1O7UA

Radiation induced tryparedoxin-i
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
143
structure length
143
Chain Sequence
GLDKYLPGIEKLRRGDGEVEVKSLAGKLVFFYFSASWCPPCRGFTPQLIEFYDKFHESKNFEVVFCTWDEEEDGFAGYFAKMPWLAVPFAQSEAVQKLSKHFNVESIPTLIGVDADSGDVVTTRARATLVKDPEGEQFPWKDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPAREDOXIN
publication title Tryparedoxins from Crithidia Fasciculata and Trypanosoma Brucei: Photoreduction of the Redox Disulfide Using Synchrotron Radiation and Evidence for a Conformational Switch Implicated in Function
pubmed doi rcsb
source organism Crithidia fasciculata
molecule tags Electron transport
total genus 43
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2002-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13905 Thioredoxin_8 Thioredoxin-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1o7uA00
2EIRA 3FR9A 2H76A 1WE0A 4V2LA 1UC7A 2C0FA 4POKA 5A4UA 4DVCA 2NPBA 4L5LA 2HSHA 1QGVA 5CP1A 1YQ1A 3EINA 1HYUA 4K0NA 3NIVA 2C3TA 1WWJA 3GYKA 1XZOA 2YNXA 5CYYA 1XPVA 1Z9HA 3TJJA 4TW5A 3EURA 5D96A 1OC9B 3TJGA 1E6BA 4QL9A 3E3EA 2TRXA 2PPTA 3IR4A 2A2SA 2VLTA 1Q4JA 4JR4A 4ZB6A 3GN3A 2JADA 2OADA 4TOPA 3N5OA 4BWQA 1MTCA 3UL3A 3W8SA 2H6XA 2CV4A 2RM6A 4GSTA 5GSSA 2JZRA 4F03A 2IL3A 1VGLA 2AHEA 4GCIA 5HFKA 4PQIA 3HKRA 2MYGA 1TRUA 3DD3A 3I43A 2E2GA 1XVWA 4I5QA 3A3TA 2JSZA 5IMZA 3GH6A 3PGTA 3VWUA 2BTOT 2IIYA 4LL1B 1EOGA 3QOUA 3TRQA 1GSEA 5HQPA 2F8FA 3ISOA 1PGTA 1C72A 1THOA 1GL8A 5DALA 2VL3A 3DMLA 4POBA 2YCDA 2CVBA 1XW9A 3AY8A 3C1RA 4MZWA 5ECKB 4Q5RA 2B5YA 5COHA 3D4MA 2VCZA 1FAAA 4ZILA 5IQYA 3L9VA 1YEPA 3US3A 2CZ3A 3TB2A 2L57A 5CRWA 5J4UA 1GTIA 3F6FA 5IOXA 2LQQA 1O73A 4JBBA 2MMNA 4MK3A 4MJCA 2VCWA 4GSNA 2B1KA 1U87A 3VWXA 3TRPA 2YWMA 1LBKA 4PXOA 4KB3A 1UVZA 2MBTA 4N30A 2P5RA 4KDUA 1TK5B 1O81A 1FHEA 5G5EA 1EWXA 6GSXA 1WP0A 4MCUA 4XCSA 4ACSA 1SKSB 3I69A 3L9SA 4G2EA 4IVFA 4KCAA 3HHVA 3WGXA 2AAWA 4OCFA 2PVQA 5D9VA 3F0IA 2JL4A 1WMJA 5A5KA 4GRFA 3NZNA 1NW2A 3QAGA 3GURA 4PUAA 3RHBA 5LD0A 4AJ7A 1SKRB 4ZBAA 2GT6A 5DQYA 4I97A 3IDVA 3H93A 3N9JA 5GZZB 5IIZA 5ECNB 3H1NA 4H86A 4G19A 1A8LA 3L0HA 4MDCA 1OE7A 1ZOFA 2AV4A 4JZQA 4L0WA 12GSA 1FW1A 5J41A 2CX4A 3HDCA 5B6MA 3LORA 1Z7RA 1X5EA 1THXA 5D9XA 1XOBA 3KTBA 2N5AA 5F0GA 1SK1A 4QQ7A 1MD4A 2AJQB 2RIIA 5C04A 3KXOA 1A23A 1OAZA 2PUKC 1V98A 3DEXA 5ECIB 2VM2A 4KAEA 2IPAA 2YV9A 4MF5A 3D4TA 5IOWA 3RBTA 2DMLA 2R4VA 1TK0B 1DBYA 4POLA 3F8UA 2DIZA 4KSOA 2IJYA 3HVSA 2HZFA 2L59A 1BYEA 1ZGNA 2GQLA 11GSA 2GZPA 3VWWA 2X8GA 1TXXA 3EE2A 3VWVA 2J23A 1T4ZA 2DJ1A 5JCGA 1V9WA 3BJ5A 3UARA 4EKZA 5A4VA 1T1VA 3LG6A 4MF6A 2C0EA 3APOA 1XOAA 2D2ZA 1ZZYA 5ABRA 5CO3A 3A2WA 4PURA 1TP9A 1XBSA 1F3BA 1A24A 1MEKA 5HR1A 4HI7A 3EVIA 3HVXA 1FB0A 1F6MC 1N8JA 3WGDA 2DC5A 1W89A 4XIHA 3ZFBA 1AC1A 2MMZA 1EOHA 1Y25A 3LWAA 4PUFC 3DKSA 1FOVA 5EY6A 3UIWA 4HZ2A 3DYRA 5DVBA 3ZIJA 4MJAA 1UA5A 3GH9A 3Q18A 1WPIA 1YEXA 1M9AA 2MZCA 1Z7PA 4J2FA 2IMFA 4NV5A 2FGXA 4ZXGA 1DE1A 3ZITA 3ZZXA 2DJ2A 4TVEA 2WDUA 1F37A 5F07A 2FHEA 4NV2A 4XTSA 4ECJA 2MMAA 2H6ZA 1I5GA 1B8XA 1AXDA 3QMXA 4ZB9A 1GTUA 1OC9A 2O89A 3TUEA 3LXZA 4EF0A 3C8EA 1S3CA 4KSMA 3FYGA 4IKHA 3WT2A 3EWLA 2VLVA 3LJRA 1T7PB 4TR0A 3EMPA 2G2QA 2LS5A 1BAYA 4DSSB 3FHKA 2CVKA 3KEBA 1R5PA 7GSSA 2HLSA 3CTGA 1G6WA 2YPMA 4BVYA 2KOKA 1MD3A 4CDOA 3S9FA 3KCMA 14GSA 3F4SA 3MDKA 5FHIA 1VF4A 5ELAA 4TN8A 1GNEA 3DVXA 1YZXA 4RQRA 1PD21 3HCZA 3UBKA 2CVDA 1JZWA 2OJLA 3IC4A 4IQAA 4LMVA 4TR1B 3F3RA 4KX4A 3MAKA 2CQ9A 4GWRA 2DJ3A 2GT5A 5G31A 2YP6A 1GTAA 3HZ8A 3IAM2 2LNTA 4MLYA 22GSA 2FA8A 4OFTA 4KE3A 5C00A 1SL0B 4YH2A 4PQHA 1BQ7A 3M0FA 1MDIA 2O87A 1TDIA 1TKDB 1YKAA 5ECLB 1K3OA 1JLVA 1ERTA 1S3DA 3FZ5A 3UVTA 4ZBBA 3SBCA 1XWBA 2JZTA 1T00A 3LGCA 2LRNA 5J3RA 5HR0A 4XS6A 5B8AA 4HJMA 2EIOA 3GUSA 2WULA 3KMNA 3PINA 4N10A 2X64A 2H0HA 2P0GA 3QDNA 5B7CA 4F9ZA 3G7IA 4LLRA 4PNFA 4RUVA 1RW1A 2QSIA 2PN8A 3TOTA 3A2XA 3C7MA 3F4RA 3RHCA 5JCUA 1YY7A 3FR6A 10GSA 5CAXA 1EZKA 1Z6MA 1OE8A 2VAFA 5EPFA 2G0FA 2PERA 3L78A 5J9CA 1ZYEA 2C0GA 1SJZA 4IELA 3GL5A 2HE3A 1VF3A 5D93A 2I3YA 2RLIA 1T4YA 2FWHA 1GSQA 4FH8A 1WOUA 1XXUA 1JZRA 3CMIA 5ECHB 3GX0A 1QMVA 1XW5A 3M9KA 3ME8A 2GSRA 4IGJA 2LRTA 1SYRA 1RK4A 3TGZA 4BA7A 4FYBA 2PMTA 1JZDA 3I6AA 5AIXA 1Z5YE 3GKMA 2RUFA 1GLPA 4IP6A 2VO4A 3D6IA 5H5SA 4ECCA 1ERWA 16GSA 4K7OA 1S3AA 3EMXA 4BPYA 2BJXA 2P5QA 3F3QA 5DAKA 1OYJA 5KN0A 4TR3A 4MPGA 5ECQB 4Q5NA 1TU8A 5IPHA 2VIMA 2OE0A 3GIXA 1QUWA 3CSHA 5A4WA 1JZOA 4JRRA 5ECPB 2HXKA 2DIYA 1K0OA 2JU5A 1X5DA 3RPPA 5FWGA 2H1BA 5D8IA 1F3AA 4D73B 1QFNA 4WR4A 2K8VA 5ECRB 2YJ7A 5IMAA 1URMA 4OD7A 1PN9A 5ECOB 3HZ4A 4IP1A 2AYTA 4ECIA 4X0XA 2RUEA 2QKEA 1J9BA 4J56E 3QFAC 2KP1A 2KHPA 2L5OA 4WBRD 2WB9A 5GAND 2E7PA 3CSIA 2C80A 1B48A 1LJRA 4L0UA 4KH7A 3CBUA 1GSFA 3KMOA 2FNOA 2J9HA 1GSSA 4DSRA 4K1FA 3O76A 2FLSA 2VL2A 1XVQA 2O85A 4N11A 2H1AA 3HY2A 2EC4A 3BCIA 1EEJA 5CREA 4KNDA 5IM9A 4AJ8A 3UOMA 4OO5A 1K0DA 4ZL7A 1ZYQB 1PMTA 2K18A 2VCVA 5KN3A 3ZVJA 2N5BA 3ZVJD 3GA4A 1GNWA 1PL2A 2H1DA 3VPQA 2REMA 4MH2A 2DJJA 1TI1A 4ZL9A 1XW6A 2YZUA 1TRSA 2YWIA 3U5RE 2K9FA 4MH3A 4DSSA 4PX1A 1SYXA 1MDKA 2VCQA 1PKZA 2P31A 2FWFA 1OKDA 2OA7A 3WYWA 4HJ2A 2RM5A 2VL2C 6GSYA 3M3MA 4ID0A 6GSWA 3TDGA 4O32A 5IMVA 4GQCA 3ZLPA 4BL7A 6GSVA 2YJHA 1DUGA 4IN0A 3F6DA 4MPFA 1G7OA 1GSYA 2C3NA 2LV3A 1TTZA 2PU9C 3GX8A 3DGQA 5IPGA 4AGSA 2B5XA 5G1KA 4WBJA 2L6DA 5H5QA 4TR1A 4ZL8A 1GUHA 3QPMA 3QCPA 1M2DA 1ST9A 3UJ1A 4LMWA 1VF1A 4ILFA 2GGTA 5DAKB 4MJEA 2GSTA 3R2QA 3GHAA 4TXVA 3KJYA 2C0DA 3A2VA 1TRWA 2H1GA 4XS4B 3LXTA 1BG5A 4ULXA 3GNJA 3D21A 2ES7A 2R3XA 2GZZA 4GSSA 5D9TA 1R26A 3QD9A 1LU4A 4DSQA 4IW9A 3HXSA 4MJBA 4MMMA 2VL9A 3VI7A 3Q74A 2B6MA 3KGKA 2NDOA 2DJKA 4NWYA 3G7JA 4NHWA 5AIVA 4MA9A 5AISA 3TJFA 2FA4A 4EVMA 3G9BA 1M2AA 3DVWA 4HOJA 5J9BA 2FCHA 2KP2A 4EDYA 1OVNA 3BBYA 2JSYA 1R5AA 2M46A 3FKFA 1ZL9A 3FW2A 3W8JA 2VM1A 5EL8A 3TCOA 1A2MA 4WETA 2HZEB 4E8HA 2LQOA 2HYXA 3P90A 5IO0A 1FO5A 2CZ2A 4IJ3A 3DIEA 1H4OA 4KW6A 2K6VA 3KH7A 3RAZA 4IHUA 2OACA 3VFIA 1DE2A 2R6KA 1Q98A 1NM3A 1F9MA 4KUNA 3IE3A 1V2AA 2WGRA 3IA1A 3IXRA 1YKCA 3LSZA 2WJUA 1FB6A 2YV7A 4BWSA 3TRXA 1VRSD 3GSSA 1DSBA 4MP4A 3ME7A 4OO4A 4WF4A 2V6KA 3GRXA 4EUYA 1SL2B 2H19A 1T8EB 5D9WA 1SK2A 2ON7A 4WR5A 4ECBA 4LA1A 3BD2A 2B7JA 2F9SA 2LJRA 3IV4A 5CNWA 4NPBA 3CYNA 2IN3A 4ZBDA 4K2DA 3CRUA 3E9JB 2R37A 4PGTA 3KP9A 1ACVA 1K0NA 1USBA 1BEDA 4JEDA 5IMDA 3IPZA 1XWCA 2B7KA 2FWEA 1O7UA 2C8UA 1PKWA 1NHOA 5G5FA 3FZ4A 1AQVA 2CAQA 1YF1A 3F9UA 3V1WA 1TJDA 1FVKA 2H01A 3M8NA 1HQOA 1NSWA 5KN2A 4D73A 3QAVA 3D0ZA 3GV1A 3TKPA 1G0TA 3U6VA 4ZB8A 5JWRB 3UBLA 1PX7A 1IYHA 2IMKA 4BVXA 2DSAA 2FUG2 5CRGA 2A2RA 2F8AA 3QAWA 1TRVA 1SKWB 1AQXA 4RI7A 3EYTA 5DJLA 3UAPA 1EGOA 2GVPA 2IWTA 4LL4B 2LKUA 4HUAA 2ON5A 1ILOA 3EU3A 1OC8A 2GQKA 5JWQB 1O6JA 4YAPA 2PBJA 4GXZA 3O3TA 1J08A 3PH9A 3IRAA 5IMFA 3FY7A 3SWLA 4YQVA 1HD2A 2CT6A 4E8EA 3GTUB 2PVOC 1GP1A 1J0FA 4O7HA 4DEJA 4K9ZA 2R2JA 1GSUA 1Z3EA 4L8EA 3LQ7A 2V2GA 2O7KA 5AN1A 2C1YA 2GTUA 5DQSA 1EP7A 4HQZA 1K0MA 2TRCP 2AB6A 3Q19A 4ML6A 2YWNA 2IFQB 2LEGA 1B9YC 1K0BA 1TK8B 3VPTA 5F06A 1B4PA 5G30A 4WF5A 1IYIA 1ERVA 4RI6A 5DCGA 1XFLA 2X99A 4Q5QA 4JU5A 2NVLA 4AF2A 2NBSA 4HEA2 4CHSA 1TW9A 2H73A 1FG4A 5B8BA 1SU9A 4GLTA 4F2IA 3KH9A 5DDLA 1O8XA 2KLXA 3FK8A 1ABAA 2ZCTA 1GSDA 3P2AA 2WS2A 3VK9A 3E0UA 2GSSA 2TIRA 1SD8A 3ED3A 4V1Ag 3TJBA 4X1UA 1EV9A 4AJ6A 1H75A 2V41A 2FY6A 1SD9A 4MZCA 2H0IA 3H79A 2M80A 1ERUA 2M72A 3HVVA 5ENUA 4NAXA 2HI7A 4TXOB 3KZQA 4J57E 1CQHA 3P7XA 3IHQA 3FZAA 3F4TA 4YAVA 4XS4A 3ZYWA 4OFMA 3ZMLA 4EL1A 4YQUA 2GZYA 2H66A 2NTOA 3M9JA 2XPEA 3TKSA 5GSTA 3M1GA 4ISDA 3P8WA 4EXJA 2F3MA 2C4JA 4KA0A 4Z7XA 3ZTLA 2DMMA 5CRHA 5G2ZA 3APQA 3HJOA 4KGIA 5ID2B 1X9WB 3NOFA 2I9HA 3ZMKA 3DWVA 1GH2A 6GSSA 4F0CA 3GKXA 1M0UA 4KDYA 4N0ZA 18GSA 1PA3A 5E59A 1R4WA 1B9XC 3A5WA 1U3AA 4I2UA 2B5EA 4OCEA 2HZEA 1TOFA 17GSA 1I9DA 2V32A 2I81A 3H4KA 3DXBA 3FR3A 5F05A 4N0VA 4XRAA 3J7Yb 4GQFA 2CA8A 1EGRA 3HYPA 2VLUA 1G7EA 1A2JA 3TKSC 4JE1A 1M7TA 3VURA 1O8WA 4K0GA 1X9MB 1X9SB 5HFGA 2GSQA 3ERGA 1XWKA 1N2AA 3EC3A 3G7YA 1AUCA 3FZ9A 5AGYA 1XWGA 4FYUA 1YF0A 5D73A 1MDJA 3MNGA 2DLXA 4G10A 3EU4A 1K3LA 1M2BA 3JCML 2B1LA 1ZCPA 4HQSA 1GUMA 4K7NA 1YJ6A 2GS3A 5DJMA 3C1SA 4HU9A 2O8VB 3KP8A 1R7HA 2N5FA 4EE0A 3ZREA 2MMOA 4X43A 2X8HA 2L6CA 1PRXA 3L4NA 5ECMB 1HNAA 2VCTA 1M99A 3D5JA 5IMCA 1YDKA 1V58A 4Q5FA 2Z9SA 2ZUPA 4MZBA 3O6TA 3HA9A 3IOSA 3CTFA 1VF2A 2OE3A 1SK0A 2JACA 3UEMA 1EP8A 2V1MA 2HRFA 3ZL5A 3J7Yk 1AW9A 1K0CA 1B4QA 3BOAA 1RQMA 3FRCA 3IBHA 2K8SA 1GRXA 4HU7A 1GUKA 2FD3A 3FEUA 4V2NA 2EIQA 1U88A 4QL7A 1O85A 2I4AA 8GSSA 1KNGA 4I2TA 4O92A 1K3YA 3CRTA 2H71A 1GTBA 1EEMA 2HRNA 3GKNA 3IK9A 4L5OA 3RPNA 1AAZA 3F63A 2GQMA 3GTUA 2OKAA 1A2LA 4TR4A 1E2YA 1BJXA 3QFBC 1V40A 1TU7A 1OKTA 2LUSA 2LTKA 1QK8A 1PQNA 5L71A 3APSA 1HNBA 4F82A 4GF0A 4NMUA 1CQGA 3GSTA 5KEJA 1XWAA 1F2EA 3CSJA 3D22A 4CW9A 1PSQA 1X0RA 4K8MA 3BCKA 2HFDA 5G1LA 2MBSA 2QC7A 1Z6NA 9GSSA 2LNSA 5JWOB 2IFQA 1G6YA 4ML1A 3L9UA 5F8BA 1EV4A 2WRTA 2VCXA 1JFUA 4POMA 1SJIA 3H8QA 3QR6A 4XHMA 1SENA 1WJKA 2QGVA 1WRYA 4P3YB 1KTEA 2GDRA 4WKWA 1U6TA 4OFNA 2E0QA 5EVOA 6GSUA 5DBQA 5J5NA 2LJKA 2I1UA 5CRDA 4KDXA 4FIWA 4PQ1A 3KTLA 3HJMA 5DALB 2XBIA 3MWHA 1A0FA 2HSYA 2H74A 20GSA 3PR8A 1M9BA 2LRCA 3GL3A 5HR3A 1GLQA 1UN2A 3IAS2 3RDWA 5H5RA 5JCWA 4NXIA 3OR5A 3UMAA 2LSTA 1ON4A 3ZFLA 4NHZA 5B6NA 4KCEA 2F51A 4GTUA 4YQMA 2L5LA 3IK7A 2YWOA 5DCHA 2H8LA 1KEBA 1FVJA 1V57A 2PWJA 5ECSA 2KUCA 2R5GA 4G9HA 1PX6A 4TXOA 2WCIA 5INYA 1Y6EA 5FT3A 3ZIVA 2ALBA 2V6OA 4XRDA 2BMXA 3Q6OA 4MABA 4WEYA 5LNKe 3W6GA 2VOCA 3MSZA 5LCZA 1SL1B 3TJKA 2GLRA 3ERWA 2YZHA 1ZMAA 2XBQA 4WXTA 3K8NA 2XHFA 4MF7A 2JZSA 5ID2A 2IMIA 3KIJA 2VD0A 5IO2A 1AIUA 2VD1A 1WIKA 4TKYA 4XS1A 2YOIA 4V1Ap 3UVHA 1A8YA 4OMVA 2IMDA 2IMEA 3LEFA 5ELGA 4O5RA 1W4VA 3C73A 4HDEA 2FWGA 3WD6A 5KN1A 3KD0A 2HT9A 5E4WA 2E2MA 1T3BA 3GMFA 3CXGA 1NHYA 3GFKA 2OBIA 2H0GA 3LYPA 3HD5A 4FYCA 3VLNA 2OE1A 3TKRA 2VUPA 2X8CA 4RQXA 5HFIA 4IBPA 1XCCA 4FO5A 2LJAA 3HJPA 4ZIJA 3TKSE 3VI5A 1ML6A 2ZNMA 2YN1A 4IJIA 2HNLA 2PGTA 3LFLA 4HZ4A 2YANA 2DJ0A 1GULA 1SJ6A 1X5CA 4V2MA 1OC3A 1JHBA 5GAPD 3GKKA 1A0RP 1JLWA 2B3SA 2H70A 2WFCA 2DBCA 3TKQA 4EDZA 1GWCA 3WGEA 4IS0A 1QQ2A 4EC0A 19GSA 1KBNA 2XPDA 2H30A 4EO3A 1QXHA 2OBKA 2H6YA 2A4VA 1U3IA 4I6XA 1XIYA 2H75A 3ZRDA 4K6XA 1AQWA 1TI3A 4IQ1A 4HS1A 3I9V2 6GSTA 4TRXA 3TOUA 3ERFA 1BX9A 2AUVA 1HNCA 4K7IA 1PL1A 2H72A 2C3QA 2L4CA 5HR2A 2L4QA 4PNGA 3DRNA 2XC2A 4JR6A 1K0AA 4I8BA 3WT1A 2WZ9A 2CX3A 4F0BA 3KM6A 3LYKA 4OWYA 3C71A 2CAIA 13GSA
