1O7UA

Radiation induced tryparedoxin-i
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
143
structure length
143
Chain Sequence
GLDKYLPGIEKLRRGDGEVEVKSLAGKLVFFYFSASWCPPCRGFTPQLIEFYDKFHESKNFEVVFCTWDEEEDGFAGYFAKMPWLAVPFAQSEAVQKLSKHFNVESIPTLIGVDADSGDVVTTRARATLVKDPEGEQFPWKDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords TRYPAREDOXIN
publication title Tryparedoxins from Crithidia Fasciculata and Trypanosoma Brucei: Photoreduction of the Redox Disulfide Using Synchrotron Radiation and Evidence for a Conformational Switch Implicated in Function
pubmed doi rcsb
source organism Crithidia fasciculata
total genus 43
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2002-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13905 Thioredoxin_8 Thioredoxin-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1o7uA00
3F0IA 4RI6A 1SL2B 5H5SA 6GSWA 2PN8A 1SKWB 4GLTA 2FWEA 2H6ZA 1UA5A 2HZEA 1SKSB 2DJKA 1RK4A 2EIRA 3GHAA 3QPMA 1ABAA 3ZRDA 18GSA 3ZIJA 3FR9A 5D9VA 3P8WA 4KDXA 3SWLA 3DVWA 5KEJA 14GSA 4POKA 2VL9A 4JR4A 1TRWA 1WPIA 4KX4A 17GSA 2AV4A 1F3AA 1THOA 5JCUA 1GSUA 1X0RA 2C3QA 5JWRB 2LJRA 3F3QA 1Z9HA 3ZFBA 1R7HA 2ZNMA 2R5GA 5DCGA 3W8SA 2PU9C 2LUSA 4J2FA 3V1WA 1EZKA 1Y6EA 3M0FA 2VL2C 4WR4A 4K8MA 3F4RA 4TR4A 3RHBA 3VFIA 2AAWA 2O89A 1XOAA 2HSYA 5HR3A 2XPEA 3CSHA 3F9UA 3J7Yb 3UMAA 4KE3A 4PNFA 4AJ8A 2VD0A 5D8IA 2JZTA 1SYXA 2H72A 3D4TA 1X5CA 1FHEA 1A0RP 2FLSA 1T1VA 2OJLA 2AHEA 4MJBA 5GAPD 3KMOA 3UARA 4OCEA 1AQWA 2JU5A 2KOKA 1SYRA 1ZMAA 2H30A 5ECNB 1NHYA 3DWVA 2HRFA 2B1LA 1G7OA 2X8GA 1W4VA 3GKNA 1N8JA 3GH6A 4L5OA 1B8XA 2MMZA 2LEGA 3LXTA 1PX6A 2EIOA 2LS5A 4ZL9A 1F6MC 5F8BA 5KN0A 4PXOA 3F6DA 2H1DA 3RHCA 1HD2A 5GSTA 3PR8A 4OO4A 2HXKA 1ERUA 3ZIVA 4GTUA 1T4YA 1GUKA 4V1Ag 2HT9A 2VLTA 3ZFLA 3ZVJA 1KNGA 1ZCPA 1Q98A 2LRTA 3LORA 2JL4A 1MDIA 4O5RA 3LSZA 2B5YA 2F51A 1ERWA 3KH7A 2KP2A 5DCHA 5AIXA 4NAXA 3C71A 4IKHA 5G2ZA 2X8HA 2G2QA 4ISDA 4MA9A 4KDYA 5ECPB 3CBUA 1SL1B 1DUGA 1G6YA 1O81A 3UVHA 1ERVA 1TRUA 4QL9A 3PINA 3I69A 3EURA 4KH7A 3GMFA 2F8FA 1SL0B 4F0BA 3H8QA 3HVVA 5EL8A 3D21A 1JHBA 3P90A 3VI7A 2C8UA 5J9BA 1JZWA 1XXUA 3IK9A 3EU4A 1TTZA 2FA4A 1B48A 3TOUA 3KJYA 2R2JA 4LL4B 2K6VA 4ZIJA 3HKRA 6GSVA 4PQ1A 1GSQA 3ZYWA 5H5RA 2ES7A 4FIWA 4TXOA 1XZOA 1BX9A 3KTBA 5DAKB 3ZLPA 5IM9A 1DSBA 4OD7A 3GTUB 5CO3A 1GTUA 2H1GA 2Z9SA 4IP6A 2AB6A 1KEBA 5IMDA 3P7XA 1HNCA 1F37A 4DSSA 1SK0A 2P5RA 3HCZA 1GUHA 3GYKA 3D0ZA 4QL7A 3TKPA 2CVKA 2AJQB 4MP4A 4GRFA 1VF3A 3P2AA 3LEFA 2GTUA 3ERWA 3IAM2 5A4WA 2NDOA 2L57A 5ID2A 1B4PA 3QFAC 3GSSA 1OKDA 3TKQA 4NMUA 1ZYEA 4YQUA 1M99A 3IE3A 2FCHA 4H86A 4XIHA 1KBNA 1PRXA 1J08A 4BWQA 3VLNA 5J3RA 3UBLA 1HNBA 1QFNA 5F06A 1B9XC 4HQSA 5GSSA 1K0CA 2LJKA 3VWWA 2B1KA 3DRNA 4E8EA 3GNJA 2C3NA 2VCVA 2N5AA 1Z6MA 1GUMA 3MWHA 1MDJA 4NXIA 3BBYA 1OC8A 4IQAA 2O85A 4EF0A 1JLVA 2L5LA 2VCWA 2R4VA 5G31A 1K0AA 3TDGA 1JZOA 2FY6A 3UEMA 2A2RA 1ZOFA 3F4SA 3KTLA 2YANA 3BJ5A 4KCEA 5CRWA 4EDZA 1AIUA 1AXDA 4K7IA 4OWYA 1Y25A 2JZSA 2LNTA 3GN3A 4JR6A 2B5XA 5JWQB 3J7Yk 4ZB6A 5AGYA 4EE0A 5DJMA 4MPGA 2B3SA 3NIVA 2LRNA 3VPTA 3QAWA 2WCIA 3ZMKA 2LQOA 2ON7A 3ZMLA 4WF5A 5JCGA 3DD3A 3IHQA 1K3YA 1TRVA 4HZ4A 4MH2A 1VF2A 3Q74A 1HYUA 2YJ7A 2VCXA 1U3AA 2IMKA 2WULA 3O3TA 5DBQA 1V40A 4BPYA 1TKDB 2JACA 4GCIA 3RPNA 1T4ZA 2M80A 3E0UA 3EINA 3Q6OA 3IRAA 2RM5A 2NPBA 1SJZA 3F63A 3L9SA 2CT6A 4EKZA 19GSA 4KW6A 1J0FA 1IYIA 3TKRA 2HZEB 1TU8A 2C1YA 3FR6A 22GSA 3GKKA 4FH8A 3IPZA 4PX1A 3TJBA 3CRUA 3TRPA 1E2YA 5A4VA 3W6GA 2RIIA 1G0TA 5FWGA 1SK1A 4ZILA 2EC4A 3MDKA 4O7HA 2YPMA 2L6CA 5IPHA 5DALA 1NM3A 1TK8B 12GSA 1ML6A 3ZVJD 5JCWA 1RW1A 2YCDA 2YP6A 1PGTA 5CREA 3FR3A 5ECLB 2YWIA 1SKRB 3DXBA 2I4AA 2CQ9A 5ECQB 2M46A 3GRXA 2MMAA 2V6OA 3IR4A 4RQRA 4G2EA 2BTOT 2CAQA 4EXJA 1FO5A 3TJJA 2MBSA 1B4QA 4EUYA 2JSYA 2V32A 1WJKA 1AQVA 4ZBDA 2TIRA 4ZXGA 2DJ1A 1MD4A 5CRDA 5C04A 4HUAA 4JU5A 2IFQA 1F3BA 4IJIA 1PL2A 4YH2A 1QXHA 2B7JA 1A24A 3QAGA 1G7EA 4XS1A 2CAIA 2FA8A 2DBCA 4Q5RA 1R5AA 2MBTA 2YWMA 2F8AA 4LLRA 3L78A 1LBKA 4G9HA 2YNXA 1ON4A 5HR0A 4I5QA 3LQ7A 1XWBA 2HFDA 1A8LA 3A2VA 4GSSA 2MYGA 1QQ2A 2IJYA 5LCZA 2GT5A 3GL5A 3OR5A 1A0FA 5J9CA 5KN3A 1A2LA 2AYTA 2H0IA 4F9ZA 3GFKA 5EY6A 2I81A 1Z3EA 5J41A 4ID0A 3IDVA 2CA8A 5FHIA 5D96A 4ZL7A 2LJAA 2HRNA 2GGTA 1GSEA 1MEKA 1GTBA 4F2IA 5IIZA 2J9HA 2QC7A 3N9JA 1XFLA 2GS3A 3SBCA 2E7PA 2BJXA 3F8UA 1V9WA 4Q5FA 1FOVA 3M3MA 2B7KA 3LYPA 4K7NA 3RBTA 3VK9A 1QGVA 1DE2A 3KP9A 3CTGA 1NHOA 1EV4A 1TU7A 1BG5A 5IMCA 2MMNA 3VWUA 3D22A 1TK5B 4O92A 4N0ZA 1X5EA 4IELA 3BCIA 2L4CA 3RPPA 4O32A 1MTCA 2N5BA 5D9TA 1XWKA 2JADA 4KSOA 4RQXA 9GSSA 1K0BA 2GZYA 4ULXA 3GL3A 1SJIA 4G19A 4K1FA 4XS4A 6GSYA 2H73A 5EPFA 4IBPA 4KA0A 4AJ7A 1JLWA 2H19A 3UIWA 6GSTA 2PGTA 2C3TA 3G7JA 5CYYA 3QD9A 2VIMA 1EGOA 4MK3A 1Z7PA 4L5LA 2FUG2 4ILFA 4TXOB 5ECKB 2LV3A 4Q5NA 2H0GA 4TKYA 4E8HA 2DJ2A 2V2GA 1FB0A 2L5OA 2WGRA 3BCKA 4JE1A 1GL8A 2YWOA 3H4KA 3TKSC 4DSSB 3DVXA 4X43A 1SU9A 1XW6A 1ZL9A 4ZB9A 4ECIA 4CHSA 2QSIA 4IVFA 3FY7A 4AGSA 1LU4A 4N10A 5JWOB 3WGDA 1R5PA 4OMVA 5ID2B 4POBA 3CSJA 2PERA 3QMXA 4MZBA 2OE0A 3DGQA 4MF6A 2FHEA 1IYHA 1W89A 2V6KA 3EVIA 1OKTA 3TUEA 4IN0A 2H01A 2B5EA 2OACA 3WT2A 4HEA2 3UJ1A 5LD0A 2HI7A 4WBRD 1PKWA 4LA1A 1EOGA 4ACSA 2I1UA 1ZGNA 4XCSA 3ZL5A 4AF2A 4KUNA 1K0NA 1XVQA 3ED3A 4J56E 2HZFA 5HFKA 4MH3A 4N30A 1SK2A 13GSA 5DJLA 1CQHA 3APOA 4HJ2A 2A4VA 2VM2A 3HA9A 2D2ZA 3UVTA 1PMTA 1A2MA 1TK0B 2YV9A 3EWLA 4TR0A 1I9DA 3D5JA 3TCOA 4KAEA 4J57E 2H6XA 1M2DA 3E3EA 5GAND 2PVOC 1N2AA 3F4TA 4NV2A 3EU3A 3R2QA 4G10A 1XVWA 2H8LA 5IPGA 1XWAA 2L59A 2VL3A 1EP8A 3C1SA 3W8JA 4N11A 3EE2A 3GIXA 3A3TA 1GULA 5IOXA 4MJCA 3CTFA 2TRXA 3M8NA 2L4QA 3FW2A 3FEUA 4KNDA 2QGVA 3HZ8A 2DMMA 1PN9A 4JBBA 1V57A 1T3BA 4I8BA 3KP8A 3GSTA 1G6WA 1M0UA 4K6XA 1BJXA 4POMA 4YAVA 1BEDA 3TGZA 2PWJA 2P0GA 3H93A 3WYWA 2GSSA 1OE8A 1THXA 2O87A 5ECRB 1H4OA 5DDLA 3LWAA 4ML1A 5ECIB 3TJFA 4MZCA 1OE7A 1T7PB 3FZ4A 2IWTA 2GSRA 3DEXA 3LG6A 2VM1A 2H1AA 5IQYA 3IBHA 5IOWA 3K8NA 4PQIA 3TRXA 2GQLA 4TR1A 1OC9B 2DJ3A 2R3XA 4MPFA 3HZ4A 4I97A 4WEYA 2CVDA 2J23A 1WIKA 2CV4A 4BVYA 3F3RA 3CXGA 5DALB 3DKSA 1C72A 4TN8A 2X64A 4PQHA 4YQMA 5ELGA 4ECJA 3MSZA 5CAXA 3ZZXA 1GLQA 2IL3A 3A2WA 3JCML 3GH9A 2KP1A 3C8EA 4XTSA 2KUCA 2H74A 1OVNA 3HXSA 1EEJA 1TRSA 3C7MA 1F9MA 3F6FA 1YF0A 4GQFA 3U6VA 1YKAA 4EC0A 2OBKA 4JRRA 3BD2A 1CQGA 2HSHA 3CMIA 3FZAA 2NVLA 4AJ6A 4D73A 3VWVA 2ZCTA 4MF7A 2RM6A 5F0GA 1GH2A 1YF1A 5F05A 2M72A 3RDWA 2IFQB 2RUFA 4ECBA 1VRSD 2E0QA 4WR5A 5ENUA 1VF1A 5HR1A 2E2MA 4OO5A 3G7IA 2FD3A 3EMXA 3VURA 4L0UA 2XHFA 3UL3A 10GSA 1TI3A 5CRGA 4ZBBA 4BA7A 1RQMA 4EL1A 5KN2A 2OE1A 2CX3A 4FYUA 1R4WA 1GTAA 1WE0A 3H1NA 3QOUA 3KH9A 3FZ5A 4F82A 2NBSA 1HNAA 3PGTA 2VL2A 1XWGA 5D73A 1HQOA 5ELAA 2GVPA 3D6IA 3APSA 4CW9A 1GSSA 3VPQA 3EC3A 2WFCA 2OA7A 1T8EB 1A23A 4I2TA 3RAZA 4F03A 1GSYA 2YJHA 1XPVA 4X0XA 3WD6A 2IMEA 1QUWA 4HI7A 1YEPA 4OCFA 7GSSA 4PUFC 4TXVA 3M1GA 4JEDA 4NV5A 1XW9A 2DLXA 2PVQA 5IMAA 3KXOA 3L9VA 2GQMA 1EV9A 4GQCA 1X9SB 4OFTA 2I9HA 2OADA 3TKSA 4HDEA 4HZ2A 4GXZA 4HS1A 1V58A 2C80A 2YZUA 1BQ7A 4XS4B 3FKFA 2YN1A 1XBSA 5F07A 1AAZA 1WOUA 4IW9A 1EWXA 5G30A 1SD8A 4EVMA 2WDUA 1XOBA 1FVJA 1X9MB 2I3YA 2REMA 4PGTA 5ECHB 4GSNA 3DIEA 5KN1A 3QR6A 1JZDA 2GQKA 1V2AA 4EO3A 2LSTA 5ABRA 2CZ2A 2KHPA 2X8CA 1X9WB 1FVKA 1OYJA 1ACVA 2H71A 2VCTA 2GSTA 3L4NA 1PL1A 2VOCA 20GSA 3CSIA 2GZPA 2R6KA 3U5RE 1K0OA 2PPTA 3L0HA 4BWSA 1X5DA 2K9FA 3IV4A 4FO5A 2LRCA 2VLUA 3LYKA 1R26A 1B9YC 2FGXA 1YKCA 4NPBA 1TJDA 1PD21 1LJRA 3S9FA 4BVXA 2OKAA 4IJ3A 1F2EA 1GSFA 2P5QA 3LXZA 2MZCA 1PKZA 3UOMA 2XBQA 1UC7A 2FWHA 3HJPA 3VI5A 1OC3A 4HU9A 1GNWA 2V1MA 4FYCA 2DJ0A 3UAPA 4JZQA 3KD0A 5B8AA 1AQXA 2K8SA 3M9JA 1XW5A 2H66A 4IGJA 3A5WA 1K3OA 1J9BA 2VAFA 4MDCA 2X99A 3AY8A 2YV7A 4ZBAA 1QK8A 4HQZA 3MAKA 4MMMA 11GSA 5CNWA 4XS6A 1BAYA 1YJ6A 1FAAA 1PX7A 2O7KA 4NHZA 3HDCA 4ML6A 2IMFA 3KZQA 5AISA 5COHA 3HVXA 5DVBA 2GDRA 1U87A 4WXTA 1YZXA 5B8BA 3EMPA 3ZTLA 4OFNA 4L8EA 1Z5YE 2H0HA 3LGCA 1AW9A 2O8VB 5G1LA 2NTOA 2YOIA 1TDIA 2G0FA 5J5NA 2N5FA 1SENA 1XWCA 3ERGA 2A2SA 3EYTA 4HJMA 2H1BA 4YAPA 4K7OA 4RI7A 1WWJA 2IIYA 2BMXA 2LQQA 3GX8A 2HNLA 3N5OA 2B6MA 1H75A 3G9BA 5HFIA 2TRCP 4TR1B 3IXRA 1WP0A 4DSQA 3Q18A 3E9JB 5G5FA 3VWXA 1EGRA 1OAZA 2F9SA 1O7UA 4F0CA 4KGIA 2GZZA 1NSWA 4YQVA 2E2GA 3MNGA 3FK8A 5CP1A 3GUSA 3M9KA 3G7YA 2ALBA 2H75A 3NZNA 3QDNA 4XHMA 2RUEA 1GTIA 2CZ3A 4TRXA 2WS2A 2WB9A 2C0DA 1JZRA 4LMWA 2PUKC 3QFBC 1T00A 1PQNA 1S3CA 3IA1A 1BYEA 5D9XA 3TB2A 4I6XA 3UBKA 5HFGA 1PA3A 4D73B 5C00A 5A4UA 3GURA 4TVEA 3BOAA 1A2JA 1M9AA 2QKEA 3QCPA 4WBJA 4WKWA 2HYXA 3IOSA 3Q19A 2XBIA 4ZB8A 2PBJA 2ON5A 1TXXA 2YZHA 5B6MA 4ECCA 2GT6A 4MZWA 3A2XA 2HE3A 1V98A 5LNKe 2H6YA 5HQPA 3TRQA 2XC2A 1M9BA 1ZZYA 1E6BA 1U3IA 3I6AA 5FT3A 1FB6A 4OFMA 2WJUA 1AUCA 4DVCA 4WF4A 4CDOA 3ZREA 1GLPA 1Z6NA 1TOFA 5AIVA 4MCUA 4TW5A 1U88A 3APQA 2DIYA 1SD9A 1VF4A 3O6TA 2VD1A 2ZUPA 3FRCA 5AN1A 1ILOA 1SJ6A 2LNSA 4TR3A 5G1KA 2WZ9A 4V2LA 1FW1A 2VLVA 4P3YB 4DEJA 1XIYA 3KMNA 1O6JA 1WMJA 4MABA 3TKSE 2IPAA 5HR2A 1FG4A 4ZL8A 3ME8A 2FWGA 2DSAA 2C0EA 4NWYA 1AC1A 4K0GA 4MF5A 2DJJA 4GSTA 1O85A 4K2DA 2OBIA 1TP9A 2F3MA 2XPDA 1YQ1A 2DIZA 1URMA 5D9WA 5INYA 4MJEA 4NHWA 3LJRA 4IP1A 2IMDA 4KB3A 3TJKA 3US3A 6GSSA 2GSQA 3PH9A 1GNEA 2KLXA 1I5GA 1PSQA 3CYNA 1EP7A 2JSZA 2VUPA 4DSRA 4XRDA 1M7TA 4KDUA 5GZZB 4IQ1A 1Q4JA 1O8XA 2C4JA 3L9UA 3CRTA 2CX4A 1GP1A 3WGEA 3D4MA 2DMLA 1UVZA 4I2UA 3H79A 1EOHA 2R37A 4IS0A 1XCCA 4BL7A 3GA4A 3IK7A 3WT1A 3HJMA 1GSDA 2L6DA 2IMIA 1A8YA 5DAKA 3GKXA 5H5QA 1TW9A 3GV1A 2H70A 3KEBA 5ECMB 1U6TA 3GTUA 4MLYA 4FYBA 1ZYQB 2P31A 2HLSA 2LKUA 1YEXA 4EDYA 2PMTA 2VCZA 3HD5A 5DQSA 4X1UA 3IC4A 1S3AA 2H76A 5IMZA 3ME7A 4HOJA 8GSSA 2YWNA 3GX0A 4KSMA 1M2BA 1UN2A 1Z7RA 4K9ZA 4HU7A 1USBA 4V1Ap 3KM6A 4QQ7A 3KGKA 4V2MA 4Q5QA 4V2NA 5B7CA 4LL1B 2JZRA 1GWCA 5ECOB 4POLA 3GKMA 3IAS2 2VCQA 2MMOA 1OC9A 5G5EA 3TJGA 1GRXA 2K8VA 3WGXA 6GSXA 1S3DA 2WRTA 16GSA 3HVSA 5IMVA 4TOPA 1DBYA 4L0WA 1ST9A 2EIQA 3KCMA 4PNGA 3C1RA 3HYPA 3HJOA 3ISOA 5A5KA 1K3LA 2C0GA 1YY7A 1MDKA 5DQYA 2FNOA 3FZ9A 4IHUA 5ECSA 1QMVA 5IMFA 3NOFA 2V41A 4GF0A 3HHVA 2AUVA 5EVOA 3DYRA 3FYGA 1O73A 1WRYA 3QAVA 3LFLA 4KCAA 5B6NA 2IN3A 3KIJA 5E4WA 5IO2A 2C0FA 2LTKA 2OE3A 1M2AA 5J4UA 3ZITA 4WETA 3ERFA 2VO4A 4MJAA 5IO0A 5E59A 4LMVA 3DMLA 2CVBA 1EEMA 2RLIA 1K0MA 4PURA 4GWRA 2FWFA 4Z7XA 4XRAA 2K18A 1YDKA 1K0DA 3TOTA 3I9V2 3I43A 4RUVA 4K0NA 4N0VA 1TI1A 1NW2A 1DE1A 3C73A 5CRHA 5L71A 1VGLA 3FHKA 3O76A 4PUAA 1JFUA 1KTEA 1O8WA 1ERTA 5D93A 6GSUA 3HY2A 1MD3A 2GLRA 2DC5A
