1R7HA

Nrdh-redoxin of corynebacterium ammoniagenes forms a domain-swapped dimer
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
74
structure length
74
Chain Sequence
MSITLYTKPACVQCTATKKALDRAGLAYNTVDISLDDEARDYVMALGYVQAPVVEVDGEHWSGFRPERIKQLQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NrdH-redoxin
publication title NrdH-redoxin of Corynebacterium ammoniagenes forms a domain-swapped dimer.
pubmed doi rcsb
source organism Corynebacterium ammoniagenes
molecule tags Electron transport
total genus 18
structure length 74
sequence length 74
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00462 Glutaredoxin Glutaredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1r7hA00
5CREA 1PKWA 1Z6NA 4YAPA 5D9VA 3HYPA 2JZTA 1G7EA 3M9KA 1WWJA 1XWKA 3D22A 4KW6A 1GULA 2FHEA 1K3OA 2F51A 4TXVA 2YN1A 5COHA 3IK7A 4L5OA 10GSA 2E2GA 4D73A 1VF4A 3IC4A 2N5BA 5EL8A 6GSUA 3TJJA 1T3BA 1QK8A 3QAVA 2GSTA 5GZZB 2FA4A 1V98A 4OWYA 1AAZA 1EV9A 2R5GA 4BPYA 5DQSA 3AY8A 1X5DA 1TRWA 3HA9A 1Q98A 4WXTA 3KCMA 5IMVA 2B1KA 1X9MB 4O92A 2PVOC 4EL1A 3RDWA 1YF0A 4EDZA 2GSSA 5DAKB 4TXOA 3EINA 3GTUA 4OO4A 3FZ4A 3BCIA 1TI1A 2CX3A 3QFAC 1F3AA 4I97A 2L6DA 2V32A 3KJYA 1Z7PA 5C04A 2J23A 2VLUA 3UBKA 3VI5A 4MCUA 1J08A 1HNAA 1ON4A 2FLSA 4KB3A 1XFLA 1XW9A 2JACA 1M99A 1JLWA 1U6TA 3DKSA 3APQA 4TVEA 1VF3A 3VFIA 2LRCA 4ZL8A 1PRXA 2K8VA 3HVVA 4GSTA 5F8BA 2GZYA 3ISOA 4NWYA 3ZTLA 1EV4A 3GL5A 3H1NA 4K8MA 4AJ8A 4MDCA 5ID2A 3TKSC 2JADA 5AIXA 3ZFLA 2ON7A 4PGTA 1ZZYA 2AHEA 3FEUA 4RI6A 5B6NA 2YWOA 1X9WB 1E6BA 3HJOA 2EC4A 2YOIA 1B9XC 3D5JA 5HFGA 2ON5A 3TDGA 2CAIA 1GNEA 3KMOA 2HFDA 4GSNA 1K0CA 4ZXGA 5DCGA 3GKMA 4IHUA 2D2ZA 1Z7RA 4CHSA 4NHWA 2LRTA 5J5NA 5F07A 17GSA 1BYEA 3UMAA 3WYWA 3P7XA 1O8XA 1OKTA 1XBSA 1PL1A 5F06A 2RUEA 1TKDB 3GSTA 3LEFA 3UBLA 4OD7A 5ECNB 2YPMA 3N9JA 6GSTA 2N5FA 1O7UA 2FA8A 2H1GA 2LKUA 3LYKA 3P2AA 3O76A 4K7NA 2VAFA 3I69A 5ECKB 3R2QA 1EOGA 1GSSA 3H4KA 2V41A 3ZVJA 4I8BA 3KEBA 3RHCA 1TK8B 1TU7A 3VURA 3QR6A 4J57E 2WDUA 1ZMAA 2AV4A 2LSTA 2B3SA 2L6CA 5GAPD 4KGIA 1A0FA 1F2EA 4FYBA 2YCDA 1JZWA 3IDVA 1WRYA 2LEGA 1RW1A 4Q5QA 2OACA 2H8LA 5ECLB 1UN2A 3F8UA 4L0UA 1EGRA 2LV3A 2RM5A 2IMKA 1AQWA 4G2EA 4MJEA 4EVMA 4WEYA 4XRDA 3UARA 1LU4A 3C1SA 3DXBA 2IMFA 3CMIA 3HY2A 3EE2A 3UOMA 1ML6A 3LYPA 5ECIB 4K0GA 5CRHA 1F37A 3GX0A 5HR3A 4NPBA 5IPGA 4GQCA 2H71A 4ID0A 2IJYA 3LJRA 4FIWA 3WD6A 2VL2A 3C73A 1TK0B 2GQLA 1SU9A 5A4WA 3TJFA 3VK9A 3ZMLA 5B6MA 2P0GA 4HOJA 4F0CA 5DJMA 3TKRA 2L4CA 3D6IA 5AISA 1M7TA 1HNCA 5E59A 5IMCA 2WGRA 3KH7A 1QMVA 11GSA 4HQSA 4YH2A 2K9FA 3BOAA 1M2DA 5ELGA 4KDUA 2R2JA 1QQ2A 3IPZA 2K6VA 1C72A 2A2RA 3QCPA 1TTZA 2TRXA 2C8UA 2FWHA 5A4UA 4ZBDA 1PL2A 1OE7A 3CYNA 3WGXA 2B7JA 2PMTA 3IAM2 1HNBA 1X0RA 3F4RA 3TKPA 4JBBA 1KTEA 1N8JA 1RQMA 4N10A 1LJRA 3CSIA 1EEJA 3TOTA 2V6KA 1GNWA 4PX1A 2DJ3A 2DJ1A 4GRFA 3C1RA 2NBSA 1PX6A 2HLSA 2QSIA 3UIWA 1XWGA 4QL9A 1X9SB 3BD2A 3I43A 2F3MA 5JCUA 1XWAA 3HXSA 5EPFA 3FR9A 1TW9A 5IMFA 1GWCA 1OAZA 2H75A 2WB9A 4ISDA 4Q5FA 3VWWA 2HYXA 2JSZA 2PU9C 3F6DA 3GIXA 3J7Yb 3EYTA 2FWGA 3F3RA 1K0AA 1LBKA 4NHZA 4H86A 1TDIA 4ML1A 4IQ1A 4MH3A 1T00A 3TRQA 2EIQA 3QD9A 3QFBC 3EU4A 4BL7A 3L78A 2L5OA 4ECIA 1GUKA 2PGTA 1O73A 3SWLA 4BWQA 4KA0A 5ECQB 3L9UA 3KP9A 3TJGA 3FW2A 2IFQB 4XRAA 1QXHA 1X5EA 3FR3A 1TRUA 4J2FA 5CRDA 1KEBA 3IHQA 1S3CA 4I5QA 3GUSA 1GP1A 2VCWA 3HJMA 1A0RP 3DYRA 2H72A 1Y25A 1FOVA 3HZ4A 2MBSA 1MD4A 4TKYA 4TRXA 2H1BA 1ERTA 2V2GA 1NHYA 2VLTA 4E8EA 2MMAA 2LQOA 3W8JA 3NZNA 2AYTA 2GGTA 3ZMKA 1YY7A 2FUG2 4PQIA 5B8AA 3ED3A 5EVOA 5DBQA 4MMMA 2VCXA 1WMJA 20GSA 1FW1A 5F0GA 1I9DA 2BJXA 4JR4A 3GYKA 4ECBA 5G1LA 4MJCA 4HEA2 2H1AA 4ZILA 3C7MA 2FCHA 4WF4A 3FR6A 3DMLA 5J3RA 3EVIA 2KP1A 2HZFA 3L0HA 2YWMA 3QAWA 1V40A 2B5YA 1GSQA 5DAKA 5IQYA 5IOXA 3GKNA 3KH9A 2DIZA 2VCVA 5D9XA 2K8SA 1S3AA 5ENUA 3UL3A 5J9BA 1IYIA 4K0NA 1F6MC 1UA5A 2MMZA 2DJJA 2FNOA 2WULA 4KH7A 4JZQA 4XS4A 3G7IA 16GSA 1DBYA 3A2WA 4JU5A 2H76A 2DJ0A 2REMA 5CRWA 2CVDA 3ZVJD 1SJZA 3SBCA 3BBYA 2OJLA 4NMUA 4ML6A 3UVTA 1XVQA 1PN9A 2E0QA 1SYXA 1THOA 2IL3A 3QMXA 1YQ1A 4WBJA 4POLA 4HS1A 3GHAA 5A5KA 4RI7A 2WFCA 3FRCA 2OE0A 1XWCA 3PGTA 3UEMA 3GX8A 3TB2A 2DSAA 3CBUA 1PGTA 2Z9SA 4Z7XA 1YKAA 4MF5A 5IMAA 1GTAA 2H6XA 4EF0A 4MZWA 4MJBA 4HJ2A 2GQMA 2H30A 1AC1A 1V58A 4NAXA 1YEPA 5AGYA 1CQHA 5CNWA 2G2QA 1YKCA 1GLPA 2O7KA 5JWRB 4N11A 3GH9A 1G6YA 1SD9A 3Q6OA 5CP1A 3Q19A 3UVHA 1FHEA 3S9FA 3VLNA 4YQVA 4O32A 3ZIVA 4I2UA 3DVXA 4WR5A 5GSSA 6GSYA 5IO0A 4TOPA 2C3TA 3TJBA 2VCQA 1TU8A 4KNDA 4AJ7A 1PA3A 2LUSA 1Z3EA 2X8GA 1DE1A 5GSTA 1FG4A 1FVKA 3L9VA 3U5RE 2MZCA 2YANA 2OADA 5JWOB 4OFTA 3PINA 5DALB 1ZYEA 1ABAA 4IJ3A 1OC8A 1NM3A 2IMIA 1SL0B 3L9SA 2VL9A 2IPAA 8GSSA 2B6MA 3TKSE 3ZIJA 1XIYA 1T4YA 2PVQA 1TRVA 2R6KA 4N0ZA 2WRTA 2GSQA 1R7HA 2IMEA 2P5QA 2LJRA 1BG5A 4TR4A 5G5EA 2RIIA 2H0IA 3TRXA 3ZLPA 3D21A 4E8HA 2QGVA 5G5FA 1VGLA 3LWAA 3RPNA 1U87A 1BQ7A 2VCZA 2XC2A 4GWRA 3BCKA 3I6AA 4LA1A 3LGCA 3F0IA 2F9SA 3IRAA 3QPMA 3CXGA 3HVXA 2WCIA 3EU3A 3APSA 4IQAA 4ZBAA 1B4QA 3GNJA 4X1UA 3GL3A 5AIVA 1XWBA 3TKQA 3TOUA 1WJKA 4TR0A 4TXOB 2J9HA 4HDEA 3DRNA 3IV4A 1ZYQB 1U88A 4WKWA 1IYHA 4WF5A 2WZ9A 4HZ4A 3H93A 4JR6A 3KMNA 4KUNA 3WGDA 3O3TA 4ZIJA 3GKXA 1YDKA 3RPPA 1SL2B 4Q5RA 1RK4A 3M0FA 5DJLA 4XS1A 2VCTA 3KP8A 4IBPA 4V1Ag 4IN0A 1QFNA 2C3NA 4PUFC 3GA4A 2PPTA 5ABRA 4NV2A 2VL2C 2VLVA 4FH8A 1TRSA 2I9HA 2LJAA 4ZL7A 2N5AA 5H5RA 5D9TA 2IN3A 5ID2B 3A2VA 4G10A 5H5SA 3TRPA 6GSWA 3OR5A 1K0BA 2ZUPA 3ZL5A 2OBKA 9GSSA 2R37A 4EE0A 3VWUA 1Z5YE 2JZRA 4GXZA 4F82A 2HRFA 2WS2A 3ZZXA 1R4WA 5IO2A 2H6YA 2MBTA 3RBTA 2GDRA 5JCWA 2XBQA 5KN2A 3LFLA 12GSA 2O87A 3LORA 4V1Ap 3DGQA 3KGKA 2DJKA 2CVBA 1SJIA 4IGJA 3A3TA 1EOHA 5FHIA 1KNGA 4XCSA 3EMXA 5ECHB 1TK5B 2GLRA 5D8IA 2ZCTA 3EWLA 3HDCA 4TN8A 2AJQB 2V6OA 3MNGA 1EZKA 3IBHA 1ZOFA 2VD1A 2P31A 4EDYA 2HNLA 4KDXA 2DMMA 2IFQA 1TI3A 4G19A 1OC9A 4RQXA 2NPBA 4Q5NA 4PUAA 1ZGNA 3C8EA 3N5OA 1R5PA 4F2IA 1GTBA 4IW9A 1BX9A 1QUWA 3LXZA 3U6VA 2LNTA 2O89A 1OKDA 4F9ZA 4OFNA 4LL4B 4ZB8A 5KN1A 5FT3A 2HSHA 3C71A 2DBCA 4BVYA 4PXOA 3APOA 1U3AA 2DJ2A 2HZEB 1GSFA 2OA7A 3KXOA 3M3MA 3GH6A 1FVJA 1YF1A 2XPEA 3VI7A 4EXJA 3FZAA 5CO3A 4TR1A 2I1UA 3NIVA 1HYUA 3EC3A 2YJHA 1E2YA 3VWVA 1YZXA 3GMFA 1ERWA 2GT5A 1G6WA 3LSZA 4BVXA 1GLQA 4DVCA 4AGSA 3FY7A 3P8WA 4XTSA 4KSOA 5D9WA 1BAYA 1GSDA 1AQVA 2C4JA 4NXIA 3ZYWA 2JZSA 1YEXA 1WPIA 1JZDA 2VL3A 5CRGA 2B5EA 2GTUA 3IA1A 2IIYA 1WP0A 1F9MA 3LQ7A 4RQRA 2E2MA 1A24A 3KIJA 1FO5A 4K9ZA 3UJ1A 3D4MA 3KM6A 4WR4A 5G2ZA 3HCZA 3J7Yk 3DWVA 2HE3A 1HD2A 2LNSA 3F4TA 1DUGA 2H01A 2CX4A 2HXKA 1SKRB 2O85A 3DD3A 2M80A 4DSRA 1GSYA 2LJKA 1I5GA 3ME7A 1SYRA 2FWFA 5IM9A 2FGXA 2KUCA 2GVPA 5KN0A 3K8NA 3NOFA 4F03A 2DIYA 1EGOA 4ZBBA 5L71A 1SK2A 1PMTA 4IS0A 5DVBA 5HR0A 4MK3A 1T8EB 1UC7A 2DC5A 1EP8A 1GUMA 1K0DA 2VUPA 3A2XA 4POKA 4IP1A 2O8VB 1OVNA 5G30A 1M2BA 1JZOA 19GSA 4ZB9A 2PERA 4KE3A 3MWHA 4EC0A 3ERWA 5EY6A 1SKSB 5A4VA 3HVSA 1XZOA 2OBIA 1XW5A 1K0MA 4PQHA 2CVKA 2P5RA 4MH2A 4LLRA 3A5WA 3CRTA 3IR4A 1NSWA 1URMA 4MP4A 4F0BA 4GF0A 4J56E 2C0GA 4GLTA 2FY6A 4EKZA 3G9BA 3CTFA 2PN8A 1XPVA 4RUVA 4WETA 1TJDA 2NVLA 1S3DA 2L5LA 4PNGA 3I9V2 1Z6MA 2LS5A 3KD0A 5HR2A 1SK1A 5G31A 1K0OA 3ZFBA 3F9UA 1EEMA 3FZ9A 5CYYA 1R5AA 5DALA 5ECRB 1YJ6A 2OE3A 2FD3A 1SL1B 2I81A 1MTCA 2MMOA 4MZCA 1USBA 4N30A 4POBA 3FZ5A 1M0UA 5D93A 2H73A 1PKZA 4OCEA 1XOAA 5J41A 2GT6A 4KAEA 2CZ3A 5KN3A 4X43A 2NDOA 1BJXA 1VF2A 2RLIA 3HD5A 5J9CA 3HZ8A 4L5LA 2YJ7A 3VPTA 2VD0A 5IOWA 2GZPA 1ERVA 3F6FA 4LMVA 3QAGA 3D4TA 3VPQA 3W8SA 2CAQA 1O6JA 5GAND 4KCAA 3WGEA 1AXDA 5ECPB 3TCOA 5DQYA 1ACVA 4K7OA 3G7JA 4DSSB 1FB0A 4MF6A 4PNFA 5LNKe 3O6TA 4IJIA 2L4QA 4IELA 1AUCA 2I3YA 2IMDA 2EIOA 4IP6A 1JHBA 2VOCA 5H5QA 1N2AA 2H0GA 2H1DA 2BTOT 1MD3A 1DE2A 14GSA 2C3QA 1BEDA 1PD21 1SD8A 3MDKA 5C00A 3F3QA 1X5CA 3P90A 1SJ6A 1CQGA 4XHMA 5B7CA 4XS4B 1A2JA 4GCIA 3ZRDA 4KX4A 5F05A 5IIZA 1ST9A 1A23A 4FYUA 2EIRA 5KEJA 2AAWA 2PBJA 2KOKA 1ZCPA 1OYJA 4D73B 4MZBA 1GTIA 4XS6A 2F8AA 4K6XA 3GV1A 5HFIA 3WT1A 4JEDA 1B48A 4XIHA 1WIKA 4G9HA 1A2MA 2KHPA 4PURA 4L0WA 3IAS2 1XCCA 1NHOA 1J9BA 3TKSA 1DSBA 1G0TA 3RAZA 3CRUA 1A8LA 4MPFA 3E0UA 1V9WA 4JRRA 1GTUA 1K0NA 4YAVA 5INYA 3GTUB 1EWXA 2VO4A 2AB6A 4V2NA 3DEXA 4WBRD 5DDLA 2GQKA 1AQXA 3WT2A 2AUVA 4FO5A 1W89A 4GTUA 4AF2A 4KDYA 3TGZA 4K7IA 4YQUA 2X8CA 3UAPA 2LTKA 3M8NA 3DIEA 3IXRA 2OKAA 5LCZA 1F3BA 4ECJA 2KLXA 3QDNA 2HZEA 3DVWA 4MABA 1TXXA 1U3IA 2JSYA 3HKRA 1V2AA 1MDIA 3GSSA 7GSSA 2YWNA 3GKKA 1GUHA 2KP2A 4OMVA 2R4VA 2A2SA 3IK9A 1XXUA 1W4VA 4DEJA 3VWXA 4KCEA 1TOFA 1GSUA 4MLYA 22GSA 5E4WA 4LMWA 6GSSA 2F8FA 2E7PA 4ECCA 1GL8A 1A2LA 2CA8A 4L8EA 4AJ6A 2C0FA 2JU5A 4HQZA 4MA9A 3Q74A 3PR8A 1Q4JA 3ZITA 3FK8A 5HQPA 1B8XA 2MYGA 2IWTA 5JWQB 1MEKA 4V2MA 4JE1A 1M9AA 4OFMA 4POMA 3JCML 2H66A 2VM1A 6GSXA 2HI7A 2HRNA 3GFKA 1GRXA 2YZUA 3GRXA 2GZZA 1V57A 1O85A 2ALBA 3H79A 5IPHA 2YWIA 4BWSA 3MAKA 1T4ZA 2C80A 4YQMA 2QC7A 2RUFA 5CAXA 1M2AA 3BJ5A 4NV5A 1SK0A 1AW9A 3CSJA 3D0ZA 3CSHA 3V1WA 4HU9A 2X64A 2C0EA 2L59A 2ES7A 5ECOB 3GURA 4DSQA 13GSA 1KBNA 5ELAA 4ACSA 5G1KA 2B7KA 4QQ7A 5B8BA 3ME8A 2H19A 2K18A 5HFKA 4ZL9A 3FHKA 3F4SA 1B9YC 5ECMB 3M1GA 3IOSA 2M72A 4LL1B 2VM2A 3MSZA 4K2DA 1R26A 1WE0A 4HJMA 2H70A 2HT9A 2B5XA 1QGVA 2WJUA 3GN3A 4O5RA 4GSSA 4OO5A 2TRCP 3FYGA 2H74A 4K1FA 3E9JB 3ERGA 2LQQA 3KZQA 1OC3A 3Q18A 3TJKA 2QKEA 3FKFA 3KTBA 1JFUA 2PUKC 2XBIA 2BMXA 5ECSA 2X99A 2A4VA 2LRNA 2NTOA 1ILOA 1O81A 1XVWA 2FWEA 4MPGA 4ULXA 2C0DA 4V2LA 3HJPA 5IMDA 4IVFA 3HHVA 1Y6EA 4QL7A 2PWJA 2V1MA 2YNXA 1PX7A 1T1VA 1NW2A 3RHBA 1FB6A 1UVZA 1FAAA 2YV9A 5LD0A 2CT6A 2G0FA 2RM6A 2H0HA 3KTLA 2L57A 4O7HA 3ERFA 4FYCA 1O8WA 2CZ2A 1G7OA 1GH2A 1PQNA 1OC9B 4TW5A 3PH9A 1Z9HA 4OCFA 1XOBA 1JZRA 2MMNA 18GSA 4IKHA 5AN1A 3QOUA 4MJAA 2HSYA 1J0FA 2XPDA 1PSQA 2R3XA 2X8HA 2YZHA 5D96A 1SENA 1T7PB 2YV7A 1XW6A 4EO3A 2ZNMA 5FWGA 2OE1A 1SKWB 1VF1A 4HU7A 1AIUA 3US3A 3IE3A 2I4AA 1H75A 2H6ZA 5IMZA 1THXA 2XHFA 1ERUA 2VIMA 4TR1B 4GQFA 3EMPA 2TIRA 1K3LA 4MF7A 6GSVA 4EUYA 4BA7A 4PQ1A 4CDOA 3H8QA 3F63A 1H4OA 4I6XA 4DSSA 3L4NA 1VRSD 4KSMA 1M9BA 1EP7A 4ZB6A 2B1LA 3E3EA 2CV4A 4P3YB 1TP9A 5D73A 4TR3A 1MDKA 2M46A 1HQOA 2GS3A 3EURA 4CW9A 1OE8A 2YP6A 4ILFA 2JL4A 3LXTA 1GSEA 2DMLA 4HI7A 5DCHA 4HUAA 3TUEA 1K3YA 3CTGA 1MDJA 2C1YA 4X0XA 1ZL9A 2DLXA 5HR1A 4HZ2A 3M9JA 3G7YA 2GSRA 5J4UA 3LG6A 2CQ9A 1JLVA 4I2TA 5JCGA 1B4PA 3W6GA 4N0VA 3ZREA 1A8YA 1WOUA
