1R7HA

Nrdh-redoxin of corynebacterium ammoniagenes forms a domain-swapped dimer
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
74
structure length
74
Chain Sequence
MSITLYTKPACVQCTATKKALDRAGLAYNTVDISLDDEARDYVMALGYVQAPVVEVDGEHWSGFRPERIKQLQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords NrdH-redoxin
publication title NrdH-redoxin of Corynebacterium ammoniagenes forms a domain-swapped dimer.
pubmed doi rcsb
source organism Corynebacterium ammoniagenes
total genus 18
structure length 74
sequence length 74
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00462 Glutaredoxin Glutaredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1r7hA00
2VL2A 3ZRDA 3D21A 2K8SA 4I6XA 3ZIJA 2JZSA 2KUCA 2OACA 5ECQB 1ON4A 1B9YC 4MF6A 2OADA 3EE2A 2L59A 2I3YA 5J4UA 4G19A 1URMA 1XW5A 3ZMKA 5CP1A 2NDOA 2HT9A 3A2VA 1SK0A 1SD9A 1SJIA 1A23A 5KN3A 2R37A 4MDCA 4IP1A 2FA8A 3TRPA 1EP7A 3F9UA 4K7OA 3IDVA 5DQYA 3HY2A 4NXIA 4TR4A 1FB6A 3P7XA 2VL2C 1F3BA 2GGTA 5CREA 4ZB8A 2YV7A 1V2AA 1O6JA 4BWSA 5CRGA 4TXOA 2HRNA 4XRAA 3DD3A 4FYUA 4JR4A 2CQ9A 2DJ2A 4FYCA 2LS5A 3VK9A 4IHUA 2H30A 2DIZA 2GVPA 3D4TA 1X5DA 1T1VA 2WFCA 4HUAA 1AXDA 3ME8A 4JU5A 2YZUA 5IMZA 1WMJA 1XWGA 1G6YA 2F51A 1Z5YE 3TJFA 1R26A 5ECMB 4L5LA 1M99A 2HZEB 4K1FA 5LD0A 2MYGA 3HVVA 2LRTA 1XWCA 5IMVA 4OWYA 1WRYA 3UEMA 3V1WA 5G1KA 2IJYA 1T3BA 1Z7PA 2GZPA 5G5EA 8GSSA 5G2ZA 2H1GA 2RLIA 2BTOT 2VLVA 2GSTA 1IYHA 1PL2A 4TW5A 1TRWA 4XRDA 4PQ1A 3F4TA 4NMUA 2A4VA 2HLSA 3IHQA 4JZQA 4K7IA 3CMIA 2YWIA 1Y25A 1RW1A 1R4WA 3GSTA 2EC4A 2H1BA 3TKQA 1O7UA 3IRAA 1FVJA 3L0HA 2NPBA 4POBA 4ECIA 5J9CA 4WF5A 2B7JA 2HZEA 4KA0A 5A5KA 4OFMA 1VF3A 1OC9B 2V32A 5AIXA 3FZAA 14GSA 3F63A 1J9BA 4YH2A 3DEXA 1OYJA 3F4SA 3M3MA 2LRNA 4LMWA 4F82A 2FUG2 2O8VB 3FY7A 3IV4A 5E4WA 3TJBA 3H79A 1G0TA 3KM6A 2BJXA 4ECBA 4GSTA 1VF1A 1O8WA 1WE0A 5A4VA 2RUEA 3ZZXA 5KN1A 2FNOA 2CAQA 2P31A 1TU8A 2V1MA 5IQYA 4XIHA 1SJ6A 4PUFC 3LFLA 2H0HA 1X9SB 5IO2A 1G6WA 4PNFA 4PGTA 3GKXA 4KUNA 4EE0A 2ALBA 2KLXA 4BL7A 3EMXA 4MA9A 4IGJA 1K3YA 3M0FA 1YF1A 1ILOA 3KGKA 2R6KA 1R7HA 3KMNA 3RHCA 4N0ZA 9GSSA 1LJRA 1K0OA 1A2JA 5AGYA 1TDIA 4HU9A 1BAYA 1WJKA 2GLRA 4K7NA 3IC4A 4IQ1A 3DWVA 5CAXA 2PGTA 1WIKA 3LSZA 3BJ5A 1K0BA 3HJMA 3KH7A 3VWVA 3HD5A 2H72A 2TRXA 2C80A 1GUMA 4MMMA 3TJGA 1TK0B 3HZ4A 2MMAA 5CYYA 4ISDA 3QAVA 2QKEA 4GXZA 2C8UA 1PN9A 4ZB6A 4TOPA 2WGRA 1OKTA 1TRUA 2BMXA 4TR0A 1HYUA 4XTSA 2PERA 2GSRA 1K0CA 2V41A 1E6BA 3GL5A 5HQPA 1GUHA 3GNJA 2QGVA 3CTFA 3PR8A 4MABA 2KP2A 2MMNA 2RIIA 3VPTA 5FHIA 4POMA 3RPPA 3Q6OA 4KE3A 1PX7A 2N5FA 5DQSA 3TKPA 4XS4B 1GTBA 1T7PB 3F0IA 1ZMAA 1TI3A 2V6OA 4O32A 2CT6A 1VF2A 1PGTA 2DSAA 3D4MA 1HNAA 1QK8A 3DKSA 3UAPA 4F0CA 1KEBA 1EGRA 2HNLA 5H5QA 2DC5A 3IR4A 4ML1A 1AQWA 1GTIA 1E2YA 3FZ5A 4ZBBA 1THOA 5ID2B 2PBJA 1EWXA 3KZQA 3Q18A 2LNTA 3F6FA 1O73A 4F9ZA 4J56E 2H1DA 1B4PA 3IOSA 4YAVA 4L5OA 2XPEA 3IE3A 3JCML 1C72A 4MPFA 1XWBA 1YQ1A 4ZBAA 4OO5A 1WP0A 3KEBA 2FWFA 3UBLA 4L0UA 4BVXA 1R5AA 3GA4A 4XS4A 4EC0A 3FR9A 2IL3A 4PX1A 3J7Yb 4K0NA 3N5OA 4AJ6A 2VCZA 3L9SA 3D0ZA 4QL7A 1THXA 1B48A 2CAIA 2YV9A 1RQMA 2B7KA 1EP8A 4I97A 19GSA 4RQXA 4IW9A 2H0IA 2IFQB 4AF2A 1PL1A 1VRSD 2PN8A 4RI6A 1UA5A 4BPYA 2WDUA 3CSHA 4HZ4A 1ERTA 3RBTA 1MDIA 5ID2A 1BEDA 2VO4A 2YOIA 5GSSA 1K0AA 1PA3A 1SL1B 4TXVA 5D73A 2DIYA 1GSEA 2J9HA 11GSA 2L5LA 3ZFBA 1TOFA 1Z6MA 3E9JB 3O6TA 4MZWA 2KOKA 1Z7RA 1AC1A 4MZCA 12GSA 4D73B 5ECPB 1XVWA 2EIRA 4GWRA 6GSWA 2C0DA 3EMPA 2DJ3A 2H6XA 3NZNA 2WULA 6GSXA 2JADA 1F37A 3IK9A 4MCUA 2FWEA 3Q19A 1JHBA 1VGLA 3FW2A 2E7PA 3EURA 2DLXA 3QFAC 1VF4A 4X1UA 2IFQA 2L4CA 5FT3A 1OE8A 4HZ2A 4ZIJA 3HJOA 2PVQA 1S3DA 1A0RP 2H19A 1GNEA 5IPHA 2FCHA 4K6XA 2F8FA 1U3AA 4BVYA 5JCUA 3CSIA 4JEDA 3TRQA 1SYXA 2LV3A 4WR4A 3A5WA 1V40A 4DVCA 3R2QA 2X8HA 3P8WA 2YN1A 1GTAA 4XS6A 3GIXA 4K0GA 5ECHB 2WCIA 4D73A 1EOHA 5F0GA 5D9WA 2CX4A 2M46A 3IXRA 4ILFA 5B8BA 1WOUA 3J7Yk 1M7TA 5AISA 4E8EA 3ZTLA 5JCWA 1KTEA 5IOWA 2VCQA 3MDKA 5G1LA 3C1SA 2E0QA 3KMOA 2VL3A 3QDNA 3M9JA 3I43A 1V58A 2TIRA 4TXOB 4NHWA 5HR3A 3FKFA 5IO0A 1FVKA 1U88A 2YWMA 1XBSA 2J23A 1QGVA 1J0FA 1N8JA 3BOAA 3GX8A 1M0UA 1K3LA 5DBQA 2DJKA 1XPVA 2LJAA 10GSA 3BCIA 2L6DA 1MDKA 4OD7A 5E59A 4POKA 3TUEA 4NV2A 4O5RA 1T4ZA 2Z9SA 3UMAA 1M2AA 1A8LA 5C00A 1V9WA 3KD0A 5GAND 3F3RA 2CVBA 2AJQB 4HI7A 4GSNA 3LJRA 3I6AA 2L5OA 3TDGA 3SBCA 1OC3A 4MK3A 2AYTA 1XFLA 1XZOA 5CRWA 4N0VA 1HNBA 4WETA 1EOGA 4IP6A 5IMFA 2H70A 2C0FA 2PPTA 4MP4A 2GQKA 4MJEA 4O92A 2K8VA 3UIWA 3HKRA 1XOAA 4YQMA 3D6IA 2GT6A 5D9TA 4IKHA 4HOJA 4GRFA 3WGDA 1JLWA 2IN3A 4MLYA 4OCFA 2MBSA 2FD3A 1A24A 3SWLA 1TXXA 4JRRA 1Z9HA 3QPMA 2VAFA 5ECRB 4ID0A 2CX3A 3MAKA 3BBYA 3TOTA 4X43A 2XBQA 5CNWA 3NIVA 2XPDA 5F06A 4PNGA 2AUVA 2LEGA 4ZL7A 1EEMA 3QD9A 3HXSA 4V2LA 2MMOA 6GSUA 3GKMA 1JZWA 1OVNA 2TRCP 2PU9C 1PMTA 4KX4A 2YANA 5HR2A 1F6MC 1K3OA 4G9HA 4JE1A 5HR1A 1JFUA 4GTUA 2AB6A 4Q5QA 2DJ1A 4HS1A 1DE1A 2LJRA 4F0BA 4MJAA 2R4VA 2OBIA 5ABRA 1TP9A 3HZ8A 5DJMA 2CV4A 1TTZA 2PVOC 1GLQA 1KBNA 2VCVA 2B3SA 1EV9A 1QXHA 3L9UA 3QCPA 5HR0A 2GSSA 4I2UA 4Q5FA 1TK5B 2WZ9A 2L4QA 3LG6A 1PRXA 1YEPA 2YWOA 1S3CA 3AY8A 1XWKA 3F4RA 2P5QA 2GTUA 4N10A 2C4JA 2LTKA 4HQZA 3C73A 1PKZA 2YCDA 1OAZA 2A2SA 4X0XA 2GDRA 4EXJA 1SU9A 3LWAA 3DYRA 3DXBA 3PINA 4OCEA 2MBTA 2M72A 3RDWA 2FLSA 2EIOA 3FR3A 4GCIA 1O8XA 2O87A 3M9KA 2LJKA 4V1Ag 2VCTA 3C1RA 2K6VA 2WS2A 3S9FA 5LNKe 1F2EA 3F6DA 4XHMA 4FO5A 2YP6A 2B5EA 5F07A 5ENUA 4KW6A 3ZLPA 3RHBA 4HJMA 3A2WA 3E0UA 3TJKA 4IJ3A 1GRXA 3C7MA 3HJPA 3TB2A 1AQVA 2CA8A 4RQRA 3C71A 3L78A 3G9BA 4MF7A 2RM5A 4KDUA 1XVQA 4ML6A 2M80A 4LLRA 3UJ1A 2C3TA 4F2IA 5JWQB 4JBBA 2H66A 1F9MA 2JL4A 3PH9A 2B1KA 3U6VA 4MH2A 3LEFA 4GQFA 4TR1B 3GHAA 1UC7A 3APQA 4IJIA 3DIEA 1ZYEA 1UVZA 3ZFLA 1ZCPA 2G2QA 3OR5A 3VLNA 3CSJA 1OE7A 4L0WA 1JZDA 4KAEA 2VOCA 5G30A 4L8EA 3FZ9A 1ERVA 4MPGA 3ZREA 2YJ7A 3HVSA 1X5CA 3FK8A 1GL8A 1ABAA 4E8HA 3GURA 1OKDA 5DVBA 2GQLA 3ERWA 3GUSA 4BA7A 1BJXA 5LCZA 3EVIA 5EPFA 2VD1A 5J5NA 4JR6A 3FHKA 1TK8B 1CQHA 3ERGA 4Q5NA 4YQVA 3WT2A 3GYKA 1YKAA 4ZBDA 3CYNA 1N2AA 3HCZA 3HA9A 2JZTA 5IOXA 4HQSA 1ST9A 1F3AA 4OMVA 1W4VA 5COHA 2F8AA 3DRNA 5F8BA 1M9BA 4K2DA 2IMKA 4TR1A 3CRUA 1K0MA 2F3MA 1BX9A 4DSSB 1XIYA 3A2XA 2VCXA 1GSSA 4WKWA 4DEJA 1YKCA 2H6YA 4ULXA 2IPAA 5B8AA 1I5GA 2C0EA 2RM6A 3UVHA 3PGTA 4I5QA 2H74A 1PX6A 1ACVA 1CQGA 5ECOB 3KJYA 5DAKB 2CVDA 4YQUA 3NOFA 2PWJA 4QQ7A 5CRHA 1T4YA 4NV5A 3UVTA 3Q74A 2REMA 1PD21 3P2AA 4G2EA 4OFNA 4PQHA 4NWYA 2WJUA 4KH7A 3IK7A 1ZL9A 3QAGA 4EDZA 1QFNA 4DSSA 3CTGA 2VLTA 3ME7A 2H6ZA 1T00A 2HSYA 4PURA 3APOA 4OFTA 1DBYA 1OC8A 1H4OA 3ZMLA 2ES7A 1SK1A 4FH8A 4WR5A 2CZ3A 3KTLA 4J57E 3VWXA 3O76A 2C0GA 4PQIA 4HEA2 4IQAA 5DAKA 3KH9A 3HYPA 5FWGA 3QR6A 3FEUA 4LL4B 2V2GA 3W8JA 2H71A 2K9FA 1EV4A 1M2DA 1JZRA 2AAWA 5D96A 4TVEA 3TKSE 3TKSA 3IAS2 1O85A 4ZB9A 2JU5A 4TKYA 4RUVA 4KCEA 5G31A 2ON7A 1GSUA 3TJJA 1AUCA 1LU4A 5KEJA 1J08A 5ECSA 5DCGA 2JSYA 3GH6A 3WT1A 1FG4A 1NM3A 1MEKA 1U6TA 1HQOA 2GZYA 4HU7A 3GV1A 2GZZA 3I9V2 2L57A 3VURA 1NHOA 2ZUPA 4EL1A 6GSYA 5DDLA 3CRTA 3G7JA 3G7YA 2OE3A 3ISOA 1YY7A 2FGXA 4GSSA 1NSWA 3VWUA 5IMAA 2MZCA 3TKSC 3EU3A 1Y6EA 4YAPA 3TKRA 3EINA 1GUKA 1SKRB 5AIVA 3BCKA 2B5YA 3FR6A 4NPBA 4RI7A 1NHYA 2IWTA 3H93A 5IPGA 3GFKA 2OJLA 4IBPA 3DMLA 2DJJA 3P90A 2N5AA 4EUYA 4QL9A 4CHSA 2AV4A 5HFGA 1YZXA 5ECIB 3WYWA 5HFKA 4V1Ap 2D2ZA 3H1NA 1GSDA 4NHZA 2WB9A 1GP1A 4IVFA 3ZITA 3ZVJD 4AJ7A 2NVLA 3MWHA 3N9JA 5H5RA 3RPNA 3H4KA 2ZCTA 1GH2A 5JCGA 2GT5A 2LKUA 4G10A 3QFBC 1TI1A 1Q98A 2OA7A 2JZRA 2H73A 2PMTA 3KTBA 2I4AA 1U3IA 5INYA 1MTCA 5ELAA 2IMFA 3UL3A 3BD2A 2IMEA 1GTUA 2VIMA 2H01A 3FYGA 1YF0A 2ZNMA 3TGZA 2YZHA 1AAZA 4TN8A 5J3RA 2LNSA 3D22A 2YWNA 4N11A 2XC2A 2GS3A 4DSQA 1MDJA 5CO3A 2HYXA 3QMXA 5DALB 5EL8A 1PSQA 1G7OA 4WF4A 2QSIA 1GSYA 3CXGA 4EDYA 2PUKC 2HRFA 3D5JA 1DE2A 2CZ2A 4EVMA 1SD8A 2FA4A 2EIQA 5D8IA 2JACA 2QC7A 1M2BA 3F8UA 4IN0A 4ECCA 2WRTA 3VI5A 3ZIVA 3DVXA 2HI7A 5D9VA 2O89A 2HE3A 3GKKA 4O7HA 1XW6A 1NW2A 2X64A 3UBKA 4NAXA 2OE0A 4N30A 4Q5RA 3VFIA 3UARA 22GSA 4V2NA 2LRCA 1SENA 1X9MB 4AJ8A 5DALA 2A2RA 4F03A 2OBKA 3GN3A 4XCSA 2KHPA 3VWWA 4ZILA 4GLTA 2VCWA 3HDCA 6GSVA 3IA1A 1DUGA 4P3YB 2V6KA 4MF5A 4KSOA 4ZL8A 18GSA 1B4QA 5ELGA 1B9XC 5ECKB 4XS1A 1FOVA 3L9VA 2LUSA 2B1LA 3EYTA 1FAAA 6GSTA 1R5PA 3IPZA 2FHEA 1TJDA 2G0FA 2RUFA 3W6GA 2H0GA 3WD6A 4FYBA 4CDOA 1Q4JA 2X99A 4WXTA 2C3NA 3US3A 2DMLA 2IIYA 3KXOA 4HDEA 2I9HA 3QAWA 2HFDA 3GKNA 1DSBA 2I1UA 3ZYWA 1JLVA 3LORA 1FHEA 2DJ0A 1ERUA 2HZFA 1GSFA 1WWJA 5KN0A 2B6MA 1UN2A 4MZBA 5A4WA 2K18A 4MH3A 4H86A 2YPMA 2GSQA 3DVWA 4IS0A 3KP9A 3KCMA 4IELA 2DBCA 3M8NA 1ZOFA 4K8MA 1O81A 1SKSB 5F05A 1SL0B 2HXKA 1PKWA 2P0GA 3TRXA 2R5GA 5J41A 1G7EA 1RK4A 1X5EA 5DCHA 1OC9A 1K0NA 1SK2A 3EWLA 2H8LA 1GWCA 5B6MA 2ON5A 3UOMA 2O85A 3GL3A 5JWOB 2C1YA 2P5RA 1Z3EA 2N5BA 2FWGA 3E3EA 1GLPA 1V57A 4TRXA 1SJZA 4WEYA 1FW1A 1LBKA 2LSTA 3H8QA 2OKAA 5JWRB 2OE1A 1AW9A 1XW9A 1QMVA 1TW9A 1ZGNA 1IYIA 3LYKA 4FIWA 4ACSA 3FZ4A 3TOUA 4KNDA 3MSZA 2HSHA 1B8XA 3MNGA 1QUWA 4KDXA 2C3QA 4BWQA 1YEXA 2R2JA 3KIJA 1EZKA 16GSA 5IMDA 4ZXGA 1TU7A 3QOUA 3CBUA 2VM2A 3M1GA 3LXZA 4TR3A 3GRXA 1QQ2A 2MMZA 3WGEA 5B6NA 3IBHA 2FWHA 2VLUA 1TRSA 4EF0A 3LYPA 1SL2B 2AHEA 4HJ2A 1XOBA 7GSSA 4I2TA 4J2FA 3ERFA 5ECNB 1XXUA 5D9XA 1EGOA 2IMDA 1I9DA 1PQNA 2O7KA 1U87A 1GSQA 4OO4A 3GMFA 4EKZA 1BQ7A 2VUPA 2YJHA 4WBRD 1AQXA 1M9AA 1JZOA 5IM9A 3GTUB 3W8SA 1MD3A 1AIUA 1USBA 1GNWA 4MJCA 3LXTA 4KDYA 3WGXA 4Z7XA 1S3AA 2H1AA 4LA1A 1V98A 3ED3A 4V2MA 1YDKA 2H75A 5GAPD 4GQCA 1SKWB 5GSTA 4KGIA 5EY6A 5H5SA 1ZYQB 1ZZYA 5AN1A 20GSA 4ECJA 4I8BA 4KSMA 2DMMA 3LGCA 1HNCA 5D93A 3K8NA 2F9SA 2VM1A 1Z6NA 4LMVA 5CRDA 3U5RE 3GX0A 1EEJA 1YJ6A 3FRCA 2NBSA 1W89A 5L71A 3VPQA 2L6CA 2E2GA 3GH9A 3GTUA 2VD0A 4CW9A 6GSSA 1T8EB 4PUAA 13GSA 5IIZA 3IAM2 2XHFA 17GSA 2FY6A 4GF0A 2R3XA 4AGSA 2VL9A 1X9WB 1TRVA 1FB0A 2E2MA 3KP8A 4DSRA 5G5FA 3EU4A 3ZL5A 3HHVA 1GULA 5ECLB 3TCOA 5HFIA 2GQMA 1H75A 3ZVJA 1MD4A 1A0FA 3O3TA 3APSA 1WPIA 4ZL9A 5A4UA 1A8YA 1BYEA 2X8CA 1FO5A 3EC3A 3GSSA 4PXOA 1ML6A 2B5XA 4K9ZA 5B7CA 3C8EA 1XWAA 5IMCA 3A3TA 2LQOA 4EO3A 5KN2A 5C04A 4WBJA 3F3QA 2H76A 2NTOA 2YNXA 1XCCA 2JSZA 3RAZA 2X8GA 5EVOA 4MJBA 3LQ7A 4KCAA 2XBIA 5DJLA 1HD2A 2KP1A 5J9BA 1K0DA 4POLA 5GZZB 1KNGA 3L4NA 4KB3A 2I81A 1X0RA 2LQQA 1ERWA 3HVXA 3G7IA 3DGQA 1BG5A 2IMIA 1A2LA 1SYRA 1TKDB 2CVKA 3I69A 1A2MA 4LL1B 3VI7A
