1R7HA

Nrdh-redoxin of corynebacterium ammoniagenes forms a domain-swapped dimer
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
74
structure length
74
Chain Sequence
MSITLYTKPACVQCTATKKALDRAGLAYNTVDISLDDEARDYVMALGYVQAPVVEVDGEHWSGFRPERIKQLQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NrdH-redoxin
publication title NrdH-redoxin of Corynebacterium ammoniagenes forms a domain-swapped dimer.
pubmed doi rcsb
source organism Corynebacterium ammoniagenes
molecule tags Electron transport
total genus 18
structure length 74
sequence length 74
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00462 Glutaredoxin Glutaredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1r7hA00
3UEMA 2FGXA 5EY6A 5DAKA 1OKTA 3MDKA 4K1FA 1LJRA 1TK8B 3FHKA 1GSSA 1GTUA 2H8LA 1EV4A 1TDIA 2B1LA 1W4VA 5DQYA 4KW6A 2C0FA 4ZB6A 1EGRA 2I3YA 3D0ZA 5ECHB 2O87A 2YP6A 3MAKA 5G30A 1J9BA 1V9WA 2MYGA 3HVXA 2HNLA 2AUVA 2H1DA 6GSXA 5EPFA 2FLSA 1K0OA 4HUAA 3V1WA 4LMWA 2NTOA 4MJEA 2IPAA 1E6BA 1FW1A 2DJ2A 2MZCA 1GLQA 4CW9A 2RUEA 1YDKA 1OYJA 3BCIA 4IW9A 1SL0B 5HFKA 3FR9A 2FHEA 5J9BA 3HDCA 3F4SA 4GSTA 3MSZA 2GGTA 4OD7A 3LFLA 2QC7A 3QAVA 1WE0A 4J56E 1TTZA 3HHVA 2VL3A 4XRAA 2F51A 5ELGA 5ECPB 2ON5A 2E2MA 1PSQA 2H1GA 5CYYA 4TN8A 1SK1A 4OO5A 1FVKA 1XW9A 4MDCA 1TRUA 3C71A 2DBCA 2V1MA 1XW5A 4ZB9A 4MJAA 2R3XA 4TXOB 1XVWA 1PL2A 2HYXA 3HZ4A 5D9VA 1BG5A 4X1UA 20GSA 1T4ZA 1XVQA 3Q19A 4ZILA 3TJGA 2OJLA 1HNCA 4YQUA 4TR1B 2YV9A 2L6DA 4IELA 2K18A 3VK9A 3WT2A 1OKDA 3APOA 1R26A 1VRSD 1SKSB 2B3SA 3D4TA 2HRNA 5HFIA 3UIWA 1HYUA 3F8UA 5DDLA 1OC9A 1VF2A 5ECLB 3QAWA 1PX6A 5ECKB 2YZHA 3ZFBA 2H71A 4WBJA 3DVXA 4MPFA 1BX9A 2FUG2 2GZYA 2B1KA 5D73A 5D8IA 2HFDA 2VLUA 5KN3A 5ECSA 5HR0A 6GSYA 1FAAA 3UOMA 4LLRA 3M3MA 3IXRA 4KNDA 2F8AA 2X99A 4MH2A 3VWWA 2M46A 1DUGA 3L0HA 1IYIA 2LNSA 2H0GA 3UJ1A 1TI1A 2WCIA 1B4QA 5E4WA 3FYGA 2X8CA 1A24A 3GSSA 4KDUA 3E3EA 3VWVA 3IE3A 3GMFA 1Z5YE 4JEDA 5J41A 3IPZA 4O92A 1MD3A 4NHWA 2YN1A 3GRXA 3F0IA 6GSWA 4Q5QA 13GSA 2FWGA 3NIVA 3KJYA 3KMNA 1PKWA 4ZBBA 2TRXA 1O6JA 1PX7A 2YNXA 4RQXA 3CBUA 2H75A 4WEYA 1M99A 3CRUA 5E59A 3CTFA 3HJPA 2KLXA 1ERWA 1UVZA 2RLIA 4IGJA 3LSZA 3I6AA 5H5SA 3DGQA 3KXOA 2C0DA 10GSA 2YWIA 1A8LA 2AJQB 4L0WA 3HJOA 3UARA 2AYTA 5AISA 5HR3A 3H93A 4EO3A 4F0CA 1EWXA 2C1YA 5EVOA 1ZCPA 4TRXA 1QFNA 4NPBA 1EEJA 3FK8A 2X8HA 2LJRA 2P5QA 5AGYA 1TOFA 3GN3A 5G5FA 2ES7A 4OCFA 3HCZA 3EINA 2R4VA 4XIHA 5G31A 2MBTA 5DJLA 2WGRA 4DEJA 3ZMKA 3HXSA 1WP0A 2P5RA 5D9TA 1SD8A 1PA3A 2RUFA 3IHQA 1AUCA 1GRXA 5ID2A 3UBKA 1TU7A 1QK8A 2KHPA 3RBTA 1F3BA 3A2XA 2NBSA 4CDOA 1PGTA 4FYBA 3I9V2 3DWVA 3FZ5A 3W8SA 1FB6A 1YEPA 1G7EA 2O89A 3G7JA 3R2QA 3LG6A 1Z6NA 1JFUA 11GSA 1X5DA 3CMIA 4XS4A 3E0UA 3EU3A 2C8UA 3EMPA 2CT6A 5JWRB 4ZB8A 2DIYA 2LQQA 2JACA 2X64A 1B9YC 1TJDA 1WRYA 4ZBDA 5C00A 3TKSE 5A4VA 2B5YA 2CAQA 3F3QA 1Q4JA 3GNJA 1AW9A 2GSQA 4GRFA 3A5WA 3VURA 2VO4A 1B9XC 1GH2A 5DALB 5IMZA 3IAM2 3C73A 4K7IA 4N11A 1PD21 2CX4A 5CNWA 1ERUA 1O8WA 4XHMA 3VFIA 1X5CA 4TVEA 1HD2A 4I2TA 3QD9A 5B7CA 1BAYA 4RUVA 3UVTA 3GHAA 5DQSA 5IMVA 4L0UA 1NSWA 3KD0A 1WWJA 5IIZA 4OFMA 3EYTA 3HYPA 3MNGA 3F9UA 1A0FA 1F3AA 2DJJA 4JRRA 1ILOA 4X43A 2MMNA 1X9MB 1XWKA 1DBYA 1K3YA 1KEBA 4HI7A 2ZCTA 3VLNA 5H5RA 3KIJA 2C3QA 2JZTA 4XCSA 4EC0A 3BCKA 5KN1A 4LA1A 5JWOB 1EOGA 3NOFA 3UAPA 3P90A 3D6IA 5HQPA 3UMAA 3D5JA 4ZXGA 3EMXA 4MMMA 5D96A 1GP1A 2I4AA 3L78A 3GKKA 1MDIA 4J2FA 2VD1A 1TK5B 2XBIA 5A4WA 1J0FA 2B7JA 3DD3A 4IS0A 4MZBA 4O5RA 5IMCA 2VM2A 2O85A 2JZRA 3L4NA 1QGVA 4NMUA 4PUAA 1JZWA 4KE3A 1XOBA 1B4PA 4EE0A 2LNTA 3IOSA 3ME8A 4XS1A 2XHFA 2H70A 5JWQB 2DMMA 3ZVJD 3RHCA 5J9CA 2IMIA 5G2ZA 5CRWA 12GSA 2C0GA 5CREA 4POMA 3CSHA 5F07A 1GSUA 3M9KA 4NV2A 3WD6A 2GTUA 4TXOA 1PL1A 4BVYA 5G1KA 1A8YA 2A4VA 1T4YA 1AQVA 4XS6A 4G19A 3PH9A 2KOKA 4I6XA 4OFTA 3N9JA 4PUFC 4TR1A 5LCZA 3M9JA 1YJ6A 2WJUA 3Q18A 2VL9A 2GQLA 3G9BA 5B6NA 5KN2A 4PGTA 5F05A 2L4QA 2FD3A 2VCQA 1XPVA 3C1SA 4YH2A 2BMXA 2YWOA 3FZ4A 3ZL5A 1WPIA 3H4KA 5FHIA 4KSMA 3C1RA 3KMOA 2XPEA 2H1BA 4MF7A 2H19A 1SJ6A 4K9ZA 7GSSA 4EF0A 2G0FA 3H79A 3TRXA 5HR1A 3M8NA 1YF0A 5JCWA 6GSTA 2OE1A 2M72A 1GL8A 2YJ7A 2R5GA 4I2UA 2NPBA 4MF6A 2PU9C 3EVIA 2G2QA 1PQNA 4KGIA 1NHYA 3ZREA 4F2IA 4KA0A 5CP1A 1TRWA 2L5OA 3TKPA 1FVJA 1XBSA 1ERVA 2IIYA 3IA1A 1SK0A 3P8WA 3IR4A 4YAPA 3QFBC 4HEA2 4YAVA 1KBNA 1XOAA 4PX1A 2D2ZA 1SU9A 3APSA 5F06A 2PGTA 2J23A 3P7XA 4EKZA 2PVOC 4EDYA 1ML6A 4N10A 1AC1A 3GH9A 2GVPA 1N2AA 4GWRA 4WETA 3A3TA 2CX3A 3ERFA 3GL3A 1TRVA 4HJ2A 4EDZA 1KTEA 22GSA 2ZUPA 5D9WA 3KH9A 4MK3A 5JCUA 5ABRA 1TW9A 9GSSA 4YQMA 2L4CA 3F6DA 2AHEA 3Q6OA 2C4JA 1OC3A 3VWUA 3QFAC 3I43A 4JZQA 2LRCA 1MEKA 1SK2A 5GAND 4HQZA 2PUKC 1ZGNA 2JSYA 5HFGA 3KM6A 4IQAA 2VLTA 4ML1A 3ZYWA 4FYUA 4Z7XA 4NWYA 4AJ7A 4ID0A 3SWLA 4Q5RA 4PQHA 4MA9A 2FA8A 3GURA 2YWNA 1O7UA 1XW6A 4I97A 1SJZA 5B8AA 2GLRA 3OR5A 5FT3A 2O7KA 4V2NA 4DVCA 5B6MA 4D73B 5CRGA 3Q74A 1U88A 1TKDB 4IP6A 3TOTA 2CVDA 2HSHA 1USBA 5ECNB 2VLVA 1O85A 2JL4A 3H1NA 2P0GA 2GS3A 2B5XA 1HNBA 2L6CA 2FWEA 2F9SA 3LGCA 1JZOA 2VL2C 2ZNMA 5IMFA 1K0DA 4HDEA 1TI3A 2FY6A 2PMTA 2HT9A 1SENA 3L9UA 4IBPA 4OMVA 3GYKA 2LRNA 2GSRA 3IK9A 2JZSA 5FWGA 4KCAA 4YQVA 2CVKA 1QXHA 1YQ1A 5ENUA 2I1UA 4MPGA 2IN3A 4MH3A 4L5LA 5A4UA 1PKZA 3BOAA 4GQFA 4QQ7A 3FRCA 4Q5FA 2FWFA 3RDWA 2VIMA 1T3BA 4HZ2A 1V2AA 2QKEA 3DEXA 4OCEA 4TR0A 5DVBA 3TCOA 2IMKA 2ON7A 5IMAA 2F8FA 2XPDA 2F3MA 1QUWA 4AJ6A 2H72A 1Y6EA 2ALBA 2IL3A 2H6YA 2XC2A 4G10A 4HU9A 4POBA 1VF4A 1GNEA 4KSOA 2DMLA 5J3RA 1OC8A 1MTCA 1GTAA 4ACSA 4EVMA 4PQ1A 1ON4A 4IVFA 1JHBA 3ZMLA 3KGKA 2VM1A 4ZL7A 5DALA 3QCPA 2KUCA 1RQMA 2L59A 5KN0A 4WXTA 2C3NA 4ISDA 4G9HA 1F9MA 2H0HA 1YKCA 1PMTA 2KP2A 1Z9HA 4MJCA 2V6KA 4POKA 1X0RA 3K8NA 2FNOA 3U5RE 3GV1A 3WYWA 1M0UA 3ERGA 2CQ9A 4XRDA 4ECJA 2IFQB 1HQOA 4GCIA 3IDVA 1S3AA 2YV7A 2LQOA 4MJBA 3LYPA 1U3IA 4KCEA 1THXA 5CRHA 5F8BA 3DKSA 1XWBA 3WGDA 2QSIA 4L5OA 1LU4A 2YWMA 1F2EA 4PXOA 4LMVA 3G7IA 1T7PB 4DSSB 2HZEB 3F6FA 4PNFA 1H75A 3TKRA 1RW1A 3BJ5A 1SKRB 3GL5A 2BTOT 2DSAA 4GTUA 1SL2B 2EIQA 4JE1A 2REMA 1O73A 3VWXA 1G6WA 2CAIA 1EP8A 3I69A 2H6XA 3TB2A 3BD2A 1UC7A 1V58A 1V98A 2L57A 5ECMB 1IYHA 6GSUA 2GSTA 2VOCA 5C04A 3TKSC 4ML6A 2N5BA 3EU4A 1A2MA 2GDRA 2N5AA 2MBSA 4HOJA 4HQSA 1BJXA 5IPHA 1EOHA 1AQXA 1WMJA 3J7Yb 2A2RA 5LNKe 5GSSA 1R4WA 1OE8A 3QR6A 1DE1A 1XZOA 4N0ZA 1LBKA 3CRTA 3ISOA 2WZ9A 4PNGA 3L9SA 1VGLA 2WB9A 3D4MA 4KDYA 3QDNA 3TOUA 2LEGA 4E8HA 3BBYA 4TW5A 3TGZA 1K0MA 4LL4B 3HJMA 3CTGA 2IWTA 3GTUB 3KEBA 4ULXA 1EGOA 2VL2A 4KB3A 2MMOA 1T1VA 4TKYA 1ZMAA 2YJHA 4KUNA 5ELAA 4KDXA 4BL7A 3EURA 3LQ7A 5IOWA 3GX0A 2IMEA 4V2LA 3UVHA 4O32A 3VPQA 2K8VA 3CXGA 3KZQA 2LV3A 4TR3A 5AIVA 1VF3A 1M9BA 4ECBA 5CAXA 2VAFA 1Z3EA 4KAEA 3GKXA 4IKHA 1RK4A 2V32A 2WRTA 1Q98A 3FEUA 1YF1A 4X0XA 3PINA 4DSRA 3FY7A 4GXZA 2HSYA 1XXUA 5IPGA 3G7YA 2L5LA 5IO0A 1M2BA 2JADA 4NHZA 2RM6A 1XWGA 2FA4A 2K9FA 3ZFLA 5DJMA 3HKRA 2HI7A 4AGSA 3M0FA 3ZLPA 2E7PA 3HVVA 1A2LA 3KP8A 2CA8A 1UN2A 2CZ3A 1O8XA 2GT6A 2X8GA 5A5KA 3TJFA 3KCMA 4ZL9A 3MWHA 2OE0A 4KX4A 3O3TA 4V2MA 5KEJA 2VCTA 3ZITA 1CQHA 2NDOA 4IP1A 4N0VA 3P2AA 2OA7A 1M2DA 2AV4A 4GSNA 4QL9A 2TIRA 1ACVA 2H76A 3QPMA 2E0QA 3GA4A 3NZNA 5GSTA 2GSSA 2H66A 4HS1A 5INYA 4HJMA 3W6GA 2DLXA 1AXDA 4ECIA 1GSYA 2LTKA 3VPTA 4HZ4A 1WOUA 2R37A 2LSTA 1ABAA 3HA9A 3RAZA 2H0IA 3F4RA 2P31A 3HD5A 1FB0A 1SYXA 4KH7A 1GULA 4ZIJA 2LUSA 2A2SA 3DMLA 4HU7A 2YZUA 3ZTLA 2BJXA 1MDKA 2GZPA 3W8JA 1W89A 3CYNA 17GSA 2V41A 3LORA 3RHBA 2YANA 6GSVA 3ME7A 3F3RA 5G5EA 2MMZA 1EV9A 4IN0A 2IMFA 3IK7A 2V2GA 3LEFA 1K0NA 2PN8A 3EC3A 2FCHA 3GX8A 4EL1A 4MZWA 5DCGA 3F4TA 3TKSA 3J7Yk 2PPTA 3C7MA 2VCWA 1Z7PA 4RI7A 1JLWA 2VCXA 1EEMA 2PBJA 5GZZB 2LKUA 3LXTA 3QMXA 1OVNA 2CVBA 3C8EA 4JU5A 1G0TA 1I9DA 3H8QA 4ILFA 2WS2A 4PQIA 3IBHA 4D73A 3U6VA 1GNWA 5DAKB 2PVQA 1R5PA 3KP9A 4FYCA 4XTSA 1CQGA 4NV5A 3HZ8A 4NAXA 1F6MC 4FO5A 3GKMA 1GLPA 3VI5A 1TXXA 1U3AA 4O7HA 3S9FA 4JR4A 8GSSA 4BA7A 4H86A 3L9VA 16GSA 2OACA 2CV4A 2AAWA 1YY7A 1XWCA 3GFKA 1K0BA 4NXIA 1T00A 5H5QA 1X9SB 4IHUA 2QGVA 3KTLA 5B8BA 5AIXA 2YCDA 1Z6MA 3TJKA 3EE2A 2LJKA 2H1AA 3AY8A 3M1GA 1G6YA 1C72A 1ERTA 4RQRA 3VI7A 2H01A 4F0BA 4TOPA 5IMDA 4GQCA 1J08A 2I81A 3RPPA 2HE3A 1OE7A 1THOA 2OKAA 4MF5A 2C0EA 1XFLA 4MABA 1A2JA 4FIWA 4FH8A 2H30A 4V1Ag 4TXVA 2WULA 1KNGA 2DIZA 3FR3A 1AAZA 4GSSA 3A2WA 2R6KA 4GF0A 1SD9A 2WFCA 2VCVA 1SYRA 5LD0A 4ZBAA 4TR4A 1AQWA 5J5NA 4WKWA 1FG4A 1TK0B 3ED3A 2OBKA 2GZZA 3LJRA 2B5EA 1R5AA 3TJJA 4OFNA 4J57E 3ZZXA 1B8XA 3GUSA 1DE2A 1WJKA 2CZ2A 2TRCP 2IFQA 2JSZA 3LYKA 2Z9SA 4RI6A 1QQ2A 4PURA 4MLYA 3O76A 3D21A 2C80A 1GUHA 3PR8A 4K7OA 3APQA 1SJIA 3WT1A 4CHSA 1OC9B 4OWYA 1G7OA 3N5OA 4DSSA 1YKAA 2VCZA 2HZEA 3TRPA 3QAGA 2AB6A 2R2JA 1JLVA 1URMA 3ZRDA 1ZZYA 3FR6A 5AN1A 2C3TA 4DSQA 1ZOFA 3DVWA 3SBCA 3GIXA 1GSDA 5J4UA 1R7HA 1H4OA 4K0GA 3LWAA 2DJKA 4LL1B 1AIUA 5IM9A 1XCCA 6GSSA 4L8EA 2KP1A 2M80A 2OE3A 1TU8A 2H74A 1O81A 4Q5NA 3FW2A 3WGEA 2MMAA 5CO3A 1MDJA 3TJBA 2HLSA 2J9HA 3GKNA 2FWHA 3E9JB 1PN9A 4I8BA 1K0CA 2PERA 4K0NA 4WR5A 2NVLA 1A0RP 1K3OA 3HY2A 1V57A 2VUPA 1Y25A 3KH7A 4BWSA 1ST9A 1F37A 3UL3A 4F82A 4E8EA 2LS5A 1GUKA 1A23A 4MCUA 5DBQA 4WF5A 4JR6A 2H73A 5CRDA 1BQ7A 4AF2A 1FOVA 1FO5A 3TRQA 2XBQA 1U87A 18GSA 1NW2A 2DJ1A 3F63A 1N8JA 1U6TA 3EWLA 2HRFA 2K8SA 2GT5A 3IRAA 3GTUA 1X5EA 2B6MA 4AJ8A 2OADA 3IC4A 1WIKA 2HXKA 2O8VB 4ZL8A 1ZL9A 4BPYA 19GSA 5D9XA 3GSTA 4K7NA 3TDGA 4OO4A 1SKWB 2K6VA 5ECRB 4BVXA 2JU5A 1OAZA 1VF1A 3ZIVA 5GAPD 5DCHA 1GSQA 5COHA 2I9HA 3DRNA 3DYRA 5L71A 1XIYA 4WBRD 2DJ0A 1M9AA 2V6OA 2H6ZA 2N5FA 1MD4A 4F03A 3US3A 2RM5A 4GLTA 4EXJA 1M2AA 3HVSA 1NM3A 3A2VA 1K0AA 2IMDA 5ECIB 4IJ3A 4BWQA 3JCML 3DIEA 3CSIA 4ECCA 1T8EB 1X9WB 3DXBA 2E2GA 3O6TA 1S3DA 1GTIA 3TUEA 1V40A 1K3LA 1I5GA 5ID2B 4WR4A 3CSJA 1M7TA 2HZFA 1TP9A 5ECQB 1JZRA 3RPNA 4IQ1A 4WF4A 3ZIJA 4K2DA 3GH6A 4K8MA 1BEDA 5G1LA 2VD0A 1TRSA 4QL7A 3IAS2 1DSBA 5HR2A 4G2EA 5IQYA 2GQKA 3KTBA 1GUMA 1FHEA 1NHOA 3ERWA 4MP4A 4P3YB 14GSA 2GQMA 4XS4B 1S3CA 4V1Ap 1YEXA 1ZYQB 4F9ZA 4IJIA 3LXZA 1PRXA 5ECOB 1ZYEA 1GSEA 2EC4A 3FZ9A 5JCGA 2PWJA 1JZDA 1YZXA 5F0GA 2YPMA 5IOXA 2WDUA 2YOIA 2EIOA 3PGTA 3D22A 3TKQA 1E2YA 3QOUA 4MZCA 4JBBA 3ZVJA 1BYEA 1QMVA 3WGXA 4POLA 1UA5A 3FKFA 2RIIA 4EUYA 2IJYA 1XWAA 3UBLA 5EL8A 1SL1B 1GTBA 4K6XA 1HNAA 2EIRA 1GWCA 3FZAA 2DJ3A 2LJAA 2LRTA 1EP7A 2B7KA 5IO2A 1EZKA 1GSFA 1B48A 2DC5A 5D93A 2OBIA 1Z7RA 4I5QA 4N30A 3IV4A