chains in the Genus database with same CATH superfamily
5CREA 1PKWA 1Z6NA 4YAPA 5D9VA 3HYPA 2JZTA 1G7EA 3M9KA 1WWJA 1XWKA 3D22A 4KW6A 1GULA 2FHEA 1K3OA 2F51A 4TXVA 2YN1A 5COHA 3IK7A 4L5OA 10GSA 2E2GA 4D73A 1VF4A 3IC4A 2N5BA 5EL8A 6GSUA 3TJJA 1T3BA 1QK8A 3QAVA 2GSTA 5GZZB 2FA4A 1V98A 4OWYA 1AAZA 1EV9A 2R5GA 4BPYA 5DQSA 3AY8A 1X5DA 1TRWA 3HA9A 1Q98A 4WXTA 3KCMA 5IMVA 2B1KA 1X9MB 4O92A 2PVOC 4EL1A 3RDWA 1YF0A 4EDZA 2GSSA 5DAKB 4TXOA 3EINA 3GTUA 4OO4A 3FZ4A 3BCIA 1TI1A 2CX3A 3QFAC 1F3AA 4I97A 2L6DA 2V32A 3KJYA 1Z7PA 5C04A 2J23A 2VLUA 4USSA 3UBKA 3VI5A 4MCUA 1J08A 1HNAA 1ON4A 2FLSA 4KB3A 1XFLA 1XW9A 2JACA 1M99A 1JLWA 2A4HA 1U6TA 3DKSA 3APQA 4TVEA 1VF3A 3VFIA 2LRCA 4ZL8A 1PRXA 2K8VA 3HVVA 4GSTA 5F8BA 2GZYA 3ISOA 4NWYA 3ZTLA 1EV4A 3GL5A 3H1NA 4K8MA 4AJ8A 4MDCA 5ID2A 2R0GA 3TKSC 2JADA 5AIXA 3ZFLA 2ON7A 4PGTA 1ZZYA 2AHEA 3FEUA 4RI6A 5B6NA 2YWOA 1X9WB 1E6BA 3HJOA 2EC4A 2X4AA 2YOIA 1B9XC 3D5JA 5HFGA 2ON5A 3TDGA 3CQFA 2CAIA 1GNEA 3KMOA 2HFDA 4GSNA 1K0CA 4ZXGA 5DCGA 3GKMA 1ZYNA 4IHUA 2D2ZA 1Z7RA 4CHSA 4NHWA 2LRTA 5J5NA 5F07A 17GSA 1BYEA 3UMAA 3WYWA 3P7XA 1O8XA 1OKTA 1XBSA 1PL1A 5F06A 2RUEA 1TKDB 3GSTA 3LEFA 3UBLA 4OD7A 5ECNB 2YPMA 3N9JA 6GSTA 2N5FA 1O7UA 2FA8A 2H1GA 2LKUA 3LYKA 3P2AA 3O76A 4K7NA 2VAFA 3I69A 5ECKB 3R2QA 1EOGA 1GSSA 3H4KA 2V41A 3ZVJA 4I8BA 3KEBA 3RHCA 1TK8B 1TU7A 3VURA 3QR6A 4J57E 2WDUA 1ZMAA 2AV4A 2LSTA 2B3SA 2L6CA 5GAPD 4KGIA 1A0FA 1F2EA 4FYBA 2YCDA 1JZWA 3IDVA 1WRYA 2LEGA 1RW1A 4Q5QA 2OACA 2H8LA 5ECLB 1UN2A 3F8UA 4L0UA 1EGRA 2QA2A 2LV3A 2RM5A 2IMKA 1AQWA 4G2EA 4MJEA 4EVMA 4WEYA 4XRDA 3UARA 1LU4A 3C1SA 3DXBA 2IMFA 4BIKA 3CMIA 3HY2A 3EE2A 3UOMA 1ML6A 3LYPA 5ECIB 4K0GA 5CRHA 1F37A 3A5IA 3GX0A 5HR3A 4NPBA 5IPGA 4GQCA 2H71A 4ID0A 2IJYA 3LJRA 4FIWA 3WD6A 2VL2A 3C73A 1TK0B 2GQLA 1SU9A 5A4WA 3TJFA 4K5SA 3VK9A 3ZMLA 5B6MA 2P0GA 4HOJA 4F0CA 5DJMA 3TKRA 2L4CA 3D6IA 5AISA 1M7TA 1HNCA 5E59A 5IMCA 2WGRA 3KH7A 1QMVA 11GSA 4HQSA 4YH2A 2K9FA 3BOAA 1M2DA 5ELGA 4KDUA 2R2JA 1QQ2A 3IPZA 2K6VA 1C72A 2A2RA 3QCPA 1TTZA 2TRXA 2C8UA 2FWHA 5A4UA 4ZBDA 1PL2A 1OE7A 3CYNA 3WGXA 2B7JA 2PMTA 3IAM2 1HNBA 1X0RA 3F4RA 3TKPA 4JBBA 1KTEA 1N8JA 1RQMA 4N10A 1LJRA 3CSIA 1EEJA 3TOTA 2V6KA 1GNWA 4PX1A 2DJ3A 2DJ1A 4GRFA 3C1RA 2NBSA 1PX6A 2HLSA 2QSIA 3UIWA 1XWGA 4QL9A 1X9SB 3BD2A 3I43A 2F3MA 3MYDA 5JCUA 1XWAA 3HXSA 5EPFA 3FR9A 1TW9A 5IMFA 1GWCA 1OAZA 2H75A 2WB9A 4ISDA 2HRAA 4Q5FA 3VWWA 2HYXA 2JSZA 2PU9C 3F6DA 3GIXA 3J7Yb 3EYTA 2FWGA 1XG8A 3F3RA 1K0AA 1LBKA 4NHZA 4H86A 1TDIA 4ML1A 4IQ1A 4MH3A 1T00A 3TRQA 2EIQA 3QD9A 3QFBC 3EU4A 4BL7A 3L78A 2L5OA 4ECIA 1GUKA 2PGTA 1O73A 3SWLA 4BWQA 4KA0A 5ECQB 3L9UA 3KP9A 3TJGA 3FW2A 2IFQB 4XRAA 1QXHA 2A2PA 1X5EA 4K5RA 3FR3A 1TRUA 4J2FA 5CRDA 1KEBA 3IHQA 1S3CA 4I5QA 3GUSA 1GP1A 2VCWA 3HJMA 1A0RP 3DYRA 2H72A 1Y25A 1FOVA 3HZ4A 2MBSA 1MD4A 4TKYA 4TRXA 2H1BA 1ERTA 2V2GA 1NHYA 2VLTA 4E8EA 2MMAA 2DKIA 2LQOA 3W8JA 3NZNA 2AYTA 2GGTA 3ZMKA 1YY7A 2FUG2 2R0CA 4PQIA 5B8AA 3ED3A 5EVOA 5DBQA 3IC8A 4MMMA 2VCXA 1WMJA 20GSA 1FW1A 5F0GA 1I9DA 2HRKA 2BJXA 4JR4A 3GYKA 4ECBA 5G1LA 4X4JA 4MJCA 4HEA2 2H1AA 4ZILA 3C7MA 2FCHA 4WF4A 3FR6A 3DMLA 5J3RA 3EVIA 2KP1A 2HZFA 3L0HA 2YWMA 3QAWA 1V40A 2B5YA 1GSQA 5DAKA 5IQYA 5IOXA 3GKNA 3KH9A 2DIZA 2VCVA 5D9XA 2K8SA 1S3AA 5ENUA 3UL3A 5J9BA 1IYIA 1PN0A 4K0NA 1F6MC 1UA5A 2MMZA 2DJJA 2FNOA 1M3IA 2WULA 4KH7A 4JZQA 4XS4A 3G7IA 16GSA 1DBYA 3A2WA 3R3EA 4JU5A 2H76A 2DJ0A 2REMA 5CRWA 2CVDA 3ZVJD 1SJZA 3SBCA 3BBYA 2OJLA 4NMUA 4ML6A 3UVTA 1XVQA 1PN9A 2E0QA 1SYXA 2HSMA 1THOA 2IL3A 3QMXA 1YQ1A 4WBJA 4POLA 4HS1A 3GHAA 5A5KA 4RI7A 2WFCA 3FRCA 2OE0A 1XWCA 3PGTA 3UEMA 3GX8A 3TB2A 2DSAA 3CBUA 1PGTA 2Z9SA 4Z7XA 1YKAA 4MF5A 5IMAA 1GTAA 2H6XA 4EF0A 4MZWA 4MJBA 4HJ2A 2GQMA 2H30A 1AC1A 1V58A 4NAXA 1YEPA 5AGYA 1CQHA 5CNWA 2G2QA 1YKCA 1GLPA 2O7KA 5JWRB 4N11A 3GH9A 1G6YA 1SD9A 3Q6OA 3EPTA 5CP1A 3Q19A 3UVHA 1FHEA 3S9FA 4K2XA 3VLNA 4YQVA 4O32A 3ZIVA 4I2UA 3DVXA 4WR5A 5GSSA 6GSYA 5IO0A 4TOPA 2C3TA 3TJBA 2VCQA 1TU8A 4KNDA 4AJ7A 1PA3A 2LUSA 1Z3EA 2X8GA 1DE1A 5GSTA 1FG4A 1FVKA 3L9VA 3U5RE 2MZCA 2YANA 2OADA 5JWOB 4OFTA 3PINA 5DALB 1ZYEA 1ABAA 4IJ3A 1OC8A 1NM3A 2IMIA 4YKGA 1SL0B 3L9SA 2VL9A 2IPAA 8GSSA 2B6MA 3TKSE 3ZIJA 1XIYA 1T4YA 2PVQA 1TRVA 2R6KA 4N0ZA 2WRTA 2GSQA 1R7HA 2IMEA 2P5QA 2LJRA 1BG5A 4TR4A 5G5EA 2RIIA 2H0IA 3TRXA 3ZLPA 3D21A 4E8HA 2QGVA 5G5FA 1VGLA 3LWAA 3RPNA 1U87A 1BQ7A 2VCZA 2XC2A 4GWRA 4G0KA 3IHGA 3BCKA 3I6AA 4LA1A 3LGCA 3F0IA 2F9SA 3IRAA 3QPMA 3CXGA 3HVXA 2WCIA 3EU3A 3APSA 4IQAA 4ZBAA 1B4QA 3GNJA 4X1UA 3GL3A 5AIVA 1XWBA 3TKQA 3TOUA 1WJKA 4TR0A 4TXOB 2J9HA 4HDEA 3DRNA 3IV4A 1S3RA 1ZYQB 1U88A 4PTSA 4WKWA 1IYHA 4WF5A 2WZ9A 4HZ4A 3H93A 4JR6A 3KMNA 4KUNA 3WGDA 3O3TA 4ZIJA 3GKXA 1YDKA 3RPPA 1SL2B 2X49A 1RK4A 4Q5RA 3M0FA 5DJLA 4XS1A 2VCTA 3KP8A 4IBPA 4V1Ag 4IN0A 1QFNA 2C3NA 4PUFC 3GA4A 2PPTA 5ABRA 4NV2A 2VL2C 2VLVA 4FH8A 1TRSA 2I9HA 2LJAA 4ZL7A 2N5AA 5H5RA 5D9TA 2IN3A 5ID2B 3A2VA 4G10A 5H5SA 3TRPA 6GSWA 3OR5A 1K0BA 2ZUPA 3HVNA 3ZL5A 2OBKA 9GSSA 2R37A 4EE0A 3VWUA 1Z5YE 2JZRA 4GXZA 4F82A 2HRFA 2WS2A 3ZZXA 1R4WA 5IO2A 2H6YA 5BRTA 2MBTA 3RBTA 2GDRA 5JCWA 2XBQA 5KN2A 3LFLA 12GSA 4CY6A 2O87A 3LORA 4V1Ap 3DGQA 3KGKA 2DJKA 2DKHA 2CVBA 1SJIA 4IGJA 3A3TA 1EOHA 5FHIA 1KNGA 4XCSA 3EMXA 5ECHB 1TK5B 2GLRA 5D8IA 2ZCTA 3EWLA 3HDCA 4TN8A 2AJQB 2V6OA 3MNGA 1EZKA 3IBHA 1ZOFA 2VD1A 2P31A 4EDYA 2HNLA 4KDXA 2DMMA 2IFQA 1TI3A 4G19A 1OC9A 4RQXA 2NPBA 4Q5NA 4PUAA 1ZGNA 3C8EA 3N5OA 5KOWA 1R5PA 4F2IA 1GTBA 4IW9A 1BX9A 1QUWA 3LXZA 3U6VA 2LNTA 2O89A 1OKDA 4F9ZA 4OFNA 4LL4B 4ZB8A 5KN1A 5FT3A 2HSHA 3C71A 2DBCA 4BVYA 4PXOA 3APOA 1U3AA 2DJ2A 2HZEB 1GSFA 2OA7A 3KXOA 3M3MA 3GH6A 1FVJA 1YF1A 2XPEA 3VI7A 4EXJA 3FZAA 5CO3A 4TR1A 2I1UA 3NIVA 1HYUA 3EC3A 2YJHA 1E2YA 3VWVA 1YZXA 3GMFA 1ERWA 2GT5A 1G6WA 3LSZA 4BVXA 1GLQA 4DVCA 4AGSA 3FY7A 3P8WA 4XTSA 4KSOA 5D9WA 1BAYA 1GSDA 1AQVA 2C4JA 4NXIA 3ZYWA 2JZSA 1YEXA 1WPIA 1JZDA 2VL3A 5CRGA 2B5EA 2GTUA 3IA1A 2IIYA 1WP0A 1F9MA 3LQ7A 4RQRA 2E2MA 1A24A 3KIJA 1FO5A 4K9ZA 3UJ1A 3D4MA 3KM6A 4WR4A 5G2ZA 3HCZA 3J7Yk 3DWVA 2HE3A 1HD2A 2LNSA 4EIQA 3F4TA 1DUGA 2H01A 2CX4A 2HXKA 1SKRB 2O85A 3DD3A 2M80A 4DSRA 1GSYA 2LJKA 1I5GA 3ME7A 1SYRA 2FWFA 5IM9A 2FGXA 2KUCA 2GVPA 5KN0A 3K8NA 3NOFA 4F03A 2DIYA 1EGOA 4ZBBA 5L71A 1SK2A 1PMTA 4IS0A 5DVBA 5HR0A 4MK3A 1T8EB 1UC7A 2DC5A 1EP8A 1GUMA 1K0DA 2VUPA 3A2XA 4POKA 4IP1A 2O8VB 1OVNA 5G30A 1M2BA 1JZOA 19GSA 4ZB9A 4G0LA 2PERA 4KE3A 3MWHA 4EC0A 3ERWA 5EY6A 1SKSB 5A4VA 3HVSA 1XZOA 2OBIA 1XW5A 1K0MA 4PQHA 2CVKA 2P5RA 4MH2A 4LLRA 3A5WA 3CRTA 3IR4A 1NSWA 1URMA 4MP4A 4F0BA 4GF0A 4J56E 2C0GA 4GLTA 2FY6A 4EKZA 3G9BA 3CTFA 2PN8A 1XPVA 4RUVA 4WETA 1TJDA 2NVLA 1S3DA 2L5LA 4PNGA 3I9V2 1Z6MA 2LS5A 3KD0A 5HR2A 1SK1A 5G31A 1K0OA 3ZFBA 3F9UA 1EEMA 3FZ9A 5CYYA 1R5AA 5DALA 5ECRB 1YJ6A 2OE3A 2FD3A 1SL1B 2I81A 1MTCA 2MMOA 4MZCA 1USBA 4N30A 4POBA 3FZ5A 1M0UA 5D93A 2H73A 1PKZA 4OCEA 1XOAA 5J41A 2GT6A 4KAEA 2CZ3A 5KN3A 4X43A 2NDOA 1BJXA 1VF2A 2RLIA 3HD5A 5J9CA 3HZ8A 4L5LA 2YJ7A 3VPTA 2VD0A 5IOWA 2GZPA 1ERVA 3F6FA 4LMVA 3QAGA 3D4TA 3VPQA 3W8SA 2CAQA 1O6JA 5GAND 4KCAA 3WGEA 1AXDA 5ECPB 3TCOA 5DQYA 1ACVA 4K7OA 3G7JA 4DSSB 1FB0A 4MF6A 4PNFA 5LNKe 3O6TA 4IJIA 2L4QA 4IELA 1AUCA 4IP6A 2I3YA 2IMDA 2EIOA 1JHBA 2VOCA 5H5QA 1N2AA 2H0GA 2H1DA 2BTOT 1MD3A 1DE2A 14GSA 2C3QA 1BEDA 1PD21 1SD8A 3MDKA 5C00A 4EIPA 3F3QA 1X5CA 4HSCX 4ICYA 3P90A 1SJ6A 1CQGA 4XHMA 5B7CA 4XS4B 1A2JA 4GCIA 3ZRDA 4KX4A 5F05A 5IIZA 4MNNA 1ST9A 1A23A 4FYUA 2EIRA 1M3JA 5KEJA 2AAWA 2PBJA 2KOKA 1ZCPA 1OYJA 4D73B 4MZBA 5BMUA 1GTIA 4XS6A 2F8AA 4K6XA 3GV1A 5HFIA 3WT1A 4JEDA 1B48A 4XIHA 1WIKA 4G9HA 1A2MA 4O5QA 2KHPA 4PURA 4L0WA 5KOXA 3IAS2 1XCCA 1NHOA 1J9BA 3TKSA 1DSBA 1G0TA 3RAZA 3CRUA 1A8LA 4MPFA 3E0UA 1PFOA 1V9WA 4KF9A 4JRRA 1GTUA 1K0NA 4YAVA 5INYA 3GTUB 1EWXA 2VO4A 2AB6A 2R0PA 4V2NA 3DEXA 4WBRD 5DDLA 2GQKA 1AQXA 3WT2A 4FQUA 2AUVA 4FO5A 1W89A 4GTUA 4AF2A 4KDYA 3TGZA 4K7IA 4YQUA 2X8CA 3UAPA 2LTKA 3M8NA 3DIEA 3IXRA 2OKAA 5LCZA 1F3BA 4ECJA 2KLXA 3QDNA 2HZEA 3DVWA 4MABA 1TXXA 1U3IA 2JSYA 3HKRA 1V2AA 1MDIA 3GSSA 7GSSA 2YWNA 3GKKA 1GUHA 2KP2A 4OMVA 2R4VA 2A2SA 3IK9A 1XXUA 1W4VA 4DEJA 3LW9A 3VWXA 4KCEA 1TOFA 1GSUA 4MLYA 22GSA 5E4WA 4LMWA 6GSSA 2QA1A 2F8FA 2E7PA 4ECCA 1GL8A 1A2LA 2CA8A 4L8EA 4AJ6A 2C0FA 2JU5A 4HQZA 4MA9A 3FMWA 3Q74A 3PR8A 3MIXA 1Q4JA 3ZITA 3FK8A 5HQPA 1B8XA 4Z2RA 2MYGA 2IWTA 5JWQB 1MEKA 4V2MA 4JE1A 1M9AA 4OFMA 4POMA 3JCML 2H66A 2VM1A 6GSXA 4Z2TA 2HI7A 2HRNA 3GFKA 1GRXA 