chains in the Genus database with same CATH superfamily
3F0IA 4RI6A 1SL2B 5H5SA 6GSWA 2PN8A 1SKWB 4GLTA 2FWEA 2H6ZA 1UA5A 2HZEA 1SKSB 2DJKA 1RK4A 2EIRA 3GHAA 3QPMA 1ABAA 3ZRDA 18GSA 3ZIJA 3FR9A 5D9VA 3P8WA 4KDXA 3SWLA 3DVWA 5KEJA 14GSA 4POKA 2VL9A 4JR4A 1TRWA 1WPIA 4KX4A 1PFOA 17GSA 2AV4A 1F3AA 1THOA 5JCUA 1GSUA 1X0RA 2C3QA 5JWRB 2LJRA 3F3QA 1Z9HA 3ZFBA 1R7HA 2ZNMA 2R5GA 5DCGA 3W8SA 2PU9C 2LUSA 4J2FA 3V1WA 1EZKA 1Y6EA 3M0FA 2VL2C 4WR4A 4K8MA 3F4RA 4TR4A 3RHBA 3VFIA 2AAWA 2O89A 1XOAA 2HSYA 5HR3A 2XPEA 3CSHA 3F9UA 3J7Yb 3UMAA 4KE3A 4PNFA 4AJ8A 2VD0A 2R0CA 5D8IA 2JZTA 1SYXA 2H72A 3D4TA 1X5CA 1FHEA 1A0RP 2FLSA 1T1VA 2OJLA 2AHEA 4MJBA 5GAPD 3KMOA 3UARA 4OCEA 1AQWA 2JU5A 2KOKA 1SYRA 1ZMAA 2H30A 5ECNB 1NHYA 3DWVA 2HRFA 2B1LA 1G7OA 2X8GA 1W4VA 3GKNA 1N8JA 4FQUA 3GH6A 4L5OA 1B8XA 2MMZA 4K5SA 2LEGA 3LXTA 1PX6A 2EIOA 2LS5A 4ZL9A 1F6MC 5F8BA 5KN0A 4PXOA 2R0GA 2H1DA 3F6DA 3RHCA 1HD2A 5GSTA 3PR8A 4OO4A 2HXKA 1ERUA 3ZIVA 4PTSA 4GTUA 1T4YA 1GUKA 4V1Ag 2HT9A 2VLTA 3ZFLA 3ZVJA 1KNGA 1ZCPA 2HRAA 1Q98A 2LRTA 3LORA 2JL4A 1MDIA 4O5RA 3LSZA 2B5YA 2F51A 1ERWA 4Z2RA 3KH7A 2KP2A 5DCHA 5AIXA 1S3RA 4NAXA 3C71A 4IKHA 5G2ZA 2X8HA 2G2QA 4ISDA 4MA9A 4KDYA 5ECPB 3CBUA 1SL1B 1DUGA 1G6YA 4YKFA 1O81A 3UVHA 1ERVA 1TRUA 4QL9A 3PINA 3I69A 3EURA 4KH7A 3GMFA 2F8FA 1SL0B 4F0BA 3H8QA 3HVVA 5EL8A 3D21A 1JHBA 3P90A 3VI7A 2C8UA 5J9BA 1JZWA 1XXUA 3IK9A 3EU4A 1TTZA 2FA4A 1B48A 3TOUA 3KJYA 2R2JA 4LL4B 2K6VA 4ZIJA 3HKRA 6GSVA 4BL7B 4PQ1A 1GSQA 3ZYWA 5H5RA 2ES7A 4FIWA 4TXOA 1XZOA 1BX9A 3KTBA 5DAKB 3ZLPA 5IM9A 1DSBA 4OD7A 3GTUB 5CO3A 1GTUA 2H1GA 2Z9SA 4IP6A 2AB6A 1KEBA 5IMDA 3P7XA 1HNCA 1F37A 4DSSA 1SK0A 2P5RA 3HCZA 1GUHA 3GYKA 3D0ZA 4QL7A 1M3JA 3TKPA 2CVKA 2AJQB 4MP4A 4GRFA 1VF3A 3P2AA 3LEFA 2GTUA 1ZYPA 3ERWA 3IAM2 5A4WA 2NDOA 2L57A 5ID2A 1B4PA 3QFAC 3GSSA 1OKDA 3TKQA 4NMUA 1ZYEA 4YQUA 1M99A 3IE3A 2FCHA 4H86A 4XIHA 1KBNA 1PRXA 1J08A 4BWQA 3VLNA 5J3RA 3UBLA 1HNBA 1QFNA 5F06A 1B9XC 4HQSA 5GSSA 1K0CA 2LJKA 3VWWA 2B1KA 3DRNA 4E8EA 3GNJA 2C3NA 2VCVA 4CY6A 2N5AA 1Z6MA 1GUMA 1FOHA 3MWHA 1MDJA 4NXIA 3BBYA 1OC8A 4IQAA 2O85A 4EF0A 1JLVA 2L5LA 2VCWA 2R4VA 5G31A 1K0AA 3TDGA 1JZOA 2FY6A 3UEMA 2A2RA 1ZOFA 3F4SA 3KTLA 2YANA 3PPUA 3BJ5A 4KCEA 5CRWA 4EDZA 1AIUA 1AXDA 4K7IA 4OWYA 1Y25A 2JZSA 2LNTA 3GN3A 4JR6A 2B5XA 5JWQB 3J7Yk 4ZB6A 5AGYA 4EE0A 5DJMA 4MPGA 2B3SA 3NIVA 2LRNA 3VPTA 3QAWA 2WCIA 3ZMKA 2LQOA 2ON7A 3ZMLA 4WF5A 5JCGA 3DD3A 3IHQA 1K3YA 1TRVA 4HZ4A 4MH2A 1VF2A 3Q74A 1HYUA 2YJ7A 2VCXA 1U3AA 2IMKA 2WULA 3O3TA 5DBQA 1V40A 4BPYA 1TKDB 2JACA 4GCIA 3RPNA 1T4ZA 2M80A 3E0UA 3EINA 3Q6OA 3IRAA 2RM5A 2NPBA 1SJZA 3F63A 3L9SA 2CT6A 4EKZA 19GSA 4KW6A 1J0FA 1IYIA 3TKRA 2HZEB 1TU8A 2C1YA 3FR6A 22GSA 3GKKA 4FH8A 3IPZA 4PX1A 3TJBA 3CRUA 3TRPA 1E2YA 5A4VA 3W6GA 2RIIA 1G0TA 5FWGA 1SK1A 3IHGA 4ZILA 2EC4A 3MDKA 4O7HA 2YPMA 2L6CA 5IPHA 5DALA 1NM3A 1TK8B 12GSA 1ML6A 3ZVJD 5JCWA 1RW1A 2YCDA 2YP6A 1PGTA 5CREA 3FR3A 5ECLB 2X4AA 2YWIA 1SKRB 3DXBA 2I4AA 2CQ9A 5ECQB 2M46A 3GRXA 2MMAA 2V6OA 3CQFA 3IR4A 4RQRA 4G2EA 2BTOT 2CAQA 4EXJA 1FO5A 3TJJA 2MBSA 1B4QA 4EUYA 2JSYA 2V32A 1WJKA 4Z2UA 1AQVA 4ZBDA 2TIRA 4ZXGA 2DJ1A 1MD4A 5CRDA 5C04A 4HUAA 4JU5A 2IFQA 1F3BA 4IJIA 1PL2A 4YH2A 1QXHA 2B7JA 1A24A 3QAGA 1G7EA 4XS1A 2CAIA 2FA8A 2DBCA 4Q5RA 1R5AA 2MBTA 2YWMA 2F8AA 4LLRA 3L78A 1LBKA 4G9HA 2YNXA 1ON4A 5HR0A 4I5QA 3LQ7A 1XWBA 2A4HA 2HFDA 1A8LA 3A2VA 4GSSA 2MYGA 1QQ2A 2IJYA 5LCZA 2GT5A 3GL5A 3OR5A 1A0FA 5J9CA 5KN3A 1A2LA 2AYTA 2H0IA 4F9ZA 3GFKA 5EY6A 2I81A 1Z3EA 5J41A 4ID0A 3IDVA 2CA8A 5FHIA 5D96A 4ZL7A 2LJAA 2HRNA 2GGTA 1GSEA 1MEKA 2R0PA 1GTBA 4F2IA 5IIZA 2J9HA 2QC7A 3N9JA 1XFLA 2GS3A 3SBCA 2E7PA 2BJXA 3F8UA 1V9WA 4Q5FA 4EIPA 1FOVA 3M3MA 2B7KA 3LYPA 4K7NA 3RBTA 3VK9A 1QGVA 1DE2A 3KP9A 3CTGA 1NHOA 1EV4A 1TU7A 1BG5A 5IMCA 2MMNA 3VWUA 3D22A 1TK5B 4O92A 4N0ZA 1X5EA 4IELA 3BCIA 2L4CA 3RPPA 4HSCX 4O32A 1MTCA 2N5BA 5D9TA 1XWKA 2JADA 4KSOA 4RQXA 9GSSA 1K0BA 2GZYA 4ULXA 3GL3A 1SJIA 4G19A 4K1FA 4XS4A 6GSYA 2H73A 5EPFA 4IBPA 4KA0A 4AJ7A 1JLWA 2H19A 3UIWA 6GSTA 4G0LA 2PGTA 2C3TA 3G7JA 5CYYA 3QD9A 2VIMA 1EGOA 2HSMA 4MK3A 1Z7PA 4L5LA 2FUG2 4ILFA 4TXOB 5ECKB 2LV3A 4Q5NA 2X49A 2H0GA 4TKYA 4E8HA 2DJ2A 2V2GA 1FB0A 2L5OA 2WGRA 3BCKA 4JE1A 1GL8A 2YWOA 3H4KA 3TKSC 4DSSB 3DVXA 2DKIA 4X43A 1SU9A 1XW6A 1ZL9A 4ZB9A 4ECIA 4O5UA 4CHSA 2QSIA 4IVFA 3FY7A 4AGSA 1PN0A 1LU4A 4N10A 5JWOB 3WGDA 1R5PA 4OMVA 5ID2B 4POBA 3CSJA 2PERA 3QMXA 4MZBA 3R3EA 4BIKA 2OE0A 3DGQA 4MF6A 2FHEA 1IYHA 4KF9A 1W89A 2V6KA 3EVIA 1OKTA 2QA1A 3TUEA 4IN0A 2H01A 2B5EA 2OACA 3WT2A 4HEA2 3UJ1A 5LD0A 2HI7A 4WBRD 1PKWA 4LA1A 1EOGA 4ACSA 2I1UA 1ZGNA 4XCSA 3ZL5A 4AF2A 4KUNA 1K0NA 1XVQA 3ED3A 4J56E 2HZFA 5HFKA 4MH3A 4N30A 1SK2A 13GSA 5DJLA 1CQHA 3APOA 4HJ2A 2A4VA 2VM2A 3HA9A 2D2ZA 3UVTA 1PMTA 1A2MA 1TK0B 2YV9A 3EWLA 4G0IA 4TR0A 1I9DA 3D5JA 3TCOA 4KAEA 4J57E 2H6XA 1M2DA 3E3EA 5GAND 5BRTA 2PVOC 1N2AA 3F4TA 4NV2A 3EU3A 3R2QA 4G10A 1XVWA 2H8LA 5IPGA 1XWAA 2L59A 2VL3A 1EP8A 3C1SA 3W8JA 4N11A 3EE2A 3GIXA 3A3TA 1GULA 5IOXA 4MJCA 3CTFA 2TRXA 3M8NA 2L4QA 3FW2A 3FEUA 4KNDA 2QGVA 3HZ8A 2DMMA 1PN9A 4JBBA 1V57A 1T3BA 4I8BA 3KP8A 3GSTA 1G6WA 1M0UA 4K6XA 1BJXA 4POMA 4YAVA 1BEDA 3TGZA 2PWJA 2P0GA 3H93A 3WYWA 2GSSA 1OE8A 1THXA 2O87A 5ECRB 1H4OA 5DDLA 3LWAA 4ML1A 5ECIB 3TJFA 4MZCA 1OE7A 1T7PB 3FZ4A 2IWTA 2GSRA 3DEXA 3LG6A 2VM1A 2H1AA 5IQYA 3IBHA 5IOWA 3K8NA 4PQIA 3TRXA 2GQLA 4TR1A 1OC9B 2DJ3A 2R3XA 4MPFA 3HZ4A 4I97A 4WEYA 2CVDA 2J23A 1WIKA 2CV4A 4BVYA 3F3RA 3CXGA 5DALB 3DKSA 1C72A 4TN8A 2X64A 4PQHA 4YQMA 5ELGA 4ECJA 3MSZA 5CAXA 3ZZXA 1GLQA 2IL3A 3A2WA 3JCML 3GH9A 2KP1A 3C8EA 4XTSA 2KUCA 2H74A 1OVNA 3HXSA 1EEJA 1TRSA 3C7MA 1F9MA 3F6FA 1YF0A 4GQFA 3U6VA 1YKAA 4EC0A 2OBKA 4JRRA 3BD2A 1CQGA 2HSHA 3CMIA 3FZAA 2NVLA 4AJ6A 4D73A 3VWVA 2ZCTA 4MF7A 2RM6A 5F0GA 1GH2A 1YF1A 5F05A 2M72A 3RDWA 2IFQB 2RUFA 4ECBA 1VRSD 2E0QA 4WR5A 5ENUA 1VF1A 5HR1A 2E2MA 4OO5A 3G7IA 2FD3A 3EMXA 3VURA 4L0UA 2XHFA 3UL3A 10GSA 1TI3A 5CRGA 4ZBBA 4BA7A 1RQMA 4EL1A 1M3IA 5KN2A 2OE1A 2CX3A 4FYUA 1R4WA 1GTAA 1WE0A 3H1NA 3QOUA 3KH9A 3FZ5A 4F82A 2NBSA 1HNAA 3PGTA 2VL2A 1XWGA 5D73A 1HQOA 5ELAA 2GVPA 3D6IA 5BMUA 3APSA 4CW9A 1GSSA 3VPQA 3EC3A 2WFCA 2OA7A 1T8EB 1A23A 4I2TA 3RAZA 4F03A 1GSYA 2YJHA 1XPVA 4X0XA 4K2XA 3WD6A 2IMEA 1QUWA 4HI7A 1YEPA 4OCFA 7GSSA 4PUFC 4TXVA 3M1GA 4JEDA 4NV5A 1XW9A 2DLXA 2PVQA 5IMAA 3KXOA 3L9VA 2GQMA 1EV9A 4GQCA 1X9SB 4OFTA 2I9HA 2OADA 3TKSA 4HDEA 4HZ2A 4GXZA 4HS1A 1V58A 3HVNA 2C80A 2YZUA 1BQ7A 4XS4B 3FKFA 2YN1A 1XBSA 5F07A 1AAZA 1WOUA 4IW9A 1EWXA 5G30A 1SD8A 4EVMA 2WDUA 1XOBA 1FVJA 1X9MB 2I3YA 2REMA 4PGTA 5ECHB 4GSNA 3DIEA 5KN1A 3QR6A 1JZDA 2GQKA 1V2AA 4EO3A 2LSTA 5ABRA 2CZ2A 2KHPA 2X8CA 4ICYA 1X9WB 1FVKA 1OYJA 1ACVA 2H71A 2VCTA 2GSTA 3L4NA 1PL1A 2VOCA 20GSA 3CSIA 2GZPA 2R6KA 3U5RE 1K0OA 2PPTA 3L0HA 4BWSA 1X5DA 2K9FA 3IV4A 4FO5A 4USSA 2LRCA 2VLUA 3LYKA 1R26A 1B9YC 2FGXA 1YKCA 4NPBA 1TJDA 1PD21 1LJRA 3S9FA 4BVXA 2OKAA 4IJ3A 1F2EA 1GSFA 2P5QA 3LXZA 2MZCA 1PKZA 3UOMA 2XBQA 1UC7A 2FWHA 3HJPA 3VI5A 1OC3A 4HU9A 1GNWA 2DKHA 2V1MA 4FYCA 2DJ0A 3UAPA 4JZQA 3KD0A 5B8AA 1AQXA 2K8SA 3M9JA 4A5PA 1XW5A 2H66A 4IGJA 3A5WA 1K3OA 1J9BA 1XG8A 2VAFA 4MDCA 2X99A 3LW9A 3AY8A 2YV7A 4ZBAA 1QK8A 4HQZA 3MAKA 4MMMA 11GSA 5CNWA 4XS6A 1BAYA 1YJ6A 1FAAA 1PX7A 2O7KA 4NHZA 3HDCA 4ML6A 2IMFA 3KZQA 5AISA 5COHA 3HVXA 3MIXA 5DVBA 2GDRA 1U87A 4WXTA 1YZXA 5B8BA 3EMPA 3ZTLA 4OFNA 4L8EA 1Z5YE 2H0HA 3LGCA 1AW9A 2O8VB 5G1LA 2NTOA 2YOIA 1TDIA 2G0FA 5J5NA 2N5FA 1SENA 1XWCA 3ERGA 2A2SA 3EYTA 4HJMA 2H1BA 4YAPA 4K7OA 4RI7A 1WWJA 2IIYA 2BMXA 2LQQA 3GX8A 2HNLA 3N5OA 5KOWA 2B6MA 1H75A 3G9BA 5HFIA 2TRCP 4TR1B 3IXRA 1WP0A 4DSQA 3Q18A 3E9JB 5G5FA 3VWXA 1EGRA 1OAZA 2F9SA 1O7UA 4BVYB 4F0CA 4KGIA 2GZZA 1NSWA 4YQVA 2E2GA 3MNGA 3FK8A 5CP1A 3GUSA 3M9KA 3G7YA 2ALBA 2H75A 3NZNA 3QDNA 4XHMA 2RUEA 1GTIA 2CZ3A 4TRXA 2WS2A 2WB9A 2C0DA 1JZRA 3EPTA 4LMWA 2PUKC 3QFBC 1T00A 1PQNA 1S3CA 3IA1A 1BYEA 5D9XA 3TB2A 4CY8A 4I6XA 3UBKA 5HFGA 1PA3A 4D73B 5C00A 5A4UA 3GURA 4TVEA 3BOAA 1A2JA 1M9AA 2QKEA 3QCPA 4WBJA 4WKWA 2HYXA 3IOSA 3Q19A 2XBIA 4ZB8A 2PBJA 2ON5A 1TXXA 2YZHA 5B6MA 4ECCA 2GT6A 3A5IA 4MZWA 3A2XA 2HE3A 4K5RA 1V98A 5LNKe 2H6YA 5HQPA 4EIQA 3TRQA 2QA2A 2XC2A 1M9BA 1ZZYA 1E6BA 1U3IA 3I6AA 5FT3A 1FB6A 4OFMA 2WJUA 1AUCA 4DVCA 4WF4A 4CDOA 3ZREA 1GLPA 1Z6NA 1TOFA 5AIVA 4MCUA 2HRKA 4TW5A 1U88A 