chains in the Genus database with same CATH superfamily
2VL2A 3ZRDA 3D21A 2K8SA 4I6XA 3ZIJA 2JZSA 2KUCA 2OACA 2R0GA 5ECQB 1ON4A 1B9YC 4MF6A 2OADA 3EE2A 2L59A 2I3YA 5J4UA 4G19A 1URMA 1XW5A 3ZMKA 5CP1A 2NDOA 2HT9A 3A2VA 1SK0A 1SD9A 1SJIA 1A23A 5KN3A 2R37A 4MDCA 4IP1A 2FA8A 3TRPA 1EP7A 3F9UA 4K7OA 3IDVA 5DQYA 3HY2A 4NXIA 4TR4A 1FB6A 3P7XA 2VL2C 1F3BA 2GGTA 5CREA 4ZB8A 2YV7A 1V2AA 1O6JA 4BWSA 5CRGA 4TXOA 2HRNA 4XRAA 3DD3A 4FYUA 4JR4A 2CQ9A 2DJ2A 4FYCA 2LS5A 3VK9A 4IHUA 2H30A 2DIZA 2GVPA 3D4TA 1X5DA 1T1VA 2WFCA 4HUAA 1AXDA 3ME8A 4JU5A 2YZUA 5IMZA 1WMJA 1XWGA 1G6YA 2F51A 1Z5YE 3TJFA 1R26A 5ECMB 4L5LA 1M99A 2HZEB 4K1FA 5LD0A 2MYGA 3HVVA 2LRTA 1XWCA 5IMVA 4OWYA 1WRYA 3UEMA 3V1WA 5G1KA 2IJYA 1T3BA 1Z7PA 2GZPA 5G5EA 8GSSA 5G2ZA 2H1GA 2RLIA 2BTOT 2VLVA 2GSTA 1IYHA 1PL2A 4TW5A 1TRWA 4XRDA 4PQ1A 3F4TA 4NMUA 2A4VA 2HLSA 3IHQA 4JZQA 4K7IA 3CMIA 2YWIA 1Y25A 1RW1A 1XG8A 1R4WA 3GSTA 2EC4A 2H1BA 3TKQA 1O7UA 3IRAA 1FVJA 4X4JA 3L0HA 2NPBA 4POBA 4ECIA 5J9CA 4WF5A 2B7JA 2HZEA 4KA0A 4BL7B 5A5KA 4O5QA 4OFMA 1VF3A 1OC9B 2V32A 5AIXA 3FZAA 14GSA 3F63A 1J9BA 4YH2A 3DEXA 1OYJA 3F4SA 3M3MA 2LRNA 4LMWA 4F82A 2FUG2 2O8VB 3FY7A 3IV4A 5E4WA 3TJBA 3H79A 1G0TA 3KM6A 2BJXA 4ECBA 4GSTA 1VF1A 1O8WA 1WE0A 5A4VA 2RUEA 3ZZXA 5KN1A 2FNOA 2CAQA 2P31A 1TU8A 2V1MA 5IQYA 4XIHA 1SJ6A 4PUFC 3LFLA 2H0HA 1X9SB 5IO2A 1G6WA 4PNFA 4PGTA 3GKXA 4KUNA 4EE0A 2ALBA 2KLXA 4BL7A 3EMXA 4MA9A 4IGJA 1K3YA 3M0FA 1YF1A 1ILOA 4YKGA 3KGKA 2R6KA 1R7HA 3KMNA 3RHCA 4N0ZA 9GSSA 1LJRA 1K0OA 1A2JA 5AGYA 1TDIA 4HU9A 1BAYA 1WJKA 2GLRA 4K7NA 3IC4A 4IQ1A 3DWVA 5CAXA 2PGTA 1WIKA 3LSZA 3BJ5A 1K0BA 3HJMA 3KH7A 3VWVA 3HD5A 2H72A 2TRXA 1S3RA 2C80A 1GUMA 4MMMA 3TJGA 1TK0B 3HZ4A 2MMAA 5CYYA 4ISDA 3QAVA 2QKEA 4GXZA 2C8UA 1PN9A 4ZB6A 4TOPA 2WGRA 1OKTA 1TRUA 2BMXA 4TR0A 1HYUA 4XTSA 2PERA 2GSRA 4O5UA 1K0CA 2V41A 1E6BA 3GL5A 5HQPA 1GUHA 3GNJA 2QGVA 3CTFA 3PR8A 4MABA 2KP2A 2MMNA 2RIIA 3VPTA 5FHIA 4POMA 3RPPA 3Q6OA 4BVXB 4KE3A 1PX7A 2N5FA 5DQSA 3TKPA 4XS4B 1GTBA 1T7PB 3F0IA 1ZMAA 1TI3A 2V6OA 4O32A 2CT6A 1VF2A 1PGTA 2DSAA 3D4MA 1HNAA 3CQFA 1QK8A 3DKSA 3UAPA 4F0CA 1KEBA 1EGRA 2HNLA 5H5QA 2DC5A 3IR4A 4Z2UA 4ML1A 1AQWA 1GTIA 1E2YA 3FZ5A 1M3JA 4ZBBA 1THOA 2A4HA 5ID2B 2PBJA 1EWXA 3KZQA 3Q18A 2LNTA 3F6FA 1O73A 4F9ZA 4J56E 2H1DA 1B4PA 3IOSA 4YAVA 4L5OA 2XPEA 3IE3A 3JCML 1C72A 4MPFA 1XWBA 1YQ1A 4ZBAA 4OO5A 1WP0A 3KEBA 2FWFA 3UBLA 4L0UA 4BVXA 1R5AA 3GA4A 4XS4A 4EC0A 3FR9A 2IL3A 4PX1A 3J7Yb 4K0NA 3N5OA 4AJ6A 2VCZA 3L9SA 3D0ZA 4QL7A 1THXA 1B48A 2CAIA 2YV9A 1RQMA 2B7KA 1EP8A 4I97A 19GSA 4RQXA 4IW9A 2H0IA 2IFQB 4AF2A 1PL1A 1VRSD 2PN8A 4RI6A 1UA5A 4BPYA 2WDUA 3CSHA 4HZ4A 1ERTA 3RBTA 4A5PA 1MDIA 5ID2A 1BEDA 2VO4A 2YOIA 5GSSA 1K0AA 1PA3A 1SL1B 4TXVA 5D73A 2DIYA 1GSEA 2J9HA 11GSA 2L5LA 3ZFBA 1TOFA 1Z6MA 3E9JB 3O6TA 4MZWA 2KOKA 1Z7RA 1AC1A 4MZCA 12GSA 4D73B 5ECPB 1XVWA 2EIRA 4GWRA 6GSWA 2C0DA 3EMPA 2DJ3A 2H6XA 3NZNA 2WULA 6GSXA 2JADA 1F37A 3IK9A 4MCUA 2FWEA 3Q19A 1JHBA 1VGLA 3FW2A 2E7PA 3EURA 2DLXA 3QFAC 4G0KA 1VF4A 4X1UA 2IFQA 2L4CA 5FT3A 1OE8A 4HZ2A 4ZIJA 3HJOA 2PVQA 1S3DA 1A0RP 2H19A 1GNEA 5IPHA 2FCHA 4K6XA 2HSMA 2F8FA 1U3AA 4BVYA 5JCUA 3CSIA 4JEDA 3TRQA 1SYXA 2LV3A 4WR4A 3A5WA 1V40A 4DVCA 3R2QA 2X8HA 3P8WA 2YN1A 1GTAA 4XS6A 3GIXA 4K0GA 5ECHB 2WCIA 4D73A 1EOHA 5F0GA 5D9WA 2CX4A 2M46A 3IXRA 4ILFA 5B8BA 1WOUA 3J7Yk 1M7TA 5AISA 4E8EA 3ZTLA 5JCWA 1KTEA 5IOWA 2VCQA 3MDKA 5G1LA 3C1SA 2E0QA 3KMOA 1M3IA 2VL3A 3QDNA 3M9JA 3I43A 1V58A 2TIRA 4TXOB 4NHWA 5HR3A 3FKFA 5IO0A 1FVKA 1U88A 2YWMA 1XBSA 2J23A 1QGVA 1J0FA 1N8JA 3BOAA 3GX8A 1M0UA 1K3LA 5DBQA 2DJKA 1XPVA 2LJAA 10GSA 3BCIA 2L6DA 1MDKA 4OD7A 3R3EA 5E59A 4POKA 3TUEA 4NV2A 4O5RA 1T4ZA 2Z9SA 3UMAA 1M2AA 1A8LA 5C00A 1V9WA 3KD0A 5GAND 3F3RA 2CVBA 2AJQB 4HI7A 4GSNA 3LJRA 3I6AA 2L5OA 3TDGA 3SBCA 1OC3A 4MK3A 2AYTA 1XFLA 1XZOA 5CRWA 4N0VA 1HNBA 4WETA 1EOGA 4IP6A 5IMFA 2H70A 2C0FA 2PPTA 4MP4A 2GQKA 4MJEA 4O92A 2K8VA 3UIWA 5BRTA 3HKRA 1XOAA 4YQMA 3D6IA 2GT6A 5D9TA 4IKHA 4HOJA 4GRFA 3WGDA 1JLWA 2IN3A 4MLYA 4OCFA 2MBSA 2FD3A 1A24A 3SWLA 1TXXA 4JRRA 1Z9HA 2QA1A 3QPMA 2VAFA 5ECRB 4ID0A 2CX3A 3MAKA 3BBYA 3TOTA 4X43A 2XBQA 5CNWA 3NIVA 2XPDA 5F06A 4PNGA 1PN0A 2AUVA 2LEGA 4ZL7A 1EEMA 3QD9A 3HXSA 3MIXA 4V2LA 2MMOA 6GSUA 3GKMA 1JZWA 1OVNA 2TRCP 2PU9C 4MNNA 1PMTA 4KX4A 2YANA 5HR2A 1F6MC 1K3OA 4G9HA 4JE1A 5HR1A 1JFUA 4GTUA 2AB6A 4Q5QA 2DJ1A 4HS1A 1DE1A 2LJRA 4F0BA 4MJAA 2R4VA 4BIKA 2OBIA 5ABRA 1TP9A 3HZ8A 5DJMA 2CV4A 1TTZA 2PVOC 4YKFA 1GLQA 1KBNA 2VCVA 2B3SA 1EV9A 1QXHA 3L9UA 1ZYPA 3QCPA 4G0IA 5HR0A 2GSSA 2HRKA 4I2UA 4Q5FA 1TK5B 2WZ9A 2L4QA 2R0PA 3LG6A 1PRXA 1YEPA 2YWOA 1S3CA 3AY8A 1XWKA 3F4RA 2P5QA 2GTUA 4N10A 2C4JA 2LTKA 4HQZA 3C73A 1PKZA 2YCDA 1OAZA 2A2SA 3A5IA 4X0XA 2GDRA 4EXJA 1SU9A 3LWAA 3DYRA 3DXBA 3PINA 4OCEA 2MBTA 2M72A 3RDWA 2FLSA 2EIOA 3FR3A 4GCIA 1O8XA 2O87A 3M9KA 2LJKA 4V1Ag 2VCTA 3C1RA 2K6VA 2WS2A 3S9FA 5LNKe 1F2EA 3F6DA 4XHMA 4FO5A 2YP6A 2B5EA 5F07A 5ENUA 4KW6A 3ZLPA 3RHBA 4HJMA 3A2WA 3E0UA 3TJKA 4IJ3A 1GRXA 4USSA 3C7MA 3HJPA 3TB2A 1AQVA 2CA8A 4RQRA 3C71A 3L78A 3G9BA 4MF7A 2RM5A 4KDUA 1XVQA 4ML6A 2M80A 4LLRA 3UJ1A 2C3TA 4F2IA 5JWQB 4JBBA 2H66A 1F9MA 2JL4A 3PH9A 2B1KA 3U6VA 4MH2A 3LEFA 1ZYNA 4GQFA 4TR1B 3GHAA 1UC7A 3APQA 4IJIA 3DIEA 1ZYEA 1UVZA 3ZFLA 1ZCPA 2G2QA 3OR5A 3VLNA 3CSJA 1OE7A 4L0WA 1JZDA 4KAEA 2VOCA 5G30A 4L8EA 3FZ9A 1ERVA 4MPGA 3ZREA 2YJ7A 3HVSA 1X5CA 3FK8A 1GL8A 1ABAA 4E8HA 3GURA 1OKDA 5DVBA 2GQLA 3ERWA 3GUSA 4BA7A 1BJXA 5LCZA 4Z2RA 3EVIA 5EPFA 2VD1A 5J5NA 4JR6A 3FHKA 1TK8B 1CQHA 3ERGA 4Q5NA 4YQVA 3WT2A 3GYKA 1YKAA 4ZBDA 3CYNA 1N2AA 3HCZA 3HA9A 2JZTA 5IOXA 4HQSA 1ST9A 1F3AA 4OMVA 1W4VA 5COHA 2F8AA 3DRNA 5F8BA 1M9BA 4K2DA 2IMKA 4TR1A 3CRUA 1K0MA 2F3MA 1BX9A 4DSSB 1XIYA 3A2XA 2VCXA 1GSSA 4WKWA 4DEJA 1YKCA 2H6YA 4ULXA 2IPAA 4CY6A 5B8AA 1I5GA 2C0EA 2RM6A 3UVHA 3PGTA 1PFOA 4I5QA 2H74A 4KF9A 1PX6A 1ACVA 1CQGA 5ECOB 3KJYA 5DAKB 2CVDA 3IHGA 4YQUA 3NOFA 2PWJA 4QQ7A 5CRHA 4ICYA 1T4YA 4NV5A 3UVTA 3Q74A 2REMA 1PD21 3P2AA 4G2EA 4OFNA 4PQHA 4NWYA 4BVYB 2WJUA 4KH7A 3IK7A 1ZL9A 3QAGA 4EDZA 1QFNA 4DSSA 3CTGA 2VLTA 3ME7A 2H6ZA 1T00A 2HSYA 4PURA 3APOA 4OFTA 1DBYA 1OC8A 1H4OA 3ZMLA 2ES7A 1SK1A 4FH8A 4WR5A 2CZ3A 3KTLA 4J57E 3VWXA 3O76A 2C0GA 4PQIA 4HEA2 4IQAA 5DAKA 3KH9A 3HYPA 5FWGA 3QR6A 3FEUA 4LL4B 2V2GA 3W8JA 2H71A 2K9FA 4PTSA 1EV4A 1M2DA 1JZRA 2AAWA 5D96A 4TVEA 3TKSE 3TKSA 3IAS2 1O85A 4ZB9A 2JU5A 4TKYA 4RUVA 4KCEA 5G31A 2ON7A 3EPTA 3HVNA 1GSUA 3TJJA 2X49A 1AUCA 1LU4A 5KEJA 1J08A 5ECSA 5DCGA 2JSYA 3GH6A 3WT1A 1FG4A 1NM3A 1MEKA 1U6TA 1HQOA 2GZYA 4HU7A 3GV1A 2GZZA 3I9V2 2L57A 3VURA 1NHOA 2ZUPA 4EL1A 6GSYA 5DDLA 4K5RA 3CRTA 3G7JA 3G7YA 2OE3A 3ISOA 1YY7A 2FGXA 4GSSA 1NSWA 3VWUA 4Z2TA 5IMAA 2MZCA 3TKSC 3EU3A 1Y6EA 4YAPA 3TKRA 3EINA 1GUKA 1SKRB 5AIVA 2UZ8A 3BCKA 2B5YA 3FR6A 4NPBA 4RI7A 1NHYA 2IWTA 3H93A 5IPGA 3GFKA 2OJLA 4IBPA 3DMLA 2DJJA 3P90A 2N5AA 4EUYA 3FMWA 4QL9A 4CHSA 2AV4A 5HFGA 1YZXA 5ECIB 3WYWA 5HFKA 4V1Ap 2D2ZA 3H1NA 1GSDA 4NHZA 2WB9A 1GP1A 4IVFA 3ZITA 3ZVJD 4AJ7A 2NVLA 3MWHA 3N9JA 5H5RA 3RPNA 3H4KA 2ZCTA 1GH2A 5JCGA 2GT5A 2LKUA 4G10A 3QFBC 1TI1A 1Q98A 2OA7A 2JZRA 2H73A 2PMTA 3KTBA 2I4AA 1U3IA 5INYA 3IC8A 1MTCA 5ELAA 2IMFA 3UL3A 3BD2A 2IMEA 1GTUA 2VIMA 2H01A 5KOXA 3FYGA 1YF0A 2ZNMA 3TGZA 2YZHA 1AAZA 4TN8A 5J3RA 2LNSA 3D22A 2R0CA 2YWNA 4N11A 2XC2A 2GS3A 4DSQA 1MDJA 5CO3A 2HYXA 3QMXA 5DALB 5EL8A 1PSQA 1G7OA 4WF4A 2QSIA 1GSYA 3CXGA 4EDYA 2PUKC 2HRFA 3D5JA 1DE2A 2CZ2A 4EVMA 1SD8A 2FA4A 2EIQA 5D8IA 2JACA 2QC7A 1M2BA 3F8UA 4IN0A 4ECCA 2WRTA 3VI5A 3ZIVA 3DVXA 4K2XA 2HI7A 5D9VA 2O89A 2HE3A 3GKKA 4O7HA 1XW6A 1NW2A 4K5SA 2X64A 2HRAA 3UBKA 4NAXA 2OE0A 4N30A 4Q5RA 3VFIA 3UARA 22GSA 4V2NA 2LRCA 1SENA 1X9MB 4AJ8A 5DALA 2A2RA 4F03A 2OBKA 3GN3A 4XCSA 2KHPA 3VWWA 4ZILA 4GLTA 2VCWA 3HDCA 6GSVA 3IA1A 1DUGA 4P3YB 2V6KA 4MF5A 4KSOA 4ZL8A 18GSA 1B4QA 5ELGA 1B9XC 5ECKB 4XS1A 1FOVA 4EIQA 3L9VA 2LUSA 2B1LA 3EYTA 1FAAA 3LW9A 6GSTA 1R5PA 3IPZA 2FHEA 1TJDA 2G0FA 2RUFA 3W6GA 2H0GA 3WD6A 4FYBA 4CDOA 1Q4JA 2X99A 3PPUA 2X4AA 4WXTA 2C3NA 3US3A 2DMLA 2IIYA 3KXOA 4HDEA 2I9HA 3QAWA 2HFDA 3GKNA 1DSBA 2I1UA 3ZYWA 1JLVA 3LORA 1FHEA 2DJ0A 1ERUA 2HZFA 1GSFA 1WWJA 2A2PA 5KN0A 2B6MA 1UN2A 4MZBA 5A4WA 2K18A 4MH3A 4H86A 2YPMA 2GSQA 3DVWA 4IS0A 3KP9A 3KCMA 4IELA 2DBCA 3M8NA 1ZOFA 4K8MA 1O81A 1SKSB 5F05A 1SL0B 2HXKA 1PKWA 2P0GA 3TRXA 2R5GA 5J41A 1G7EA 1RK4A 1X5EA 5DCHA 1OC9A 1K0NA 1SK2A 3EWLA 2H8LA 1GWCA 5B6MA 2ON5A 3UOMA 2O85A 3GL3A 5JWOB 2C1YA 2P5RA 1Z3EA 