2YZUA 3GRXA 2GZZA 1V57A 1O85A 1ZYPA 2ALBA 3H79A 5IPHA 2YWIA 4BWSA 3MAKA 1T4ZA 2C80A 4YQMA 2QC7A 2RUFA 5CAXA 1M2AA 3BJ5A 4NV5A 1SK0A 1AW9A 3CSJA 3D0ZA 3CSHA 3V1WA 4HU9A 2X64A 2C0EA 2L59A 2ES7A 5ECOB 3GURA 4DSQA 13GSA 4YKFA 1KBNA 5ELAA 4ACSA 5G1KA 2B7KA 4QQ7A 5B8BA 3ME8A 2H19A 2K18A 5HFKA 4O5UA 4ZL9A 3FHKA 3F4SA 1B9YC 5ECMB 3M1GA 3IOSA 2M72A 4LL1B 2VM2A 3MSZA 4K2DA 1R26A 1WE0A 4HJMA 2H70A 2HT9A 2B5XA 1QGVA 2WJUA 3GN3A 4O5RA 4GSSA 4OO5A 2TRCP 3FYGA 2H74A 4K1FA 3E9JB 3ERGA 2LQQA 3KZQA 1OC3A 3Q18A 3TJKA 2QKEA 3FKFA 3KTBA 1JFUA 2PUKC 2XBIA 2BMXA 5ECSA 2X99A 2A4VA 2LRNA 2NTOA 1ILOA 1O81A 1XVWA 2FWEA 4MPGA 4ULXA 2C0DA 4V2LA 3HJPA 5IMDA 4IVFA 3HHVA 1Y6EA 4QL7A 2PWJA 2V1MA 2YNXA 1PX7A 1T1VA 1NW2A 3RHBA 1FB6A 2UZ8A 1UVZA 1FAAA 2YV9A 5LD0A 2CT6A 2G0FA 2RM6A 2H0HA 3KTLA 2L57A 4O7HA 3ERFA 4FYCA 1O8WA 2CZ2A 1G7OA 1GH2A 1PQNA 1OC9B 4TW5A 3PH9A 1Z9HA 4OCFA 1XOBA 1JZRA 2MMNA 4A5PA 18GSA 4IKHA 5AN1A 3QOUA 4MJAA 2HSYA 1J0FA 2XPDA 1PSQA 2R3XA 2X8HA 2YZHA 5D96A 1SENA 1T7PB 2YV7A 1XW6A 4EO3A 2ZNMA 5FWGA 2OE1A 1SKWB 1VF1A 4HU7A 4BVYB 1AIUA 3US3A 3IE3A 2I4AA 1H75A 2H6ZA 5IMZA 1THXA 2XHFA 1ERUA 4G0IA 2VIMA 4TR1B 4GQFA 3EMPA 2TIRA 1FOHA 1K3LA 4MF7A 6GSVA 4EUYA 4BA7A 4PQ1A 4CDOA 3H8QA 3F63A 1H4OA 4I6XA 4DSSA 3L4NA 1VRSD 4Z2UA 4KSMA 1M9BA 1EP7A 4ZB6A 2B1LA 4BVXB 3E3EA 2CV4A 4P3YB 1TP9A 5D73A 4TR3A 1MDKA 2M46A 1HQOA 2GS3A 3EURA 4CW9A 1OE8A 2YP6A 4ILFA 2JL4A 3LXTA 1GSEA 2DMLA 4BL7B 4HI7A 5DCHA 4HUAA 3TUEA 1K3YA 3CTGA 1MDJA 2C1YA 4X0XA 1ZL9A 4CY8A 2DLXA 5HR1A 4HZ2A 3M9JA 3G7YA 3PPUA 2GSRA 5J4UA 3LG6A 2CQ9A 1JLVA 4I2TA 5JCGA 1B4PA 3W6GA 4N0VA 3ZREA 1A8YA 1WOUA
chains in the Genus database with same CATH topology
5CREA 1PKWA 1Z6NA 4YAPA 5D9VA 3HYPA 2JZTA 1G7EA 3M9KA 1WWJA 1XWKA 3D22A 4KW6A 1GULA 2FHEA 1K3OA 2F51A 4TXVA 2YN1A 5COHA 3IK7A 4L5OA 10GSA 2E2GA 4D73A 1VF4A 3IC4A 2N5BA 5EL8A 6GSUA 3TJJA 1T3BA 1QK8A 3QAVA 2GSTA 5GZZB 2FA4A 1V98A 4OWYA 1AAZA 1EV9A 2R5GA 4BPYA 5DQSA 3AY8A 1X5DA 1TRWA 3HA9A 1Q98A 4WXTA 3KCMA 5IMVA 2B1KA 1X9MB 4O92A 2PVOC 4EL1A 3RDWA 1YF0A 4EDZA 2GSSA 5DAKB 4TXOA 3EINA 3GTUA 4OO4A 3FZ4A 3BCIA 1TI1A 2CX3A 3QFAC 1F3AA 4I97A 2L6DA 2V32A 3KJYA 1Z7PA 5C04A 2J23A 2VLUA 4USSA 3UBKA 3VI5A 4MCUA 1J08A 1HNAA 1ON4A 2FLSA 4KB3A 1XFLA 1XW9A 2JACA 1M99A 1JLWA 2A4HA 1U6TA 3DKSA 3APQA 4TVEA 1VF3A 3VFIA 2LRCA 4ZL8A 1PRXA 2K8VA 3HVVA 4GSTA 5F8BA 2GZYA 3ISOA 4NWYA 3ZTLA 1EV4A 3GL5A 3H1NA 4K8MA 4AJ8A 4MDCA 5ID2A 2R0GA 3TKSC 2JADA 5AIXA 3ZFLA 2ON7A 4PGTA 1ZZYA 2AHEA 3FEUA 4RI6A 5B6NA 2YWOA 1X9WB 1E6BA 3HJOA 2EC4A 2X4AA 2YOIA 1B9XC 3D5JA 5HFGA 2ON5A 3TDGA 2CAIA 1GNEA 3KMOA 2HFDA 4GSNA 1K0CA 4ZXGA 5DCGA 3GKMA 1ZYNA 4IHUA 2D2ZA 1Z7RA 4CHSA 4NHWA 2LRTA 5J5NA 5F07A 17GSA 1BYEA 3UMAA 3WYWA 3P7XA 1O8XA 1OKTA 1XBSA 1PL1A 5F06A 2RUEA 1TKDB 3GSTA 3LEFA 3UBLA 4OD7A 5ECNB 2YPMA 3N9JA 6GSTA 2N5FA 1O7UA 2FA8A 2H1GA 2LKUA 3LYKA 3P2AA 3O76A 4K7NA 2VAFA 3I69A 5ECKB 3R2QA 1EOGA 1GSSA 3H4KA 2V41A 3ZVJA 4I8BA 3KEBA 3RHCA 1TK8B 1TU7A 3VURA 3QR6A 4J57E 2WDUA 1ZMAA 2AV4A 2LSTA 2B3SA 2L6CA 5GAPD 4KGIA 1A0FA 1F2EA 4FYBA 2YCDA 1JZWA 3IDVA 1WRYA 2LEGA 1RW1A 4Q5QA 2OACA 2H8LA 5ECLB 1UN2A 3F8UA 4L0UA 1EGRA 2QA2A 2LV3A 2RM5A 2IMKA 1AQWA 4G2EA 4MJEA 4EVMA 4WEYA 4XRDA 3UARA 1LU4A 3C1SA 3DXBA 2IMFA 3CMIA 3HY2A 3EE2A 3UOMA 1ML6A 3LYPA 5ECIB 4K0GA 5CRHA 1F37A 3A5IA 3GX0A 5HR3A 4NPBA 5IPGA 4GQCA 2H71A 4ID0A 2IJYA 3LJRA 4FIWA 3WD6A 2VL2A 3C73A 1TK0B 2GQLA 1SU9A 5A4WA 3TJFA 4K5SA 3VK9A 3ZMLA 5B6MA 2P0GA 4HOJA 4F0CA 5DJMA 3TKRA 2L4CA 3D6IA 5AISA 1M7TA 1HNCA 5E59A 5IMCA 2WGRA 3KH7A 1QMVA 11GSA 4HQSA 4YH2A 2K9FA 3BOAA 1M2DA 5ELGA 4KDUA 2R2JA 1QQ2A 3IPZA 2K6VA 1C72A 2A2RA 3QCPA 1TTZA 2TRXA 2C8UA 2FWHA 5A4UA 4ZBDA 1PL2A 1OE7A 3CYNA 3WGXA 2B7JA 2PMTA 3IAM2 1HNBA 1X0RA 3F4RA 3TKPA 4JBBA 1KTEA 1N8JA 1RQMA 4N10A 1LJRA 3CSIA 1EEJA 3TOTA 2V6KA 1GNWA 4PX1A 2DJ3A 2DJ1A 4GRFA 3C1RA 2NBSA 1PX6A 2HLSA 2QSIA 3UIWA 1XWGA 4QL9A 1X9SB 3BD2A 3I43A 2F3MA 3MYDA 5JCUA 1XWAA 3HXSA 5EPFA 3FR9A 1TW9A 5IMFA 1GWCA 1OAZA 2H75A 2WB9A 4ISDA 2HRAA 4Q5FA 3VWWA 2HYXA 2JSZA 2PU9C 3F6DA 3GIXA 3J7Yb 3EYTA 2FWGA 3F3RA 1K0AA 1LBKA 4NHZA 4H86A 1TDIA 4ML1A 4IQ1A 4MH3A 1T00A 3TRQA 2EIQA 3QD9A 3QFBC 3EU4A 4BL7A 3L78A 2L5OA 4ECIA 1GUKA 2PGTA 1O73A 3SWLA 4BWQA 4KA0A 5ECQB 3L9UA 3KP9A 3TJGA 3FW2A 2IFQB 4XRAA 1QXHA 2A2PA 1X5EA 4K5RA 3FR3A 1TRUA 4J2FA 5CRDA 1KEBA 3IHQA 1S3CA 4I5QA 3GUSA 1GP1A 2VCWA 3HJMA 1A0RP 3DYRA 2H72A 1Y25A 1FOVA 3HZ4A 2MBSA 1MD4A 4TKYA 4TRXA 2H1BA 1ERTA 2V2GA 1NHYA 2VLTA 4E8EA 2MMAA 2DKIA 2LQOA 3W8JA 3NZNA 2AYTA 2GGTA 3ZMKA 1YY7A 2FUG2 2R0CA 4PQIA 5B8AA 3ED3A 5EVOA 5DBQA 3IC8A 4MMMA 2VCXA 1WMJA 20GSA 1FW1A 5F0GA 1I9DA 2HRKA 2BJXA 4JR4A 3GYKA 4ECBA 5G1LA 4X4JA 4MJCA 4HEA2 2H1AA 4ZILA 3C7MA 2FCHA 4WF4A 3FR6A 3DMLA 5J3RA 3EVIA 2KP1A 2HZFA 3L0HA 2YWMA 3QAWA 1V40A 2B5YA 1GSQA 5DAKA 5IQYA 5IOXA 3GKNA 3KH9A 2DIZA 2VCVA 5D9XA 2K8SA 1S3AA 5ENUA 3UL3A 5J9BA 1IYIA 1PN0A 4K0NA 1F6MC 1UA5A 2MMZA 2DJJA 2FNOA 2WULA 4KH7A 4JZQA 4XS4A 3G7IA 16GSA 1DBYA 3A2WA 3R3EA 4JU5A 2H76A 2DJ0A 2REMA 5CRWA 2CVDA 3ZVJD 1SJZA 3SBCA 3BBYA 2OJLA 4NMUA 4ML6A 3UVTA 1XVQA 1PN9A 2E0QA 1SYXA 2HSMA 1THOA 2IL3A 3QMXA 1YQ1A 4WBJA 4POLA 4HS1A 3GHAA 5A5KA 4RI7A 2WFCA 3FRCA 2OE0A 1XWCA 3PGTA 3UEMA 3GX8A 3TB2A 2DSAA 3CBUA 1PGTA 2Z9SA 4Z7XA 1YKAA 4MF5A 5IMAA 1GTAA 2H6XA 4EF0A 4MZWA 4MJBA 4HJ2A 2GQMA 2H30A 1AC1A 1V58A 4NAXA 1YEPA 5AGYA 1CQHA 5CNWA 2G2QA 1YKCA 1GLPA 2O7KA 5JWRB 4N11A 3GH9A 1G6YA 1SD9A 3Q6OA 3EPTA 5CP1A 3Q19A 3UVHA 1FHEA 3S9FA 4K2XA 3VLNA 4YQVA 4O32A 3ZIVA 4I2UA 3DVXA 4WR5A 5GSSA 6GSYA 5IO0A 4TOPA 2C3TA 3TJBA 2VCQA 1TU8A 4KNDA 4AJ7A 1PA3A 2LUSA 1Z3EA 2X8GA 1DE1A 5GSTA 1FG4A 1FVKA 3L9VA 3U5RE 2MZCA 2YANA 2OADA 5JWOB 4OFTA 3PINA 5DALB 1ZYEA 1ABAA 4IJ3A 1OC8A 1NM3A 2IMIA 4YKGA 1SL0B 3L9SA 2VL9A 2IPAA 8GSSA 2B6MA 3TKSE 3ZIJA 1XIYA 1T4YA 2PVQA 1TRVA 2R6KA 4N0ZA 2WRTA 2GSQA 1R7HA 2IMEA 2P5QA 2LJRA 1BG5A 4TR4A 5G5EA 2RIIA 2H0IA 3TRXA 3ZLPA 3D21A 4E8HA 2QGVA 5G5FA 1VGLA 3LWAA 3RPNA 1U87A 1BQ7A 2VCZA 2XC2A 4GWRA 4G0KA 3IHGA 3BCKA 3I6AA 4LA1A 3LGCA 3F0IA 2F9SA 3IRAA 3QPMA 3CXGA 3HVXA 2WCIA 3EU3A 3APSA 4IQAA 4ZBAA 1B4QA 3GNJA 4X1UA 3GL3A 5AIVA 1XWBA 3TKQA 3TOUA 1WJKA 4TR0A 4TXOB 2J9HA 4HDEA 3DRNA 3IV4A 1ZYQB 1U88A 4PTSA 4WKWA 1IYHA 4WF5A 2WZ9A 4HZ4A 3H93A 4JR6A 3KMNA 4KUNA 3WGDA 3O3TA 4ZIJA 3GKXA 1YDKA 3RPPA 1SL2B 2X49A 1RK4A 4Q5RA 3M0FA 5DJLA 4XS1A 2VCTA 3KP8A 4IBPA 4V1Ag 4IN0A 1QFNA 2C3NA 4PUFC 3GA4A 2PPTA 5ABRA 4NV2A 2VL2C 2VLVA 4FH8A 1TRSA 2I9HA 2LJAA 4ZL7A 2N5AA 5H5RA 5D9TA 2IN3A 5ID2B 3A2VA 4G10A 5H5SA 3TRPA 6GSWA 3OR5A 1K0BA 2ZUPA 3ZL5A 2OBKA 9GSSA 2R37A 4EE0A 3VWUA 1Z5YE 2JZRA 4GXZA 4F82A 2HRFA 2WS2A 3ZZXA 1R4WA 5IO2A 2H6YA 5BRTA 2MBTA 3RBTA 2GDRA 5JCWA 2XBQA 5KN2A 3LFLA 12GSA 4CY6A 2O87A 3LORA 4V1Ap 3DGQA 3KGKA 2DJKA 2DKHA 2CVBA 1SJIA 4IGJA 3A3TA 1EOHA 5FHIA 1KNGA 4XCSA 3EMXA 5ECHB 1TK5B 2GLRA 5D8IA 2ZCTA 3EWLA 3HDCA 4TN8A 2AJQB 2V6OA 3MNGA 1EZKA 3IBHA 1ZOFA 2VD1A 2P31A 4EDYA 2HNLA 4KDXA 2DMMA 2IFQA 1TI3A 4G19A 1OC9A 4RQXA 2NPBA 4Q5NA 4PUAA 1ZGNA 3C8EA 3N5OA 5KOWA 1R5PA 4F2IA 1GTBA 4IW9A 1BX9A 1QUWA 3LXZA 3U6VA 2LNTA 2O89A 1OKDA 4F9ZA 4OFNA 4LL4B 4ZB8A 5KN1A 5FT3A 2HSHA 3C71A 2DBCA 4BVYA 4PXOA 3APOA 1U3AA 2DJ2A 2HZEB 1GSFA 2OA7A 3KXOA 3M3MA 3GH6A 1FVJA 1YF1A 2XPEA 3VI7A 4EXJA 3FZAA 5CO3A 4TR1A 2I1UA 3NIVA 1HYUA 3EC3A 2YJHA 1E2YA 3VWVA 1YZXA 3GMFA 1ERWA 2GT5A 1G6WA 3LSZA 4BVXA 1GLQA 4DVCA 4AGSA 3FY7A 3P8WA 4XTSA 4KSOA 5D9WA 1BAYA 1GSDA 1AQVA 2C4JA 4NXIA 3ZYWA 2JZSA 1YEXA 1WPIA 1JZDA 2VL3A 5CRGA 2B5EA 2GTUA 3IA1A 2IIYA 1WP0A 1F9MA 3LQ7A 4RQRA 2E2MA 1A24A 3KIJA 1FO5A 4K9ZA 3UJ1A 3D4MA 3KM6A 4WR4A 5G2ZA 3HCZA 3J7Yk 3DWVA 2HE3A 1HD2A 2LNSA 4EIQA 3F4TA 1DUGA 2H01A 2CX4A 2HXKA 1SKRB 2O85A 3DD3A 2M80A 4DSRA 1GSYA 2LJKA 1I5GA 3ME7A 1SYRA 2FWFA 5IM9A 2FGXA 2KUCA 2GVPA 5KN0A 3K8NA 3NOFA 4F03A 2DIYA 1EGOA 4ZBBA 5L71A 1SK2A 1PMTA 4IS0A 5DVBA 5HR0A 4MK3A 1T8EB 1UC7A 2DC5A 1EP8A 1GUMA 1K0DA 2VUPA 3A2XA 4POKA 4IP1A 2O8VB 1OVNA 5G30A 1M2BA 1JZOA 19GSA 4ZB9A 4G0LA 2PERA 4KE3A 3MWHA 4EC0A 3ERWA 5EY6A 1SKSB 5A4VA 3HVSA 1XZOA 2OBIA 1XW5A 1K0MA 4PQHA 2CVKA 2P5RA 4MH2A 4LLRA 3A5WA 3CRTA 3IR4A 1NSWA 1URMA 4MP4A 4F0BA 4GF0A 4J56E 2C0GA 4GLTA 2FY6A 4EKZA 3G9BA 3CTFA 2PN8A 1XPVA 4RUVA 4WETA 1TJDA 2NVLA 1S3DA 2L5LA 4PNGA 3I9V2 1Z6MA 2LS5A 3KD0A 5HR2A 1SK1A 5G31A 1K0OA 3ZFBA 3F9UA 1EEMA 3FZ9A 5CYYA 1R5AA 5DALA 5ECRB 1YJ6A 2OE3A 2FD3A 1SL1B 2I81A 1MTCA 2MMOA 4MZCA 1USBA 4N30A 4POBA 3FZ5A 1M0UA 5D93A 2H73A 1PKZA 4OCEA 1XOAA 5J41A 2GT6A 4KAEA 2CZ3A 5KN3A 4X43A 2NDOA 1BJXA 1VF2A 2RLIA 3HD5A 5J9CA 3HZ8A 4L5LA 2YJ7A 3VPTA 2VD0A 5IOWA 2GZPA 1ERVA 3F6FA 4LMVA 3QAGA 3D4TA 3VPQA 3W8SA 2CAQA 1O6JA 5GAND 4KCAA 3WGEA 1AXDA 5ECPB 3TCOA 5DQYA 1ACVA 4K7OA 3G7JA 4DSSB 1FB0A 4MF6A 4PNFA 5LNKe 3O6TA 4IJIA 2L4QA 4IELA 1AUCA 4IP6A 2I3YA 2IMDA 2EIOA 1JHBA 2VOCA 5H5QA 1N2AA 2H0GA 2H1DA 2BTOT 1MD3A 1DE2A 14GSA 2C3QA 1BEDA 1PD21 1SD8A 3MDKA 5C00A 4EIPA 3F3QA 1X5CA 4ICYA 3P90A 1SJ6A 1CQGA 4XHMA 5B7CA 4XS4B 1A2JA 4GCIA 3ZRDA 4KX4A 5F05A 5IIZA 4MNNA 1ST9A 1A23A 4FYUA 2EIRA 5KEJA 2AAWA 2PBJA 2KOKA 1ZCPA 1OYJA 4D73B 4MZBA 5BMUA 1GTIA 4XS6A 2F8AA 4K6XA 3GV1A 5HFIA 3WT1A 4JEDA 1B48A 4XIHA 1WIKA 4G9HA 1A2MA 4O5QA 2KHPA 4PURA 4L0WA 5KOXA 3IAS2 1XCCA 1NHOA 1J9BA 3TKSA 1DSBA 1G0TA 3RAZA 3CRUA 1A8LA 4MPFA 3E0UA 1V9WA 4KF9A 4JRRA 1GTUA 1K0NA 4YAVA 5INYA 3GTUB 1EWXA 2VO4A 2AB6A 2R0PA 