3APQA 2DIYA 1SD9A 1VF4A 3O6TA 2VD1A 2ZUPA 3FRCA 5AN1A 1ILOA 1SJ6A 2LNSA 4TR3A 5G1KA 2WZ9A 4V2LA 1FW1A 2VLVA 4P3YB 4DEJA 5KOXA 1XIYA 3KMNA 1O6JA 1WMJA 4MABA 3TKSE 2IPAA 5HR2A 1FG4A 4ZL8A 3ME8A 2FWGA 2DSAA 2C0EA 4NWYA 1AC1A 4K0GA 4MF5A 2DJJA 4GSTA 1O85A 4K2DA 2OBIA 1TP9A 4Z2TA 2F3MA 2XPDA 1YQ1A 2DIZA 1URMA 5D9WA 5INYA 4MJEA 4NHWA 3LJRA 4IP1A 2IMDA 4KB3A 3TJKA 3US3A 6GSSA 2GSQA 3PH9A 1GNEA 2KLXA 1I5GA 3MYDA 1PSQA 3CYNA 1EP7A 2JSZA 2VUPA 4DSRA 4XRDA 2UZ8A 1M7TA 4KDUA 5GZZB 4IQ1A 1Q4JA 1O8XA 2C4JA 3L9UA 3CRTA 2CX4A 1GP1A 3WGEA 3D4MA 2DMLA 1UVZA 4I2UA 3H79A 1EOHA 2R37A 4IS0A 1XCCA 4BL7A 3GA4A 3IK7A 3WT1A 3HJMA 1GSDA 2L6DA 2IMIA 1A8YA 5DAKA 3GKXA 5H5QA 1TW9A 3GV1A 2H70A 3KEBA 5ECMB 1U6TA 3GTUA 4MLYA 4G0KA 4FYBA 1ZYQB 2P31A 2HLSA 2LKUA 1YEXA 2A2PA 4EDYA 2PMTA 2VCZA 3HD5A 5DQSA 4X1UA 3FMWA 4BVXB 3IC4A 1S3AA 4YKGA 2H76A 5IMZA 3ME7A 4HOJA 8GSSA 2YWNA 3GX0A 4KSMA 1M2BA 1UN2A 1Z7RA 4K9ZA 4HU7A 1USBA 4V1Ap 3KM6A 4QQ7A 3KGKA 4V2MA 4Q5QA 4V2NA 5B7CA 4LL1B 2JZRA 1GWCA 5ECOB 4POLA 3GKMA 3IAS2 2VCQA 2MMOA 1OC9A 5G5EA 3TJGA 1GRXA 2K8VA 3WGXA 6GSXA 1S3DA 2WRTA 16GSA 3HVSA 5IMVA 4TOPA 1DBYA 4L0WA 1ST9A 2EIQA 3KCMA 4PNGA 3C1RA 3HYPA 3HJOA 3ISOA 5A5KA 1K3LA 2C0GA 1YY7A 1MDKA 5DQYA 2FNOA 3FZ9A 4IHUA 4O5QA 5ECSA 1QMVA 5IMFA 3IC8A 3NOFA 2V41A 4GF0A 3HHVA 2AUVA 5EVOA 3DYRA 3FYGA 1O73A 1WRYA 3QAVA 3LFLA 4KCAA 5B6NA 2IN3A 1ZYNA 3KIJA 5E4WA 5IO2A 2C0FA 2LTKA 2OE3A 1M2AA 5J4UA 3ZITA 4WETA 3ERFA 2VO4A 4MJAA 5IO0A 4MNNA 5E59A 4LMVA 3DMLA 2CVBA 1EEMA 2RLIA 1K0MA 4PURA 4GWRA 2FWFA 4Z7XA 4XRAA 2K18A 1YDKA 1K0DA 3TOTA 3I9V2 3I43A 4RUVA 4K0NA 4N0VA 1TI1A 1NW2A 1DE1A 3C73A 5CRHA 5L71A 1VGLA 3FHKA 3O76A 4PUAA 1JFUA 1KTEA 1O8WA 1ERTA 5D93A 6GSUA 3HY2A 1MD3A 4X4JA 2GLRA 2DC5A
chains in the Genus database with same CATH topology
3F0IA 4RI6A 1SL2B 5H5SA 6GSWA 2PN8A 1SKWB 4GLTA 2FWEA 2H6ZA 1UA5A 2HZEA 1SKSB 2DJKA 1RK4A 2EIRA 3GHAA 3QPMA 1ABAA 3ZRDA 18GSA 3ZIJA 3FR9A 5D9VA 3P8WA 4KDXA 3SWLA 3DVWA 5KEJA 14GSA 4POKA 2VL9A 4JR4A 1TRWA 1WPIA 4KX4A 17GSA 2AV4A 1F3AA 1THOA 5JCUA 1GSUA 1X0RA 2C3QA 5JWRB 2LJRA 3F3QA 1Z9HA 3ZFBA 1R7HA 2ZNMA 2R5GA 5DCGA 3W8SA 2PU9C 2LUSA 4J2FA 3V1WA 1EZKA 1Y6EA 3M0FA 2VL2C 4WR4A 4K8MA 3F4RA 4TR4A 3RHBA 3VFIA 2AAWA 2O89A 1XOAA 2HSYA 5HR3A 2XPEA 3CSHA 3F9UA 3J7Yb 3UMAA 4KE3A 4PNFA 4AJ8A 2VD0A 2R0CA 5D8IA 2JZTA 1SYXA 2H72A 3D4TA 1X5CA 1FHEA 1A0RP 2FLSA 1T1VA 2OJLA 2AHEA 4MJBA 5GAPD 3KMOA 3UARA 4OCEA 1AQWA 2JU5A 2KOKA 1SYRA 1ZMAA 2H30A 5ECNB 1NHYA 3DWVA 2HRFA 2B1LA 1G7OA 2X8GA 1W4VA 3GKNA 1N8JA 4FQUA 3GH6A 4L5OA 1B8XA 2MMZA 4K5SA 2LEGA 3LXTA 1PX6A 2EIOA 2LS5A 4ZL9A 1F6MC 5F8BA 5KN0A 4PXOA 2R0GA 2H1DA 3F6DA 3RHCA 1HD2A 5GSTA 3PR8A 4OO4A 2HXKA 1ERUA 3ZIVA 4PTSA 4GTUA 1T4YA 1GUKA 4V1Ag 2HT9A 2VLTA 3ZFLA 3ZVJA 1KNGA 1ZCPA 2HRAA 1Q98A 2LRTA 3LORA 2JL4A 1MDIA 4O5RA 3LSZA 2B5YA 2F51A 1ERWA 4Z2RA 3KH7A 2KP2A 5DCHA 5AIXA 4NAXA 3C71A 4IKHA 5G2ZA 2X8HA 2G2QA 4ISDA 4MA9A 4KDYA 5ECPB 3CBUA 1SL1B 1DUGA 1G6YA 4YKFA 1O81A 3UVHA 1ERVA 1TRUA 4QL9A 3PINA 3I69A 3EURA 4KH7A 3GMFA 2F8FA 1SL0B 4F0BA 3H8QA 3HVVA 5EL8A 3D21A 1JHBA 3P90A 3VI7A 2C8UA 5J9BA 1JZWA 1XXUA 3IK9A 3EU4A 1TTZA 2FA4A 1B48A 3TOUA 3KJYA 2R2JA 4LL4B 2K6VA 4ZIJA 3HKRA 6GSVA 4BL7B 4PQ1A 1GSQA 3ZYWA 5H5RA 2ES7A 4FIWA 4TXOA 1XZOA 1BX9A 3KTBA 5DAKB 3ZLPA 5IM9A 1DSBA 4OD7A 3GTUB 5CO3A 1GTUA 2H1GA 2Z9SA 4IP6A 2AB6A 1KEBA 5IMDA 3P7XA 1HNCA 1F37A 4DSSA 1SK0A 2P5RA 3HCZA 1GUHA 3GYKA 3D0ZA 4QL7A 3TKPA 2CVKA 2AJQB 4MP4A 4GRFA 1VF3A 3P2AA 3LEFA 2GTUA 1ZYPA 3ERWA 3IAM2 5A4WA 2NDOA 2L57A 5ID2A 1B4PA 3QFAC 3GSSA 1OKDA 3TKQA 4NMUA 1ZYEA 4YQUA 1M99A 3IE3A 2FCHA 4H86A 4XIHA 1KBNA 1PRXA 1J08A 4BWQA 3VLNA 5J3RA 3UBLA 1HNBA 1QFNA 5F06A 1B9XC 4HQSA 5GSSA 1K0CA 2LJKA 3VWWA 2B1KA 3DRNA 4E8EA 3GNJA 2C3NA 2VCVA 4CY6A 2N5AA 1Z6MA 1GUMA 1FOHA 3MWHA 1MDJA 4NXIA 3BBYA 1OC8A 4IQAA 2O85A 4EF0A 1JLVA 2L5LA 2VCWA 2R4VA 5G31A 1K0AA 3TDGA 1JZOA 2FY6A 3UEMA 2A2RA 1ZOFA 3F4SA 3KTLA 2YANA 3PPUA 3BJ5A 4KCEA 5CRWA 4EDZA 1AIUA 1AXDA 4K7IA 4OWYA 1Y25A 2JZSA 2LNTA 3GN3A 4JR6A 2B5XA 5JWQB 3J7Yk 4ZB6A 5AGYA 4EE0A 5DJMA 4MPGA 2B3SA 3NIVA 2LRNA 3VPTA 3QAWA 2WCIA 3ZMKA 2LQOA 2ON7A 3ZMLA 4WF5A 5JCGA 3DD3A 3IHQA 1K3YA 1TRVA 4HZ4A 4MH2A 1VF2A 3Q74A 1HYUA 2YJ7A 2VCXA 1U3AA 2IMKA 2WULA 3O3TA 5DBQA 1V40A 4BPYA 1TKDB 2JACA 4GCIA 3RPNA 1T4ZA 2M80A 3E0UA 3EINA 3Q6OA 3IRAA 2RM5A 2NPBA 1SJZA 3F63A 3L9SA 2CT6A 4EKZA 19GSA 4KW6A 1J0FA 1IYIA 3TKRA 2HZEB 1TU8A 2C1YA 3FR6A 22GSA 3GKKA 4FH8A 3IPZA 4PX1A 3TJBA 3CRUA 3TRPA 1E2YA 5A4VA 3W6GA 2RIIA 1G0TA 5FWGA 1SK1A 3IHGA 4ZILA 2EC4A 3MDKA 4O7HA 2YPMA 2L6CA 5IPHA 5DALA 1NM3A 1TK8B 12GSA 1ML6A 3ZVJD 5JCWA 1RW1A 2YCDA 2YP6A 1PGTA 5CREA 3FR3A 5ECLB 2X4AA 2YWIA 1SKRB 3DXBA 2I4AA 2CQ9A 5ECQB 2M46A 3GRXA 2MMAA 2V6OA 3IR4A 4RQRA 4G2EA 2BTOT 2CAQA 4EXJA 1FO5A 3TJJA 2MBSA 1B4QA 4EUYA 2JSYA 2V32A 1WJKA 4Z2UA 1AQVA 4ZBDA 2TIRA 4ZXGA 2DJ1A 1MD4A 5CRDA 5C04A 4HUAA 4JU5A 2IFQA 1F3BA 4IJIA 1PL2A 4YH2A 1QXHA 2B7JA 1A24A 3QAGA 1G7EA 4XS1A 2CAIA 2FA8A 2DBCA 4Q5RA 1R5AA 2MBTA 2YWMA 2F8AA 4LLRA 3L78A 1LBKA 4G9HA 2YNXA 1ON4A 5HR0A 4I5QA 3LQ7A 1XWBA 2A4HA 2HFDA 1A8LA 3A2VA 4GSSA 2MYGA 1QQ2A 2IJYA 5LCZA 2GT5A 3GL5A 3OR5A 1A0FA 5J9CA 5KN3A 1A2LA 2AYTA 2H0IA 4F9ZA 3GFKA 5EY6A 2I81A 1Z3EA 5J41A 4ID0A 3IDVA 2CA8A 5FHIA 5D96A 4ZL7A 2LJAA 2HRNA 2GGTA 1GSEA 1MEKA 2R0PA 1GTBA 4F2IA 5IIZA 2J9HA 2QC7A 3N9JA 1XFLA 2GS3A 3SBCA 2E7PA 2BJXA 3F8UA 1V9WA 4Q5FA 4EIPA 1FOVA 3M3MA 2B7KA 3LYPA 4K7NA 3RBTA 3VK9A 1QGVA 1DE2A 3KP9A 3CTGA 1NHOA 1EV4A 1TU7A 1BG5A 5IMCA 2MMNA 3VWUA 3D22A 1TK5B 4O92A 4N0ZA 1X5EA 4IELA 3BCIA 2L4CA 3RPPA 4O32A 1MTCA 2N5BA 5D9TA 1XWKA 2JADA 4KSOA 4RQXA 9GSSA 1K0BA 2GZYA 4ULXA 3GL3A 1SJIA 4G19A 4K1FA 4XS4A 6GSYA 2H73A 5EPFA 4IBPA 4KA0A 4AJ7A 1JLWA 2H19A 3UIWA 6GSTA 4G0LA 2PGTA 2C3TA 3G7JA 5CYYA 3QD9A 2VIMA 1EGOA 2HSMA 4MK3A 1Z7PA 4L5LA 2FUG2 4ILFA 4TXOB 5ECKB 2LV3A 4Q5NA 2X49A 2H0GA 4TKYA 4E8HA 2DJ2A 2V2GA 1FB0A 2L5OA 2WGRA 3BCKA 4JE1A 1GL8A 2YWOA 3H4KA 3TKSC 4DSSB 3DVXA 2DKIA 4X43A 1SU9A 1XW6A 1ZL9A 4ZB9A 4ECIA 4O5UA 4CHSA 2QSIA 4IVFA 3FY7A 4AGSA 1PN0A 1LU4A 4N10A 5JWOB 3WGDA 1R5PA 4OMVA 5ID2B 4POBA 3CSJA 2PERA 3QMXA 4MZBA 3R3EA 2OE0A 3DGQA 4MF6A 2FHEA 1IYHA 4KF9A 1W89A 2V6KA 3EVIA 1OKTA 2QA1A 3TUEA 4IN0A 2H01A 2B5EA 2OACA 3WT2A 4HEA2 3UJ1A 5LD0A 2HI7A 4WBRD 1PKWA 4LA1A 1EOGA 4ACSA 2I1UA 1ZGNA 4XCSA 3ZL5A 4AF2A 4KUNA 1K0NA 1XVQA 3ED3A 4J56E 2HZFA 5HFKA 4MH3A 4N30A 1SK2A 13GSA 5DJLA 1CQHA 3APOA 4HJ2A 2A4VA 2VM2A 3HA9A 2D2ZA 3UVTA 1PMTA 1A2MA 1TK0B 2YV9A 3EWLA 4G0IA 4TR0A 1I9DA 3D5JA 3TCOA 4KAEA 4J57E 2H6XA 1M2DA 3E3EA 5GAND 5BRTA 2PVOC 1N2AA 3F4TA 4NV2A 3EU3A 3R2QA 4G10A 1XVWA 2H8LA 5IPGA 1XWAA 2L59A 2VL3A 1EP8A 3C1SA 3W8JA 4N11A 3EE2A 3GIXA 3A3TA 1GULA 5IOXA 4MJCA 3CTFA 2TRXA 3M8NA 2L4QA 3FW2A 3FEUA 4KNDA 2QGVA 3HZ8A 2DMMA 1PN9A 4JBBA 1V57A 1T3BA 4I8BA 3KP8A 3GSTA 1G6WA 1M0UA 4K6XA 1BJXA 4POMA 4YAVA 1BEDA 3TGZA 2PWJA 2P0GA 3H93A 3WYWA 2GSSA 1OE8A 1THXA 2O87A 5ECRB 1H4OA 5DDLA 3LWAA 4ML1A 5ECIB 3TJFA 4MZCA 1OE7A 1T7PB 3FZ4A 2IWTA 2GSRA 3DEXA 3LG6A 2VM1A 2H1AA 5IQYA 3IBHA 5IOWA 3K8NA 4PQIA 3TRXA 2GQLA 4TR1A 1OC9B 2DJ3A 2R3XA 4MPFA 3HZ4A 4I97A 4WEYA 2CVDA 2J23A 1WIKA 2CV4A 4BVYA 3F3RA 3CXGA 5DALB 3DKSA 1C72A 4TN8A 2X64A 4PQHA 4YQMA 5ELGA 4ECJA 3MSZA 5CAXA 3ZZXA 1GLQA 2IL3A 3A2WA 3JCML 3GH9A 2KP1A 3C8EA 4XTSA 2KUCA 2H74A 1OVNA 3HXSA 1EEJA 1TRSA 3C7MA 1F9MA 3F6FA 1YF0A 4GQFA 3U6VA 1YKAA 4EC0A 2OBKA 4JRRA 3BD2A 1CQGA 2HSHA 3CMIA 3FZAA 2NVLA 4AJ6A 4D73A 3VWVA 2ZCTA 4MF7A 2RM6A 5F0GA 1GH2A 1YF1A 5F05A 2M72A 3RDWA 2IFQB 2RUFA 4ECBA 1VRSD 2E0QA 4WR5A 5ENUA 1VF1A 5HR1A 2E2MA 4OO5A 3G7IA 2FD3A 3EMXA 3VURA 4L0UA 2XHFA 3UL3A 10GSA 1TI3A 5CRGA 4ZBBA 4BA7A 1RQMA 4EL1A 5KN2A 2OE1A 2CX3A 4FYUA 1R4WA 1GTAA 1WE0A 3H1NA 3QOUA 3KH9A 3FZ5A 4F82A 2NBSA 1HNAA 3PGTA 2VL2A 1XWGA 5D73A 1HQOA 5ELAA 2GVPA 3D6IA 5BMUA 3APSA 4CW9A 1GSSA 3VPQA 3EC3A 2WFCA 2OA7A 1T8EB 1A23A 4I2TA 3RAZA 4F03A 1GSYA 2YJHA 1XPVA 4X0XA 4K2XA 3WD6A 2IMEA 1QUWA 4HI7A 1YEPA 4OCFA 7GSSA 4PUFC 4TXVA 3M1GA 4JEDA 4NV5A 1XW9A 2DLXA 2PVQA 5IMAA 3KXOA 3L9VA 2GQMA 1EV9A 4GQCA 1X9SB 4OFTA 2I9HA 2OADA 3TKSA 4HDEA 4HZ2A 4GXZA 4HS1A 1V58A 2C80A 2YZUA 1BQ7A 4XS4B 3FKFA 2YN1A 1XBSA 5F07A 1AAZA 1WOUA 4IW9A 1EWXA 5G30A 1SD8A 4EVMA 2WDUA 1XOBA 1FVJA 1X9MB 2I3YA 2REMA 4PGTA 5ECHB 4GSNA 3DIEA 5KN1A 3QR6A 1JZDA 2GQKA 1V2AA 4EO3A 2LSTA 5ABRA 2CZ2A 2KHPA 2X8CA 4ICYA 1X9WB 1FVKA 1OYJA 1ACVA 2H71A 2VCTA 2GSTA 3L4NA 1PL1A 2VOCA 20GSA 3CSIA 2GZPA 2R6KA 3U5RE 1K0OA 2PPTA 3L0HA 4BWSA 1X5DA 2K9FA 3IV4A 4FO5A 4USSA 2LRCA 2VLUA 3LYKA 1R26A 1B9YC 2FGXA 1YKCA 4NPBA 1TJDA 1PD21 1LJRA 3S9FA 4BVXA 2OKAA 4IJ3A 1F2EA 1GSFA 2P5QA 3LXZA 2MZCA 1PKZA 3UOMA 2XBQA 1UC7A 2FWHA 3HJPA 3VI5A 1OC3A 4HU9A 1GNWA 2DKHA 2V1MA 4FYCA 2DJ0A 3UAPA 4JZQA 3KD0A 5B8AA 1AQXA 2K8SA 3M9JA 4A5PA 1XW5A 2H66A 4IGJA 3A5WA 1K3OA 1J9BA 2VAFA 4MDCA 2X99A 3LW9A 3AY8A 2YV7A 4ZBAA 1QK8A 4HQZA 3MAKA 4MMMA 11GSA 5CNWA 4XS6A 1BAYA 1YJ6A 1FAAA 1PX7A 2O7KA 4NHZA 3HDCA 4ML6A 2IMFA 3KZQA 5AISA 5COHA 3HVXA 3MIXA 5DVBA 2GDRA 1U87A 4WXTA 1YZXA 5B8BA 3EMPA 3ZTLA 4OFNA 4L8EA 1Z5YE 2H0HA 3LGCA 1AW9A 2O8VB 5G1LA 2NTOA 2YOIA 1TDIA 2G0FA 5J5NA 2N5FA 1SENA 1XWCA 3ERGA 2A2SA 3EYTA 4HJMA 2H1BA 4YAPA 4K7OA 4RI7A 1WWJA 2IIYA 2BMXA 2LQQA 3GX8A 2HNLA 3N5OA 5KOWA 2B6MA 1H75A 3G9BA 5HFIA 2TRCP 4TR1B 3IXRA 1WP0A 4DSQA 3Q18A 3E9JB 5G5FA 3VWXA 1EGRA 1OAZA 2F9SA 1O7UA 4BVYB 4F0CA 