2N5BA 2FWGA 3E3EA 1GLPA 1V57A 4TRXA 1SJZA 4WEYA 1FW1A 1LBKA 2LSTA 3H8QA 2QA2A 2OKAA 5JWRB 2OE1A 4FQUA 1AW9A 1XW9A 1QMVA 1TW9A 1ZGNA 1IYIA 3LYKA 4FIWA 4ACSA 3FZ4A 3TOUA 4KNDA 3MSZA 2HSHA 1B8XA 3MNGA 1QUWA 4KDXA 2C3QA 4BWQA 1YEXA 2R2JA 3KIJA 1EZKA 16GSA 5IMDA 4ZXGA 1TU7A 3QOUA 3CBUA 2VM2A 3M1GA 3LXZA 4TR3A 3GRXA 1QQ2A 2MMZA 3WGEA 5B6NA 5KOWA 3IBHA 2FWHA 2VLUA 1TRSA 4EF0A 3LYPA 1SL2B 2AHEA 4HJ2A 1XOBA 7GSSA 4I2TA 4J2FA 3ERFA 5ECNB 1XXUA 5D9XA 1EGOA 2IMDA 1I9DA 1PQNA 2O7KA 1U87A 1GSQA 4OO4A 3GMFA 4EKZA 1BQ7A 2VUPA 2YJHA 4HSCX 4WBRD 1AQXA 1M9AA 1JZOA 4CY8A 5IM9A 3GTUB 3W8SA 1MD3A 1AIUA 1USBA 1GNWA 4MJCA 3LXTA 4KDYA 3WGXA 4Z7XA 1S3AA 2H1AA 4LA1A 1V98A 3ED3A 4V2MA 1YDKA 2H75A 5GAPD 4GQCA 1SKWB 5GSTA 4KGIA 5EY6A 5H5SA 1ZYQB 1ZZYA 5AN1A 20GSA 4ECJA 4I8BA 4KSMA 2DMMA 3LGCA 1HNCA 5D93A 3K8NA 2F9SA 2VM1A 1Z6NA 4LMVA 5CRDA 3U5RE 3GX0A 1EEJA 1YJ6A 3FRCA 2NBSA 1W89A 5L71A 3VPQA 2L6CA 2E2GA 3GH9A 3GTUA 1FOHA 2VD0A 4CW9A 6GSSA 1T8EB 4PUAA 13GSA 5IIZA 3IAM2 2XHFA 17GSA 2FY6A 4GF0A 2R3XA 4AGSA 2VL9A 1X9WB 1TRVA 1FB0A 2E2MA 3KP8A 2DKHA 4DSRA 5G5FA 3EU4A 3ZL5A 3HHVA 1GULA 5ECLB 3TCOA 5HFIA 2GQMA 1H75A 3ZVJA 1MD4A 1A0FA 3O3TA 3APSA 1WPIA 4ZL9A 5A4UA 1A8YA 1BYEA 2X8CA 1FO5A 3EC3A 3GSSA 4PXOA 2DKIA 1ML6A 2B5XA 4K9ZA 5B7CA 3C8EA 1XWAA 5IMCA 3A3TA 2LQOA 4EO3A 5KN2A 5C04A 4WBJA 3F3QA 2H76A 2NTOA 2YNXA 1XCCA 2JSZA 4EIPA 3RAZA 2X8GA 5EVOA 4MJBA 3LQ7A 4KCAA 2XBIA 5DJLA 1HD2A 2KP1A 5J9BA 1K0DA 4G0LA 3MYDA 5GZZB 4POLA 1KNGA 3L4NA 4KB3A 2I81A 1X0RA 2LQQA 1ERWA 5BMUA 3HVXA 3G7IA 3DGQA 1BG5A 2IMIA 1A2LA 1SYRA 1TKDB 2CVKA 3I69A 1A2MA 4LL1B 3VI7A
chains in the Genus database with same CATH topology
2VL2A 3ZRDA 3D21A 2K8SA 4I6XA 3ZIJA 2JZSA 2KUCA 2OACA 2R0GA 5ECQB 1ON4A 1B9YC 4MF6A 2OADA 3EE2A 2L59A 2I3YA 5J4UA 4G19A 1URMA 1XW5A 3ZMKA 5CP1A 2NDOA 2HT9A 3A2VA 1SK0A 1SD9A 1SJIA 1A23A 5KN3A 2R37A 4MDCA 4IP1A 2FA8A 3TRPA 1EP7A 3F9UA 4K7OA 3IDVA 5DQYA 3HY2A 4NXIA 4TR4A 1FB6A 3P7XA 2VL2C 1F3BA 2GGTA 5CREA 4ZB8A 2YV7A 1V2AA 1O6JA 4BWSA 5CRGA 4TXOA 2HRNA 4XRAA 3DD3A 4FYUA 4JR4A 2CQ9A 2DJ2A 4FYCA 2LS5A 3VK9A 4IHUA 2H30A 2DIZA 2GVPA 3D4TA 1X5DA 1T1VA 2WFCA 4HUAA 1AXDA 3ME8A 4JU5A 2YZUA 5IMZA 1WMJA 1XWGA 1G6YA 2F51A 1Z5YE 3TJFA 1R26A 5ECMB 4L5LA 1M99A 2HZEB 4K1FA 5LD0A 2MYGA 3HVVA 2LRTA 1XWCA 5IMVA 4OWYA 1WRYA 3UEMA 3V1WA 5G1KA 2IJYA 1T3BA 1Z7PA 2GZPA 5G5EA 8GSSA 5G2ZA 2H1GA 2RLIA 2BTOT 2VLVA 2GSTA 1IYHA 1PL2A 4TW5A 1TRWA 4XRDA 4PQ1A 3F4TA 4NMUA 2A4VA 2HLSA 3IHQA 4JZQA 4K7IA 3CMIA 2YWIA 1Y25A 1RW1A 1R4WA 3GSTA 2EC4A 2H1BA 3TKQA 1O7UA 3IRAA 1FVJA 4X4JA 3L0HA 2NPBA 4POBA 4ECIA 5J9CA 4WF5A 2B7JA 2HZEA 4KA0A 4BL7B 5A5KA 4O5QA 4OFMA 1VF3A 1OC9B 2V32A 5AIXA 3FZAA 14GSA 3F63A 1J9BA 4YH2A 3DEXA 1OYJA 3F4SA 3M3MA 2LRNA 4LMWA 4F82A 2FUG2 2O8VB 3FY7A 3IV4A 5E4WA 3TJBA 3H79A 1G0TA 3KM6A 2BJXA 4ECBA 4GSTA 1VF1A 1O8WA 1WE0A 5A4VA 2RUEA 3ZZXA 5KN1A 2FNOA 2CAQA 2P31A 1TU8A 2V1MA 5IQYA 4XIHA 1SJ6A 4PUFC 3LFLA 2H0HA 1X9SB 5IO2A 1G6WA 4PNFA 4PGTA 3GKXA 4KUNA 4EE0A 2ALBA 2KLXA 4BL7A 3EMXA 4MA9A 4IGJA 1K3YA 3M0FA 1YF1A 1ILOA 4YKGA 3KGKA 2R6KA 1R7HA 3KMNA 3RHCA 4N0ZA 9GSSA 1LJRA 1K0OA 1A2JA 5AGYA 1TDIA 4HU9A 1BAYA 1WJKA 2GLRA 4K7NA 3IC4A 4IQ1A 3DWVA 5CAXA 2PGTA 1WIKA 3LSZA 3BJ5A 1K0BA 3HJMA 3KH7A 3VWVA 3HD5A 2H72A 2TRXA 2C80A 1GUMA 4MMMA 3TJGA 1TK0B 3HZ4A 2MMAA 5CYYA 4ISDA 3QAVA 2QKEA 4GXZA 2C8UA 1PN9A 4ZB6A 4TOPA 2WGRA 1OKTA 1TRUA 2BMXA 4TR0A 1HYUA 4XTSA 2PERA 2GSRA 4O5UA 1K0CA 2V41A 1E6BA 3GL5A 5HQPA 1GUHA 3GNJA 2QGVA 3CTFA 3PR8A 4MABA 2KP2A 2MMNA 2RIIA 3VPTA 5FHIA 4POMA 3RPPA 3Q6OA 4BVXB 4KE3A 1PX7A 2N5FA 5DQSA 3TKPA 4XS4B 1GTBA 1T7PB 3F0IA 1ZMAA 1TI3A 2V6OA 4O32A 2CT6A 1VF2A 1PGTA 2DSAA 3D4MA 1HNAA 1QK8A 3DKSA 3UAPA 4F0CA 1KEBA 1EGRA 2HNLA 5H5QA 2DC5A 3IR4A 4Z2UA 4ML1A 1AQWA 1GTIA 1E2YA 3FZ5A 4ZBBA 1THOA 2A4HA 5ID2B 2PBJA 1EWXA 3KZQA 3Q18A 2LNTA 3F6FA 1O73A 4F9ZA 4J56E 2H1DA 1B4PA 3IOSA 4YAVA 4L5OA 2XPEA 3IE3A 3JCML 1C72A 4MPFA 1XWBA 1YQ1A 4ZBAA 4OO5A 1WP0A 3KEBA 2FWFA 3UBLA 4L0UA 4BVXA 1R5AA 3GA4A 4XS4A 4EC0A 3FR9A 2IL3A 4PX1A 3J7Yb 4K0NA 3N5OA 4AJ6A 2VCZA 3L9SA 3D0ZA 4QL7A 1THXA 1B48A 2CAIA 2YV9A 1RQMA 2B7KA 1EP8A 4I97A 19GSA 4RQXA 4IW9A 2H0IA 2IFQB 4AF2A 1PL1A 1VRSD 2PN8A 4RI6A 1UA5A 4BPYA 2WDUA 3CSHA 4HZ4A 1ERTA 3RBTA 4A5PA 1MDIA 5ID2A 1BEDA 2VO4A 2YOIA 5GSSA 1K0AA 1PA3A 1SL1B 4TXVA 5D73A 2DIYA 1GSEA 2J9HA 11GSA 2L5LA 3ZFBA 1TOFA 1Z6MA 3E9JB 3O6TA 4MZWA 2KOKA 1Z7RA 1AC1A 4MZCA 12GSA 4D73B 5ECPB 1XVWA 2EIRA 4GWRA 6GSWA 2C0DA 3EMPA 2DJ3A 2H6XA 3NZNA 2WULA 6GSXA 2JADA 1F37A 3IK9A 4MCUA 2FWEA 3Q19A 1JHBA 1VGLA 3FW2A 2E7PA 3EURA 2DLXA 3QFAC 4G0KA 1VF4A 4X1UA 2IFQA 2L4CA 5FT3A 1OE8A 4HZ2A 4ZIJA 3HJOA 2PVQA 1S3DA 1A0RP 2H19A 1GNEA 5IPHA 2FCHA 4K6XA 2HSMA 2F8FA 1U3AA 4BVYA 5JCUA 3CSIA 4JEDA 3TRQA 1SYXA 2LV3A 4WR4A 3A5WA 1V40A 4DVCA 3R2QA 2X8HA 3P8WA 2YN1A 1GTAA 4XS6A 3GIXA 4K0GA 5ECHB 2WCIA 4D73A 1EOHA 5F0GA 5D9WA 2CX4A 2M46A 3IXRA 4ILFA 5B8BA 1WOUA 3J7Yk 1M7TA 5AISA 4E8EA 3ZTLA 5JCWA 1KTEA 5IOWA 2VCQA 3MDKA 5G1LA 3C1SA 2E0QA 3KMOA 2VL3A 3QDNA 3M9JA 3I43A 1V58A 2TIRA 4TXOB 4NHWA 5HR3A 3FKFA 5IO0A 1FVKA 1U88A 2YWMA 1XBSA 2J23A 1QGVA 1J0FA 1N8JA 3BOAA 3GX8A 1M0UA 1K3LA 5DBQA 2DJKA 1XPVA 2LJAA 10GSA 3BCIA 2L6DA 1MDKA 4OD7A 3R3EA 5E59A 4POKA 3TUEA 4NV2A 4O5RA 1T4ZA 2Z9SA 3UMAA 1M2AA 1A8LA 5C00A 1V9WA 3KD0A 5GAND 3F3RA 2CVBA 2AJQB 4HI7A 4GSNA 3LJRA 3I6AA 2L5OA 3TDGA 3SBCA 1OC3A 4MK3A 2AYTA 1XFLA 1XZOA 5CRWA 4N0VA 1HNBA 4WETA 1EOGA 4IP6A 5IMFA 2H70A 2C0FA 2PPTA 4MP4A 2GQKA 4MJEA 4O92A 2K8VA 3UIWA 5BRTA 3HKRA 1XOAA 4YQMA 3D6IA 2GT6A 5D9TA 4IKHA 4HOJA 4GRFA 3WGDA 1JLWA 2IN3A 4MLYA 4OCFA 2MBSA 2FD3A 1A24A 3SWLA 1TXXA 4JRRA 1Z9HA 2QA1A 3QPMA 2VAFA 5ECRB 4ID0A 2CX3A 3MAKA 3BBYA 3TOTA 4X43A 2XBQA 5CNWA 3NIVA 2XPDA 5F06A 4PNGA 1PN0A 2AUVA 2LEGA 4ZL7A 1EEMA 3QD9A 3HXSA 3MIXA 4V2LA 2MMOA 6GSUA 3GKMA 1JZWA 1OVNA 2TRCP 2PU9C 4MNNA 1PMTA 4KX4A 2YANA 5HR2A 1F6MC 1K3OA 4G9HA 4JE1A 5HR1A 1JFUA 4GTUA 2AB6A 4Q5QA 2DJ1A 4HS1A 1DE1A 2LJRA 4F0BA 4MJAA 2R4VA 2OBIA 5ABRA 1TP9A 3HZ8A 5DJMA 2CV4A 1TTZA 2PVOC 4YKFA 1GLQA 1KBNA 2VCVA 2B3SA 1EV9A 1QXHA 3L9UA 1ZYPA 3QCPA 4G0IA 5HR0A 2GSSA 2HRKA 4I2UA 4Q5FA 1TK5B 2WZ9A 2L4QA 2R0PA 3LG6A 1PRXA 1YEPA 2YWOA 1S3CA 3AY8A 1XWKA 3F4RA 2P5QA 2GTUA 4N10A 2C4JA 2LTKA 4HQZA 3C73A 1PKZA 2YCDA 1OAZA 2A2SA 3A5IA 4X0XA 2GDRA 4EXJA 1SU9A 3LWAA 3DYRA 3DXBA 3PINA 4OCEA 2MBTA 2M72A 3RDWA 2FLSA 2EIOA 3FR3A 4GCIA 1O8XA 2O87A 3M9KA 2LJKA 4V1Ag 2VCTA 3C1RA 2K6VA 2WS2A 3S9FA 5LNKe 1F2EA 3F6DA 4XHMA 4FO5A 2YP6A 2B5EA 5F07A 5ENUA 4KW6A 3ZLPA 3RHBA 4HJMA 3A2WA 3E0UA 3TJKA 4IJ3A 1GRXA 4USSA 3C7MA 3HJPA 3TB2A 1AQVA 2CA8A 4RQRA 3C71A 3L78A 3G9BA 4MF7A 2RM5A 4KDUA 1XVQA 4ML6A 2M80A 4LLRA 3UJ1A 2C3TA 4F2IA 5JWQB 4JBBA 2H66A 1F9MA 2JL4A 3PH9A 2B1KA 3U6VA 4MH2A 3LEFA 1ZYNA 4GQFA 4TR1B 3GHAA 1UC7A 3APQA 4IJIA 3DIEA 1ZYEA 1UVZA 3ZFLA 1ZCPA 2G2QA 3OR5A 3VLNA 3CSJA 1OE7A 4L0WA 1JZDA 4KAEA 2VOCA 5G30A 4L8EA 3FZ9A 1ERVA 4MPGA 3ZREA 2YJ7A 3HVSA 1X5CA 3FK8A 1GL8A 1ABAA 4E8HA 3GURA 1OKDA 5DVBA 2GQLA 3ERWA 3GUSA 4BA7A 1BJXA 5LCZA 4Z2RA 3EVIA 5EPFA 2VD1A 5J5NA 4JR6A 3FHKA 1TK8B 1CQHA 3ERGA 4Q5NA 4YQVA 3WT2A 3GYKA 1YKAA 4ZBDA 3CYNA 1N2AA 3HCZA 3HA9A 2JZTA 5IOXA 4HQSA 1ST9A 1F3AA 4OMVA 1W4VA 5COHA 2F8AA 3DRNA 5F8BA 1M9BA 4K2DA 2IMKA 4TR1A 3CRUA 1K0MA 2F3MA 1BX9A 4DSSB 1XIYA 3A2XA 2VCXA 1GSSA 4WKWA 4DEJA 1YKCA 2H6YA 4ULXA 2IPAA 4CY6A 5B8AA 1I5GA 2C0EA 2RM6A 3UVHA 3PGTA 4I5QA 2H74A 4KF9A 1PX6A 1ACVA 1CQGA 5ECOB 3KJYA 5DAKB 2CVDA 3IHGA 4YQUA 3NOFA 2PWJA 4QQ7A 5CRHA 4ICYA 1T4YA 4NV5A 3UVTA 3Q74A 2REMA 1PD21 3P2AA 4G2EA 4OFNA 4PQHA 4NWYA 4BVYB 2WJUA 4KH7A 3IK7A 1ZL9A 3QAGA 4EDZA 1QFNA 4DSSA 3CTGA 2VLTA 3ME7A 2H6ZA 1T00A 2HSYA 4PURA 3APOA 4OFTA 1DBYA 1OC8A 1H4OA 3ZMLA 2ES7A 1SK1A 4FH8A 4WR5A 2CZ3A 3KTLA 4J57E 3VWXA 3O76A 2C0GA 4PQIA 4HEA2 4IQAA 5DAKA 3KH9A 3HYPA 5FWGA 3QR6A 3FEUA 4LL4B 2V2GA 3W8JA 2H71A 2K9FA 4PTSA 1EV4A 1M2DA 1JZRA 2AAWA 5D96A 4TVEA 3TKSE 3TKSA 3IAS2 1O85A 4ZB9A 2JU5A 4TKYA 4RUVA 4KCEA 5G31A 2ON7A 3EPTA 1GSUA 3TJJA 2X49A 1AUCA 1LU4A 5KEJA 1J08A 5ECSA 5DCGA 2JSYA 3GH6A 3WT1A 1FG4A 1NM3A 1MEKA 1U6TA 1HQOA 2GZYA 4HU7A 3GV1A 2GZZA 3I9V2 2L57A 3VURA 1NHOA 2ZUPA 4EL1A 6GSYA 5DDLA 4K5RA 3CRTA 3G7JA 3G7YA 2OE3A 3ISOA 1YY7A 2FGXA 4GSSA 1NSWA 3VWUA 4Z2TA 5IMAA 2MZCA 3TKSC 3EU3A 1Y6EA 4YAPA 3TKRA 3EINA 1GUKA 1SKRB 5AIVA 2UZ8A 3BCKA 2B5YA 3FR6A 4NPBA 4RI7A 1NHYA 2IWTA 3H93A 5IPGA 3GFKA 2OJLA 4IBPA 3DMLA 2DJJA 3P90A 2N5AA 4EUYA 3FMWA 4QL9A 4CHSA 2AV4A 5HFGA 1YZXA 5ECIB 3WYWA 5HFKA 4V1Ap 2D2ZA 3H1NA 1GSDA 4NHZA 2WB9A 1GP1A 4IVFA 3ZITA 3ZVJD 4AJ7A 2NVLA 3MWHA 3N9JA 5H5RA 3RPNA 3H4KA 2ZCTA 1GH2A 5JCGA 2GT5A 2LKUA 4G10A 3QFBC 1TI1A 1Q98A 2OA7A 2JZRA 2H73A 2PMTA 3KTBA 2I4AA 1U3IA 5INYA 3IC8A 1MTCA 5ELAA 2IMFA 3UL3A 3BD2A 2IMEA 1GTUA 2VIMA 2H01A 5KOXA 3FYGA 1YF0A 2ZNMA 3TGZA 2YZHA 1AAZA 4TN8A 5J3RA 2LNSA 3D22A 2R0CA 2YWNA 4N11A 2XC2A 2GS3A 4DSQA 1MDJA 5CO3A 2HYXA 3QMXA 5DALB 5EL8A 1PSQA 1G7OA 4WF4A 2QSIA 1GSYA 3CXGA 4EDYA 2PUKC 2HRFA 3D5JA 1DE2A 2CZ2A 4EVMA 1SD8A 2FA4A 2EIQA 5D8IA 2JACA 2QC7A 1M2BA 3F8UA 4IN0A 4ECCA 2WRTA 3VI5A 3ZIVA 3DVXA 4K2XA 2HI7A 5D9VA 2O89A 2HE3A 3GKKA 4O7HA 1XW6A 1NW2A 4K5SA 2X64A 2HRAA 3UBKA 4NAXA 2OE0A 4N30A 4Q5RA 3VFIA 3UARA 22GSA 4V2NA 2LRCA 1SENA 1X9MB 4AJ8A 5DALA 2A2RA 4F03A 2OBKA 3GN3A 4XCSA 2KHPA 3VWWA 4ZILA 4GLTA 2VCWA 3HDCA 6GSVA 3IA1A 1DUGA 4P3YB 2V6KA 4MF5A 