chains in the Genus database with same CATH superfamily
2EIRA 3FR9A 2H76A 1WE0A 4V2LA 1UC7A 2C0FA 4POKA 5A4UA 4DVCA 2NPBA 4L5LA 2HSHA 4EIPA 1QGVA 5CP1A 1YQ1A 3EINA 1HYUA 4K0NA 3NIVA 2C3TA 1WWJA 3GYKA 1XZOA 2YNXA 5CYYA 1XPVA 3HVNA 1Z9HA 3TJJA 4TW5A 2A4HA 3EURA 5D96A 1OC9B 3TJGA 1E6BA 4QL9A 3E3EA 2TRXA 2PPTA 3IR4A 1FOHA 2A2SA 2VLTA 1Q4JA 4JR4A 4ZB6A 3GN3A 2JADA 2OADA 4TOPA 3N5OA 4BWQA 1MTCA 3UL3A 3W8SA 2H6XA 2CV4A 2RM6A 4GSTA 5GSSA 2JZRA 4F03A 2IL3A 1VGLA 2AHEA 4GCIA 5HFKA 4PQIA 3HKRA 2MYGA 1TRUA 3DD3A 3I43A 2E2GA 1XVWA 4I5QA 4BVYB 3A3TA 2JSZA 5IMZA 3GH6A 3PGTA 3VWUA 2BTOT 2IIYA 4LL1B 1EOGA 2DKIA 3QOUA 3TRQA 1GSEA 5HQPA 2F8FA 3ISOA 1PGTA 1C72A 1THOA 1GL8A 5DALA 2VL3A 3DMLA 4POBA 2YCDA 2CVBA 1XW9A 3AY8A 3C1RA 4MZWA 2QA1A 5ECKB 4Q5RA 2B5YA 5COHA 3D4MA 2VCZA 1FAAA 4ZILA 5IQYA 3L9VA 1YEPA 1S3RA 3US3A 2CZ3A 3TB2A 2L57A 5CRWA 5J4UA 1GTIA 3F6FA 5IOXA 2LQQA 1O73A 4JBBA 2MMNA 2HSMA 4MK3A 4MJCA 2VCWA 4GSNA 2B1KA 1U87A 3VWXA 3TRPA 2YWMA 1LBKA 4PXOA 4KB3A 1UVZA 2MBTA 4N30A 2P5RA 4KDUA 1TK5B 1O81A 1FHEA 5G5EA 1EWXA 6GSXA 1WP0A 4MCUA 4XCSA 4ACSA 1SKSB 3I69A 3L9SA 4G2EA 4IVFA 4KCAA 3HHVA 3WGXA 2AAWA 4OCFA 2PVQA 5D9VA 3F0IA 2JL4A 1WMJA 4KF9A 5A5KA 4GRFA 3NZNA 1NW2A 3QAGA 3GURA 4PUAA 3RHBA 5LD0A 4AJ7A 1SKRB 4ZBAA 2GT6A 5DQYA 4I97A 3IDVA 3H93A 3N9JA 5GZZB 5IIZA 5ECNB 3H1NA 4H86A 4G19A 4X4JA 1A8LA 3L0HA 4MDCA 1OE7A 1ZOFA 2AV4A 4JZQA 4L0WA 12GSA 1FW1A 5J41A 2CX4A 3HDCA 5B6MA 3LORA 1Z7RA 1X5EA 1THXA 5D9XA 1XOBA 3KTBA 2N5AA 5F0GA 1SK1A 4QQ7A 3PPUA 1MD4A 2AJQB 2RIIA 5C04A 3KXOA 1A23A 1OAZA 2PUKC 1V98A 3DEXA 5ECIB 2VM2A 4KAEA 2IPAA 2YV9A 4MF5A 3D4TA 5IOWA 3RBTA 2DMLA 2R4VA 1TK0B 1DBYA 4POLA 3F8UA 2DIZA 4KSOA 2IJYA 3HVSA 2HZFA 2L59A 1BYEA 1ZGNA 2GQLA 11GSA 2GZPA 3VWWA 2X8GA 1TXXA 3EE2A 3VWVA 2J23A 1T4ZA 2DJ1A 5JCGA 1V9WA 3BJ5A 3UARA 4EKZA 5A4VA 1T1VA 3LG6A 4MF6A 2C0EA 3APOA 1XOAA 2D2ZA 1ZZYA 5ABRA 5CO3A 3A2WA 4PURA 1TP9A 1XBSA 1F3BA 1A24A 1MEKA 5HR1A 4HI7A 3EVIA 3HVXA 1FB0A 1F6MC 1N8JA 3WGDA 2DC5A 1W89A 1PN0A 4XIHA 3ZFBA 1AC1A 2MMZA 1EOHA 1Y25A 3LWAA 4PTSA 4PUFC 3DKSA 1FOVA 5EY6A 3UIWA 4HZ2A 3DYRA 5DVBA 3ZIJA 4MJAA 1UA5A 3GH9A 3Q18A 1WPIA 1YEXA 1M9AA 2MZCA 1Z7PA 4J2FA 2IMFA 4NV5A 2FGXA 4ZXGA 1DE1A 3ZITA 3ZZXA 2DJ2A 4TVEA 2WDUA 1F37A 5F07A 2FHEA 4NV2A 4XTSA 4ECJA 2MMAA 2H6ZA 1I5GA 1B8XA 1AXDA 3QMXA 4ZB9A 1GTUA 1OC9A 2O89A 3TUEA 3LXZA 4EF0A 3C8EA 1S3CA 4KSMA 3FYGA 4IKHA 3WT2A 3EWLA 2VLVA 3LJRA 1T7PB 4TR0A 3EMPA 2G2QA 2LS5A 1BAYA 4DSSB 3FHKA 2CVKA 3KEBA 1R5PA 7GSSA 2HLSA 3CTGA 1G6WA 2YPMA 4BVYA 2KOKA 1MD3A 4CDOA 3S9FA 4BL7B 3KCMA 14GSA 3F4SA 3MDKA 5FHIA 1VF4A 5ELAA 4TN8A 1GNEA 3DVXA 1YZXA 4RQRA 1PD21 3HCZA 3UBKA 2CVDA 1JZWA 2OJLA 3IC4A 4IQAA 4LMVA 4TR1B 3F3RA 4KX4A 3MAKA 2CQ9A 4GWRA 2DJ3A 2GT5A 5G31A 2YP6A 1GTAA 3HZ8A 3IAM2 2LNTA 4MLYA 22GSA 2FA8A 3IC8A 4KE3A 4OFTA 5C00A 1SL0B 5BMUA 4YH2A 4PQHA 1BQ7A 3M0FA 1MDIA 2O87A 1TDIA 1TKDB 1YKAA 5ECLB 1K3OA 1JLVA 1ERTA 1S3DA 3FZ5A 3UVTA 4ZBBA 3SBCA 1XWBA 2JZTA 1T00A 3LGCA 2LRNA 5J3RA 5HR0A 4XS6A 3EPTA 5B8AA 4HJMA 2EIOA 3GUSA 2WULA 3KMNA 3PINA 4N10A 2X64A 2H0HA 2P0GA 3QDNA 5B7CA 4F9ZA 3G7IA 4LLRA 4PNFA 4RUVA 1RW1A 2QSIA 4G0IA 2PN8A 3TOTA 4A5PA 3A2XA 3C7MA 3F4RA 3RHCA 5JCUA 1YY7A 3FR6A 10GSA 5CAXA 1EZKA 1Z6MA 1OE8A 2VAFA 2G0FA 5EPFA 2PERA 3L78A 5J9CA 1ZYEA 2C0GA 1SJZA 4IELA 3GL5A 2HE3A 1VF3A 5D93A 2I3YA 2RLIA 1T4YA 2FWHA 2QA2A 1GSQA 4FH8A 1WOUA 1XXUA 3R3EA 1JZRA 3CMIA 5ECHB 3GX0A 1QMVA 4USSA 1XW5A 3M9KA 3ME8A 2GSRA 4IGJA 2LRTA 1SYRA 1RK4A 3TGZA 4BA7A 4FYBA 2PMTA 1JZDA 3I6AA 5AIXA 1Z5YE 3GKMA 2RUFA 1GLPA 4IP6A 2VO4A 3D6IA 5H5SA 4ECCA 1ERWA 16GSA 4K7OA 1S3AA 3EMXA 4BPYA 2BJXA 2P5QA 3F3QA 5DAKA 1OYJA 5KN0A 4TR3A 4MPGA 5ECQB 4Q5NA 1TU8A 5IPHA 2VIMA 2OE0A 3GIXA 1QUWA 3CSHA 5A4WA 1JZOA 4JRRA 4Z2RA 5ECPB 2HXKA 2DIYA 1K0OA 2JU5A 1X5DA 3RPPA 5FWGA 2H1BA 5D8IA 1F3AA 4D73B 1QFNA 4WR4A 2K8VA 2YJ7A 5ECRB 5IMAA 1URMA 4OD7A 1PN9A 5ECOB 3HZ4A 4BVXB 4IP1A 2AYTA 1PFOA 4ECIA 4X0XA 2RUEA 2QKEA 1J9BA 4J56E 3QFAC 2KP1A 2KHPA 2L5OA 4WBRD 2WB9A 5GAND 2E7PA 3CSIA 2C80A 1B48A 1LJRA 4L0UA 4KH7A 2A2PA 3CBUA 1GSFA 3KMOA 2FNOA 2J9HA 1GSSA 2HRKA 4DSRA 4K1FA 3O76A 2FLSA 2VL2A 1XVQA 2O85A 4N11A 2H1AA 3HY2A 2EC4A 3BCIA 1EEJA 5CREA 4KNDA 5IM9A 4AJ8A 3UOMA 4OO5A 1K0DA 4ZL7A 1ZYQB 1PMTA 2K18A 2VCVA 5KN3A 3ZVJA 2N5BA 3ZVJD 3GA4A 1GNWA 1PL2A 2H1DA 3VPQA 2REMA 4MH2A 2DJJA 1TI1A 4ZL9A 1XW6A 2YZUA 1TRSA 2YWIA 3U5RE 2K9FA 4MH3A 4DSSA 4PX1A 1SYXA 1MDKA 2VCQA 1PKZA 2P31A 2FWFA 1OKDA 2OA7A 3WYWA 4HJ2A 2RM5A 2VL2C 6GSYA 3M3MA 4ID0A 6GSWA 3TDGA 4O32A 5IMVA 5KOXA 4GQCA 3ZLPA 4BL7A 6GSVA 2YJHA 1DUGA 4IN0A 3F6DA 4MPFA 1G7OA 1GSYA 2C3NA 2LV3A 1TTZA 2PU9C 3GX8A 3DGQA 5IPGA 4AGSA 2B5XA 5G1KA 4WBJA 2L6DA 5H5QA 4TR1A 4ZL8A 1GUHA 3QPMA 3QCPA 1M2DA 1ST9A 3UJ1A 4LMWA 1VF1A 4ILFA 2GGTA 5DAKB 4MJEA 2GSTA 3R2QA 3GHAA 4TXVA 3KJYA 2C0DA 3A2VA 1TRWA 4XS4B 2H1GA 4K2XA 3LXTA 1BG5A 4ULXA 3GNJA 3D21A 2ES7A 2R3XA 2GZZA 4GSSA 5D9TA 1R26A 3QD9A 1LU4A 4DSQA 4IW9A 3HXSA 4MJBA 4MMMA 2VL9A 3VI7A 3Q74A 2B6MA 3KGKA 2NDOA 2DJKA 4NWYA 3G7JA 4NHWA 5AIVA 4MA9A 4YKGA 5AISA 3TJFA 2FA4A 4EVMA 3G9BA 1M2AA 3DVWA 4HOJA 5J9BA 2FCHA 2KP2A 4EDYA 1OVNA 3BBYA 2JSYA 1R5AA 2M46A 3FKFA 1ZL9A 3FW2A 3W8JA 2VM1A 5EL8A 3TCOA 1A2MA 4WETA 2HZEB 4E8HA 2LQOA 2HYXA 3P90A 5IO0A 1FO5A 2CZ2A 4IJ3A 3DIEA 1H4OA 4KW6A 2K6VA 3KH7A 3RAZA 4IHUA 2OACA 3VFIA 1DE2A 2R6KA 1Q98A 1NM3A 1F9MA 4KUNA 5BRTA 3IE3A 1V2AA 2WGRA 3IA1A 3IXRA 1YKCA 3LSZA 2WJUA 1FB6A 2YV7A 4BWSA 3TRXA 1VRSD 3GSSA 1DSBA 4MP4A 2HRAA 3ME7A 4OO4A 4WF4A 2V6KA 3GRXA 4EUYA 1SL2B 2H19A 1T8EB 5D9WA 1SK2A 2ON7A 4WR5A 4ECBA 4LA1A 3BD2A 2B7JA 2F9SA 2LJRA 3IV4A 5CNWA 4NPBA 3CYNA 2IN3A 4ZBDA 4K2DA 3CRUA 3E9JB 2R37A 4PGTA 3KP9A 1ACVA 1K0NA 1USBA 1BEDA 4JEDA 5IMDA 3IPZA 1XWCA 2B7KA 2FWEA 1O7UA 3CQFA 2C8UA 1PKWA 1NHOA 5G5FA 3FZ4A 1AQVA 2CAQA 1YF1A 3F9UA 4K5SA 3V1WA 1TJDA 1FVKA 2H01A 3M8NA 1HQOA 1NSWA 5KN2A 4D73A 3QAVA 3D0ZA 3GV1A 3TKPA 1G0TA 3U6VA 4ZB8A 5JWRB 3UBLA 1PX7A 1IYHA 2IMKA 4BVXA 2DSAA 2FUG2 5CRGA 1ZYNA 2A2RA 2F8AA 3QAWA 1TRVA 1SKWB 1AQXA 4RI7A 3EYTA 5DJLA 3UAPA 1EGOA 2GVPA 2IWTA 4LL4B 3MYDA 2LKUA 4HUAA 2ON5A 1ILOA 3EU3A 1OC8A 2GQKA 5JWQB 1O6JA 4YAPA 2PBJA 4GXZA 3O3TA 1J08A 3PH9A 2R0CA 3IRAA 5IMFA 3FY7A 3SWLA 4YQVA 1HD2A 2CT6A 4E8EA 3GTUB 2PVOC 1GP1A 1J0FA 4O7HA 4DEJA 4K9ZA 2R2JA 1GSUA 1Z3EA 4L8EA 3LQ7A 2V2GA 2O7KA 2X49A 5AN1A 2C1YA 2GTUA 5DQSA 1EP7A 4HQZA 1K0MA 2TRCP 2AB6A 3Q19A 4ML6A 2YWNA 2IFQB 2LEGA 1B9YC 1K0BA 1TK8B 3VPTA 5F06A 1B4PA 5G30A 4WF5A 1IYIA 1ERVA 4RI6A 4CY6A 5DCGA 1XFLA 2X99A 4Q5QA 4JU5A 2NVLA 4AF2A 2NBSA 4HEA2 4CHSA 1TW9A 2H73A 1FG4A 5B8BA 1SU9A 4GLTA 4F2IA 3KH9A 5DDLA 1O8XA 1M3IA 2KLXA 3FK8A 1ABAA 2ZCTA 1GSDA 3P2AA 2WS2A 3VK9A 3E0UA 2GSSA 2TIRA 1SD8A 3ED3A 4V1Ag 3TJBA 4X1UA 1EV9A 4AJ6A 1H75A 2V41A 2FY6A 1SD9A 4MZCA 2H0IA 3H79A 2M80A 1ERUA 2M72A 3HVVA 5ENUA 4NAXA 2HI7A 4TXOB 3KZQA 4J57E 1CQHA 3P7XA 3IHQA 3FZAA 4ICYA 3F4TA 4O5UA 4YAVA 4XS4A 3ZYWA 4OFMA 3ZMLA 4EL1A 4YQUA 2GZYA 2H66A 5KOWA 2NTOA 4CY8A 3M9JA 2XPEA 3TKSA 5GSTA 3M1GA 4ISDA 3P8WA 4EXJA 2F3MA 2C4JA 4KA0A 4Z7XA 3ZTLA 2DMMA 5CRHA 5G2ZA 4K5RA 3APQA 3HJOA 4KGIA 5ID2B 1X9WB 3IHGA 3NOFA 2I9HA 4G0LA 3ZMKA 3DWVA 1GH2A 6GSSA 4F0CA 3GKXA 1M0UA 4KDYA 4N0ZA 18GSA 1PA3A 5E59A 1R4WA 1B9XC 3A5WA 1U3AA 4G0KA 4I2UA 2B5EA 4OCEA 2HZEA 1TOFA 17GSA 1I9DA 4EIQA 2V32A 4YKFA 2I81A 3H4KA 3DXBA 3FR3A 5F05A 4N0VA 4XRAA 3J7Yb 4GQFA 2CA8A 1EGRA 3HYPA 2VLUA 1G7EA 2X4AA 1A2JA 3TKSC 4JE1A 1M7TA 3VURA 1O8WA 4K0GA 1X9MB 1X9SB 5HFGA 2GSQA 3ERGA 1XWKA 1N2AA 3EC3A 3G7YA 1AUCA 3FZ9A 5AGYA 1XG8A 1XWGA 4FYUA 1YF0A 5D73A 1MDJA 3MNGA 2DLXA 4G10A 3EU4A 1K3LA 1M2BA 3JCML 2B1LA 1ZCPA 3FMWA 4HQSA 1GUMA 4K7NA 1YJ6A 2GS3A 5DJMA 3C1SA 4HU9A 2O8VB 3KP8A 1R7HA 2N5FA 4EE0A 3ZREA 2MMOA 4X43A 2X8HA 2L6CA 1PRXA 3L4NA 5ECMB 1HNAA 2VCTA 1M99A 3D5JA 5IMCA 1YDKA 1ZYPA 1V58A 4Q5FA 2Z9SA 4MZBA 2ZUPA 3O6TA 3HA9A 3IOSA 3CTFA 1VF2A 2OE3A 1SK0A 2JACA 3UEMA 1EP8A 2V1MA 2HRFA 3ZL5A 4HSCX 3J7Yk 1AW9A 1K0CA 1B4QA 3BOAA 1RQMA 2DKHA 3FRCA 3IBHA 2K8SA 1GRXA 4HU7A 1GUKA 2FD3A 3FEUA 4V2NA 2EIQA 1U88A 4QL7A 1O85A 1M3JA 2R0GA 2I4AA 8GSSA 1KNGA 4I2TA 4O92A 1K3YA 3CRTA 2H71A 1GTBA 1EEMA 2HRNA 3GKNA 3IK9A 4L5OA 3RPNA 1AAZA 3F63A 2GQMA 3GTUA 2OKAA 1A2LA 4TR4A 1E2YA 1BJXA 3QFBC 1V40A 1TU7A 1OKTA 2LUSA 2LTKA 1QK8A 1PQNA 5L71A 3APSA 1HNBA 4F82A 