chains in the Genus database with same CATH superfamily
3UEMA 2FGXA 5EY6A 5DAKA 1OKTA 3MDKA 4K1FA 1LJRA 1TK8B 3FHKA 1GSSA 1GTUA 2H8LA 1EV4A 1TDIA 2B1LA 1W4VA 5DQYA 4KW6A 2C0FA 4ZB6A 1EGRA 2I3YA 3D0ZA 5ECHB 2HRAA 2O87A 2YP6A 3MAKA 5G30A 1J9BA 1V9WA 2MYGA 3HVXA 2HNLA 2AUVA 2H1DA 6GSXA 5EPFA 2FLSA 1K0OA 4HUAA 3V1WA 4LMWA 2NTOA 4MJEA 2IPAA 1E6BA 1FW1A 2DJ2A 2MZCA 1GLQA 4HSCX 4CW9A 2RUEA 1YDKA 1OYJA 3BCIA 4IW9A 1SL0B 5HFKA 3FR9A 2FHEA 5J9BA 3HDCA 3F4SA 4GSTA 3MSZA 2GGTA 4OD7A 3LFLA 2QC7A 3QAVA 1WE0A 4J56E 1TTZA 3HHVA 2VL3A 4XRAA 2F51A 5ELGA 5ECPB 2ON5A 2E2MA 1PSQA 2H1GA 5CYYA 4TN8A 1SK1A 4OO5A 1FVKA 1XW9A 4MDCA 1TRUA 3C71A 2DBCA 2V1MA 1XW5A 4ZB9A 4MJAA 2R3XA 4TXOB 1XVWA 1PL2A 2HYXA 3HZ4A 5D9VA 4CY8A 4BVYB 1BG5A 4X1UA 20GSA 1T4ZA 4MNNA 1XVQA 3Q19A 4ZILA 3TJGA 2OJLA 1HNCA 4YQUA 4TR1B 2YV9A 4X4JA 2L6DA 4IELA 2K18A 3VK9A 3WT2A 1OKDA 3APOA 1R26A 1VRSD 1SKSB 2B3SA 3D4TA 2HRNA 5HFIA 3UIWA 1HYUA 3F8UA 5DDLA 1OC9A 1VF2A 3LW9A 5ECLB 3QAWA 4YKFA 1PX6A 5ECKB 2YZHA 3ZFBA 2H71A 4WBJA 3DVXA 4MPFA 1BX9A 2FUG2 2GZYA 2B1KA 5D73A 5D8IA 2HFDA 2VLUA 5KN3A 5ECSA 5HR0A 6GSYA 1FAAA 3UOMA 4LLRA 3M3MA 3IXRA 4KNDA 2F8AA 2X99A 4MH2A 4A5PA 3VWWA 2M46A 1DUGA 3L0HA 1IYIA 2LNSA 2H0GA 3UJ1A 1TI1A 2WCIA 1B4QA 5E4WA 3FYGA 2X8CA 1A24A 3GSSA 4KDUA 3E3EA 3VWVA 3IE3A 3GMFA 1Z5YE 4JEDA 5J41A 3IPZA 4O92A 1MD3A 4NHWA 2YN1A 3GRXA 3F0IA 6GSWA 4Q5QA 13GSA 2FWGA 3NIVA 3KJYA 3KMNA 1PKWA 4ZBBA 2TRXA 1O6JA 1PX7A 2YNXA 4RQXA 3CBUA 2H75A 4WEYA 1M99A 3CRUA 5E59A 3CTFA 3HJPA 2KLXA 1ERWA 2X49A 1UVZA 2RLIA 4IGJA 3LSZA 3I6AA 5H5SA 3DGQA 3KXOA 2C0DA 10GSA 2YWIA 1A8LA 2AJQB 4L0WA 3HJOA 3R3EA 3UARA 2AYTA 5AISA 5HR3A 3H93A 4EO3A 4F0CA 1EWXA 2C1YA 5EVOA 1ZCPA 4TRXA 1QFNA 4NPBA 1EEJA 3FK8A 2X8HA 5KOWA 2LJRA 2P5QA 5AGYA 1TOFA 3GN3A 5G5FA 2ES7A 4OCFA 3HCZA 3EINA 2R4VA 4XIHA 5G31A 2MBTA 5DJLA 2WGRA 4DEJA 3ZMKA 3HXSA 1WP0A 2P5RA 5D9TA 1PFOA 1SD8A 1PA3A 2RUFA 3IHQA 1AUCA 1GRXA 5ID2A 3UBKA 1TU7A 1QK8A 2KHPA 3RBTA 1F3BA 3A2XA 2NBSA 4CDOA 1PGTA 4FYBA 3I9V2 3DWVA 3FZ5A 3W8SA 1FB6A 1YEPA 1G7EA 2O89A 3G7JA 3R2QA 3LG6A 1Z6NA 1JFUA 11GSA 1X5DA 3CMIA 4XS4A 3E0UA 3EU3A 2C8UA 3EMPA 2CT6A 5JWRB 4ZB8A 2DIYA 2LQQA 2JACA 2X64A 1B9YC 1TJDA 1WRYA 4ZBDA 5C00A 3TKSE 5A4VA 2B5YA 2CAQA 3F3QA 1Q4JA 3GNJA 1AW9A 2GSQA 4GRFA 3A5WA 3VURA 2VO4A 1B9XC 1GH2A 5DALB 5IMZA 3IAM2 3C73A 4K7IA 4N11A 1PD21 2CX4A 5CNWA 1ERUA 1O8WA 4XHMA 3VFIA 1X5CA 4TVEA 1HD2A 4I2TA 3QD9A 5B7CA 1BAYA 4RUVA 3UVTA 3GHAA 3FMWA 5DQSA 5IMVA 4L0UA 1NSWA 3KD0A 1WWJA 5IIZA 4OFMA 3EYTA 3HYPA 3MNGA 3F9UA 1A0FA 1F3AA 2DJJA 4JRRA 1ILOA 4X43A 2MMNA 1X9MB 1XWKA 1DBYA 1K3YA 1KEBA 4HI7A 2A2PA 2ZCTA 3VLNA 5H5RA 3KIJA 2C3QA 2JZTA 4XCSA 4EC0A 3BCKA 5KN1A 4LA1A 5JWOB 1EOGA 3NOFA 3UAPA 3P90A 3D6IA 5HQPA 3UMAA 3D5JA 4ZXGA 3EMXA 4MMMA 5D96A 1GP1A 2I4AA 3L78A 3GKKA 1MDIA 4J2FA 2VD1A 1TK5B 2XBIA 5A4WA 1J0FA 2B7JA 3DD3A 4IS0A 4MZBA 4O5RA 5IMCA 2VM2A 2O85A 2JZRA 3L4NA 1QGVA 4NMUA 4PUAA 1JZWA 4KE3A 1XOBA 1B4PA 4EE0A 2LNTA 3IOSA 3ME8A 4XS1A 2XHFA 2H70A 5JWQB 2DMMA 3ZVJD 3RHCA 5J9CA 2IMIA 5G2ZA 5CRWA 12GSA 2C0GA 5CREA 4POMA 3CSHA 5F07A 1GSUA 3M9KA 4NV2A 3WD6A 2GTUA 4TXOA 4BL7B 1PL1A 4BVYA 5G1KA 1A8YA 2A4VA 4EIPA 1T4YA 1AQVA 4XS6A 4G19A 3PH9A 2KOKA 4I6XA 4OFTA 3N9JA 4PUFC 4TR1A 5LCZA 3M9JA 1YJ6A 2WJUA 3Q18A 2VL9A 2GQLA 3G9BA 4Z2UA 5B6NA 5KN2A 4PGTA 5F05A 2L4QA 2FD3A 2VCQA 1XPVA 3C1SA 4YH2A 2BMXA 2YWOA 3FZ4A 3ZL5A 1WPIA 3H4KA 5FHIA 4KSMA 3C1RA 3KMOA 2XPEA 2H1BA 4MF7A 2H19A 1SJ6A 4K9ZA 7GSSA 4EF0A 4O5QA 2G0FA 3H79A 3TRXA 5HR1A 3M8NA 1YF0A 5JCWA 6GSTA 1FOHA 2OE1A 2M72A 1GL8A 2YJ7A 2R5GA 4I2UA 2NPBA 4MF6A 2PU9C 3EVIA 2G2QA 1PQNA 4KGIA 1NHYA 3ZREA 4F2IA 4KA0A 5CP1A 1TRWA 2L5OA 3TKPA 1FVJA 1XBSA 1ERVA 2IIYA 3IA1A 1SK0A 3P8WA 3IR4A 4YAPA 3QFBC 4HEA2 4YAVA 1KBNA 1XOAA 4PX1A 2D2ZA 1SU9A 3APSA 5F06A 2PGTA 2J23A 3P7XA 4EKZA 2PVOC 4EDYA 1ML6A 4N10A 1AC1A 3GH9A 2GVPA 4G0KA 1N2AA 4GWRA 4WETA 3A3TA 2CX3A 3ERFA 3GL3A 1TRVA 4HJ2A 4EDZA 1KTEA 22GSA 2ZUPA 5D9WA 3KH9A 4MK3A 5JCUA 2QA1A 5ABRA 1TW9A 9GSSA 4YQMA 2L4CA 3F6DA 2AHEA 3Q6OA 2C4JA 1OC3A 3VWUA 3QFAC 3I43A 4JZQA 2LRCA 1MEKA 1SK2A 5GAND 4HQZA 2PUKC 1ZGNA 2JSYA 5HFGA 3KM6A 4IQAA 2VLTA 4ML1A 3ZYWA 4FYUA 4Z7XA 4NWYA 4AJ7A 4ID0A 4YKGA 3SWLA 4Q5RA 4PQHA 4MA9A 2FA8A 3GURA 2YWNA 1O7UA 1XW6A 4I97A 1SJZA 5B8AA 2GLRA 3OR5A 4G0IA 5FT3A 2O7KA 4V2NA 4DVCA 5B6MA 4D73B 5CRGA 3Q74A 1U88A 1TKDB 4IP6A 3TOTA 2CVDA 2HSHA 1USBA 5ECNB 2VLVA 1O85A 2JL4A 3H1NA 2P0GA 2GS3A 2B5XA 1HNBA 2L6CA 2FWEA 2F9SA 3LGCA 1JZOA 2VL2C 2ZNMA 5IMFA 1K0DA 4HDEA 1TI3A 2FY6A 2PMTA 2HT9A 1SENA 3L9UA 4IBPA 4OMVA 3GYKA 4CY6A 2LRNA 4ICYA 2GSRA 3IK9A 2JZSA 1S3RA 5FWGA 4KCAA 4YQVA 2CVKA 1QXHA 1YQ1A 5ENUA 2I1UA 4MPGA 2IN3A 4MH3A 4L5LA 5A4UA 1PKZA 3BOAA 4GQFA 4QQ7A 3FRCA 4Q5FA 2FWFA 3RDWA 2VIMA 1T3BA 4HZ2A 1V2AA 2QKEA 3DEXA 4OCEA 4TR0A 5DVBA 3TCOA 2IMKA 2ON7A 5IMAA 2F8FA 2XPDA 2F3MA 1QUWA 4AJ6A 2H72A 1Y6EA 2ALBA 2IL3A 2H6YA 2XC2A 4G10A 2HRKA 4HU9A 4POBA 1VF4A 1GNEA 4KSOA 2DMLA 5J3RA 1OC8A 1MTCA 1GTAA 4ACSA 4EVMA 4PQ1A 1ON4A 4IVFA 1JHBA 3ZMLA 3KGKA 2VM1A 4ZL7A 5DALA 3QCPA 2KUCA 1RQMA 2L59A 5KN0A 4WXTA 2C3NA 4ISDA 4G9HA 1F9MA 2H0HA 1YKCA 2R0PA 1PMTA 2KP2A 1Z9HA 4MJCA 2V6KA 4POKA 1X0RA 3K8NA 2FNOA 3U5RE 3GV1A 3WYWA 1M0UA 3ERGA 2CQ9A 4XRDA 4ECJA 2IFQB 1HQOA 4GCIA 3IDVA 1S3AA 2YV7A 2LQOA 4MJBA 3LYPA 1U3IA 4KCEA 4PTSA 1THXA 5CRHA 5F8BA 3DKSA 1XWBA 3WGDA 4Z2TA 2QSIA 4L5OA 1LU4A 2A4HA 2YWMA 1F2EA 4PXOA 4LMVA 3G7IA 1T7PB 4DSSB 2HZEB 3F6FA 4PNFA 1H75A 1PN0A 3TKRA 1RW1A 3BJ5A 1SKRB 3GL5A 2BTOT 2DSAA 2X4AA 4GTUA 1SL2B 1ZYPA 2EIQA 4JE1A 2REMA 1O73A 3VWXA 1G6WA 2CAIA 1EP8A 3I69A 2H6XA 3TB2A 3BD2A 1UC7A 1V58A 1V98A 2L57A 5ECMB 1IYHA 6GSUA 3PPUA 2GSTA 2VOCA 5C04A 3TKSC 4ML6A 2N5BA 3EU4A 1A2MA 2GDRA 2N5AA 2MBSA 4HOJA 4HQSA 1BJXA 5IPHA 1EOHA 1AQXA 1WMJA 3J7Yb 2R0CA 2A2RA 5LNKe 5GSSA 1R4WA 1OE8A 3QR6A 1DE1A 1XZOA 4N0ZA 1LBKA 3CRTA 3ISOA 2WZ9A 4PNGA 3L9SA 1VGLA 2WB9A 3D4MA 4KDYA 3QDNA 3HVNA 4FQUA 3TOUA 2LEGA 4E8HA 3BBYA 4TW5A 3TGZA 1K0MA 4LL4B 3HJMA 3CTGA 2IWTA 3GTUB 3KEBA 4ULXA 1EGOA 2VL2A 4KB3A 2MMOA 1T1VA 4TKYA 1ZMAA 2YJHA 4KUNA 5ELAA 4KDXA 4BL7A 3EURA 3LQ7A 5IOWA 3GX0A 2IMEA 4V2LA 3UVHA 4BVXB 4O32A 3VPQA 2K8VA 3CXGA 3KZQA 2LV3A 4TR3A 5AIVA 1VF3A 1M9BA 4ECBA 5CAXA 2VAFA 1Z3EA 4KAEA 3GKXA 4IKHA 1RK4A 2V32A 2WRTA 1Q98A 3FEUA 1YF1A 4X0XA 3PINA 4DSRA 3FY7A 4GXZA 2HSYA 1XXUA 5IPGA 3G7YA 2L5LA 5IO0A 1M2BA 2JADA 4NHZA 2RM6A 1XWGA 2FA4A 2K9FA 3ZFLA 5DJMA 3HKRA 2HI7A 4AGSA 3M0FA 3ZLPA 2E7PA 3HVVA 1A2LA 3KP8A 2CA8A 1UN2A 2CZ3A 1O8XA 2GT6A 2X8GA 5A5KA 3TJFA 3KCMA 4ZL9A 3MWHA 2OE0A 4KX4A 3O3TA 4V2MA 5KEJA 2VCTA 3ZITA 1CQHA 2NDOA 4IP1A 4N0VA 3P2AA 2OA7A 1M2DA 2AV4A 4GSNA 4QL9A 2TIRA 1ACVA 2H76A 3QPMA 2E0QA 3GA4A 3NZNA 3EPTA 5GSTA 2GSSA 2H66A 4HS1A 5INYA 4KF9A 4HJMA 3W6GA 2DLXA 3A5IA 1AXDA 4ECIA 1GSYA 2LTKA 3VPTA 4HZ4A 1WOUA 2R37A 2LSTA 1ABAA 3HA9A 3RAZA 2H0IA 3F4RA 2P31A 3HD5A 1FB0A 1SYXA 4KH7A 1GULA 4ZIJA 2LUSA 2A2SA 3DMLA 4HU7A 2YZUA 3ZTLA 2BJXA 1MDKA 2GZPA 3W8JA 1W89A 3CYNA 17GSA 2V41A 3LORA 3RHBA 2YANA 5BMUA 6GSVA 4G0LA 3ME7A 3F3RA 5G5EA 2MMZA 1EV9A 4IN0A 2IMFA 3IK7A 2V2GA 3LEFA 1K0NA 2PN8A 3EC3A 4O5UA 2FCHA 3GX8A 4EL1A 4MZWA 5DCGA 3F4TA 3TKSA 3J7Yk 2PPTA 3C7MA 2VCWA 1Z7PA 4RI7A 1JLWA 2VCXA 1EEMA 2PBJA 5GZZB 2LKUA 3LXTA 1ZYNA 3QMXA 1OVNA 2CVBA 3C8EA 4JU5A 1G0TA 1I9DA 3H8QA 4ILFA 2WS2A 4PQIA 3IBHA 4D73A 3U6VA 1GNWA 5DAKB 2PVQA 1R5PA 3KP9A 4FYCA 4XTSA 1CQGA 4NV5A 2R0GA 3HZ8A 4NAXA 1F6MC 4FO5A 3GKMA 1GLPA 3VI5A 1TXXA 1U3AA 2QA2A 4O7HA 3S9FA 4JR4A 8GSSA 4BA7A 4H86A 3L9VA 16GSA 2OACA 2CV4A 2AAWA 1YY7A 1XWCA 3GFKA 1K0BA 4NXIA 1T00A 5H5QA 1X9SB 4IHUA 2QGVA 3KTLA 5B8BA 5AIXA 2YCDA 1Z6MA 3TJKA 3EE2A 2LJKA 2H1AA 3AY8A 3M1GA 1G6YA 4BIKA 1C72A 1ERTA 4RQRA 3VI7A 2H01A 4F0BA 2UZ8A 4TOPA 5IMDA 4GQCA 1J08A 2I81A 3RPPA 2HE3A 1OE7A 1THOA 2OKAA 4MF5A 2C0EA 1XFLA 4MABA 1A2JA 4FIWA 2DKHA 4FH8A 2H30A 4V1Ag 4TXVA 2WULA 1KNGA 2DIZA 3FR3A 1AAZA 4GSSA 3A2WA 2R6KA 4GF0A 1SD9A 2WFCA 2VCVA 1SYRA 5LD0A 4ZBAA 4TR4A 1AQWA 5J5NA 4WKWA 1FG4A 1TK0B 3ED3A 2OBKA 3IC8A 2GZZA 3LJRA 2B5EA 1R5AA 3TJJA 4OFNA 4J57E 3ZZXA 1B8XA 3GUSA 1DE2A 1WJKA 2CZ2A 2TRCP 2IFQA 2JSZA 1M3JA 3LYKA 2Z9SA 4RI6A 1QQ2A 4PURA 4MLYA 3O76A 3D21A 2HSMA 2C80A 1GUHA 3PR8A 4K7OA 3APQA 1SJIA 3WT1A 4CHSA 1OC9B 4OWYA 1G7OA 3N5OA 4DSSA 1YKAA 2VCZA 2HZEA 3TRPA 3QAGA 2AB6A 2R2JA 1JLVA 1URMA 3ZRDA 1ZZYA 3FR6A 5AN1A 2C3TA 4DSQA 1ZOFA 3DVWA 3SBCA 3GIXA 1GSDA 5J4UA 1R7HA 1H4OA 4K0GA 3MIXA 3LWAA 