4KSOA 4ZL8A 18GSA 1B4QA 5ELGA 1B9XC 5ECKB 4XS1A 1FOVA 4EIQA 3L9VA 2LUSA 2B1LA 3EYTA 1FAAA 3LW9A 6GSTA 1R5PA 3IPZA 2FHEA 1TJDA 2G0FA 2RUFA 3W6GA 2H0GA 3WD6A 4FYBA 4CDOA 1Q4JA 2X99A 3PPUA 2X4AA 4WXTA 2C3NA 3US3A 2DMLA 2IIYA 3KXOA 4HDEA 2I9HA 3QAWA 2HFDA 3GKNA 1DSBA 2I1UA 3ZYWA 1JLVA 3LORA 1FHEA 2DJ0A 1ERUA 2HZFA 1GSFA 1WWJA 2A2PA 5KN0A 2B6MA 1UN2A 4MZBA 5A4WA 2K18A 4MH3A 4H86A 2YPMA 2GSQA 3DVWA 4IS0A 3KP9A 3KCMA 4IELA 2DBCA 3M8NA 1ZOFA 4K8MA 1O81A 1SKSB 5F05A 1SL0B 2HXKA 1PKWA 2P0GA 3TRXA 2R5GA 5J41A 1G7EA 1RK4A 1X5EA 5DCHA 1OC9A 1K0NA 1SK2A 3EWLA 2H8LA 1GWCA 5B6MA 2ON5A 3UOMA 2O85A 3GL3A 5JWOB 2C1YA 2P5RA 1Z3EA 2N5BA 2FWGA 3E3EA 1GLPA 1V57A 4TRXA 1SJZA 4WEYA 1FW1A 1LBKA 2LSTA 3H8QA 2QA2A 2OKAA 5JWRB 2OE1A 4FQUA 1AW9A 1XW9A 1QMVA 1TW9A 1ZGNA 1IYIA 3LYKA 4FIWA 4ACSA 3FZ4A 3TOUA 4KNDA 3MSZA 2HSHA 1B8XA 3MNGA 1QUWA 4KDXA 2C3QA 4BWQA 1YEXA 2R2JA 3KIJA 1EZKA 16GSA 5IMDA 4ZXGA 1TU7A 3QOUA 3CBUA 2VM2A 3M1GA 3LXZA 4TR3A 3GRXA 1QQ2A 2MMZA 3WGEA 5B6NA 5KOWA 3IBHA 2FWHA 2VLUA 1TRSA 4EF0A 3LYPA 1SL2B 2AHEA 4HJ2A 1XOBA 7GSSA 4I2TA 4J2FA 3ERFA 5ECNB 1XXUA 5D9XA 1EGOA 2IMDA 1I9DA 1PQNA 2O7KA 1U87A 1GSQA 4OO4A 3GMFA 4EKZA 1BQ7A 2VUPA 2YJHA 4WBRD 1AQXA 1M9AA 1JZOA 4CY8A 5IM9A 3GTUB 3W8SA 1MD3A 1AIUA 1USBA 1GNWA 4MJCA 3LXTA 4KDYA 3WGXA 4Z7XA 1S3AA 2H1AA 4LA1A 1V98A 3ED3A 4V2MA 1YDKA 2H75A 5GAPD 4GQCA 1SKWB 5GSTA 4KGIA 5EY6A 5H5SA 1ZYQB 1ZZYA 5AN1A 20GSA 4ECJA 4I8BA 4KSMA 2DMMA 3LGCA 1HNCA 5D93A 3K8NA 2F9SA 2VM1A 1Z6NA 4LMVA 5CRDA 3U5RE 3GX0A 1EEJA 1YJ6A 3FRCA 2NBSA 1W89A 5L71A 3VPQA 2L6CA 2E2GA 3GH9A 3GTUA 1FOHA 2VD0A 4CW9A 6GSSA 1T8EB 4PUAA 13GSA 5IIZA 3IAM2 2XHFA 17GSA 2FY6A 4GF0A 2R3XA 4AGSA 2VL9A 1X9WB 1TRVA 1FB0A 2E2MA 3KP8A 2DKHA 4DSRA 5G5FA 3EU4A 3ZL5A 3HHVA 1GULA 5ECLB 3TCOA 5HFIA 2GQMA 1H75A 3ZVJA 1MD4A 1A0FA 3O3TA 3APSA 1WPIA 4ZL9A 5A4UA 1A8YA 1BYEA 2X8CA 1FO5A 3EC3A 3GSSA 4PXOA 2DKIA 1ML6A 2B5XA 4K9ZA 5B7CA 3C8EA 1XWAA 5IMCA 3A3TA 2LQOA 4EO3A 5KN2A 5C04A 4WBJA 3F3QA 2H76A 2NTOA 2YNXA 1XCCA 2JSZA 4EIPA 3RAZA 2X8GA 5EVOA 4MJBA 3LQ7A 4KCAA 2XBIA 5DJLA 1HD2A 2KP1A 5J9BA 1K0DA 4G0LA 3MYDA 5GZZB 4POLA 1KNGA 3L4NA 4KB3A 2I81A 1X0RA 2LQQA 1ERWA 5BMUA 3HVXA 3G7IA 3DGQA 1BG5A 2IMIA 1A2LA 1SYRA 1TKDB 2CVKA 3I69A 1A2MA 4LL1B 3VI7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VL2 A;  3ZRD A;  3D21 A;  2K8S A;  4I6X A;  3ZIJ A;  2JZS A;  2KUC A;  2OAC A;  5ECQ B;  1ON4 A;  1B9Y C;  4MF6 A;  2OAD A;  3EE2 A;  2L59 A;  2I3Y A;  5J4U A;  4G19 A;  1URM A;  1XW5 A;  3ZMK A;  5CP1 A;  2NDO A;  2HT9 A;  3A2V A;  1SK0 A;  1SD9 A;  1SJI A;  1A23 A;  5KN3 A;  2R37 A;  4MDC A;  4IP1 A;  2FA8 A;  3TRP A;  1EP7 A;  3F9U A;  4K7O A;  3IDV A;  5DQY A;  3HY2 A;  4NXI A;  4TR4 A;  1FB6 A;  3P7X A;  2VL2 C;  1F3B A;  2GGT A;  5CRE A;  4ZB8 A;  2YV7 A;  1V2A A;  1O6J A;  4BWS A;  5CRG A;  4TXO A;  2HRN A;  4XRA A;  3DD3 A;  4FYU A;  4JR4 A;  2CQ9 A;  2DJ2 A;  4FYC A;  2LS5 A;  3VK9 A;  4IHU A;  2H30 A;  2DIZ A;  2GVP A;  3D4T A;  1X5D A;  1T1V A;  2WFC A;  4HUA A;  1AXD A;  3ME8 A;  4JU5 A;  2YZU A;  5IMZ A;  1WMJ A;  1XWG A;  1G6Y A;  2F51 A;  1Z5Y E;  3TJF A;  1R26 A;  5ECM B;  4L5L A;  1M99 A;  2HZE B;  4K1F A;  5LD0 A;  2MYG A;  3HVV A;  2LRT A;  1XWC A;  5IMV A;  4OWY A;  1WRY A;  3UEM A;  3V1W A;  5G1K A;  2IJY A;  1T3B A;  1Z7P A;  2GZP A;  5G5E A;  8GSS A;  5G2Z A;  2H1G A;  2RLI A;  2BTO T;  2VLV A;  2GST A;  1IYH A;  1PL2 A;  4TW5 A;  1TRW A;  4XRD A;  4PQ1 A;  3F4T A;  4NMU A;  2A4V A;  2HLS A;  3IHQ A;  4JZQ A;  4K7I A;  3CMI A;  2YWI A;  1Y25 A;  1RW1 A;  1R4W A;  3GST A;  2EC4 A;  2H1B A;  3TKQ A;  1O7U A;  3IRA A;  1FVJ A;  3L0H A;  2NPB A;  4POB A;  4ECI A;  5J9C A;  4WF5 A;  2B7J A;  2HZE A;  4KA0 A;  5A5K A;  4OFM A;  1VF3 A;  1OC9 B;  2V32 A;  5AIX A;  3FZA A;  14GS A;  3F63 A;  1J9B A;  4YH2 A;  3DEX A;  1OYJ A;  3F4S A;  3M3M A;  2LRN A;  4LMW A;  4F82 A;  2FUG 2;  2O8V B;  3FY7 A;  3IV4 A;  5E4W A;  3TJB A;  3H79 A;  1G0T A;  3KM6 A;  2BJX A;  4ECB A;  4GST A;  1VF1 A;  1O8W A;  1WE0 A;  5A4V A;  2RUE A;  3ZZX A;  5KN1 A;  2FNO A;  2CAQ A;  2P31 A;  1TU8 A;  2V1M A;  5IQY A;  4XIH A;  1SJ6 A;  4PUF C;  3LFL A;  2H0H A;  1X9S B;  5IO2 A;  1G6W A;  4PNF A;  4PGT A;  3GKX A;  4KUN A;  4EE0 A;  2ALB A;  2KLX A;  4BL7 A;  3EMX A;  4MA9 A;  4IGJ A;  1K3Y A;  3M0F A;  1YF1 A;  1ILO A;  3KGK A;  2R6K A;  1R7H A;  3KMN A;  3RHC A;  4N0Z A;  9GSS A;  1LJR A;  1K0O A;  1A2J A;  5AGY A;  1TDI A;  4HU9 A;  1BAY A;  1WJK A;  2GLR A;  4K7N A;  3IC4 A;  4IQ1 A;  3DWV A;  5CAX A;  2PGT A;  1WIK A;  3LSZ A;  3BJ5 A;  1K0B A;  3HJM A;  3KH7 A;  3VWV A;  3HD5 A;  2H72 A;  2TRX A;  2C80 A;  1GUM A;  4MMM A;  3TJG A;  1TK0 B;  3HZ4 A;  2MMA A;  5CYY A;  4ISD A;  3QAV A;  2QKE A;  4GXZ A;  2C8U A;  1PN9 A;  4ZB6 A;  4TOP A;  2WGR A;  1OKT A;  1TRU A;  2BMX A;  4TR0 A;  1HYU A;  4XTS A;  2PER A;  2GSR A;  1K0C A;  2V41 A;  1E6B A;  3GL5 A;  5HQP A;  1GUH A;  3GNJ A;  2QGV A;  3CTF A;  3PR8 A;  4MAB A;  2KP2 A;  2MMN A;  2RII A;  3VPT A;  5FHI A;  4POM A;  3RPP A;  3Q6O A;  4KE3 A;  1PX7 A;  2N5F A;  5DQS A;  3TKP A;  4XS4 B;  1GTB A;  1T7P B;  3F0I A;  1ZMA A;  1TI3 A;  2V6O A;  4O32 A;  2CT6 A;  1VF2 A;  1PGT A;  2DSA A;  3D4M A;  1HNA A;  1QK8 A;  3DKS A;  3UAP A;  4F0C A;  1KEB A;  1EGR A;  2HNL A;  5H5Q A;  2DC5 A;  3IR4 A;  4ML1 A;  1AQW A;  1GTI A;  1E2Y A;  3FZ5 A;  4ZBB A;  1THO A;  5ID2 B;  2PBJ A;  1EWX A;  3KZQ A;  3Q18 A;  2LNT A;  3F6F A;  1O73 A;  4F9Z A;  4J56 E;  2H1D A;  1B4P A;  3IOS A;  4YAV A;  4L5O A;  2XPE A;  3IE3 A;  3JCM L;  1C72 A;  4MPF A;  1XWB A;  1YQ1 A;  4ZBA A;  4OO5 A;  1WP0 A;  3KEB A;  2FWF A;  3UBL A;  4L0U A;  4BVX A;  1R5A A;  3GA4 A;  4XS4 A;  4EC0 A;  3FR9 A;  2IL3 A;  4PX1 A;  3J7Y b;  4K0N A;  3N5O A;  4AJ6 A;  2VCZ A;  3L9S A;  3D0Z A;  4QL7 A;  1THX A;  1B48 A;  2CAI A;  2YV9 A;  1RQM A;  2B7K A;  1EP8 A;  4I97 A;  19GS A;  4RQX A;  4IW9 A;  2H0I A;  2IFQ B;  4AF2 A;  1PL1 A;  1VRS D;  2PN8 A;  4RI6 A;  1UA5 A;  4BPY A;  2WDU A;  3CSH A;  4HZ4 A;  1ERT A;  3RBT A;  1MDI A;  5ID2 A;  1BED A;  2VO4 A;  2YOI A;  5GSS A;  1K0A A;  1PA3 A;  1SL1 B;  4TXV A;  5D73 A;  2DIY A;  1GSE A;  2J9H A;  11GS A;  2L5L A;  3ZFB A;  1TOF A;  1Z6M A;  3E9J B;  3O6T A;  4MZW A;  2KOK A;  1Z7R A;  1AC1 A;  4MZC A;  12GS A;  4D73 B;  5ECP B;  1XVW A;  2EIR A;  4GWR A;  6GSW A;  2C0D A;  3EMP A;  2DJ3 A;  2H6X A;  3NZN A;  2WUL A;  6GSX A;  2JAD A;  1F37 A;  3IK9 A;  4MCU A;  2FWE A;  3Q19 A;  1JHB A;  1VGL A;  3FW2 A;  2E7P A;  3EUR A;  2DLX A;  3QFA C;  1VF4 A;  4X1U A;  2IFQ A;  2L4C A;  5FT3 A;  1OE8 A;  4HZ2 A;  4ZIJ A;  3HJO A;  2PVQ A;  1S3D A;  1A0R P;  2H19 A;  1GNE A;  5IPH A;  2FCH A;  4K6X A;  2F8F A;  1U3A A;  4BVY A;  5JCU A;  3CSI A;  4JED A;  3TRQ A;  1SYX A;  2LV3 A;  4WR4 A;  3A5W A;  1V40 A;  4DVC A;  3R2Q A;  2X8H A;  3P8W A;  2YN1 A;  1GTA A;  4XS6 A;  3GIX A;  4K0G A;  5ECH B;  2WCI A;  4D73 A;  1EOH A;  5F0G A;  5D9W A;  2CX4 A;  2M46 A;  3IXR A;  4ILF A;  5B8B A;  1WOU A;  3J7Y k;  1M7T A;  5AIS A;  4E8E A;  3ZTL A;  5JCW A;  1KTE A;  5IOW A;  2VCQ A;  3MDK A;  5G1L A;  3C1S A;  2E0Q A;  3KMO A;  2VL3 A;  3QDN A;  3M9J A;  3I43 A;  1V58 A;  2TIR A;  4TXO B;  4NHW A;  5HR3 A;  3FKF A;  5IO0 A;  1FVK A;  1U88 A;  2YWM A;  1XBS A;  2J23 A;  1QGV A;  1J0F A;  1N8J A;  3BOA A;  3GX8 A;  1M0U A;  1K3L A;  5DBQ A;  2DJK A;  1XPV A;  2LJA A;  10GS A;  3BCI A;  2L6D A;  1MDK A;  4OD7 A;  5E59 A;  4POK A;  3TUE A;  4NV2 A;  4O5R A;  1T4Z A;  2Z9S A;  3UMA A;  1M2A A;  1A8L A;  5C00 A;  1V9W A;  3KD0 A;  5GAN D;  3F3R A;  2CVB A;  2AJQ B;  4HI7 A;  4GSN A;  3LJR A;  3I6A A;  2L5O A;  3TDG A;  3SBC A;  1OC3 A;  4MK3 A;  2AYT A;  1XFL A;  1XZO A;  5CRW A;  4N0V A;  1HNB A;  4WET A;  1EOG A;  4IP6 A;  5IMF A;  2H70 A;  2C0F A;  2PPT A;  4MP4 A;  2GQK A;  4MJE A;  4O92 A;  2K8V A;  3UIW A;  3HKR A;  1XOA A;  4YQM A;  3D6I A;  2GT6 A;  5D9T A;  4IKH A;  4HOJ A;  4GRF A;  3WGD A;  1JLW A;  2IN3 A;  4MLY A;  4OCF A;  2MBS A;  2FD3 A;  1A24 A;  3SWL A;  1TXX A;  4JRR A;  1Z9H A;  3QPM A;  2VAF A;  5ECR B;  4ID0 A;  2CX3 A;  3MAK A;  3BBY A;  3TOT A;  4X43 A;  2XBQ A;  5CNW A;  3NIV A;  2XPD A;  5F06 A;  4PNG A;  2AUV A;  2LEG A;  4ZL7 A;  1EEM A;  3QD9 A;  3HXS A;  4V2L A;  2MMO A;  6GSU A;  3GKM A;  1JZW A;  1OVN A;  2TRC P;  2PU9 C;  1PMT A;  4KX4 A;  2YAN A;  5HR2 A;  1F6M C;  1K3O A;  4G9H A;  4JE1 A;  5HR1 A;  1JFU A;  4GTU A;  2AB6 A;  4Q5Q A;  2DJ1 A;  4HS1 A;  1DE1 A;  2LJR A;  4F0B A;  4MJA A;  2R4V A;  2OBI A;  5ABR A;  1TP9 A;  3HZ8 A;  5DJM A;  2CV4 A;  1TTZ A;  2PVO C;  1GLQ A;  1KBN A;  2VCV A;  2B3S A;  1EV9 A;  1QXH A;  3L9U A;  3QCP A;  5HR0 A;  2GSS A;  4I2U A;  4Q5F A;  1TK5 B;  2WZ9 A;  2L4Q A;  3LG6 A;  1PRX A;  1YEP A;  2YWO A;  1S3C A;  3AY8 A;  1XWK A;  3F4R A;  2P5Q A;  2GTU A;  4N10 A;  2C4J A;  2LTK A;  4HQZ A;  3C73 A;  1PKZ A;  2YCD A;  1OAZ A;  2A2S A;  4X0X A;  2GDR A;  4EXJ A;  1SU9 A;  3LWA A;  3DYR A;  3DXB A;  3PIN A;  4OCE A;  2MBT A;  2M72 A;  3RDW A;  2FLS A;  2EIO A;  3FR3 A;  4GCI A;  1O8X A;  2O87 A;  3M9K A;  2LJK A;  4V1A g;  2VCT A;  3C1R A;  2K6V A;  2WS2 A;  3S9F A;  5LNK e;  1F2E A;  3F6D A;  4XHM A;  4FO5 A;  2YP6 A;  2B5E A;  5F07 A;  5ENU A;  