4KGIA 2GZZA 1NSWA 4YQVA 2E2GA 3MNGA 3FK8A 5CP1A 3GUSA 3M9KA 3G7YA 2ALBA 2H75A 3NZNA 3QDNA 4XHMA 2RUEA 1GTIA 2CZ3A 4TRXA 2WS2A 2WB9A 2C0DA 1JZRA 3EPTA 4LMWA 2PUKC 3QFBC 1T00A 1PQNA 1S3CA 3IA1A 1BYEA 5D9XA 3TB2A 4CY8A 4I6XA 3UBKA 5HFGA 1PA3A 4D73B 5C00A 5A4UA 3GURA 4TVEA 3BOAA 1A2JA 1M9AA 2QKEA 3QCPA 4WBJA 4WKWA 2HYXA 3IOSA 3Q19A 2XBIA 4ZB8A 2PBJA 2ON5A 1TXXA 2YZHA 5B6MA 4ECCA 2GT6A 3A5IA 4MZWA 3A2XA 2HE3A 4K5RA 1V98A 5LNKe 2H6YA 5HQPA 4EIQA 3TRQA 2QA2A 2XC2A 1M9BA 1ZZYA 1E6BA 1U3IA 3I6AA 5FT3A 1FB6A 4OFMA 2WJUA 1AUCA 4DVCA 4WF4A 4CDOA 3ZREA 1GLPA 1Z6NA 1TOFA 5AIVA 4MCUA 2HRKA 4TW5A 1U88A 3APQA 2DIYA 1SD9A 1VF4A 3O6TA 2VD1A 2ZUPA 3FRCA 5AN1A 1ILOA 1SJ6A 2LNSA 4TR3A 5G1KA 2WZ9A 4V2LA 1FW1A 2VLVA 4P3YB 4DEJA 5KOXA 1XIYA 3KMNA 1O6JA 1WMJA 4MABA 3TKSE 2IPAA 5HR2A 1FG4A 4ZL8A 3ME8A 2FWGA 2DSAA 2C0EA 4NWYA 1AC1A 4K0GA 4MF5A 2DJJA 4GSTA 1O85A 4K2DA 2OBIA 1TP9A 4Z2TA 2F3MA 2XPDA 1YQ1A 2DIZA 1URMA 5D9WA 5INYA 4MJEA 4NHWA 3LJRA 4IP1A 2IMDA 4KB3A 3TJKA 3US3A 6GSSA 2GSQA 3PH9A 1GNEA 2KLXA 1I5GA 3MYDA 1PSQA 3CYNA 1EP7A 2JSZA 2VUPA 4DSRA 4XRDA 2UZ8A 1M7TA 4KDUA 5GZZB 4IQ1A 1Q4JA 1O8XA 2C4JA 3L9UA 3CRTA 2CX4A 1GP1A 3WGEA 3D4MA 2DMLA 1UVZA 4I2UA 3H79A 1EOHA 2R37A 4IS0A 1XCCA 4BL7A 3GA4A 3IK7A 3WT1A 3HJMA 1GSDA 2L6DA 2IMIA 1A8YA 5DAKA 3GKXA 5H5QA 1TW9A 3GV1A 2H70A 3KEBA 5ECMB 1U6TA 3GTUA 4MLYA 4G0KA 4FYBA 1ZYQB 2P31A 2HLSA 2LKUA 1YEXA 2A2PA 4EDYA 2PMTA 2VCZA 3HD5A 5DQSA 4X1UA 3FMWA 4BVXB 3IC4A 1S3AA 4YKGA 2H76A 5IMZA 3ME7A 4HOJA 8GSSA 2YWNA 3GX0A 4KSMA 1M2BA 1UN2A 1Z7RA 4K9ZA 4HU7A 1USBA 4V1Ap 3KM6A 4QQ7A 3KGKA 4V2MA 4Q5QA 4V2NA 5B7CA 4LL1B 2JZRA 1GWCA 5ECOB 4POLA 3GKMA 3IAS2 2VCQA 2MMOA 1OC9A 5G5EA 3TJGA 1GRXA 2K8VA 3WGXA 6GSXA 1S3DA 2WRTA 16GSA 3HVSA 5IMVA 4TOPA 1DBYA 4L0WA 1ST9A 2EIQA 3KCMA 4PNGA 3C1RA 3HYPA 3HJOA 3ISOA 5A5KA 1K3LA 2C0GA 1YY7A 1MDKA 5DQYA 2FNOA 3FZ9A 4IHUA 4O5QA 5ECSA 1QMVA 5IMFA 3IC8A 3NOFA 2V41A 4GF0A 3HHVA 2AUVA 5EVOA 3DYRA 3FYGA 1O73A 1WRYA 3QAVA 3LFLA 4KCAA 5B6NA 2IN3A 1ZYNA 3KIJA 5E4WA 5IO2A 2C0FA 2LTKA 2OE3A 1M2AA 5J4UA 3ZITA 4WETA 3ERFA 2VO4A 4MJAA 5IO0A 4MNNA 5E59A 4LMVA 3DMLA 2CVBA 1EEMA 2RLIA 1K0MA 4PURA 4GWRA 2FWFA 4Z7XA 4XRAA 2K18A 1YDKA 1K0DA 3TOTA 3I9V2 3I43A 4RUVA 4K0NA 4N0VA 1TI1A 1NW2A 1DE1A 3C73A 5CRHA 5L71A 1VGLA 3FHKA 3O76A 4PUAA 1JFUA 1KTEA 1O8WA 1ERTA 5D93A 6GSUA 3HY2A 1MD3A 4X4JA 2GLRA 2DC5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F0I A;  4RI6 A;  1SL2 B;  5H5S A;  6GSW A;  2PN8 A;  1SKW B;  4GLT A;  2FWE A;  2H6Z A;  1UA5 A;  2HZE A;  1SKS B;  2DJK A;  1RK4 A;  2EIR A;  3GHA A;  3QPM A;  1ABA A;  3ZRD A;  18GS A;  3ZIJ A;  3FR9 A;  5D9V A;  3P8W A;  4KDX A;  3SWL A;  3DVW A;  5KEJ A;  14GS A;  4POK A;  2VL9 A;  4JR4 A;  1TRW A;  1WPI A;  4KX4 A;  17GS A;  2AV4 A;  1F3A A;  1THO A;  5JCU A;  1GSU A;  1X0R A;  2C3Q A;  5JWR B;  2LJR A;  3F3Q A;  1Z9H A;  3ZFB A;  1R7H A;  2ZNM A;  2R5G A;  5DCG A;  3W8S A;  2PU9 C;  2LUS A;  4J2F A;  3V1W A;  1EZK A;  1Y6E A;  3M0F A;  2VL2 C;  4WR4 A;  4K8M A;  3F4R A;  4TR4 A;  3RHB A;  3VFI A;  2AAW A;  2O89 A;  1XOA A;  2HSY A;  5HR3 A;  2XPE A;  3CSH A;  3F9U A;  3J7Y b;  3UMA A;  4KE3 A;  4PNF A;  4AJ8 A;  2VD0 A;  5D8I A;  2JZT A;  1SYX A;  2H72 A;  3D4T A;  1X5C A;  1FHE A;  1A0R P;  2FLS A;  1T1V A;  2OJL A;  2AHE A;  4MJB A;  5GAP D;  3KMO A;  3UAR A;  4OCE A;  1AQW A;  2JU5 A;  2KOK A;  1SYR A;  1ZMA A;  2H30 A;  5ECN B;  1NHY A;  3DWV A;  2HRF A;  2B1L A;  1G7O A;  2X8G A;  1W4V A;  3GKN A;  1N8J A;  3GH6 A;  4L5O A;  1B8X A;  2MMZ A;  2LEG A;  3LXT A;  1PX6 A;  2EIO A;  2LS5 A;  4ZL9 A;  1F6M C;  5F8B A;  5KN0 A;  4PXO A;  3F6D A;  2H1D A;  3RHC A;  1HD2 A;  5GST A;  3PR8 A;  4OO4 A;  2HXK A;  1ERU A;  3ZIV A;  4GTU A;  1T4Y A;  1GUK A;  4V1A g;  2HT9 A;  2VLT A;  3ZFL A;  3ZVJ A;  1KNG A;  1ZCP A;  1Q98 A;  2LRT A;  3LOR A;  2JL4 A;  1MDI A;  4O5R A;  3LSZ A;  2B5Y A;  2F51 A;  1ERW A;  3KH7 A;  2KP2 A;  5DCH A;  5AIX A;  4NAX A;  3C71 A;  4IKH A;  5G2Z A;  2X8H A;  2G2Q A;  4ISD A;  4MA9 A;  4KDY A;  5ECP B;  3CBU A;  1SL1 B;  1DUG A;  1G6Y A;  1O81 A;  3UVH A;  1ERV A;  1TRU A;  4QL9 A;  3PIN A;  3I69 A;  3EUR A;  4KH7 A;  3GMF A;  2F8F A;  1SL0 B;  4F0B A;  3H8Q A;  3HVV A;  5EL8 A;  3D21 A;  1JHB A;  3P90 A;  3VI7 A;  2C8U A;  5J9B A;  1JZW A;  1XXU A;  3IK9 A;  3EU4 A;  1TTZ A;  2FA4 A;  1B48 A;  3TOU A;  3KJY A;  2R2J A;  4LL4 B;  2K6V A;  4ZIJ A;  3HKR A;  6GSV A;  4PQ1 A;  1GSQ A;  3ZYW A;  5H5R A;  2ES7 A;  4FIW A;  4TXO A;  1XZO A;  1BX9 A;  3KTB A;  5DAK B;  3ZLP A;  5IM9 A;  1DSB A;  4OD7 A;  3GTU B;  5CO3 A;  1GTU A;  2H1G A;  2Z9S A;  4IP6 A;  2AB6 A;  1KEB A;  5IMD A;  3P7X A;  1HNC A;  1F37 A;  4DSS A;  1SK0 A;  2P5R A;  3HCZ A;  1GUH A;  3GYK A;  3D0Z A;  4QL7 A;  3TKP A;  2CVK A;  2AJQ B;  4MP4 A;  4GRF A;  1VF3 A;  3P2A A;  3LEF A;  2GTU A;  3ERW A;  3IAM 2;  5A4W A;  2NDO A;  2L57 A;  5ID2 A;  1B4P A;  3QFA C;  3GSS A;  1OKD A;  3TKQ A;  4NMU A;  1ZYE A;  4YQU A;  1M99 A;  3IE3 A;  2FCH A;  4H86 A;  4XIH A;  1KBN A;  1PRX A;  1J08 A;  4BWQ A;  3VLN A;  5J3R A;  3UBL A;  1HNB A;  1QFN A;  5F06 A;  1B9X C;  4HQS A;  5GSS A;  1K0C A;  2LJK A;  3VWW A;  2B1K A;  3DRN A;  4E8E A;  3GNJ A;  2C3N A;  2VCV A;  2N5A A;  1Z6M A;  1GUM A;  3MWH A;  1MDJ A;  4NXI A;  3BBY A;  1OC8 A;  4IQA A;  2O85 A;  4EF0 A;  1JLV A;  2L5L A;  2VCW A;  2R4V A;  5G31 A;  1K0A A;  3TDG A;  1JZO A;  2FY6 A;  3UEM A;  2A2R A;  1ZOF A;  3F4S A;  3KTL A;  2YAN A;  3BJ5 A;  4KCE A;  5CRW A;  4EDZ A;  1AIU A;  1AXD A;  4K7I A;  4OWY A;  1Y25 A;  2JZS A;  2LNT A;  3GN3 A;  4JR6 A;  2B5X A;  5JWQ B;  3J7Y k;  4ZB6 A;  5AGY A;  4EE0 A;  5DJM A;  4MPG A;  2B3S A;  3NIV A;  2LRN A;  3VPT A;  3QAW A;  2WCI A;  3ZMK A;  2LQO A;  2ON7 A;  3ZML A;  4WF5 A;  5JCG A;  3DD3 A;  3IHQ A;  1K3Y A;  1TRV A;  4HZ4 A;  4MH2 A;  1VF2 A;  3Q74 A;  1HYU A;  2YJ7 A;  2VCX A;  1U3A A;  2IMK A;  2WUL A;  3O3T A;  5DBQ A;  1V40 A;  4BPY A;  1TKD B;  2JAC A;  4GCI A;  3RPN A;  1T4Z A;  2M80 A;  3E0U A;  3EIN A;  3Q6O A;  3IRA A;  2RM5 A;  2NPB A;  1SJZ A;  3F63 A;  3L9S A;  2CT6 A;  4EKZ A;  19GS A;  4KW6 A;  1J0F A;  1IYI A;  3TKR A;  2HZE B;  1TU8 A;  2C1Y A;  3FR6 A;  22GS A;  3GKK A;  4FH8 A;  3IPZ A;  4PX1 A;  3TJB A;  3CRU A;  3TRP A;  1E2Y A;  5A4V A;  3W6G A;  2RII A;  1G0T A;  5FWG A;  1SK1 A;  4ZIL A;  2EC4 A;  3MDK A;  4O7H A;  2YPM A;  2L6C A;  5IPH A;  5DAL A;  1NM3 A;  1TK8 B;  12GS A;  1ML6 A;  3ZVJ D;  5JCW A;  1RW1 A;  2YCD A;  2YP6 A;  1PGT A;  5CRE A;  3FR3 A;  5ECL B;  2YWI A;  1SKR B;  3DXB A;  2I4A A;  2CQ9 A;  5ECQ B;  2M46 A;  3GRX A;  2MMA A;  2V6O A;  3IR4 A;  4RQR A;  4G2E A;  2BTO T;  2CAQ A;  4EXJ A;  1FO5 A;  3TJJ A;  2MBS A;  1B4Q A;  4EUY A;  2JSY A;  2V32 A;  1WJK A;  1AQV A;  4ZBD A;  2TIR A;  4ZXG A;  2DJ1 A;  1MD4 A;  5CRD A;  5C04 A;  4HUA A;  4JU5 A;  2IFQ A;  1F3B A;  4IJI A;  1PL2 A;  4YH2 A;  1QXH A;  2B7J A;  1A24 A;  3QAG A;  1G7E A;  4XS1 A;  2CAI A;  2FA8 A;  2DBC A;  4Q5R A;  1R5A A;  2MBT A;  2YWM A;  2F8A A;  4LLR A;  3L78 A;  1LBK A;  4G9H A;  2YNX A;  1ON4 A;  5HR0 A;  4I5Q A;  3LQ7 A;  1XWB A;  2HFD A;  1A8L A;  3A2V A;  4GSS A;  2MYG A;  1QQ2 A;  2IJY A;  5LCZ A;  2GT5 A;  3GL5 A;  3OR5 A;  1A0F A;  5J9C A;  5KN3 A;  1A2L A;  2AYT A;  2H0I A;  4F9Z A;  3GFK A;  5EY6 A;  2I81 A;  1Z3E A;  5J41 A;  4ID0 A;  3IDV A;  2CA8 A;  5FHI A;  5D96 A;  4ZL7 A;  2LJA A;  2HRN A;  2GGT A;  1GSE A;  1MEK A;  1GTB A;  4F2I A;  5IIZ A;  2J9H A;  2QC7 A;  3N9J A;  1XFL A;  2GS3 A;  3SBC A;  2E7P A;  2BJX A;  3F8U A;  1V9W A;  4Q5F A;  1FOV A;  3M3M A;  2B7K A;  3LYP A;  4K7N A;  3RBT A;  3VK9 A;  1QGV A;  1DE2 A;  3KP9 A;  3CTG A;  1NHO A;  1EV4 A;  1TU7 A;  1BG5 A;  5IMC A;  2MMN A;  3VWU A;  3D22 A;  1TK5 B;  4O92 A;  4N0Z A;  1X5E A;  4IEL A;  3BCI A;  2L4C A;  3RPP A;  4O32 A;  1MTC A;  2N5B A;  5D9T A;  1XWK A;  2JAD A;  4KSO A;  4RQX A;  9GSS A;  1K0B A;  2GZY A;  4ULX A;  3GL3 A;  1SJI A;  4G19 A;  4K1F A;  4XS4 A;  6GSY A;  2H73 A;  5EPF A;  4IBP A;  4KA0 A;  4AJ7 A;  1JLW A;  2H19 A;  3UIW A;  6GST A;  2PGT A;  2C3T A;  3G7J A;  5CYY A;  3QD9 A;  2VIM A;  1EGO A;  4MK3 A;  1Z7P A;  4L5L A;  2FUG 2;  4ILF A;  4TXO B;  5ECK B;  2LV3 A;  4Q5N A;  2H0G A;  4TKY A;  4E8H A;  2DJ2 A;  2V2G A;  1FB0 A;  2L5O A;  2WGR A;  3BCK A;  4JE1 A;  1GL8 A;  2YWO A;  3H4K A;  3TKS C;  4DSS B;  3DVX A;  4X43 A;  1SU9 A;  1XW6 A;  1ZL9 A;  4ZB9 A;  4ECI A;  4CHS A;  2QSI A;  4IVF A;  3FY7 A;  4AGS A;  1LU4 A;  4N10 A;  5JWO B;  3WGD A;  1R5P A;  4OMV A;  5ID2 B;  4POB A;  3CSJ A;  2PER A;  3QMX A;  4MZB A;  2OE0 A;  3DGQ A;  4MF6 A;  2FHE A;  1IYH A;  1W89 A;  2V6K A;  3EVI A;  1OKT A;  3TUE A;  4IN0 A;  2H01 A;  2B5E A;  2OAC A;  3WT2 A;  4HEA 2;  3UJ1 A;  5LD0 A;  2HI7 A;  4WBR D;  1PKW A;  4LA1 A;  1EOG A;  4ACS A;  2I1U A;  1ZGN A;  4XCS A;  3ZL5 A;  4AF2 A;  4KUN A;  1K0N A;  1XVQ A;  3ED3 A;  4J56 E;  2HZF A;  5HFK A;  4MH3 A;  4N30 A;  1SK2 A;  13GS A;  5DJL A;  1CQH A;  3APO A;  4HJ2 A;  2A4V A;  2VM2 A;  3HA9 A;  2D2Z A;  3UVT A;  1PMT A;  1A2M A;  1TK0 B;  2YV9 A;  3EWL A;  4TR0 A;  1I9D A;  3D5J A;  3TCO A;  4KAE A;  4J57 E;  2H6X A;  1M2D A;  3E3E A;  5GAN D;  2PVO C;  1N2A A;  3F4T A;  4NV2 A;  3EU3 A;  3R2Q A;  4G10 A;  1XVW