2DJKA 4LL1B 1AIUA 5IM9A 1XCCA 3MYDA 6GSSA 4L8EA 2KP1A 4Z2RA 2M80A 2OE3A 1TU8A 2H74A 1O81A 4Q5NA 3FW2A 3WGEA 2MMAA 5CO3A 1MDJA 3TJBA 2HLSA 2J9HA 3GKNA 4EIQA 2FWHA 3E9JB 5KOXA 1PN9A 4I8BA 1K0CA 2PERA 4K0NA 4WR5A 2NVLA 1A0RP 1K3OA 3HY2A 1V57A 2VUPA 1Y25A 3KH7A 4BWSA 1ST9A 1F37A 3UL3A 4F82A 4E8EA 2LS5A 1GUKA 1A23A 4MCUA 5DBQA 4WF5A 4JR6A 2H73A 5CRDA 1BQ7A 4AF2A 1FOVA 1FO5A 3TRQA 2XBQA 1U87A 18GSA 1NW2A 2DJ1A 3F63A 1N8JA 2DKIA 1U6TA 3EWLA 2HRFA 2K8SA 2GT5A 3IRAA 3GTUA 1X5EA 2B6MA 4AJ8A 2OADA 3IC4A 1WIKA 2HXKA 2O8VB 4ZL8A 1ZL9A 4BPYA 19GSA 3CQFA 5D9XA 3GSTA 4K7NA 3TDGA 4OO4A 1SKWB 2K6VA 5ECRB 4BVXA 2JU5A 1OAZA 1VF1A 3ZIVA 5GAPD 5DCHA 1GSQA 5COHA 2I9HA 3DRNA 3DYRA 5L71A 1XIYA 4WBRD 2DJ0A 1M9AA 2V6OA 2H6ZA 2N5FA 1MD4A 4F03A 3US3A 2RM5A 4GLTA 4EXJA 1M2AA 3IHGA 3HVSA 1NM3A 3A2VA 1K0AA 2IMDA 5ECIB 4IJ3A 4BWQA 3JCML 3DIEA 3CSIA 4ECCA 1T8EB 1X9WB 3DXBA 2E2GA 3O6TA 1S3DA 1GTIA 3TUEA 1V40A 1K3LA 1I5GA 5ID2B 4WR4A 3CSJA 1M7TA 2HZFA 1TP9A 5ECQB 1JZRA 1XG8A 3RPNA 4IQ1A 4WF4A 3ZIJA 4K2DA 3GH6A 4K8MA 1BEDA 5G1LA 2VD0A 1TRSA 4QL7A 3IAS2 1DSBA 4K2XA 5HR2A 4G2EA 4USSA 5IQYA 2GQKA 3KTBA 1GUMA 1FHEA 1M3IA 1NHOA 3ERWA 4MP4A 4P3YB 14GSA 2GQMA 4XS4B 1S3CA 4V1Ap 1YEXA 1ZYQB 4K5SA 4F9ZA 4IJIA 3LXZA 1PRXA 4K5RA 5ECOB 1ZYEA 1GSEA 2EC4A 3FZ9A 5JCGA 2PWJA 1JZDA 1YZXA 5F0GA 2YPMA 5IOXA 2WDUA 2YOIA 2EIOA 3PGTA 3D22A 3TKQA 1E2YA 3QOUA 4MZCA 4JBBA 3ZVJA 1BYEA 1QMVA 5BRTA 3WGXA 4POLA 1UA5A 3FKFA 2RIIA 4EUYA 2IJYA 1XWAA 3UBLA 5EL8A 1SL1B 1GTBA 4K6XA 1HNAA 2EIRA 1GWCA 3FZAA 2DJ3A 2LJAA 2LRTA 1EP7A 2B7KA 5IO2A 1EZKA 1GSFA 1B48A 2DC5A 5D93A 2OBIA 1Z7RA 4I5QA 4N30A 3IV4A
chains in the Genus database with same CATH topology
3UEMA 2FGXA 5EY6A 5DAKA 1OKTA 3MDKA 4K1FA 1LJRA 1TK8B 3FHKA 1GSSA 1GTUA 2H8LA 1EV4A 1TDIA 2B1LA 1W4VA 5DQYA 4KW6A 2C0FA 4ZB6A 1EGRA 2I3YA 3D0ZA 5ECHB 2HRAA 2O87A 2YP6A 3MAKA 5G30A 1J9BA 1V9WA 2MYGA 3HVXA 2HNLA 2AUVA 2H1DA 6GSXA 5EPFA 2FLSA 1K0OA 4HUAA 3V1WA 4LMWA 2NTOA 4MJEA 2IPAA 1E6BA 1FW1A 2DJ2A 2MZCA 1GLQA 4CW9A 2RUEA 1YDKA 1OYJA 3BCIA 4IW9A 1SL0B 5HFKA 3FR9A 2FHEA 5J9BA 3HDCA 3F4SA 4GSTA 3MSZA 2GGTA 4OD7A 3LFLA 2QC7A 3QAVA 1WE0A 4J56E 1TTZA 3HHVA 2VL3A 4XRAA 2F51A 5ELGA 5ECPB 2ON5A 2E2MA 1PSQA 2H1GA 5CYYA 4TN8A 1SK1A 4OO5A 1FVKA 1XW9A 4MDCA 1TRUA 3C71A 2DBCA 2V1MA 1XW5A 4ZB9A 4MJAA 2R3XA 4TXOB 1XVWA 1PL2A 2HYXA 3HZ4A 5D9VA 4CY8A 4BVYB 1BG5A 4X1UA 20GSA 1T4ZA 4MNNA 1XVQA 3Q19A 4ZILA 3TJGA 2OJLA 1HNCA 4YQUA 4TR1B 2YV9A 4X4JA 2L6DA 4IELA 2K18A 3VK9A 3WT2A 1OKDA 3APOA 1R26A 1VRSD 1SKSB 2B3SA 3D4TA 2HRNA 5HFIA 3UIWA 1HYUA 3F8UA 5DDLA 1OC9A 1VF2A 3LW9A 5ECLB 3QAWA 4YKFA 1PX6A 5ECKB 2YZHA 3ZFBA 2H71A 4WBJA 3DVXA 4MPFA 1BX9A 2FUG2 2GZYA 2B1KA 5D73A 5D8IA 2HFDA 2VLUA 5KN3A 5ECSA 5HR0A 6GSYA 1FAAA 3UOMA 4LLRA 3M3MA 3IXRA 4KNDA 2F8AA 2X99A 4MH2A 4A5PA 3VWWA 2M46A 1DUGA 3L0HA 1IYIA 2LNSA 2H0GA 3UJ1A 1TI1A 2WCIA 1B4QA 5E4WA 3FYGA 2X8CA 1A24A 3GSSA 4KDUA 3E3EA 3VWVA 3IE3A 3GMFA 1Z5YE 4JEDA 5J41A 3IPZA 4O92A 1MD3A 4NHWA 2YN1A 3GRXA 3F0IA 6GSWA 4Q5QA 13GSA 2FWGA 3NIVA 3KJYA 3KMNA 1PKWA 4ZBBA 2TRXA 1O6JA 1PX7A 2YNXA 4RQXA 3CBUA 2H75A 4WEYA 1M99A 3CRUA 5E59A 3CTFA 3HJPA 2KLXA 1ERWA 2X49A 1UVZA 2RLIA 4IGJA 3LSZA 3I6AA 5H5SA 3DGQA 3KXOA 2C0DA 10GSA 2YWIA 1A8LA 2AJQB 4L0WA 3HJOA 3R3EA 3UARA 2AYTA 5AISA 5HR3A 3H93A 4EO3A 4F0CA 1EWXA 2C1YA 5EVOA 1ZCPA 4TRXA 1QFNA 4NPBA 1EEJA 3FK8A 2X8HA 5KOWA 2LJRA 2P5QA 5AGYA 1TOFA 3GN3A 5G5FA 2ES7A 4OCFA 3HCZA 3EINA 2R4VA 4XIHA 5G31A 2MBTA 5DJLA 2WGRA 4DEJA 3ZMKA 3HXSA 1WP0A 2P5RA 5D9TA 1SD8A 1PA3A 2RUFA 3IHQA 1AUCA 1GRXA 5ID2A 3UBKA 1TU7A 1QK8A 2KHPA 3RBTA 1F3BA 3A2XA 2NBSA 4CDOA 1PGTA 4FYBA 3I9V2 3DWVA 3FZ5A 3W8SA 1FB6A 1YEPA 1G7EA 2O89A 3G7JA 3R2QA 3LG6A 1Z6NA 1JFUA 11GSA 1X5DA 3CMIA 4XS4A 3E0UA 3EU3A 2C8UA 3EMPA 2CT6A 5JWRB 4ZB8A 2DIYA 2LQQA 2JACA 2X64A 1B9YC 1TJDA 1WRYA 4ZBDA 5C00A 3TKSE 5A4VA 2B5YA 2CAQA 3F3QA 1Q4JA 3GNJA 1AW9A 2GSQA 4GRFA 3A5WA 3VURA 2VO4A 1B9XC 1GH2A 5DALB 5IMZA 3IAM2 3C73A 4K7IA 4N11A 1PD21 2CX4A 5CNWA 1ERUA 1O8WA 4XHMA 3VFIA 1X5CA 4TVEA 1HD2A 4I2TA 3QD9A 5B7CA 1BAYA 4RUVA 3UVTA 3GHAA 3FMWA 5DQSA 5IMVA 4L0UA 1NSWA 3KD0A 1WWJA 5IIZA 4OFMA 3EYTA 3HYPA 3MNGA 3F9UA 1A0FA 1F3AA 2DJJA 4JRRA 1ILOA 4X43A 2MMNA 1X9MB 1XWKA 1DBYA 1K3YA 1KEBA 4HI7A 2A2PA 2ZCTA 3VLNA 5H5RA 3KIJA 2C3QA 2JZTA 4XCSA 4EC0A 3BCKA 5KN1A 4LA1A 5JWOB 1EOGA 3NOFA 3UAPA 3P90A 3D6IA 5HQPA 3UMAA 3D5JA 4ZXGA 3EMXA 4MMMA 5D96A 1GP1A 2I4AA 3L78A 3GKKA 1MDIA 4J2FA 2VD1A 1TK5B 2XBIA 5A4WA 1J0FA 2B7JA 3DD3A 4IS0A 4MZBA 4O5RA 5IMCA 2VM2A 2O85A 2JZRA 3L4NA 1QGVA 4NMUA 4PUAA 1JZWA 4KE3A 1XOBA 1B4PA 4EE0A 2LNTA 3IOSA 3ME8A 4XS1A 2XHFA 2H70A 5JWQB 2DMMA 3ZVJD 3RHCA 5J9CA 2IMIA 5G2ZA 5CRWA 12GSA 2C0GA 5CREA 4POMA 3CSHA 5F07A 1GSUA 3M9KA 4NV2A 3WD6A 2GTUA 4TXOA 4BL7B 1PL1A 4BVYA 5G1KA 1A8YA 2A4VA 4EIPA 1T4YA 1AQVA 4XS6A 4G19A 3PH9A 2KOKA 4I6XA 4OFTA 3N9JA 4PUFC 4TR1A 5LCZA 3M9JA 1YJ6A 2WJUA 3Q18A 2VL9A 2GQLA 3G9BA 4Z2UA 5B6NA 5KN2A 4PGTA 5F05A 2L4QA 2FD3A 2VCQA 1XPVA 3C1SA 4YH2A 2BMXA 2YWOA 3FZ4A 3ZL5A 1WPIA 3H4KA 5FHIA 4KSMA 3C1RA 3KMOA 2XPEA 2H1BA 4MF7A 2H19A 1SJ6A 4K9ZA 7GSSA 4EF0A 4O5QA 2G0FA 3H79A 3TRXA 5HR1A 3M8NA 1YF0A 5JCWA 6GSTA 1FOHA 2OE1A 2M72A 1GL8A 2YJ7A 2R5GA 4I2UA 2NPBA 4MF6A 2PU9C 3EVIA 2G2QA 1PQNA 4KGIA 1NHYA 3ZREA 4F2IA 4KA0A 5CP1A 1TRWA 2L5OA 3TKPA 1FVJA 1XBSA 1ERVA 2IIYA 3IA1A 1SK0A 3P8WA 3IR4A 4YAPA 3QFBC 4HEA2 4YAVA 1KBNA 1XOAA 4PX1A 2D2ZA 1SU9A 3APSA 5F06A 2PGTA 2J23A 3P7XA 4EKZA 2PVOC 4EDYA 1ML6A 4N10A 1AC1A 3GH9A 2GVPA 4G0KA 1N2AA 4GWRA 4WETA 3A3TA 2CX3A 3ERFA 3GL3A 1TRVA 4HJ2A 4EDZA 1KTEA 22GSA 2ZUPA 5D9WA 3KH9A 4MK3A 5JCUA 2QA1A 5ABRA 1TW9A 9GSSA 4YQMA 2L4CA 3F6DA 2AHEA 3Q6OA 2C4JA 1OC3A 3VWUA 3QFAC 3I43A 4JZQA 2LRCA 1MEKA 1SK2A 5GAND 4HQZA 2PUKC 1ZGNA 2JSYA 5HFGA 3KM6A 4IQAA 2VLTA 4ML1A 3ZYWA 4FYUA 4Z7XA 4NWYA 4AJ7A 4ID0A 4YKGA 3SWLA 4Q5RA 4PQHA 4MA9A 2FA8A 3GURA 2YWNA 1O7UA 1XW6A 4I97A 1SJZA 5B8AA 2GLRA 3OR5A 4G0IA 5FT3A 2O7KA 4V2NA 4DVCA 5B6MA 4D73B 5CRGA 3Q74A 1U88A 1TKDB 4IP6A 3TOTA 2CVDA 2HSHA 1USBA 5ECNB 2VLVA 1O85A 2JL4A 3H1NA 2P0GA 2GS3A 2B5XA 1HNBA 2L6CA 2FWEA 2F9SA 3LGCA 1JZOA 2VL2C 2ZNMA 5IMFA 1K0DA 4HDEA 1TI3A 2FY6A 2PMTA 2HT9A 1SENA 3L9UA 4IBPA 4OMVA 3GYKA 4CY6A 2LRNA 4ICYA 2GSRA 3IK9A 2JZSA 5FWGA 4KCAA 4YQVA 2CVKA 1QXHA 1YQ1A 5ENUA 2I1UA 4MPGA 2IN3A 4MH3A 4L5LA 5A4UA 1PKZA 3BOAA 4GQFA 4QQ7A 3FRCA 4Q5FA 2FWFA 3RDWA 2VIMA 1T3BA 4HZ2A 1V2AA 2QKEA 3DEXA 4OCEA 4TR0A 5DVBA 3TCOA 2IMKA 2ON7A 5IMAA 2F8FA 2XPDA 2F3MA 1QUWA 4AJ6A 2H72A 1Y6EA 2ALBA 2IL3A 2H6YA 2XC2A 4G10A 2HRKA 4HU9A 4POBA 1VF4A 1GNEA 4KSOA 2DMLA 5J3RA 1OC8A 1MTCA 1GTAA 4ACSA 4EVMA 4PQ1A 1ON4A 4IVFA 1JHBA 3ZMLA 3KGKA 2VM1A 4ZL7A 5DALA 3QCPA 2KUCA 1RQMA 2L59A 5KN0A 4WXTA 2C3NA 4ISDA 4G9HA 1F9MA 2H0HA 1YKCA 2R0PA 1PMTA 2KP2A 1Z9HA 4MJCA 2V6KA 4POKA 1X0RA 3K8NA 2FNOA 3U5RE 3GV1A 3WYWA 1M0UA 3ERGA 2CQ9A 4XRDA 4ECJA 2IFQB 1HQOA 4GCIA 3IDVA 1S3AA 2YV7A 2LQOA 4MJBA 3LYPA 1U3IA 4KCEA 4PTSA 1THXA 5CRHA 5F8BA 3DKSA 1XWBA 3WGDA 4Z2TA 2QSIA 4L5OA 1LU4A 2A4HA 2YWMA 1F2EA 4PXOA 4LMVA 3G7IA 1T7PB 4DSSB 2HZEB 3F6FA 4PNFA 1H75A 1PN0A 3TKRA 1RW1A 3BJ5A 1SKRB 3GL5A 2BTOT 2DSAA 2X4AA 4GTUA 1SL2B 1ZYPA 2EIQA 4JE1A 2REMA 1O73A 3VWXA 1G6WA 2CAIA 1EP8A 3I69A 2H6XA 3TB2A 3BD2A 1UC7A 1V58A 1V98A 2L57A 5ECMB 1IYHA 6GSUA 3PPUA 2GSTA 2VOCA 5C04A 3TKSC 4ML6A 2N5BA 3EU4A 1A2MA 2GDRA 2N5AA 2MBSA 4HOJA 4HQSA 1BJXA 5IPHA 1EOHA 1AQXA 1WMJA 3J7Yb 2R0CA 2A2RA 5LNKe 5GSSA 1R4WA 1OE8A 3QR6A 1DE1A 1XZOA 4N0ZA 1LBKA 3CRTA 3ISOA 2WZ9A 4PNGA 3L9SA 1VGLA 2WB9A 3D4MA 4KDYA 3QDNA 4FQUA 3TOUA 2LEGA 4E8HA 3BBYA 4TW5A 3TGZA 1K0MA 4LL4B 3HJMA 3CTGA 2IWTA 3GTUB 3KEBA 4ULXA 1EGOA 2VL2A 4KB3A 2MMOA 1T1VA 4TKYA 1ZMAA 2YJHA 4KUNA 5ELAA 4KDXA 4BL7A 3EURA 3LQ7A 5IOWA 3GX0A 2IMEA 4V2LA 3UVHA 4BVXB 4O32A 3VPQA 2K8VA 3CXGA 3KZQA 2LV3A 4TR3A 5AIVA 1VF3A 1M9BA 4ECBA 5CAXA 2VAFA 1Z3EA 4KAEA 3GKXA 4IKHA 1RK4A 2V32A 2WRTA 1Q98A 3FEUA 1YF1A 4X0XA 3PINA 4DSRA 3FY7A 4GXZA 2HSYA 1XXUA 5IPGA 3G7YA 2L5LA 5IO0A 1M2BA 2JADA 4NHZA 2RM6A 1XWGA 2FA4A 2K9FA 3ZFLA 5DJMA 3HKRA 2HI7A 4AGSA 3M0FA 3ZLPA 2E7PA 3HVVA 1A2LA 3KP8A 2CA8A 1UN2A 2CZ3A 1O8XA 2GT6A 2X8GA 5A5KA 3TJFA 3KCMA 4ZL9A 3MWHA 2OE0A 4KX4A 3O3TA 4V2MA 5KEJA 2VCTA 3ZITA 1CQHA 2NDOA 4IP1A 4N0VA 3P2AA 2OA7A 1M2DA 2AV4A 4GSNA 4QL9A 2TIRA 1ACVA 2H76A 3QPMA 2E0QA 3GA4A 3NZNA 3EPTA 5GSTA 2GSSA 2H66A 4HS1A 5INYA 4KF9A 4HJMA 3W6GA 2DLXA 3A5IA 1AXDA 4ECIA 1GSYA 2LTKA 3VPTA 4HZ4A 1WOUA 2R37A 2LSTA 1ABAA 3HA9A 3RAZA 2H0IA 3F4RA 2P31A 3HD5A 1FB0A 1SYXA 4KH7A 1GULA 4ZIJA 2LUSA 2A2SA 3DMLA 4HU7A 2YZUA 3ZTLA 2BJXA 1MDKA 2GZPA 3W8JA 1W89A 3CYNA 17GSA 2V41A 3LORA 3RHBA 2YANA 5BMUA 6GSVA 4G0LA 3ME7A 3F3RA 5G5EA 2MMZA 1EV9A 4IN0A 2IMFA 3IK7A 2V2GA 3LEFA 1K0NA 2PN8A 3EC3A 4O5UA 2FCHA 3GX8A 4EL1A 4MZWA 5DCGA 3F4TA 3TKSA 3J7Yk 2PPTA 3C7MA 2VCWA 1Z7PA 4RI7A 1JLWA 2VCXA 1EEMA 2PBJA 5GZZB 2LKUA 3LXTA 1ZYNA 3QMXA 1OVNA 2CVBA 3C8EA 4JU5A 1G0TA 1I9DA 3H8QA 4ILFA 2WS2A 4PQIA 3IBHA 4D73A 3U6VA 1GNWA 5DAKB 2PVQA 1R5PA 3KP9A 4FYCA 4XTSA 1CQGA 4NV5A 2R0GA 3HZ8A 4NAXA 1F6MC 4FO5A 3GKMA 1GLPA 3VI5A 1TXXA 1U3AA 2QA2A 4O7HA 3S9FA 4JR4A 8GSSA 4BA7A 4H86A 3L9VA 16GSA 2OACA 2CV4A 2AAWA 1YY7A 1XWCA 3GFKA 1K0BA 4NXIA 1T00A 5H5QA 1X9SB 4IHUA 2QGVA 3KTLA 5B8BA 5AIXA 2YCDA 1Z6MA 3TJKA 3EE2A 2LJKA 2H1AA 3AY8A 3M1GA 1G6YA 1C72A 1ERTA 4RQRA 3VI7A 2H01A 4F0BA 2UZ8A 4TOPA 5IMDA 4GQCA 1J08A 