4KW6 A;  3ZLP A;  3RHB A;  4HJM A;  3A2W A;  3E0U A;  3TJK A;  4IJ3 A;  1GRX A;  3C7M A;  3HJP A;  3TB2 A;  1AQV A;  2CA8 A;  4RQR A;  3C71 A;  3L78 A;  3G9B A;  4MF7 A;  2RM5 A;  4KDU A;  1XVQ A;  4ML6 A;  2M80 A;  4LLR A;  3UJ1 A;  2C3T A;  4F2I A;  5JWQ B;  4JBB A;  2H66 A;  1F9M A;  2JL4 A;  3PH9 A;  2B1K A;  3U6V A;  4MH2 A;  3LEF A;  4GQF A;  4TR1 B;  3GHA A;  1UC7 A;  3APQ A;  4IJI A;  3DIE A;  1ZYE A;  1UVZ A;  3ZFL A;  1ZCP A;  2G2Q A;  3OR5 A;  3VLN A;  3CSJ A;  1OE7 A;  4L0W A;  1JZD A;  4KAE A;  2VOC A;  5G30 A;  4L8E A;  3FZ9 A;  1ERV A;  4MPG A;  3ZRE A;  2YJ7 A;  3HVS A;  1X5C A;  3FK8 A;  1GL8 A;  1ABA A;  4E8H A;  3GUR A;  1OKD A;  5DVB A;  2GQL A;  3ERW A;  3GUS A;  4BA7 A;  1BJX A;  5LCZ A;  3EVI A;  5EPF A;  2VD1 A;  5J5N A;  4JR6 A;  3FHK A;  1TK8 B;  1CQH A;  3ERG A;  4Q5N A;  4YQV A;  3WT2 A;  3GYK A;  1YKA A;  4ZBD A;  3CYN A;  1N2A A;  3HCZ A;  3HA9 A;  2JZT A;  5IOX A;  4HQS A;  1ST9 A;  1F3A A;  4OMV A;  1W4V A;  5COH A;  2F8A A;  3DRN A;  5F8B A;  1M9B A;  4K2D A;  2IMK A;  4TR1 A;  3CRU A;  1K0M A;  2F3M A;  1BX9 A;  4DSS B;  1XIY A;  3A2X A;  2VCX A;  1GSS A;  4WKW A;  4DEJ A;  1YKC A;  2H6Y A;  4ULX A;  2IPA A;  5B8A A;  1I5G A;  2C0E A;  2RM6 A;  3UVH A;  3PGT A;  4I5Q A;  2H74 A;  1PX6 A;  1ACV A;  1CQG A;  5ECO B;  3KJY A;  5DAK B;  2CVD A;  4YQU A;  3NOF A;  2PWJ A;  4QQ7 A;  5CRH A;  1T4Y A;  4NV5 A;  3UVT A;  3Q74 A;  2REM A;  1PD2 1;  3P2A A;  4G2E A;  4OFN A;  4PQH A;  4NWY A;  2WJU A;  4KH7 A;  3IK7 A;  1ZL9 A;  3QAG A;  4EDZ A;  1QFN A;  4DSS A;  3CTG A;  2VLT A;  3ME7 A;  2H6Z A;  1T00 A;  2HSY A;  4PUR A;  3APO A;  4OFT A;  1DBY A;  1OC8 A;  1H4O A;  3ZML A;  2ES7 A;  1SK1 A;  4FH8 A;  4WR5 A;  2CZ3 A;  3KTL A;  4J57 E;  3VWX A;  3O76 A;  2C0G A;  4PQI A;  4HEA 2;  4IQA A;  5DAK A;  3KH9 A;  3HYP A;  5FWG A;  3QR6 A;  3FEU A;  4LL4 B;  2V2G A;  3W8J A;  2H71 A;  2K9F A;  1EV4 A;  1M2D A;  1JZR A;  2AAW A;  5D96 A;  4TVE A;  3TKS E;  3TKS A;  3IAS 2;  1O85 A;  4ZB9 A;  2JU5 A;  4TKY A;  4RUV A;  4KCE A;  5G31 A;  2ON7 A;  1GSU A;  3TJJ A;  1AUC A;  1LU4 A;  5KEJ A;  1J08 A;  5ECS A;  5DCG A;  2JSY A;  3GH6 A;  3WT1 A;  1FG4 A;  1NM3 A;  1MEK A;  1U6T A;  1HQO A;  2GZY A;  4HU7 A;  3GV1 A;  2GZZ A;  3I9V 2;  2L57 A;  3VUR A;  1NHO A;  2ZUP A;  4EL1 A;  6GSY A;  5DDL A;  3CRT A;  3G7J A;  3G7Y A;  2OE3 A;  3ISO A;  1YY7 A;  2FGX A;  4GSS A;  1NSW A;  3VWU A;  5IMA A;  2MZC A;  3TKS C;  3EU3 A;  1Y6E A;  4YAP A;  3TKR A;  3EIN A;  1GUK A;  1SKR B;  5AIV A;  3BCK A;  2B5Y A;  3FR6 A;  4NPB A;  4RI7 A;  1NHY A;  2IWT A;  3H93 A;  5IPG A;  3GFK A;  2OJL A;  4IBP A;  3DML A;  2DJJ A;  3P90 A;  2N5A A;  4EUY A;  4QL9 A;  4CHS A;  2AV4 A;  5HFG A;  1YZX A;  5ECI B;  3WYW A;  5HFK A;  4V1A p;  2D2Z A;  3H1N A;  1GSD A;  4NHZ A;  2WB9 A;  1GP1 A;  4IVF A;  3ZIT A;  3ZVJ D;  4AJ7 A;  2NVL A;  3MWH A;  3N9J A;  5H5R A;  3RPN A;  3H4K A;  2ZCT A;  1GH2 A;  5JCG A;  2GT5 A;  2LKU A;  4G10 A;  3QFB C;  1TI1 A;  1Q98 A;  2OA7 A;  2JZR A;  2H73 A;  2PMT A;  3KTB A;  2I4A A;  1U3I A;  5INY A;  1MTC A;  5ELA A;  2IMF A;  3UL3 A;  3BD2 A;  2IME A;  1GTU A;  2VIM A;  2H01 A;  3FYG A;  1YF0 A;  2ZNM A;  3TGZ A;  2YZH A;  1AAZ A;  4TN8 A;  5J3R A;  2LNS A;  3D22 A;  2YWN A;  4N11 A;  2XC2 A;  2GS3 A;  4DSQ A;  1MDJ A;  5CO3 A;  2HYX A;  3QMX A;  5DAL B;  5EL8 A;  1PSQ A;  1G7O A;  4WF4 A;  2QSI A;  1GSY A;  3CXG A;  4EDY A;  2PUK C;  2HRF A;  3D5J A;  1DE2 A;  2CZ2 A;  4EVM A;  1SD8 A;  2FA4 A;  2EIQ A;  5D8I A;  2JAC A;  2QC7 A;  1M2B A;  3F8U A;  4IN0 A;  4ECC A;  2WRT A;  3VI5 A;  3ZIV A;  3DVX A;  2HI7 A;  5D9V A;  2O89 A;  2HE3 A;  3GKK A;  4O7H A;  1XW6 A;  1NW2 A;  2X64 A;  3UBK A;  4NAX A;  2OE0 A;  4N30 A;  4Q5R A;  3VFI A;  3UAR A;  22GS A;  4V2N A;  2LRC A;  1SEN A;  1X9M B;  4AJ8 A;  5DAL A;  2A2R A;  4F03 A;  2OBK A;  3GN3 A;  4XCS A;  2KHP A;  3VWW A;  4ZIL A;  4GLT A;  2VCW A;  3HDC A;  6GSV A;  3IA1 A;  1DUG A;  4P3Y B;  2V6K A;  4MF5 A;  4KSO A;  4ZL8 A;  18GS A;  1B4Q A;  5ELG A;  1B9X C;  5ECK B;  4XS1 A;  1FOV A;  3L9V A;  2LUS A;  2B1L A;  3EYT A;  1FAA A;  6GST A;  1R5P A;  3IPZ A;  2FHE A;  1TJD A;  2G0F A;  2RUF A;  3W6G A;  2H0G A;  3WD6 A;  4FYB A;  4CDO A;  1Q4J A;  2X99 A;  4WXT A;  2C3N A;  3US3 A;  2DML A;  2IIY A;  3KXO A;  4HDE A;  2I9H A;  3QAW A;  2HFD A;  3GKN A;  1DSB A;  2I1U A;  3ZYW A;  1JLV A;  3LOR A;  1FHE A;  2DJ0 A;  1ERU A;  2HZF A;  1GSF A;  1WWJ A;  5KN0 A;  2B6M A;  1UN2 A;  4MZB A;  5A4W A;  2K18 A;  4MH3 A;  4H86 A;  2YPM A;  2GSQ A;  3DVW A;  4IS0 A;  3KP9 A;  3KCM A;  4IEL A;  2DBC A;  3M8N A;  1ZOF A;  4K8M A;  1O81 A;  1SKS B;  5F05 A;  1SL0 B;  2HXK A;  1PKW A;  2P0G A;  3TRX A;  2R5G A;  5J41 A;  1G7E A;  1RK4 A;  1X5E A;  5DCH A;  1OC9 A;  1K0N A;  1SK2 A;  3EWL A;  2H8L A;  1GWC A;  5B6M A;  2ON5 A;  3UOM A;  2O85 A;  3GL3 A;  5JWO B;  2C1Y A;  2P5R A;  1Z3E A;  2N5B A;  2FWG A;  3E3E A;  1GLP A;  1V57 A;  4TRX A;  1SJZ A;  4WEY A;  1FW1 A;  1LBK A;  2LST A;  3H8Q A;  2OKA A;  5JWR B;  2OE1 A;  1AW9 A;  1XW9 A;  1QMV A;  1TW9 A;  1ZGN A;  1IYI A;  3LYK A;  4FIW A;  4ACS A;  3FZ4 A;  3TOU A;  4KND A;  3MSZ A;  2HSH A;  1B8X A;  3MNG A;  1QUW A;  4KDX A;  2C3Q A;  4BWQ A;  1YEX A;  2R2J A;  3KIJ A;  1EZK A;  16GS A;  5IMD A;  4ZXG A;  1TU7 A;  3QOU A;  3CBU A;  2VM2 A;  3M1G A;  3LXZ A;  4TR3 A;  3GRX A;  1QQ2 A;  2MMZ A;  3WGE A;  5B6N A;  3IBH A;  2FWH A;  2VLU A;  1TRS A;  4EF0 A;  3LYP A;  1SL2 B;  2AHE A;  4HJ2 A;  1XOB A;  7GSS A;  4I2T A;  4J2F A;  3ERF A;  5ECN B;  1XXU A;  5D9X A;  1EGO A;  2IMD A;  1I9D A;  1PQN A;  2O7K A;  1U87 A;  1GSQ A;  4OO4 A;  3GMF A;  4EKZ A;  1BQ7 A;  2VUP A;  2YJH A;  4WBR D;  1AQX A;  1M9A A;  1JZO A;  5IM9 A;  3GTU B;  3W8S A;  1MD3 A;  1AIU A;  1USB A;  1GNW A;  4MJC A;  3LXT A;  4KDY A;  3WGX A;  4Z7X A;  1S3A A;  2H1A A;  4LA1 A;  1V98 A;  3ED3 A;  4V2M A;  1YDK A;  2H75 A;  5GAP D;  4GQC A;  1SKW B;  5GST A;  4KGI A;  5EY6 A;  5H5S A;  1ZYQ B;  1ZZY A;  5AN1 A;  20GS A;  4ECJ A;  4I8B A;  4KSM A;  2DMM A;  3LGC A;  1HNC A;  5D93 A;  3K8N A;  2F9S A;  2VM1 A;  1Z6N A;  4LMV A;  5CRD A;  3U5R E;  3GX0 A;  1EEJ A;  1YJ6 A;  3FRC A;  2NBS A;  1W89 A;  5L71 A;  3VPQ A;  2L6C A;  2E2G A;  3GH9 A;  3GTU A;  2VD0 A;  4CW9 A;  6GSS A;  1T8E B;  4PUA A;  13GS A;  5IIZ A;  3IAM 2;  2XHF A;  17GS A;  2FY6 A;  4GF0 A;  2R3X A;  4AGS A;  2VL9 A;  1X9W B;  1TRV A;  1FB0 A;  2E2M A;  3KP8 A;  4DSR A;  5G5F A;  3EU4 A;  3ZL5 A;  3HHV A;  1GUL A;  5ECL B;  3TCO A;  5HFI A;  2GQM A;  1H75 A;  3ZVJ A;  1MD4 A;  1A0F A;  3O3T A;  3APS A;  1WPI A;  4ZL9 A;  5A4U A;  1A8Y A;  1BYE A;  2X8C A;  1FO5 A;  3EC3 A;  3GSS A;  4PXO A;  1ML6 A;  2B5X A;  4K9Z A;  5B7C A;  3C8E A;  1XWA A;  5IMC A;  3A3T A;  2LQO A;  4EO3 A;  5KN2 A;  5C04 A;  4WBJ A;  3F3Q A;  2H76 A;  2NTO A;  2YNX A;  1XCC A;  2JSZ A;  3RAZ A;  2X8G A;  5EVO A;  4MJB A;  3LQ7 A;  4KCA A;  2XBI A;  5DJL A;  1HD2 A;  2KP1 A;  5J9B A;  1K0D A;  4POL A;  5GZZ B;  1KNG A;  3L4N A;  4KB3 A;  2I81 A;  1X0R A;  2LQQ A;  1ERW A;  3HVX A;  3G7I A;  3DGQ A;  1BG5 A;  2IMI A;  1A2L A;  1SYR A;  1TKD B;  2CVK A;  3I69 A;  1A2M A;  4LL1 B;  3VI7 A; 
#chains in the Genus database with same CATH topology
 2VL2 A;  3ZRD A;  3D21 A;  2K8S A;  4I6X A;  3ZIJ A;  2JZS A;  2KUC A;  2OAC A;  2R0G A;  5ECQ B;  1ON4 A;  1B9Y C;  4MF6 A;  2OAD A;  3EE2 A;  2L59 A;  2I3Y A;  5J4U A;  4G19 A;  1URM A;  1XW5 A;  3ZMK A;  5CP1 A;  2NDO A;  2HT9 A;  3A2V A;  1SK0 A;  1SD9 A;  1SJI A;  1A23 A;  5KN3 A;  2R37 A;  4MDC A;  4IP1 A;  2FA8 A;  3TRP A;  1EP7 A;  3F9U A;  4K7O A;  3IDV A;  5DQY A;  3HY2 A;  4NXI A;  4TR4 A;  1FB6 A;  3P7X A;  2VL2 C;  1F3B A;  2GGT A;  5CRE A;  4ZB8 A;  2YV7 A;  1V2A A;  1O6J A;  4BWS A;  5CRG A;  4TXO A;  2HRN A;  4XRA A;  3DD3 A;  4FYU A;  4JR4 A;  2CQ9 A;  2DJ2 A;  4FYC A;  2LS5 A;  3VK9 A;  4IHU A;  2H30 A;  2DIZ A;  2GVP A;  3D4T A;  1X5D A;  1T1V A;  2WFC A;  4HUA A;  1AXD A;  3ME8 A;  4JU5 A;  2YZU A;  5IMZ A;  1WMJ A;  1XWG A;  1G6Y A;  2F51 A;  1Z5Y E;  3TJF A;  1R26 A;  5ECM B;  4L5L A;  1M99 A;  2HZE B;  4K1F A;  5LD0 A;  2MYG A;  3HVV A;  2LRT A;  1XWC A;  5IMV A;  4OWY A;  1WRY A;  3UEM A;  3V1W A;  5G1K A;  2IJY A;  1T3B A;  1Z7P A;  2GZP A;  5G5E A;  8GSS A;  5G2Z A;  2H1G A;  2RLI A;  2BTO T;  2VLV A;  2GST A;  1IYH A;  1PL2 A;  4TW5 A;  1TRW A;  4XRD A;  4PQ1 A;  3F4T A;  4NMU A;  2A4V A;  2HLS A;  3IHQ A;  4JZQ A;  4K7I A;  3CMI A;  2YWI A;  1Y25 A;  1RW1 A;  1XG8 A;  1R4W A;  3GST A;  2EC4 A;  2H1B A;  3TKQ A;  1O7U A;  3IRA A;  1FVJ A;  4X4J A;  3L0H A;  2NPB A;  4POB A;  4ECI A;  5J9C A;  4WF5 A;  2B7J A;  2HZE A;  4KA0 A;  4BL7 B;  5A5K A;  4O5Q A;  4OFM A;  1VF3 A;  1OC9 B;  2V32 A;  5AIX A;  3FZA A;  14GS A;  3F63 A;  1J9B A;  4YH2 A;  3DEX A;  1OYJ A;  3F4S A;  3M3M A;  2LRN A;  4LMW A;  4F82 A;  2FUG 2;  2O8V B;  3FY7 A;  3IV4 A;  5E4W A;  3TJB A;  3H79 A;  1G0T A;  3KM6 A;  2BJX A;  4ECB A;  4GST A;  1VF1 A;  1O8W A;  1WE0 A;  5A4V A;  2RUE A;  3ZZX A;  5KN1 A;  2FNO A;  2CAQ A;  2P31 A;  1TU8 A;  2V1M A;  5IQY A;  4XIH A;  1SJ6 A;  4PUF C;  3LFL A;  2H0H A;  1X9S B;  5IO2 A;  1G6W A;  4PNF A;  4PGT A;  3GKX