4GF0A 4NMUA 1CQGA 3GSTA 5KEJA 1XWAA 1F2EA 3CSJA 3D22A 4CW9A 1PSQA 1X0RA 4K8MA 3BCKA 2HFDA 5G1LA 2MBSA 2QC7A 4FQUA 1Z6NA 9GSSA 2LNSA 5JWOB 2IFQA 1G6YA 4ML1A 3L9UA 5F8BA 1EV4A 2WRTA 2VCXA 1JFUA 4POMA 1SJIA 3H8QA 3QR6A 4XHMA 1SENA 1WJKA 2QGVA 1WRYA 4P3YB 1KTEA 2GDRA 4WKWA 1U6TA 4OFNA 2E0QA 5EVOA 6GSUA 5DBQA 5J5NA 2LJKA 2I1UA 5CRDA 4KDXA 4FIWA 4PQ1A 3KTLA 3HJMA 5DALB 2XBIA 3MWHA 1A0FA 2HSYA 4MNNA 2H74A 20GSA 3PR8A 1M9BA 2LRCA 3GL3A 5HR3A 1GLQA 1UN2A 3IAS2 3RDWA 5H5RA 5JCWA 4NXIA 3OR5A 3UMAA 2LSTA 1ON4A 4O5QA 3ZFLA 4NHZA 5B6NA 4KCEA 2F51A 4GTUA 4YQMA 2L5LA 3IK7A 2YWOA 5DCHA 2H8LA 1KEBA 1FVJA 1V57A 2PWJA 5ECSA 2KUCA 2R5GA 4G9HA 1PX6A 4TXOA 2WCIA 5INYA 1Y6EA 5FT3A 3ZIVA 2ALBA 2V6OA 4XRDA 2BMXA 3Q6OA 4MABA 4WEYA 5LNKe 3W6GA 2VOCA 3MSZA 5LCZA 1SL1B 3TJKA 2GLRA 3ERWA 2YZHA 1ZMAA 2XBQA 4Z2TA 3MIXA 4WXTA 3K8NA 2XHFA 4MF7A 2JZSA 5ID2A 2IMIA 3KIJA 2VD0A 5IO2A 1AIUA 2VD1A 1WIKA 4TKYA 4XS1A 2YOIA 4V1Ap 3UVHA 1A8YA 4OMVA 2IMDA 2IMEA 3LEFA 5ELGA 4O5RA 1W4VA 3C73A 4HDEA 2FWGA 3WD6A 5KN1A 3KD0A 2HT9A 5E4WA 2E2MA 1T3BA 3GMFA 3CXGA 1NHYA 3GFKA 2OBIA 2H0GA 3LYPA 3HD5A 4FYCA 3VLNA 2OE1A 3TKRA 2VUPA 2X8CA 4RQXA 5HFIA 4IBPA 1XCCA 4FO5A 2LJAA 3HJPA 4ZIJA 3TKSE 3VI5A 1ML6A 2R0PA 2ZNMA 2YN1A 4IJIA 2HNLA 2PGTA 3LFLA 4HZ4A 2YANA 2DJ0A 1GULA 1SJ6A 1X5CA 4V2MA 1OC3A 1JHBA 5GAPD 3GKKA 1A0RP 1JLWA 2B3SA 2H70A 2WFCA 2DBCA 3TKQA 4EDZA 1GWCA 3WGEA 4IS0A 1QQ2A 4BIKA 4EC0A 19GSA 1KBNA 2XPDA 2H30A 3A5IA 4EO3A 1QXHA 2OBKA 2H6YA 2A4VA 1U3IA 4I6XA 1XIYA 2H75A 3ZRDA 4K6XA 1AQWA 1TI3A 4IQ1A 4Z2UA 4HS1A 3I9V2 6GSTA 4TRXA 3TOUA 3ERFA 1BX9A 2AUVA 1HNCA 4K7IA 1PL1A 2H72A 2C3QA 3LW9A 2L4CA 5HR2A 2L4QA 4PNGA 3DRNA 2UZ8A 2XC2A 4JR6A 1K0AA 4I8BA 3WT1A 2WZ9A 2CX3A 4F0BA 3KM6A 3LYKA 4OWYA 3C71A 2CAIA 13GSA
chains in the Genus database with same CATH topology
2EIRA 3FR9A 2H76A 1WE0A 4V2LA 1UC7A 2C0FA 4POKA 5A4UA 4DVCA 2NPBA 4L5LA 2HSHA 4EIPA 1QGVA 5CP1A 1YQ1A 3EINA 1HYUA 4K0NA 3NIVA 2C3TA 1WWJA 3GYKA 1XZOA 2YNXA 5CYYA 1XPVA 1Z9HA 3TJJA 4TW5A 2A4HA 3EURA 5D96A 1OC9B 3TJGA 1E6BA 4QL9A 3E3EA 2TRXA 2PPTA 3IR4A 1FOHA 2A2SA 2VLTA 1Q4JA 4JR4A 4ZB6A 3GN3A 2JADA 2OADA 4TOPA 3N5OA 4BWQA 1MTCA 3UL3A 3W8SA 2H6XA 2CV4A 2RM6A 4GSTA 5GSSA 2JZRA 4F03A 2IL3A 1VGLA 2AHEA 4GCIA 5HFKA 4PQIA 3HKRA 2MYGA 1TRUA 3DD3A 3I43A 2E2GA 1XVWA 4I5QA 4BVYB 3A3TA 2JSZA 5IMZA 3GH6A 3PGTA 3VWUA 2BTOT 2IIYA 4LL1B 1EOGA 2DKIA 3QOUA 3TRQA 1GSEA 5HQPA 2F8FA 3ISOA 1PGTA 1C72A 1THOA 1GL8A 5DALA 2VL3A 3DMLA 4POBA 2YCDA 2CVBA 1XW9A 3AY8A 3C1RA 4MZWA 2QA1A 5ECKB 4Q5RA 2B5YA 5COHA 3D4MA 2VCZA 1FAAA 4ZILA 5IQYA 3L9VA 1YEPA 3US3A 2CZ3A 3TB2A 2L57A 5CRWA 5J4UA 1GTIA 3F6FA 5IOXA 2LQQA 1O73A 4JBBA 2MMNA 2HSMA 4MK3A 4MJCA 2VCWA 4GSNA 2B1KA 1U87A 3VWXA 3TRPA 2YWMA 1LBKA 4PXOA 4KB3A 1UVZA 2MBTA 4N30A 2P5RA 4KDUA 1TK5B 1O81A 1FHEA 5G5EA 1EWXA 6GSXA 1WP0A 4MCUA 4XCSA 4ACSA 1SKSB 3I69A 3L9SA 4G2EA 4IVFA 4KCAA 3HHVA 3WGXA 2AAWA 4OCFA 2PVQA 5D9VA 3F0IA 2JL4A 1WMJA 4KF9A 5A5KA 4GRFA 3NZNA 1NW2A 3QAGA 3GURA 4PUAA 3RHBA 5LD0A 4AJ7A 1SKRB 4ZBAA 2GT6A 5DQYA 4I97A 3IDVA 3H93A 3N9JA 5GZZB 5IIZA 5ECNB 3H1NA 4H86A 4G19A 4X4JA 1A8LA 3L0HA 4MDCA 1OE7A 1ZOFA 2AV4A 4JZQA 4L0WA 12GSA 1FW1A 5J41A 2CX4A 3HDCA 5B6MA 3LORA 1Z7RA 1X5EA 1THXA 5D9XA 1XOBA 3KTBA 2N5AA 5F0GA 1SK1A 4QQ7A 3PPUA 1MD4A 2AJQB 2RIIA 5C04A 3KXOA 1A23A 1OAZA 2PUKC 1V98A 3DEXA 5ECIB 2VM2A 4KAEA 2IPAA 2YV9A 4MF5A 3D4TA 5IOWA 3RBTA 2DMLA 2R4VA 1TK0B 1DBYA 4POLA 3F8UA 2DIZA 4KSOA 2IJYA 3HVSA 2HZFA 2L59A 1BYEA 1ZGNA 2GQLA 11GSA 2GZPA 3VWWA 2X8GA 1TXXA 3EE2A 3VWVA 2J23A 1T4ZA 2DJ1A 5JCGA 1V9WA 3BJ5A 3UARA 4EKZA 5A4VA 1T1VA 3LG6A 4MF6A 2C0EA 3APOA 1XOAA 2D2ZA 1ZZYA 5ABRA 5CO3A 3A2WA 4PURA 1TP9A 1XBSA 1F3BA 1A24A 1MEKA 5HR1A 4HI7A 3EVIA 3HVXA 1FB0A 1F6MC 1N8JA 3WGDA 2DC5A 1W89A 1PN0A 4XIHA 3ZFBA 1AC1A 2MMZA 1EOHA 1Y25A 3LWAA 4PTSA 4PUFC 3DKSA 1FOVA 5EY6A 3UIWA 4HZ2A 3DYRA 5DVBA 3ZIJA 4MJAA 1UA5A 3GH9A 3Q18A 1WPIA 1YEXA 1M9AA 2MZCA 1Z7PA 4J2FA 2IMFA 4NV5A 2FGXA 4ZXGA 1DE1A 3ZITA 3ZZXA 2DJ2A 4TVEA 2WDUA 1F37A 5F07A 2FHEA 4NV2A 4XTSA 4ECJA 2MMAA 2H6ZA 1I5GA 1B8XA 1AXDA 3QMXA 4ZB9A 1GTUA 1OC9A 2O89A 3TUEA 3LXZA 4EF0A 3C8EA 1S3CA 4KSMA 3FYGA 4IKHA 3WT2A 3EWLA 2VLVA 3LJRA 1T7PB 4TR0A 3EMPA 2G2QA 2LS5A 1BAYA 4DSSB 3FHKA 2CVKA 3KEBA 1R5PA 7GSSA 2HLSA 3CTGA 1G6WA 2YPMA 4BVYA 2KOKA 1MD3A 4CDOA 3S9FA 4BL7B 3KCMA 14GSA 3F4SA 3MDKA 5FHIA 1VF4A 5ELAA 4TN8A 1GNEA 3DVXA 1YZXA 4RQRA 1PD21 3HCZA 3UBKA 2CVDA 1JZWA 2OJLA 3IC4A 4IQAA 4LMVA 4TR1B 3F3RA 4KX4A 3MAKA 2CQ9A 4GWRA 2DJ3A 2GT5A 5G31A 2YP6A 1GTAA 3HZ8A 3IAM2 2LNTA 4MLYA 22GSA 2FA8A 3IC8A 4KE3A 4OFTA 5C00A 1SL0B 5BMUA 4YH2A 4PQHA 1BQ7A 3M0FA 1MDIA 2O87A 1TDIA 1TKDB 1YKAA 5ECLB 1K3OA 1JLVA 1ERTA 1S3DA 3FZ5A 3UVTA 4ZBBA 3SBCA 1XWBA 2JZTA 1T00A 3LGCA 2LRNA 5J3RA 5HR0A 4XS6A 3EPTA 5B8AA 4HJMA 2EIOA 3GUSA 2WULA 3KMNA 3PINA 4N10A 2X64A 2H0HA 2P0GA 3QDNA 5B7CA 4F9ZA 3G7IA 4LLRA 4PNFA 4RUVA 1RW1A 2QSIA 4G0IA 2PN8A 3TOTA 4A5PA 3A2XA 3C7MA 3F4RA 3RHCA 5JCUA 1YY7A 3FR6A 10GSA 5CAXA 1EZKA 1Z6MA 1OE8A 2VAFA 2G0FA 5EPFA 2PERA 3L78A 5J9CA 1ZYEA 2C0GA 1SJZA 4IELA 3GL5A 2HE3A 1VF3A 5D93A 2I3YA 2RLIA 1T4YA 2FWHA 2QA2A 1GSQA 4FH8A 1WOUA 1XXUA 3R3EA 1JZRA 3CMIA 5ECHB 3GX0A 1QMVA 4USSA 1XW5A 3M9KA 3ME8A 2GSRA 4IGJA 2LRTA 1SYRA 1RK4A 3TGZA 4BA7A 4FYBA 2PMTA 1JZDA 3I6AA 5AIXA 1Z5YE 3GKMA 2RUFA 1GLPA 4IP6A 2VO4A 3D6IA 5H5SA 4ECCA 1ERWA 16GSA 4K7OA 1S3AA 3EMXA 4BPYA 2BJXA 2P5QA 3F3QA 5DAKA 1OYJA 5KN0A 4TR3A 4MPGA 5ECQB 4Q5NA 1TU8A 5IPHA 2VIMA 2OE0A 3GIXA 1QUWA 3CSHA 5A4WA 1JZOA 4JRRA 4Z2RA 5ECPB 2HXKA 2DIYA 1K0OA 2JU5A 1X5DA 3RPPA 5FWGA 2H1BA 5D8IA 1F3AA 4D73B 1QFNA 4WR4A 2K8VA 2YJ7A 5ECRB 5IMAA 1URMA 4OD7A 1PN9A 5ECOB 3HZ4A 4BVXB 4IP1A 2AYTA 4ECIA 4X0XA 2RUEA 2QKEA 1J9BA 4J56E 3QFAC 2KP1A 2KHPA 2L5OA 4WBRD 2WB9A 5GAND 2E7PA 3CSIA 2C80A 1B48A 1LJRA 4L0UA 4KH7A 2A2PA 3CBUA 1GSFA 3KMOA 2FNOA 2J9HA 1GSSA 2HRKA 4DSRA 4K1FA 3O76A 2FLSA 2VL2A 1XVQA 2O85A 4N11A 2H1AA 3HY2A 2EC4A 3BCIA 1EEJA 5CREA 4KNDA 5IM9A 4AJ8A 3UOMA 4OO5A 1K0DA 4ZL7A 1ZYQB 1PMTA 2K18A 2VCVA 5KN3A 3ZVJA 2N5BA 3ZVJD 3GA4A 1GNWA 1PL2A 2H1DA 3VPQA 2REMA 4MH2A 2DJJA 1TI1A 4ZL9A 1XW6A 2YZUA 1TRSA 2YWIA 3U5RE 2K9FA 4MH3A 4DSSA 4PX1A 1SYXA 1MDKA 2VCQA 1PKZA 2P31A 2FWFA 1OKDA 2OA7A 3WYWA 4HJ2A 2RM5A 2VL2C 6GSYA 3M3MA 4ID0A 6GSWA 3TDGA 4O32A 5IMVA 5KOXA 4GQCA 3ZLPA 4BL7A 6GSVA 2YJHA 1DUGA 4IN0A 3F6DA 4MPFA 1G7OA 1GSYA 2C3NA 2LV3A 1TTZA 2PU9C 3GX8A 3DGQA 5IPGA 4AGSA 2B5XA 5G1KA 4WBJA 2L6DA 5H5QA 4TR1A 4ZL8A 1GUHA 3QPMA 3QCPA 1M2DA 1ST9A 3UJ1A 4LMWA 1VF1A 4ILFA 2GGTA 5DAKB 4MJEA 2GSTA 3R2QA 3GHAA 4TXVA 3KJYA 2C0DA 3A2VA 1TRWA 4XS4B 2H1GA 4K2XA 3LXTA 1BG5A 4ULXA 3GNJA 3D21A 2ES7A 2R3XA 2GZZA 4GSSA 5D9TA 1R26A 3QD9A 1LU4A 4DSQA 4IW9A 3HXSA 4MJBA 4MMMA 2VL9A 3VI7A 3Q74A 2B6MA 3KGKA 2NDOA 2DJKA 4NWYA 3G7JA 4NHWA 5AIVA 4MA9A 4YKGA 5AISA 3TJFA 2FA4A 4EVMA 3G9BA 1M2AA 3DVWA 4HOJA 5J9BA 2FCHA 2KP2A 4EDYA 1OVNA 3BBYA 2JSYA 1R5AA 2M46A 3FKFA 1ZL9A 3FW2A 3W8JA 2VM1A 5EL8A 3TCOA 1A2MA 4WETA 2HZEB 4E8HA 2LQOA 2HYXA 3P90A 5IO0A 1FO5A 2CZ2A 4IJ3A 3DIEA 1H4OA 4KW6A 2K6VA 3KH7A 3RAZA 4IHUA 2OACA 3VFIA 1DE2A 2R6KA 1Q98A 1NM3A 1F9MA 4KUNA 5BRTA 3IE3A 1V2AA 2WGRA 3IA1A 3IXRA 1YKCA 3LSZA 2WJUA 1FB6A 2YV7A 4BWSA 3TRXA 1VRSD 3GSSA 1DSBA 4MP4A 2HRAA 3ME7A 4OO4A 4WF4A 2V6KA 3GRXA 4EUYA 1SL2B 2H19A 1T8EB 5D9WA 1SK2A 2ON7A 4WR5A 4ECBA 4LA1A 3BD2A 2B7JA 2F9SA 2LJRA 3IV4A 5CNWA 4NPBA 3CYNA 2IN3A 4ZBDA 4K2DA 3CRUA 3E9JB 2R37A 4PGTA 3KP9A 1ACVA 1K0NA 1USBA 1BEDA 4JEDA 5IMDA 3IPZA 1XWCA 2B7KA 2FWEA 1O7UA 2C8UA 1PKWA 1NHOA 5G5FA 3FZ4A 1AQVA 2CAQA 1YF1A 3F9UA 4K5SA 3V1WA 1TJDA 1FVKA 2H01A 3M8NA 1HQOA 1NSWA 5KN2A 4D73A 3QAVA 3D0ZA 3GV1A 3TKPA 1G0TA 3U6VA 4ZB8A 5JWRB 3UBLA 1PX7A 1IYHA 2IMKA 4BVXA 2DSAA 2FUG2 5CRGA 1ZYNA 2A2RA 2F8AA 3QAWA 1TRVA 1SKWB 1AQXA 4RI7A 3EYTA 5DJLA 3UAPA 1EGOA 2GVPA 2IWTA 4LL4B 3MYDA 2LKUA 4HUAA 2ON5A 1ILOA 3EU3A 1OC8A 2GQKA 5JWQB 1O6JA 4YAPA 2PBJA 4GXZA 3O3TA 1J08A 3PH9A 2R0CA 3IRAA 5IMFA 3FY7A 3SWLA 4YQVA 1HD2A 2CT6A 4E8EA 3GTUB 2PVOC 1GP1A 1J0FA 4O7HA 4DEJA 4K9ZA 2R2JA 1GSUA 1Z3EA 4L8EA 3LQ7A 2V2GA 2O7KA 2X49A 5AN1A 2C1YA 2GTUA 5DQSA 1EP7A 4HQZA 1K0MA 2TRCP 2AB6A 3Q19A 4ML6A 2YWNA 2IFQB 2LEGA 1B9YC 1K0BA 1TK8B 3VPTA 5F06A 1B4PA 5G30A 4WF5A 1IYIA 1ERVA 4RI6A 4CY6A 5DCGA 1XFLA 2X99A 4Q5QA 4JU5A 2NVLA 4AF2A 2NBSA 4HEA2 4CHSA 1TW9A 2H73A 1FG4A 5B8BA 1SU9A 4GLTA 4F2IA 3KH9A 5DDLA 1O8XA 2KLXA 3FK8A 1ABAA 2ZCTA 1GSDA 3P2AA 2WS2A 3VK9A 3E0UA 2GSSA 2TIRA 1SD8A 3ED3A 4V1Ag 3TJBA 4X1UA 1EV9A 4AJ6A 1H75A 2V41A 2FY6A 1SD9A 4MZCA 2H0IA 3H79A 2M80A 1ERUA 2M72A 3HVVA 5ENUA 4NAXA 2HI7A 4TXOB 3KZQA 4J57E 1CQHA 3P7XA 3IHQA 3FZAA 4ICYA 3F4TA 4O5UA 4YAVA 4XS4A 3ZYWA 4OFMA 3ZMLA 4EL1A 4YQUA 2GZYA 2H66A 5KOWA 2NTOA 4CY8A 3M9JA 2XPEA 3TKSA 5GSTA 3M1GA 4ISDA 3P8WA 4EXJA 2F3MA 2C4JA 4KA0A 4Z7XA 3ZTLA 2DMMA 5CRHA 5G2ZA 4K5RA 3APQA 3HJOA 4KGIA 5ID2B 1X9WB 3IHGA 3NOFA 2I9HA 4G0LA 3ZMKA 3DWVA 1GH2A 6GSSA 4F0CA 3GKXA 1M0UA 4KDYA 4N0ZA 18GSA 1PA3A 5E59A 1R4WA 1B9XC 3A5WA 1U3AA 4G0KA 4I2UA 2B5EA 4OCEA 2HZEA 1TOFA 17GSA 1I9DA 4EIQA 2V32A 4YKFA 2I81A 3H4KA 3DXBA 3FR3A 5F05A 4N0VA 4XRAA 3J7Yb 4GQFA 2CA8A 1EGRA 3HYPA 2VLUA 1G7EA 2X4AA 1A2JA 3TKSC 4JE1A 1M7TA 3VURA 1O8WA 4K0GA 1X9MB 1X9SB 5HFGA 2GSQA 3ERGA 1XWKA 1N2AA 3EC3A 3G7YA 1AUCA 3FZ9A 5AGYA 1XWGA 4FYUA 1YF0A 5D73A 1MDJA 3MNGA 2DLXA 4G10A 3EU4A 1K3LA 1M2BA 3JCML 2B1LA 1ZCPA 3FMWA 4HQSA 1GUMA 4K7NA 1YJ6A 