4V2NA 3DEXA 4WBRD 5DDLA 2GQKA 1AQXA 3WT2A 4FQUA 2AUVA 4FO5A 1W89A 4GTUA 4AF2A 4KDYA 3TGZA 4K7IA 4YQUA 2X8CA 3UAPA 2LTKA 3M8NA 3DIEA 3IXRA 2OKAA 5LCZA 1F3BA 4ECJA 2KLXA 3QDNA 2HZEA 3DVWA 4MABA 1TXXA 1U3IA 2JSYA 3HKRA 1V2AA 1MDIA 3GSSA 7GSSA 2YWNA 3GKKA 1GUHA 2KP2A 4OMVA 2R4VA 2A2SA 3IK9A 1XXUA 1W4VA 4DEJA 3LW9A 3VWXA 4KCEA 1TOFA 1GSUA 4MLYA 22GSA 5E4WA 4LMWA 6GSSA 2QA1A 2F8FA 2E7PA 4ECCA 1GL8A 1A2LA 2CA8A 4L8EA 4AJ6A 2C0FA 2JU5A 4HQZA 4MA9A 3FMWA 3Q74A 3PR8A 3MIXA 1Q4JA 3ZITA 3FK8A 5HQPA 1B8XA 4Z2RA 2MYGA 2IWTA 5JWQB 1MEKA 4V2MA 4JE1A 1M9AA 4OFMA 4POMA 3JCML 2H66A 2VM1A 6GSXA 4Z2TA 2HI7A 2HRNA 3GFKA 1GRXA 2YZUA 3GRXA 2GZZA 1V57A 1O85A 1ZYPA 2ALBA 3H79A 5IPHA 2YWIA 4BWSA 3MAKA 1T4ZA 2C80A 4YQMA 2QC7A 2RUFA 5CAXA 1M2AA 3BJ5A 4NV5A 1SK0A 1AW9A 3CSJA 3D0ZA 3CSHA 3V1WA 4HU9A 2X64A 2C0EA 2L59A 2ES7A 5ECOB 3GURA 4DSQA 13GSA 4YKFA 1KBNA 5ELAA 4ACSA 5G1KA 2B7KA 4QQ7A 5B8BA 3ME8A 2H19A 2K18A 5HFKA 4O5UA 4ZL9A 3FHKA 3F4SA 1B9YC 5ECMB 3M1GA 3IOSA 2M72A 4LL1B 2VM2A 3MSZA 4K2DA 1R26A 1WE0A 4HJMA 2H70A 2HT9A 2B5XA 1QGVA 2WJUA 3GN3A 4O5RA 4GSSA 4OO5A 2TRCP 3FYGA 2H74A 4K1FA 3E9JB 3ERGA 2LQQA 3KZQA 1OC3A 3Q18A 3TJKA 2QKEA 3FKFA 3KTBA 1JFUA 2PUKC 2XBIA 2BMXA 5ECSA 2X99A 2A4VA 2LRNA 2NTOA 1ILOA 1O81A 1XVWA 2FWEA 4MPGA 4ULXA 2C0DA 4V2LA 3HJPA 5IMDA 4IVFA 3HHVA 1Y6EA 4QL7A 2PWJA 2V1MA 2YNXA 1PX7A 1T1VA 1NW2A 3RHBA 1FB6A 2UZ8A 1UVZA 1FAAA 2YV9A 5LD0A 2CT6A 2G0FA 2RM6A 2H0HA 3KTLA 2L57A 4O7HA 3ERFA 4FYCA 1O8WA 2CZ2A 1G7OA 1GH2A 1PQNA 1OC9B 4TW5A 3PH9A 1Z9HA 4OCFA 1XOBA 1JZRA 2MMNA 4A5PA 18GSA 4IKHA 5AN1A 3QOUA 4MJAA 2HSYA 1J0FA 2XPDA 1PSQA 2R3XA 2X8HA 2YZHA 5D96A 1SENA 1T7PB 2YV7A 1XW6A 4EO3A 2ZNMA 5FWGA 2OE1A 1SKWB 1VF1A 4HU7A 4BVYB 1AIUA 3US3A 3IE3A 2I4AA 1H75A 2H6ZA 5IMZA 1THXA 2XHFA 1ERUA 4G0IA 2VIMA 4TR1B 4GQFA 3EMPA 2TIRA 1FOHA 1K3LA 4MF7A 6GSVA 4EUYA 4BA7A 4PQ1A 4CDOA 3H8QA 3F63A 1H4OA 4I6XA 4DSSA 3L4NA 1VRSD 4Z2UA 4KSMA 1M9BA 1EP7A 4ZB6A 2B1LA 4BVXB 3E3EA 2CV4A 4P3YB 1TP9A 5D73A 4TR3A 1MDKA 2M46A 1HQOA 2GS3A 3EURA 4CW9A 1OE8A 2YP6A 4ILFA 2JL4A 3LXTA 1GSEA 2DMLA 4BL7B 4HI7A 5DCHA 4HUAA 3TUEA 1K3YA 3CTGA 1MDJA 2C1YA 4X0XA 1ZL9A 4CY8A 2DLXA 5HR1A 4HZ2A 3M9JA 3G7YA 3PPUA 2GSRA 5J4UA 3LG6A 2CQ9A 1JLVA 4I2TA 5JCGA 1B4PA 3W6GA 4N0VA 3ZREA 1A8YA 1WOUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CRE A;  1PKW A;  1Z6N A;  4YAP A;  5D9V A;  3HYP A;  2JZT A;  1G7E A;  3M9K A;  1WWJ A;  1XWK A;  3D22 A;  4KW6 A;  1GUL A;  2FHE A;  1K3O A;  2F51 A;  4TXV A;  2YN1 A;  5COH A;  3IK7 A;  4L5O A;  10GS A;  2E2G A;  4D73 A;  1VF4 A;  3IC4 A;  2N5B A;  5EL8 A;  6GSU A;  3TJJ A;  1T3B A;  1QK8 A;  3QAV A;  2GST A;  5GZZ B;  2FA4 A;  1V98 A;  4OWY A;  1AAZ A;  1EV9 A;  2R5G A;  4BPY A;  5DQS A;  3AY8 A;  1X5D A;  1TRW A;  3HA9 A;  1Q98 A;  4WXT A;  3KCM A;  5IMV A;  2B1K A;  1X9M B;  4O92 A;  2PVO C;  4EL1 A;  3RDW A;  1YF0 A;  4EDZ A;  2GSS A;  5DAK B;  4TXO A;  3EIN A;  3GTU A;  4OO4 A;  3FZ4 A;  3BCI A;  1TI1 A;  2CX3 A;  3QFA C;  1F3A A;  4I97 A;  2L6D A;  2V32 A;  3KJY A;  1Z7P A;  5C04 A;  2J23 A;  2VLU A;  3UBK A;  3VI5 A;  4MCU A;  1J08 A;  1HNA A;  1ON4 A;  2FLS A;  4KB3 A;  1XFL A;  1XW9 A;  2JAC A;  1M99 A;  1JLW A;  1U6T A;  3DKS A;  3APQ A;  4TVE A;  1VF3 A;  3VFI A;  2LRC A;  4ZL8 A;  1PRX A;  2K8V A;  3HVV A;  4GST A;  5F8B A;  2GZY A;  3ISO A;  4NWY A;  3ZTL A;  1EV4 A;  3GL5 A;  3H1N A;  4K8M A;  4AJ8 A;  4MDC A;  5ID2 A;  3TKS C;  2JAD A;  5AIX A;  3ZFL A;  2ON7 A;  4PGT A;  1ZZY A;  2AHE A;  3FEU A;  4RI6 A;  5B6N A;  2YWO A;  1X9W B;  1E6B A;  3HJO A;  2EC4 A;  2YOI A;  1B9X C;  3D5J A;  5HFG A;  2ON5 A;  3TDG A;  2CAI A;  1GNE A;  3KMO A;  2HFD A;  4GSN A;  1K0C A;  4ZXG A;  5DCG A;  3GKM A;  4IHU A;  2D2Z A;  1Z7R A;  4CHS A;  4NHW A;  2LRT A;  5J5N A;  5F07 A;  17GS A;  1BYE A;  3UMA A;  3WYW A;  3P7X A;  1O8X A;  1OKT A;  1XBS A;  1PL1 A;  5F06 A;  2RUE A;  1TKD B;  3GST A;  3LEF A;  3UBL A;  4OD7 A;  5ECN B;  2YPM A;  3N9J A;  6GST A;  2N5F A;  1O7U A;  2FA8 A;  2H1G A;  2LKU A;  3LYK A;  3P2A A;  3O76 A;  4K7N A;  2VAF A;  3I69 A;  5ECK B;  3R2Q A;  1EOG A;  1GSS A;  3H4K A;  2V41 A;  3ZVJ A;  4I8B A;  3KEB A;  3RHC A;  1TK8 B;  1TU7 A;  3VUR A;  3QR6 A;  4J57 E;  2WDU A;  1ZMA A;  2AV4 A;  2LST A;  2B3S A;  2L6C A;  5GAP D;  4KGI A;  1A0F A;  1F2E A;  4FYB A;  2YCD A;  1JZW A;  3IDV A;  1WRY A;  2LEG A;  1RW1 A;  4Q5Q A;  2OAC A;  2H8L A;  5ECL B;  1UN2 A;  3F8U A;  4L0U A;  1EGR A;  2LV3 A;  2RM5 A;  2IMK A;  1AQW A;  4G2E A;  4MJE A;  4EVM A;  4WEY A;  4XRD A;  3UAR A;  1LU4 A;  3C1S A;  3DXB A;  2IMF A;  3CMI A;  3HY2 A;  3EE2 A;  3UOM A;  1ML6 A;  3LYP A;  5ECI B;  4K0G A;  5CRH A;  1F37 A;  3GX0 A;  5HR3 A;  4NPB A;  5IPG A;  4GQC A;  2H71 A;  4ID0 A;  2IJY A;  3LJR A;  4FIW A;  3WD6 A;  2VL2 A;  3C73 A;  1TK0 B;  2GQL A;  1SU9 A;  5A4W A;  3TJF A;  3VK9 A;  3ZML A;  5B6M A;  2P0G A;  4HOJ A;  4F0C A;  5DJM A;  3TKR A;  2L4C A;  3D6I A;  5AIS A;  1M7T A;  1HNC A;  5E59 A;  5IMC A;  2WGR A;  3KH7 A;  1QMV A;  11GS A;  4HQS A;  4YH2 A;  2K9F A;  3BOA A;  1M2D A;  5ELG A;  4KDU A;  2R2J A;  1QQ2 A;  3IPZ A;  2K6V A;  1C72 A;  2A2R A;  3QCP A;  1TTZ A;  2TRX A;  2C8U A;  2FWH A;  5A4U A;  4ZBD A;  1PL2 A;  1OE7 A;  3CYN A;  3WGX A;  2B7J A;  2PMT A;  3IAM 2;  1HNB A;  1X0R A;  3F4R A;  3TKP A;  4JBB A;  1KTE A;  1N8J A;  1RQM A;  4N10 A;  1LJR A;  3CSI A;  1EEJ A;  3TOT A;  2V6K A;  1GNW A;  4PX1 A;  2DJ3 A;  2DJ1 A;  4GRF A;  3C1R A;  2NBS A;  1PX6 A;  2HLS A;  2QSI A;  3UIW A;  1XWG A;  4QL9 A;  1X9S B;  3BD2 A;  3I43 A;  2F3M A;  5JCU A;  1XWA A;  3HXS A;  5EPF A;  3FR9 A;  1TW9 A;  5IMF A;  1GWC A;  1OAZ A;  2H75 A;  2WB9 A;  4ISD A;  4Q5F A;  3VWW A;  2HYX A;  2JSZ A;  2PU9 C;  3F6D A;  3GIX A;  3J7Y b;  3EYT A;  2FWG A;  3F3R A;  1K0A A;  1LBK A;  4NHZ A;  4H86 A;  1TDI A;  4ML1 A;  4IQ1 A;  4MH3 A;  1T00 A;  3TRQ A;  2EIQ A;  3QD9 A;  3QFB C;  3EU4 A;  4BL7 A;  3L78 A;  2L5O A;  4ECI A;  1GUK A;  2PGT A;  1O73 A;  3SWL A;  4BWQ A;  4KA0 A;  5ECQ B;  3L9U A;  3KP9 A;  3TJG A;  3FW2 A;  2IFQ B;  4XRA A;  1QXH A;  1X5E A;  3FR3 A;  1TRU A;  4J2F A;  5CRD A;  1KEB A;  3IHQ A;  1S3C A;  4I5Q A;  3GUS A;  1GP1 A;  2VCW A;  3HJM A;  1A0R P;  3DYR A;  2H72 A;  1Y25 A;  1FOV A;  3HZ4 A;  2MBS A;  1MD4 A;  4TKY A;  4TRX A;  2H1B A;  1ERT A;  2V2G A;  1NHY A;  2VLT A;  4E8E A;  2MMA A;  2LQO A;  3W8J A;  3NZN A;  2AYT A;  2GGT A;  3ZMK A;  1YY7 A;  2FUG 2;  4PQI A;  5B8A A;  3ED3 A;  5EVO A;  5DBQ A;  4MMM A;  2VCX A;  1WMJ A;  20GS A;  1FW1 A;  5F0G A;  1I9D A;  2BJX A;  4JR4 A;  3GYK A;  4ECB A;  5G1L A;  4MJC A;  4HEA 2;  2H1A A;  4ZIL A;  3C7M A;  2FCH A;  4WF4 A;  3FR6 A;  3DML A;  5J3R A;  3EVI A;  2KP1 A;  2HZF A;  3L0H A;  2YWM A;  3QAW A;  1V40 A;  2B5Y A;  1GSQ A;  5DAK A;  5IQY A;  5IOX A;  3GKN A;  3KH9 A;  2DIZ A;  2VCV A;  5D9X A;  2K8S A;  1S3A A;  5ENU A;  3UL3 A;  5J9B A;  1IYI A;  4K0N A;  1F6M C;  1UA5 A;  2MMZ A;  2DJJ A;  2FNO A;  2WUL A;  4KH7 A;  4JZQ A;  4XS4 A;  3G7I A;  16GS A;  1DBY A;  3A2W A;  4JU5 A;  2H76 A;  2DJ0 A;  2REM A;  5CRW A;  2CVD A;  3ZVJ D;  1SJZ A;  3SBC A;  3BBY A;  2OJL A;  4NMU A;  4ML6 A;  3UVT A;  1XVQ A;  1PN9 A;  2E0Q A;  1SYX A;  1THO A;  2IL3 A;  3QMX A;  1YQ1 A;  4WBJ A;  4POL A;  4HS1 A;  3GHA A;  5A5K A;  4RI7 A;  2WFC A;  3FRC A;  2OE0 A;  1XWC A;  3PGT A;  3UEM A;  3GX8 A;  3TB2 A;  2DSA A;  3CBU A;  1PGT A;  2Z9S A;  4Z7X A;  1YKA A;  4MF5 A;  5IMA A;  1GTA A;  2H6X A;  4EF0 A;  4MZW A;  4MJB A;  4HJ2 A;  2GQM A;  2H30 A;  1AC1 A;  1V58 A;  4NAX A;  1YEP A;  5AGY A;  1CQH A;  5CNW A;  2G2Q A;  1YKC A;  1GLP A;  2O7K A;  5JWR B;  4N11 A;  3GH9 A;  1G6Y A;  1SD9 A;  3Q6O A;  5CP1 A;  3Q19 A;  3UVH A;  1FHE A;  3S9F A;  3VLN A;  4YQV A;  4O32 A;  3ZIV A;  4I2U A;  3DVX A;  4WR5 A;  5GSS A;  6GSY A;  5IO0 A;  4TOP A;  2C3T A;  3TJB A;  2VCQ A;  1TU8 A;  4KND A;  4AJ7 A;  1PA3 A;  2LUS A;  1Z3E A;  2X8G A;  1DE1 A;  5GST A;  1FG4 A;  1FVK A;  3L9V A;  3U5R E;  2MZC A;  2YAN A;  2OAD A;  5JWO B;  4OFT A;  3PIN A;  5DAL B;  1ZYE A;  1ABA A;  4IJ3 A;  1OC8 A;  1NM3 A;  2IMI A;  1SL0 B;  3L9S A;  2VL9 A;  2IPA A;  8GSS A;  2B6M A;  3TKS E;  3ZIJ A;  1XIY A;  1T4Y A;  2PVQ A;  1TRV A;  2R6K A;  4N0Z A;  2WRT A;  2GSQ A;  1R7H A;  2IME A;  2P5Q A;  2LJR A;  1BG5 A;  4TR4 A;  5G5E A;  2RII A;  2H0I A;  3TRX A;  3ZLP A;  3D21 A;  4E8H A;  2QGV A;  5G5F A;  1VGL A;  3LWA A;  3RPN A;  1U87 A;  1BQ7 A;  2VCZ A;  2XC2 A;  4GWR A;  3BCK A;  3I6A A;  4LA1 A;  3LGC A;  3F0I A;  2F9S A;  3IRA A;  3QPM A;  3CXG A;  3HVX A;  2WCI A;  3EU3 A;  3APS A;  4IQA A;  4ZBA A;  1B4Q A;  3GNJ A;  4X1U A;  3GL3 A;  5AIV A;  1XWB A;  3TKQ A;  3TOU A;  1WJK A;  4TR0 A;  4TXO B;  2J9H A;  4HDE A;  3DRN A;  3IV4 A;  1ZYQ B;  1U88 A;  4WKW A;  1IYH A;  4WF5 A;  2WZ9 A;  4HZ4 A;  3H93 A;  4JR6 A;  3KMN A;  4KUN A;  3WGD A;  3O3T A;  4ZIJ A;  3GKX A;  1YDK A;  3RPP A;  1SL2 B;  4Q5R A;  1RK4 A;  3M0F A;  5DJL A;  4XS1 A;  2VCT A;  3KP8 A;  4IBP A;  4V1A g;  4IN0 A;  1QFN A;  2C3N A;  4PUF C;  3GA4 A;  2PPT A;  5ABR A;  4NV2 A;  2VL2 C;  2VLV A;  4FH8 A;  1TRS A;  2I9H A;  2LJA A;  4ZL7 A;  2N5A A;  5H5R A;  5D9T A;  2IN3 A;  5ID2 B;  3A2V A;  4G10 A;  5H5S A;  3TRP A;  6GSW