A;  4KUN A;  4EE0 A;  2ALB A;  2KLX A;  4BL7 A;  3EMX A;  4MA9 A;  4IGJ A;  1K3Y A;  3M0F A;  1YF1 A;  1ILO A;  4YKG A;  3KGK A;  2R6K A;  1R7H A;  3KMN A;  3RHC A;  4N0Z A;  9GSS A;  1LJR A;  1K0O A;  1A2J A;  5AGY A;  1TDI A;  4HU9 A;  1BAY A;  1WJK A;  2GLR A;  4K7N A;  3IC4 A;  4IQ1 A;  3DWV A;  5CAX A;  2PGT A;  1WIK A;  3LSZ A;  3BJ5 A;  1K0B A;  3HJM A;  3KH7 A;  3VWV A;  3HD5 A;  2H72 A;  2TRX A;  1S3R A;  2C80 A;  1GUM A;  4MMM A;  3TJG A;  1TK0 B;  3HZ4 A;  2MMA A;  5CYY A;  4ISD A;  3QAV A;  2QKE A;  4GXZ A;  2C8U A;  1PN9 A;  4ZB6 A;  4TOP A;  2WGR A;  1OKT A;  1TRU A;  2BMX A;  4TR0 A;  1HYU A;  4XTS A;  2PER A;  2GSR A;  4O5U A;  1K0C A;  2V41 A;  1E6B A;  3GL5 A;  5HQP A;  1GUH A;  3GNJ A;  2QGV A;  3CTF A;  3PR8 A;  4MAB A;  2KP2 A;  2MMN A;  2RII A;  3VPT A;  5FHI A;  4POM A;  3RPP A;  3Q6O A;  4BVX B;  4KE3 A;  1PX7 A;  2N5F A;  5DQS A;  3TKP A;  4XS4 B;  1GTB A;  1T7P B;  3F0I A;  1ZMA A;  1TI3 A;  2V6O A;  4O32 A;  2CT6 A;  1VF2 A;  1PGT A;  2DSA A;  3D4M A;  1HNA A;  3CQF A;  1QK8 A;  3DKS A;  3UAP A;  4F0C A;  1KEB A;  1EGR A;  2HNL A;  5H5Q A;  2DC5 A;  3IR4 A;  4Z2U A;  4ML1 A;  1AQW A;  1GTI A;  1E2Y A;  3FZ5 A;  1M3J A;  4ZBB A;  1THO A;  2A4H A;  5ID2 B;  2PBJ A;  1EWX A;  3KZQ A;  3Q18 A;  2LNT A;  3F6F A;  1O73 A;  4F9Z A;  4J56 E;  2H1D A;  1B4P A;  3IOS A;  4YAV A;  4L5O A;  2XPE A;  3IE3 A;  3JCM L;  1C72 A;  4MPF A;  1XWB A;  1YQ1 A;  4ZBA A;  4OO5 A;  1WP0 A;  3KEB A;  2FWF A;  3UBL A;  4L0U A;  4BVX A;  1R5A A;  3GA4 A;  4XS4 A;  4EC0 A;  3FR9 A;  2IL3 A;  4PX1 A;  3J7Y b;  4K0N A;  3N5O A;  4AJ6 A;  2VCZ A;  3L9S A;  3D0Z A;  4QL7 A;  1THX A;  1B48 A;  2CAI A;  2YV9 A;  1RQM A;  2B7K A;  1EP8 A;  4I97 A;  19GS A;  4RQX A;  4IW9 A;  2H0I A;  2IFQ B;  4AF2 A;  1PL1 A;  1VRS D;  2PN8 A;  4RI6 A;  1UA5 A;  4BPY A;  2WDU A;  3CSH A;  4HZ4 A;  1ERT A;  3RBT A;  4A5P A;  1MDI A;  5ID2 A;  1BED A;  2VO4 A;  2YOI A;  5GSS A;  1K0A A;  1PA3 A;  1SL1 B;  4TXV A;  5D73 A;  2DIY A;  1GSE A;  2J9H A;  11GS A;  2L5L A;  3ZFB A;  1TOF A;  1Z6M A;  3E9J B;  3O6T A;  4MZW A;  2KOK A;  1Z7R A;  1AC1 A;  4MZC A;  12GS A;  4D73 B;  5ECP B;  1XVW A;  2EIR A;  4GWR A;  6GSW A;  2C0D A;  3EMP A;  2DJ3 A;  2H6X A;  3NZN A;  2WUL A;  6GSX A;  2JAD A;  1F37 A;  3IK9 A;  4MCU A;  2FWE A;  3Q19 A;  1JHB A;  1VGL A;  3FW2 A;  2E7P A;  3EUR A;  2DLX A;  3QFA C;  4G0K A;  1VF4 A;  4X1U A;  2IFQ A;  2L4C A;  5FT3 A;  1OE8 A;  4HZ2 A;  4ZIJ A;  3HJO A;  2PVQ A;  1S3D A;  1A0R P;  2H19 A;  1GNE A;  5IPH A;  2FCH A;  4K6X A;  2HSM A;  2F8F A;  1U3A A;  4BVY A;  5JCU A;  3CSI A;  4JED A;  3TRQ A;  1SYX A;  2LV3 A;  4WR4 A;  3A5W A;  1V40 A;  4DVC A;  3R2Q A;  2X8H A;  3P8W A;  2YN1 A;  1GTA A;  4XS6 A;  3GIX A;  4K0G A;  5ECH B;  2WCI A;  4D73 A;  1EOH A;  5F0G A;  5D9W A;  2CX4 A;  2M46 A;  3IXR A;  4ILF A;  5B8B A;  1WOU A;  3J7Y k;  1M7T A;  5AIS A;  4E8E A;  3ZTL A;  5JCW A;  1KTE A;  5IOW A;  2VCQ A;  3MDK A;  5G1L A;  3C1S A;  2E0Q A;  3KMO A;  1M3I A;  2VL3 A;  3QDN A;  3M9J A;  3I43 A;  1V58 A;  2TIR A;  4TXO B;  4NHW A;  5HR3 A;  3FKF A;  5IO0 A;  1FVK A;  1U88 A;  2YWM A;  1XBS A;  2J23 A;  1QGV A;  1J0F A;  1N8J A;  3BOA A;  3GX8 A;  1M0U A;  1K3L A;  5DBQ A;  2DJK A;  1XPV A;  2LJA A;  10GS A;  3BCI A;  2L6D A;  1MDK A;  4OD7 A;  3R3E A;  5E59 A;  4POK A;  3TUE A;  4NV2 A;  4O5R A;  1T4Z A;  2Z9S A;  3UMA A;  1M2A A;  1A8L A;  5C00 A;  1V9W A;  3KD0 A;  5GAN D;  3F3R A;  2CVB A;  2AJQ B;  4HI7 A;  4GSN A;  3LJR A;  3I6A A;  2L5O A;  3TDG A;  3SBC A;  1OC3 A;  4MK3 A;  2AYT A;  1XFL A;  1XZO A;  5CRW A;  4N0V A;  1HNB A;  4WET A;  1EOG A;  4IP6 A;  5IMF A;  2H70 A;  2C0F A;  2PPT A;  4MP4 A;  2GQK A;  4MJE A;  4O92 A;  2K8V A;  3UIW A;  5BRT A;  3HKR A;  1XOA A;  4YQM A;  3D6I A;  2GT6 A;  5D9T A;  4IKH A;  4HOJ A;  4GRF A;  3WGD A;  1JLW A;  2IN3 A;  4MLY A;  4OCF A;  2MBS A;  2FD3 A;  1A24 A;  3SWL A;  1TXX A;  4JRR A;  1Z9H A;  2QA1 A;  3QPM A;  2VAF A;  5ECR B;  4ID0 A;  2CX3 A;  3MAK A;  3BBY A;  3TOT A;  4X43 A;  2XBQ A;  5CNW A;  3NIV A;  2XPD A;  5F06 A;  4PNG A;  1PN0 A;  2AUV A;  2LEG A;  4ZL7 A;  1EEM A;  3QD9 A;  3HXS A;  3MIX A;  4V2L A;  2MMO A;  6GSU A;  3GKM A;  1JZW A;  1OVN A;  2TRC P;  2PU9 C;  4MNN A;  1PMT A;  4KX4 A;  2YAN A;  5HR2 A;  1F6M C;  1K3O A;  4G9H A;  4JE1 A;  5HR1 A;  1JFU A;  4GTU A;  2AB6 A;  4Q5Q A;  2DJ1 A;  4HS1 A;  1DE1 A;  2LJR A;  4F0B A;  4MJA A;  2R4V A;  4BIK A;  2OBI A;  5ABR A;  1TP9 A;  3HZ8 A;  5DJM A;  2CV4 A;  1TTZ A;  2PVO C;  4YKF A;  1GLQ A;  1KBN A;  2VCV A;  2B3S A;  1EV9 A;  1QXH A;  3L9U A;  1ZYP A;  3QCP A;  4G0I A;  5HR0 A;  2GSS A;  2HRK A;  4I2U A;  4Q5F A;  1TK5 B;  2WZ9 A;  2L4Q A;  2R0P A;  3LG6 A;  1PRX A;  1YEP A;  2YWO A;  1S3C A;  3AY8 A;  1XWK A;  3F4R A;  2P5Q A;  2GTU A;  4N10 A;  2C4J A;  2LTK A;  4HQZ A;  3C73 A;  1PKZ A;  2YCD A;  1OAZ A;  2A2S A;  3A5I A;  4X0X A;  2GDR A;  4EXJ A;  1SU9 A;  3LWA A;  3DYR A;  3DXB A;  3PIN A;  4OCE A;  2MBT A;  2M72 A;  3RDW A;  2FLS A;  2EIO A;  3FR3 A;  4GCI A;  1O8X A;  2O87 A;  3M9K A;  2LJK A;  4V1A g;  2VCT A;  3C1R A;  2K6V A;  2WS2 A;  3S9F A;  5LNK e;  1F2E A;  3F6D A;  4XHM A;  4FO5 A;  2YP6 A;  2B5E A;  5F07 A;  5ENU A;  4KW6 A;  3ZLP A;  3RHB A;  4HJM A;  3A2W A;  3E0U A;  3TJK A;  4IJ3 A;  1GRX A;  4USS A;  3C7M A;  3HJP A;  3TB2 A;  1AQV A;  2CA8 A;  4RQR A;  3C71 A;  3L78 A;  3G9B A;  4MF7 A;  2RM5 A;  4KDU A;  1XVQ A;  4ML6 A;  2M80 A;  4LLR A;  3UJ1 A;  2C3T A;  4F2I A;  5JWQ B;  4JBB A;  2H66 A;  1F9M A;  2JL4 A;  3PH9 A;  2B1K A;  3U6V A;  4MH2 A;  3LEF A;  1ZYN A;  4GQF A;  4TR1 B;  3GHA A;  1UC7 A;  3APQ A;  4IJI A;  3DIE A;  1ZYE A;  1UVZ A;  3ZFL A;  1ZCP A;  2G2Q A;  3OR5 A;  3VLN A;  3CSJ A;  1OE7 A;  4L0W A;  1JZD A;  4KAE A;  2VOC A;  5G30 A;  4L8E A;  3FZ9 A;  1ERV A;  4MPG A;  3ZRE A;  2YJ7 A;  3HVS A;  1X5C A;  3FK8 A;  1GL8 A;  1ABA A;  4E8H A;  3GUR A;  1OKD A;  5DVB A;  2GQL A;  3ERW A;  3GUS A;  4BA7 A;  1BJX A;  5LCZ A;  4Z2R A;  3EVI A;  5EPF A;  2VD1 A;  5J5N A;  4JR6 A;  3FHK A;  1TK8 B;  1CQH A;  3ERG A;  4Q5N A;  4YQV A;  3WT2 A;  3GYK A;  1YKA A;  4ZBD A;  3CYN A;  1N2A A;  3HCZ A;  3HA9 A;  2JZT A;  5IOX A;  4HQS A;  1ST9 A;  1F3A A;  4OMV A;  1W4V A;  5COH A;  2F8A A;  3DRN A;  5F8B A;  1M9B A;  4K2D A;  2IMK A;  4TR1 A;  3CRU A;  1K0M A;  2F3M A;  1BX9 A;  4DSS B;  1XIY A;  3A2X A;  2VCX A;  1GSS A;  4WKW A;  4DEJ A;  1YKC A;  2H6Y A;  4ULX A;  2IPA A;  4CY6 A;  5B8A A;  1I5G A;  2C0E A;  2RM6 A;  3UVH A;  3PGT A;  1PFO A;  4I5Q A;  2H74 A;  4KF9 A;  1PX6 A;  1ACV A;  1CQG A;  5ECO B;  3KJY A;  5DAK B;  2CVD A;  3IHG A;  4YQU A;  3NOF A;  2PWJ A;  4QQ7 A;  5CRH A;  4ICY A;  1T4Y A;  4NV5 A;  3UVT A;  3Q74 A;  2REM A;  1PD2 1;  3P2A A;  4G2E A;  4OFN A;  4PQH A;  4NWY A;  4BVY B;  2WJU A;  4KH7 A;  3IK7 A;  1ZL9 A;  3QAG A;  4EDZ A;  1QFN A;  4DSS A;  3CTG A;  2VLT A;  3ME7 A;  2H6Z A;  1T00 A;  2HSY A;  4PUR A;  3APO A;  4OFT A;  1DBY A;  1OC8 A;  1H4O A;  3ZML A;  2ES7 A;  1SK1 A;  4FH8 A;  4WR5 A;  2CZ3 A;  3KTL A;  4J57 E;  3VWX A;  3O76 A;  2C0G A;  4PQI A;  4HEA 2;  4IQA A;  5DAK A;  3KH9 A;  3HYP A;  5FWG A;  3QR6 A;  3FEU A;  4LL4 B;  2V2G A;  3W8J A;  2H71 A;  2K9F A;  4PTS A;  1EV4 A;  1M2D A;  1JZR A;  2AAW A;  5D96 A;  4TVE A;  3TKS E;  3TKS A;  3IAS 2;  1O85 A;  4ZB9 A;  2JU5 A;  4TKY A;  4RUV A;  4KCE A;  5G31 A;  2ON7 A;  3EPT A;  3HVN A;  1GSU A;  3TJJ A;  2X49 A;  1AUC A;  1LU4 A;  5KEJ A;  1J08 A;  5ECS A;  5DCG A;  2JSY A;  3GH6 A;  3WT1 A;  1FG4 A;  1NM3 A;  1MEK A;  1U6T A;  1HQO A;  2GZY A;  4HU7 A;  3GV1 A;  2GZZ A;  3I9V 2;  2L57 A;  3VUR A;  1NHO A;  2ZUP A;  4EL1 A;  6GSY A;  5DDL A;  4K5R A;  3CRT A;  3G7J A;  3G7Y A;  2OE3 A;  3ISO A;  1YY7 A;  2FGX A;  4GSS A;  1NSW A;  3VWU A;  4Z2T A;  5IMA A;  2MZC A;  3TKS C;  3EU3 A;  1Y6E A;  4YAP A;  3TKR A;  3EIN A;  1GUK A;  1SKR B;  5AIV A;  2UZ8 A;  3BCK A;  2B5Y A;  3FR6 A;  4NPB A;  4RI7 A;  1NHY A;  2IWT A;  3H93 A;  5IPG A;  3GFK A;  2OJL A;  4IBP A;  3DML A;  2DJJ A;  3P90 A;  2N5A A;  4EUY A;  3FMW A;  4QL9 A;  4CHS A;  2AV4 A;  5HFG A;  1YZX A;  5ECI B;  3WYW A;  5HFK A;  4V1A p;  2D2Z A;  3H1N A;  1GSD A;  4NHZ A;  2WB9 A;  1GP1 A;  4IVF A;  3ZIT A;  3ZVJ D;  4AJ7 A;  2NVL A;  3MWH A;  3N9J A;  5H5R A;  3RPN A;  3H4K A;  2ZCT A;  1GH2 A;  5JCG A;  2GT5 A;  2LKU A;  4G10 A;  3QFB C;  1TI1 A;  1Q98 A;  2OA7 A;  2JZR A;  2H73 A;  2PMT A;  3KTB A;  2I4A A;  1U3I A;  5INY A;  3IC8 A;  1MTC A;  5ELA A;  2IMF A;  3UL3 A;  3BD2 A;  2IME A;  1GTU A;  2VIM A;  2H01 A;  5KOX A;  3FYG A;  1YF0 A;  2ZNM A;  3TGZ A;  2YZH A;  1AAZ A;  4TN8 A;  5J3R A;  2LNS A;  3D22 A;  2R0C A;  2YWN A;  4N11 A;  2XC2 A;  2GS3 A;  4DSQ A;  1MDJ A;  5CO3 A;  2HYX A;  3QMX A;  5DAL B;  5EL8 A;  1PSQ A;  1G7O A;  4WF4 A;  2QSI A;  1GSY A;  3CXG A;  4EDY A;  2PUK C;  2HRF A;  3D5J A;  1DE2 A;  2CZ2 A;  4EVM A;  1SD8 A;  2FA4 A;  2EIQ A;  5D8I A;  2JAC A;  2QC7 A;  1M2B A;  3F8U A;  4IN0 A;  4ECC A;  2WRT A;  3VI5 A;  3ZIV A;  3DVX A;  4K2X A;  2HI7 A;  5D9V A;  2O89 A;  2HE3 A;  3GKK A;  4O7H A;  1XW6 A;  1NW2 A;  4K5S A;  2X64 A;  2HRA A;  3UBK A;  4NAX A;  2OE0 A;  4N30 A;  4Q5R A;  3VFI A;  3UAR A;  22GS A;  4V2N A;  2LRC A;  1SEN A;  1X9M B;  4AJ8 A;  5DAL A;  2A2R A;  4F03 A;  2OBK A;  3GN3 A;  4XCS A;  2KHP A;  3VWW A;  4ZIL A;  4GLT A;  2VCW A;  3HDC A;  6GSV A;  3IA1 A;  1DUG A;  4P3Y B;  2V6K A;  4MF5 A;  4KSO A;  4ZL8 A;  18GS A;  1B4Q A;  5ELG A;  1B9X C;  5ECK B;  4XS1 A;  1FOV A;  4EIQ A;  3L9V A;  2LUS A;  2B1L A;  3EYT A;  1FAA A;  3LW9 A;  6GST A;  1R5P A;  3IPZ A;  2FHE A;  1TJD A;  2G0F A;  2RUF A;  3W6G A;  2H0G A;  3WD6 A;  4FYB A;  4CDO A;  1Q4J A;  2X99 A;  3PPU A;  2X4A A;  4WXT A;  2C3N A;  3US3 A;  2DML A;  2IIY A;  3KXO A;  4HDE A;  2I9H A;  3QAW A;  2HFD A;  3GKN A;  1DSB A;  2I1U A;  3ZYW A;  1JLV A;  3LOR A;  1FHE A;  2DJ0 A;  1ERU A;  2HZF A;  1GSF A;  1WWJ A;  2A2P A;  5KN0 A;  2B6M A;  1UN2 A;  4MZB A;  5A4W A;  2K18 A;  4MH3 A;  4H86 A;  2YPM A;  2GSQ A;  3DVW A;  4IS0 A;  3KP9 A;  3KCM A;  4IEL A;  2DBC A;  3M8N A;  1ZOF A;  4K8M A;  1O81 A;  1SKS B;  5F05 A;  1SL0 B;  2HXK A;  1PKW A;  2P0G A;  3TRX A;  2R5G A;  5J41 A;  1G7E A;  1RK4 A;  1X5E A;  5DCH A;  1OC9 A;  1K0N A;  1SK2 A;  3EWL A;  2H8L A;  1GWC A;  5B6M A;  2ON5 A;  3UOM A;  2O85 A;  3GL3 A;  5JWO B;  2C1Y A;  2P5R A;  1Z3E A;  2N5B A;  2FWG A;  3E3E A;  1GLP A;  1V57 A;  4TRX A;  1SJZ A;  4WEY A;  1FW1 A;  1LBK A;  2LST A;  3H8Q A;  2QA2 A;  2OKA A;  5JWR B;  2OE1 A;  4FQU A;  1AW9 A;  1XW9 A;  1QMV A;  1TW9 A;  1ZGN A;  1IYI A;  3LYK A;  4FIW A;  4ACS A;  3FZ4 A;  3TOU A;  4KND A;  3MSZ A;  2HSH A;  1B8X A;  3MNG A;  1QUW A;  4KDX A;  2C3Q A;  4BWQ A;  1YEX A;  2R2J A;  3KIJ A;  1EZK A;  16GS A;  5IMD A;  4ZXG A;  1TU7 A;  3QOU A;  3CBU A;  2VM2 A;  3M1G A;  3LXZ A;  4TR3 A;  3GRX A;  1QQ2 A;  2MMZ A;  3WGE A;  5B6N A;  5KOW A;  3IBH A;  2FWH A;  2VLU A;  1TRS A;  4EF0 A;  3LYP A;  1SL2 B;  2AHE A;  4HJ2 A;  1XOB A;  7GSS A;  4I2T A;  4J2F A;  3ERF A;  5ECN B;  1XXU A;  5D9X A;  1EGO A;  2IMD A;  1I9D A;  1PQN A;  2O7K A;  1U87 A;  1GSQ A;  4OO4 A;  3GMF A;  4EKZ A;  1BQ7 A;  2VUP A;  2YJH A;  4HSC X;  4WBR D;  1AQX A;  1M9A A;  1JZO A;  4CY8 A;  5IM9 A;  3GTU B;  3W8S A;  1MD3 A;  1AIU A;  1USB A;  1GNW A;  4MJC A;  3LXT A;  4KDY A;  3WGX A;  4Z7X A;  1S3A A;  2H1A A;  4LA1 A;  1V98 A;  3ED3 A;  4V2M A;  1YDK A;  2H75 A;  5GAP D;  4GQC A;  1SKW B;  5GST A;  4KGI A;  5EY6 A;  5H5S A;  1ZYQ B;  1ZZY A;  5AN1 A;  20GS A;  4ECJ A;  4I8B A;  4KSM A;  2DMM A;  3LGC A;  1HNC A;  5D93 A;  3K8N A;  2F9S A;  2VM1 A;  1Z6N A;  4LMV A;  5CRD A;  3U5R E;  3GX0 A;  1EEJ A;  1YJ6 A;  3FRC A;  2NBS A;  1W89 A;  5L71 A;  3VPQ A;  2L6C A;  2E2G A;  3GH9 A;  3GTU A;  1FOH A;  2VD0 A;  4CW9 A;  6GSS A;  1T8E B;  4PUA A;  13GS A;  5IIZ A;  3IAM 2;  2XHF A;  17GS A;  2FY6 A;  4GF0 A;  2R3X A;  4AGS A;  2VL9 A;  1X9W B;  1TRV A;  1FB0 A;  2E2M A;  3KP8 A;  2DKH A;  4DSR A;  5G5F A;  3EU4 A;  3ZL5 A;  3HHV A;  1GUL A;  5ECL B;  3TCO A;  5HFI A;  2GQM A;  1H75 A;  3ZVJ A;  1MD4 A;  1A0F A;  3O3T A;  3APS A;  1WPI A;  4ZL9 A;  5A4U A;  1A8Y A;  1BYE A;  2X8C A;  1FO5 A;  3EC3 A;  3GSS A;  4PXO A;  2DKI A;  1ML6 A;  2B5X A;  4K9Z A;  5B7C A;  3C8E A;  1XWA A;  5IMC A;  3A3T A;  2LQO A;  4EO3 A;  5KN2 A;  5C04 A;  4WBJ A;  3F3Q A;  2H76 A;  2NTO A;  2YNX A;  1XCC A;  2JSZ A;  4EIP A;  3RAZ A;  2X8G A;  5EVO A;  4MJB A;  3LQ7 A;  4KCA A;  2XBI A;  5DJL A;  1HD2 A;  2KP1 A;  5J9B A;  1K0D A;  4G0L A;  3MYD A;  5GZZ B;  4POL A;  1KNG A;  3L4N A;  4KB3 A;  2I81 A;  1X0R A;  2LQQ A;  1ERW A;  5BMU A;  3HVX A;  3G7I A;  3DGQ A;  1BG5 A;  2IMI A;  1A2L A;  1SYR A;  1TKD B;  2CVK A;  3I69 A;  1A2M A;  4LL1 B;  3VI7 A; 
#chains in the Genus database with same CATH homology
 2VL2 A;  3ZRD A;  3D21 A;  2K8S A;  4I6X A;  3ZIJ A;  2JZS A;  2KUC A;  2OAC A;  2R0G A;  5ECQ B;  1ON4 A;  1B9Y C;  4MF6 A;  2OAD A;  3EE2 A;  2L59 A;  2I3Y A;  5J4U A;  4G19 A;  1URM A;  1XW5 A;  3ZMK A;  5CP1 A;  2NDO A;  2HT9 A;  3A2V A;  1SK0 A;  1SD9 A;  1SJI A;  1A23 A;  5KN3 A;  2R37 A;  4MDC A;  4IP1 A;  2FA8 A;  3TRP A;  1EP7 A;  3F9U A;  4K7O A;  3IDV A;  5DQY A;  3HY2 A;  4NXI A;  4TR4 A;  1FB6 A;  3P7X A;  2VL2 C;  1F3B A;  2GGT A;  5CRE A;  4ZB8 A;  2YV7 A;  1V2A A;  1O6J A;  4BWS A;  5CRG A;  4TXO A;  2HRN A;  4XRA A;  3DD3 A;  4FYU A;  4JR4 A;  2CQ9 A;  2DJ2 A;  4FYC A;  2LS5 A;  3VK9 A;  4IHU A;  2H30 A;  2DIZ A;  2GVP A;  3D4T A;  1X5D A;  1T1V A;  2WFC A;  4HUA A;  1AXD A;  3ME8 A;  4JU5 A;  2YZU A;  5IMZ A;  1WMJ A;  1XWG A;  1G6Y A;  2F51 A;  1Z5Y E;  3TJF A;  1R26 A;  5ECM B;  4L5L A;  1M99 A;  2HZE B;  4K1F A;  5LD0 A;  2MYG A;  3HVV A;  2LRT A;  1XWC A;  5IMV A;  4OWY A;  1WRY A;  3UEM A;  3V1W A;  5G1K A;  2IJY A;  1T3B A;  1Z7P A;  2GZP A;  5G5E A;  8GSS A;  5G2Z A;  2H1G A;  2RLI A;  2BTO T;  2VLV A;  2GST A;  1IYH A;  1PL2 A;  4TW5 A;  1TRW A;  4XRD A;  4PQ1 A;  3F4T A;  4NMU A;  2A4V A;  2HLS A;  3IHQ A;  4JZQ A;  4K7I A;  3CMI A;  2YWI A;  1Y25 A;  1RW1 A;  1R4W A;  3GST A;  2EC4 A;  2H1B A;  3TKQ A;  1O7U A;  3IRA A;  1FVJ A;  4X4J A;  3L0H A;  2NPB A;  4POB A;  4ECI A;  5J9C A;  4WF5 A;  2B7J A;  2HZE A;  4KA0 A;  4BL7 B;  5A5K A;  4O5Q A;  4OFM A;  1VF3 A;  1OC9 B;  2V32 A;  5AIX A;  3FZA A;  14GS A;  3F63 A;  1J9B A;  4YH2 A;  3DEX A;  1OYJ A;  3F4S A;  3M3M A;  2LRN A;  4LMW A;  4F82 A;  2FUG 2;  2O8V B;  3FY7 A;  3IV4 A;  5E4W A;  3TJB A;  3H79 A;  1G0T A;  3KM6 A;  2BJX A;  4ECB A;  4GST A;  1VF1 A;  1O8W A;  1WE0 A;  5A4V A;  2RUE A;  3ZZX A;  5KN1 A;  2FNO A;  2CAQ A;  2P31 A;  1TU8 A;  2V1M A;  5IQY A;  4XIH A;  1SJ6 A;  4PUF C;  3LFL A;  2H0H A;  1X9S B;  5IO2 A;  1G6W A;  4PNF A;  4PGT A;  3GKX A;  4KUN A;  4EE0 A;  2ALB A;  2KLX A;  4BL7 A;  3EMX A;  4MA9 A;  4IGJ A;  1K3Y A;  3M0F A;  1YF1 A;  1ILO A;  4YKG A;  3KGK A;  2R6K A;  1R7H A;  3KMN A;  3RHC A;  4N0Z A;  9GSS A;  1LJR A;  1K0O A;  1A2J A;  5AGY A;  1TDI A;  4HU9 A;  1BAY A;  1WJK A;  2GLR A;  4K7N A;  3IC4 A;  4IQ1 A;  3DWV A;  5CAX A;  2PGT A;  1WIK A;  3LSZ A;  3BJ5 A;  1K0B A;  3HJM A;  3KH7 A;  3VWV A;  3HD5 A;  2H72 A;  2TRX A;  2C80 A;  1GUM A;  4MMM A;  3TJG A;  1TK0 B;  3HZ4 A;  2MMA A;  5CYY A;  4ISD A;  3QAV A;  2QKE A;  4GXZ A;  2C8U A;  1PN9 A;  4ZB6 A;  4TOP A;  2WGR A;  1OKT A;  1TRU A;  2BMX A;  4TR0 A;  1HYU A;  4XTS A;  2PER A;  2GSR A;  4O5U A;  1K0C A;  2V41 A;  1E6B A;  3GL5 A;  5HQP A;  1GUH A;  3GNJ A;  2QGV A;  3CTF A;  3PR8 A;  4MAB A;  2KP2 A;  2MMN A;  2RII A;  3VPT A;  5FHI A;  4POM A;  3RPP A;  3Q6O A;  4BVX B;  4KE3 A;  1PX7 A;  2N5F A;  5DQS A;  3TKP A;  4XS4 B;  1GTB A;  1T7P B;  3F0I A;  1ZMA A;  1TI3 A;  2V6O A;  4O32 A;  2CT6 A;  1VF2 A;  1PGT A;  2DSA A;  3D4M A;  1HNA A;  1QK8 A;  3DKS A;  3UAP A;  4F0C A;  1KEB A;  1EGR A;  2HNL A;  5H5Q A;  2DC5 A;  3IR4 A;  4Z2U A;  4ML1 A;  1AQW A;  1GTI A;  1E2Y A;  3FZ5 A;  4ZBB A;  1THO A;  2A4H A;  5ID2 B;  2PBJ A;  1EWX A;  3KZQ A;  3Q18 A;  2LNT A;  3F6F A;  1O73 A;  4F9Z A;  4J56 E;  2H1D A;  1B4P A;  3IOS A;  4YAV A;  4L5O A;  2XPE A;  3IE3 A;  3JCM L;  1C72 A;  4MPF A;  1XWB A;  1YQ1 A;  4ZBA A;  4OO5 A;  1WP0 A;  3KEB A;  2FWF A;  3UBL A;  4L0U A;  4BVX A;  1R5A A;  3GA4 A;  4XS4 A;  4EC0 A;  3FR9 A;  2IL3 A;  4PX1 A;  3J7Y b;  4K0N A;  3N5O A;  4AJ6 A;  2VCZ A;  3L9S A;  3D0Z A;  4QL7 A;  1THX A;  1B48 A;  2CAI A;  2YV9 A;  1RQM A;  2B7K A;  1EP8 A;  4I97 A;  19GS A;  4RQX A;  4IW9 A;  2H0I A;  2IFQ B;  4AF2 A;  1PL1 A;  1VRS D;  2PN8 A;  4RI6 A;  1UA5 A;  4BPY A;  2WDU A;  3CSH A;  4HZ4 A;  1ERT A;  3RBT A;  4A5P A;  1MDI A;  5ID2 A;  1BED A;  2VO4 A;  2YOI A;  5GSS A;  1K0A A;  1PA3 A;  1SL1 B;  4TXV A;  5D73 A;  2DIY A;  1GSE A;  2J9H A;  11GS A;  2L5L A;  3ZFB A;  1TOF A;  1Z6M A;  3E9J B;  3O6T A;  4MZW A;  2KOK A;  1Z7R A;  1AC1 A;  4MZC A;  12GS A;  4D73 B;  5ECP B;  1XVW A;  2EIR A;  4GWR A;  6GSW A;  2C0D A;  3EMP A;  2DJ3 A;  2H6X A;  3NZN A;  2WUL A;  6GSX A;  2JAD A;  1F37 A;  3IK9 A;  4MCU A;  2FWE A;  3Q19 A;  1JHB A;  1VGL A;  3FW2 A;  2E7P A;  3EUR A;  2DLX A;  3QFA C;  4G0K A;  1VF4 A;  4X1U A;  2IFQ A;  2L4C A;  5FT3 A;  1OE8 A;  4HZ2 A;  4ZIJ A;  3HJO A;  2PVQ A;  1S3D A;  1A0R P;  2H19 A;  1GNE A;  5IPH A;  2FCH A;  4K6X A;  2HSM A;  2F8F A;  1U3A A;  4BVY A;  5JCU A;  3CSI A;  4JED A;  3TRQ A;  1SYX A;  2LV3 A;  4WR4 A;  3A5W A;  1V40 A;  4DVC A;  3R2Q A;  2X8H A;  3P8W A;  2YN1 A;  1GTA A;  4XS6 A;  3GIX A;  4K0G A;  5ECH B;  2WCI A;  4D73 A;  1EOH A;  5F0G A;  5D9W A;  2CX4 A;  2M46 A;  3IXR A;  4ILF A;  5B8B A;  1WOU A;  3J7Y k;  1M7T A;  5AIS A;  4E8E A;  3ZTL A;  5JCW A;  1KTE A;  5IOW A;  2VCQ A;  3MDK A;  5G1L A;  3C1S A;  2E0Q A;  3KMO A;  2VL3 A;  3QDN A;  3M9J A;  3I43 A;  1V58 A;  2TIR A;  4TXO B;  4NHW A;  5HR3 A;  3FKF A;  5IO0 A;  1FVK A;  1U88 A;  2YWM A;  1XBS A;  2J23 A;  1QGV A;  1J0F A;  1N8J A;  3BOA A;  3GX8 A;  1M0U A;  1K3L A;  5DBQ A;  2DJK A;  1XPV A;  2LJA A;  10GS A;  3BCI A;  2L6D A;  1MDK A;  4OD7 A;  3R3E A;  5E59 A;  4POK A;  3TUE A;  4NV2 A;  4O5R A;  1T4Z A;  2Z9S A;  3UMA A;  1M2A A;  1A8L A;  5C00 A;  1V9W A;  3KD0 A;  5GAN D;  3F3R A;  2CVB A;  2AJQ B;  4HI7 A;  4GSN A;  3LJR A;  3I6A A;  2L5O A;  3TDG A;  3SBC A;  1OC3 A;  4MK3 A;  2AYT A;  1XFL A;  1XZO A;  5CRW A;  4N0V A;  