A;  2H8L A;  5IPG A;  1XWA A;  2L59 A;  2VL3 A;  1EP8 A;  3C1S A;  3W8J A;  4N11 A;  3EE2 A;  3GIX A;  3A3T A;  1GUL A;  5IOX A;  4MJC A;  3CTF A;  2TRX A;  3M8N A;  2L4Q A;  3FW2 A;  3FEU A;  4KND A;  2QGV A;  3HZ8 A;  2DMM A;  1PN9 A;  4JBB A;  1V57 A;  1T3B A;  4I8B A;  3KP8 A;  3GST A;  1G6W A;  1M0U A;  4K6X A;  1BJX A;  4POM A;  4YAV A;  1BED A;  3TGZ A;  2PWJ A;  2P0G A;  3H93 A;  3WYW A;  2GSS A;  1OE8 A;  1THX A;  2O87 A;  5ECR B;  1H4O A;  5DDL A;  3LWA A;  4ML1 A;  5ECI B;  3TJF A;  4MZC A;  1OE7 A;  1T7P B;  3FZ4 A;  2IWT A;  2GSR A;  3DEX A;  3LG6 A;  2VM1 A;  2H1A A;  5IQY A;  3IBH A;  5IOW A;  3K8N A;  4PQI A;  3TRX A;  2GQL A;  4TR1 A;  1OC9 B;  2DJ3 A;  2R3X A;  4MPF A;  3HZ4 A;  4I97 A;  4WEY A;  2CVD A;  2J23 A;  1WIK A;  2CV4 A;  4BVY A;  3F3R A;  3CXG A;  5DAL B;  3DKS A;  1C72 A;  4TN8 A;  2X64 A;  4PQH A;  4YQM A;  5ELG A;  4ECJ A;  3MSZ A;  5CAX A;  3ZZX A;  1GLQ A;  2IL3 A;  3A2W A;  3JCM L;  3GH9 A;  2KP1 A;  3C8E A;  4XTS A;  2KUC A;  2H74 A;  1OVN A;  3HXS A;  1EEJ A;  1TRS A;  3C7M A;  1F9M A;  3F6F A;  1YF0 A;  4GQF A;  3U6V A;  1YKA A;  4EC0 A;  2OBK A;  4JRR A;  3BD2 A;  1CQG A;  2HSH A;  3CMI A;  3FZA A;  2NVL A;  4AJ6 A;  4D73 A;  3VWV A;  2ZCT A;  4MF7 A;  2RM6 A;  5F0G A;  1GH2 A;  1YF1 A;  5F05 A;  2M72 A;  3RDW A;  2IFQ B;  2RUF A;  4ECB A;  1VRS D;  2E0Q A;  4WR5 A;  5ENU A;  1VF1 A;  5HR1 A;  2E2M A;  4OO5 A;  3G7I A;  2FD3 A;  3EMX A;  3VUR A;  4L0U A;  2XHF A;  3UL3 A;  10GS A;  1TI3 A;  5CRG A;  4ZBB A;  4BA7 A;  1RQM A;  4EL1 A;  5KN2 A;  2OE1 A;  2CX3 A;  4FYU A;  1R4W A;  1GTA A;  1WE0 A;  3H1N A;  3QOU A;  3KH9 A;  3FZ5 A;  4F82 A;  2NBS A;  1HNA A;  3PGT A;  2VL2 A;  1XWG A;  5D73 A;  1HQO A;  5ELA A;  2GVP A;  3D6I A;  3APS A;  4CW9 A;  1GSS A;  3VPQ A;  3EC3 A;  2WFC A;  2OA7 A;  1T8E B;  1A23 A;  4I2T A;  3RAZ A;  4F03 A;  1GSY A;  2YJH A;  1XPV A;  4X0X A;  3WD6 A;  2IME A;  1QUW A;  4HI7 A;  1YEP A;  4OCF A;  7GSS A;  4PUF C;  4TXV A;  3M1G A;  4JED A;  4NV5 A;  1XW9 A;  2DLX A;  2PVQ A;  5IMA A;  3KXO A;  3L9V A;  2GQM A;  1EV9 A;  4GQC A;  1X9S B;  4OFT A;  2I9H A;  2OAD A;  3TKS A;  4HDE A;  4HZ2 A;  4GXZ A;  4HS1 A;  1V58 A;  2C80 A;  2YZU A;  1BQ7 A;  4XS4 B;  3FKF A;  2YN1 A;  1XBS A;  5F07 A;  1AAZ A;  1WOU A;  4IW9 A;  1EWX A;  5G30 A;  1SD8 A;  4EVM A;  2WDU A;  1XOB A;  1FVJ A;  1X9M B;  2I3Y A;  2REM A;  4PGT A;  5ECH B;  4GSN A;  3DIE A;  5KN1 A;  3QR6 A;  1JZD A;  2GQK A;  1V2A A;  4EO3 A;  2LST A;  5ABR A;  2CZ2 A;  2KHP A;  2X8C A;  1X9W B;  1FVK A;  1OYJ A;  1ACV A;  2H71 A;  2VCT A;  2GST A;  3L4N A;  1PL1 A;  2VOC A;  20GS A;  3CSI A;  2GZP A;  2R6K A;  3U5R E;  1K0O A;  2PPT A;  3L0H A;  4BWS A;  1X5D A;  2K9F A;  3IV4 A;  4FO5 A;  2LRC A;  2VLU A;  3LYK A;  1R26 A;  1B9Y C;  2FGX A;  1YKC A;  4NPB A;  1TJD A;  1PD2 1;  1LJR A;  3S9F A;  4BVX A;  2OKA A;  4IJ3 A;  1F2E A;  1GSF A;  2P5Q A;  3LXZ A;  2MZC A;  1PKZ A;  3UOM A;  2XBQ A;  1UC7 A;  2FWH A;  3HJP A;  3VI5 A;  1OC3 A;  4HU9 A;  1GNW A;  2V1M A;  4FYC A;  2DJ0 A;  3UAP A;  4JZQ A;  3KD0 A;  5B8A A;  1AQX A;  2K8S A;  3M9J A;  1XW5 A;  2H66 A;  4IGJ A;  3A5W A;  1K3O A;  1J9B A;  2VAF A;  4MDC A;  2X99 A;  3AY8 A;  2YV7 A;  4ZBA A;  1QK8 A;  4HQZ A;  3MAK A;  4MMM A;  11GS A;  5CNW A;  4XS6 A;  1BAY A;  1YJ6 A;  1FAA A;  1PX7 A;  2O7K A;  4NHZ A;  3HDC A;  4ML6 A;  2IMF A;  3KZQ A;  5AIS A;  5COH A;  3HVX A;  5DVB A;  2GDR A;  1U87 A;  4WXT A;  1YZX A;  5B8B A;  3EMP A;  3ZTL A;  4OFN A;  4L8E A;  1Z5Y E;  2H0H A;  3LGC A;  1AW9 A;  2O8V B;  5G1L A;  2NTO A;  2YOI A;  1TDI A;  2G0F A;  5J5N A;  2N5F A;  1SEN A;  1XWC A;  3ERG A;  2A2S A;  3EYT A;  4HJM A;  2H1B A;  4YAP A;  4K7O A;  4RI7 A;  1WWJ A;  2IIY A;  2BMX A;  2LQQ A;  3GX8 A;  2HNL A;  3N5O A;  2B6M A;  1H75 A;  3G9B A;  5HFI A;  2TRC P;  4TR1 B;  3IXR A;  1WP0 A;  4DSQ A;  3Q18 A;  3E9J B;  5G5F A;  3VWX A;  1EGR A;  1OAZ A;  2F9S A;  1O7U A;  4F0C A;  4KGI A;  2GZZ A;  1NSW A;  4YQV A;  2E2G A;  3MNG A;  3FK8 A;  5CP1 A;  3GUS A;  3M9K A;  3G7Y A;  2ALB A;  2H75 A;  3NZN A;  3QDN A;  4XHM A;  2RUE A;  1GTI A;  2CZ3 A;  4TRX A;  2WS2 A;  2WB9 A;  2C0D A;  1JZR A;  4LMW A;  2PUK C;  3QFB C;  1T00 A;  1PQN A;  1S3C A;  3IA1 A;  1BYE A;  5D9X A;  3TB2 A;  4I6X A;  3UBK A;  5HFG A;  1PA3 A;  4D73 B;  5C00 A;  5A4U A;  3GUR A;  4TVE A;  3BOA A;  1A2J A;  1M9A A;  2QKE A;  3QCP A;  4WBJ A;  4WKW A;  2HYX A;  3IOS A;  3Q19 A;  2XBI A;  4ZB8 A;  2PBJ A;  2ON5 A;  1TXX A;  2YZH A;  5B6M A;  4ECC A;  2GT6 A;  4MZW A;  3A2X A;  2HE3 A;  1V98 A;  5LNK e;  2H6Y A;  5HQP A;  3TRQ A;  2XC2 A;  1M9B A;  1ZZY A;  1E6B A;  1U3I A;  3I6A A;  5FT3 A;  1FB6 A;  4OFM A;  2WJU A;  1AUC A;  4DVC A;  4WF4 A;  4CDO A;  3ZRE A;  1GLP A;  1Z6N A;  1TOF A;  5AIV A;  4MCU A;  4TW5 A;  1U88 A;  3APQ A;  2DIY A;  1SD9 A;  1VF4 A;  3O6T A;  2VD1 A;  2ZUP A;  3FRC A;  5AN1 A;  1ILO A;  1SJ6 A;  2LNS A;  4TR3 A;  5G1K A;  2WZ9 A;  4V2L A;  1FW1 A;  2VLV A;  4P3Y B;  4DEJ A;  1XIY A;  3KMN A;  1O6J A;  1WMJ A;  4MAB A;  3TKS E;  2IPA A;  5HR2 A;  1FG4 A;  4ZL8 A;  3ME8 A;  2FWG A;  2DSA A;  2C0E A;  4NWY A;  1AC1 A;  4K0G A;  4MF5 A;  2DJJ A;  4GST A;  1O85 A;  4K2D A;  2OBI A;  1TP9 A;  2F3M A;  2XPD A;  1YQ1 A;  2DIZ A;  1URM A;  5D9W A;  5INY A;  4MJE A;  4NHW A;  3LJR A;  4IP1 A;  2IMD A;  4KB3 A;  3TJK A;  3US3 A;  6GSS A;  2GSQ A;  3PH9 A;  1GNE A;  2KLX A;  1I5G A;  1PSQ A;  3CYN A;  1EP7 A;  2JSZ A;  2VUP A;  4DSR A;  4XRD A;  1M7T A;  4KDU A;  5GZZ B;  4IQ1 A;  1Q4J A;  1O8X A;  2C4J A;  3L9U A;  3CRT A;  2CX4 A;  1GP1 A;  3WGE A;  3D4M A;  2DML A;  1UVZ A;  4I2U A;  3H79 A;  1EOH A;  2R37 A;  4IS0 A;  1XCC A;  4BL7 A;  3GA4 A;  3IK7 A;  3WT1 A;  3HJM A;  1GSD A;  2L6D A;  2IMI A;  1A8Y A;  5DAK A;  3GKX A;  5H5Q A;  1TW9 A;  3GV1 A;  2H70 A;  3KEB A;  5ECM B;  1U6T A;  3GTU A;  4MLY A;  4FYB A;  1ZYQ B;  2P31 A;  2HLS A;  2LKU A;  1YEX A;  4EDY A;  2PMT A;  2VCZ A;  3HD5 A;  5DQS A;  4X1U A;  3IC4 A;  1S3A A;  2H76 A;  5IMZ A;  3ME7 A;  4HOJ A;  8GSS A;  2YWN A;  3GX0 A;  4KSM A;  1M2B A;  1UN2 A;  1Z7R A;  4K9Z A;  4HU7 A;  1USB A;  4V1A p;  3KM6 A;  4QQ7 A;  3KGK A;  4V2M A;  4Q5Q A;  4V2N A;  5B7C A;  4LL1 B;  2JZR A;  1GWC A;  5ECO B;  4POL A;  3GKM A;  3IAS 2;  2VCQ A;  2MMO A;  1OC9 A;  5G5E A;  3TJG A;  1GRX A;  2K8V A;  3WGX A;  6GSX A;  1S3D A;  2WRT A;  16GS A;  3HVS A;  5IMV A;  4TOP A;  1DBY A;  4L0W A;  1ST9 A;  2EIQ A;  3KCM A;  4PNG A;  3C1R A;  3HYP A;  3HJO A;  3ISO A;  5A5K A;  1K3L A;  2C0G A;  1YY7 A;  1MDK A;  5DQY A;  2FNO A;  3FZ9 A;  4IHU A;  5ECS A;  1QMV A;  5IMF A;  3NOF A;  2V41 A;  4GF0 A;  3HHV A;  2AUV A;  5EVO A;  3DYR A;  3FYG A;  1O73 A;  1WRY A;  3QAV A;  3LFL A;  4KCA A;  5B6N A;  2IN3 A;  3KIJ A;  5E4W A;  5IO2 A;  2C0F A;  2LTK A;  2OE3 A;  1M2A A;  5J4U A;  3ZIT A;  4WET A;  3ERF A;  2VO4 A;  4MJA A;  5IO0 A;  5E59 A;  4LMV A;  3DML A;  2CVB A;  1EEM A;  2RLI A;  1K0M A;  4PUR A;  4GWR A;  2FWF A;  4Z7X A;  4XRA A;  2K18 A;  1YDK A;  1K0D A;  3TOT A;  3I9V 2;  3I43 A;  4RUV A;  4K0N A;  4N0V A;  1TI1 A;  1NW2 A;  1DE1 A;  3C73 A;  5CRH A;  5L71 A;  1VGL A;  3FHK A;  3O76 A;  4PUA A;  1JFU A;  1KTE A;  1O8W A;  1ERT A;  5D93 A;  6GSU A;  3HY2 A;  1MD3 A;  2GLR A;  2DC5 A; 
#chains in the Genus database with same CATH topology
 3F0I A;  4RI6 A;  1SL2 B;  5H5S A;  6GSW A;  2PN8 A;  1SKW B;  4GLT A;  2FWE A;  2H6Z A;  1UA5 A;  2HZE A;  1SKS B;  2DJK A;  1RK4 A;  2EIR A;  3GHA A;  3QPM A;  1ABA A;  3ZRD A;  18GS A;  3ZIJ A;  3FR9 A;  5D9V A;  3P8W A;  4KDX A;  3SWL A;  3DVW A;  5KEJ A;  14GS A;  4POK A;  2VL9 A;  4JR4 A;  1TRW A;  1WPI A;  4KX4 A;  1PFO A;  17GS A;  2AV4 A;  1F3A A;  1THO A;  5JCU A;  1GSU A;  1X0R A;  2C3Q A;  5JWR B;  2LJR A;  3F3Q A;  1Z9H A;  3ZFB A;  1R7H A;  2ZNM A;  2R5G A;  5DCG A;  3W8S A;  2PU9 C;  2LUS A;  4J2F A;  3V1W A;  1EZK A;  1Y6E A;  3M0F A;  2VL2 C;  4WR4 A;  4K8M A;  3F4R A;  4TR4 A;  3RHB A;  3VFI A;  2AAW A;  2O89 A;  1XOA A;  2HSY A;  5HR3 A;  2XPE A;  3CSH A;  3F9U A;  3J7Y b;  3UMA A;  4KE3 A;  4PNF A;  4AJ8 A;  2VD0 A;  2R0C A;  5D8I A;  2JZT A;  1SYX A;  2H72 A;  3D4T A;  1X5C A;  1FHE A;  1A0R P;  2FLS A;  1T1V A;  2OJL A;  2AHE A;  4MJB A;  5GAP D;  3KMO A;  3UAR A;  4OCE A;  1AQW A;  2JU5 A;  2KOK A;  1SYR A;  1ZMA A;  2H30 A;  5ECN B;  1NHY A;  3DWV A;  2HRF A;  2B1L A;  1G7O A;  2X8G A;  1W4V A;  3GKN A;  1N8J A;  4FQU A;  3GH6 A;  4L5O A;  1B8X A;  2MMZ A;  4K5S A;  2LEG A;  3LXT A;  1PX6 A;  2EIO A;  2LS5 A;  4ZL9 A;  1F6M C;  5F8B A;  5KN0 A;  4PXO A;  2R0G A;  2H1D A;  3F6D A;  3RHC A;  1HD2 A;  5GST A;  3PR8 A;  4OO4 A;  2HXK A;  1ERU A;  3ZIV A;  4PTS A;  4GTU A;  1T4Y A;  1GUK A;  4V1A g;  2HT9 A;  2VLT A;  3ZFL A;  3ZVJ A;  1KNG A;  1ZCP A;  2HRA A;  1Q98 A;  2LRT A;  3LOR A;  2JL4 A;  1MDI A;  4O5R A;  3LSZ A;  2B5Y A;  2F51 A;  1ERW A;  4Z2R A;  3KH7 A;  2KP2 A;  5DCH A;  5AIX A;  1S3R A;  4NAX A;  3C71 A;  4IKH A;  5G2Z A;  2X8H A;  2G2Q A;  4ISD A;  4MA9 A;  4KDY A;  5ECP B;  3CBU A;  1SL1 B;  1DUG A;  1G6Y A;  4YKF A;  1O81 A;  3UVH A;  1ERV A;  1TRU A;  4QL9 A;  3PIN A;  3I69 A;  3EUR A;  4KH7 A;  3GMF A;  2F8F A;  1SL0 B;  4F0B A;  3H8Q A;  3HVV