A;  3OR5 A;  1K0B A;  2ZUP A;  3ZL5 A;  2OBK A;  9GSS A;  2R37 A;  4EE0 A;  3VWU A;  1Z5Y E;  2JZR A;  4GXZ A;  4F82 A;  2HRF A;  2WS2 A;  3ZZX A;  1R4W A;  5IO2 A;  2H6Y A;  2MBT A;  3RBT A;  2GDR A;  5JCW A;  2XBQ A;  5KN2 A;  3LFL A;  12GS A;  2O87 A;  3LOR A;  4V1A p;  3DGQ A;  3KGK A;  2DJK A;  2CVB A;  1SJI A;  4IGJ A;  3A3T A;  1EOH A;  5FHI A;  1KNG A;  4XCS A;  3EMX A;  5ECH B;  1TK5 B;  2GLR A;  5D8I A;  2ZCT A;  3EWL A;  3HDC A;  4TN8 A;  2AJQ B;  2V6O A;  3MNG A;  1EZK A;  3IBH A;  1ZOF A;  2VD1 A;  2P31 A;  4EDY A;  2HNL A;  4KDX A;  2DMM A;  2IFQ A;  1TI3 A;  4G19 A;  1OC9 A;  4RQX A;  2NPB A;  4Q5N A;  4PUA A;  1ZGN A;  3C8E A;  3N5O A;  1R5P A;  4F2I A;  1GTB A;  4IW9 A;  1BX9 A;  1QUW A;  3LXZ A;  3U6V A;  2LNT A;  2O89 A;  1OKD A;  4F9Z A;  4OFN A;  4LL4 B;  4ZB8 A;  5KN1 A;  5FT3 A;  2HSH A;  3C71 A;  2DBC A;  4BVY A;  4PXO A;  3APO A;  1U3A A;  2DJ2 A;  2HZE B;  1GSF A;  2OA7 A;  3KXO A;  3M3M A;  3GH6 A;  1FVJ A;  1YF1 A;  2XPE A;  3VI7 A;  4EXJ A;  3FZA A;  5CO3 A;  4TR1 A;  2I1U A;  3NIV A;  1HYU A;  3EC3 A;  2YJH A;  1E2Y A;  3VWV A;  1YZX A;  3GMF A;  1ERW A;  2GT5 A;  1G6W A;  3LSZ A;  4BVX A;  1GLQ A;  4DVC A;  4AGS A;  3FY7 A;  3P8W A;  4XTS A;  4KSO A;  5D9W A;  1BAY A;  1GSD A;  1AQV A;  2C4J A;  4NXI A;  3ZYW A;  2JZS A;  1YEX A;  1WPI A;  1JZD A;  2VL3 A;  5CRG A;  2B5E A;  2GTU A;  3IA1 A;  2IIY A;  1WP0 A;  1F9M A;  3LQ7 A;  4RQR A;  2E2M A;  1A24 A;  3KIJ A;  1FO5 A;  4K9Z A;  3UJ1 A;  3D4M A;  3KM6 A;  4WR4 A;  5G2Z A;  3HCZ A;  3J7Y k;  3DWV A;  2HE3 A;  1HD2 A;  2LNS A;  3F4T A;  1DUG A;  2H01 A;  2CX4 A;  2HXK A;  1SKR B;  2O85 A;  3DD3 A;  2M80 A;  4DSR A;  1GSY A;  2LJK A;  1I5G A;  3ME7 A;  1SYR A;  2FWF A;  5IM9 A;  2FGX A;  2KUC A;  2GVP A;  5KN0 A;  3K8N A;  3NOF A;  4F03 A;  2DIY A;  1EGO A;  4ZBB A;  5L71 A;  1SK2 A;  1PMT A;  4IS0 A;  5DVB A;  5HR0 A;  4MK3 A;  1T8E B;  1UC7 A;  2DC5 A;  1EP8 A;  1GUM A;  1K0D A;  2VUP A;  3A2X A;  4POK A;  4IP1 A;  2O8V B;  1OVN A;  5G30 A;  1M2B A;  1JZO A;  19GS A;  4ZB9 A;  2PER A;  4KE3 A;  3MWH A;  4EC0 A;  3ERW A;  5EY6 A;  1SKS B;  5A4V A;  3HVS A;  1XZO A;  2OBI A;  1XW5 A;  1K0M A;  4PQH A;  2CVK A;  2P5R A;  4MH2 A;  4LLR A;  3A5W A;  3CRT A;  3IR4 A;  1NSW A;  1URM A;  4MP4 A;  4F0B A;  4GF0 A;  4J56 E;  2C0G A;  4GLT A;  2FY6 A;  4EKZ A;  3G9B A;  3CTF A;  2PN8 A;  1XPV A;  4RUV A;  4WET A;  1TJD A;  2NVL A;  1S3D A;  2L5L A;  4PNG A;  3I9V 2;  1Z6M A;  2LS5 A;  3KD0 A;  5HR2 A;  1SK1 A;  5G31 A;  1K0O A;  3ZFB A;  3F9U A;  1EEM A;  3FZ9 A;  5CYY A;  1R5A A;  5DAL A;  5ECR B;  1YJ6 A;  2OE3 A;  2FD3 A;  1SL1 B;  2I81 A;  1MTC A;  2MMO A;  4MZC A;  1USB A;  4N30 A;  4POB A;  3FZ5 A;  1M0U A;  5D93 A;  2H73 A;  1PKZ A;  4OCE A;  1XOA A;  5J41 A;  2GT6 A;  4KAE A;  2CZ3 A;  5KN3 A;  4X43 A;  2NDO A;  1BJX A;  1VF2 A;  2RLI A;  3HD5 A;  5J9C A;  3HZ8 A;  4L5L A;  2YJ7 A;  3VPT A;  2VD0 A;  5IOW A;  2GZP A;  1ERV A;  3F6F A;  4LMV A;  3QAG A;  3D4T A;  3VPQ A;  3W8S A;  2CAQ A;  1O6J A;  5GAN D;  4KCA A;  3WGE A;  1AXD A;  5ECP B;  3TCO A;  5DQY A;  1ACV A;  4K7O A;  3G7J A;  4DSS B;  1FB0 A;  4MF6 A;  4PNF A;  5LNK e;  3O6T A;  4IJI A;  2L4Q A;  4IEL A;  1AUC A;  2I3Y A;  2IMD A;  2EIO A;  4IP6 A;  1JHB A;  2VOC A;  5H5Q A;  1N2A A;  2H0G A;  2H1D A;  2BTO T;  1MD3 A;  1DE2 A;  14GS A;  2C3Q A;  1BED A;  1PD2 1;  1SD8 A;  3MDK A;  5C00 A;  3F3Q A;  1X5C A;  3P90 A;  1SJ6 A;  1CQG A;  4XHM A;  5B7C A;  4XS4 B;  1A2J A;  4GCI A;  3ZRD A;  4KX4 A;  5F05 A;  5IIZ A;  1ST9 A;  1A23 A;  4FYU A;  2EIR A;  5KEJ A;  2AAW A;  2PBJ A;  2KOK A;  1ZCP A;  1OYJ A;  4D73 B;  4MZB A;  1GTI A;  4XS6 A;  2F8A A;  4K6X A;  3GV1 A;  5HFI A;  3WT1 A;  4JED A;  1B48 A;  4XIH A;  1WIK A;  4G9H A;  1A2M A;  2KHP A;  4PUR A;  4L0W A;  3IAS 2;  1XCC A;  1NHO A;  1J9B A;  3TKS A;  1DSB A;  1G0T A;  3RAZ A;  3CRU A;  1A8L A;  4MPF A;  3E0U A;  1V9W A;  4JRR A;  1GTU A;  1K0N A;  4YAV A;  5INY A;  3GTU B;  1EWX A;  2VO4 A;  2AB6 A;  4V2N A;  3DEX A;  4WBR D;  5DDL A;  2GQK A;  1AQX A;  3WT2 A;  2AUV A;  4FO5 A;  1W89 A;  4GTU A;  4AF2 A;  4KDY A;  3TGZ A;  4K7I A;  4YQU A;  2X8C A;  3UAP A;  2LTK A;  3M8N A;  3DIE A;  3IXR A;  2OKA A;  5LCZ A;  1F3B A;  4ECJ A;  2KLX A;  3QDN A;  2HZE A;  3DVW A;  4MAB A;  1TXX A;  1U3I A;  2JSY A;  3HKR A;  1V2A A;  1MDI A;  3GSS A;  7GSS A;  2YWN A;  3GKK A;  1GUH A;  2KP2 A;  4OMV A;  2R4V A;  2A2S A;  3IK9 A;  1XXU A;  1W4V A;  4DEJ A;  3VWX A;  4KCE A;  1TOF A;  1GSU A;  4MLY A;  22GS A;  5E4W A;  4LMW A;  6GSS A;  2F8F A;  2E7P A;  4ECC A;  1GL8 A;  1A2L A;  2CA8 A;  4L8E A;  4AJ6 A;  2C0F A;  2JU5 A;  4HQZ A;  4MA9 A;  3Q74 A;  3PR8 A;  1Q4J A;  3ZIT A;  3FK8 A;  5HQP A;  1B8X A;  2MYG A;  2IWT A;  5JWQ B;  1MEK A;  4V2M A;  4JE1 A;  1M9A A;  4OFM A;  4POM A;  3JCM L;  2H66 A;  2VM1 A;  6GSX A;  2HI7 A;  2HRN A;  3GFK A;  1GRX A;  2YZU A;  3GRX A;  2GZZ A;  1V57 A;  1O85 A;  2ALB A;  3H79 A;  5IPH A;  2YWI A;  4BWS A;  3MAK A;  1T4Z A;  2C80 A;  4YQM A;  2QC7 A;  2RUF A;  5CAX A;  1M2A A;  3BJ5 A;  4NV5 A;  1SK0 A;  1AW9 A;  3CSJ A;  3D0Z A;  3CSH A;  3V1W A;  4HU9 A;  2X64 A;  2C0E A;  2L59 A;  2ES7 A;  5ECO B;  3GUR A;  4DSQ A;  13GS A;  1KBN A;  5ELA A;  4ACS A;  5G1K A;  2B7K A;  4QQ7 A;  5B8B A;  3ME8 A;  2H19 A;  2K18 A;  5HFK A;  4ZL9 A;  3FHK A;  3F4S A;  1B9Y C;  5ECM B;  3M1G A;  3IOS A;  2M72 A;  4LL1 B;  2VM2 A;  3MSZ A;  4K2D A;  1R26 A;  1WE0 A;  4HJM A;  2H70 A;  2HT9 A;  2B5X A;  1QGV A;  2WJU A;  3GN3 A;  4O5R A;  4GSS A;  4OO5 A;  2TRC P;  3FYG A;  2H74 A;  4K1F A;  3E9J B;  3ERG A;  2LQQ A;  3KZQ A;  1OC3 A;  3Q18 A;  3TJK A;  2QKE A;  3FKF A;  3KTB A;  1JFU A;  2PUK C;  2XBI A;  2BMX A;  5ECS A;  2X99 A;  2A4V A;  2LRN A;  2NTO A;  1ILO A;  1O81 A;  1XVW A;  2FWE A;  4MPG A;  4ULX A;  2C0D A;  4V2L A;  3HJP A;  5IMD A;  4IVF A;  3HHV A;  1Y6E A;  4QL7 A;  2PWJ A;  2V1M A;  2YNX A;  1PX7 A;  1T1V A;  1NW2 A;  3RHB A;  1FB6 A;  1UVZ A;  1FAA A;  2YV9 A;  5LD0 A;  2CT6 A;  2G0F A;  2RM6 A;  2H0H A;  3KTL A;  2L57 A;  4O7H A;  3ERF A;  4FYC A;  1O8W A;  2CZ2 A;  1G7O A;  1GH2 A;  1PQN A;  1OC9 B;  4TW5 A;  3PH9 A;  1Z9H A;  4OCF A;  1XOB A;  1JZR A;  2MMN A;  18GS A;  4IKH A;  5AN1 A;  3QOU A;  4MJA A;  2HSY A;  1J0F A;  2XPD A;  1PSQ A;  2R3X A;  2X8H A;  2YZH A;  5D96 A;  1SEN A;  1T7P B;  2YV7 A;  1XW6 A;  4EO3 A;  2ZNM A;  5FWG A;  2OE1 A;  1SKW B;  1VF1 A;  4HU7 A;  1AIU A;  3US3 A;  3IE3 A;  2I4A A;  1H75 A;  2H6Z A;  5IMZ A;  1THX A;  2XHF A;  1ERU A;  2VIM A;  4TR1 B;  4GQF A;  3EMP A;  2TIR A;  1K3L A;  4MF7 A;  6GSV A;  4EUY A;  4BA7 A;  4PQ1 A;  4CDO A;  3H8Q A;  3F63 A;  1H4O A;  4I6X A;  4DSS A;  3L4N A;  1VRS D;  4KSM A;  1M9B A;  1EP7 A;  4ZB6 A;  2B1L A;  3E3E A;  2CV4 A;  4P3Y B;  1TP9 A;  5D73 A;  4TR3 A;  1MDK A;  2M46 A;  1HQO A;  2GS3 A;  3EUR A;  4CW9 A;  1OE8 A;  2YP6 A;  4ILF A;  2JL4 A;  3LXT A;  1GSE A;  2DML A;  4HI7 A;  5DCH A;  4HUA A;  3TUE A;  1K3Y A;  3CTG A;  1MDJ A;  2C1Y A;  4X0X A;  1ZL9 A;  2DLX A;  5HR1 A;  4HZ2 A;  3M9J A;  3G7Y A;  2GSR A;  5J4U A;  3LG6 A;  2CQ9 A;  1JLV A;  4I2T A;  5JCG A;  1B4P A;  3W6G A;  4N0V A;  3ZRE A;  1A8Y A;  1WOU A; 
#chains in the Genus database with same CATH topology
 5CRE A;  1PKW A;  1Z6N A;  4YAP A;  5D9V A;  3HYP A;  2JZT A;  1G7E A;  3M9K A;  1WWJ A;  1XWK A;  3D22 A;  4KW6 A;  1GUL A;  2FHE A;  1K3O A;  2F51 A;  4TXV A;  2YN1 A;  5COH A;  3IK7 A;  4L5O A;  10GS A;  2E2G A;  4D73 A;  1VF4 A;  3IC4 A;  2N5B A;  5EL8 A;  6GSU A;  3TJJ A;  1T3B A;  1QK8 A;  3QAV A;  2GST A;  5GZZ B;  2FA4 A;  1V98 A;  4OWY A;  1AAZ A;  1EV9 A;  2R5G A;  4BPY A;  5DQS A;  3AY8 A;  1X5D A;  1TRW A;  3HA9 A;  1Q98 A;  4WXT A;  3KCM A;  5IMV A;  2B1K A;  1X9M B;  4O92 A;  2PVO C;  4EL1 A;  3RDW A;  1YF0 A;  4EDZ A;  2GSS A;  5DAK B;  4TXO A;  3EIN A;  3GTU A;  4OO4 A;  3FZ4 A;  3BCI A;  1TI1 A;  2CX3 A;  3QFA C;  1F3A A;  4I97 A;  2L6D A;  2V32 A;  3KJY A;  1Z7P A;  5C04 A;  2J23 A;  2VLU A;  4USS A;  3UBK A;  3VI5 A;  4MCU A;  1J08 A;  1HNA A;  1ON4 A;  2FLS A;  4KB3 A;  1XFL A;  1XW9 A;  2JAC A;  1M99 A;  1JLW A;  2A4H A;  1U6T A;  3DKS A;  3APQ A;  4TVE A;  1VF3 A;  3VFI A;  2LRC A;  4ZL8 A;  1PRX A;  2K8V A;  3HVV A;  4GST A;  5F8B A;  2GZY A;  3ISO A;  4NWY A;  3ZTL A;  1EV4 A;  3GL5 A;  3H1N A;  4K8M A;  4AJ8 A;  4MDC A;  5ID2 A;  2R0G A;  3TKS C;  2JAD A;  5AIX A;  3ZFL A;  2ON7 A;  4PGT A;  1ZZY A;  2AHE A;  3FEU A;  4RI6 A;  5B6N A;  2YWO A;  1X9W B;  1E6B A;  3HJO A;  2EC4 A;  2X4A A;  2YOI A;  1B9X C;  3D5J A;  5HFG A;  2ON5 A;  3TDG A;  3CQF A;  2CAI A;  1GNE A;  3KMO A;  2HFD A;  4GSN A;  1K0C A;  4ZXG A;  5DCG A;  3GKM A;  1ZYN A;  4IHU A;  2D2Z A;  1Z7R A;  4CHS A;  4NHW A;  2LRT A;  5J5N A;  5F07 A;  17GS A;  1BYE A;  3UMA A;  3WYW A;  3P7X A;  1O8X A;  1OKT A;  1XBS A;  1PL1 A;  5F06 A;  2RUE A;  1TKD B;  3GST A;  3LEF A;  3UBL A;  4OD7 A;  5ECN B;  2YPM A;  3N9J A;  6GST A;  2N5F A;  1O7U A;  2FA8 A;  2H1G A;  2LKU A;  3LYK A;  3P2A A;  3O76 A;  4K7N A;  2VAF A;  3I69 A;  5ECK B;  3R2Q A;  1EOG A;  1GSS A;  3H4K A;  2V41 A;  3ZVJ A;  4I8B A;  3KEB A;  3RHC A;  1TK8 B;  1TU7 A;  3VUR A;  3QR6 A;  