1HNB A;  4WET A;  1EOG A;  4IP6 A;  5IMF A;  2H70 A;  2C0F A;  2PPT A;  4MP4 A;  2GQK A;  4MJE A;  4O92 A;  2K8V A;  3UIW A;  5BRT A;  3HKR A;  1XOA A;  4YQM A;  3D6I A;  2GT6 A;  5D9T A;  4IKH A;  4HOJ A;  4GRF A;  3WGD A;  1JLW A;  2IN3 A;  4MLY A;  4OCF A;  2MBS A;  2FD3 A;  1A24 A;  3SWL A;  1TXX A;  4JRR A;  1Z9H A;  2QA1 A;  3QPM A;  2VAF A;  5ECR B;  4ID0 A;  2CX3 A;  3MAK A;  3BBY A;  3TOT A;  4X43 A;  2XBQ A;  5CNW A;  3NIV A;  2XPD A;  5F06 A;  4PNG A;  1PN0 A;  2AUV A;  2LEG A;  4ZL7 A;  1EEM A;  3QD9 A;  3HXS A;  3MIX A;  4V2L A;  2MMO A;  6GSU A;  3GKM A;  1JZW A;  1OVN A;  2TRC P;  2PU9 C;  4MNN A;  1PMT A;  4KX4 A;  2YAN A;  5HR2 A;  1F6M C;  1K3O A;  4G9H A;  4JE1 A;  5HR1 A;  1JFU A;  4GTU A;  2AB6 A;  4Q5Q A;  2DJ1 A;  4HS1 A;  1DE1 A;  2LJR A;  4F0B A;  4MJA A;  2R4V A;  2OBI A;  5ABR A;  1TP9 A;  3HZ8 A;  5DJM A;  2CV4 A;  1TTZ A;  2PVO C;  4YKF A;  1GLQ A;  1KBN A;  2VCV A;  2B3S A;  1EV9 A;  1QXH A;  3L9U A;  1ZYP A;  3QCP A;  4G0I A;  5HR0 A;  2GSS A;  2HRK A;  4I2U A;  4Q5F A;  1TK5 B;  2WZ9 A;  2L4Q A;  2R0P A;  3LG6 A;  1PRX A;  1YEP A;  2YWO A;  1S3C A;  3AY8 A;  1XWK A;  3F4R A;  2P5Q A;  2GTU A;  4N10 A;  2C4J A;  2LTK A;  4HQZ A;  3C73 A;  1PKZ A;  2YCD A;  1OAZ A;  2A2S A;  3A5I A;  4X0X A;  2GDR A;  4EXJ A;  1SU9 A;  3LWA A;  3DYR A;  3DXB A;  3PIN A;  4OCE A;  2MBT A;  2M72 A;  3RDW A;  2FLS A;  2EIO A;  3FR3 A;  4GCI A;  1O8X A;  2O87 A;  3M9K A;  2LJK A;  4V1A g;  2VCT A;  3C1R A;  2K6V A;  2WS2 A;  3S9F A;  5LNK e;  1F2E A;  3F6D A;  4XHM A;  4FO5 A;  2YP6 A;  2B5E A;  5F07 A;  5ENU A;  4KW6 A;  3ZLP A;  3RHB A;  4HJM A;  3A2W A;  3E0U A;  3TJK A;  4IJ3 A;  1GRX A;  4USS A;  3C7M A;  3HJP A;  3TB2 A;  1AQV A;  2CA8 A;  4RQR A;  3C71 A;  3L78 A;  3G9B A;  4MF7 A;  2RM5 A;  4KDU A;  1XVQ A;  4ML6 A;  2M80 A;  4LLR A;  3UJ1 A;  2C3T A;  4F2I A;  5JWQ B;  4JBB A;  2H66 A;  1F9M A;  2JL4 A;  3PH9 A;  2B1K A;  3U6V A;  4MH2 A;  3LEF A;  1ZYN A;  4GQF A;  4TR1 B;  3GHA A;  1UC7 A;  3APQ A;  4IJI A;  3DIE A;  1ZYE A;  1UVZ A;  3ZFL A;  1ZCP A;  2G2Q A;  3OR5 A;  3VLN A;  3CSJ A;  1OE7 A;  4L0W A;  1JZD A;  4KAE A;  2VOC A;  5G30 A;  4L8E A;  3FZ9 A;  1ERV A;  4MPG A;  3ZRE A;  2YJ7 A;  3HVS A;  1X5C A;  3FK8 A;  1GL8 A;  1ABA A;  4E8H A;  3GUR A;  1OKD A;  5DVB A;  2GQL A;  3ERW A;  3GUS A;  4BA7 A;  1BJX A;  5LCZ A;  4Z2R A;  3EVI A;  5EPF A;  2VD1 A;  5J5N A;  4JR6 A;  3FHK A;  1TK8 B;  1CQH A;  3ERG A;  4Q5N A;  4YQV A;  3WT2 A;  3GYK A;  1YKA A;  4ZBD A;  3CYN A;  1N2A A;  3HCZ A;  3HA9 A;  2JZT A;  5IOX A;  4HQS A;  1ST9 A;  1F3A A;  4OMV A;  1W4V A;  5COH A;  2F8A A;  3DRN A;  5F8B A;  1M9B A;  4K2D A;  2IMK A;  4TR1 A;  3CRU A;  1K0M A;  2F3M A;  1BX9 A;  4DSS B;  1XIY A;  3A2X A;  2VCX A;  1GSS A;  4WKW A;  4DEJ A;  1YKC A;  2H6Y A;  4ULX A;  2IPA A;  4CY6 A;  5B8A A;  1I5G A;  2C0E A;  2RM6 A;  3UVH A;  3PGT A;  4I5Q A;  2H74 A;  4KF9 A;  1PX6 A;  1ACV A;  1CQG A;  5ECO B;  3KJY A;  5DAK B;  2CVD A;  3IHG A;  4YQU A;  3NOF A;  2PWJ A;  4QQ7 A;  5CRH A;  4ICY A;  1T4Y A;  4NV5 A;  3UVT A;  3Q74 A;  2REM A;  1PD2 1;  3P2A A;  4G2E A;  4OFN A;  4PQH A;  4NWY A;  4BVY B;  2WJU A;  4KH7 A;  3IK7 A;  1ZL9 A;  3QAG A;  4EDZ A;  1QFN A;  4DSS A;  3CTG A;  2VLT A;  3ME7 A;  2H6Z A;  1T00 A;  2HSY A;  4PUR A;  3APO A;  4OFT A;  1DBY A;  1OC8 A;  1H4O A;  3ZML A;  2ES7 A;  1SK1 A;  4FH8 A;  4WR5 A;  2CZ3 A;  3KTL A;  4J57 E;  3VWX A;  3O76 A;  2C0G A;  4PQI A;  4HEA 2;  4IQA A;  5DAK A;  3KH9 A;  3HYP A;  5FWG A;  3QR6 A;  3FEU A;  4LL4 B;  2V2G A;  3W8J A;  2H71 A;  2K9F A;  4PTS A;  1EV4 A;  1M2D A;  1JZR A;  2AAW A;  5D96 A;  4TVE A;  3TKS E;  3TKS A;  3IAS 2;  1O85 A;  4ZB9 A;  2JU5 A;  4TKY A;  4RUV A;  4KCE A;  5G31 A;  2ON7 A;  3EPT A;  1GSU A;  3TJJ A;  2X49 A;  1AUC A;  1LU4 A;  5KEJ A;  1J08 A;  5ECS A;  5DCG A;  2JSY A;  3GH6 A;  3WT1 A;  1FG4 A;  1NM3 A;  1MEK A;  1U6T A;  1HQO A;  2GZY A;  4HU7 A;  3GV1 A;  2GZZ A;  3I9V 2;  2L57 A;  3VUR A;  1NHO A;  2ZUP A;  4EL1 A;  6GSY A;  5DDL A;  4K5R A;  3CRT A;  3G7J A;  3G7Y A;  2OE3 A;  3ISO A;  1YY7 A;  2FGX A;  4GSS A;  1NSW A;  3VWU A;  4Z2T A;  5IMA A;  2MZC A;  3TKS C;  3EU3 A;  1Y6E A;  4YAP A;  3TKR A;  3EIN A;  1GUK A;  1SKR B;  5AIV A;  2UZ8 A;  3BCK A;  2B5Y A;  3FR6 A;  4NPB A;  4RI7 A;  1NHY A;  2IWT A;  3H93 A;  5IPG A;  3GFK A;  2OJL A;  4IBP A;  3DML A;  2DJJ A;  3P90 A;  2N5A A;  4EUY A;  3FMW A;  4QL9 A;  4CHS A;  2AV4 A;  5HFG A;  1YZX A;  5ECI B;  3WYW A;  5HFK A;  4V1A p;  2D2Z A;  3H1N A;  1GSD A;  4NHZ A;  2WB9 A;  1GP1 A;  4IVF A;  3ZIT A;  3ZVJ D;  4AJ7 A;  2NVL A;  3MWH A;  3N9J A;  5H5R A;  3RPN A;  3H4K A;  2ZCT A;  1GH2 A;  5JCG A;  2GT5 A;  2LKU A;  4G10 A;  3QFB C;  1TI1 A;  1Q98 A;  2OA7 A;  2JZR A;  2H73 A;  2PMT A;  3KTB A;  2I4A A;  1U3I A;  5INY A;  3IC8 A;  1MTC A;  5ELA A;  2IMF A;  3UL3 A;  3BD2 A;  2IME A;  1GTU A;  2VIM A;  2H01 A;  5KOX A;  3FYG A;  1YF0 A;  2ZNM A;  3TGZ A;  2YZH A;  1AAZ A;  4TN8 A;  5J3R A;  2LNS A;  3D22 A;  2R0C A;  2YWN A;  4N11 A;  2XC2 A;  2GS3 A;  4DSQ A;  1MDJ A;  5CO3 A;  2HYX A;  3QMX A;  5DAL B;  5EL8 A;  1PSQ A;  1G7O A;  4WF4 A;  2QSI A;  1GSY A;  3CXG A;  4EDY A;  2PUK C;  2HRF A;  3D5J A;  1DE2 A;  2CZ2 A;  4EVM A;  1SD8 A;  2FA4 A;  2EIQ A;  5D8I A;  2JAC A;  2QC7 A;  1M2B A;  3F8U A;  4IN0 A;  4ECC A;  2WRT A;  3VI5 A;  3ZIV A;  3DVX A;  4K2X A;  2HI7 A;  5D9V A;  2O89 A;  2HE3 A;  3GKK A;  4O7H A;  1XW6 A;  1NW2 A;  4K5S A;  2X64 A;  2HRA A;  3UBK A;  4NAX A;  2OE0 A;  4N30 A;  4Q5R A;  3VFI A;  3UAR A;  22GS A;  4V2N A;  2LRC A;  1SEN A;  1X9M B;  4AJ8 A;  5DAL A;  2A2R A;  4F03 A;  2OBK A;  3GN3 A;  4XCS A;  2KHP A;  3VWW A;  4ZIL A;  4GLT A;  2VCW A;  3HDC A;  6GSV A;  3IA1 A;  1DUG A;  4P3Y B;  2V6K A;  4MF5 A;  4KSO A;  4ZL8 A;  18GS A;  1B4Q A;  5ELG A;  1B9X C;  5ECK B;  4XS1 A;  1FOV A;  4EIQ A;  3L9V A;  2LUS A;  2B1L A;  3EYT A;  1FAA A;  3LW9 A;  6GST A;  1R5P A;  3IPZ A;  2FHE A;  1TJD A;  2G0F A;  2RUF A;  3W6G A;  2H0G A;  3WD6 A;  4FYB A;  4CDO A;  1Q4J A;  2X99 A;  3PPU A;  2X4A A;  4WXT A;  2C3N A;  3US3 A;  2DML A;  2IIY A;  3KXO A;  4HDE A;  2I9H A;  3QAW A;  2HFD A;  3GKN A;  1DSB A;  2I1U A;  3ZYW A;  1JLV A;  3LOR A;  1FHE A;  2DJ0 A;  1ERU A;  2HZF A;  1GSF A;  1WWJ A;  2A2P A;  5KN0 A;  2B6M A;  1UN2 A;  4MZB A;  5A4W A;  2K18 A;  4MH3 A;  4H86 A;  2YPM A;  2GSQ A;  3DVW A;  4IS0 A;  3KP9 A;  3KCM A;  4IEL A;  2DBC A;  3M8N A;  1ZOF A;  4K8M A;  1O81 A;  1SKS B;  5F05 A;  1SL0 B;  2HXK A;  1PKW A;  2P0G A;  3TRX A;  2R5G A;  5J41 A;  1G7E A;  1RK4 A;  1X5E A;  5DCH A;  1OC9 A;  1K0N A;  1SK2 A;  3EWL A;  2H8L A;  1GWC A;  5B6M A;  2ON5 A;  3UOM A;  2O85 A;  3GL3 A;  5JWO B;  2C1Y A;  2P5R A;  1Z3E A;  2N5B A;  2FWG A;  3E3E A;  1GLP A;  1V57 A;  4TRX A;  1SJZ A;  4WEY A;  1FW1 A;  1LBK A;  2LST A;  3H8Q A;  2QA2 A;  2OKA A;  5JWR B;  2OE1 A;  4FQU A;  1AW9 A;  1XW9 A;  1QMV A;  1TW9 A;  1ZGN A;  1IYI A;  3LYK A;  4FIW A;  4ACS A;  3FZ4 A;  3TOU A;  4KND A;  3MSZ A;  2HSH A;  1B8X A;  3MNG A;  1QUW A;  4KDX A;  2C3Q A;  4BWQ A;  1YEX A;  2R2J A;  3KIJ A;  1EZK A;  16GS A;  5IMD A;  4ZXG A;  1TU7 A;  3QOU A;  3CBU A;  2VM2 A;  3M1G A;  3LXZ A;  4TR3 A;  3GRX A;  1QQ2 A;  2MMZ A;  3WGE A;  5B6N A;  5KOW A;  3IBH A;  2FWH A;  2VLU A;  1TRS A;  4EF0 A;  3LYP A;  1SL2 B;  2AHE A;  4HJ2 A;  1XOB A;  7GSS A;  4I2T A;  4J2F A;  3ERF A;  5ECN B;  1XXU A;  5D9X A;  1EGO A;  2IMD A;  1I9D A;  1PQN A;  2O7K A;  1U87 A;  1GSQ A;  4OO4 A;  3GMF A;  4EKZ A;  1BQ7 A;  2VUP A;  2YJH A;  4WBR D;  1AQX A;  1M9A A;  1JZO A;  4CY8 A;  5IM9 A;  3GTU B;  3W8S A;  1MD3 A;  1AIU A;  1USB A;  1GNW A;  4MJC A;  3LXT A;  4KDY A;  3WGX A;  4Z7X A;  1S3A A;  2H1A A;  4LA1 A;  1V98 A;  3ED3 A;  4V2M A;  1YDK A;  2H75 A;  5GAP D;  4GQC A;  1SKW B;  5GST A;  4KGI A;  5EY6 A;  5H5S A;  1ZYQ B;  1ZZY A;  5AN1 A;  20GS A;  4ECJ A;  4I8B A;  4KSM A;  2DMM A;  3LGC A;  1HNC A;  5D93 A;  3K8N A;  2F9S A;  2VM1 A;  1Z6N A;  4LMV A;  5CRD A;  3U5R E;  3GX0 A;  1EEJ A;  1YJ6 A;  3FRC A;  2NBS A;  1W89 A;  5L71 A;  3VPQ A;  2L6C A;  2E2G A;  3GH9 A;  3GTU A;  1FOH A;  2VD0 A;  4CW9 A;  6GSS A;  1T8E B;  4PUA A;  13GS A;  5IIZ A;  3IAM 2;  2XHF A;  17GS A;  2FY6 A;  4GF0 A;  2R3X A;  4AGS A;  2VL9 A;  1X9W B;  1TRV A;  1FB0 A;  2E2M A;  3KP8 A;  2DKH A;  4DSR A;  5G5F A;  3EU4 A;  3ZL5 A;  3HHV A;  1GUL A;  5ECL B;  3TCO A;  5HFI A;  2GQM A;  1H75 A;  3ZVJ A;  1MD4 A;  1A0F A;  3O3T A;  3APS A;  1WPI A;  4ZL9 A;  5A4U A;  1A8Y A;  1BYE A;  2X8C A;  1FO5 A;  3EC3 A;  3GSS A;  4PXO A;  2DKI A;  1ML6 A;  2B5X A;  4K9Z A;  5B7C A;  3C8E A;  1XWA A;  5IMC A;  3A3T A;  2LQO A;  4EO3 A;  5KN2 A;  5C04 A;  4WBJ A;  3F3Q A;  2H76 A;  2NTO A;  2YNX A;  1XCC A;  2JSZ A;  4EIP A;  3RAZ A;  2X8G A;  5EVO A;  4MJB A;  3LQ7 A;  4KCA A;  2XBI A;  5DJL A;  1HD2 A;  2KP1 A;  5J9B A;  1K0D A;  4G0L A;  3MYD A;  5GZZ B;  4POL A;  1KNG A;  3L4N A;  4KB3 A;  2I81 A;  1X0R A;  2LQQ A;  1ERW A;  5BMU A;  3HVX A;  3G7I A;  3DGQ A;  1BG5 A;  2IMI A;  1A2L A;  1SYR A;  1TKD B;  2CVK A;  3I69 A;  1A2M A;  4LL1 B;  3VI7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...