2I81A 3RPPA 2HE3A 1OE7A 1THOA 2OKAA 4MF5A 2C0EA 1XFLA 4MABA 1A2JA 4FIWA 2DKHA 4FH8A 2H30A 4V1Ag 4TXVA 2WULA 1KNGA 2DIZA 3FR3A 1AAZA 4GSSA 3A2WA 2R6KA 4GF0A 1SD9A 2WFCA 2VCVA 1SYRA 5LD0A 4ZBAA 4TR4A 1AQWA 5J5NA 4WKWA 1FG4A 1TK0B 3ED3A 2OBKA 3IC8A 2GZZA 3LJRA 2B5EA 1R5AA 3TJJA 4OFNA 4J57E 3ZZXA 1B8XA 3GUSA 1DE2A 1WJKA 2CZ2A 2TRCP 2IFQA 2JSZA 3LYKA 2Z9SA 4RI6A 1QQ2A 4PURA 4MLYA 3O76A 3D21A 2HSMA 2C80A 1GUHA 3PR8A 4K7OA 3APQA 1SJIA 3WT1A 4CHSA 1OC9B 4OWYA 1G7OA 3N5OA 4DSSA 1YKAA 2VCZA 2HZEA 3TRPA 3QAGA 2AB6A 2R2JA 1JLVA 1URMA 3ZRDA 1ZZYA 3FR6A 5AN1A 2C3TA 4DSQA 1ZOFA 3DVWA 3SBCA 3GIXA 1GSDA 5J4UA 1R7HA 1H4OA 4K0GA 3MIXA 3LWAA 2DJKA 4LL1B 1AIUA 5IM9A 1XCCA 3MYDA 6GSSA 4L8EA 2KP1A 4Z2RA 2M80A 2OE3A 1TU8A 2H74A 1O81A 4Q5NA 3FW2A 3WGEA 2MMAA 5CO3A 1MDJA 3TJBA 2HLSA 2J9HA 3GKNA 4EIQA 2FWHA 3E9JB 5KOXA 1PN9A 4I8BA 1K0CA 2PERA 4K0NA 4WR5A 2NVLA 1A0RP 1K3OA 3HY2A 1V57A 2VUPA 1Y25A 3KH7A 4BWSA 1ST9A 1F37A 3UL3A 4F82A 4E8EA 2LS5A 1GUKA 1A23A 4MCUA 5DBQA 4WF5A 4JR6A 2H73A 5CRDA 1BQ7A 4AF2A 1FOVA 1FO5A 3TRQA 2XBQA 1U87A 18GSA 1NW2A 2DJ1A 3F63A 1N8JA 2DKIA 1U6TA 3EWLA 2HRFA 2K8SA 2GT5A 3IRAA 3GTUA 1X5EA 2B6MA 4AJ8A 2OADA 3IC4A 1WIKA 2HXKA 2O8VB 4ZL8A 1ZL9A 4BPYA 19GSA 5D9XA 3GSTA 4K7NA 3TDGA 4OO4A 1SKWB 2K6VA 5ECRB 4BVXA 2JU5A 1OAZA 1VF1A 3ZIVA 5GAPD 5DCHA 1GSQA 5COHA 2I9HA 3DRNA 3DYRA 5L71A 1XIYA 4WBRD 2DJ0A 1M9AA 2V6OA 2H6ZA 2N5FA 1MD4A 4F03A 3US3A 2RM5A 4GLTA 4EXJA 1M2AA 3IHGA 3HVSA 1NM3A 3A2VA 1K0AA 2IMDA 5ECIB 4IJ3A 4BWQA 3JCML 3DIEA 3CSIA 4ECCA 1T8EB 1X9WB 3DXBA 2E2GA 3O6TA 1S3DA 1GTIA 3TUEA 1V40A 1K3LA 1I5GA 5ID2B 4WR4A 3CSJA 1M7TA 2HZFA 1TP9A 5ECQB 1JZRA 3RPNA 4IQ1A 4WF4A 3ZIJA 4K2DA 3GH6A 4K8MA 1BEDA 5G1LA 2VD0A 1TRSA 4QL7A 3IAS2 1DSBA 4K2XA 5HR2A 4G2EA 4USSA 5IQYA 2GQKA 3KTBA 1GUMA 1FHEA 1NHOA 3ERWA 4MP4A 4P3YB 14GSA 2GQMA 4XS4B 1S3CA 4V1Ap 1YEXA 1ZYQB 4K5SA 4F9ZA 4IJIA 3LXZA 1PRXA 4K5RA 5ECOB 1ZYEA 1GSEA 2EC4A 3FZ9A 5JCGA 2PWJA 1JZDA 1YZXA 5F0GA 2YPMA 5IOXA 2WDUA 2YOIA 2EIOA 3PGTA 3D22A 3TKQA 1E2YA 3QOUA 4MZCA 4JBBA 3ZVJA 1BYEA 1QMVA 5BRTA 3WGXA 4POLA 1UA5A 3FKFA 2RIIA 4EUYA 2IJYA 1XWAA 3UBLA 5EL8A 1SL1B 1GTBA 4K6XA 1HNAA 2EIRA 1GWCA 3FZAA 2DJ3A 2LJAA 2LRTA 1EP7A 2B7KA 5IO2A 1EZKA 1GSFA 1B48A 2DC5A 5D93A 2OBIA 1Z7RA 4I5QA 4N30A 3IV4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UEM A;  2FGX A;  5EY6 A;  5DAK A;  1OKT A;  3MDK A;  4K1F A;  1LJR A;  1TK8 B;  3FHK A;  1GSS A;  1GTU A;  2H8L A;  1EV4 A;  1TDI A;  2B1L A;  1W4V A;  5DQY A;  4KW6 A;  2C0F A;  4ZB6 A;  1EGR A;  2I3Y A;  3D0Z A;  5ECH B;  2O87 A;  2YP6 A;  3MAK A;  5G30 A;  1J9B A;  1V9W A;  2MYG A;  3HVX A;  2HNL A;  2AUV A;  2H1D A;  6GSX A;  5EPF A;  2FLS A;  1K0O A;  4HUA A;  3V1W A;  4LMW A;  2NTO A;  4MJE A;  2IPA A;  1E6B A;  1FW1 A;  2DJ2 A;  2MZC A;  1GLQ A;  4CW9 A;  2RUE A;  1YDK A;  1OYJ A;  3BCI A;  4IW9 A;  1SL0 B;  5HFK A;  3FR9 A;  2FHE A;  5J9B A;  3HDC A;  3F4S A;  4GST A;  3MSZ A;  2GGT A;  4OD7 A;  3LFL A;  2QC7 A;  3QAV A;  1WE0 A;  4J56 E;  1TTZ A;  3HHV A;  2VL3 A;  4XRA A;  2F51 A;  5ELG A;  5ECP B;  2ON5 A;  2E2M A;  1PSQ A;  2H1G A;  5CYY A;  4TN8 A;  1SK1 A;  4OO5 A;  1FVK A;  1XW9 A;  4MDC A;  1TRU A;  3C71 A;  2DBC A;  2V1M A;  1XW5 A;  4ZB9 A;  4MJA A;  2R3X A;  4TXO B;  1XVW A;  1PL2 A;  2HYX A;  3HZ4 A;  5D9V A;  1BG5 A;  4X1U A;  20GS A;  1T4Z A;  1XVQ A;  3Q19 A;  4ZIL A;  3TJG A;  2OJL A;  1HNC A;  4YQU A;  4TR1 B;  2YV9 A;  2L6D A;  4IEL A;  2K18 A;  3VK9 A;  3WT2 A;  1OKD A;  3APO A;  1R26 A;  1VRS D;  1SKS B;  2B3S A;  3D4T A;  2HRN A;  5HFI A;  3UIW A;  1HYU A;  3F8U A;  5DDL A;  1OC9 A;  1VF2 A;  5ECL B;  3QAW A;  1PX6 A;  5ECK B;  2YZH A;  3ZFB A;  2H71 A;  4WBJ A;  3DVX A;  4MPF A;  1BX9 A;  2FUG 2;  2GZY A;  2B1K A;  5D73 A;  5D8I A;  2HFD A;  2VLU A;  5KN3 A;  5ECS A;  5HR0 A;  6GSY A;  1FAA A;  3UOM A;  4LLR A;  3M3M A;  3IXR A;  4KND A;  2F8A A;  2X99 A;  4MH2 A;  3VWW A;  2M46 A;  1DUG A;  3L0H A;  1IYI A;  2LNS A;  2H0G A;  3UJ1 A;  1TI1 A;  2WCI A;  1B4Q A;  5E4W A;  3FYG A;  2X8C A;  1A24 A;  3GSS A;  4KDU A;  3E3E A;  3VWV A;  3IE3 A;  3GMF A;  1Z5Y E;  4JED A;  5J41 A;  3IPZ A;  4O92 A;  1MD3 A;  4NHW A;  2YN1 A;  3GRX A;  3F0I A;  6GSW A;  4Q5Q A;  13GS A;  2FWG A;  3NIV A;  3KJY A;  3KMN A;  1PKW A;  4ZBB A;  2TRX A;  1O6J A;  1PX7 A;  2YNX A;  4RQX A;  3CBU A;  2H75 A;  4WEY A;  1M99 A;  3CRU A;  5E59 A;  3CTF A;  3HJP A;  2KLX A;  1ERW A;  1UVZ A;  2RLI A;  4IGJ A;  3LSZ A;  3I6A A;  5H5S A;  3DGQ A;  3KXO A;  2C0D A;  10GS A;  2YWI A;  1A8L A;  2AJQ B;  4L0W A;  3HJO A;  3UAR A;  2AYT A;  5AIS A;  5HR3 A;  3H93 A;  4EO3 A;  4F0C A;  1EWX A;  2C1Y A;  5EVO A;  1ZCP A;  4TRX A;  1QFN A;  4NPB A;  1EEJ A;  3FK8 A;  2X8H A;  2LJR A;  2P5Q A;  5AGY A;  1TOF A;  3GN3 A;  5G5F A;  2ES7 A;  4OCF A;  3HCZ A;  3EIN A;  2R4V A;  4XIH A;  5G31 A;  2MBT A;  5DJL A;  2WGR A;  4DEJ A;  3ZMK A;  3HXS A;  1WP0 A;  2P5R A;  5D9T A;  1SD8 A;  1PA3 A;  2RUF A;  3IHQ A;  1AUC A;  1GRX A;  5ID2 A;  3UBK A;  1TU7 A;  1QK8 A;  2KHP A;  3RBT A;  1F3B A;  3A2X A;  2NBS A;  4CDO A;  1PGT A;  4FYB A;  3I9V 2;  3DWV A;  3FZ5 A;  3W8S A;  1FB6 A;  1YEP A;  1G7E A;  2O89 A;  3G7J A;  3R2Q A;  3LG6 A;  1Z6N A;  1JFU A;  11GS A;  1X5D A;  3CMI A;  4XS4 A;  3E0U A;  3EU3 A;  2C8U A;  3EMP A;  2CT6 A;  5JWR B;  4ZB8 A;  2DIY A;  2LQQ A;  2JAC A;  2X64 A;  1B9Y C;  1TJD A;  1WRY A;  4ZBD A;  5C00 A;  3TKS E;  5A4V A;  2B5Y A;  2CAQ A;  3F3Q A;  1Q4J A;  3GNJ A;  1AW9 A;  2GSQ A;  4GRF A;  3A5W A;  3VUR A;  2VO4 A;  1B9X C;  1GH2 A;  5DAL B;  5IMZ A;  3IAM 2;  3C73 A;  4K7I A;  4N11 A;  1PD2 1;  2CX4 A;  5CNW A;  1ERU A;  1O8W A;  4XHM A;  3VFI A;  1X5C A;  4TVE A;  1HD2 A;  4I2T A;  3QD9 A;  5B7C A;  1BAY A;  4RUV A;  3UVT A;  3GHA A;  5DQS A;  5IMV A;  4L0U A;  1NSW A;  3KD0 A;  1WWJ A;  5IIZ A;  4OFM A;  3EYT A;  3HYP A;  3MNG A;  3F9U A;  1A0F A;  1F3A A;  2DJJ A;  4JRR A;  1ILO A;  4X43 A;  2MMN A;  1X9M B;  1XWK A;  1DBY A;  1K3Y A;  1KEB A;  4HI7 A;  2ZCT A;  3VLN A;  5H5R A;  3KIJ A;  2C3Q A;  2JZT A;  4XCS A;  4EC0 A;  3BCK A;  5KN1 A;  4LA1 A;  5JWO B;  1EOG A;  3NOF A;  3UAP A;  3P90 A;  3D6I A;  5HQP A;  3UMA A;  3D5J A;  4ZXG A;  3EMX A;  4MMM A;  5D96 A;  1GP1 A;  2I4A A;  3L78 A;  3GKK A;  1MDI A;  4J2F A;  2VD1 A;  1TK5 B;  2XBI A;  5A4W A;  1J0F A;  2B7J A;  3DD3 A;  4IS0 A;  4MZB A;  4O5R A;  5IMC A;  2VM2 A;  2O85 A;  2JZR A;  3L4N A;  1QGV A;  4NMU A;  4PUA A;  1JZW A;  4KE3 A;  1XOB A;  1B4P A;  4EE0 A;  2LNT A;  3IOS A;  3ME8 A;  4XS1 A;  2XHF A;  2H70 A;  5JWQ B;  2DMM A;  3ZVJ D;  3RHC A;  5J9C A;  2IMI A;  5G2Z A;  5CRW A;  12GS A;  2C0G A;  5CRE A;  4POM A;  3CSH A;  5F07 A;  1GSU A;  3M9K A;  4NV2 A;  3WD6 A;  2GTU A;  4TXO A;  1PL1 A;  4BVY A;  5G1K A;  1A8Y A;  2A4V A;  1T4Y A;  1AQV A;  4XS6 A;  4G19 A;  3PH9 A;  2KOK A;  4I6X A;  4OFT A;  3N9J A;  4PUF C;  4TR1 A;  5LCZ A;  3M9J A;  1YJ6 A;  2WJU A;  3Q18 A;  2VL9 A;  2GQL A;  3G9B A;  5B6N A;  5KN2 A;  4PGT A;  5F05 A;  2L4Q A;  2FD3 A;  2VCQ A;  1XPV A;  3C1S A;  4YH2 A;  2BMX A;  2YWO A;  3FZ4 A;  3ZL5 A;  1WPI A;  3H4K A;  5FHI A;  4KSM A;  3C1R A;  3KMO A;  2XPE A;  2H1B A;  4MF7 A;  2H19 A;  1SJ6 A;  4K9Z A;  7GSS A;  4EF0 A;  2G0F A;  3H79 A;  3TRX A;  5HR1 A;  3M8N A;  1YF0 A;  5JCW A;  6GST A;  2OE1 A;  2M72 A;  1GL8 A;  2YJ7 A;  2R5G A;  4I2U A;  2NPB A;  4MF6 A;  2PU9 C;  3EVI A;  2G2Q A;  1PQN A;  4KGI A;  1NHY A;  3ZRE A;  4F2I A;  4KA0 A;  5CP1 A;  1TRW A;  2L5O A;  3TKP A;  1FVJ A;  1XBS A;  1ERV A;  2IIY A;  3IA1 A;  1SK0 A;  3P8W A;  3IR4 A;  4YAP A;  3QFB C;  4HEA 2;  4YAV A;  1KBN A;  1XOA A;  4PX1 A;  2D2Z A;  1SU9 A;  3APS A;  5F06 A;  2PGT A;  2J23 A;  3P7X A;  4EKZ A;  2PVO C;  4EDY A;  1ML6 A;  4N10 A;  1AC1 A;  3GH9 A;  2GVP A;  1N2A A;  4GWR A;  4WET A;  3A3T A;  2CX3 A;  3ERF A;  3GL3 A;  1TRV A;  4HJ2 A;  4EDZ A;  1KTE A;  22GS A;  2ZUP A;  5D9W A;  3KH9 A;  4MK3 A;  5JCU A;  5ABR A;  1TW9 A;  9GSS A;  4YQM A;  2L4C A;  3F6D A;  2AHE A;  3Q6O A;  2C4J A;  1OC3 A;  3VWU A;  3QFA C;  3I43 A;  4JZQ A;  2LRC A;  1MEK A;  1SK2 A;  5GAN D;  4HQZ A;  2PUK C;  1ZGN A;  2JSY A;  5HFG A;  3KM6 A;  4IQA A;  2VLT A;  4ML1 A;  3ZYW A;  4FYU A;  4Z7X A;  4NWY A;  4AJ7 A;  4ID0 A;  3SWL A;  4Q5R A;  4PQH A;  4MA9 A;  2FA8 A;  3GUR A;  2YWN A;  1O7U A;  1XW6 A;  4I97 A;  1SJZ A;  5B8A A;  2GLR A;  3OR5 A;  5FT3 A;  2O7K A;  4V2N A;  4DVC A;  5B6M A;  4D73 B;  5CRG A;  3Q74 A;  1U88 A;  1TKD B;  4IP6 A;  3TOT A;  2CVD A;  2HSH A;  1USB A;  5ECN B;  2VLV A;  1O85 A;  2JL4 A;  3H1N A;  2P0G A;  2GS3 A;  2B5X A;  1HNB A;  2L6C A;  2FWE A;  2F9S A;  3LGC A;  1JZO A;  2VL2 C;  2ZNM A;  5IMF A;  1K0D A;  4HDE A;  1TI3 A;  2FY6 A;  2PMT A;  2HT9 A;  1SEN A;  3L9U A;  4IBP A;  4OMV A;  3GYK A;  2LRN A;  2GSR A;  3IK9 A;  2JZS A;  5FWG A;  4KCA A;  4YQV A;  2CVK A;  1QXH A;  1YQ1 A;  5ENU A;  2I1U A;  4MPG A;  2IN3 A;  4MH3 A;  4L5L A;  5A4U A;  1PKZ A;  3BOA A;  4GQF A;  4QQ7 A;  3FRC A;  4Q5F A;  2FWF A;  3RDW A;  2VIM A;  1T3B A;  4HZ2 A;  1V2A A;  2QKE A;  3DEX A;  4OCE A;  4TR0 A;  5DVB A;  3TCO A;  2IMK A;  2ON7 A;  5IMA A;  2F8F A;  2XPD A;  2F3M A;  1QUW A;  4AJ6 A;  2H72 A;  1Y6E A;  2ALB A;  2IL3 A;  2H6Y A;  2XC2 