4J57 E;  2WDU A;  1ZMA A;  2AV4 A;  2LST A;  2B3S A;  2L6C A;  5GAP D;  4KGI A;  1A0F A;  1F2E A;  4FYB A;  2YCD A;  1JZW A;  3IDV A;  1WRY A;  2LEG A;  1RW1 A;  4Q5Q A;  2OAC A;  2H8L A;  5ECL B;  1UN2 A;  3F8U A;  4L0U A;  1EGR A;  2QA2 A;  2LV3 A;  2RM5 A;  2IMK A;  1AQW A;  4G2E A;  4MJE A;  4EVM A;  4WEY A;  4XRD A;  3UAR A;  1LU4 A;  3C1S A;  3DXB A;  2IMF A;  4BIK A;  3CMI A;  3HY2 A;  3EE2 A;  3UOM A;  1ML6 A;  3LYP A;  5ECI B;  4K0G A;  5CRH A;  1F37 A;  3A5I A;  3GX0 A;  5HR3 A;  4NPB A;  5IPG A;  4GQC A;  2H71 A;  4ID0 A;  2IJY A;  3LJR A;  4FIW A;  3WD6 A;  2VL2 A;  3C73 A;  1TK0 B;  2GQL A;  1SU9 A;  5A4W A;  3TJF A;  4K5S A;  3VK9 A;  3ZML A;  5B6M A;  2P0G A;  4HOJ A;  4F0C A;  5DJM A;  3TKR A;  2L4C A;  3D6I A;  5AIS A;  1M7T A;  1HNC A;  5E59 A;  5IMC A;  2WGR A;  3KH7 A;  1QMV A;  11GS A;  4HQS A;  4YH2 A;  2K9F A;  3BOA A;  1M2D A;  5ELG A;  4KDU A;  2R2J A;  1QQ2 A;  3IPZ A;  2K6V A;  1C72 A;  2A2R A;  3QCP A;  1TTZ A;  2TRX A;  2C8U A;  2FWH A;  5A4U A;  4ZBD A;  1PL2 A;  1OE7 A;  3CYN A;  3WGX A;  2B7J A;  2PMT A;  3IAM 2;  1HNB A;  1X0R A;  3F4R A;  3TKP A;  4JBB A;  1KTE A;  1N8J A;  1RQM A;  4N10 A;  1LJR A;  3CSI A;  1EEJ A;  3TOT A;  2V6K A;  1GNW A;  4PX1 A;  2DJ3 A;  2DJ1 A;  4GRF A;  3C1R A;  2NBS A;  1PX6 A;  2HLS A;  2QSI A;  3UIW A;  1XWG A;  4QL9 A;  1X9S B;  3BD2 A;  3I43 A;  2F3M A;  3MYD A;  5JCU A;  1XWA A;  3HXS A;  5EPF A;  3FR9 A;  1TW9 A;  5IMF A;  1GWC A;  1OAZ A;  2H75 A;  2WB9 A;  4ISD A;  2HRA A;  4Q5F A;  3VWW A;  2HYX A;  2JSZ A;  2PU9 C;  3F6D A;  3GIX A;  3J7Y b;  3EYT A;  2FWG A;  1XG8 A;  3F3R A;  1K0A A;  1LBK A;  4NHZ A;  4H86 A;  1TDI A;  4ML1 A;  4IQ1 A;  4MH3 A;  1T00 A;  3TRQ A;  2EIQ A;  3QD9 A;  3QFB C;  3EU4 A;  4BL7 A;  3L78 A;  2L5O A;  4ECI A;  1GUK A;  2PGT A;  1O73 A;  3SWL A;  4BWQ A;  4KA0 A;  5ECQ B;  3L9U A;  3KP9 A;  3TJG A;  3FW2 A;  2IFQ B;  4XRA A;  1QXH A;  2A2P A;  1X5E A;  4K5R A;  3FR3 A;  1TRU A;  4J2F A;  5CRD A;  1KEB A;  3IHQ A;  1S3C A;  4I5Q A;  3GUS A;  1GP1 A;  2VCW A;  3HJM A;  1A0R P;  3DYR A;  2H72 A;  1Y25 A;  1FOV A;  3HZ4 A;  2MBS A;  1MD4 A;  4TKY A;  4TRX A;  2H1B A;  1ERT A;  2V2G A;  1NHY A;  2VLT A;  4E8E A;  2MMA A;  2DKI A;  2LQO A;  3W8J A;  3NZN A;  2AYT A;  2GGT A;  3ZMK A;  1YY7 A;  2FUG 2;  2R0C A;  4PQI A;  5B8A A;  3ED3 A;  5EVO A;  5DBQ A;  3IC8 A;  4MMM A;  2VCX A;  1WMJ A;  20GS A;  1FW1 A;  5F0G A;  1I9D A;  2HRK A;  2BJX A;  4JR4 A;  3GYK A;  4ECB A;  5G1L A;  4X4J A;  4MJC A;  4HEA 2;  2H1A A;  4ZIL A;  3C7M A;  2FCH A;  4WF4 A;  3FR6 A;  3DML A;  5J3R A;  3EVI A;  2KP1 A;  2HZF A;  3L0H A;  2YWM A;  3QAW A;  1V40 A;  2B5Y A;  1GSQ A;  5DAK A;  5IQY A;  5IOX A;  3GKN A;  3KH9 A;  2DIZ A;  2VCV A;  5D9X A;  2K8S A;  1S3A A;  5ENU A;  3UL3 A;  5J9B A;  1IYI A;  1PN0 A;  4K0N A;  1F6M C;  1UA5 A;  2MMZ A;  2DJJ A;  2FNO A;  1M3I A;  2WUL A;  4KH7 A;  4JZQ A;  4XS4 A;  3G7I A;  16GS A;  1DBY A;  3A2W A;  3R3E A;  4JU5 A;  2H76 A;  2DJ0 A;  2REM A;  5CRW A;  2CVD A;  3ZVJ D;  1SJZ A;  3SBC A;  3BBY A;  2OJL A;  4NMU A;  4ML6 A;  3UVT A;  1XVQ A;  1PN9 A;  2E0Q A;  1SYX A;  2HSM A;  1THO A;  2IL3 A;  3QMX A;  1YQ1 A;  4WBJ A;  4POL A;  4HS1 A;  3GHA A;  5A5K A;  4RI7 A;  2WFC A;  3FRC A;  2OE0 A;  1XWC A;  3PGT A;  3UEM A;  3GX8 A;  3TB2 A;  2DSA A;  3CBU A;  1PGT A;  2Z9S A;  4Z7X A;  1YKA A;  4MF5 A;  5IMA A;  1GTA A;  2H6X A;  4EF0 A;  4MZW A;  4MJB A;  4HJ2 A;  2GQM A;  2H30 A;  1AC1 A;  1V58 A;  4NAX A;  1YEP A;  5AGY A;  1CQH A;  5CNW A;  2G2Q A;  1YKC A;  1GLP A;  2O7K A;  5JWR B;  4N11 A;  3GH9 A;  1G6Y A;  1SD9 A;  3Q6O A;  3EPT A;  5CP1 A;  3Q19 A;  3UVH A;  1FHE A;  3S9F A;  4K2X A;  3VLN A;  4YQV A;  4O32 A;  3ZIV A;  4I2U A;  3DVX A;  4WR5 A;  5GSS A;  6GSY A;  5IO0 A;  4TOP A;  2C3T A;  3TJB A;  2VCQ A;  1TU8 A;  4KND A;  4AJ7 A;  1PA3 A;  2LUS A;  1Z3E A;  2X8G A;  1DE1 A;  5GST A;  1FG4 A;  1FVK A;  3L9V A;  3U5R E;  2MZC A;  2YAN A;  2OAD A;  5JWO B;  4OFT A;  3PIN A;  5DAL B;  1ZYE A;  1ABA A;  4IJ3 A;  1OC8 A;  1NM3 A;  2IMI A;  4YKG A;  1SL0 B;  3L9S A;  2VL9 A;  2IPA A;  8GSS A;  2B6M A;  3TKS E;  3ZIJ A;  1XIY A;  1T4Y A;  2PVQ A;  1TRV A;  2R6K A;  4N0Z A;  2WRT A;  2GSQ A;  1R7H A;  2IME A;  2P5Q A;  2LJR A;  1BG5 A;  4TR4 A;  5G5E A;  2RII A;  2H0I A;  3TRX A;  3ZLP A;  3D21 A;  4E8H A;  2QGV A;  5G5F A;  1VGL A;  3LWA A;  3RPN A;  1U87 A;  1BQ7 A;  2VCZ A;  2XC2 A;  4GWR A;  4G0K A;  3IHG A;  3BCK A;  3I6A A;  4LA1 A;  3LGC A;  3F0I A;  2F9S A;  3IRA A;  3QPM A;  3CXG A;  3HVX A;  2WCI A;  3EU3 A;  3APS A;  4IQA A;  4ZBA A;  1B4Q A;  3GNJ A;  4X1U A;  3GL3 A;  5AIV A;  1XWB A;  3TKQ A;  3TOU A;  1WJK A;  4TR0 A;  4TXO B;  2J9H A;  4HDE A;  3DRN A;  3IV4 A;  1S3R A;  1ZYQ B;  1U88 A;  4PTS A;  4WKW A;  1IYH A;  4WF5 A;  2WZ9 A;  4HZ4 A;  3H93 A;  4JR6 A;  3KMN A;  4KUN A;  3WGD A;  3O3T A;  4ZIJ A;  3GKX A;  1YDK A;  3RPP A;  1SL2 B;  2X49 A;  1RK4 A;  4Q5R A;  3M0F A;  5DJL A;  4XS1 A;  2VCT A;  3KP8 A;  4IBP A;  4V1A g;  4IN0 A;  1QFN A;  2C3N A;  4PUF C;  3GA4 A;  2PPT A;  5ABR A;  4NV2 A;  2VL2 C;  2VLV A;  4FH8 A;  1TRS A;  2I9H A;  2LJA A;  4ZL7 A;  2N5A A;  5H5R A;  5D9T A;  2IN3 A;  5ID2 B;  3A2V A;  4G10 A;  5H5S A;  3TRP A;  6GSW A;  3OR5 A;  1K0B A;  2ZUP A;  3HVN A;  3ZL5 A;  2OBK A;  9GSS A;  2R37 A;  4EE0 A;  3VWU A;  1Z5Y E;  2JZR A;  4GXZ A;  4F82 A;  2HRF A;  2WS2 A;  3ZZX A;  1R4W A;  5IO2 A;  2H6Y A;  5BRT A;  2MBT A;  3RBT A;  2GDR A;  5JCW A;  2XBQ A;  5KN2 A;  3LFL A;  12GS A;  4CY6 A;  2O87 A;  3LOR A;  4V1A p;  3DGQ A;  3KGK A;  2DJK A;  2DKH A;  2CVB A;  1SJI A;  4IGJ A;  3A3T A;  1EOH A;  5FHI A;  1KNG A;  4XCS A;  3EMX A;  5ECH B;  1TK5 B;  2GLR A;  5D8I A;  2ZCT A;  3EWL A;  3HDC A;  4TN8 A;  2AJQ B;  2V6O A;  3MNG A;  1EZK A;  3IBH A;  1ZOF A;  2VD1 A;  2P31 A;  4EDY A;  2HNL A;  4KDX A;  2DMM A;  2IFQ A;  1TI3 A;  4G19 A;  1OC9 A;  4RQX A;  2NPB A;  4Q5N A;  4PUA A;  1ZGN A;  3C8E A;  3N5O A;  5KOW A;  1R5P A;  4F2I A;  1GTB A;  4IW9 A;  1BX9 A;  1QUW A;  3LXZ A;  3U6V A;  2LNT A;  2O89 A;  1OKD A;  4F9Z A;  4OFN A;  4LL4 B;  4ZB8 A;  5KN1 A;  5FT3 A;  2HSH A;  3C71 A;  2DBC A;  4BVY A;  4PXO A;  3APO A;  1U3A A;  2DJ2 A;  2HZE B;  1GSF A;  2OA7 A;  3KXO A;  3M3M A;  3GH6 A;  1FVJ A;  1YF1 A;  2XPE A;  3VI7 A;  4EXJ A;  3FZA A;  5CO3 A;  4TR1 A;  2I1U A;  3NIV A;  1HYU A;  3EC3 A;  2YJH A;  1E2Y A;  3VWV A;  1YZX A;  3GMF A;  1ERW A;  2GT5 A;  1G6W A;  3LSZ A;  4BVX A;  1GLQ A;  4DVC A;  4AGS A;  3FY7 A;  3P8W A;  4XTS A;  4KSO A;  5D9W A;  1BAY A;  1GSD A;  1AQV A;  2C4J A;  4NXI A;  3ZYW A;  2JZS A;  1YEX A;  1WPI A;  1JZD A;  2VL3 A;  5CRG A;  2B5E A;  2GTU A;  3IA1 A;  2IIY A;  1WP0 A;  1F9M A;  3LQ7 A;  4RQR A;  2E2M A;  1A24 A;  3KIJ A;  1FO5 A;  4K9Z A;  3UJ1 A;  3D4M A;  3KM6 A;  4WR4 A;  5G2Z A;  3HCZ A;  3J7Y k;  3DWV A;  2HE3 A;  1HD2 A;  2LNS A;  4EIQ A;  3F4T A;  1DUG A;  2H01 A;  2CX4 A;  2HXK A;  1SKR B;  2O85 A;  3DD3 A;  2M80 A;  4DSR A;  1GSY A;  2LJK A;  1I5G A;  3ME7 A;  1SYR A;  2FWF A;  5IM9 A;  2FGX A;  2KUC A;  2GVP A;  5KN0 A;  3K8N A;  3NOF A;  4F03 A;  2DIY A;  1EGO A;  4ZBB A;  5L71 A;  1SK2 A;  1PMT A;  4IS0 A;  5DVB A;  5HR0 A;  4MK3 A;  1T8E B;  1UC7 A;  2DC5 A;  1EP8 A;  1GUM A;  1K0D A;  2VUP A;  3A2X A;  4POK A;  4IP1 A;  2O8V B;  1OVN A;  5G30 A;  1M2B A;  1JZO A;  19GS A;  4ZB9 A;  4G0L A;  2PER A;  4KE3 A;  3MWH A;  4EC0 A;  3ERW A;  5EY6 A;  1SKS B;  5A4V A;  3HVS A;  1XZO A;  2OBI A;  1XW5 A;  1K0M A;  4PQH A;  2CVK A;  2P5R A;  4MH2 A;  4LLR A;  3A5W A;  3CRT A;  3IR4 A;  1NSW A;  1URM A;  4MP4 A;  4F0B A;  4GF0 A;  4J56 E;  2C0G A;  4GLT A;  2FY6 A;  4EKZ A;  3G9B A;  3CTF A;  2PN8 A;  1XPV A;  4RUV A;  4WET A;  1TJD A;  2NVL A;  1S3D A;  2L5L A;  4PNG A;  3I9V 2;  1Z6M A;  2LS5 A;  3KD0 A;  5HR2 A;  1SK1 A;  5G31 A;  1K0O A;  3ZFB A;  3F9U A;  1EEM A;  3FZ9 A;  5CYY A;  1R5A A;  5DAL A;  5ECR B;  1YJ6 A;  2OE3 A;  2FD3 A;  1SL1 B;  2I81 A;  1MTC A;  2MMO A;  4MZC A;  1USB A;  4N30 A;  4POB A;  3FZ5 A;  1M0U A;  5D93 A;  2H73 A;  1PKZ A;  4OCE A;  1XOA A;  5J41 A;  2GT6 A;  4KAE A;  2CZ3 A;  5KN3 A;  4X43 A;  2NDO A;  1BJX A;  1VF2 A;  2RLI A;  3HD5 A;  5J9C A;  3HZ8 A;  4L5L A;  2YJ7 A;  3VPT A;  2VD0 A;  5IOW A;  2GZP A;  1ERV A;  3F6F A;  4LMV A;  3QAG A;  3D4T A;  3VPQ A;  3W8S A;  2CAQ A;  1O6J A;  5GAN D;  4KCA A;  3WGE A;  1AXD A;  5ECP B;  3TCO A;  5DQY A;  1ACV A;  4K7O A;  3G7J A;  4DSS B;  1FB0 A;  4MF6 A;  4PNF A;  5LNK e;  3O6T A;  4IJI A;  2L4Q A;  4IEL A;  1AUC A;  4IP6 A;  2I3Y A;  2IMD A;  2EIO A;  1JHB A;  2VOC A;  5H5Q A;  1N2A A;  2H0G A;  2H1D A;  2BTO T;  1MD3 A;  1DE2 A;  14GS A;  2C3Q A;  1BED A;  1PD2 1;  1SD8 A;  3MDK A;  5C00 A;  4EIP A;  3F3Q A;  1X5C A;  4HSC X;  4ICY A;  3P90 A;  1SJ6 A;  1CQG A;  4XHM A;  5B7C A;  4XS4 B;  1A2J A;  4GCI A;  3ZRD A;  4KX4 A;  5F05 A;  5IIZ A;  4MNN A;  1ST9 A;  1A23 A;  4FYU A;  2EIR A;  1M3J A;  5KEJ A;  2AAW A;  2PBJ A;  2KOK A;  1ZCP A;  1OYJ A;  4D73 B;  4MZB A;  5BMU A;  1GTI A;  4XS6 A;  2F8A A;  4K6X A;  3GV1 A;  5HFI A;  3WT1 A;  4JED A;  1B48 A;  4XIH A;  1WIK A;  4G9H A;  1A2M A;  4O5Q A;  2KHP A;  4PUR A;  4L0W A;  