A;  5EL8 A;  3D21 A;  1JHB A;  3P90 A;  3VI7 A;  2C8U A;  5J9B A;  1JZW A;  1XXU A;  3IK9 A;  3EU4 A;  1TTZ A;  2FA4 A;  1B48 A;  3TOU A;  3KJY A;  2R2J A;  4LL4 B;  2K6V A;  4ZIJ A;  3HKR A;  6GSV A;  4BL7 B;  4PQ1 A;  1GSQ A;  3ZYW A;  5H5R A;  2ES7 A;  4FIW A;  4TXO A;  1XZO A;  1BX9 A;  3KTB A;  5DAK B;  3ZLP A;  5IM9 A;  1DSB A;  4OD7 A;  3GTU B;  5CO3 A;  1GTU A;  2H1G A;  2Z9S A;  4IP6 A;  2AB6 A;  1KEB A;  5IMD A;  3P7X A;  1HNC A;  1F37 A;  4DSS A;  1SK0 A;  2P5R A;  3HCZ A;  1GUH A;  3GYK A;  3D0Z A;  4QL7 A;  1M3J A;  3TKP A;  2CVK A;  2AJQ B;  4MP4 A;  4GRF A;  1VF3 A;  3P2A A;  3LEF A;  2GTU A;  1ZYP A;  3ERW A;  3IAM 2;  5A4W A;  2NDO A;  2L57 A;  5ID2 A;  1B4P A;  3QFA C;  3GSS A;  1OKD A;  3TKQ A;  4NMU A;  1ZYE A;  4YQU A;  1M99 A;  3IE3 A;  2FCH A;  4H86 A;  4XIH A;  1KBN A;  1PRX A;  1J08 A;  4BWQ A;  3VLN A;  5J3R A;  3UBL A;  1HNB A;  1QFN A;  5F06 A;  1B9X C;  4HQS A;  5GSS A;  1K0C A;  2LJK A;  3VWW A;  2B1K A;  3DRN A;  4E8E A;  3GNJ A;  2C3N A;  2VCV A;  4CY6 A;  2N5A A;  1Z6M A;  1GUM A;  1FOH A;  3MWH A;  1MDJ A;  4NXI A;  3BBY A;  1OC8 A;  4IQA A;  2O85 A;  4EF0 A;  1JLV A;  2L5L A;  2VCW A;  2R4V A;  5G31 A;  1K0A A;  3TDG A;  1JZO A;  2FY6 A;  3UEM A;  2A2R A;  1ZOF A;  3F4S A;  3KTL A;  2YAN A;  3PPU A;  3BJ5 A;  4KCE A;  5CRW A;  4EDZ A;  1AIU A;  1AXD A;  4K7I A;  4OWY A;  1Y25 A;  2JZS A;  2LNT A;  3GN3 A;  4JR6 A;  2B5X A;  5JWQ B;  3J7Y k;  4ZB6 A;  5AGY A;  4EE0 A;  5DJM A;  4MPG A;  2B3S A;  3NIV A;  2LRN A;  3VPT A;  3QAW A;  2WCI A;  3ZMK A;  2LQO A;  2ON7 A;  3ZML A;  4WF5 A;  5JCG A;  3DD3 A;  3IHQ A;  1K3Y A;  1TRV A;  4HZ4 A;  4MH2 A;  1VF2 A;  3Q74 A;  1HYU A;  2YJ7 A;  2VCX A;  1U3A A;  2IMK A;  2WUL A;  3O3T A;  5DBQ A;  1V40 A;  4BPY A;  1TKD B;  2JAC A;  4GCI A;  3RPN A;  1T4Z A;  2M80 A;  3E0U A;  3EIN A;  3Q6O A;  3IRA A;  2RM5 A;  2NPB A;  1SJZ A;  3F63 A;  3L9S A;  2CT6 A;  4EKZ A;  19GS A;  4KW6 A;  1J0F A;  1IYI A;  3TKR A;  2HZE B;  1TU8 A;  2C1Y A;  3FR6 A;  22GS A;  3GKK A;  4FH8 A;  3IPZ A;  4PX1 A;  3TJB A;  3CRU A;  3TRP A;  1E2Y A;  5A4V A;  3W6G A;  2RII A;  1G0T A;  5FWG A;  1SK1 A;  3IHG A;  4ZIL A;  2EC4 A;  3MDK A;  4O7H A;  2YPM A;  2L6C A;  5IPH A;  5DAL A;  1NM3 A;  1TK8 B;  12GS A;  1ML6 A;  3ZVJ D;  5JCW A;  1RW1 A;  2YCD A;  2YP6 A;  1PGT A;  5CRE A;  3FR3 A;  5ECL B;  2X4A A;  2YWI A;  1SKR B;  3DXB A;  2I4A A;  2CQ9 A;  5ECQ B;  2M46 A;  3GRX A;  2MMA A;  2V6O A;  3CQF A;  3IR4 A;  4RQR A;  4G2E A;  2BTO T;  2CAQ A;  4EXJ A;  1FO5 A;  3TJJ A;  2MBS A;  1B4Q A;  4EUY A;  2JSY A;  2V32 A;  1WJK A;  4Z2U A;  1AQV A;  4ZBD A;  2TIR A;  4ZXG A;  2DJ1 A;  1MD4 A;  5CRD A;  5C04 A;  4HUA A;  4JU5 A;  2IFQ A;  1F3B A;  4IJI A;  1PL2 A;  4YH2 A;  1QXH A;  2B7J A;  1A24 A;  3QAG A;  1G7E A;  4XS1 A;  2CAI A;  2FA8 A;  2DBC A;  4Q5R A;  1R5A A;  2MBT A;  2YWM A;  2F8A A;  4LLR A;  3L78 A;  1LBK A;  4G9H A;  2YNX A;  1ON4 A;  5HR0 A;  4I5Q A;  3LQ7 A;  1XWB A;  2A4H A;  2HFD A;  1A8L A;  3A2V A;  4GSS A;  2MYG A;  1QQ2 A;  2IJY A;  5LCZ A;  2GT5 A;  3GL5 A;  3OR5 A;  1A0F A;  5J9C A;  5KN3 A;  1A2L A;  2AYT A;  2H0I A;  4F9Z A;  3GFK A;  5EY6 A;  2I81 A;  1Z3E A;  5J41 A;  4ID0 A;  3IDV A;  2CA8 A;  5FHI A;  5D96 A;  4ZL7 A;  2LJA A;  2HRN A;  2GGT A;  1GSE A;  1MEK A;  2R0P A;  1GTB A;  4F2I A;  5IIZ A;  2J9H A;  2QC7 A;  3N9J A;  1XFL A;  2GS3 A;  3SBC A;  2E7P A;  2BJX A;  3F8U A;  1V9W A;  4Q5F A;  4EIP A;  1FOV A;  3M3M A;  2B7K A;  3LYP A;  4K7N A;  3RBT A;  3VK9 A;  1QGV A;  1DE2 A;  3KP9 A;  3CTG A;  1NHO A;  1EV4 A;  1TU7 A;  1BG5 A;  5IMC A;  2MMN A;  3VWU A;  3D22 A;  1TK5 B;  4O92 A;  4N0Z A;  1X5E A;  4IEL A;  3BCI A;  2L4C A;  3RPP A;  4HSC X;  4O32 A;  1MTC A;  2N5B A;  5D9T A;  1XWK A;  2JAD A;  4KSO A;  4RQX A;  9GSS A;  1K0B A;  2GZY A;  4ULX A;  3GL3 A;  1SJI A;  4G19 A;  4K1F A;  4XS4 A;  6GSY A;  2H73 A;  5EPF A;  4IBP A;  4KA0 A;  4AJ7 A;  1JLW A;  2H19 A;  3UIW A;  6GST A;  4G0L A;  2PGT A;  2C3T A;  3G7J A;  5CYY A;  3QD9 A;  2VIM A;  1EGO A;  2HSM A;  4MK3 A;  1Z7P A;  4L5L A;  2FUG 2;  4ILF A;  4TXO B;  5ECK B;  2LV3 A;  4Q5N A;  2X49 A;  2H0G A;  4TKY A;  4E8H A;  2DJ2 A;  2V2G A;  1FB0 A;  2L5O A;  2WGR A;  3BCK A;  4JE1 A;  1GL8 A;  2YWO A;  3H4K A;  3TKS C;  4DSS B;  3DVX A;  2DKI A;  4X43 A;  1SU9 A;  1XW6 A;  1ZL9 A;  4ZB9 A;  4ECI A;  4O5U A;  4CHS A;  2QSI A;  4IVF A;  3FY7 A;  4AGS A;  1PN0 A;  1LU4 A;  4N10 A;  5JWO B;  3WGD A;  1R5P A;  4OMV A;  5ID2 B;  4POB A;  3CSJ A;  2PER A;  3QMX A;  4MZB A;  3R3E A;  4BIK A;  2OE0 A;  3DGQ A;  4MF6 A;  2FHE A;  1IYH A;  4KF9 A;  1W89 A;  2V6K A;  3EVI A;  1OKT A;  2QA1 A;  3TUE A;  4IN0 A;  2H01 A;  2B5E A;  2OAC A;  3WT2 A;  4HEA 2;  3UJ1 A;  5LD0 A;  2HI7 A;  4WBR D;  1PKW A;  4LA1 A;  1EOG A;  4ACS A;  2I1U A;  1ZGN A;  4XCS A;  3ZL5 A;  4AF2 A;  4KUN A;  1K0N A;  1XVQ A;  3ED3 A;  4J56 E;  2HZF A;  5HFK A;  4MH3 A;  4N30 A;  1SK2 A;  13GS A;  5DJL A;  1CQH A;  3APO A;  4HJ2 A;  2A4V A;  2VM2 A;  3HA9 A;  2D2Z A;  3UVT A;  1PMT A;  1A2M A;  1TK0 B;  2YV9 A;  3EWL A;  4G0I A;  4TR0 A;  1I9D A;  3D5J A;  3TCO A;  4KAE A;  4J57 E;  2H6X A;  1M2D A;  3E3E A;  5GAN D;  5BRT A;  2PVO C;  1N2A A;  3F4T A;  4NV2 A;  3EU3 A;  3R2Q A;  4G10 A;  1XVW A;  2H8L A;  5IPG A;  1XWA A;  2L59 A;  2VL3 A;  1EP8 A;  3C1S A;  3W8J A;  4N11 A;  3EE2 A;  3GIX A;  3A3T A;  1GUL A;  5IOX A;  4MJC A;  3CTF A;  2TRX A;  3M8N A;  2L4Q A;  3FW2 A;  3FEU A;  4KND A;  2QGV A;  3HZ8 A;  2DMM A;  1PN9 A;  4JBB A;  1V57 A;  1T3B A;  4I8B A;  3KP8 A;  3GST A;  1G6W A;  1M0U A;  4K6X A;  1BJX A;  4POM A;  4YAV A;  1BED A;  3TGZ A;  2PWJ A;  2P0G A;  3H93 A;  3WYW A;  2GSS A;  1OE8 A;  1THX A;  2O87 A;  5ECR B;  1H4O A;  5DDL A;  3LWA A;  4ML1 A;  5ECI B;  3TJF A;  4MZC A;  1OE7 A;  1T7P B;  3FZ4 A;  2IWT A;  2GSR A;  3DEX A;  3LG6 A;  2VM1 A;  2H1A A;  5IQY A;  3IBH A;  5IOW A;  3K8N A;  4PQI A;  3TRX A;  2GQL A;  4TR1 A;  1OC9 B;  2DJ3 A;  2R3X A;  4MPF A;  3HZ4 A;  4I97 A;  4WEY A;  2CVD A;  2J23 A;  1WIK A;  2CV4 A;  4BVY A;  3F3R A;  3CXG A;  5DAL B;  3DKS A;  1C72 A;  4TN8 A;  2X64 A;  4PQH A;  4YQM A;  5ELG A;  4ECJ A;  3MSZ A;  5CAX A;  3ZZX A;  1GLQ A;  2IL3 A;  3A2W A;  3JCM L;  3GH9 A;  2KP1 A;  3C8E A;  4XTS A;  2KUC A;  2H74 A;  1OVN A;  3HXS A;  1EEJ A;  1TRS A;  3C7M A;  1F9M A;  3F6F A;  1YF0 A;  4GQF A;  3U6V A;  1YKA A;  4EC0 A;  2OBK A;  4JRR A;  3BD2 A;  1CQG A;  2HSH A;  3CMI A;  3FZA A;  2NVL A;  4AJ6 A;  4D73 A;  3VWV A;  2ZCT A;  4MF7 A;  2RM6 A;  5F0G A;  1GH2 A;  1YF1 A;  5F05 A;  2M72 A;  3RDW A;  2IFQ B;  2RUF A;  4ECB A;  1VRS D;  2E0Q A;  4WR5 A;  5ENU A;  1VF1 A;  5HR1 A;  2E2M A;  4OO5 A;  3G7I A;  2FD3 A;  3EMX A;  3VUR A;  4L0U A;  2XHF A;  3UL3 A;  10GS A;  1TI3 A;  5CRG A;  4ZBB A;  4BA7 A;  1RQM A;  4EL1 A;  1M3I A;  5KN2 A;  2OE1 A;  2CX3 A;  4FYU A;  1R4W A;  1GTA A;  1WE0 A;  3H1N A;  3QOU A;  3KH9 A;  3FZ5 A;  4F82 A;  2NBS A;  1HNA A;  3PGT A;  2VL2 A;  1XWG A;  5D73 A;  1HQO A;  5ELA A;  2GVP A;  3D6I A;  5BMU A;  3APS A;  4CW9 A;  1GSS A;  3VPQ A;  3EC3 A;  2WFC A;  2OA7 A;  1T8E B;  1A23 A;  4I2T A;  3RAZ A;  4F03 A;  1GSY A;  2YJH A;  1XPV A;  4X0X A;  4K2X A;  3WD6 A;  2IME A;  1QUW A;  4HI7 A;  1YEP A;  4OCF A;  7GSS A;  4PUF C;  4TXV A;  3M1G A;  4JED A;  4NV5 A;  1XW9 A;  2DLX A;  2PVQ A;  5IMA A;  3KXO A;  3L9V A;  2GQM A;  1EV9 A;  4GQC A;  1X9S B;  4OFT A;  2I9H A;  2OAD A;  3TKS A;  4HDE A;  4HZ2 A;  4GXZ A;  4HS1 A;  1V58 A;  3HVN A;  2C80 A;  2YZU A;  1BQ7 A;  4XS4 B;  3FKF A;  2YN1 A;  1XBS A;  5F07 A;  1AAZ A;  1WOU A;  4IW9 A;  1EWX A;  5G30 A;  1SD8 A;  4EVM A;  2WDU A;  1XOB A;  1FVJ A;  1X9M B;  2I3Y A;  2REM A;  4PGT A;  5ECH B;  4GSN A;  3DIE A;  5KN1 A;  3QR6 A;  1JZD A;  2GQK A;  1V2A A;  4EO3 A;  2LST A;  5ABR A;  2CZ2 A;  2KHP A;  2X8C A;  4ICY A;  1X9W B;  1FVK A;  1OYJ A;  1ACV A;  2H71 A;  2VCT A;  2GST A;  3L4N A;  1PL1 A;  2VOC A;  20GS A;  3CSI A;  2GZP A;  2R6K A;  3U5R E;  1K0O A;  2PPT A;  3L0H A;  4BWS A;  1X5D A;  2K9F A;  3IV4 A;  4FO5 A;  4USS A;  2LRC A;  2VLU A;  3LYK A;  1R26 A;  1B9Y C;  2FGX A;  1YKC A;  4NPB A;  1TJD A;  1PD2 1;  1LJR A;  3S9F A;  4BVX A;  2OKA A;  4IJ3 A;  1F2E A;  1GSF A;  2P5Q A;  3LXZ A;  2MZC A;  1PKZ A;  3UOM A;  2XBQ A;  1UC7 A;  2FWH A;  3HJP A;  3VI5 A;  1OC3 A;  4HU9 A;  1GNW A;  2DKH A;  2V1M A;  4FYC A;  2DJ0 A;  3UAP A;  4JZQ A;  3KD0 A;  5B8A A;  1AQX A;  2K8S A;  3M9J A;  4A5P A;  1XW5 A;  2H66 A;  4IGJ A;  3A5W A;  1K3O A;  1J9B A;  1XG8 A;  2VAF A;  4MDC A;  2X99 A;  3LW9 A;  3AY8 A;  2YV7 A;  4ZBA A;  1QK8 A;  4HQZ A;  3MAK A;  4MMM A;  11GS A;  5CNW A;  4XS6 A;  1BAY A;  1YJ6 A;  1FAA A;  1PX7 A;  2O7K A;  4NHZ A;  3HDC A;  4ML6 A;  2IMF A;  3KZQ A;  5AIS A;  5COH A;  3HVX A;  3MIX A;  5DVB A;  2GDR A;  1U87 A;  4WXT A;  1YZX A;  5B8B A;  3EMP A;  3ZTL A;  4OFN A;  4L8E A;  1Z5Y E;  2H0H A;  3LGC A;  1AW9 A;  2O8V B;  5G1L A;  2NTO A;  2YOI A;  1TDI A;  2G0F A;  5J5N A;  2N5F A;  1SEN A;  1XWC A;  3ERG A;  2A2S A;  3EYT A;  4HJM A;  2H1B A;  4YAP A;  4K7O A;  4RI7 A;  1WWJ A;  2IIY A;  2BMX A;  2LQQ A;  3GX8 A;  2HNL A;  3N5O A;  5KOW A;  2B6M A;  1H75 A;  3G9B A;  5HFI A;  