A;  4G10 A;  4HU9 A;  4POB A;  1VF4 A;  1GNE A;  4KSO A;  2DML A;  5J3R A;  1OC8 A;  1MTC A;  1GTA A;  4ACS A;  4EVM A;  4PQ1 A;  1ON4 A;  4IVF A;  1JHB A;  3ZML A;  3KGK A;  2VM1 A;  4ZL7 A;  5DAL A;  3QCP A;  2KUC A;  1RQM A;  2L59 A;  5KN0 A;  4WXT A;  2C3N A;  4ISD A;  4G9H A;  1F9M A;  2H0H A;  1YKC A;  1PMT A;  2KP2 A;  1Z9H A;  4MJC A;  2V6K A;  4POK A;  1X0R A;  3K8N A;  2FNO A;  3U5R E;  3GV1 A;  3WYW A;  1M0U A;  3ERG A;  2CQ9 A;  4XRD A;  4ECJ A;  2IFQ B;  1HQO A;  4GCI A;  3IDV A;  1S3A A;  2YV7 A;  2LQO A;  4MJB A;  3LYP A;  1U3I A;  4KCE A;  1THX A;  5CRH A;  5F8B A;  3DKS A;  1XWB A;  3WGD A;  2QSI A;  4L5O A;  1LU4 A;  2YWM A;  1F2E A;  4PXO A;  4LMV A;  3G7I A;  1T7P B;  4DSS B;  2HZE B;  3F6F A;  4PNF A;  1H75 A;  3TKR A;  1RW1 A;  3BJ5 A;  1SKR B;  3GL5 A;  2BTO T;  2DSA A;  4GTU A;  1SL2 B;  2EIQ A;  4JE1 A;  2REM A;  1O73 A;  3VWX A;  1G6W A;  2CAI A;  1EP8 A;  3I69 A;  2H6X A;  3TB2 A;  3BD2 A;  1UC7 A;  1V58 A;  1V98 A;  2L57 A;  5ECM B;  1IYH A;  6GSU A;  2GST A;  2VOC A;  5C04 A;  3TKS C;  4ML6 A;  2N5B A;  3EU4 A;  1A2M A;  2GDR A;  2N5A A;  2MBS A;  4HOJ A;  4HQS A;  1BJX A;  5IPH A;  1EOH A;  1AQX A;  1WMJ A;  3J7Y b;  2A2R A;  5LNK e;  5GSS A;  1R4W A;  1OE8 A;  3QR6 A;  1DE1 A;  1XZO A;  4N0Z A;  1LBK A;  3CRT A;  3ISO A;  2WZ9 A;  4PNG A;  3L9S A;  1VGL A;  2WB9 A;  3D4M A;  4KDY A;  3QDN A;  3TOU A;  2LEG A;  4E8H A;  3BBY A;  4TW5 A;  3TGZ A;  1K0M A;  4LL4 B;  3HJM A;  3CTG A;  2IWT A;  3GTU B;  3KEB A;  4ULX A;  1EGO A;  2VL2 A;  4KB3 A;  2MMO A;  1T1V A;  4TKY A;  1ZMA A;  2YJH A;  4KUN A;  5ELA A;  4KDX A;  4BL7 A;  3EUR A;  3LQ7 A;  5IOW A;  3GX0 A;  2IME A;  4V2L A;  3UVH A;  4O32 A;  3VPQ A;  2K8V A;  3CXG A;  3KZQ A;  2LV3 A;  4TR3 A;  5AIV A;  1VF3 A;  1M9B A;  4ECB A;  5CAX A;  2VAF A;  1Z3E A;  4KAE A;  3GKX A;  4IKH A;  1RK4 A;  2V32 A;  2WRT A;  1Q98 A;  3FEU A;  1YF1 A;  4X0X A;  3PIN A;  4DSR A;  3FY7 A;  4GXZ A;  2HSY A;  1XXU A;  5IPG A;  3G7Y A;  2L5L A;  5IO0 A;  1M2B A;  2JAD A;  4NHZ A;  2RM6 A;  1XWG A;  2FA4 A;  2K9F A;  3ZFL A;  5DJM A;  3HKR A;  2HI7 A;  4AGS A;  3M0F A;  3ZLP A;  2E7P A;  3HVV A;  1A2L A;  3KP8 A;  2CA8 A;  1UN2 A;  2CZ3 A;  1O8X A;  2GT6 A;  2X8G A;  5A5K A;  3TJF A;  3KCM A;  4ZL9 A;  3MWH A;  2OE0 A;  4KX4 A;  3O3T A;  4V2M A;  5KEJ A;  2VCT A;  3ZIT A;  1CQH A;  2NDO A;  4IP1 A;  4N0V A;  3P2A A;  2OA7 A;  1M2D A;  2AV4 A;  4GSN A;  4QL9 A;  2TIR A;  1ACV A;  2H76 A;  3QPM A;  2E0Q A;  3GA4 A;  3NZN A;  5GST A;  2GSS A;  2H66 A;  4HS1 A;  5INY A;  4HJM A;  3W6G A;  2DLX A;  1AXD A;  4ECI A;  1GSY A;  2LTK A;  3VPT A;  4HZ4 A;  1WOU A;  2R37 A;  2LST A;  1ABA A;  3HA9 A;  3RAZ A;  2H0I A;  3F4R A;  2P31 A;  3HD5 A;  1FB0 A;  1SYX A;  4KH7 A;  1GUL A;  4ZIJ A;  2LUS A;  2A2S A;  3DML A;  4HU7 A;  2YZU A;  3ZTL A;  2BJX A;  1MDK A;  2GZP A;  3W8J A;  1W89 A;  3CYN A;  17GS A;  2V41 A;  3LOR A;  3RHB A;  2YAN A;  6GSV A;  3ME7 A;  3F3R A;  5G5E A;  2MMZ A;  1EV9 A;  4IN0 A;  2IMF A;  3IK7 A;  2V2G A;  3LEF A;  1K0N A;  2PN8 A;  3EC3 A;  2FCH A;  3GX8 A;  4EL1 A;  4MZW A;  5DCG A;  3F4T A;  3TKS A;  3J7Y k;  2PPT A;  3C7M A;  2VCW A;  1Z7P A;  4RI7 A;  1JLW A;  2VCX A;  1EEM A;  2PBJ A;  5GZZ B;  2LKU A;  3LXT A;  3QMX A;  1OVN A;  2CVB A;  3C8E A;  4JU5 A;  1G0T A;  1I9D A;  3H8Q A;  4ILF A;  2WS2 A;  4PQI A;  3IBH A;  4D73 A;  3U6V A;  1GNW A;  5DAK B;  2PVQ A;  1R5P A;  3KP9 A;  4FYC A;  4XTS A;  1CQG A;  4NV5 A;  3HZ8 A;  4NAX A;  1F6M C;  4FO5 A;  3GKM A;  1GLP A;  3VI5 A;  1TXX A;  1U3A A;  4O7H A;  3S9F A;  4JR4 A;  8GSS A;  4BA7 A;  4H86 A;  3L9V A;  16GS A;  2OAC A;  2CV4 A;  2AAW A;  1YY7 A;  1XWC A;  3GFK A;  1K0B A;  4NXI A;  1T00 A;  5H5Q A;  1X9S B;  4IHU A;  2QGV A;  3KTL A;  5B8B A;  5AIX A;  2YCD A;  1Z6M A;  3TJK A;  3EE2 A;  2LJK A;  2H1A A;  3AY8 A;  3M1G A;  1G6Y A;  1C72 A;  1ERT A;  4RQR A;  3VI7 A;  2H01 A;  4F0B A;  4TOP A;  5IMD A;  4GQC A;  1J08 A;  2I81 A;  3RPP A;  2HE3 A;  1OE7 A;  1THO A;  2OKA A;  4MF5 A;  2C0E A;  1XFL A;  4MAB A;  1A2J A;  4FIW A;  4FH8 A;  2H30 A;  4V1A g;  4TXV A;  2WUL A;  1KNG A;  2DIZ A;  3FR3 A;  1AAZ A;  4GSS A;  3A2W A;  2R6K A;  4GF0 A;  1SD9 A;  2WFC A;  2VCV A;  1SYR A;  5LD0 A;  4ZBA A;  4TR4 A;  1AQW A;  5J5N A;  4WKW A;  1FG4 A;  1TK0 B;  3ED3 A;  2OBK A;  2GZZ A;  3LJR A;  2B5E A;  1R5A A;  3TJJ A;  4OFN A;  4J57 E;  3ZZX A;  1B8X A;  3GUS A;  1DE2 A;  1WJK A;  2CZ2 A;  2TRC P;  2IFQ A;  2JSZ A;  3LYK A;  2Z9S A;  4RI6 A;  1QQ2 A;  4PUR A;  4MLY A;  3O76 A;  3D21 A;  2C80 A;  1GUH A;  3PR8 A;  4K7O A;  3APQ A;  1SJI A;  3WT1 A;  4CHS A;  1OC9 B;  4OWY A;  1G7O A;  3N5O A;  4DSS A;  1YKA A;  2VCZ A;  2HZE A;  3TRP A;  3QAG A;  2AB6 A;  2R2J A;  1JLV A;  1URM A;  3ZRD A;  1ZZY A;  3FR6 A;  5AN1 A;  2C3T A;  4DSQ A;  1ZOF A;  3DVW A;  3SBC A;  3GIX A;  1GSD A;  5J4U A;  1R7H A;  1H4O A;  4K0G A;  3LWA A;  2DJK A;  4LL1 B;  1AIU A;  5IM9 A;  1XCC A;  6GSS A;  4L8E A;  2KP1 A;  2M80 A;  2OE3 A;  1TU8 A;  2H74 A;  1O81 A;  4Q5N A;  3FW2 A;  3WGE A;  2MMA A;  5CO3 A;  1MDJ A;  3TJB A;  2HLS A;  2J9H A;  3GKN A;  2FWH A;  3E9J B;  1PN9 A;  4I8B A;  1K0C A;  2PER A;  4K0N A;  4WR5 A;  2NVL A;  1A0R P;  1K3O A;  3HY2 A;  1V57 A;  2VUP A;  1Y25 A;  3KH7 A;  4BWS A;  1ST9 A;  1F37 A;  3UL3 A;  4F82 A;  4E8E A;  2LS5 A;  1GUK A;  1A23 A;  4MCU A;  5DBQ A;  4WF5 A;  4JR6 A;  2H73 A;  5CRD A;  1BQ7 A;  4AF2 A;  1FOV A;  1FO5 A;  3TRQ A;  2XBQ A;  1U87 A;  18GS A;  1NW2 A;  2DJ1 A;  3F63 A;  1N8J A;  1U6T A;  3EWL A;  2HRF A;  2K8S A;  2GT5 A;  3IRA A;  3GTU A;  1X5E A;  2B6M A;  4AJ8 A;  2OAD A;  3IC4 A;  1WIK A;  2HXK A;  2O8V B;  4ZL8 A;  1ZL9 A;  4BPY A;  19GS A;  5D9X A;  3GST A;  4K7N A;  3TDG A;  4OO4 A;  1SKW B;  2K6V A;  5ECR B;  4BVX A;  2JU5 A;  1OAZ A;  1VF1 A;  3ZIV A;  5GAP D;  5DCH A;  1GSQ A;  5COH A;  2I9H A;  3DRN A;  3DYR A;  5L71 A;  1XIY A;  4WBR D;  2DJ0 A;  1M9A A;  2V6O A;  2H6Z A;  2N5F A;  1MD4 A;  4F03 A;  3US3 A;  2RM5 A;  4GLT A;  4EXJ A;  1M2A A;  3HVS A;  1NM3 A;  3A2V A;  1K0A A;  2IMD A;  5ECI B;  4IJ3 A;  4BWQ A;  3JCM L;  3DIE A;  3CSI A;  4ECC A;  1T8E B;  1X9W B;  3DXB A;  2E2G A;  3O6T A;  1S3D A;  1GTI A;  3TUE A;  1V40 A;  1K3L A;  1I5G A;  5ID2 B;  4WR4 A;  3CSJ A;  1M7T A;  2HZF A;  1TP9 A;  5ECQ B;  1JZR A;  3RPN A;  4IQ1 A;  4WF4 A;  3ZIJ A;  4K2D A;  3GH6 A;  4K8M A;  1BED A;  5G1L A;  2VD0 A;  1TRS A;  4QL7 A;  3IAS 2;  1DSB A;  5HR2 A;  4G2E A;  5IQY A;  2GQK A;  3KTB A;  1GUM A;  1FHE A;  1NHO A;  3ERW A;  4MP4 A;  4P3Y B;  14GS A;  2GQM A;  4XS4 B;  1S3C A;  4V1A p;  1YEX A;  1ZYQ B;  4F9Z A;  4IJI A;  3LXZ A;  1PRX A;  5ECO B;  1ZYE A;  1GSE A;  2EC4 A;  3FZ9 A;  5JCG A;  2PWJ A;  1JZD A;  1YZX A;  5F0G A;  2YPM A;  5IOX A;  2WDU A;  2YOI A;  2EIO A;  3PGT A;  3D22 A;  3TKQ A;  1E2Y A;  3QOU A;  4MZC A;  4JBB A;  3ZVJ A;  1BYE A;  1QMV A;  3WGX A;  4POL A;  1UA5 A;  3FKF A;  2RII A;  4EUY A;  2IJY A;  1XWA A;  3UBL A;  5EL8 A;  1SL1 B;  1GTB A;  4K6X A;  1HNA A;  2EIR A;  1GWC A;  3FZA A;  2DJ3 A;  2LJA A;  2LRT A;  1EP7 A;  2B7K A;  5IO2 A;  1EZK A;  1GSF A;  1B48 A;  2DC5 A;  5D93 A;  2OBI A;  1Z7R A;  4I5Q A;  4N30 A;  3IV4 A; 
#chains in the Genus database with same CATH topology
 3UEM A;  2FGX A;  5EY6 A;  5DAK A;  1OKT A;  3MDK A;  4K1F A;  1LJR A;  1TK8 B;  3FHK A;  1GSS A;  1GTU A;  2H8L A;  1EV4 A;  1TDI A;  2B1L A;  1W4V A;  5DQY A;  4KW6 A;  2C0F A;  4ZB6 A;  1EGR A;  2I3Y A;  3D0Z A;  5ECH B;  2HRA A;  2O87 A;  2YP6 A;  3MAK A;  5G30 A;  1J9B A;  1V9W A;  2MYG A;  3HVX A;  2HNL A;  2AUV A;  2H1D A;  6GSX A;  5EPF A;  2FLS A;  1K0O A;  4HUA A;  3V1W A;  4LMW A;  2NTO A;  4MJE A;  2IPA A;  1E6B A;  1FW1 A;  2DJ2 A;  2MZC A;  1GLQ A;  4HSC X;  4CW9 A;  2RUE A;  1YDK A;  1OYJ A;  3BCI A;  4IW9 A;  1SL0 B;  5HFK A;  3FR9 A;  2FHE A;  5J9B A;  3HDC A;  3F4S A;  4GST A;  3MSZ A;  2GGT A;  4OD7 A;  3LFL A;  2QC7 A;  3QAV A;  1WE0 A;  4J56 E;  1TTZ A;  3HHV A;  2VL3 A;  4XRA A;  2F51 A;  5ELG A;  5ECP B;  2ON5 A;  2E2M A;  1PSQ A;  2H1G A;  5CYY A;  4TN8 A;  1SK1 A;  4OO5 A;  1FVK A;  1XW9 A;  4MDC A;  1TRU A;  3C71 A;  2DBC A;  2V1M A;  1XW5 A;  4ZB9 A;  4MJA A;  2R3X A;  4TXO B;  1XVW A;  1PL2 A;  2HYX A;  3HZ4 A;  5D9V A;  4CY8 A;  4BVY B;  1BG5 A;  4X1U A;  20GS A;  1T4Z A;  4MNN A;  1XVQ A;  3Q19 A;  4ZIL A;  3TJG A;  2OJL A;  1HNC A;  4YQU A;  4TR1 B;  2YV9 A;  4X4J A;  2L6D A;  4IEL A;  2K18 A;  3VK9 A;  3WT2 A;  1OKD A;  3APO A;  1R26 A;  1VRS D;  1SKS B;  2B3S A;  3D4T A;  2HRN A;  5HFI A;  3UIW A;  1HYU A;  3F8U A;  5DDL A;  1OC9 A;  1VF2 A;  3LW9 A;  5ECL B;  3QAW A;  4YKF A;  1PX6 A;  5ECK B;  2YZH A;  3ZFB A;  2H71 A;  4WBJ A;  3DVX A;  4MPF A;  1BX9 A;  2FUG 2;  2GZY A;  2B1K A;  5D73 A;  5D8I A;  2HFD A;  2VLU A;  5KN3 A;  5ECS A;  5HR0 A;  6GSY A;  1FAA A;  3UOM A;  4LLR A;  3M3M A;  3IXR A;  4KND A;  2F8A A;  2X99 A;  4MH2 A;  4A5P A;  3VWW A;  2M46 A;  1DUG A;  3L0H A;  1IYI A;  2LNS A;  2H0G A;  3UJ1 A;  1TI1 A;  2WCI A;  1B4Q A;  5E4W A;  3FYG A;  2X8C A;  1A24 A;  3GSS A;  4KDU A;  3E3E A;  3VWV A;  3IE3 A;  3GMF A;  1Z5Y E;  4JED A;  5J41 A;  3IPZ A;  4O92 A;  1MD3 A;  4NHW A;  2YN1 A;  