2GS3A 5DJMA 3C1SA 4HU9A 2O8VB 3KP8A 1R7HA 2N5FA 4EE0A 3ZREA 2MMOA 4X43A 2X8HA 2L6CA 1PRXA 3L4NA 5ECMB 1HNAA 2VCTA 1M99A 3D5JA 5IMCA 1YDKA 1ZYPA 1V58A 4Q5FA 2Z9SA 4MZBA 2ZUPA 3O6TA 3HA9A 3IOSA 3CTFA 1VF2A 2OE3A 1SK0A 2JACA 3UEMA 1EP8A 2V1MA 2HRFA 3ZL5A 3J7Yk 1AW9A 1K0CA 1B4QA 3BOAA 1RQMA 2DKHA 3FRCA 3IBHA 2K8SA 1GRXA 4HU7A 1GUKA 2FD3A 3FEUA 4V2NA 2EIQA 1U88A 4QL7A 1O85A 2R0GA 2I4AA 8GSSA 1KNGA 4I2TA 4O92A 1K3YA 3CRTA 2H71A 1GTBA 1EEMA 2HRNA 3GKNA 3IK9A 4L5OA 3RPNA 1AAZA 3F63A 2GQMA 3GTUA 2OKAA 1A2LA 4TR4A 1E2YA 1BJXA 3QFBC 1V40A 1TU7A 1OKTA 2LUSA 2LTKA 1QK8A 1PQNA 5L71A 3APSA 1HNBA 4F82A 4GF0A 4NMUA 1CQGA 3GSTA 5KEJA 1XWAA 1F2EA 3CSJA 3D22A 4CW9A 1PSQA 1X0RA 4K8MA 3BCKA 2HFDA 5G1LA 2MBSA 2QC7A 4FQUA 1Z6NA 9GSSA 2LNSA 5JWOB 2IFQA 1G6YA 4ML1A 3L9UA 5F8BA 1EV4A 2WRTA 2VCXA 1JFUA 4POMA 1SJIA 3H8QA 3QR6A 4XHMA 1SENA 1WJKA 2QGVA 1WRYA 4P3YB 1KTEA 2GDRA 4WKWA 1U6TA 4OFNA 2E0QA 5EVOA 6GSUA 5DBQA 5J5NA 2LJKA 2I1UA 5CRDA 4KDXA 4FIWA 4PQ1A 3KTLA 3HJMA 5DALB 2XBIA 3MWHA 1A0FA 2HSYA 4MNNA 2H74A 20GSA 3PR8A 1M9BA 2LRCA 3GL3A 5HR3A 1GLQA 1UN2A 3IAS2 3RDWA 5H5RA 5JCWA 4NXIA 3OR5A 3UMAA 2LSTA 1ON4A 4O5QA 3ZFLA 4NHZA 5B6NA 4KCEA 2F51A 4GTUA 4YQMA 2L5LA 3IK7A 2YWOA 5DCHA 2H8LA 1KEBA 1FVJA 1V57A 2PWJA 5ECSA 2KUCA 2R5GA 4G9HA 1PX6A 4TXOA 2WCIA 5INYA 1Y6EA 5FT3A 3ZIVA 2ALBA 2V6OA 4XRDA 2BMXA 3Q6OA 4MABA 4WEYA 5LNKe 3W6GA 2VOCA 3MSZA 5LCZA 1SL1B 3TJKA 2GLRA 3ERWA 2YZHA 1ZMAA 2XBQA 4Z2TA 3MIXA 4WXTA 3K8NA 2XHFA 4MF7A 2JZSA 5ID2A 2IMIA 3KIJA 2VD0A 5IO2A 1AIUA 2VD1A 1WIKA 4TKYA 4XS1A 2YOIA 4V1Ap 3UVHA 1A8YA 4OMVA 2IMDA 2IMEA 3LEFA 5ELGA 4O5RA 1W4VA 3C73A 4HDEA 2FWGA 3WD6A 5KN1A 3KD0A 2HT9A 5E4WA 2E2MA 1T3BA 3GMFA 3CXGA 1NHYA 3GFKA 2OBIA 2H0GA 3LYPA 3HD5A 4FYCA 3VLNA 2OE1A 3TKRA 2VUPA 2X8CA 4RQXA 5HFIA 4IBPA 1XCCA 4FO5A 2LJAA 3HJPA 4ZIJA 3TKSE 3VI5A 1ML6A 2R0PA 2ZNMA 2YN1A 4IJIA 2HNLA 2PGTA 3LFLA 4HZ4A 2YANA 2DJ0A 1GULA 1SJ6A 1X5CA 4V2MA 1OC3A 1JHBA 5GAPD 3GKKA 1A0RP 1JLWA 2B3SA 2H70A 2WFCA 2DBCA 3TKQA 4EDZA 1GWCA 3WGEA 4IS0A 1QQ2A 4EC0A 19GSA 1KBNA 2XPDA 2H30A 3A5IA 4EO3A 1QXHA 2OBKA 2H6YA 2A4VA 1U3IA 4I6XA 1XIYA 2H75A 3ZRDA 4K6XA 1AQWA 1TI3A 4IQ1A 4Z2UA 4HS1A 3I9V2 6GSTA 4TRXA 3TOUA 3ERFA 1BX9A 2AUVA 1HNCA 4K7IA 1PL1A 2H72A 2C3QA 3LW9A 2L4CA 5HR2A 2L4QA 4PNGA 3DRNA 2UZ8A 2XC2A 4JR6A 1K0AA 4I8BA 3WT1A 2WZ9A 2CX3A 4F0BA 3KM6A 3LYKA 4OWYA 3C71A 2CAIA 13GSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EIR A;  3FR9 A;  2H76 A;  1WE0 A;  4V2L A;  1UC7 A;  2C0F A;  4POK A;  5A4U A;  4DVC A;  2NPB A;  4L5L A;  2HSH A;  1QGV A;  5CP1 A;  1YQ1 A;  3EIN A;  1HYU A;  4K0N A;  3NIV A;  2C3T A;  1WWJ A;  3GYK A;  1XZO A;  2YNX A;  5CYY A;  1XPV A;  1Z9H A;  3TJJ A;  4TW5 A;  3EUR A;  5D96 A;  1OC9 B;  3TJG A;  1E6B A;  4QL9 A;  3E3E A;  2TRX A;  2PPT A;  3IR4 A;  2A2S A;  2VLT A;  1Q4J A;  4JR4 A;  4ZB6 A;  3GN3 A;  2JAD A;  2OAD A;  4TOP A;  3N5O A;  4BWQ A;  1MTC A;  3UL3 A;  3W8S A;  2H6X A;  2CV4 A;  2RM6 A;  4GST A;  5GSS A;  2JZR A;  4F03 A;  2IL3 A;  1VGL A;  2AHE A;  4GCI A;  5HFK A;  4PQI A;  3HKR A;  2MYG A;  1TRU A;  3DD3 A;  3I43 A;  2E2G A;  1XVW A;  4I5Q A;  3A3T A;  2JSZ A;  5IMZ A;  3GH6 A;  3PGT A;  3VWU A;  2BTO T;  2IIY A;  4LL1 B;  1EOG A;  3QOU A;  3TRQ A;  1GSE A;  5HQP A;  2F8F A;  3ISO A;  1PGT A;  1C72 A;  1THO A;  1GL8 A;  5DAL A;  2VL3 A;  3DML A;  4POB A;  2YCD A;  2CVB A;  1XW9 A;  3AY8 A;  3C1R A;  4MZW A;  5ECK B;  4Q5R A;  2B5Y A;  5COH A;  3D4M A;  2VCZ A;  1FAA A;  4ZIL A;  5IQY A;  3L9V A;  1YEP A;  3US3 A;  2CZ3 A;  3TB2 A;  2L57 A;  5CRW A;  5J4U A;  1GTI A;  3F6F A;  5IOX A;  2LQQ A;  1O73 A;  4JBB A;  2MMN A;  4MK3 A;  4MJC A;  2VCW A;  4GSN A;  2B1K A;  1U87 A;  3VWX A;  3TRP A;  2YWM A;  1LBK A;  4PXO A;  4KB3 A;  1UVZ A;  2MBT A;  4N30 A;  2P5R A;  4KDU A;  1TK5 B;  1O81 A;  1FHE A;  5G5E A;  1EWX A;  6GSX A;  1WP0 A;  4MCU A;  4XCS A;  4ACS A;  1SKS B;  3I69 A;  3L9S A;  4G2E A;  4IVF A;  4KCA A;  3HHV A;  3WGX A;  2AAW A;  4OCF A;  2PVQ A;  5D9V A;  3F0I A;  2JL4 A;  1WMJ A;  5A5K A;  4GRF A;  3NZN A;  1NW2 A;  3QAG A;  3GUR A;  4PUA A;  3RHB A;  5LD0 A;  4AJ7 A;  1SKR B;  4ZBA A;  2GT6 A;  5DQY A;  4I97 A;  3IDV A;  3H93 A;  3N9J A;  5GZZ B;  5IIZ A;  5ECN B;  3H1N A;  4H86 A;  4G19 A;  1A8L A;  3L0H A;  4MDC A;  1OE7 A;  1ZOF A;  2AV4 A;  4JZQ A;  4L0W A;  12GS A;  1FW1 A;  5J41 A;  2CX4 A;  3HDC A;  5B6M A;  3LOR A;  1Z7R A;  1X5E A;  1THX A;  5D9X A;  1XOB A;  3KTB A;  2N5A A;  5F0G A;  1SK1 A;  4QQ7 A;  1MD4 A;  2AJQ B;  2RII A;  5C04 A;  3KXO A;  1A23 A;  1OAZ A;  2PUK C;  1V98 A;  3DEX A;  5ECI B;  2VM2 A;  4KAE A;  2IPA A;  2YV9 A;  4MF5 A;  3D4T A;  5IOW A;  3RBT A;  2DML A;  2R4V A;  1TK0 B;  1DBY A;  4POL A;  3F8U A;  2DIZ A;  4KSO A;  2IJY A;  3HVS A;  2HZF A;  2L59 A;  1BYE A;  1ZGN A;  2GQL A;  11GS A;  2GZP A;  3VWW A;  2X8G A;  1TXX A;  3EE2 A;  3VWV A;  2J23 A;  1T4Z A;  2DJ1 A;  5JCG A;  1V9W A;  3BJ5 A;  3UAR A;  4EKZ A;  5A4V A;  1T1V A;  3LG6 A;  4MF6 A;  2C0E A;  3APO A;  1XOA A;  2D2Z A;  1ZZY A;  5ABR A;  5CO3 A;  3A2W A;  4PUR A;  1TP9 A;  1XBS A;  1F3B A;  1A24 A;  1MEK A;  5HR1 A;  4HI7 A;  3EVI A;  3HVX A;  1FB0 A;  1F6M C;  1N8J A;  3WGD A;  2DC5 A;  1W89 A;  4XIH A;  3ZFB A;  1AC1 A;  2MMZ A;  1EOH A;  1Y25 A;  3LWA A;  4PUF C;  3DKS A;  1FOV A;  5EY6 A;  3UIW A;  4HZ2 A;  3DYR A;  5DVB A;  3ZIJ A;  4MJA A;  1UA5 A;  3GH9 A;  3Q18 A;  1WPI A;  1YEX A;  1M9A A;  2MZC A;  1Z7P A;  4J2F A;  2IMF A;  4NV5 A;  2FGX A;  4ZXG A;  1DE1 A;  3ZIT A;  3ZZX A;  2DJ2 A;  4TVE A;  2WDU A;  1F37 A;  5F07 A;  2FHE A;  4NV2 A;  4XTS A;  4ECJ A;  2MMA A;  2H6Z A;  1I5G A;  1B8X A;  1AXD A;  3QMX A;  4ZB9 A;  1GTU A;  1OC9 A;  2O89 A;  3TUE A;  3LXZ A;  4EF0 A;  3C8E A;  1S3C A;  4KSM A;  3FYG A;  4IKH A;  3WT2 A;  3EWL A;  2VLV A;  3LJR A;  1T7P B;  4TR0 A;  3EMP A;  2G2Q A;  2LS5 A;  1BAY A;  4DSS B;  3FHK A;  2CVK A;  3KEB A;  1R5P A;  7GSS A;  2HLS A;  3CTG A;  1G6W A;  2YPM A;  4BVY A;  2KOK A;  1MD3 A;  4CDO A;  3S9F A;  3KCM A;  14GS A;  3F4S A;  3MDK A;  5FHI A;  1VF4 A;  5ELA A;  4TN8 A;  1GNE A;  3DVX A;  1YZX A;  4RQR A;  1PD2 1;  3HCZ A;  3UBK A;  2CVD A;  1JZW A;  2OJL A;  3IC4 A;  4IQA A;  4LMV A;  4TR1 B;  3F3R A;  4KX4 A;  3MAK A;  2CQ9 A;  4GWR A;  2DJ3 A;  2GT5 A;  5G31 A;  2YP6 A;  1GTA A;  3HZ8 A;  3IAM 2;  2LNT A;  4MLY A;  22GS A;  2FA8 A;  4OFT A;  4KE3 A;  5C00 A;  1SL0 B;  4YH2 A;  4PQH A;  1BQ7 A;  3M0F A;  1MDI A;  2O87 A;  1TDI A;  1TKD B;  1YKA A;  5ECL B;  1K3O A;  1JLV A;  1ERT A;  1S3D A;  3FZ5 A;  3UVT A;  4ZBB A;  3SBC A;  1XWB A;  2JZT A;  1T00 A;  3LGC A;  2LRN A;  5J3R A;  5HR0 A;  4XS6 A;  5B8A A;  4HJM A;  2EIO A;  3GUS A;  2WUL A;  3KMN A;  3PIN A;  4N10 A;  2X64 A;  2H0H A;  2P0G A;  3QDN A;  5B7C A;  4F9Z A;  3G7I A;  4LLR A;  4PNF A;  4RUV A;  1RW1 A;  2QSI A;  2PN8 A;  3TOT A;  3A2X A;  3C7M A;  3F4R A;  3RHC A;  5JCU A;  1YY7 A;  3FR6 A;  10GS A;  5CAX A;  1EZK A;  1Z6M A;  1OE8 A;  2VAF A;  5EPF A;  2G0F A;  2PER A;  3L78 A;  5J9C A;  1ZYE A;  2C0G A;  1SJZ A;  4IEL A;  3GL5 A;  2HE3 A;  1VF3 A;  5D93 A;  2I3Y A;  2RLI A;  1T4Y A;  2FWH A;  1GSQ A;  4FH8 A;  1WOU A;  1XXU A;  1JZR A;  3CMI A;  5ECH B;  3GX0 A;  1QMV A;  1XW5 A;  3M9K A;  3ME8 A;  2GSR A;  4IGJ A;  2LRT A;  1SYR A;  1RK4 A;  3TGZ A;  4BA7 A;  4FYB A;  2PMT A;  1JZD A;  3I6A A;  5AIX A;  1Z5Y E;  3GKM A;  2RUF A;  1GLP A;  4IP6 A;  2VO4 A;  3D6I A;  5H5S A;  4ECC A;  1ERW A;  16GS A;  4K7O A;  1S3A A;  3EMX A;  4BPY A;  2BJX A;  2P5Q A;  3F3Q A;  5DAK A;  1OYJ A;  5KN0 A;  4TR3 A;  4MPG A;  5ECQ B;  4Q5N A;  1TU8 A;  5IPH A;  2VIM A;  2OE0 A;  3GIX A;  1QUW A;  3CSH A;  5A4W A;  1JZO A;  4JRR A;  5ECP B;  2HXK A;  2DIY A;  1K0O A;  2JU5 A;  1X5D A;  3RPP A;  5FWG A;  2H1B A;  5D8I A;  1F3A A;  4D73 B;  1QFN A;  4WR4 A;  2K8V A;  5ECR B;  2YJ7 A;  5IMA A;  1URM A;  4OD7 A;  1PN9 A;  5ECO B;  3HZ4 A;  4IP1 A;  2AYT A;  4ECI A;  4X0X A;  2RUE A;  2QKE A;  1J9B A;  4J56 E;  3QFA C;  2KP1 A;  2KHP A;  2L5O A;  4WBR D;  2WB9 A;  5GAN D;  2E7P A;  3CSI A;  2C80 A;  1B48 A;  1LJR A;  4L0U A;  4KH7 A;  3CBU A;  1GSF A;  3KMO A;  2FNO A;  2J9H A;  1GSS A;  4DSR A;  4K1F A;  3O76 A;  2FLS A;  2VL2 A;  1XVQ A;  2O85 A;  4N11 A;  2H1A A;  3HY2 A;  2EC4 A;  3BCI A;  1EEJ A;  5CRE A;  4KND A;  5IM9 A;  4AJ8 A;  3UOM A;  4OO5 A;  1K0D A;  4ZL7 A;  1ZYQ B;  1PMT A;  2K18 A;  2VCV A;  5KN3 A;  3ZVJ A;  2N5B A;  3ZVJ D;  3GA4 A;  1GNW A;  1PL2 A;  2H1D A;  3VPQ A;  2REM A;  4MH2 A;  2DJJ A;  1TI1 A;  4ZL9 A;  1XW6 A;  2YZU A;  1TRS A;  2YWI A;  3U5R E;  2K9F A;  4MH3 A;  4DSS A;  4PX1 A;  1SYX A;  1MDK A;  2VCQ A;  1PKZ A;  2P31 A;  2FWF A;  1OKD A;  2OA7 A;  3WYW A;  4HJ2 A;  2RM5 A;  2VL2 C;  6GSY A;  3M3M A;  4ID0 A;  6GSW A;  3TDG A;  4O32 A;  5IMV A;  4GQC A;  3ZLP A;  4BL7 A;  6GSV A;  2YJH A;  1DUG A;  4IN0 A;  3F6D A;  4MPF A;  1G7O A;  1GSY A;  2C3N A;  2LV3 A;  1TTZ A;  2PU9 C;  3GX8 A;  3DGQ A;  5IPG A;  4AGS A;  2B5X A;  5G1K A;  4WBJ A;  2L6D A;  5H5Q A;  4TR1 A;  4ZL8 A;  1GUH A;  3QPM A;  3QCP A;  1M2D A;  1ST9 A;  3UJ1 A;  4LMW A;  1VF1 A;  4ILF A;  2GGT A;  5DAK B;  4MJE A;  2GST A;  3R2Q A;  3GHA A;  4TXV A;  3KJY A;  2C0D A;  3A2V A;  1TRW A;  2H1G A;  4XS4 B;  3LXT A;  