2TRC P;  4TR1 B;  3IXR A;  1WP0 A;  4DSQ A;  3Q18 A;  3E9J B;  5G5F A;  3VWX A;  1EGR A;  1OAZ A;  2F9S A;  1O7U A;  4BVY B;  4F0C A;  4KGI A;  2GZZ A;  1NSW A;  4YQV A;  2E2G A;  3MNG A;  3FK8 A;  5CP1 A;  3GUS A;  3M9K A;  3G7Y A;  2ALB A;  2H75 A;  3NZN A;  3QDN A;  4XHM A;  2RUE A;  1GTI A;  2CZ3 A;  4TRX A;  2WS2 A;  2WB9 A;  2C0D A;  1JZR A;  3EPT A;  4LMW A;  2PUK C;  3QFB C;  1T00 A;  1PQN A;  1S3C A;  3IA1 A;  1BYE A;  5D9X A;  3TB2 A;  4CY8 A;  4I6X A;  3UBK A;  5HFG A;  1PA3 A;  4D73 B;  5C00 A;  5A4U A;  3GUR A;  4TVE A;  3BOA A;  1A2J A;  1M9A A;  2QKE A;  3QCP A;  4WBJ A;  4WKW A;  2HYX A;  3IOS A;  3Q19 A;  2XBI A;  4ZB8 A;  2PBJ A;  2ON5 A;  1TXX A;  2YZH A;  5B6M A;  4ECC A;  2GT6 A;  3A5I A;  4MZW A;  3A2X A;  2HE3 A;  4K5R A;  1V98 A;  5LNK e;  2H6Y A;  5HQP A;  4EIQ A;  3TRQ A;  2QA2 A;  2XC2 A;  1M9B A;  1ZZY A;  1E6B A;  1U3I A;  3I6A A;  5FT3 A;  1FB6 A;  4OFM A;  2WJU A;  1AUC A;  4DVC A;  4WF4 A;  4CDO A;  3ZRE A;  1GLP A;  1Z6N A;  1TOF A;  5AIV A;  4MCU A;  2HRK A;  4TW5 A;  1U88 A;  3APQ A;  2DIY A;  1SD9 A;  1VF4 A;  3O6T A;  2VD1 A;  2ZUP A;  3FRC A;  5AN1 A;  1ILO A;  1SJ6 A;  2LNS A;  4TR3 A;  5G1K A;  2WZ9 A;  4V2L A;  1FW1 A;  2VLV A;  4P3Y B;  4DEJ A;  5KOX A;  1XIY A;  3KMN A;  1O6J A;  1WMJ A;  4MAB A;  3TKS E;  2IPA A;  5HR2 A;  1FG4 A;  4ZL8 A;  3ME8 A;  2FWG A;  2DSA A;  2C0E A;  4NWY A;  1AC1 A;  4K0G A;  4MF5 A;  2DJJ A;  4GST A;  1O85 A;  4K2D A;  2OBI A;  1TP9 A;  4Z2T A;  2F3M A;  2XPD A;  1YQ1 A;  2DIZ A;  1URM A;  5D9W A;  5INY A;  4MJE A;  4NHW A;  3LJR A;  4IP1 A;  2IMD A;  4KB3 A;  3TJK A;  3US3 A;  6GSS A;  2GSQ A;  3PH9 A;  1GNE A;  2KLX A;  1I5G A;  3MYD A;  1PSQ A;  3CYN A;  1EP7 A;  2JSZ A;  2VUP A;  4DSR A;  4XRD A;  2UZ8 A;  1M7T A;  4KDU A;  5GZZ B;  4IQ1 A;  1Q4J A;  1O8X A;  2C4J A;  3L9U A;  3CRT A;  2CX4 A;  1GP1 A;  3WGE A;  3D4M A;  2DML A;  1UVZ A;  4I2U A;  3H79 A;  1EOH A;  2R37 A;  4IS0 A;  1XCC A;  4BL7 A;  3GA4 A;  3IK7 A;  3WT1 A;  3HJM A;  1GSD A;  2L6D A;  2IMI A;  1A8Y A;  5DAK A;  3GKX A;  5H5Q A;  1TW9 A;  3GV1 A;  2H70 A;  3KEB A;  5ECM B;  1U6T A;  3GTU A;  4MLY A;  4G0K A;  4FYB A;  1ZYQ B;  2P31 A;  2HLS A;  2LKU A;  1YEX A;  2A2P A;  4EDY A;  2PMT A;  2VCZ A;  3HD5 A;  5DQS A;  4X1U A;  3FMW A;  4BVX B;  3IC4 A;  1S3A A;  4YKG A;  2H76 A;  5IMZ A;  3ME7 A;  4HOJ A;  8GSS A;  2YWN A;  3GX0 A;  4KSM A;  1M2B A;  1UN2 A;  1Z7R A;  4K9Z A;  4HU7 A;  1USB A;  4V1A p;  3KM6 A;  4QQ7 A;  3KGK A;  4V2M A;  4Q5Q A;  4V2N A;  5B7C A;  4LL1 B;  2JZR A;  1GWC A;  5ECO B;  4POL A;  3GKM A;  3IAS 2;  2VCQ A;  2MMO A;  1OC9 A;  5G5E A;  3TJG A;  1GRX A;  2K8V A;  3WGX A;  6GSX A;  1S3D A;  2WRT A;  16GS A;  3HVS A;  5IMV A;  4TOP A;  1DBY A;  4L0W A;  1ST9 A;  2EIQ A;  3KCM A;  4PNG A;  3C1R A;  3HYP A;  3HJO A;  3ISO A;  5A5K A;  1K3L A;  2C0G A;  1YY7 A;  1MDK A;  5DQY A;  2FNO A;  3FZ9 A;  4IHU A;  4O5Q A;  5ECS A;  1QMV A;  5IMF A;  3IC8 A;  3NOF A;  2V41 A;  4GF0 A;  3HHV A;  2AUV A;  5EVO A;  3DYR A;  3FYG A;  1O73 A;  1WRY A;  3QAV A;  3LFL A;  4KCA A;  5B6N A;  2IN3 A;  1ZYN A;  3KIJ A;  5E4W A;  5IO2 A;  2C0F A;  2LTK A;  2OE3 A;  1M2A A;  5J4U A;  3ZIT A;  4WET A;  3ERF A;  2VO4 A;  4MJA A;  5IO0 A;  4MNN A;  5E59 A;  4LMV A;  3DML A;  2CVB A;  1EEM A;  2RLI A;  1K0M A;  4PUR A;  4GWR A;  2FWF A;  4Z7X A;  4XRA A;  2K18 A;  1YDK A;  1K0D A;  3TOT A;  3I9V 2;  3I43 A;  4RUV A;  4K0N A;  4N0V A;  1TI1 A;  1NW2 A;  1DE1 A;  3C73 A;  5CRH A;  5L71 A;  1VGL A;  3FHK A;  3O76 A;  4PUA A;  1JFU A;  1KTE A;  1O8W A;  1ERT A;  5D93 A;  6GSU A;  3HY2 A;  1MD3 A;  4X4J A;  2GLR A;  2DC5 A; 
#chains in the Genus database with same CATH homology
 3F0I A;  4RI6 A;  1SL2 B;  5H5S A;  6GSW A;  2PN8 A;  1SKW B;  4GLT A;  2FWE A;  2H6Z A;  1UA5 A;  2HZE A;  1SKS B;  2DJK A;  1RK4 A;  2EIR A;  3GHA A;  3QPM A;  1ABA A;  3ZRD A;  18GS A;  3ZIJ A;  3FR9 A;  5D9V A;  3P8W A;  4KDX A;  3SWL A;  3DVW A;  5KEJ A;  14GS A;  4POK A;  2VL9 A;  4JR4 A;  1TRW A;  1WPI A;  4KX4 A;  17GS A;  2AV4 A;  1F3A A;  1THO A;  5JCU A;  1GSU A;  1X0R A;  2C3Q A;  5JWR B;  2LJR A;  3F3Q A;  1Z9H A;  3ZFB A;  1R7H A;  2ZNM A;  2R5G A;  5DCG A;  3W8S A;  2PU9 C;  2LUS A;  4J2F A;  3V1W A;  1EZK A;  1Y6E A;  3M0F A;  2VL2 C;  4WR4 A;  4K8M A;  3F4R A;  4TR4 A;  3RHB A;  3VFI A;  2AAW A;  2O89 A;  1XOA A;  2HSY A;  5HR3 A;  2XPE A;  3CSH A;  3F9U A;  3J7Y b;  3UMA A;  4KE3 A;  4PNF A;  4AJ8 A;  2VD0 A;  2R0C A;  5D8I A;  2JZT A;  1SYX A;  2H72 A;  3D4T A;  1X5C A;  1FHE A;  1A0R P;  2FLS A;  1T1V A;  2OJL A;  2AHE A;  4MJB A;  5GAP D;  3KMO A;  3UAR A;  4OCE A;  1AQW A;  2JU5 A;  2KOK A;  1SYR A;  1ZMA A;  2H30 A;  5ECN B;  1NHY A;  3DWV A;  2HRF A;  2B1L A;  1G7O A;  2X8G A;  1W4V A;  3GKN A;  1N8J A;  4FQU A;  3GH6 A;  4L5O A;  1B8X A;  2MMZ A;  4K5S A;  2LEG A;  3LXT A;  1PX6 A;  2EIO A;  2LS5 A;  4ZL9 A;  1F6M C;  5F8B A;  5KN0 A;  4PXO A;  2R0G A;  2H1D A;  3F6D A;  3RHC A;  1HD2 A;  5GST A;  3PR8 A;  4OO4 A;  2HXK A;  1ERU A;  3ZIV A;  4PTS A;  4GTU A;  1T4Y A;  1GUK A;  4V1A g;  2HT9 A;  2VLT A;  3ZFL A;  3ZVJ A;  1KNG A;  1ZCP A;  2HRA A;  1Q98 A;  2LRT A;  3LOR A;  2JL4 A;  1MDI A;  4O5R A;  3LSZ A;  2B5Y A;  2F51 A;  1ERW A;  4Z2R A;  3KH7 A;  2KP2 A;  5DCH A;  5AIX A;  4NAX A;  3C71 A;  4IKH A;  5G2Z A;  2X8H A;  2G2Q A;  4ISD A;  4MA9 A;  4KDY A;  5ECP B;  3CBU A;  1SL1 B;  1DUG A;  1G6Y A;  4YKF A;  1O81 A;  3UVH A;  1ERV A;  1TRU A;  4QL9 A;  3PIN A;  3I69 A;  3EUR A;  4KH7 A;  3GMF A;  2F8F A;  1SL0 B;  4F0B A;  3H8Q A;  3HVV A;  5EL8 A;  3D21 A;  1JHB A;  3P90 A;  3VI7 A;  2C8U A;  5J9B A;  1JZW A;  1XXU A;  3IK9 A;  3EU4 A;  1TTZ A;  2FA4 A;  1B48 A;  3TOU A;  3KJY A;  2R2J A;  4LL4 B;  2K6V A;  4ZIJ A;  3HKR A;  6GSV A;  4BL7 B;  4PQ1 A;  1GSQ A;  3ZYW A;  5H5R A;  2ES7 A;  4FIW A;  4TXO A;  1XZO A;  1BX9 A;  3KTB A;  5DAK B;  3ZLP A;  5IM9 A;  1DSB A;  4OD7 A;  3GTU B;  5CO3 A;  1GTU A;  2H1G A;  2Z9S A;  4IP6 A;  2AB6 A;  1KEB A;  5IMD A;  3P7X A;  1HNC A;  1F37 A;  4DSS A;  1SK0 A;  2P5R A;  3HCZ A;  1GUH A;  3GYK A;  3D0Z A;  4QL7 A;  3TKP A;  2CVK A;  2AJQ B;  4MP4 A;  4GRF A;  1VF3 A;  3P2A A;  3LEF A;  2GTU A;  1ZYP A;  3ERW A;  3IAM 2;  5A4W A;  2NDO A;  2L57 A;  5ID2 A;  1B4P A;  3QFA C;  3GSS A;  1OKD A;  3TKQ A;  4NMU A;  1ZYE A;  4YQU A;  1M99 A;  3IE3 A;  2FCH A;  4H86 A;  4XIH A;  1KBN A;  1PRX A;  1J08 A;  4BWQ A;  3VLN A;  5J3R A;  3UBL A;  1HNB A;  1QFN A;  5F06 A;  1B9X C;  4HQS A;  5GSS A;  1K0C A;  2LJK A;  3VWW A;  2B1K A;  3DRN A;  4E8E A;  3GNJ A;  2C3N A;  2VCV A;  4CY6 A;  2N5A A;  1Z6M A;  1GUM A;  1FOH A;  3MWH A;  1MDJ A;  4NXI A;  3BBY A;  1OC8 A;  4IQA A;  2O85 A;  4EF0 A;  1JLV A;  2L5L A;  2VCW A;  2R4V A;  5G31 A;  1K0A A;  3TDG A;  1JZO A;  2FY6 A;  3UEM A;  2A2R A;  1ZOF A;  3F4S A;  3KTL A;  2YAN A;  3PPU A;  3BJ5 A;  4KCE A;  5CRW A;  4EDZ A;  1AIU A;  1AXD A;  4K7I A;  4OWY A;  1Y25 A;  2JZS A;  2LNT A;  3GN3 A;  4JR6 A;  2B5X A;  5JWQ B;  3J7Y k;  4ZB6 A;  5AGY A;  4EE0 A;  5DJM A;  4MPG A;  2B3S A;  3NIV A;  2LRN A;  3VPT A;  3QAW A;  2WCI A;  3ZMK A;  2LQO A;  2ON7 A;  3ZML A;  4WF5 A;  5JCG A;  3DD3 A;  3IHQ A;  1K3Y A;  1TRV A;  4HZ4 A;  4MH2 A;  1VF2 A;  3Q74 A;  1HYU A;  2YJ7 A;  2VCX A;  1U3A A;  2IMK A;  2WUL A;  3O3T A;  5DBQ A;  1V40 A;  4BPY A;  1TKD B;  2JAC A;  4GCI A;  3RPN A;  1T4Z A;  2M80 A;  3E0U A;  3EIN A;  3Q6O A;  3IRA A;  2RM5 A;  2NPB A;  1SJZ A;  3F63 A;  3L9S A;  2CT6 A;  4EKZ A;  19GS A;  4KW6 A;  1J0F A;  1IYI A;  3TKR A;  2HZE B;  1TU8 A;  2C1Y A;  3FR6 A;  22GS A;  3GKK A;  4FH8 A;  3IPZ A;  4PX1 A;  3TJB A;  3CRU A;  3TRP A;  1E2Y A;  5A4V A;  3W6G A;  2RII A;  1G0T A;  5FWG A;  1SK1 A;  3IHG A;  4ZIL A;  2EC4 A;  3MDK A;  4O7H A;  2YPM A;  2L6C A;  5IPH A;  5DAL A;  1NM3 A;  1TK8 B;  12GS A;  1ML6 A;  3ZVJ D;  5JCW A;  1RW1 A;  2YCD A;  2YP6 A;  1PGT A;  5CRE A;  3FR3 A;  5ECL B;  2X4A A;  2YWI A;  1SKR B;  3DXB A;  2I4A A;  2CQ9 A;  5ECQ B;  2M46 A;  3GRX A;  2MMA A;  2V6O A;  3IR4 A;  4RQR A;  4G2E A;  2BTO T;  2CAQ A;  4EXJ A;  1FO5 A;  3TJJ A;  2MBS A;  1B4Q A;  4EUY A;  2JSY A;  2V32 A;  1WJK A;  4Z2U A;  1AQV A;  4ZBD A;  2TIR A;  4ZXG A;  2DJ1 A;  1MD4 A;  5CRD A;  5C04 A;  4HUA A;  4JU5 A;  2IFQ A;  1F3B A;  4IJI A;  1PL2 A;  4YH2 A;  1QXH A;  2B7J A;  1A24 A;  3QAG A;  1G7E A;  4XS1 A;  2CAI A;  2FA8 A;  2DBC A;  4Q5R A;  1R5A A;  2MBT A;  2YWM A;  2F8A A;  4LLR A;  3L78 A;  1LBK A;  4G9H A;  2YNX A;  1ON4 A;  5HR0 A;  4I5Q A;  3LQ7 A;  1XWB A;  2A4H A;  2HFD A;  1A8L A;  3A2V A;  4GSS A;  2MYG A;  1QQ2 A;  2IJY A;  5LCZ A;  2GT5 A;  3GL5 A;  3OR5 A;  1A0F A;  5J9C A;  5KN3 A;  1A2L A;  2AYT A;  2H0I A;  4F9Z A;  3GFK A;  5EY6 A;  2I81 A;  1Z3E A;  5J41 A;  4ID0 A;  3IDV A;  2CA8 A;  5FHI A;  5D96 A;  4ZL7 A;  2LJA A;  2HRN A;  2GGT A;  1GSE A;  1MEK A;  2R0P A;  1GTB A;  4F2I A;  5IIZ A;  2J9H A;  2QC7 A;  3N9J A;  1XFL A;  2GS3 A;  3SBC A;  2E7P A;  2BJX A;  3F8U A;  1V9W A;  4Q5F A;  4EIP A;  1FOV A;  3M3M A;  2B7K A;  3LYP A;  4K7N A;  3RBT A;  3VK9 A;  1QGV A;  1DE2 A;  3KP9 A;  3CTG A;  1NHO A;  1EV4 A;  1TU7 A;  1BG5 A;  5IMC A;  2MMN A;  3VWU A;  3D22 A;  1TK5 B;  4O92 A;  