3GRX A;  3F0I A;  6GSW A;  4Q5Q A;  13GS A;  2FWG A;  3NIV A;  3KJY A;  3KMN A;  1PKW A;  4ZBB A;  2TRX A;  1O6J A;  1PX7 A;  2YNX A;  4RQX A;  3CBU A;  2H75 A;  4WEY A;  1M99 A;  3CRU A;  5E59 A;  3CTF A;  3HJP A;  2KLX A;  1ERW A;  2X49 A;  1UVZ A;  2RLI A;  4IGJ A;  3LSZ A;  3I6A A;  5H5S A;  3DGQ A;  3KXO A;  2C0D A;  10GS A;  2YWI A;  1A8L A;  2AJQ B;  4L0W A;  3HJO A;  3R3E A;  3UAR A;  2AYT A;  5AIS A;  5HR3 A;  3H93 A;  4EO3 A;  4F0C A;  1EWX A;  2C1Y A;  5EVO A;  1ZCP A;  4TRX A;  1QFN A;  4NPB A;  1EEJ A;  3FK8 A;  2X8H A;  5KOW A;  2LJR A;  2P5Q A;  5AGY A;  1TOF A;  3GN3 A;  5G5F A;  2ES7 A;  4OCF A;  3HCZ A;  3EIN A;  2R4V A;  4XIH A;  5G31 A;  2MBT A;  5DJL A;  2WGR A;  4DEJ A;  3ZMK A;  3HXS A;  1WP0 A;  2P5R A;  5D9T A;  1PFO A;  1SD8 A;  1PA3 A;  2RUF A;  3IHQ A;  1AUC A;  1GRX A;  5ID2 A;  3UBK A;  1TU7 A;  1QK8 A;  2KHP A;  3RBT A;  1F3B A;  3A2X A;  2NBS A;  4CDO A;  1PGT A;  4FYB A;  3I9V 2;  3DWV A;  3FZ5 A;  3W8S A;  1FB6 A;  1YEP A;  1G7E A;  2O89 A;  3G7J A;  3R2Q A;  3LG6 A;  1Z6N A;  1JFU A;  11GS A;  1X5D A;  3CMI A;  4XS4 A;  3E0U A;  3EU3 A;  2C8U A;  3EMP A;  2CT6 A;  5JWR B;  4ZB8 A;  2DIY A;  2LQQ A;  2JAC A;  2X64 A;  1B9Y C;  1TJD A;  1WRY A;  4ZBD A;  5C00 A;  3TKS E;  5A4V A;  2B5Y A;  2CAQ A;  3F3Q A;  1Q4J A;  3GNJ A;  1AW9 A;  2GSQ A;  4GRF A;  3A5W A;  3VUR A;  2VO4 A;  1B9X C;  1GH2 A;  5DAL B;  5IMZ A;  3IAM 2;  3C73 A;  4K7I A;  4N11 A;  1PD2 1;  2CX4 A;  5CNW A;  1ERU A;  1O8W A;  4XHM A;  3VFI A;  1X5C A;  4TVE A;  1HD2 A;  4I2T A;  3QD9 A;  5B7C A;  1BAY A;  4RUV A;  3UVT A;  3GHA A;  3FMW A;  5DQS A;  5IMV A;  4L0U A;  1NSW A;  3KD0 A;  1WWJ A;  5IIZ A;  4OFM A;  3EYT A;  3HYP A;  3MNG A;  3F9U A;  1A0F A;  1F3A A;  2DJJ A;  4JRR A;  1ILO A;  4X43 A;  2MMN A;  1X9M B;  1XWK A;  1DBY A;  1K3Y A;  1KEB A;  4HI7 A;  2A2P A;  2ZCT A;  3VLN A;  5H5R A;  3KIJ A;  2C3Q A;  2JZT A;  4XCS A;  4EC0 A;  3BCK A;  5KN1 A;  4LA1 A;  5JWO B;  1EOG A;  3NOF A;  3UAP A;  3P90 A;  3D6I A;  5HQP A;  3UMA A;  3D5J A;  4ZXG A;  3EMX A;  4MMM A;  5D96 A;  1GP1 A;  2I4A A;  3L78 A;  3GKK A;  1MDI A;  4J2F A;  2VD1 A;  1TK5 B;  2XBI A;  5A4W A;  1J0F A;  2B7J A;  3DD3 A;  4IS0 A;  4MZB A;  4O5R A;  5IMC A;  2VM2 A;  2O85 A;  2JZR A;  3L4N A;  1QGV A;  4NMU A;  4PUA A;  1JZW A;  4KE3 A;  1XOB A;  1B4P A;  4EE0 A;  2LNT A;  3IOS A;  3ME8 A;  4XS1 A;  2XHF A;  2H70 A;  5JWQ B;  2DMM A;  3ZVJ D;  3RHC A;  5J9C A;  2IMI A;  5G2Z A;  5CRW A;  12GS A;  2C0G A;  5CRE A;  4POM A;  3CSH A;  5F07 A;  1GSU A;  3M9K A;  4NV2 A;  3WD6 A;  2GTU A;  4TXO A;  4BL7 B;  1PL1 A;  4BVY A;  5G1K A;  1A8Y A;  2A4V A;  4EIP A;  1T4Y A;  1AQV A;  4XS6 A;  4G19 A;  3PH9 A;  2KOK A;  4I6X A;  4OFT A;  3N9J A;  4PUF C;  4TR1 A;  5LCZ A;  3M9J A;  1YJ6 A;  2WJU A;  3Q18 A;  2VL9 A;  2GQL A;  3G9B A;  4Z2U A;  5B6N A;  5KN2 A;  4PGT A;  5F05 A;  2L4Q A;  2FD3 A;  2VCQ A;  1XPV A;  3C1S A;  4YH2 A;  2BMX A;  2YWO A;  3FZ4 A;  3ZL5 A;  1WPI A;  3H4K A;  5FHI A;  4KSM A;  3C1R A;  3KMO A;  2XPE A;  2H1B A;  4MF7 A;  2H19 A;  1SJ6 A;  4K9Z A;  7GSS A;  4EF0 A;  4O5Q A;  2G0F A;  3H79 A;  3TRX A;  5HR1 A;  3M8N A;  1YF0 A;  5JCW A;  6GST A;  1FOH A;  2OE1 A;  2M72 A;  1GL8 A;  2YJ7 A;  2R5G A;  4I2U A;  2NPB A;  4MF6 A;  2PU9 C;  3EVI A;  2G2Q A;  1PQN A;  4KGI A;  1NHY A;  3ZRE A;  4F2I A;  4KA0 A;  5CP1 A;  1TRW A;  2L5O A;  3TKP A;  1FVJ A;  1XBS A;  1ERV A;  2IIY A;  3IA1 A;  1SK0 A;  3P8W A;  3IR4 A;  4YAP A;  3QFB C;  4HEA 2;  4YAV A;  1KBN A;  1XOA A;  4PX1 A;  2D2Z A;  1SU9 A;  3APS A;  5F06 A;  2PGT A;  2J23 A;  3P7X A;  4EKZ A;  2PVO C;  4EDY A;  1ML6 A;  4N10 A;  1AC1 A;  3GH9 A;  2GVP A;  4G0K A;  1N2A A;  4GWR A;  4WET A;  3A3T A;  2CX3 A;  3ERF A;  3GL3 A;  1TRV A;  4HJ2 A;  4EDZ A;  1KTE A;  22GS A;  2ZUP A;  5D9W A;  3KH9 A;  4MK3 A;  5JCU A;  2QA1 A;  5ABR A;  1TW9 A;  9GSS A;  4YQM A;  2L4C A;  3F6D A;  2AHE A;  3Q6O A;  2C4J A;  1OC3 A;  3VWU A;  3QFA C;  3I43 A;  4JZQ A;  2LRC A;  1MEK A;  1SK2 A;  5GAN D;  4HQZ A;  2PUK C;  1ZGN A;  2JSY A;  5HFG A;  3KM6 A;  4IQA A;  2VLT A;  4ML1 A;  3ZYW A;  4FYU A;  4Z7X A;  4NWY A;  4AJ7 A;  4ID0 A;  4YKG A;  3SWL A;  4Q5R A;  4PQH A;  4MA9 A;  2FA8 A;  3GUR A;  2YWN A;  1O7U A;  1XW6 A;  4I97 A;  1SJZ A;  5B8A A;  2GLR A;  3OR5 A;  4G0I A;  5FT3 A;  2O7K A;  4V2N A;  4DVC A;  5B6M A;  4D73 B;  5CRG A;  3Q74 A;  1U88 A;  1TKD B;  4IP6 A;  3TOT A;  2CVD A;  2HSH A;  1USB A;  5ECN B;  2VLV A;  1O85 A;  2JL4 A;  3H1N A;  2P0G A;  2GS3 A;  2B5X A;  1HNB A;  2L6C A;  2FWE A;  2F9S A;  3LGC A;  1JZO A;  2VL2 C;  2ZNM A;  5IMF A;  1K0D A;  4HDE A;  1TI3 A;  2FY6 A;  2PMT A;  2HT9 A;  1SEN A;  3L9U A;  4IBP A;  4OMV A;  3GYK A;  4CY6 A;  2LRN A;  4ICY A;  2GSR A;  3IK9 A;  2JZS A;  1S3R A;  5FWG A;  4KCA A;  4YQV A;  2CVK A;  1QXH A;  1YQ1 A;  5ENU A;  2I1U A;  4MPG A;  2IN3 A;  4MH3 A;  4L5L A;  5A4U A;  1PKZ A;  3BOA A;  4GQF A;  4QQ7 A;  3FRC A;  4Q5F A;  2FWF A;  3RDW A;  2VIM A;  1T3B A;  4HZ2 A;  1V2A A;  2QKE A;  3DEX A;  4OCE A;  4TR0 A;  5DVB A;  3TCO A;  2IMK A;  2ON7 A;  5IMA A;  2F8F A;  2XPD A;  2F3M A;  1QUW A;  4AJ6 A;  2H72 A;  1Y6E A;  2ALB A;  2IL3 A;  2H6Y A;  2XC2 A;  4G10 A;  2HRK A;  4HU9 A;  4POB A;  1VF4 A;  1GNE A;  4KSO A;  2DML A;  5J3R A;  1OC8 A;  1MTC A;  1GTA A;  4ACS A;  4EVM A;  4PQ1 A;  1ON4 A;  4IVF A;  1JHB A;  3ZML A;  3KGK A;  2VM1 A;  4ZL7 A;  5DAL A;  3QCP A;  2KUC A;  1RQM A;  2L59 A;  5KN0 A;  4WXT A;  2C3N A;  4ISD A;  4G9H A;  1F9M A;  2H0H A;  1YKC A;  2R0P A;  1PMT A;  2KP2 A;  1Z9H A;  4MJC A;  2V6K A;  4POK A;  1X0R A;  3K8N A;  2FNO A;  3U5R E;  3GV1 A;  3WYW A;  1M0U A;  3ERG A;  2CQ9 A;  4XRD A;  4ECJ A;  2IFQ B;  1HQO A;  4GCI A;  3IDV A;  1S3A A;  2YV7 A;  2LQO A;  4MJB A;  3LYP A;  1U3I A;  4KCE A;  4PTS A;  1THX A;  5CRH A;  5F8B A;  3DKS A;  1XWB A;  3WGD A;  4Z2T A;  2QSI A;  4L5O A;  1LU4 A;  2A4H A;  2YWM A;  1F2E A;  4PXO A;  4LMV A;  3G7I A;  1T7P B;  4DSS B;  2HZE B;  3F6F A;  4PNF A;  1H75 A;  1PN0 A;  3TKR A;  1RW1 A;  3BJ5 A;  1SKR B;  3GL5 A;  2BTO T;  2DSA A;  2X4A A;  4GTU A;  1SL2 B;  1ZYP A;  2EIQ A;  4JE1 A;  2REM A;  1O73 A;  3VWX A;  1G6W A;  2CAI A;  1EP8 A;  3I69 A;  2H6X A;  3TB2 A;  3BD2 A;  1UC7 A;  1V58 A;  1V98 A;  2L57 A;  5ECM B;  1IYH A;  6GSU A;  3PPU A;  2GST A;  2VOC A;  5C04 A;  3TKS C;  4ML6 A;  2N5B A;  3EU4 A;  1A2M A;  2GDR A;  2N5A A;  2MBS A;  4HOJ A;  4HQS A;  1BJX A;  5IPH A;  1EOH A;  1AQX A;  1WMJ A;  3J7Y b;  2R0C A;  2A2R A;  5LNK e;  5GSS A;  1R4W A;  1OE8 A;  3QR6 A;  1DE1 A;  1XZO A;  4N0Z A;  1LBK A;  3CRT A;  3ISO A;  2WZ9 A;  4PNG A;  3L9S A;  1VGL A;  2WB9 A;  3D4M A;  4KDY A;  3QDN A;  3HVN A;  4FQU A;  3TOU A;  2LEG A;  4E8H A;  3BBY A;  4TW5 A;  3TGZ A;  1K0M A;  4LL4 B;  3HJM A;  3CTG A;  2IWT A;  3GTU B;  3KEB A;  4ULX A;  1EGO A;  2VL2 A;  4KB3 A;  2MMO A;  1T1V A;  4TKY A;  1ZMA A;  2YJH A;  4KUN A;  5ELA A;  4KDX A;  4BL7 A;  3EUR A;  3LQ7 A;  5IOW A;  3GX0 A;  2IME A;  4V2L A;  3UVH A;  4BVX B;  4O32 A;  3VPQ A;  2K8V A;  3CXG A;  3KZQ A;  2LV3 A;  4TR3 A;  5AIV A;  1VF3 A;  1M9B A;  4ECB A;  5CAX A;  2VAF A;  1Z3E A;  4KAE A;  3GKX A;  4IKH A;  1RK4 A;  2V32 A;  2WRT A;  1Q98 A;  3FEU A;  1YF1 A;  4X0X A;  3PIN A;  4DSR A;  3FY7 A;  4GXZ A;  2HSY A;  1XXU A;  5IPG A;  3G7Y A;  2L5L A;  5IO0 A;  1M2B A;  2JAD A;  4NHZ A;  2RM6 A;  1XWG A;  2FA4 A;  2K9F A;  3ZFL A;  5DJM A;  3HKR A;  2HI7 A;  4AGS A;  3M0F A;  3ZLP A;  2E7P A;  3HVV A;  1A2L A;  3KP8 A;  2CA8 A;  1UN2 A;  2CZ3 A;  1O8X A;  2GT6 A;  2X8G A;  5A5K A;  3TJF A;  3KCM A;  4ZL9 A;  3MWH A;  2OE0 A;  4KX4 A;  3O3T A;  4V2M A;  5KEJ A;  2VCT A;  3ZIT A;  1CQH A;  2NDO A;  4IP1 A;  4N0V A;  3P2A A;  2OA7 A;  1M2D A;  2AV4 A;  4GSN A;  4QL9 A;  2TIR A;  1ACV A;  2H76 A;  3QPM A;  2E0Q A;  3GA4 A;  3NZN A;  3EPT A;  5GST A;  2GSS A;  2H66 A;  4HS1 A;  5INY A;  4KF9 A;  4HJM A;  3W6G A;  2DLX A;  3A5I A;  1AXD A;  4ECI A;  1GSY A;  2LTK A;  3VPT A;  4HZ4 A;  1WOU A;  2R37 A;  2LST A;  1ABA A;  3HA9 A;  3RAZ A;  2H0I A;  3F4R A;  2P31 A;  3HD5 A;  1FB0 A;  1SYX A;  4KH7 A;  1GUL A;  4ZIJ A;  2LUS A;  2A2S A;  3DML A;  4HU7 A;  2YZU A;  3ZTL A;  2BJX A;  1MDK A;  2GZP A;  3W8J A;  1W89 A;  3CYN A;  17GS A;  2V41 A;  3LOR A;  3RHB A;  2YAN A;  5BMU A;  6GSV A;  4G0L A;  3ME7 A;  3F3R A;  5G5E A;  2MMZ A;  1EV9 A;  4IN0 A;  2IMF A;  3IK7 A;  2V2G A;  3LEF A;  1K0N A;  2PN8 A;  3EC3 A;  4O5U A;  2FCH A;  3GX8 A;  4EL1 A;  4MZW A;  5DCG A;  3F4T A;  3TKS A;  3J7Y k;  2PPT A;  3C7M A;  2VCW A;  1Z7P A;  4RI7 A;  1JLW A;  2VCX A;  1EEM A;  2PBJ A;  5GZZ B;  2LKU A;  3LXT A;  1ZYN A;  3QMX A;  1OVN A;  2CVB A;  3C8E A;  4JU5 A;  1G0T A;  1I9D A;  3H8Q A;  4ILF A;  2WS2 A;  4PQI A;  3IBH A;  4D73 A;  3U6V A;  1GNW A;  5DAK B;  2PVQ A;  1R5P A;  3KP9 A;  4FYC A;  4XTS A;  1CQG A;  4NV5 A;  2R0G A;  3HZ8 A;  4NAX A;  1F6M C;  4FO5 A;  3GKM A;  1GLP A;  3VI5 A;  1TXX A;  1U3A A;  2QA2 A;  4O7H A;  3S9F A;  4JR4 A;  8GSS A;  4BA7 A;  4H86 A;  3L9V A;  16GS A;  2OAC A;  2CV4 A;  2AAW A;  1YY7 A;  1XWC A;  3GFK A;  1K0B A;  4NXI A;  1T00 A;  5H5Q A;  1X9S B;  4IHU A;  2QGV A;  3KTL A;  5B8B A;  