1BG5 A;  4ULX A;  3GNJ A;  3D21 A;  2ES7 A;  2R3X A;  2GZZ A;  4GSS A;  5D9T A;  1R26 A;  3QD9 A;  1LU4 A;  4DSQ A;  4IW9 A;  3HXS A;  4MJB A;  4MMM A;  2VL9 A;  3VI7 A;  3Q74 A;  2B6M A;  3KGK A;  2NDO A;  2DJK A;  4NWY A;  3G7J A;  4NHW A;  5AIV A;  4MA9 A;  5AIS A;  3TJF A;  2FA4 A;  4EVM A;  3G9B A;  1M2A A;  3DVW A;  4HOJ A;  5J9B A;  2FCH A;  2KP2 A;  4EDY A;  1OVN A;  3BBY A;  2JSY A;  1R5A A;  2M46 A;  3FKF A;  1ZL9 A;  3FW2 A;  3W8J A;  2VM1 A;  5EL8 A;  3TCO A;  1A2M A;  4WET A;  2HZE B;  4E8H A;  2LQO A;  2HYX A;  3P90 A;  5IO0 A;  1FO5 A;  2CZ2 A;  4IJ3 A;  3DIE A;  1H4O A;  4KW6 A;  2K6V A;  3KH7 A;  3RAZ A;  4IHU A;  2OAC A;  3VFI A;  1DE2 A;  2R6K A;  1Q98 A;  1NM3 A;  1F9M A;  4KUN A;  3IE3 A;  1V2A A;  2WGR A;  3IA1 A;  3IXR A;  1YKC A;  3LSZ A;  2WJU A;  1FB6 A;  2YV7 A;  4BWS A;  3TRX A;  1VRS D;  3GSS A;  1DSB A;  4MP4 A;  3ME7 A;  4OO4 A;  4WF4 A;  2V6K A;  3GRX A;  4EUY A;  1SL2 B;  2H19 A;  1T8E B;  5D9W A;  1SK2 A;  2ON7 A;  4WR5 A;  4ECB A;  4LA1 A;  3BD2 A;  2B7J A;  2F9S A;  2LJR A;  3IV4 A;  5CNW A;  4NPB A;  3CYN A;  2IN3 A;  4ZBD A;  4K2D A;  3CRU A;  3E9J B;  2R37 A;  4PGT A;  3KP9 A;  1ACV A;  1K0N A;  1USB A;  1BED A;  4JED A;  5IMD A;  3IPZ A;  1XWC A;  2B7K A;  2FWE A;  1O7U A;  2C8U A;  1PKW A;  1NHO A;  5G5F A;  3FZ4 A;  1AQV A;  2CAQ A;  1YF1 A;  3F9U A;  3V1W A;  1TJD A;  1FVK A;  2H01 A;  3M8N A;  1HQO A;  1NSW A;  5KN2 A;  4D73 A;  3QAV A;  3D0Z A;  3GV1 A;  3TKP A;  1G0T A;  3U6V A;  4ZB8 A;  5JWR B;  3UBL A;  1PX7 A;  1IYH A;  2IMK A;  4BVX A;  2DSA A;  2FUG 2;  5CRG A;  2A2R A;  2F8A A;  3QAW A;  1TRV A;  1SKW B;  1AQX A;  4RI7 A;  3EYT A;  5DJL A;  3UAP A;  1EGO A;  2GVP A;  2IWT A;  4LL4 B;  2LKU A;  4HUA A;  2ON5 A;  1ILO A;  3EU3 A;  1OC8 A;  2GQK A;  5JWQ B;  1O6J A;  4YAP A;  2PBJ A;  4GXZ A;  3O3T A;  1J08 A;  3PH9 A;  3IRA A;  5IMF A;  3FY7 A;  3SWL A;  4YQV A;  1HD2 A;  2CT6 A;  4E8E A;  3GTU B;  2PVO C;  1GP1 A;  1J0F A;  4O7H A;  4DEJ A;  4K9Z A;  2R2J A;  1GSU A;  1Z3E A;  4L8E A;  3LQ7 A;  2V2G A;  2O7K A;  5AN1 A;  2C1Y A;  2GTU A;  5DQS A;  1EP7 A;  4HQZ A;  1K0M A;  2TRC P;  2AB6 A;  3Q19 A;  4ML6 A;  2YWN A;  2IFQ B;  2LEG A;  1B9Y C;  1K0B A;  1TK8 B;  3VPT A;  5F06 A;  1B4P A;  5G30 A;  4WF5 A;  1IYI A;  1ERV A;  4RI6 A;  5DCG A;  1XFL A;  2X99 A;  4Q5Q A;  4JU5 A;  2NVL A;  4AF2 A;  2NBS A;  4HEA 2;  4CHS A;  1TW9 A;  2H73 A;  1FG4 A;  5B8B A;  1SU9 A;  4GLT A;  4F2I A;  3KH9 A;  5DDL A;  1O8X A;  2KLX A;  3FK8 A;  1ABA A;  2ZCT A;  1GSD A;  3P2A A;  2WS2 A;  3VK9 A;  3E0U A;  2GSS A;  2TIR A;  1SD8 A;  3ED3 A;  4V1A g;  3TJB A;  4X1U A;  1EV9 A;  4AJ6 A;  1H75 A;  2V41 A;  2FY6 A;  1SD9 A;  4MZC A;  2H0I A;  3H79 A;  2M80 A;  1ERU A;  2M72 A;  3HVV A;  5ENU A;  4NAX A;  2HI7 A;  4TXO B;  3KZQ A;  4J57 E;  1CQH A;  3P7X A;  3IHQ A;  3FZA A;  3F4T A;  4YAV A;  4XS4 A;  3ZYW A;  4OFM A;  3ZML A;  4EL1 A;  4YQU A;  2GZY A;  2H66 A;  2NTO A;  3M9J A;  2XPE A;  3TKS A;  5GST A;  3M1G A;  4ISD A;  3P8W A;  4EXJ A;  2F3M A;  2C4J A;  4KA0 A;  4Z7X A;  3ZTL A;  2DMM A;  5CRH A;  5G2Z A;  3APQ A;  3HJO A;  4KGI A;  5ID2 B;  1X9W B;  3NOF A;  2I9H A;  3ZMK A;  3DWV A;  1GH2 A;  6GSS A;  4F0C A;  3GKX A;  1M0U A;  4KDY A;  4N0Z A;  18GS A;  1PA3 A;  5E59 A;  1R4W A;  1B9X C;  3A5W A;  1U3A A;  4I2U A;  2B5E A;  4OCE A;  2HZE A;  1TOF A;  17GS A;  1I9D A;  2V32 A;  2I81 A;  3H4K A;  3DXB A;  3FR3 A;  5F05 A;  4N0V A;  4XRA A;  3J7Y b;  4GQF A;  2CA8 A;  1EGR A;  3HYP A;  2VLU A;  1G7E A;  1A2J A;  3TKS C;  4JE1 A;  1M7T A;  3VUR A;  1O8W A;  4K0G A;  1X9M B;  1X9S B;  5HFG A;  2GSQ A;  3ERG A;  1XWK A;  1N2A A;  3EC3 A;  3G7Y A;  1AUC A;  3FZ9 A;  5AGY A;  1XWG A;  4FYU A;  1YF0 A;  5D73 A;  1MDJ A;  3MNG A;  2DLX A;  4G10 A;  3EU4 A;  1K3L A;  1M2B A;  3JCM L;  2B1L A;  1ZCP A;  4HQS A;  1GUM A;  4K7N A;  1YJ6 A;  2GS3 A;  5DJM A;  3C1S A;  4HU9 A;  2O8V B;  3KP8 A;  1R7H A;  2N5F A;  4EE0 A;  3ZRE A;  2MMO A;  4X43 A;  2X8H A;  2L6C A;  1PRX A;  3L4N A;  5ECM B;  1HNA A;  2VCT A;  1M99 A;  3D5J A;  5IMC A;  1YDK A;  1V58 A;  4Q5F A;  2Z9S A;  2ZUP A;  4MZB A;  3O6T A;  3HA9 A;  3IOS A;  3CTF A;  1VF2 A;  2OE3 A;  1SK0 A;  2JAC A;  3UEM A;  1EP8 A;  2V1M A;  2HRF A;  3ZL5 A;  3J7Y k;  1AW9 A;  1K0C A;  1B4Q A;  3BOA A;  1RQM A;  3FRC A;  3IBH A;  2K8S A;  1GRX A;  4HU7 A;  1GUK A;  2FD3 A;  3FEU A;  4V2N A;  2EIQ A;  1U88 A;  4QL7 A;  1O85 A;  2I4A A;  8GSS A;  1KNG A;  4I2T A;  4O92 A;  1K3Y A;  3CRT A;  2H71 A;  1GTB A;  1EEM A;  2HRN A;  3GKN A;  3IK9 A;  4L5O A;  3RPN A;  1AAZ A;  3F63 A;  2GQM A;  3GTU A;  2OKA A;  1A2L A;  4TR4 A;  1E2Y A;  1BJX A;  3QFB C;  1V40 A;  1TU7 A;  1OKT A;  2LUS A;  2LTK A;  1QK8 A;  1PQN A;  5L71 A;  3APS A;  1HNB A;  4F82 A;  4GF0 A;  4NMU A;  1CQG A;  3GST A;  5KEJ A;  1XWA A;  1F2E A;  3CSJ A;  3D22 A;  4CW9 A;  1PSQ A;  1X0R A;  4K8M A;  3BCK A;  2HFD A;  5G1L A;  2MBS A;  2QC7 A;  1Z6N A;  9GSS A;  2LNS A;  5JWO B;  2IFQ A;  1G6Y A;  4ML1 A;  3L9U A;  5F8B A;  1EV4 A;  2WRT A;  2VCX A;  1JFU A;  4POM A;  1SJI A;  3H8Q A;  3QR6 A;  4XHM A;  1SEN A;  1WJK A;  2QGV A;  1WRY A;  4P3Y B;  1KTE A;  2GDR A;  4WKW A;  1U6T A;  4OFN A;  2E0Q A;  5EVO A;  6GSU A;  5DBQ A;  5J5N A;  2LJK A;  2I1U A;  5CRD A;  4KDX A;  4FIW A;  4PQ1 A;  3KTL A;  3HJM A;  5DAL B;  2XBI A;  3MWH A;  1A0F A;  2HSY A;  2H74 A;  20GS A;  3PR8 A;  1M9B A;  2LRC A;  3GL3 A;  5HR3 A;  1GLQ A;  1UN2 A;  3IAS 2;  3RDW A;  5H5R A;  5JCW A;  4NXI A;  3OR5 A;  3UMA A;  2LST A;  1ON4 A;  3ZFL A;  4NHZ A;  5B6N A;  4KCE A;  2F51 A;  4GTU A;  4YQM A;  2L5L A;  3IK7 A;  2YWO A;  5DCH A;  2H8L A;  1KEB A;  1FVJ A;  1V57 A;  2PWJ A;  5ECS A;  2KUC A;  2R5G A;  4G9H A;  1PX6 A;  4TXO A;  2WCI A;  5INY A;  1Y6E A;  5FT3 A;  3ZIV A;  2ALB A;  2V6O A;  4XRD A;  2BMX A;  3Q6O A;  4MAB A;  4WEY A;  5LNK e;  3W6G A;  2VOC A;  3MSZ A;  5LCZ A;  1SL1 B;  3TJK A;  2GLR A;  3ERW A;  2YZH A;  1ZMA A;  2XBQ A;  4WXT A;  3K8N A;  2XHF A;  4MF7 A;  2JZS A;  5ID2 A;  2IMI A;  3KIJ A;  2VD0 A;  5IO2 A;  1AIU A;  2VD1 A;  1WIK A;  4TKY A;  4XS1 A;  2YOI A;  4V1A p;  3UVH A;  1A8Y A;  4OMV A;  2IMD A;  2IME A;  3LEF A;  5ELG A;  4O5R A;  1W4V A;  3C73 A;  4HDE A;  2FWG A;  3WD6 A;  5KN1 A;  3KD0 A;  2HT9 A;  5E4W A;  2E2M A;  1T3B A;  3GMF A;  3CXG A;  1NHY A;  3GFK A;  2OBI A;  2H0G A;  3LYP A;  3HD5 A;  4FYC A;  3VLN A;  2OE1 A;  3TKR A;  2VUP A;  2X8C A;  4RQX A;  5HFI A;  4IBP A;  1XCC A;  4FO5 A;  2LJA A;  3HJP A;  4ZIJ A;  3TKS E;  3VI5 A;  1ML6 A;  2ZNM A;  2YN1 A;  4IJI A;  2HNL A;  2PGT A;  3LFL A;  4HZ4 A;  2YAN A;  2DJ0 A;  1GUL A;  1SJ6 A;  1X5C A;  4V2M A;  1OC3 A;  1JHB A;  5GAP D;  3GKK A;  1A0R P;  1JLW A;  2B3S A;  2H70 A;  2WFC A;  2DBC A;  3TKQ A;  4EDZ A;  1GWC A;  3WGE A;  4IS0 A;  1QQ2 A;  4EC0 A;  19GS A;  1KBN A;  2XPD A;  2H30 A;  4EO3 A;  1QXH A;  2OBK A;  2H6Y A;  2A4V A;  1U3I A;  4I6X A;  1XIY A;  2H75 A;  3ZRD A;  4K6X A;  1AQW A;  1TI3 A;  4IQ1 A;  4HS1 A;  3I9V 2;  6GST A;  4TRX A;  3TOU A;  3ERF A;  1BX9 A;  2AUV A;  1HNC A;  4K7I A;  1PL1 A;  2H72 A;  2C3Q A;  2L4C A;  5HR2 A;  2L4Q A;  4PNG A;  3DRN A;  2XC2 A;  4JR6 A;  1K0A A;  4I8B A;  3WT1 A;  2WZ9 A;  2CX3 A;  4F0B A;  3KM6 A;  3LYK A;  4OWY A;  3C71 A;  2CAI A;  13GS A; 
#chains in the Genus database with same CATH topology
 2EIR A;  3FR9 A;  2H76 A;  1WE0 A;  4V2L A;  1UC7 A;  2C0F A;  4POK A;  5A4U A;  4DVC A;  2NPB A;  4L5L A;  2HSH A;  4EIP A;  1QGV A;  5CP1 A;  1YQ1 A;  3EIN A;  1HYU A;  4K0N A;  3NIV A;  2C3T A;  1WWJ A;  3GYK A;  1XZO A;  2YNX A;  5CYY A;  1XPV A;  3HVN A;  1Z9H A;  3TJJ A;  4TW5 A;  2A4H A;  3EUR A;  5D96 A;  1OC9 B;  3TJG A;  1E6B A;  4QL9 A;  3E3E A;  2TRX A;  2PPT A;  3IR4 A;  1FOH A;  2A2S A;  2VLT A;  1Q4J A;  4JR4 A;  4ZB6 A;  3GN3 A;  2JAD A;  2OAD A;  4TOP A;  3N5O A;  4BWQ A;  1MTC A;  3UL3 A;  3W8S A;  2H6X A;  2CV4 A;  2RM6 A;  4GST A;  5GSS A;  2JZR A;  4F03 A;  2IL3 A;  1VGL A;  2AHE A;  4GCI A;  5HFK A;  4PQI A;  3HKR A;  2MYG A;  1TRU A;  3DD3 A;  3I43 A;  2E2G A;  1XVW A;  4I5Q A;  4BVY B;  3A3T A;  2JSZ A;  5IMZ A;  3GH6 A;  3PGT A;  3VWU A;  2BTO T;  2IIY A;  4LL1 B;  1EOG A;  2DKI A;  3QOU A;  3TRQ A;  1GSE A;  5HQP A;  2F8F A;  3ISO A;  1PGT A;  1C72 A;  1THO A;  1GL8 A;  5DAL A;  2VL3 A;  3DML A;  4POB A;  2YCD A;  2CVB A;  1XW9 A;  3AY8 A;  3C1R A;  4MZW A;  2QA1 A;  5ECK B;  4Q5R A;  2B5Y A;  5COH A;  3D4M A;  2VCZ A;  1FAA A;  4ZIL A;  5IQY A;  3L9V A;  1YEP A;  1S3R A;  3US3 A;  2CZ3 A;  3TB2 A;  2L57 A;  5CRW A;  5J4U A;  1GTI A;  3F6F A;  5IOX A;  2LQQ A;  1O73 A;  4JBB A;  2MMN A;  2HSM A;  4MK3 A;  4MJC A;  2VCW A;  4GSN A;  2B1K A;  1U87 A;  3VWX A;  3TRP A;  2YWM A;  1LBK A;  4PXO A;  4KB3 A;  1UVZ A;  2MBT A;  4N30 A;  2P5R A;  4KDU A;  1TK5 B;  1O81 A;  1FHE A;  5G5E A;  1EWX A;  6GSX A;  1WP0 A;  4MCU A;  4XCS A;  4ACS A;  1SKS B;  3I69 A;  3L9S A;  4G2E A;  4IVF A;  4KCA A;  3HHV A;  3WGX A;  2AAW A;  4OCF A;  2PVQ A;  5D9V A;  3F0I A;  2JL4 A;  1WMJ A;  4KF9 A;  5A5K A;  4GRF A;  3NZN A;  1NW2 A;  3QAG A;  3GUR A;  4PUA A;  3RHB A;  5LD0 A;  4AJ7 A;  1SKR B;  4ZBA A;  2GT6 A;  5DQY A;  4I97 A;  3IDV A;  3H93 A;  3N9J A;  5GZZ B;  5IIZ A;  5ECN B;  3H1N A;  4H86 A;  4G19 A;  4X4J A;  1A8L A;  3L0H A;  4MDC A;  1OE7 A;  1ZOF A;  2AV4 A;  4JZQ A;  4L0W A;  12GS A;  1FW1 A;  5J41 A;  2CX4 A;  3HDC A;  5B6M A;  3LOR A;  1Z7R A;  1X5E A;  1THX A;  5D9X A;  1XOB A;  3KTB A;  2N5A A;  5F0G A;  1SK1 A;  4QQ7 A;  3PPU A;  1MD4 A;  2AJQ B;  2RII A;  5C04 A;  3KXO A;  1A23 A;  1OAZ A;  2PUK C;  1V98 A;  3DEX A;  5ECI B;  2VM2 A;  4KAE A;  2IPA A;  2YV9 A;  4MF5 A;  3D4T A;  5IOW A;  3RBT A;  2DML A;  2R4V A;  1TK0 B;  1DBY A;  4POL A;  3F8U A;  2DIZ A;  4KSO A;  2IJY A;  3HVS A;  2HZF A;  2L59 A;  1BYE A;  1ZGN A;  2GQL A;  11GS A;  2GZP A;  3VWW A;  2X8G A;  1TXX A;  3EE2 A;  3VWV A;  2J23 A;  1T4Z A;  2DJ1 A;  5JCG A;  1V9W A;  3BJ5 A;  3UAR A;  4EKZ A;  5A4V A;  1T1V A;  3LG6 A;  4MF6 A;  2C0E A;  3APO A;  1XOA A;  2D2Z A;  1ZZY A;  5ABR A;  5CO3 A;  3A2W A;  4PUR A;  1TP9 A;  1XBS A;  1F3B A;  1A24 A;  1MEK A;  5HR1 A;  4HI7 A;  3EVI A;  3HVX A;  1FB0 A;  1F6M C;  1N8J A;  3WGD A;  2DC5 A;  1W89 A;  1PN0 A;  4XIH A;  3ZFB A;  1AC1 A;  2MMZ A;  1EOH A;  1Y25 A;  3LWA A;  4PTS A;  4PUF C;  3DKS A;  1FOV A;  5EY6 A;  3UIW A;  4HZ2 A;  3DYR A;  5DVB A;  3ZIJ A;  4MJA A;  1UA5 A;  3GH9 A;  3Q18 A;  1WPI A;  1YEX A;  1M9A A;  2MZC A;  1Z7P A;  4J2F A;  2IMF A;  4NV5 A;  2FGX A;  4ZXG A;  1DE1 A;  3ZIT A;  3ZZX A;  2DJ2 A;  4TVE A;  2WDU A;  1F37 A;  5F07 A;  2FHE A;  4NV2 A;  4XTS A;  4ECJ A;  2MMA A;  2H6Z A;  1I5G A;  1B8X A;  1AXD A;  3QMX A;  4ZB9 A;  1GTU A;  1OC9 A;  2O89 A;  3TUE A;  3LXZ A;  4EF0 A;  3C8E A;  1S3C A;  4KSM A;  3FYG A;  4IKH A;  3WT2 A;  3EWL A;  2VLV A;  3LJR A;  1T7P B;  4TR0 A;  3EMP A;  2G2Q A;  2LS5 A;  1BAY A;  4DSS B;  3FHK A;  2CVK A;  3KEB A;  1R5P A;  7GSS A;  2HLS A;  3CTG A;  1G6W A;  2YPM A;  4BVY A;  2KOK A;  1MD3 A;  4CDO A;  3S9F A;  4BL7 B;  3KCM A;  14GS A;  3F4S A;  3MDK A;  5FHI A;  1VF4 A;  5ELA A;  4TN8 A;  1GNE A;  3DVX A;  1YZX A;  4RQR A;  1PD2 1;  3HCZ A;  3UBK A;  2CVD A;  1JZW A;  2OJL A;  3IC4 A;  4IQA A;  4LMV A;  4TR1 B;  3F3R A;  4KX4 A;  3MAK A;  2CQ9 A;  4GWR A;  2DJ3 A;  2GT5 A;  5G31 A;  2YP6 A;  1GTA A;  3HZ8 A;  3IAM 2;  2LNT A;  4MLY A;  22GS A;  2FA8 A;  3IC8 A;  4KE3 A;  4OFT A;  5C00 A;  1SL0 B;  5BMU A;  4YH2 A;  4PQH A;  1BQ7 A;  3M0F A;  1MDI A;  2O87 A;  1TDI A;  1TKD B;  1YKA A;  5ECL B;  1K3O A;  1JLV A;  1ERT A;  1S3D A;  3FZ5 A;  3UVT A;  4ZBB A;  3SBC A;  1XWB A;  2JZT A;  1T00 A;  3LGC A;  2LRN A;  5J3R A;  5HR0 A;  4XS6 A;  3EPT A;  5B8A A;  4HJM A;  2EIO A;  3GUS A;  2WUL A;  3KMN A;  3PIN A;  4N10 A;  2X64 A;  2H0H A;  2P0G A;  3QDN A;  5B7C A;  4F9Z A;  3G7I A;  4LLR A;  4PNF A;  4RUV A;  1RW1 A;  2QSI A;  4G0I A;  2PN8 A;  3TOT A;  4A5P A;  3A2X A;  3C7M A;  3F4R A;  3RHC A;  5JCU A;  1YY7 A;  3FR6 A;  10GS A;  5CAX A;  1EZK A;  1Z6M A;  1OE8 A;  2VAF A;  2G0F A;  5EPF A;  2PER A;  3L78 A;  5J9C A;  1ZYE A;  2C0G A;  1SJZ A;  4IEL A;  3GL5 A;  2HE3 A;  1VF3 A;  5D93 A;  2I3Y A;  2RLI A;  1T4Y A;  2FWH A;  2QA2 A;  1GSQ A;  4FH8 A;  1WOU A;  1XXU A;  3R3E A;  1JZR A;  3CMI A;  5ECH B;  3GX0 A;  1QMV A;  4USS A;  1XW5 A;  3M9K A;  3ME8 A;  2GSR A;  4IGJ A;  2LRT A;  1SYR A;  1RK4 A;  3TGZ A;  4BA7 A;  4FYB A;  2PMT A;  1JZD A;  3I6A A;  5AIX A;  1Z5Y E;  3GKM A;  2RUF A;  1GLP A;  4IP6 A;  2VO4 A;  3D6I A;  5H5S A;  4ECC A;  1ERW A;  16GS A;  4K7O A;  1S3A A;  3EMX A;  4BPY A;  2BJX A;  2P5Q A;  3F3Q A;  5DAK A;  1OYJ A;  5KN0 A;  4TR3 A;  4MPG A;  5ECQ B;  4Q5N A;  1TU8 A;  5IPH A;  2VIM A;  2OE0 A;  3GIX A;  1QUW A;  3CSH A;  5A4W A;  1JZO A;  4JRR A;  4Z2R A;  5ECP B;  2HXK A;  2DIY A;  1K0O A;  2JU5 A;  1X5D A;  3RPP A;  5FWG A;  2H1B A;  5D8I A;  1F3A A;  4D73 B;  1QFN A;  4WR4 A;  2K8V A;  2YJ7 A;  5ECR B;  5IMA A;  1URM A;  4OD7 A;  1PN9 A;  5ECO B;  3HZ4 A;  4BVX B;  4IP1 A;  2AYT A;  1PFO A;  4ECI A;  4X0X A;  2RUE A;  2QKE A;  1J9B A;  4J56 E;  3QFA C;  2KP1 A;  2KHP A;  2L5O A;  4WBR D;  2WB9 A;  5GAN D;  2E7P A;  3CSI A;  2C80 A;  1B48 A;  1LJR A;  4L0U A;  4KH7 A;  2A2P A;  3CBU A;  1GSF A;  3KMO A;  2FNO A;  2J9H A;  1GSS A;  2HRK A;  4DSR A;  4K1F A;  3O76 A;  2FLS A;  2VL2 A;  1XVQ A;  2O85 A;  4N11 A;  2H1A A;  3HY2 A;  2EC4 A;  3BCI A;  1EEJ A;  5CRE A;  4KND A;  5IM9 A;  4AJ8 A;  3UOM A;  4OO5 A;  1K0D A;  4ZL7 A;  1ZYQ B;  1PMT A;  2K18 A;  2VCV A;  5KN3 A;  3ZVJ A;  2N5B A;  3ZVJ D;  3GA4 A;  1GNW A;  1PL2 A;  2H1D A;  3VPQ A;  2REM A;  4MH2 A;  2DJJ A;  1TI1 A;  4ZL9 A;  1XW6 A;  2YZU A;  1TRS A;  2YWI A;  3U5R E;  2K9F A;  4MH3 A;  4DSS A;  4PX1 A;  1SYX A;  1MDK A;  2VCQ A;  1PKZ A;  2P31 A;  2FWF A;  1OKD A;  2OA7 A;  3WYW A;  4HJ2 A;  2RM5 A;  2VL2 C;  6GSY A;  3M3M A;  4ID0 A;  6GSW A;  3TDG A;  4O32 A;  5IMV A;  5KOX A;  4GQC A;  3ZLP A;  4BL7 A;  6GSV A;  2YJH A;  1DUG A;  4IN0 A;  3F6D A;  4MPF A;  1G7O A;  1GSY A;  2C3N A;  2LV3 A;  1TTZ A;  2PU9 C;  3GX8 A;  3DGQ A;  5IPG A;  4AGS A;  2B5X A;  5G1K A;  4WBJ A;  2L6D A;  5H5Q A;  4TR1 A;  4ZL8 A;  1GUH A;  3QPM A;  3QCP A;  1M2D A;  1ST9 A;  3UJ1 A;  4LMW A;  1VF1 A;  4ILF A;  2GGT A;  5DAK B;  4MJE A;  2GST A;  3R2Q A;  3GHA A;  4TXV A;  3KJY A;  2C0D A;  3A2V A;  1TRW A;  4XS4 B;  2H1G A;  4K2X A;  3LXT A;  1BG5 A;  4ULX A;  3GNJ A;  3D21 A;  2ES7 A;  2R3X A;  2GZZ A;  4GSS A;  5D9T A;  1R26 A;  3QD9 A;  1LU4 A;  4DSQ A;  4IW9 A;  3HXS A;  4MJB A;  4MMM A;  2VL9 A;  3VI7 A;  3Q74 A;  2B6M A;  3KGK A;  2NDO A;  2DJK A;  4NWY A;  3G7J A;  4NHW A;  5AIV A;  4MA9 A;  4YKG A;  5AIS A;  3TJF A;  2FA4 A;  4EVM A;  3G9B A;  1M2A A;  3DVW A;  4HOJ A;  5J9B A;  2FCH A;  2KP2 A;  4EDY A;  1OVN A;  3BBY A;  2JSY A;  1R5A A;  2M46 A;  3FKF A;  1ZL9 A;  3FW2 A;  3W8J A;  2VM1 A;  5EL8 A;  3TCO A;  1A2M A;  4WET A;  2HZE B;  4E8H A;  2LQO A;  2HYX A;  3P90 A;  5IO0 A;  1FO5 A;  2CZ2 A;  4IJ3 A;  3DIE A;  1H4O A;  4KW6 A;  2K6V A;  3KH7 A;  3RAZ A;  4IHU A;  2OAC A;  3VFI A;  1DE2 A;  2R6K A;  1Q98 A;  1NM3 A;  1F9M A;  4KUN A;  5BRT A;  3IE3 A;  1V2A A;  2WGR A;  3IA1 A;  3IXR A;  1YKC A;  3LSZ A;  2WJU A;  1FB6 A;  2YV7 A;  4BWS A;  3TRX A;  1VRS D;  3GSS A;  1DSB A;  4MP4 A;  2HRA A;  3ME7 A;  4OO4 A;  4WF4 A;  2V6K A;  3GRX A;  4EUY A;  1SL2 B;  2H19 A;  1T8E B;  5D9W A;  1SK2 A;  2ON7 A;  4WR5 A;  4ECB A;  4LA1 A;  3BD2 A;  2B7J A;  2F9S A;  2LJR A;  3IV4 A;  5CNW A;  4NPB A;  3CYN A;  2IN3 A;  4ZBD A;  4K2D A;  3CRU A;  3E9J B;  2R37 A;  4PGT A;  3KP9 A;  1ACV A;  1K0N A;  1USB A;  1BED A;  4JED A;  5IMD A;  3IPZ A;  1XWC A;  2B7K A;  2FWE A;  1O7U A;  3CQF A;  2C8U A;  1PKW A;  1NHO A;  5G5F A;  3FZ4 A;  1AQV A;  2CAQ A;  1YF1 A;  3F9U A;  4K5S A;  3V1W A;  1TJD A;  1FVK A;  2H01 A;  3M8N A;  1HQO A;  1NSW A;  5KN2 A;  4D73 A;  3QAV A;  3D0Z A;  3GV1 A;  3TKP A;  1G0T A;  3U6V A;  4ZB8 A;  5JWR B;  3UBL A;  1PX7 A;  1IYH A;  2IMK A;  4BVX A;  2DSA A;  2FUG 2;  5CRG A;  1ZYN A;  2A2R A;  2F8A A;  3QAW A;  1TRV A;  1SKW B;  1AQX A;  4RI7 A;  3EYT A;  5DJL A;  3UAP A;  1EGO A;  2GVP A;  2IWT A;  4LL4 B;  3MYD A;  2LKU A;  4HUA A;  2ON5 A;  1ILO A;  3EU3 A;  1OC8 A;  2GQK A;  5JWQ B;  1O6J A;  4YAP A;  2PBJ A;  4GXZ A;  3O3T A;  1J08 A;  3PH9 A;  2R0C A;  3IRA A;  5IMF A;  3FY7 A;  3SWL A;  4YQV A;  1HD2 A;  2CT6 A;  4E8E A;  3GTU B;  2PVO C;  1GP1 A;  1J0F A;  4O7H A;  4DEJ A;  4K9Z A;  2R2J A;  1GSU A;  1Z3E A;  4L8E A;  3LQ7 A;  2V2G A;  2O7K A;  2X49 A;  5AN1 A;  2C1Y A;  2GTU A;  5DQS A;  1EP7 A;  4HQZ A;  1K0M A;  2TRC P;  2AB6 A;  3Q19 A;  4ML6 A;  2YWN A;  2IFQ B;  2LEG A;  1B9Y C;  1K0B A;  1TK8 B;  3VPT A;  5F06 A;  1B4P A;  5G30 A;  4WF5 A;  1IYI A;  1ERV A;  4RI6 A;  4CY6 A;  5DCG A;  1XFL A;  2X99 A;  4Q5Q A;  4JU5 A;  2NVL A;  4AF2 A;  2NBS A;  4HEA 2;  4CHS A;  1TW9 A;  2H73 A;  1FG4 A;  5B8B A;  1SU9 A;  4GLT A;  4F2I A;  3KH9 A;  5DDL A;  1O8X A;  1M3I A;  2KLX A;  3FK8 A;  1ABA A;  2ZCT A;  1GSD A;  3P2A A;  2WS2 A;  3VK9 A;  3E0U A;  2GSS A;  2TIR A;  1SD8 A;  3ED3 A;  4V1A g;  3TJB A;  4X1U A;  1EV9 A;  4AJ6 A;  1H75 A;  2V41 A;  2FY6 A;  1SD9 A;  4MZC A;  2H0I A;  3H79 A;  2M80 A;  1ERU A;  2M72 A;  3HVV A;  5ENU A;  4NAX A;  2HI7 A;  4TXO B;  3KZQ A;  4J57 E;  1CQH A;  3P7X A;  3IHQ A;  3FZA A;  4ICY A;  3F4T A;  4O5U A;  4YAV A;  4XS4 A;  3ZYW A;  4OFM A;  3ZML A;  4EL1 A;  4YQU A;  2GZY A;  2H66 A;  5KOW A;  2NTO A;  4CY8 A;  3M9J A;  2XPE A;  3TKS A;  5GST A;  3M1G A;  4ISD A;  3P8W A;  4EXJ A;  2F3M A;  2C4J A;  4KA0 A;  4Z7X A;  3ZTL A;  2DMM A;  5CRH A;  5G2Z A;  4K5R A;  3APQ A;  3HJO A;  4KGI A;  5ID2 B;  1X9W B;  3IHG A;  3NOF A;  2I9H A;  4G0L A;  3ZMK A;  3DWV A;  1GH2 A;  6GSS A;  4F0C A;  3GKX A;  1M0U A;  4KDY A;  4N0Z A;  18GS A;  1PA3 A;  5E59 A;  1R4W A;  1B9X C;  3A5W A;  1U3A A;  4G0K A;  4I2U A;  2B5E A;  4OCE A;  2HZE A;  1TOF A;  17GS A;  1I9D A;  4EIQ A;  2V32 A;  4YKF A;  2I81 A;  3H4K A;  3DXB A;  3FR3 A;  5F05 A;  4N0V A;  4XRA A;  3J7Y b;  4GQF A;  2CA8 A;  1EGR A;  3HYP A;  2VLU A;  1G7E A;  2X4A A;  1A2J A;  3TKS C;  4JE1 A;  1M7T A;  3VUR A;  1O8W A;  4K0G A;  1X9M B;  1X9S B;  5HFG A;  2GSQ A;  3ERG A;  1XWK A;  1N2A A;  3EC3 A;  3G7Y A;  1AUC A;  3FZ9 A;  5AGY A;  1XG8 A;  1XWG A;  4FYU A;  1YF0 A;  5D73 A;  1MDJ A;  3MNG A;  2DLX A;  4G10 A;  3EU4 