5KOX A;  3IAS 2;  1XCC A;  1NHO A;  1J9B A;  3TKS A;  1DSB A;  1G0T A;  3RAZ A;  3CRU A;  1A8L A;  4MPF A;  3E0U A;  1PFO A;  1V9W A;  4KF9 A;  4JRR A;  1GTU A;  1K0N A;  4YAV A;  5INY A;  3GTU B;  1EWX A;  2VO4 A;  2AB6 A;  2R0P A;  4V2N A;  3DEX A;  4WBR D;  5DDL A;  2GQK A;  1AQX A;  3WT2 A;  4FQU A;  2AUV A;  4FO5 A;  1W89 A;  4GTU A;  4AF2 A;  4KDY A;  3TGZ A;  4K7I A;  4YQU A;  2X8C A;  3UAP A;  2LTK A;  3M8N A;  3DIE A;  3IXR A;  2OKA A;  5LCZ A;  1F3B A;  4ECJ A;  2KLX A;  3QDN A;  2HZE A;  3DVW A;  4MAB A;  1TXX A;  1U3I A;  2JSY A;  3HKR A;  1V2A A;  1MDI A;  3GSS A;  7GSS A;  2YWN A;  3GKK A;  1GUH A;  2KP2 A;  4OMV A;  2R4V A;  2A2S A;  3IK9 A;  1XXU A;  1W4V A;  4DEJ A;  3LW9 A;  3VWX A;  4KCE A;  1TOF A;  1GSU A;  4MLY A;  22GS A;  5E4W A;  4LMW A;  6GSS A;  2QA1 A;  2F8F A;  2E7P A;  4ECC A;  1GL8 A;  1A2L A;  2CA8 A;  4L8E A;  4AJ6 A;  2C0F A;  2JU5 A;  4HQZ A;  4MA9 A;  3FMW A;  3Q74 A;  3PR8 A;  3MIX A;  1Q4J A;  3ZIT A;  3FK8 A;  5HQP A;  1B8X A;  4Z2R A;  2MYG A;  2IWT A;  5JWQ B;  1MEK A;  4V2M A;  4JE1 A;  1M9A A;  4OFM A;  4POM A;  3JCM L;  2H66 A;  2VM1 A;  6GSX A;  4Z2T A;  2HI7 A;  2HRN A;  3GFK A;  1GRX A;  2YZU A;  3GRX A;  2GZZ A;  1V57 A;  1O85 A;  1ZYP A;  2ALB A;  3H79 A;  5IPH A;  2YWI A;  4BWS A;  3MAK A;  1T4Z A;  2C80 A;  4YQM A;  2QC7 A;  2RUF A;  5CAX A;  1M2A A;  3BJ5 A;  4NV5 A;  1SK0 A;  1AW9 A;  3CSJ A;  3D0Z A;  3CSH A;  3V1W A;  4HU9 A;  2X64 A;  2C0E A;  2L59 A;  2ES7 A;  5ECO B;  3GUR A;  4DSQ A;  13GS A;  4YKF A;  1KBN A;  5ELA A;  4ACS A;  5G1K A;  2B7K A;  4QQ7 A;  5B8B A;  3ME8 A;  2H19 A;  2K18 A;  5HFK A;  4O5U A;  4ZL9 A;  3FHK A;  3F4S A;  1B9Y C;  5ECM B;  3M1G A;  3IOS A;  2M72 A;  4LL1 B;  2VM2 A;  3MSZ A;  4K2D A;  1R26 A;  1WE0 A;  4HJM A;  2H70 A;  2HT9 A;  2B5X A;  1QGV A;  2WJU A;  3GN3 A;  4O5R A;  4GSS A;  4OO5 A;  2TRC P;  3FYG A;  2H74 A;  4K1F A;  3E9J B;  3ERG A;  2LQQ A;  3KZQ A;  1OC3 A;  3Q18 A;  3TJK A;  2QKE A;  3FKF A;  3KTB A;  1JFU A;  2PUK C;  2XBI A;  2BMX A;  5ECS A;  2X99 A;  2A4V A;  2LRN A;  2NTO A;  1ILO A;  1O81 A;  1XVW A;  2FWE A;  4MPG A;  4ULX A;  2C0D A;  4V2L A;  3HJP A;  5IMD A;  4IVF A;  3HHV A;  1Y6E A;  4QL7 A;  2PWJ A;  2V1M A;  2YNX A;  1PX7 A;  1T1V A;  1NW2 A;  3RHB A;  1FB6 A;  2UZ8 A;  1UVZ A;  1FAA A;  2YV9 A;  5LD0 A;  2CT6 A;  2G0F A;  2RM6 A;  2H0H A;  3KTL A;  2L57 A;  4O7H A;  3ERF A;  4FYC A;  1O8W A;  2CZ2 A;  1G7O A;  1GH2 A;  1PQN A;  1OC9 B;  4TW5 A;  3PH9 A;  1Z9H A;  4OCF A;  1XOB A;  1JZR A;  2MMN A;  4A5P A;  18GS A;  4IKH A;  5AN1 A;  3QOU A;  4MJA A;  2HSY A;  1J0F A;  2XPD A;  1PSQ A;  2R3X A;  2X8H A;  2YZH A;  5D96 A;  1SEN A;  1T7P B;  2YV7 A;  1XW6 A;  4EO3 A;  2ZNM A;  5FWG A;  2OE1 A;  1SKW B;  1VF1 A;  4HU7 A;  4BVY B;  1AIU A;  3US3 A;  3IE3 A;  2I4A A;  1H75 A;  2H6Z A;  5IMZ A;  1THX A;  2XHF A;  1ERU A;  4G0I A;  2VIM A;  4TR1 B;  4GQF A;  3EMP A;  2TIR A;  1FOH A;  1K3L A;  4MF7 A;  6GSV A;  4EUY A;  4BA7 A;  4PQ1 A;  4CDO A;  3H8Q A;  3F63 A;  1H4O A;  4I6X A;  4DSS A;  3L4N A;  1VRS D;  4Z2U A;  4KSM A;  1M9B A;  1EP7 A;  4ZB6 A;  2B1L A;  4BVX B;  3E3E A;  2CV4 A;  4P3Y B;  1TP9 A;  5D73 A;  4TR3 A;  1MDK A;  2M46 A;  1HQO A;  2GS3 A;  3EUR A;  4CW9 A;  1OE8 A;  2YP6 A;  4ILF A;  2JL4 A;  3LXT A;  1GSE A;  2DML A;  4BL7 B;  4HI7 A;  5DCH A;  4HUA A;  3TUE A;  1K3Y A;  3CTG A;  1MDJ A;  2C1Y A;  4X0X A;  1ZL9 A;  4CY8 A;  2DLX A;  5HR1 A;  4HZ2 A;  3M9J A;  3G7Y A;  3PPU A;  2GSR A;  5J4U A;  3LG6 A;  2CQ9 A;  1JLV A;  4I2T A;  5JCG A;  1B4P A;  3W6G A;  4N0V A;  3ZRE A;  1A8Y A;  1WOU A; 
#chains in the Genus database with same CATH homology
 5CRE A;  1PKW A;  1Z6N A;  4YAP A;  5D9V A;  3HYP A;  2JZT A;  1G7E A;  3M9K A;  1WWJ A;  1XWK A;  3D22 A;  4KW6 A;  1GUL A;  2FHE A;  1K3O A;  2F51 A;  4TXV A;  2YN1 A;  5COH A;  3IK7 A;  4L5O A;  10GS A;  2E2G A;  4D73 A;  1VF4 A;  3IC4 A;  2N5B A;  5EL8 A;  6GSU A;  3TJJ A;  1T3B A;  1QK8 A;  3QAV A;  2GST A;  5GZZ B;  2FA4 A;  1V98 A;  4OWY A;  1AAZ A;  1EV9 A;  2R5G A;  4BPY A;  5DQS A;  3AY8 A;  1X5D A;  1TRW A;  3HA9 A;  1Q98 A;  4WXT A;  3KCM A;  5IMV A;  2B1K A;  1X9M B;  4O92 A;  2PVO C;  4EL1 A;  3RDW A;  1YF0 A;  4EDZ A;  2GSS A;  5DAK B;  4TXO A;  3EIN A;  3GTU A;  4OO4 A;  3FZ4 A;  3BCI A;  1TI1 A;  2CX3 A;  3QFA C;  1F3A A;  4I97 A;  2L6D A;  2V32 A;  3KJY A;  1Z7P A;  5C04 A;  2J23 A;  2VLU A;  4USS A;  3UBK A;  3VI5 A;  4MCU A;  1J08 A;  1HNA A;  1ON4 A;  2FLS A;  4KB3 A;  1XFL A;  1XW9 A;  2JAC A;  1M99 A;  1JLW A;  2A4H A;  1U6T A;  3DKS A;  3APQ A;  4TVE A;  1VF3 A;  3VFI A;  2LRC A;  4ZL8 A;  1PRX A;  2K8V A;  3HVV A;  4GST A;  5F8B A;  2GZY A;  3ISO A;  4NWY A;  3ZTL A;  1EV4 A;  3GL5 A;  3H1N A;  4K8M A;  4AJ8 A;  4MDC A;  5ID2 A;  2R0G A;  3TKS C;  2JAD A;  5AIX A;  3ZFL A;  2ON7 A;  4PGT A;  1ZZY A;  2AHE A;  3FEU A;  4RI6 A;  5B6N A;  2YWO A;  1X9W B;  1E6B A;  3HJO A;  2EC4 A;  2X4A A;  2YOI A;  1B9X C;  3D5J A;  5HFG A;  2ON5 A;  3TDG A;  2CAI A;  1GNE A;  3KMO A;  2HFD A;  4GSN A;  1K0C A;  4ZXG A;  5DCG A;  3GKM A;  1ZYN A;  4IHU A;  2D2Z A;  1Z7R A;  4CHS A;  4NHW A;  2LRT A;  5J5N A;  5F07 A;  17GS A;  1BYE A;  3UMA A;  3WYW A;  3P7X A;  1O8X A;  1OKT A;  1XBS A;  1PL1 A;  5F06 A;  2RUE A;  1TKD B;  3GST A;  3LEF A;  3UBL A;  4OD7 A;  5ECN B;  2YPM A;  3N9J A;  6GST A;  2N5F A;  1O7U A;  2FA8 A;  2H1G A;  2LKU A;  3LYK A;  3P2A A;  3O76 A;  4K7N A;  2VAF A;  3I69 A;  5ECK B;  3R2Q A;  1EOG A;  1GSS A;  3H4K A;  2V41 A;  3ZVJ A;  4I8B A;  3KEB A;  3RHC A;  1TK8 B;  1TU7 A;  3VUR A;  3QR6 A;  4J57 E;  2WDU A;  1ZMA A;  2AV4 A;  2LST A;  2B3S A;  2L6C A;  5GAP D;  4KGI A;  1A0F A;  1F2E A;  4FYB A;  2YCD A;  1JZW A;  3IDV A;  1WRY A;  2LEG A;  1RW1 A;  4Q5Q A;  2OAC A;  2H8L A;  5ECL B;  1UN2 A;  3F8U A;  4L0U A;  1EGR A;  2QA2 A;  2LV3 A;  2RM5 A;  2IMK A;  1AQW A;  4G2E A;  4MJE A;  4EVM A;  4WEY A;  4XRD A;  3UAR A;  1LU4 A;  3C1S A;  3DXB A;  2IMF A;  3CMI A;  3HY2 A;  3EE2 A;  3UOM A;  1ML6 A;  3LYP A;  5ECI B;  4K0G A;  5CRH A;  1F37 A;  3A5I A;  3GX0 A;  5HR3 A;  4NPB A;  5IPG A;  4GQC A;  2H71 A;  4ID0 A;  2IJY A;  3LJR A;  4FIW A;  3WD6 A;  2VL2 A;  3C73 A;  1TK0 B;  2GQL A;  1SU9 A;  5A4W A;  3TJF A;  4K5S A;  3VK9 A;  3ZML A;  5B6M A;  2P0G A;  4HOJ A;  4F0C A;  5DJM A;  3TKR A;  2L4C A;  3D6I A;  5AIS A;  1M7T A;  1HNC A;  5E59 A;  5IMC A;  2WGR A;  3KH7 A;  1QMV A;  11GS A;  4HQS A;  4YH2 A;  2K9F A;  3BOA A;  1M2D A;  5ELG A;  4KDU A;  2R2J A;  1QQ2 A;  3IPZ A;  2K6V A;  1C72 A;  2A2R A;  3QCP A;  1TTZ A;  2TRX A;  2C8U A;  2FWH A;  5A4U A;  4ZBD A;  1PL2 A;  1OE7 A;  3CYN A;  3WGX A;  2B7J A;  2PMT A;  3IAM 2;  1HNB A;  1X0R A;  3F4R A;  3TKP A;  4JBB A;  1KTE A;  1N8J A;  1RQM A;  4N10 A;  1LJR A;  3CSI A;  1EEJ A;  3TOT A;  2V6K A;  1GNW A;  4PX1 A;  2DJ3 A;  2DJ1 A;  4GRF A;  3C1R A;  2NBS A;  1PX6 A;  2HLS A;  2QSI A;  3UIW A;  1XWG A;  4QL9 A;  1X9S B;  3BD2 A;  3I43 A;  2F3M A;  3MYD A;  5JCU A;  1XWA A;  3HXS A;  5EPF A;  3FR9 A;  1TW9 A;  5IMF A;  1GWC A;  1OAZ A;  2H75 A;  2WB9 A;  4ISD A;  2HRA A;  4Q5F A;  3VWW A;  2HYX A;  2JSZ A;  2PU9 C;  3F6D A;  3GIX A;  3J7Y b;  3EYT A;  2FWG A;  3F3R A;  1K0A A;  1LBK A;  4NHZ A;  4H86 A;  1TDI A;  4ML1 A;  4IQ1 A;  4MH3 A;  1T00 A;  3TRQ A;  2EIQ A;  3QD9 A;  3QFB C;  3EU4 A;  4BL7 A;  3L78 A;  2L5O A;  4ECI A;  1GUK A;  2PGT A;  1O73 A;  3SWL A;  4BWQ A;  4KA0 A;  5ECQ B;  3L9U A;  3KP9 A;  3TJG A;  3FW2 A;  2IFQ B;  4XRA A;  1QXH A;  2A2P A;  1X5E A;  4K5R A;  3FR3 A;  1TRU A;  4J2F A;  5CRD A;  1KEB A;  3IHQ A;  1S3C A;  4I5Q A;  3GUS A;  1GP1 A;  2VCW A;  3HJM A;  1A0R P;  3DYR A;  2H72 A;  1Y25 A;  1FOV A;  3HZ4 A;  2MBS A;  1MD4 A;  4TKY A;  4TRX A;  2H1B A;  1ERT A;  2V2G A;  1NHY A;  2VLT A;  4E8E A;  2MMA A;  2DKI A;  2LQO A;  3W8J A;  3NZN A;  2AYT A;  2GGT A;  3ZMK A;  1YY7 A;  2FUG 2;  2R0C A;  4PQI A;  5B8A A;  3ED3 A;  5EVO A;  5DBQ A;  3IC8 A;  4MMM A;  2VCX A;  1WMJ A;  20GS A;  1FW1 A;  5F0G A;  1I9D A;  2HRK A;  2BJX A;  4JR4 A;  3GYK A;  4ECB A;  5G1L A;  4X4J A;  4MJC A;  4HEA 2;  2H1A A;  4ZIL A;  3C7M A;  2FCH A;  4WF4 A;  3FR6 A;  3DML A;  5J3R A;  3EVI A;  2KP1 A;  2HZF A;  3L0H A;  2YWM A;  3QAW A;  1V40 A;  2B5Y A;  1GSQ A;  5DAK A;  5IQY A;  5IOX A;  3GKN A;  3KH9 A;  2DIZ A;  2VCV A;  5D9X A;  2K8S A;  1S3A A;  5ENU A;  3UL3 A;  5J9B A;  1IYI A;  1PN0 A;  4K0N A;  1F6M C;  1UA5 A;  2MMZ A;  2DJJ A;  2FNO A;  2WUL A;  4KH7 A;  4JZQ A;  4XS4 A;  3G7I A;  16GS A;  1DBY A;  3A2W A;  3R3E A;  4JU5 A;  2H76 A;  2DJ0 A;  2REM A;  5CRW A;  2CVD A;  3ZVJ D;  1SJZ A;  3SBC A;  3BBY A;  2OJL A;  4NMU A;  4ML6 A;  3UVT A;  1XVQ A;  1PN9 A;  2E0Q A;  1SYX A;  2HSM A;  1THO A;  2IL3 A;  3QMX A;  1YQ1 A;  4WBJ A;  4POL A;  4HS1 A;  3GHA A;  5A5K A;  4RI7 A;  2WFC A;  3FRC A;  2OE0 A;  1XWC A;  3PGT A;  3UEM A;  3GX8 A;  3TB2 A;  2DSA A;  3CBU A;  1PGT A;  2Z9S A;  4Z7X A;  1YKA A;  4MF5 A;  5IMA A;  1GTA A;  2H6X A;  4EF0 A;  4MZW A;  4MJB A;  4HJ2 A;  2GQM A;  2H30 A;  1AC1 A;  1V58 A;  4NAX A;  1YEP A;  5AGY A;  1CQH A;  5CNW A;  2G2Q A;  1YKC A;  1GLP A;  2O7K A;  5JWR B;  4N11 A;  3GH9 A;  1G6Y A;  1SD9 A;  