5AIX A;  2YCD A;  1Z6M A;  3TJK A;  3EE2 A;  2LJK A;  2H1A A;  3AY8 A;  3M1G A;  1G6Y A;  4BIK A;  1C72 A;  1ERT A;  4RQR A;  3VI7 A;  2H01 A;  4F0B A;  2UZ8 A;  4TOP A;  5IMD A;  4GQC A;  1J08 A;  2I81 A;  3RPP A;  2HE3 A;  1OE7 A;  1THO A;  2OKA A;  4MF5 A;  2C0E A;  1XFL A;  4MAB A;  1A2J A;  4FIW A;  2DKH A;  4FH8 A;  2H30 A;  4V1A g;  4TXV A;  2WUL A;  1KNG A;  2DIZ A;  3FR3 A;  1AAZ A;  4GSS A;  3A2W A;  2R6K A;  4GF0 A;  1SD9 A;  2WFC A;  2VCV A;  1SYR A;  5LD0 A;  4ZBA A;  4TR4 A;  1AQW A;  5J5N A;  4WKW A;  1FG4 A;  1TK0 B;  3ED3 A;  2OBK A;  3IC8 A;  2GZZ A;  3LJR A;  2B5E A;  1R5A A;  3TJJ A;  4OFN A;  4J57 E;  3ZZX A;  1B8X A;  3GUS A;  1DE2 A;  1WJK A;  2CZ2 A;  2TRC P;  2IFQ A;  2JSZ A;  1M3J A;  3LYK A;  2Z9S A;  4RI6 A;  1QQ2 A;  4PUR A;  4MLY A;  3O76 A;  3D21 A;  2HSM A;  2C80 A;  1GUH A;  3PR8 A;  4K7O A;  3APQ A;  1SJI A;  3WT1 A;  4CHS A;  1OC9 B;  4OWY A;  1G7O A;  3N5O A;  4DSS A;  1YKA A;  2VCZ A;  2HZE A;  3TRP A;  3QAG A;  2AB6 A;  2R2J A;  1JLV A;  1URM A;  3ZRD A;  1ZZY A;  3FR6 A;  5AN1 A;  2C3T A;  4DSQ A;  1ZOF A;  3DVW A;  3SBC A;  3GIX A;  1GSD A;  5J4U A;  1R7H A;  1H4O A;  4K0G A;  3MIX A;  3LWA A;  2DJK A;  4LL1 B;  1AIU A;  5IM9 A;  1XCC A;  3MYD A;  6GSS A;  4L8E A;  2KP1 A;  4Z2R A;  2M80 A;  2OE3 A;  1TU8 A;  2H74 A;  1O81 A;  4Q5N A;  3FW2 A;  3WGE A;  2MMA A;  5CO3 A;  1MDJ A;  3TJB A;  2HLS A;  2J9H A;  3GKN A;  4EIQ A;  2FWH A;  3E9J B;  5KOX A;  1PN9 A;  4I8B A;  1K0C A;  2PER A;  4K0N A;  4WR5 A;  2NVL A;  1A0R P;  1K3O A;  3HY2 A;  1V57 A;  2VUP A;  1Y25 A;  3KH7 A;  4BWS A;  1ST9 A;  1F37 A;  3UL3 A;  4F82 A;  4E8E A;  2LS5 A;  1GUK A;  1A23 A;  4MCU A;  5DBQ A;  4WF5 A;  4JR6 A;  2H73 A;  5CRD A;  1BQ7 A;  4AF2 A;  1FOV A;  1FO5 A;  3TRQ A;  2XBQ A;  1U87 A;  18GS A;  1NW2 A;  2DJ1 A;  3F63 A;  1N8J A;  2DKI A;  1U6T A;  3EWL A;  2HRF A;  2K8S A;  2GT5 A;  3IRA A;  3GTU A;  1X5E A;  2B6M A;  4AJ8 A;  2OAD A;  3IC4 A;  1WIK A;  2HXK A;  2O8V B;  4ZL8 A;  1ZL9 A;  4BPY A;  19GS A;  3CQF A;  5D9X A;  3GST A;  4K7N A;  3TDG A;  4OO4 A;  1SKW B;  2K6V A;  5ECR B;  4BVX A;  2JU5 A;  1OAZ A;  1VF1 A;  3ZIV A;  5GAP D;  5DCH A;  1GSQ A;  5COH A;  2I9H A;  3DRN A;  3DYR A;  5L71 A;  1XIY A;  4WBR D;  2DJ0 A;  1M9A A;  2V6O A;  2H6Z A;  2N5F A;  1MD4 A;  4F03 A;  3US3 A;  2RM5 A;  4GLT A;  4EXJ A;  1M2A A;  3IHG A;  3HVS A;  1NM3 A;  3A2V A;  1K0A A;  2IMD A;  5ECI B;  4IJ3 A;  4BWQ A;  3JCM L;  3DIE A;  3CSI A;  4ECC A;  1T8E B;  1X9W B;  3DXB A;  2E2G A;  3O6T A;  1S3D A;  1GTI A;  3TUE A;  1V40 A;  1K3L A;  1I5G A;  5ID2 B;  4WR4 A;  3CSJ A;  1M7T A;  2HZF A;  1TP9 A;  5ECQ B;  1JZR A;  1XG8 A;  3RPN A;  4IQ1 A;  4WF4 A;  3ZIJ A;  4K2D A;  3GH6 A;  4K8M A;  1BED A;  5G1L A;  2VD0 A;  1TRS A;  4QL7 A;  3IAS 2;  1DSB A;  4K2X A;  5HR2 A;  4G2E A;  4USS A;  5IQY A;  2GQK A;  3KTB A;  1GUM A;  1FHE A;  1M3I A;  1NHO A;  3ERW A;  4MP4 A;  4P3Y B;  14GS A;  2GQM A;  4XS4 B;  1S3C A;  4V1A p;  1YEX A;  1ZYQ B;  4K5S A;  4F9Z A;  4IJI A;  3LXZ A;  1PRX A;  4K5R A;  5ECO B;  1ZYE A;  1GSE A;  2EC4 A;  3FZ9 A;  5JCG A;  2PWJ A;  1JZD A;  1YZX A;  5F0G A;  2YPM A;  5IOX A;  2WDU A;  2YOI A;  2EIO A;  3PGT A;  3D22 A;  3TKQ A;  1E2Y A;  3QOU A;  4MZC A;  4JBB A;  3ZVJ A;  1BYE A;  1QMV A;  5BRT A;  3WGX A;  4POL A;  1UA5 A;  3FKF A;  2RII A;  4EUY A;  2IJY A;  1XWA A;  3UBL A;  5EL8 A;  1SL1 B;  1GTB A;  4K6X A;  1HNA A;  2EIR A;  1GWC A;  3FZA A;  2DJ3 A;  2LJA A;  2LRT A;  1EP7 A;  2B7K A;  5IO2 A;  1EZK A;  1GSF A;  1B48 A;  2DC5 A;  5D93 A;  2OBI A;  1Z7R A;  4I5Q A;  4N30 A;  3IV4 A; 
#chains in the Genus database with same CATH homology
 3UEM A;  2FGX A;  5EY6 A;  5DAK A;  1OKT A;  3MDK A;  4K1F A;  1LJR A;  1TK8 B;  3FHK A;  1GSS A;  1GTU A;  2H8L A;  1EV4 A;  1TDI A;  2B1L A;  1W4V A;  5DQY A;  4KW6 A;  2C0F A;  4ZB6 A;  1EGR A;  2I3Y A;  3D0Z A;  5ECH B;  2HRA A;  2O87 A;  2YP6 A;  3MAK A;  5G30 A;  1J9B A;  1V9W A;  2MYG A;  3HVX A;  2HNL A;  2AUV A;  2H1D A;  6GSX A;  5EPF A;  2FLS A;  1K0O A;  4HUA A;  3V1W A;  4LMW A;  2NTO A;  4MJE A;  2IPA A;  1E6B A;  1FW1 A;  2DJ2 A;  2MZC A;  1GLQ A;  4CW9 A;  2RUE A;  1YDK A;  1OYJ A;  3BCI A;  4IW9 A;  1SL0 B;  5HFK A;  3FR9 A;  2FHE A;  5J9B A;  3HDC A;  3F4S A;  4GST A;  3MSZ A;  2GGT A;  4OD7 A;  3LFL A;  2QC7 A;  3QAV A;  1WE0 A;  4J56 E;  1TTZ A;  3HHV A;  2VL3 A;  4XRA A;  2F51 A;  5ELG A;  5ECP B;  2ON5 A;  2E2M A;  1PSQ A;  2H1G A;  5CYY A;  4TN8 A;  1SK1 A;  4OO5 A;  1FVK A;  1XW9 A;  4MDC A;  1TRU A;  3C71 A;  2DBC A;  2V1M A;  1XW5 A;  4ZB9 A;  4MJA A;  2R3X A;  4TXO B;  1XVW A;  1PL2 A;  2HYX A;  3HZ4 A;  5D9V A;  4CY8 A;  4BVY B;  1BG5 A;  4X1U A;  20GS A;  1T4Z A;  4MNN A;  1XVQ A;  3Q19 A;  4ZIL A;  3TJG A;  2OJL A;  1HNC A;  4YQU A;  4TR1 B;  2YV9 A;  4X4J A;  2L6D A;  4IEL A;  2K18 A;  3VK9 A;  3WT2 A;  1OKD A;  3APO A;  1R26 A;  1VRS D;  1SKS B;  2B3S A;  3D4T A;  2HRN A;  5HFI A;  3UIW A;  1HYU A;  3F8U A;  5DDL A;  1OC9 A;  1VF2 A;  3LW9 A;  5ECL B;  3QAW A;  4YKF A;  1PX6 A;  5ECK B;  2YZH A;  3ZFB A;  2H71 A;  4WBJ A;  3DVX A;  4MPF A;  1BX9 A;  2FUG 2;  2GZY A;  2B1K A;  5D73 A;  5D8I A;  2HFD A;  2VLU A;  5KN3 A;  5ECS A;  5HR0 A;  6GSY A;  1FAA A;  3UOM A;  4LLR A;  3M3M A;  3IXR A;  4KND A;  2F8A A;  2X99 A;  4MH2 A;  4A5P A;  3VWW A;  2M46 A;  1DUG A;  3L0H A;  1IYI A;  2LNS A;  2H0G A;  3UJ1 A;  1TI1 A;  2WCI A;  1B4Q A;  5E4W A;  3FYG A;  2X8C A;  1A24 A;  3GSS A;  4KDU A;  3E3E A;  3VWV A;  3IE3 A;  3GMF A;  1Z5Y E;  4JED A;  5J41 A;  3IPZ A;  4O92 A;  1MD3 A;  4NHW A;  2YN1 A;  3GRX A;  3F0I A;  6GSW A;  4Q5Q A;  13GS A;  2FWG A;  3NIV A;  3KJY A;  3KMN A;  1PKW A;  4ZBB A;  2TRX A;  1O6J A;  1PX7 A;  2YNX A;  4RQX A;  3CBU A;  2H75 A;  4WEY A;  1M99 A;  3CRU A;  5E59 A;  3CTF A;  3HJP A;  2KLX A;  1ERW A;  2X49 A;  1UVZ A;  2RLI A;  4IGJ A;  3LSZ A;  3I6A A;  5H5S A;  3DGQ A;  3KXO A;  2C0D A;  10GS A;  2YWI A;  1A8L A;  2AJQ B;  4L0W A;  3HJO A;  3R3E A;  3UAR A;  2AYT A;  5AIS A;  5HR3 A;  3H93 A;  4EO3 A;  4F0C A;  1EWX A;  2C1Y A;  5EVO A;  1ZCP A;  4TRX A;  1QFN A;  4NPB A;  1EEJ A;  3FK8 A;  2X8H A;  5KOW A;  2LJR A;  2P5Q A;  5AGY A;  1TOF A;  3GN3 A;  5G5F A;  2ES7 A;  4OCF A;  3HCZ A;  3EIN A;  2R4V A;  4XIH A;  5G31 A;  2MBT A;  5DJL A;  2WGR A;  4DEJ A;  3ZMK A;  3HXS A;  1WP0 A;  2P5R A;  5D9T A;  1SD8 A;  1PA3 A;  2RUF A;  3IHQ A;  1AUC A;  1GRX A;  5ID2 A;  3UBK A;  1TU7 A;  1QK8 A;  2KHP A;  3RBT A;  1F3B A;  3A2X A;  2NBS A;  4CDO A;  1PGT A;  4FYB A;  3I9V 2;  3DWV A;  3FZ5 A;  3W8S A;  1FB6 A;  1YEP A;  1G7E A;  2O89 A;  3G7J A;  3R2Q A;  3LG6 A;  1Z6N A;  1JFU A;  11GS A;  1X5D A;  3CMI A;  4XS4 A;  3E0U A;  3EU3 A;  2C8U A;  3EMP A;  2CT6 A;  5JWR B;  4ZB8 A;  2DIY A;  2LQQ A;  2JAC A;  2X64 A;  1B9Y C;  1TJD A;  1WRY A;  4ZBD A;  5C00 A;  3TKS E;  5A4V A;  2B5Y A;  2CAQ A;  3F3Q A;  1Q4J A;  3GNJ A;  1AW9 A;  2GSQ A;  4GRF A;  3A5W A;  3VUR A;  2VO4 A;  1B9X C;  1GH2 A;  5DAL B;  5IMZ A;  3IAM 2;  3C73 A;  4K7I A;  4N11 A;  1PD2 1;  2CX4 A;  5CNW A;  1ERU A;  1O8W A;  4XHM A;  3VFI A;  1X5C A;  4TVE A;  1HD2 A;  4I2T A;  3QD9 A;  5B7C A;  1BAY A;  4RUV A;  3UVT A;  3GHA A;  3FMW A;  5DQS A;  5IMV A;  4L0U A;  1NSW A;  3KD0 A;  1WWJ A;  5IIZ A;  4OFM A;  3EYT A;  3HYP A;  3MNG A;  3F9U A;  1A0F A;  1F3A A;  2DJJ A;  4JRR A;  1ILO A;  4X43 A;  2MMN A;  1X9M B;  1XWK A;  1DBY A;  1K3Y A;  1KEB A;  4HI7 A;  2A2P A;  2ZCT A;  3VLN A;  5H5R A;  3KIJ A;  2C3Q A;  2JZT A;  4XCS A;  4EC0 A;  3BCK A;  5KN1 A;  4LA1 A;  5JWO B;  1EOG A;  3NOF A;  3UAP A;  3P90 A;  3D6I A;  5HQP A;  3UMA A;  3D5J A;  4ZXG A;  3EMX A;  4MMM A;  5D96 A;  1GP1 A;  2I4A A;  3L78 A;  3GKK A;  1MDI A;  4J2F A;  2VD1 A;  1TK5 B;  2XBI A;  5A4W A;  1J0F A;  2B7J A;  3DD3 A;  4IS0 A;  4MZB A;  4O5R A;  5IMC A;  2VM2 A;  2O85 A;  2JZR A;  3L4N A;  1QGV A;  4NMU A;  4PUA A;  1JZW A;  4KE3 A;  1XOB A;  1B4P A;  4EE0 A;  2LNT A;  3IOS A;  3ME8 A;  4XS1 A;  2XHF A;  2H70 A;  5JWQ B;  2DMM A;  3ZVJ D;  3RHC A;  5J9C A;  2IMI A;  5G2Z A;  5CRW A;  12GS A;  2C0G A;  5CRE A;  4POM A;  3CSH A;  5F07 A;  1GSU A;  3M9K A;  4NV2 A;  3WD6 A;  2GTU A;  4TXO A;  4BL7 B;  1PL1 A;  4BVY A;  5G1K A;  1A8Y A;  2A4V A;  4EIP A;  1T4Y A;  1AQV A;  4XS6 A;  4G19 A;  3PH9 A;  2KOK A;  4I6X A;  4OFT A;  3N9J A;  4PUF C;  4TR1 A;  5LCZ A;  3M9J A;  1YJ6 A;  2WJU A;  3Q18 A;  2VL9 A;  2GQL A;  3G9B A;  4Z2U A;  5B6N A;  5KN2 A;  4PGT A;  5F05 A;  2L4Q A;  2FD3 A;  2VCQ A;  1XPV A;  3C1S A;  4YH2 A;  2BMX A;  2YWO A;  3FZ4 A;  3ZL5 A;  1WPI A;  3H4K A;  5FHI A;  4KSM A;  3C1R A;  3KMO A;  2XPE A;  2H1B A;  4MF7 A;  2H19 A;  1SJ6 A;  4K9Z A;  7GSS A;  4EF0 A;  4O5Q A;  2G0F A;  3H79 A;  3TRX A;  5HR1 A;  3M8N A;  1YF0 A;  5JCW A;  6GST A;  1FOH A;  2OE1 A;  2M72 A;  1GL8 A;  2YJ7 A;  2R5G A;  4I2U A;  2NPB A;  4MF6 A;  2PU9 C;  3EVI A;  2G2Q A;  1PQN A;  4KGI A;  1NHY A;  3ZRE A;  4F2I A;  4KA0 A;  5CP1 A;  1TRW A;  2L5O A;  3TKP A;  1FVJ A;  1XBS A;  1ERV A;  2IIY A;  3IA1 A;  1SK0 A;  3P8W A;  3IR4 A;  4YAP A;  3QFB C;  4HEA 2;  4YAV A;  1KBN A;  1XOA A;  4PX1 A;  2D2Z A;  1SU9 A;  3APS A;  5F06 A;  2PGT A;  2J23 A;  