A;  1K3L A;  1M2B A;  3JCM L;  2B1L A;  1ZCP A;  3FMW A;  4HQS A;  1GUM A;  4K7N A;  1YJ6 A;  2GS3 A;  5DJM A;  3C1S A;  4HU9 A;  2O8V B;  3KP8 A;  1R7H A;  2N5F A;  4EE0 A;  3ZRE A;  2MMO A;  4X43 A;  2X8H A;  2L6C A;  1PRX A;  3L4N A;  5ECM B;  1HNA A;  2VCT A;  1M99 A;  3D5J A;  5IMC A;  1YDK A;  1ZYP A;  1V58 A;  4Q5F A;  2Z9S A;  4MZB A;  2ZUP A;  3O6T A;  3HA9 A;  3IOS A;  3CTF A;  1VF2 A;  2OE3 A;  1SK0 A;  2JAC A;  3UEM A;  1EP8 A;  2V1M A;  2HRF A;  3ZL5 A;  4HSC X;  3J7Y k;  1AW9 A;  1K0C A;  1B4Q A;  3BOA A;  1RQM A;  2DKH A;  3FRC A;  3IBH A;  2K8S A;  1GRX A;  4HU7 A;  1GUK A;  2FD3 A;  3FEU A;  4V2N A;  2EIQ A;  1U88 A;  4QL7 A;  1O85 A;  1M3J A;  2R0G A;  2I4A A;  8GSS A;  1KNG A;  4I2T A;  4O92 A;  1K3Y A;  3CRT A;  2H71 A;  1GTB A;  1EEM A;  2HRN A;  3GKN A;  3IK9 A;  4L5O A;  3RPN A;  1AAZ A;  3F63 A;  2GQM A;  3GTU A;  2OKA A;  1A2L A;  4TR4 A;  1E2Y A;  1BJX A;  3QFB C;  1V40 A;  1TU7 A;  1OKT A;  2LUS A;  2LTK A;  1QK8 A;  1PQN A;  5L71 A;  3APS A;  1HNB A;  4F82 A;  4GF0 A;  4NMU A;  1CQG A;  3GST A;  5KEJ A;  1XWA A;  1F2E A;  3CSJ A;  3D22 A;  4CW9 A;  1PSQ A;  1X0R A;  4K8M A;  3BCK A;  2HFD A;  5G1L A;  2MBS A;  2QC7 A;  4FQU A;  1Z6N A;  9GSS A;  2LNS A;  5JWO B;  2IFQ A;  1G6Y A;  4ML1 A;  3L9U A;  5F8B A;  1EV4 A;  2WRT A;  2VCX A;  1JFU A;  4POM A;  1SJI A;  3H8Q A;  3QR6 A;  4XHM A;  1SEN A;  1WJK A;  2QGV A;  1WRY A;  4P3Y B;  1KTE A;  2GDR A;  4WKW A;  1U6T A;  4OFN A;  2E0Q A;  5EVO A;  6GSU A;  5DBQ A;  5J5N A;  2LJK A;  2I1U A;  5CRD A;  4KDX A;  4FIW A;  4PQ1 A;  3KTL A;  3HJM A;  5DAL B;  2XBI A;  3MWH A;  1A0F A;  2HSY A;  4MNN A;  2H74 A;  20GS A;  3PR8 A;  1M9B A;  2LRC A;  3GL3 A;  5HR3 A;  1GLQ A;  1UN2 A;  3IAS 2;  3RDW A;  5H5R A;  5JCW A;  4NXI A;  3OR5 A;  3UMA A;  2LST A;  1ON4 A;  4O5Q A;  3ZFL A;  4NHZ A;  5B6N A;  4KCE A;  2F51 A;  4GTU A;  4YQM A;  2L5L A;  3IK7 A;  2YWO A;  5DCH A;  2H8L A;  1KEB A;  1FVJ A;  1V57 A;  2PWJ A;  5ECS A;  2KUC A;  2R5G A;  4G9H A;  1PX6 A;  4TXO A;  2WCI A;  5INY A;  1Y6E A;  5FT3 A;  3ZIV A;  2ALB A;  2V6O A;  4XRD A;  2BMX A;  3Q6O A;  4MAB A;  4WEY A;  5LNK e;  3W6G A;  2VOC A;  3MSZ A;  5LCZ A;  1SL1 B;  3TJK A;  2GLR A;  3ERW A;  2YZH A;  1ZMA A;  2XBQ A;  4Z2T A;  3MIX A;  4WXT A;  3K8N A;  2XHF A;  4MF7 A;  2JZS A;  5ID2 A;  2IMI A;  3KIJ A;  2VD0 A;  5IO2 A;  1AIU A;  2VD1 A;  1WIK A;  4TKY A;  4XS1 A;  2YOI A;  4V1A p;  3UVH A;  1A8Y A;  4OMV A;  2IMD A;  2IME A;  3LEF A;  5ELG A;  4O5R A;  1W4V A;  3C73 A;  4HDE A;  2FWG A;  3WD6 A;  5KN1 A;  3KD0 A;  2HT9 A;  5E4W A;  2E2M A;  1T3B A;  3GMF A;  3CXG A;  1NHY A;  3GFK A;  2OBI A;  2H0G A;  3LYP A;  3HD5 A;  4FYC A;  3VLN A;  2OE1 A;  3TKR A;  2VUP A;  2X8C A;  4RQX A;  5HFI A;  4IBP A;  1XCC A;  4FO5 A;  2LJA A;  3HJP A;  4ZIJ A;  3TKS E;  3VI5 A;  1ML6 A;  2R0P A;  2ZNM A;  2YN1 A;  4IJI A;  2HNL A;  2PGT A;  3LFL A;  4HZ4 A;  2YAN A;  2DJ0 A;  1GUL A;  1SJ6 A;  1X5C A;  4V2M A;  1OC3 A;  1JHB A;  5GAP D;  3GKK A;  1A0R P;  1JLW A;  2B3S A;  2H70 A;  2WFC A;  2DBC A;  3TKQ A;  4EDZ A;  1GWC A;  3WGE A;  4IS0 A;  1QQ2 A;  4BIK A;  4EC0 A;  19GS A;  1KBN A;  2XPD A;  2H30 A;  3A5I A;  4EO3 A;  1QXH A;  2OBK A;  2H6Y A;  2A4V A;  1U3I A;  4I6X A;  1XIY A;  2H75 A;  3ZRD A;  4K6X A;  1AQW A;  1TI3 A;  4IQ1 A;  4Z2U A;  4HS1 A;  3I9V 2;  6GST A;  4TRX A;  3TOU A;  3ERF A;  1BX9 A;  2AUV A;  1HNC A;  4K7I A;  1PL1 A;  2H72 A;  2C3Q A;  3LW9 A;  2L4C A;  5HR2 A;  2L4Q A;  4PNG A;  3DRN A;  2UZ8 A;  2XC2 A;  4JR6 A;  1K0A A;  4I8B A;  3WT1 A;  2WZ9 A;  2CX3 A;  4F0B A;  3KM6 A;  3LYK A;  4OWY A;  3C71 A;  2CAI A;  13GS A; 
#chains in the Genus database with same CATH homology
 2EIR A;  3FR9 A;  2H76 A;  1WE0 A;  4V2L A;  1UC7 A;  2C0F A;  4POK A;  5A4U A;  4DVC A;  2NPB A;  4L5L A;  2HSH A;  4EIP A;  1QGV A;  5CP1 A;  1YQ1 A;  3EIN A;  1HYU A;  4K0N A;  3NIV A;  2C3T A;  1WWJ A;  3GYK A;  1XZO A;  2YNX A;  5CYY A;  1XPV A;  1Z9H A;  3TJJ A;  4TW5 A;  2A4H A;  3EUR A;  5D96 A;  1OC9 B;  3TJG A;  1E6B A;  4QL9 A;  3E3E A;  2TRX A;  2PPT A;  3IR4 A;  1FOH A;  2A2S A;  2VLT A;  1Q4J A;  4JR4 A;  4ZB6 A;  3GN3 A;  2JAD A;  2OAD A;  4TOP A;  3N5O A;  4BWQ A;  1MTC A;  3UL3 A;  3W8S A;  2H6X A;  2CV4 A;  2RM6 A;  4GST A;  5GSS A;  2JZR A;  4F03 A;  2IL3 A;  1VGL A;  2AHE A;  4GCI A;  5HFK A;  4PQI A;  3HKR A;  2MYG A;  1TRU A;  3DD3 A;  3I43 A;  2E2G A;  1XVW A;  4I5Q A;  4BVY B;  3A3T A;  2JSZ A;  5IMZ A;  3GH6 A;  3PGT A;  3VWU A;  2BTO T;  2IIY A;  4LL1 B;  1EOG A;  2DKI A;  3QOU A;  3TRQ A;  1GSE A;  5HQP A;  2F8F A;  3ISO A;  1PGT A;  1C72 A;  1THO A;  1GL8 A;  5DAL A;  2VL3 A;  3DML A;  4POB A;  2YCD A;  2CVB A;  1XW9 A;  3AY8 A;  3C1R A;  4MZW A;  2QA1 A;  5ECK B;  4Q5R A;  2B5Y A;  5COH A;  3D4M A;  2VCZ A;  1FAA A;  4ZIL A;  5IQY A;  3L9V A;  1YEP A;  3US3 A;  2CZ3 A;  3TB2 A;  2L57 A;  5CRW A;  5J4U A;  1GTI A;  3F6F A;  5IOX A;  2LQQ A;  1O73 A;  4JBB A;  2MMN A;  2HSM A;  4MK3 A;  4MJC A;  2VCW A;  4GSN A;  2B1K A;  1U87 A;  3VWX A;  3TRP A;  2YWM A;  1LBK A;  4PXO A;  4KB3 A;  1UVZ A;  2MBT A;  4N30 A;  2P5R A;  4KDU A;  1TK5 B;  1O81 A;  1FHE A;  5G5E A;  1EWX A;  6GSX A;  1WP0 A;  4MCU A;  4XCS A;  4ACS A;  1SKS B;  3I69 A;  3L9S A;  4G2E A;  4IVF A;  4KCA A;  3HHV A;  3WGX A;  2AAW A;  4OCF A;  2PVQ A;  5D9V A;  3F0I A;  2JL4 A;  1WMJ A;  4KF9 A;  5A5K A;  4GRF A;  3NZN A;  1NW2 A;  3QAG A;  3GUR A;  4PUA A;  3RHB A;  5LD0 A;  4AJ7 A;  1SKR B;  4ZBA A;  2GT6 A;  5DQY A;  4I97 A;  3IDV A;  3H93 A;  3N9J A;  5GZZ B;  5IIZ A;  5ECN B;  3H1N A;  4H86 A;  4G19 A;  4X4J A;  1A8L A;  3L0H A;  4MDC A;  1OE7 A;  1ZOF A;  2AV4 A;  4JZQ A;  4L0W A;  12GS A;  1FW1 A;  5J41 A;  2CX4 A;  3HDC A;  5B6M A;  3LOR A;  1Z7R A;  1X5E A;  1THX A;  5D9X A;  1XOB A;  3KTB A;  2N5A A;  5F0G A;  1SK1 A;  4QQ7 A;  3PPU A;  1MD4 A;  2AJQ B;  2RII A;  5C04 A;  3KXO A;  1A23 A;  1OAZ A;  2PUK C;  1V98 A;  3DEX A;  5ECI B;  2VM2 A;  4KAE A;  2IPA A;  2YV9 A;  4MF5 A;  3D4T A;  5IOW A;  3RBT A;  2DML A;  2R4V A;  1TK0 B;  1DBY A;  4POL A;  3F8U A;  2DIZ A;  4KSO A;  2IJY A;  3HVS A;  2HZF A;  2L59 A;  1BYE A;  1ZGN A;  2GQL A;  11GS A;  2GZP A;  3VWW A;  2X8G A;  1TXX A;  3EE2 A;  3VWV A;  2J23 A;  1T4Z A;  2DJ1 A;  5JCG A;  1V9W A;  3BJ5 A;  3UAR A;  4EKZ A;  5A4V A;  1T1V A;  3LG6 A;  4MF6 A;  2C0E A;  3APO A;  1XOA A;  2D2Z A;  1ZZY A;  5ABR A;  5CO3 A;  3A2W A;  4PUR A;  1TP9 A;  1XBS A;  1F3B A;  1A24 A;  1MEK A;  5HR1 A;  4HI7 A;  3EVI A;  3HVX A;  1FB0 A;  1F6M C;  1N8J A;  3WGD A;  2DC5 A;  1W89 A;  1PN0 A;  4XIH A;  3ZFB A;  1AC1 A;  2MMZ A;  1EOH A;  1Y25 A;  3LWA A;  4PTS A;  4PUF C;  3DKS A;  1FOV A;  5EY6 A;  3UIW A;  4HZ2 A;  3DYR A;  5DVB A;  3ZIJ A;  4MJA A;  1UA5 A;  3GH9 A;  3Q18 A;  1WPI A;  1YEX A;  1M9A A;  2MZC A;  1Z7P A;  4J2F A;  2IMF A;  4NV5 A;  2FGX A;  4ZXG A;  1DE1 A;  3ZIT A;  3ZZX A;  2DJ2 A;  4TVE A;  2WDU A;  1F37 A;  5F07 A;  2FHE A;  4NV2 A;  4XTS A;  4ECJ A;  2MMA A;  2H6Z A;  1I5G A;  1B8X A;  1AXD A;  3QMX A;  4ZB9 A;  1GTU A;  1OC9 A;  2O89 A;  3TUE A;  3LXZ A;  4EF0 A;  3C8E A;  1S3C A;  4KSM A;  3FYG A;  4IKH A;  3WT2 A;  3EWL A;  2VLV A;  3LJR A;  1T7P B;  4TR0 A;  3EMP A;  2G2Q A;  2LS5 A;  1BAY A;  4DSS B;  3FHK A;  2CVK A;  3KEB A;  1R5P A;  7GSS A;  2HLS A;  3CTG A;  1G6W A;  2YPM A;  4BVY A;  2KOK A;  1MD3 A;  4CDO A;  3S9F A;  4BL7 B;  3KCM A;  14GS A;  3F4S A;  3MDK A;  5FHI A;  1VF4 A;  5ELA A;  4TN8 A;  1GNE A;  3DVX A;  1YZX A;  4RQR A;  1PD2 1;  3HCZ A;  3UBK A;  2CVD A;  1JZW A;  2OJL A;  3IC4 A;  4IQA A;  4LMV A;  4TR1 B;  3F3R A;  4KX4 A;  3MAK A;  2CQ9 A;  4GWR A;  2DJ3 A;  2GT5 A;  5G31 A;  2YP6 A;  1GTA A;  3HZ8 A;  3IAM 2;  2LNT A;  4MLY A;  22GS A;  2FA8 A;  3IC8 A;  4KE3 A;  4OFT A;  5C00 A;  1SL0 B;  5BMU A;  4YH2 A;  4PQH A;  1BQ7 A;  3M0F A;  1MDI A;  2O87 A;  1TDI A;  1TKD B;  1YKA A;  5ECL B;  1K3O A;  1JLV A;  1ERT A;  1S3D A;  3FZ5 A;  3UVT A;  4ZBB A;  3SBC A;  1XWB A;  2JZT A;  1T00 A;  3LGC A;  2LRN A;  5J3R A;  5HR0 A;  4XS6 A;  3EPT A;  5B8A A;  4HJM A;  2EIO A;  3GUS A;  2WUL A;  3KMN A;  3PIN A;  4N10 A;  2X64 A;  2H0H A;  2P0G A;  3QDN A;  5B7C A;  4F9Z A;  3G7I A;  4LLR A;  4PNF A;  4RUV A;  1RW1 A;  2QSI A;  4G0I A;  2PN8 A;  3TOT A;  4A5P A;  3A2X A;  3C7M A;  3F4R A;  3RHC A;  5JCU A;  1YY7 A;  3FR6 A;  10GS A;  5CAX A;  1EZK A;  1Z6M A;  1OE8 A;  2VAF A;  2G0F A;  5EPF A;  2PER A;  3L78 A;  5J9C A;  1ZYE A;  2C0G A;  1SJZ A;  4IEL A;  3GL5 A;  2HE3 A;  1VF3 A;  5D93 A;  2I3Y A;  2RLI A;  1T4Y A;  2FWH A;  2QA2 A;  1GSQ A;  4FH8 A;  1WOU A;  1XXU A;  3R3E A;  1JZR A;  3CMI A;  5ECH B;  3GX0 A;  1QMV A;  4USS A;  1XW5 A;  3M9K A;  3ME8 A;  2GSR A;  4IGJ A;  2LRT A;  1SYR A;  1RK4 A;  3TGZ A;  4BA7 A;  4FYB A;  2PMT A;  1JZD A;  3I6A A;  5AIX A;  1Z5Y E;  3GKM A;  2RUF A;  1GLP A;  4IP6 A;  2VO4 A;  3D6I A;  5H5S A;  4ECC A;  1ERW A;  16GS A;  4K7O A;  1S3A A;  3EMX A;  4BPY A;  2BJX A;  2P5Q A;  3F3Q A;  5DAK A;  1OYJ A;  5KN0 A;  4TR3 A;  4MPG A;  5ECQ B;  4Q5N A;  1TU8 A;  5IPH A;  2VIM A;  2OE0 A;  3GIX A;  1QUW A;  3CSH A;  5A4W A;  1JZO A;  4JRR A;  4Z2R A;  5ECP B;  2HXK A;  2DIY A;  1K0O A;  2JU5 A;  1X5D