4N0Z A;  1X5E A;  4IEL A;  3BCI A;  2L4C A;  3RPP A;  4O32 A;  1MTC A;  2N5B A;  5D9T A;  1XWK A;  2JAD A;  4KSO A;  4RQX A;  9GSS A;  1K0B A;  2GZY A;  4ULX A;  3GL3 A;  1SJI A;  4G19 A;  4K1F A;  4XS4 A;  6GSY A;  2H73 A;  5EPF A;  4IBP A;  4KA0 A;  4AJ7 A;  1JLW A;  2H19 A;  3UIW A;  6GST A;  4G0L A;  2PGT A;  2C3T A;  3G7J A;  5CYY A;  3QD9 A;  2VIM A;  1EGO A;  2HSM A;  4MK3 A;  1Z7P A;  4L5L A;  2FUG 2;  4ILF A;  4TXO B;  5ECK B;  2LV3 A;  4Q5N A;  2X49 A;  2H0G A;  4TKY A;  4E8H A;  2DJ2 A;  2V2G A;  1FB0 A;  2L5O A;  2WGR A;  3BCK A;  4JE1 A;  1GL8 A;  2YWO A;  3H4K A;  3TKS C;  4DSS B;  3DVX A;  2DKI A;  4X43 A;  1SU9 A;  1XW6 A;  1ZL9 A;  4ZB9 A;  4ECI A;  4O5U A;  4CHS A;  2QSI A;  4IVF A;  3FY7 A;  4AGS A;  1PN0 A;  1LU4 A;  4N10 A;  5JWO B;  3WGD A;  1R5P A;  4OMV A;  5ID2 B;  4POB A;  3CSJ A;  2PER A;  3QMX A;  4MZB A;  3R3E A;  2OE0 A;  3DGQ A;  4MF6 A;  2FHE A;  1IYH A;  4KF9 A;  1W89 A;  2V6K A;  3EVI A;  1OKT A;  2QA1 A;  3TUE A;  4IN0 A;  2H01 A;  2B5E A;  2OAC A;  3WT2 A;  4HEA 2;  3UJ1 A;  5LD0 A;  2HI7 A;  4WBR D;  1PKW A;  4LA1 A;  1EOG A;  4ACS A;  2I1U A;  1ZGN A;  4XCS A;  3ZL5 A;  4AF2 A;  4KUN A;  1K0N A;  1XVQ A;  3ED3 A;  4J56 E;  2HZF A;  5HFK A;  4MH3 A;  4N30 A;  1SK2 A;  13GS A;  5DJL A;  1CQH A;  3APO A;  4HJ2 A;  2A4V A;  2VM2 A;  3HA9 A;  2D2Z A;  3UVT A;  1PMT A;  1A2M A;  1TK0 B;  2YV9 A;  3EWL A;  4G0I A;  4TR0 A;  1I9D A;  3D5J A;  3TCO A;  4KAE A;  4J57 E;  2H6X A;  1M2D A;  3E3E A;  5GAN D;  5BRT A;  2PVO C;  1N2A A;  3F4T A;  4NV2 A;  3EU3 A;  3R2Q A;  4G10 A;  1XVW A;  2H8L A;  5IPG A;  1XWA A;  2L59 A;  2VL3 A;  1EP8 A;  3C1S A;  3W8J A;  4N11 A;  3EE2 A;  3GIX A;  3A3T A;  1GUL A;  5IOX A;  4MJC A;  3CTF A;  2TRX A;  3M8N A;  2L4Q A;  3FW2 A;  3FEU A;  4KND A;  2QGV A;  3HZ8 A;  2DMM A;  1PN9 A;  4JBB A;  1V57 A;  1T3B A;  4I8B A;  3KP8 A;  3GST A;  1G6W A;  1M0U A;  4K6X A;  1BJX A;  4POM A;  4YAV A;  1BED A;  3TGZ A;  2PWJ A;  2P0G A;  3H93 A;  3WYW A;  2GSS A;  1OE8 A;  1THX A;  2O87 A;  5ECR B;  1H4O A;  5DDL A;  3LWA A;  4ML1 A;  5ECI B;  3TJF A;  4MZC A;  1OE7 A;  1T7P B;  3FZ4 A;  2IWT A;  2GSR A;  3DEX A;  3LG6 A;  2VM1 A;  2H1A A;  5IQY A;  3IBH A;  5IOW A;  3K8N A;  4PQI A;  3TRX A;  2GQL A;  4TR1 A;  1OC9 B;  2DJ3 A;  2R3X A;  4MPF A;  3HZ4 A;  4I97 A;  4WEY A;  2CVD A;  2J23 A;  1WIK A;  2CV4 A;  4BVY A;  3F3R A;  3CXG A;  5DAL B;  3DKS A;  1C72 A;  4TN8 A;  2X64 A;  4PQH A;  4YQM A;  5ELG A;  4ECJ A;  3MSZ A;  5CAX A;  3ZZX A;  1GLQ A;  2IL3 A;  3A2W A;  3JCM L;  3GH9 A;  2KP1 A;  3C8E A;  4XTS A;  2KUC A;  2H74 A;  1OVN A;  3HXS A;  1EEJ A;  1TRS A;  3C7M A;  1F9M A;  3F6F A;  1YF0 A;  4GQF A;  3U6V A;  1YKA A;  4EC0 A;  2OBK A;  4JRR A;  3BD2 A;  1CQG A;  2HSH A;  3CMI A;  3FZA A;  2NVL A;  4AJ6 A;  4D73 A;  3VWV A;  2ZCT A;  4MF7 A;  2RM6 A;  5F0G A;  1GH2 A;  1YF1 A;  5F05 A;  2M72 A;  3RDW A;  2IFQ B;  2RUF A;  4ECB A;  1VRS D;  2E0Q A;  4WR5 A;  5ENU A;  1VF1 A;  5HR1 A;  2E2M A;  4OO5 A;  3G7I A;  2FD3 A;  3EMX A;  3VUR A;  4L0U A;  2XHF A;  3UL3 A;  10GS A;  1TI3 A;  5CRG A;  4ZBB A;  4BA7 A;  1RQM A;  4EL1 A;  5KN2 A;  2OE1 A;  2CX3 A;  4FYU A;  1R4W A;  1GTA A;  1WE0 A;  3H1N A;  3QOU A;  3KH9 A;  3FZ5 A;  4F82 A;  2NBS A;  1HNA A;  3PGT A;  2VL2 A;  1XWG A;  5D73 A;  1HQO A;  5ELA A;  2GVP A;  3D6I A;  5BMU A;  3APS A;  4CW9 A;  1GSS A;  3VPQ A;  3EC3 A;  2WFC A;  2OA7 A;  1T8E B;  1A23 A;  4I2T A;  3RAZ A;  4F03 A;  1GSY A;  2YJH A;  1XPV A;  4X0X A;  4K2X A;  3WD6 A;  2IME A;  1QUW A;  4HI7 A;  1YEP A;  4OCF A;  7GSS A;  4PUF C;  4TXV A;  3M1G A;  4JED A;  4NV5 A;  1XW9 A;  2DLX A;  2PVQ A;  5IMA A;  3KXO A;  3L9V A;  2GQM A;  1EV9 A;  4GQC A;  1X9S B;  4OFT A;  2I9H A;  2OAD A;  3TKS A;  4HDE A;  4HZ2 A;  4GXZ A;  4HS1 A;  1V58 A;  2C80 A;  2YZU A;  1BQ7 A;  4XS4 B;  3FKF A;  2YN1 A;  1XBS A;  5F07 A;  1AAZ A;  1WOU A;  4IW9 A;  1EWX A;  5G30 A;  1SD8 A;  4EVM A;  2WDU A;  1XOB A;  1FVJ A;  1X9M B;  2I3Y A;  2REM A;  4PGT A;  5ECH B;  4GSN A;  3DIE A;  5KN1 A;  3QR6 A;  1JZD A;  2GQK A;  1V2A A;  4EO3 A;  2LST A;  5ABR A;  2CZ2 A;  2KHP A;  2X8C A;  4ICY A;  1X9W B;  1FVK A;  1OYJ A;  1ACV A;  2H71 A;  2VCT A;  2GST A;  3L4N A;  1PL1 A;  2VOC A;  20GS A;  3CSI A;  2GZP A;  2R6K A;  3U5R E;  1K0O A;  2PPT A;  3L0H A;  4BWS A;  1X5D A;  2K9F A;  3IV4 A;  4FO5 A;  4USS A;  2LRC A;  2VLU A;  3LYK A;  1R26 A;  1B9Y C;  2FGX A;  1YKC A;  4NPB A;  1TJD A;  1PD2 1;  1LJR A;  3S9F A;  4BVX A;  2OKA A;  4IJ3 A;  1F2E A;  1GSF A;  2P5Q A;  3LXZ A;  2MZC A;  1PKZ A;  3UOM A;  2XBQ A;  1UC7 A;  2FWH A;  3HJP A;  3VI5 A;  1OC3 A;  4HU9 A;  1GNW A;  2DKH A;  2V1M A;  4FYC A;  2DJ0 A;  3UAP A;  4JZQ A;  3KD0 A;  5B8A A;  1AQX A;  2K8S A;  3M9J A;  4A5P A;  1XW5 A;  2H66 A;  4IGJ A;  3A5W A;  1K3O A;  1J9B A;  2VAF A;  4MDC A;  2X99 A;  3LW9 A;  3AY8 A;  2YV7 A;  4ZBA A;  1QK8 A;  4HQZ A;  3MAK A;  4MMM A;  11GS A;  5CNW A;  4XS6 A;  1BAY A;  1YJ6 A;  1FAA A;  1PX7 A;  2O7K A;  4NHZ A;  3HDC A;  4ML6 A;  2IMF A;  3KZQ A;  5AIS A;  5COH A;  3HVX A;  3MIX A;  5DVB A;  2GDR A;  1U87 A;  4WXT A;  1YZX A;  5B8B A;  3EMP A;  3ZTL A;  4OFN A;  4L8E A;  1Z5Y E;  2H0H A;  3LGC A;  1AW9 A;  2O8V B;  5G1L A;  2NTO A;  2YOI A;  1TDI A;  2G0F A;  5J5N A;  2N5F A;  1SEN A;  1XWC A;  3ERG A;  2A2S A;  3EYT A;  4HJM A;  2H1B A;  4YAP A;  4K7O A;  4RI7 A;  1WWJ A;  2IIY A;  2BMX A;  2LQQ A;  3GX8 A;  2HNL A;  3N5O A;  5KOW A;  2B6M A;  1H75 A;  3G9B A;  5HFI A;  2TRC P;  4TR1 B;  3IXR A;  1WP0 A;  4DSQ A;  3Q18 A;  3E9J B;  5G5F A;  3VWX A;  1EGR A;  1OAZ A;  2F9S A;  1O7U A;  4BVY B;  4F0C A;  4KGI A;  2GZZ A;  1NSW A;  4YQV A;  2E2G A;  3MNG A;  3FK8 A;  5CP1 A;  3GUS A;  3M9K A;  3G7Y A;  2ALB A;  2H75 A;  3NZN A;  3QDN A;  4XHM A;  2RUE A;  1GTI A;  2CZ3 A;  4TRX A;  2WS2 A;  2WB9 A;  2C0D A;  1JZR A;  3EPT A;  4LMW A;  2PUK C;  3QFB C;  1T00 A;  1PQN A;  1S3C A;  3IA1 A;  1BYE A;  5D9X A;  3TB2 A;  4CY8 A;  4I6X A;  3UBK A;  5HFG A;  1PA3 A;  4D73 B;  5C00 A;  5A4U A;  3GUR A;  4TVE A;  3BOA A;  1A2J A;  1M9A A;  2QKE A;  3QCP A;  4WBJ A;  4WKW A;  2HYX A;  3IOS A;  3Q19 A;  2XBI A;  4ZB8 A;  2PBJ A;  2ON5 A;  1TXX A;  2YZH A;  5B6M A;  4ECC A;  2GT6 A;  3A5I A;  4MZW A;  3A2X A;  2HE3 A;  4K5R A;  1V98 A;  5LNK e;  2H6Y A;  5HQP A;  4EIQ A;  3TRQ A;  2QA2 A;  2XC2 A;  1M9B A;  1ZZY A;  1E6B A;  1U3I A;  3I6A A;  5FT3 A;  1FB6 A;  4OFM A;  2WJU A;  1AUC A;  4DVC A;  4WF4 A;  4CDO A;  3ZRE A;  1GLP A;  1Z6N A;  1TOF A;  5AIV A;  4MCU A;  2HRK A;  4TW5 A;  1U88 A;  3APQ A;  2DIY A;  1SD9 A;  1VF4 A;  3O6T A;  2VD1 A;  2ZUP A;  3FRC A;  5AN1 A;  1ILO A;  1SJ6 A;  2LNS A;  4TR3 A;  5G1K A;  2WZ9 A;  4V2L A;  1FW1 A;  2VLV A;  4P3Y B;  4DEJ A;  5KOX A;  1XIY A;  3KMN A;  1O6J A;  1WMJ A;  4MAB A;  3TKS E;  2IPA A;  5HR2 A;  1FG4 A;  4ZL8 A;  3ME8 A;  2FWG A;  2DSA A;  2C0E A;  4NWY A;  1AC1 A;  4K0G A;  4MF5 A;  2DJJ A;  4GST A;  1O85 A;  4K2D A;  2OBI A;  1TP9 A;  4Z2T A;  2F3M A;  2XPD A;  1YQ1 A;  2DIZ A;  1URM A;  5D9W A;  5INY A;  4MJE A;  4NHW A;  3LJR A;  4IP1 A;  2IMD A;  4KB3 A;  3TJK A;  3US3 A;  6GSS A;  2GSQ A;  3PH9 A;  1GNE A;  2KLX A;  1I5G A;  3MYD A;  1PSQ A;  3CYN A;  1EP7 A;  2JSZ A;  2VUP A;  4DSR A;  4XRD A;  2UZ8 A;  1M7T A;  4KDU A;  5GZZ B;  4IQ1 A;  1Q4J A;  1O8X A;  2C4J A;  3L9U A;  3CRT A;  2CX4 A;  1GP1 A;  3WGE A;  3D4M A;  2DML A;  1UVZ A;  4I2U A;  3H79 A;  1EOH A;  2R37 A;  4IS0 A;  1XCC A;  4BL7 A;  3GA4 A;  3IK7 A;  3WT1 A;  3HJM A;  1GSD A;  2L6D A;  2IMI A;  1A8Y A;  5DAK A;  3GKX A;  5H5Q A;  1TW9 A;  3GV1 A;  2H70 A;  3KEB A;  5ECM B;  1U6T A;  3GTU A;  4MLY A;  4G0K A;  4FYB A;  1ZYQ B;  2P31 A;  2HLS A;  2LKU A;  1YEX A;  2A2P A;  4EDY A;  2PMT A;  2VCZ A;  3HD5 A;  5DQS A;  4X1U A;  3FMW A;  4BVX B;  3IC4 A;  1S3A A;  4YKG A;  2H76 A;  5IMZ A;  3ME7 A;  4HOJ A;  8GSS A;  2YWN A;  3GX0 A;  4KSM A;  1M2B A;  1UN2 A;  1Z7R A;  4K9Z A;  4HU7 A;  1USB A;  4V1A p;  3KM6 A;  4QQ7 A;  3KGK A;  4V2M A;  4Q5Q A;  4V2N A;  5B7C A;  4LL1 B;  2JZR A;  1GWC A;  5ECO B;  4POL A;  3GKM A;  3IAS 2;  2VCQ A;  2MMO A;  1OC9 A;  5G5E A;  3TJG A;  1GRX A;  2K8V A;  3WGX A;  6GSX A;  1S3D A;  2WRT A;  16GS A;  3HVS A;  5IMV A;  4TOP A;  1DBY A;  4L0W A;  1ST9 A;  2EIQ A;  3KCM A;  4PNG A;  3C1R A;  3HYP A;  3HJO A;  3ISO A;  5A5K A;  1K3L A;  2C0G A;  1YY7 A;  1MDK A;  5DQY A;  2FNO A;  3FZ9 A;  4IHU A;  4O5Q A;  5ECS A;  1QMV A;  5IMF A;  3IC8 A;  3NOF A;  2V41 A;  4GF0 A;  3HHV A;  2AUV A;  5EVO A;  3DYR A;  3FYG A;  1O73 A;  1WRY A;  3QAV A;  3LFL A;  4KCA A;  5B6N A;  2IN3 A;  1ZYN A;  3KIJ A;  5E4W A;  5IO2 A;  2C0F A;  2LTK A;  2OE3 A;  1M2A A;  5J4U A;  3ZIT A;  4WET A;  3ERF A;  2VO4 A;  4MJA A;  5IO0 A;  4MNN A;  5E59 A;  4LMV A;  3DML A;  2CVB A;  1EEM A;  2RLI A;  1K0M A;  4PUR A;  4GWR A;  2FWF A;  4Z7X A;  4XRA A;  2K18 A;  1YDK A;  1K0D A;  3TOT A;  3I9V 2;  3I43 A;  4RUV A;  4K0N A;  4N0V A;  1TI1 A;  1NW2 A;  1DE1 A;  3C73 A;  5CRH A;  5L71 A;  1VGL A;  3FHK A;  3O76 A;  4PUA A;  1JFU A;  1KTE A;  1O8W A;  1ERT A;  5D93 A;  6GSU A;  3HY2 A;  1MD3 A;  4X4J A;  2GLR A;  2DC5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...