3P7X A;  4EKZ A;  2PVO C;  4EDY A;  1ML6 A;  4N10 A;  1AC1 A;  3GH9 A;  2GVP A;  4G0K A;  1N2A A;  4GWR A;  4WET A;  3A3T A;  2CX3 A;  3ERF A;  3GL3 A;  1TRV A;  4HJ2 A;  4EDZ A;  1KTE A;  22GS A;  2ZUP A;  5D9W A;  3KH9 A;  4MK3 A;  5JCU A;  2QA1 A;  5ABR A;  1TW9 A;  9GSS A;  4YQM A;  2L4C A;  3F6D A;  2AHE A;  3Q6O A;  2C4J A;  1OC3 A;  3VWU A;  3QFA C;  3I43 A;  4JZQ A;  2LRC A;  1MEK A;  1SK2 A;  5GAN D;  4HQZ A;  2PUK C;  1ZGN A;  2JSY A;  5HFG A;  3KM6 A;  4IQA A;  2VLT A;  4ML1 A;  3ZYW A;  4FYU A;  4Z7X A;  4NWY A;  4AJ7 A;  4ID0 A;  4YKG A;  3SWL A;  4Q5R A;  4PQH A;  4MA9 A;  2FA8 A;  3GUR A;  2YWN A;  1O7U A;  1XW6 A;  4I97 A;  1SJZ A;  5B8A A;  2GLR A;  3OR5 A;  4G0I A;  5FT3 A;  2O7K A;  4V2N A;  4DVC A;  5B6M A;  4D73 B;  5CRG A;  3Q74 A;  1U88 A;  1TKD B;  4IP6 A;  3TOT A;  2CVD A;  2HSH A;  1USB A;  5ECN B;  2VLV A;  1O85 A;  2JL4 A;  3H1N A;  2P0G A;  2GS3 A;  2B5X A;  1HNB A;  2L6C A;  2FWE A;  2F9S A;  3LGC A;  1JZO A;  2VL2 C;  2ZNM A;  5IMF A;  1K0D A;  4HDE A;  1TI3 A;  2FY6 A;  2PMT A;  2HT9 A;  1SEN A;  3L9U A;  4IBP A;  4OMV A;  3GYK A;  4CY6 A;  2LRN A;  4ICY A;  2GSR A;  3IK9 A;  2JZS A;  5FWG A;  4KCA A;  4YQV A;  2CVK A;  1QXH A;  1YQ1 A;  5ENU A;  2I1U A;  4MPG A;  2IN3 A;  4MH3 A;  4L5L A;  5A4U A;  1PKZ A;  3BOA A;  4GQF A;  4QQ7 A;  3FRC A;  4Q5F A;  2FWF A;  3RDW A;  2VIM A;  1T3B A;  4HZ2 A;  1V2A A;  2QKE A;  3DEX A;  4OCE A;  4TR0 A;  5DVB A;  3TCO A;  2IMK A;  2ON7 A;  5IMA A;  2F8F A;  2XPD A;  2F3M A;  1QUW A;  4AJ6 A;  2H72 A;  1Y6E A;  2ALB A;  2IL3 A;  2H6Y A;  2XC2 A;  4G10 A;  2HRK A;  4HU9 A;  4POB A;  1VF4 A;  1GNE A;  4KSO A;  2DML A;  5J3R A;  1OC8 A;  1MTC A;  1GTA A;  4ACS A;  4EVM A;  4PQ1 A;  1ON4 A;  4IVF A;  1JHB A;  3ZML A;  3KGK A;  2VM1 A;  4ZL7 A;  5DAL A;  3QCP A;  2KUC A;  1RQM A;  2L59 A;  5KN0 A;  4WXT A;  2C3N A;  4ISD A;  4G9H A;  1F9M A;  2H0H A;  1YKC A;  2R0P A;  1PMT A;  2KP2 A;  1Z9H A;  4MJC A;  2V6K A;  4POK A;  1X0R A;  3K8N A;  2FNO A;  3U5R E;  3GV1 A;  3WYW A;  1M0U A;  3ERG A;  2CQ9 A;  4XRD A;  4ECJ A;  2IFQ B;  1HQO A;  4GCI A;  3IDV A;  1S3A A;  2YV7 A;  2LQO A;  4MJB A;  3LYP A;  1U3I A;  4KCE A;  4PTS A;  1THX A;  5CRH A;  5F8B A;  3DKS A;  1XWB A;  3WGD A;  4Z2T A;  2QSI A;  4L5O A;  1LU4 A;  2A4H A;  2YWM A;  1F2E A;  4PXO A;  4LMV A;  3G7I A;  1T7P B;  4DSS B;  2HZE B;  3F6F A;  4PNF A;  1H75 A;  1PN0 A;  3TKR A;  1RW1 A;  3BJ5 A;  1SKR B;  3GL5 A;  2BTO T;  2DSA A;  2X4A A;  4GTU A;  1SL2 B;  1ZYP A;  2EIQ A;  4JE1 A;  2REM A;  1O73 A;  3VWX A;  1G6W A;  2CAI A;  1EP8 A;  3I69 A;  2H6X A;  3TB2 A;  3BD2 A;  1UC7 A;  1V58 A;  1V98 A;  2L57 A;  5ECM B;  1IYH A;  6GSU A;  3PPU A;  2GST A;  2VOC A;  5C04 A;  3TKS C;  4ML6 A;  2N5B A;  3EU4 A;  1A2M A;  2GDR A;  2N5A A;  2MBS A;  4HOJ A;  4HQS A;  1BJX A;  5IPH A;  1EOH A;  1AQX A;  1WMJ A;  3J7Y b;  2R0C A;  2A2R A;  5LNK e;  5GSS A;  1R4W A;  1OE8 A;  3QR6 A;  1DE1 A;  1XZO A;  4N0Z A;  1LBK A;  3CRT A;  3ISO A;  2WZ9 A;  4PNG A;  3L9S A;  1VGL A;  2WB9 A;  3D4M A;  4KDY A;  3QDN A;  4FQU A;  3TOU A;  2LEG A;  4E8H A;  3BBY A;  4TW5 A;  3TGZ A;  1K0M A;  4LL4 B;  3HJM A;  3CTG A;  2IWT A;  3GTU B;  3KEB A;  4ULX A;  1EGO A;  2VL2 A;  4KB3 A;  2MMO A;  1T1V A;  4TKY A;  1ZMA A;  2YJH A;  4KUN A;  5ELA A;  4KDX A;  4BL7 A;  3EUR A;  3LQ7 A;  5IOW A;  3GX0 A;  2IME A;  4V2L A;  3UVH A;  4BVX B;  4O32 A;  3VPQ A;  2K8V A;  3CXG A;  3KZQ A;  2LV3 A;  4TR3 A;  5AIV A;  1VF3 A;  1M9B A;  4ECB A;  5CAX A;  2VAF A;  1Z3E A;  4KAE A;  3GKX A;  4IKH A;  1RK4 A;  2V32 A;  2WRT A;  1Q98 A;  3FEU A;  1YF1 A;  4X0X A;  3PIN A;  4DSR A;  3FY7 A;  4GXZ A;  2HSY A;  1XXU A;  5IPG A;  3G7Y A;  2L5L A;  5IO0 A;  1M2B A;  2JAD A;  4NHZ A;  2RM6 A;  1XWG A;  2FA4 A;  2K9F A;  3ZFL A;  5DJM A;  3HKR A;  2HI7 A;  4AGS A;  3M0F A;  3ZLP A;  2E7P A;  3HVV A;  1A2L A;  3KP8 A;  2CA8 A;  1UN2 A;  2CZ3 A;  1O8X A;  2GT6 A;  2X8G A;  5A5K A;  3TJF A;  3KCM A;  4ZL9 A;  3MWH A;  2OE0 A;  4KX4 A;  3O3T A;  4V2M A;  5KEJ A;  2VCT A;  3ZIT A;  1CQH A;  2NDO A;  4IP1 A;  4N0V A;  3P2A A;  2OA7 A;  1M2D A;  2AV4 A;  4GSN A;  4QL9 A;  2TIR A;  1ACV A;  2H76 A;  3QPM A;  2E0Q A;  3GA4 A;  3NZN A;  3EPT A;  5GST A;  2GSS A;  2H66 A;  4HS1 A;  5INY A;  4KF9 A;  4HJM A;  3W6G A;  2DLX A;  3A5I A;  1AXD A;  4ECI A;  1GSY A;  2LTK A;  3VPT A;  4HZ4 A;  1WOU A;  2R37 A;  2LST A;  1ABA A;  3HA9 A;  3RAZ A;  2H0I A;  3F4R A;  2P31 A;  3HD5 A;  1FB0 A;  1SYX A;  4KH7 A;  1GUL A;  4ZIJ A;  2LUS A;  2A2S A;  3DML A;  4HU7 A;  2YZU A;  3ZTL A;  2BJX A;  1MDK A;  2GZP A;  3W8J A;  1W89 A;  3CYN A;  17GS A;  2V41 A;  3LOR A;  3RHB A;  2YAN A;  5BMU A;  6GSV A;  4G0L A;  3ME7 A;  3F3R A;  5G5E A;  2MMZ A;  1EV9 A;  4IN0 A;  2IMF A;  3IK7 A;  2V2G A;  3LEF A;  1K0N A;  2PN8 A;  3EC3 A;  4O5U A;  2FCH A;  3GX8 A;  4EL1 A;  4MZW A;  5DCG A;  3F4T A;  3TKS A;  3J7Y k;  2PPT A;  3C7M A;  2VCW A;  1Z7P A;  4RI7 A;  1JLW A;  2VCX A;  1EEM A;  2PBJ A;  5GZZ B;  2LKU A;  3LXT A;  1ZYN A;  3QMX A;  1OVN A;  2CVB A;  3C8E A;  4JU5 A;  1G0T A;  1I9D A;  3H8Q A;  4ILF A;  2WS2 A;  4PQI A;  3IBH A;  4D73 A;  3U6V A;  1GNW A;  5DAK B;  2PVQ A;  1R5P A;  3KP9 A;  4FYC A;  4XTS A;  1CQG A;  4NV5 A;  2R0G A;  3HZ8 A;  4NAX A;  1F6M C;  4FO5 A;  3GKM A;  1GLP A;  3VI5 A;  1TXX A;  1U3A A;  2QA2 A;  4O7H A;  3S9F A;  4JR4 A;  8GSS A;  4BA7 A;  4H86 A;  3L9V A;  16GS A;  2OAC A;  2CV4 A;  2AAW A;  1YY7 A;  1XWC A;  3GFK A;  1K0B A;  4NXI A;  1T00 A;  5H5Q A;  1X9S B;  4IHU A;  2QGV A;  3KTL A;  5B8B A;  5AIX A;  2YCD A;  1Z6M A;  3TJK A;  3EE2 A;  2LJK A;  2H1A A;  3AY8 A;  3M1G A;  1G6Y A;  1C72 A;  1ERT A;  4RQR A;  3VI7 A;  2H01 A;  4F0B A;  2UZ8 A;  4TOP A;  5IMD A;  4GQC A;  1J08 A;  2I81 A;  3RPP A;  2HE3 A;  1OE7 A;  1THO A;  2OKA A;  4MF5 A;  2C0E A;  1XFL A;  4MAB A;  1A2J A;  4FIW A;  2DKH A;  4FH8 A;  2H30 A;  4V1A g;  4TXV A;  2WUL A;  1KNG A;  2DIZ A;  3FR3 A;  1AAZ A;  4GSS A;  3A2W A;  2R6K A;  4GF0 A;  1SD9 A;  2WFC A;  2VCV A;  1SYR A;  5LD0 A;  4ZBA A;  4TR4 A;  1AQW A;  5J5N A;  4WKW A;  1FG4 A;  1TK0 B;  3ED3 A;  2OBK A;  3IC8 A;  2GZZ A;  3LJR A;  2B5E A;  1R5A A;  3TJJ A;  4OFN A;  4J57 E;  3ZZX A;  1B8X A;  3GUS A;  1DE2 A;  1WJK A;  2CZ2 A;  2TRC P;  2IFQ A;  2JSZ A;  3LYK A;  2Z9S A;  4RI6 A;  1QQ2 A;  4PUR A;  4MLY A;  3O76 A;  3D21 A;  2HSM A;  2C80 A;  1GUH A;  3PR8 A;  4K7O A;  3APQ A;  1SJI A;  3WT1 A;  4CHS A;  1OC9 B;  4OWY A;  1G7O A;  3N5O A;  4DSS A;  1YKA A;  2VCZ A;  2HZE A;  3TRP A;  3QAG A;  2AB6 A;  2R2J A;  1JLV A;  1URM A;  3ZRD A;  1ZZY A;  3FR6 A;  5AN1 A;  2C3T A;  4DSQ A;  1ZOF A;  3DVW A;  3SBC A;  3GIX A;  1GSD A;  5J4U A;  1R7H A;  1H4O A;  4K0G A;  3MIX A;  3LWA A;  2DJK A;  4LL1 B;  1AIU A;  5IM9 A;  1XCC A;  3MYD A;  6GSS A;  4L8E A;  2KP1 A;  4Z2R A;  2M80 A;  2OE3 A;  1TU8 A;  2H74 A;  1O81 A;  4Q5N A;  3FW2 A;  3WGE A;  2MMA A;  5CO3 A;  1MDJ A;  3TJB A;  2HLS A;  2J9H A;  3GKN A;  4EIQ A;  2FWH A;  3E9J B;  5KOX A;  1PN9 A;  4I8B A;  1K0C A;  2PER A;  4K0N A;  4WR5 A;  2NVL A;  1A0R P;  1K3O A;  3HY2 A;  1V57 A;  2VUP A;  1Y25 A;  3KH7 A;  4BWS A;  1ST9 A;  1F37 A;  3UL3 A;  4F82 A;  4E8E A;  2LS5 A;  1GUK A;  1A23 A;  4MCU A;  5DBQ A;  4WF5 A;  4JR6 A;  2H73 A;  5CRD A;  1BQ7 A;  4AF2 A;  1FOV A;  1FO5 A;  3TRQ A;  2XBQ A;  1U87 A;  18GS A;  1NW2 A;  2DJ1 A;  3F63 A;  1N8J A;  2DKI A;  1U6T A;  3EWL A;  2HRF A;  2K8S A;  2GT5 A;  3IRA A;  3GTU A;  1X5E A;  2B6M A;  4AJ8 A;  2OAD A;  3IC4 A;  1WIK A;  2HXK A;  2O8V B;  4ZL8 A;  1ZL9 A;  4BPY A;  19GS A;  5D9X A;  3GST A;  4K7N A;  3TDG A;  4OO4 A;  1SKW B;  2K6V A;  5ECR B;  4BVX A;  2JU5 A;  1OAZ A;  1VF1 A;  3ZIV A;  5GAP D;  5DCH A;  1GSQ A;  5COH A;  2I9H A;  3DRN A;  3DYR A;  5L71 A;  1XIY A;  4WBR D;  2DJ0 A;  1M9A A;  2V6O A;  2H6Z A;  2N5F A;  1MD4 A;  4F03 A;  3US3 A;  2RM5 A;  4GLT A;  4EXJ A;  1M2A A;  3IHG A;  3HVS A;  1NM3 A;  3A2V A;  1K0A A;  2IMD A;  5ECI B;  4IJ3 A;  4BWQ A;  3JCM L;  3DIE A;  3CSI A;  4ECC A;  1T8E B;  1X9W B;  3DXB A;  2E2G A;  3O6T A;  1S3D A;  1GTI A;  3TUE A;  1V40 A;  1K3L A;  1I5G A;  5ID2 B;  4WR4 A;  3CSJ A;  1M7T A;  2HZF A;  1TP9 A;  5ECQ B;  1JZR A;  3RPN A;  4IQ1 A;  4WF4 A;  3ZIJ A;  4K2D A;  3GH6 A;  4K8M A;  1BED A;  5G1L A;  2VD0 A;  1TRS A;  4QL7 A;  3IAS 2;  1DSB A;  4K2X A;  5HR2 A;  4G2E A;  4USS A;  5IQY A;  2GQK A;  3KTB A;  1GUM A;  1FHE A;  1NHO A;  3ERW A;  4MP4 A;  4P3Y B;  14GS A;  2GQM A;  4XS4 B;  1S3C A;  4V1A p;  1YEX A;  1ZYQ B;  4K5S A;  4F9Z A;  4IJI A;  3LXZ A;  1PRX A;  4K5R A;  5ECO B;  1ZYE A;  1GSE A;  2EC4 A;  3FZ9 A;  5JCG A;  2PWJ A;  1JZD A;  1YZX A;  5F0G A;  2YPM A;  5IOX A;  2WDU A;  2YOI A;  2EIO A;  3PGT A;  3D22 A;  3TKQ A;  1E2Y A;  3QOU A;  4MZC A;  4JBB A;  3ZVJ A;  1BYE A;  1QMV A;  5BRT A;  3WGX A;  4POL A;  1UA5 A;  3FKF A;  2RII A;  4EUY A;  2IJY A;  1XWA A;  3UBL A;  5EL8 A;  1SL1 B;  1GTB A;  4K6X A;  1HNA A;  2EIR A;  1GWC A;  3FZA A;  2DJ3 A;  2LJA A;  2LRT A;  1EP7 A;  2B7K A;  5IO2 A;  1EZK A;  1GSF A;  1B48 A;  2DC5 A;  5D93 A;  2OBI A;  1Z7R A;  4I5Q A;  4N30 A;  3IV4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...