A;  3RPP A;  5FWG A;  2H1B A;  5D8I A;  1F3A A;  4D73 B;  1QFN A;  4WR4 A;  2K8V A;  2YJ7 A;  5ECR B;  5IMA A;  1URM A;  4OD7 A;  1PN9 A;  5ECO B;  3HZ4 A;  4BVX B;  4IP1 A;  2AYT A;  4ECI A;  4X0X A;  2RUE A;  2QKE A;  1J9B A;  4J56 E;  3QFA C;  2KP1 A;  2KHP A;  2L5O A;  4WBR D;  2WB9 A;  5GAN D;  2E7P A;  3CSI A;  2C80 A;  1B48 A;  1LJR A;  4L0U A;  4KH7 A;  2A2P A;  3CBU A;  1GSF A;  3KMO A;  2FNO A;  2J9H A;  1GSS A;  2HRK A;  4DSR A;  4K1F A;  3O76 A;  2FLS A;  2VL2 A;  1XVQ A;  2O85 A;  4N11 A;  2H1A A;  3HY2 A;  2EC4 A;  3BCI A;  1EEJ A;  5CRE A;  4KND A;  5IM9 A;  4AJ8 A;  3UOM A;  4OO5 A;  1K0D A;  4ZL7 A;  1ZYQ B;  1PMT A;  2K18 A;  2VCV A;  5KN3 A;  3ZVJ A;  2N5B A;  3ZVJ D;  3GA4 A;  1GNW A;  1PL2 A;  2H1D A;  3VPQ A;  2REM A;  4MH2 A;  2DJJ A;  1TI1 A;  4ZL9 A;  1XW6 A;  2YZU A;  1TRS A;  2YWI A;  3U5R E;  2K9F A;  4MH3 A;  4DSS A;  4PX1 A;  1SYX A;  1MDK A;  2VCQ A;  1PKZ A;  2P31 A;  2FWF A;  1OKD A;  2OA7 A;  3WYW A;  4HJ2 A;  2RM5 A;  2VL2 C;  6GSY A;  3M3M A;  4ID0 A;  6GSW A;  3TDG A;  4O32 A;  5IMV A;  5KOX A;  4GQC A;  3ZLP A;  4BL7 A;  6GSV A;  2YJH A;  1DUG A;  4IN0 A;  3F6D A;  4MPF A;  1G7O A;  1GSY A;  2C3N A;  2LV3 A;  1TTZ A;  2PU9 C;  3GX8 A;  3DGQ A;  5IPG A;  4AGS A;  2B5X A;  5G1K A;  4WBJ A;  2L6D A;  5H5Q A;  4TR1 A;  4ZL8 A;  1GUH A;  3QPM A;  3QCP A;  1M2D A;  1ST9 A;  3UJ1 A;  4LMW A;  1VF1 A;  4ILF A;  2GGT A;  5DAK B;  4MJE A;  2GST A;  3R2Q A;  3GHA A;  4TXV A;  3KJY A;  2C0D A;  3A2V A;  1TRW A;  4XS4 B;  2H1G A;  4K2X A;  3LXT A;  1BG5 A;  4ULX A;  3GNJ A;  3D21 A;  2ES7 A;  2R3X A;  2GZZ A;  4GSS A;  5D9T A;  1R26 A;  3QD9 A;  1LU4 A;  4DSQ A;  4IW9 A;  3HXS A;  4MJB A;  4MMM A;  2VL9 A;  3VI7 A;  3Q74 A;  2B6M A;  3KGK A;  2NDO A;  2DJK A;  4NWY A;  3G7J A;  4NHW A;  5AIV A;  4MA9 A;  4YKG A;  5AIS A;  3TJF A;  2FA4 A;  4EVM A;  3G9B A;  1M2A A;  3DVW A;  4HOJ A;  5J9B A;  2FCH A;  2KP2 A;  4EDY A;  1OVN A;  3BBY A;  2JSY A;  1R5A A;  2M46 A;  3FKF A;  1ZL9 A;  3FW2 A;  3W8J A;  2VM1 A;  5EL8 A;  3TCO A;  1A2M A;  4WET A;  2HZE B;  4E8H A;  2LQO A;  2HYX A;  3P90 A;  5IO0 A;  1FO5 A;  2CZ2 A;  4IJ3 A;  3DIE A;  1H4O A;  4KW6 A;  2K6V A;  3KH7 A;  3RAZ A;  4IHU A;  2OAC A;  3VFI A;  1DE2 A;  2R6K A;  1Q98 A;  1NM3 A;  1F9M A;  4KUN A;  5BRT A;  3IE3 A;  1V2A A;  2WGR A;  3IA1 A;  3IXR A;  1YKC A;  3LSZ A;  2WJU A;  1FB6 A;  2YV7 A;  4BWS A;  3TRX A;  1VRS D;  3GSS A;  1DSB A;  4MP4 A;  2HRA A;  3ME7 A;  4OO4 A;  4WF4 A;  2V6K A;  3GRX A;  4EUY A;  1SL2 B;  2H19 A;  1T8E B;  5D9W A;  1SK2 A;  2ON7 A;  4WR5 A;  4ECB A;  4LA1 A;  3BD2 A;  2B7J A;  2F9S A;  2LJR A;  3IV4 A;  5CNW A;  4NPB A;  3CYN A;  2IN3 A;  4ZBD A;  4K2D A;  3CRU A;  3E9J B;  2R37 A;  4PGT A;  3KP9 A;  1ACV A;  1K0N A;  1USB A;  1BED A;  4JED A;  5IMD A;  3IPZ A;  1XWC A;  2B7K A;  2FWE A;  1O7U A;  2C8U A;  1PKW A;  1NHO A;  5G5F A;  3FZ4 A;  1AQV A;  2CAQ A;  1YF1 A;  3F9U A;  4K5S A;  3V1W A;  1TJD A;  1FVK A;  2H01 A;  3M8N A;  1HQO A;  1NSW A;  5KN2 A;  4D73 A;  3QAV A;  3D0Z A;  3GV1 A;  3TKP A;  1G0T A;  3U6V A;  4ZB8 A;  5JWR B;  3UBL A;  1PX7 A;  1IYH A;  2IMK A;  4BVX A;  2DSA A;  2FUG 2;  5CRG A;  1ZYN A;  2A2R A;  2F8A A;  3QAW A;  1TRV A;  1SKW B;  1AQX A;  4RI7 A;  3EYT A;  5DJL A;  3UAP A;  1EGO A;  2GVP A;  2IWT A;  4LL4 B;  3MYD A;  2LKU A;  4HUA A;  2ON5 A;  1ILO A;  3EU3 A;  1OC8 A;  2GQK A;  5JWQ B;  1O6J A;  4YAP A;  2PBJ A;  4GXZ A;  3O3T A;  1J08 A;  3PH9 A;  2R0C A;  3IRA A;  5IMF A;  3FY7 A;  3SWL A;  4YQV A;  1HD2 A;  2CT6 A;  4E8E A;  3GTU B;  2PVO C;  1GP1 A;  1J0F A;  4O7H A;  4DEJ A;  4K9Z A;  2R2J A;  1GSU A;  1Z3E A;  4L8E A;  3LQ7 A;  2V2G A;  2O7K A;  2X49 A;  5AN1 A;  2C1Y A;  2GTU A;  5DQS A;  1EP7 A;  4HQZ A;  1K0M A;  2TRC P;  2AB6 A;  3Q19 A;  4ML6 A;  2YWN A;  2IFQ B;  2LEG A;  1B9Y C;  1K0B A;  1TK8 B;  3VPT A;  5F06 A;  1B4P A;  5G30 A;  4WF5 A;  1IYI A;  1ERV A;  4RI6 A;  4CY6 A;  5DCG A;  1XFL A;  2X99 A;  4Q5Q A;  4JU5 A;  2NVL A;  4AF2 A;  2NBS A;  4HEA 2;  4CHS A;  1TW9 A;  2H73 A;  1FG4 A;  5B8B A;  1SU9 A;  4GLT A;  4F2I A;  3KH9 A;  5DDL A;  1O8X A;  2KLX A;  3FK8 A;  1ABA A;  2ZCT A;  1GSD A;  3P2A A;  2WS2 A;  3VK9 A;  3E0U A;  2GSS A;  2TIR A;  1SD8 A;  3ED3 A;  4V1A g;  3TJB A;  4X1U A;  1EV9 A;  4AJ6 A;  1H75 A;  2V41 A;  2FY6 A;  1SD9 A;  4MZC A;  2H0I A;  3H79 A;  2M80 A;  1ERU A;  2M72 A;  3HVV A;  5ENU A;  4NAX A;  2HI7 A;  4TXO B;  3KZQ A;  4J57 E;  1CQH A;  3P7X A;  3IHQ A;  3FZA A;  4ICY A;  3F4T A;  4O5U A;  4YAV A;  4XS4 A;  3ZYW A;  4OFM A;  3ZML A;  4EL1 A;  4YQU A;  2GZY A;  2H66 A;  5KOW A;  2NTO A;  4CY8 A;  3M9J A;  2XPE A;  3TKS A;  5GST A;  3M1G A;  4ISD A;  3P8W A;  4EXJ A;  2F3M A;  2C4J A;  4KA0 A;  4Z7X A;  3ZTL A;  2DMM A;  5CRH A;  5G2Z A;  4K5R A;  3APQ A;  3HJO A;  4KGI A;  5ID2 B;  1X9W B;  3IHG A;  3NOF A;  2I9H A;  4G0L A;  3ZMK A;  3DWV A;  1GH2 A;  6GSS A;  4F0C A;  3GKX A;  1M0U A;  4KDY A;  4N0Z A;  18GS A;  1PA3 A;  5E59 A;  1R4W A;  1B9X C;  3A5W A;  1U3A A;  4G0K A;  4I2U A;  2B5E A;  4OCE A;  2HZE A;  1TOF A;  17GS A;  1I9D A;  4EIQ A;  2V32 A;  4YKF A;  2I81 A;  3H4K A;  3DXB A;  3FR3 A;  5F05 A;  4N0V A;  4XRA A;  3J7Y b;  4GQF A;  2CA8 A;  1EGR A;  3HYP A;  2VLU A;  1G7E A;  2X4A A;  1A2J A;  3TKS C;  4JE1 A;  1M7T A;  3VUR A;  1O8W A;  4K0G A;  1X9M B;  1X9S B;  5HFG A;  2GSQ A;  3ERG A;  1XWK A;  1N2A A;  3EC3 A;  3G7Y A;  1AUC A;  3FZ9 A;  5AGY A;  1XWG A;  4FYU A;  1YF0 A;  5D73 A;  1MDJ A;  3MNG A;  2DLX A;  4G10 A;  3EU4 A;  1K3L A;  1M2B A;  3JCM L;  2B1L A;  1ZCP A;  3FMW A;  4HQS A;  1GUM A;  4K7N A;  1YJ6 A;  2GS3 A;  5DJM A;  3C1S A;  4HU9 A;  2O8V B;  3KP8 A;  1R7H A;  2N5F A;  4EE0 A;  3ZRE A;  2MMO A;  4X43 A;  2X8H A;  2L6C A;  1PRX A;  3L4N A;  5ECM B;  1HNA A;  2VCT A;  1M99 A;  3D5J A;  5IMC A;  1YDK A;  1ZYP A;  1V58 A;  4Q5F A;  2Z9S A;  4MZB A;  2ZUP A;  3O6T A;  3HA9 A;  3IOS A;  3CTF A;  1VF2 A;  2OE3 A;  1SK0 A;  2JAC A;  3UEM A;  1EP8 A;  2V1M A;  2HRF A;  3ZL5 A;  3J7Y k;  1AW9 A;  1K0C A;  1B4Q A;  3BOA A;  1RQM A;  2DKH A;  3FRC A;  3IBH A;  2K8S A;  1GRX A;  4HU7 A;  1GUK A;  2FD3 A;  3FEU A;  4V2N A;  2EIQ A;  1U88 A;  4QL7 A;  1O85 A;  2R0G A;  2I4A A;  8GSS A;  1KNG A;  4I2T A;  4O92 A;  1K3Y A;  3CRT A;  2H71 A;  1GTB A;  1EEM A;  2HRN A;  3GKN A;  3IK9 A;  4L5O A;  3RPN A;  1AAZ A;  3F63 A;  2GQM A;  3GTU A;  2OKA A;  1A2L A;  4TR4 A;  1E2Y A;  1BJX A;  3QFB C;  1V40 A;  1TU7 A;  1OKT A;  2LUS A;  2LTK A;  1QK8 A;  1PQN A;  5L71 A;  3APS A;  1HNB A;  4F82 A;  4GF0 A;  4NMU A;  1CQG A;  3GST A;  5KEJ A;  1XWA A;  1F2E A;  3CSJ A;  3D22 A;  4CW9 A;  1PSQ A;  1X0R A;  4K8M A;  3BCK A;  2HFD A;  5G1L A;  2MBS A;  2QC7 A;  4FQU A;  1Z6N A;  9GSS A;  2LNS A;  5JWO B;  2IFQ A;  1G6Y A;  4ML1 A;  3L9U A;  5F8B A;  1EV4 A;  2WRT A;  2VCX A;  1JFU A;  4POM A;  1SJI A;  3H8Q A;  3QR6 A;  4XHM A;  1SEN A;  1WJK A;  2QGV A;  1WRY A;  4P3Y B;  1KTE A;  2GDR A;  4WKW A;  1U6T A;  4OFN A;  2E0Q A;  5EVO A;  6GSU A;  5DBQ A;  5J5N A;  2LJK A;  2I1U A;  5CRD A;  4KDX A;  4FIW A;  4PQ1 A;  3KTL A;  3HJM A;  5DAL B;  2XBI A;  3MWH A;  1A0F A;  2HSY A;  4MNN A;  2H74 A;  20GS A;  3PR8 A;  1M9B A;  2LRC A;  3GL3 A;  5HR3 A;  1GLQ A;  1UN2 A;  3IAS 2;  3RDW A;  5H5R A;  5JCW A;  4NXI A;  3OR5 A;  3UMA A;  2LST A;  1ON4 A;  4O5Q A;  3ZFL A;  4NHZ A;  5B6N A;  4KCE A;  2F51 A;  4GTU A;  4YQM A;  2L5L A;  3IK7 A;  2YWO A;  5DCH A;  2H8L A;  1KEB A;  1FVJ A;  1V57 A;  2PWJ A;  5ECS A;  2KUC A;  2R5G A;  4G9H A;  1PX6 A;  4TXO A;  2WCI A;  5INY A;  1Y6E A;  5FT3 A;  3ZIV A;  2ALB A;  2V6O A;  4XRD A;  2BMX A;  3Q6O A;  4MAB A;  4WEY A;  5LNK e;  3W6G A;  2VOC A;  3MSZ A;  5LCZ A;  1SL1 B;  3TJK A;  2GLR A;  3ERW A;  2YZH A;  1ZMA A;  2XBQ A;  4Z2T A;  3MIX A;  4WXT A;  3K8N A;  2XHF A;  4MF7 A;  2JZS A;  5ID2 A;  2IMI A;  3KIJ A;  2VD0 A;  5IO2 A;  1AIU A;  2VD1 A;  1WIK A;  4TKY A;  4XS1 A;  2YOI A;  4V1A p;  3UVH A;  1A8Y A;  4OMV A;  2IMD A;  2IME A;  3LEF A;  5ELG A;  4O5R A;  1W4V A;  3C73 A;  4HDE A;  2FWG A;  3WD6 A;  5KN1 A;  3KD0 A;  2HT9 A;  5E4W A;  2E2M A;  1T3B A;  3GMF A;  3CXG A;  1NHY A;  3GFK A;  2OBI A;  2H0G A;  3LYP A;  3HD5 A;  4FYC A;  3VLN A;  2OE1 A;  3TKR A;  2VUP A;  2X8C A;  4RQX A;  5HFI A;  4IBP A;  1XCC A;  4FO5 A;  2LJA A;  3HJP A;  4ZIJ A;  3TKS E;  3VI5 A;  1ML6 A;  2R0P A;  2ZNM A;  2YN1 A;  4IJI A;  2HNL A;  2PGT A;  3LFL A;  4HZ4 A;  2YAN A;  2DJ0 A;  1GUL A;  1SJ6 A;  1X5C A;  4V2M A;  1OC3 A;  1JHB A;  5GAP D;  3GKK A;  1A0R P;  1JLW A;  2B3S A;  2H70 A;  2WFC A;  2DBC A;  3TKQ A;  4EDZ A;  1GWC A;  3WGE A;  4IS0 A;  1QQ2 A;  4EC0 A;  19GS A;  1KBN A;  2XPD A;  2H30 A;  3A5I A;  4EO3 A;  1QXH A;  2OBK A;  2H6Y A;  2A4V A;  1U3I A;  4I6X A;  1XIY A;  2H75 A;  3ZRD A;  4K6X A;  1AQW A;  1TI3 A;  4IQ1 A;  4Z2U A;  4HS1 A;  3I9V 2;  6GST A;  4TRX A;  3TOU A;  3ERF A;  1BX9 A;  2AUV A;  1HNC A;  4K7I A;  1PL1 A;  2H72 A;  2C3Q A;  3LW9 A;  2L4C A;  5HR2 A;  2L4Q A;  4PNG A;  3DRN A;  2UZ8 A;  2XC2 A;  4JR6 A;  1K0A A;  4I8B A;  3WT1 A;  2WZ9 A;  2CX3 A;  4F0B A;  3KM6 A;  3LYK A;  4OWY A;  3C71 A;  2CAI A;  13GS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...