3Q6O A;  3EPT A;  5CP1 A;  3Q19 A;  3UVH A;  1FHE A;  3S9F A;  4K2X A;  3VLN A;  4YQV A;  4O32 A;  3ZIV A;  4I2U A;  3DVX A;  4WR5 A;  5GSS A;  6GSY A;  5IO0 A;  4TOP A;  2C3T A;  3TJB A;  2VCQ A;  1TU8 A;  4KND A;  4AJ7 A;  1PA3 A;  2LUS A;  1Z3E A;  2X8G A;  1DE1 A;  5GST A;  1FG4 A;  1FVK A;  3L9V A;  3U5R E;  2MZC A;  2YAN A;  2OAD A;  5JWO B;  4OFT A;  3PIN A;  5DAL B;  1ZYE A;  1ABA A;  4IJ3 A;  1OC8 A;  1NM3 A;  2IMI A;  4YKG A;  1SL0 B;  3L9S A;  2VL9 A;  2IPA A;  8GSS A;  2B6M A;  3TKS E;  3ZIJ A;  1XIY A;  1T4Y A;  2PVQ A;  1TRV A;  2R6K A;  4N0Z A;  2WRT A;  2GSQ A;  1R7H A;  2IME A;  2P5Q A;  2LJR A;  1BG5 A;  4TR4 A;  5G5E A;  2RII A;  2H0I A;  3TRX A;  3ZLP A;  3D21 A;  4E8H A;  2QGV A;  5G5F A;  1VGL A;  3LWA A;  3RPN A;  1U87 A;  1BQ7 A;  2VCZ A;  2XC2 A;  4GWR A;  4G0K A;  3IHG A;  3BCK A;  3I6A A;  4LA1 A;  3LGC A;  3F0I A;  2F9S A;  3IRA A;  3QPM A;  3CXG A;  3HVX A;  2WCI A;  3EU3 A;  3APS A;  4IQA A;  4ZBA A;  1B4Q A;  3GNJ A;  4X1U A;  3GL3 A;  5AIV A;  1XWB A;  3TKQ A;  3TOU A;  1WJK A;  4TR0 A;  4TXO B;  2J9H A;  4HDE A;  3DRN A;  3IV4 A;  1ZYQ B;  1U88 A;  4PTS A;  4WKW A;  1IYH A;  4WF5 A;  2WZ9 A;  4HZ4 A;  3H93 A;  4JR6 A;  3KMN A;  4KUN A;  3WGD A;  3O3T A;  4ZIJ A;  3GKX A;  1YDK A;  3RPP A;  1SL2 B;  2X49 A;  1RK4 A;  4Q5R A;  3M0F A;  5DJL A;  4XS1 A;  2VCT A;  3KP8 A;  4IBP A;  4V1A g;  4IN0 A;  1QFN A;  2C3N A;  4PUF C;  3GA4 A;  2PPT A;  5ABR A;  4NV2 A;  2VL2 C;  2VLV A;  4FH8 A;  1TRS A;  2I9H A;  2LJA A;  4ZL7 A;  2N5A A;  5H5R A;  5D9T A;  2IN3 A;  5ID2 B;  3A2V A;  4G10 A;  5H5S A;  3TRP A;  6GSW A;  3OR5 A;  1K0B A;  2ZUP A;  3ZL5 A;  2OBK A;  9GSS A;  2R37 A;  4EE0 A;  3VWU A;  1Z5Y E;  2JZR A;  4GXZ A;  4F82 A;  2HRF A;  2WS2 A;  3ZZX A;  1R4W A;  5IO2 A;  2H6Y A;  5BRT A;  2MBT A;  3RBT A;  2GDR A;  5JCW A;  2XBQ A;  5KN2 A;  3LFL A;  12GS A;  4CY6 A;  2O87 A;  3LOR A;  4V1A p;  3DGQ A;  3KGK A;  2DJK A;  2DKH A;  2CVB A;  1SJI A;  4IGJ A;  3A3T A;  1EOH A;  5FHI A;  1KNG A;  4XCS A;  3EMX A;  5ECH B;  1TK5 B;  2GLR A;  5D8I A;  2ZCT A;  3EWL A;  3HDC A;  4TN8 A;  2AJQ B;  2V6O A;  3MNG A;  1EZK A;  3IBH A;  1ZOF A;  2VD1 A;  2P31 A;  4EDY A;  2HNL A;  4KDX A;  2DMM A;  2IFQ A;  1TI3 A;  4G19 A;  1OC9 A;  4RQX A;  2NPB A;  4Q5N A;  4PUA A;  1ZGN A;  3C8E A;  3N5O A;  5KOW A;  1R5P A;  4F2I A;  1GTB A;  4IW9 A;  1BX9 A;  1QUW A;  3LXZ A;  3U6V A;  2LNT A;  2O89 A;  1OKD A;  4F9Z A;  4OFN A;  4LL4 B;  4ZB8 A;  5KN1 A;  5FT3 A;  2HSH A;  3C71 A;  2DBC A;  4BVY A;  4PXO A;  3APO A;  1U3A A;  2DJ2 A;  2HZE B;  1GSF A;  2OA7 A;  3KXO A;  3M3M A;  3GH6 A;  1FVJ A;  1YF1 A;  2XPE A;  3VI7 A;  4EXJ A;  3FZA A;  5CO3 A;  4TR1 A;  2I1U A;  3NIV A;  1HYU A;  3EC3 A;  2YJH A;  1E2Y A;  3VWV A;  1YZX A;  3GMF A;  1ERW A;  2GT5 A;  1G6W A;  3LSZ A;  4BVX A;  1GLQ A;  4DVC A;  4AGS A;  3FY7 A;  3P8W A;  4XTS A;  4KSO A;  5D9W A;  1BAY A;  1GSD A;  1AQV A;  2C4J A;  4NXI A;  3ZYW A;  2JZS A;  1YEX A;  1WPI A;  1JZD A;  2VL3 A;  5CRG A;  2B5E A;  2GTU A;  3IA1 A;  2IIY A;  1WP0 A;  1F9M A;  3LQ7 A;  4RQR A;  2E2M A;  1A24 A;  3KIJ A;  1FO5 A;  4K9Z A;  3UJ1 A;  3D4M A;  3KM6 A;  4WR4 A;  5G2Z A;  3HCZ A;  3J7Y k;  3DWV A;  2HE3 A;  1HD2 A;  2LNS A;  4EIQ A;  3F4T A;  1DUG A;  2H01 A;  2CX4 A;  2HXK A;  1SKR B;  2O85 A;  3DD3 A;  2M80 A;  4DSR A;  1GSY A;  2LJK A;  1I5G A;  3ME7 A;  1SYR A;  2FWF A;  5IM9 A;  2FGX A;  2KUC A;  2GVP A;  5KN0 A;  3K8N A;  3NOF A;  4F03 A;  2DIY A;  1EGO A;  4ZBB A;  5L71 A;  1SK2 A;  1PMT A;  4IS0 A;  5DVB A;  5HR0 A;  4MK3 A;  1T8E B;  1UC7 A;  2DC5 A;  1EP8 A;  1GUM A;  1K0D A;  2VUP A;  3A2X A;  4POK A;  4IP1 A;  2O8V B;  1OVN A;  5G30 A;  1M2B A;  1JZO A;  19GS A;  4ZB9 A;  4G0L A;  2PER A;  4KE3 A;  3MWH A;  4EC0 A;  3ERW A;  5EY6 A;  1SKS B;  5A4V A;  3HVS A;  1XZO A;  2OBI A;  1XW5 A;  1K0M A;  4PQH A;  2CVK A;  2P5R A;  4MH2 A;  4LLR A;  3A5W A;  3CRT A;  3IR4 A;  1NSW A;  1URM A;  4MP4 A;  4F0B A;  4GF0 A;  4J56 E;  2C0G A;  4GLT A;  2FY6 A;  4EKZ A;  3G9B A;  3CTF A;  2PN8 A;  1XPV A;  4RUV A;  4WET A;  1TJD A;  2NVL A;  1S3D A;  2L5L A;  4PNG A;  3I9V 2;  1Z6M A;  2LS5 A;  3KD0 A;  5HR2 A;  1SK1 A;  5G31 A;  1K0O A;  3ZFB A;  3F9U A;  1EEM A;  3FZ9 A;  5CYY A;  1R5A A;  5DAL A;  5ECR B;  1YJ6 A;  2OE3 A;  2FD3 A;  1SL1 B;  2I81 A;  1MTC A;  2MMO A;  4MZC A;  1USB A;  4N30 A;  4POB A;  3FZ5 A;  1M0U A;  5D93 A;  2H73 A;  1PKZ A;  4OCE A;  1XOA A;  5J41 A;  2GT6 A;  4KAE A;  2CZ3 A;  5KN3 A;  4X43 A;  2NDO A;  1BJX A;  1VF2 A;  2RLI A;  3HD5 A;  5J9C A;  3HZ8 A;  4L5L A;  2YJ7 A;  3VPT A;  2VD0 A;  5IOW A;  2GZP A;  1ERV A;  3F6F A;  4LMV A;  3QAG A;  3D4T A;  3VPQ A;  3W8S A;  2CAQ A;  1O6J A;  5GAN D;  4KCA A;  3WGE A;  1AXD A;  5ECP B;  3TCO A;  5DQY A;  1ACV A;  4K7O A;  3G7J A;  4DSS B;  1FB0 A;  4MF6 A;  4PNF A;  5LNK e;  3O6T A;  4IJI A;  2L4Q A;  4IEL A;  1AUC A;  4IP6 A;  2I3Y A;  2IMD A;  2EIO A;  1JHB A;  2VOC A;  5H5Q A;  1N2A A;  2H0G A;  2H1D A;  2BTO T;  1MD3 A;  1DE2 A;  14GS A;  2C3Q A;  1BED A;  1PD2 1;  1SD8 A;  3MDK A;  5C00 A;  4EIP A;  3F3Q A;  1X5C A;  4ICY A;  3P90 A;  1SJ6 A;  1CQG A;  4XHM A;  5B7C A;  4XS4 B;  1A2J A;  4GCI A;  3ZRD A;  4KX4 A;  5F05 A;  5IIZ A;  4MNN A;  1ST9 A;  1A23 A;  4FYU A;  2EIR A;  5KEJ A;  2AAW A;  2PBJ A;  2KOK A;  1ZCP A;  1OYJ A;  4D73 B;  4MZB A;  5BMU A;  1GTI A;  4XS6 A;  2F8A A;  4K6X A;  3GV1 A;  5HFI A;  3WT1 A;  4JED A;  1B48 A;  4XIH A;  1WIK A;  4G9H A;  1A2M A;  4O5Q A;  2KHP A;  4PUR A;  4L0W A;  5KOX A;  3IAS 2;  1XCC A;  1NHO A;  1J9B A;  3TKS A;  1DSB A;  1G0T A;  3RAZ A;  3CRU A;  1A8L A;  4MPF A;  3E0U A;  1V9W A;  4KF9 A;  4JRR A;  1GTU A;  1K0N A;  4YAV A;  5INY A;  3GTU B;  1EWX A;  2VO4 A;  2AB6 A;  2R0P A;  4V2N A;  3DEX A;  4WBR D;  5DDL A;  2GQK A;  1AQX A;  3WT2 A;  4FQU A;  2AUV A;  4FO5 A;  1W89 A;  4GTU A;  4AF2 A;  4KDY A;  3TGZ A;  4K7I A;  4YQU A;  2X8C A;  3UAP A;  2LTK A;  3M8N A;  3DIE A;  3IXR A;  2OKA A;  5LCZ A;  1F3B A;  4ECJ A;  2KLX A;  3QDN A;  2HZE A;  3DVW A;  4MAB A;  1TXX A;  1U3I A;  2JSY A;  3HKR A;  1V2A A;  1MDI A;  3GSS A;  7GSS A;  2YWN A;  3GKK A;  1GUH A;  2KP2 A;  4OMV A;  2R4V A;  2A2S A;  3IK9 A;  1XXU A;  1W4V A;  4DEJ A;  3LW9 A;  3VWX A;  4KCE A;  1TOF A;  1GSU A;  4MLY A;  22GS A;  5E4W A;  4LMW A;  6GSS A;  2QA1 A;  2F8F A;  2E7P A;  4ECC A;  1GL8 A;  1A2L A;  2CA8 A;  4L8E A;  4AJ6 A;  2C0F A;  2JU5 A;  4HQZ A;  4MA9 A;  3FMW A;  3Q74 A;  3PR8 A;  3MIX A;  1Q4J A;  3ZIT A;  3FK8 A;  5HQP A;  1B8X A;  4Z2R A;  2MYG A;  2IWT A;  5JWQ B;  1MEK A;  4V2M A;  4JE1 A;  1M9A A;  4OFM A;  4POM A;  3JCM L;  2H66 A;  2VM1 A;  6GSX A;  4Z2T A;  2HI7 A;  2HRN A;  3GFK A;  1GRX A;  2YZU A;  3GRX A;  2GZZ A;  1V57 A;  1O85 A;  1ZYP A;  2ALB A;  3H79 A;  5IPH A;  2YWI A;  4BWS A;  3MAK A;  1T4Z A;  2C80 A;  4YQM A;  2QC7 A;  2RUF A;  5CAX A;  1M2A A;  3BJ5 A;  4NV5 A;  1SK0 A;  1AW9 A;  3CSJ A;  3D0Z A;  3CSH A;  3V1W A;  4HU9 A;  2X64 A;  2C0E A;  2L59 A;  2ES7 A;  5ECO B;  3GUR A;  4DSQ A;  13GS A;  4YKF A;  1KBN A;  5ELA A;  4ACS A;  5G1K A;  2B7K A;  4QQ7 A;  5B8B A;  3ME8 A;  2H19 A;  2K18 A;  5HFK A;  4O5U A;  4ZL9 A;  3FHK A;  3F4S A;  1B9Y C;  5ECM B;  3M1G A;  3IOS A;  2M72 A;  4LL1 B;  2VM2 A;  3MSZ A;  4K2D A;  1R26 A;  1WE0 A;  4HJM A;  2H70 A;  2HT9 A;  2B5X A;  1QGV A;  2WJU A;  3GN3 A;  4O5R A;  4GSS A;  4OO5 A;  2TRC P;  3FYG A;  2H74 A;  4K1F A;  3E9J B;  3ERG A;  2LQQ A;  3KZQ A;  1OC3 A;  3Q18 A;  3TJK A;  2QKE A;  3FKF A;  3KTB A;  1JFU A;  2PUK C;  2XBI A;  2BMX A;  5ECS A;  2X99 A;  2A4V A;  2LRN A;  2NTO A;  1ILO A;  1O81 A;  1XVW A;  2FWE A;  4MPG A;  4ULX A;  2C0D A;  4V2L A;  3HJP A;  5IMD A;  4IVF A;  3HHV A;  1Y6E A;  4QL7 A;  2PWJ A;  2V1M A;  2YNX A;  1PX7 A;  1T1V A;  1NW2 A;  3RHB A;  1FB6 A;  2UZ8 A;  1UVZ A;  1FAA A;  2YV9 A;  5LD0 A;  2CT6 A;  2G0F A;  2RM6 A;  2H0H A;  3KTL A;  2L57 A;  4O7H A;  3ERF A;  4FYC A;  1O8W A;  2CZ2 A;  1G7O A;  1GH2 A;  1PQN A;  1OC9 B;  4TW5 A;  3PH9 A;  1Z9H A;  4OCF A;  1XOB A;  1JZR A;  2MMN A;  4A5P A;  18GS A;  4IKH A;  5AN1 A;  3QOU A;  4MJA A;  2HSY A;  1J0F A;  2XPD A;  1PSQ A;  2R3X A;  2X8H A;  2YZH A;  5D96 A;  1SEN A;  1T7P B;  2YV7 A;  1XW6 A;  4EO3 A;  2ZNM A;  5FWG A;  2OE1 A;  1SKW B;  1VF1 A;  4HU7 A;  4BVY B;  1AIU A;  3US3 A;  3IE3 A;  2I4A A;  1H75 A;  2H6Z A;  5IMZ A;  1THX A;  2XHF A;  1ERU A;  4G0I A;  2VIM A;  4TR1 B;  4GQF A;  3EMP A;  2TIR A;  1FOH A;  1K3L A;  4MF7 A;  6GSV A;  4EUY A;  4BA7 A;  4PQ1 A;  4CDO A;  3H8Q A;  3F63 A;  1H4O A;  4I6X A;  4DSS A;  3L4N A;  1VRS D;  4Z2U A;  4KSM A;  1M9B A;  1EP7 A;  4ZB6 A;  2B1L A;  4BVX B;  3E3E A;  2CV4 A;  4P3Y B;  1TP9 A;  5D73 A;  4TR3 A;  1MDK A;  2M46 A;  1HQO A;  2GS3 A;  3EUR A;  4CW9 A;  1OE8 A;  2YP6 A;  4ILF A;  2JL4 A;  3LXT A;  1GSE A;  2DML A;  4BL7 B;  4HI7 A;  5DCH A;  4HUA A;  3TUE A;  1K3Y A;  3CTG A;  1MDJ A;  2C1Y A;  4X0X A;  1ZL9 A;  4CY8 A;  2DLX A;  5HR1 A;  4HZ2 A;  3M9J A;  3G7Y A;  3PPU A;  2GSR A;  5J4U A;  3LG6 A;  2CQ9 A;  1JLV A;  4I2T A;  5JCG A;  1B4P A;  3W6G A;  4N0V A;  3ZRE A;  1A8Y A;  1WOU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...