TB2 A;  3FZ4 A;  3DKS A;  4K9Z A;  2X8G A;  1PN9 A;  1UA5 A;  1HNA A;  3D6I A;  5ELA A;  4HJ2 A;  4F0C A;  2I9H A;  1VRS D;  6GSY A;  2CAI A;  5B7C A;  1K3O A;  1BJX A;  1WIK A;  4I2U A;  1X9M B;  4O5R A;  3W6G A;  2Z9S A;  4WEY A;  3Q74 A;  3M3M A;  2GTU A;  3H8Q A;  4LL4 B;  4MZB A;  1U87 A;  3GKK A;  3LYK A;  1B4Q A;  4GRF A;  1ST9 A;  4OO5 A;  3M0F A;  2YCD A;  5IIZ A;  1A0R P;  1BQ7 A;  5CRG A;  5G2Z A;  1NW2 A;  1SEN A;  3ME7 A;  5IO0 A;  4Q5Q A;  3S9F A;  5DCH A;  3FRC A;  5L71 A;  2PU9 C;  2OAD A;  5DDL A;  3DGQ A;  4KSO A;  3WGD A;  4MJB A;  3Q19 A;  1OYJ A;  3VUR A;  3QAG A;  2X64 A;  1KTE A;  1TI1 A;  4Q5N A;  1QK8 A;  1S3D A;  4XRA A;  2V6O A;  2OJL A;  4TKY A;  1SK2 A;  3U6V A;  3IR4 A;  4ECB A;  3LXT A;  2E0Q A;  4DEJ A;  2WGR A;  4A5P A;  2RII A;  3QFA C;  4BVX B;  1K3Y A;  1GSD A;  4ZIL A;  5D73 A;  4RQR A;  4XCS A;  4GCI A;  2F51 A;  2B1K A;  2LJR A;  2GSR A;  5DAK A;  5ID2 A;  3DRN A;  4NXI A;  2FNO A;  5KOX A;  4TR3 A;  2QC7 A;  2PWJ A;  4PUF C;  1YY7 A;  4LLR A;  1K0M A;  1GTU A;  1H4O A;  2PER A;  5KEJ A;  4MH2 A;  2DSA A;  3BJ5 A;  4FIW A;  5COH A;  1GTI A;  3FR3 A;  2HSY A;  3KIJ A;  1PD2 1;  3EUR A;  5INY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...