4XCSA

Human peroxiredoxin-1 c83s mutant
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
179
structure length
179
Chain Sequence
GSHMSSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFSHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQFTDKHGEVCPAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Peroxiredoxin-1
publication title Crystal Structure of Dimeric Human Peroxiredoxin-1 C83S Mutant
doi rcsb
source organism Homo sapiens
total genus 54
structure length 179
sequence length 179
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2014-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
A PF10417 1-cysPrx_C C-terminal domain of 1-Cys peroxiredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4xcsA00
3TUEA 2O8VB 2LKUA 3E3EA 3P2AA 3HZ8A 3O6TA 6GSVA 4MABA 2X8HA 1TU8A 5DCGA 2CVDA 3N9JA 3QAGA 5AIXA 3DVWA 4HEA2 1GSYA 2IWTA 3N5OA 3F63A 4GWRA 4TVEA 2LJKA 3W8JA 1HNCA 5EL8A 4AGSA 4RUVA 1A2MA 1GUHA 2H1AA 3ZITA 2KOKA 4WR5A 5IMDA 4GQCA 5J9CA 2HRFA 3MNGA 4MPGA 1RQMA 1PMTA 5EPFA 4E8HA 1W4VA 1XW5A 1ZOFA 4L5LA 2VCXA 2P5QA 1K0NA 2H66A 2YPMA 1TW9A 2PPTA 3F4RA 4YQUA 1A24A 4EKZA 1ABAA 4EDYA 1JFUA 2GGTA 2GZYA 3BD2A 4POLA 4NV2A 3LYPA 5ELAA 1VRSD 5F07A 1QGVA 3U5RE 2CVBA 1X9SB 5A4UA 1LBKA 2AV4A 4MK3A 3PGTA 3KP9A 5IM9A 1ON4A 2K9FA 3BJ5A 2YNXA 4GSSA 1FHEA 2HSHA 3C7MA 4NHZA 2VLUA 2CZ3A 3A2WA 1K3LA 4G2EA 5ECNB 1X9MB 4MDCA 2HZEA 3L9SA 1OKDA 1Z6NA 2H01A 4BVYA 1SK0A 1UVZA 3IC4A 4IQAA 3IR4A 4TOPA 9GSSA 4WBJA 2XBIA 5LNKe 3HVVA 4POKA 3FW2A 3D6IA 5AGYA 2JL4A 4POBA 5IO2A 3ZLPA 4HQSA 1V2AA 3EYTA 1TRUA 2R6KA 6GSSA 2H6YA 1AUCA 2H0HA 5ECOB 2D2ZA 3GMFA 2XC2A 4HU9A 5KN2A 5B6NA 4QQ7A 2H75A 3D0ZA 1BX9A 1VF4A 3GFKA 3ZRDA 3L0HA 4HJ2A 2CZ2A 5JCGA 4P3YB 2HZEB 2OE3A 5DALA 5C04A 1SL0B 2LRTA 4WKWA 2LRCA 4AJ6A 3TRPA 4LMWA 2IPAA 2OKAA 4KH7A 3ZMKA 2YZHA 3KGKA 2J9HA 3Q74A 1SJZA 2C0FA 2E2MA 1PQNA 20GSA 3DGQA 4NWYA 2L6DA 3LSZA 3E9JB 3GKXA 4AF2A 5IO0A 2FWEA 5D93A 3CRUA 3SWLA 2H74A 3O76A 3EMPA 3EURA 3LEFA 2PVQA 2FUG2 1GRXA 1BEDA 1XPVA 3EC3A 3GL5A 3TKQA 3ZIVA 1K0OA 5ELGA 1M9BA 3FHKA 2JACA 2REMA 2JZTA 5ECRB 2CQ9A 4EE0A 4MJCA 12GSA 3KTBA 1HQOA 3KH7A 2A2RA 4BPYA 3QD9A 5DALB 2GSRA 1GSQA 3DWVA 1THXA 4ZB6A 3CSIA 2GSSA 5J9BA 1C72A 10GSA 3HXSA 3VI7A 1EGRA 1TDIA 5IOXA 3FZAA 4IKHA 1GLQA 5A4VA 2B6MA 1J08A 3D4MA 1PD21 4RQXA 4CHSA 4MF6A 7GSSA 3TKSC 2ZUPA 3GKMA 3LQ7A 3ISOA 3K8NA 4KW6A 4N11A 3GHAA 2QGVA 2EIRA 1V58A 5JWOB 1SL2B 4JR6A 1H75A 1SD8A 4IGJA 4FIWA 4KDUA 3M8NA 2EIOA 1ERUA 3ZZXA 2YZUA 4ZB8A 2YCDA 2E7PA 2F8FA 4F03A 2NBSA 4XRAA 1OC9A 5DAKA 1DE2A 2IMEA 4H86A 3F4TA 3TJGA 2M46A 5B8BA 4WXTA 1Q98A 2DLXA 2JADA 3ME7A 2IFQA 3HY2A 6GSYA 4PQ1A 3WT1A 4OCEA 5IPGA 1PRXA 18GSA 3W8SA 2WDUA 5IPHA 4F0CA 5LD0A 2LS5A 3WGDA 3RPNA 5H5RA 4K7NA 3KP8A 3IK7A 2WFCA 2AJQB 3UBKA 4MF5A 1PX6A 4X1UA 2HNLA 2RIIA 1OKTA 2KP1A 4YAPA 4Q5FA 3LJRA 2IN3A 2VL2C 2VO4A 5J3RA 1QQ2A 3LXZA 3TJBA 1Z7PA 4J56E 4KSOA 2IMKA 4IN0A 1EWXA 4TXOB 3KXOA 4GLTA 2V6OA 2CAIA 1TI1A 3KMOA 5DAKB 1VF2A 2L4QA 1Z3EA 3ZIJA 5DVBA 2AUVA 3TKPA 2IFQB 2QKEA 3TGZA 1VF3A 5G5EA 1QXHA 4DEJA 2CX4A 1DBYA 3A3TA 4Q5RA 3J7Yk 3GRXA 3UIWA 1XWBA 4L8EA 1KBNA 1XBSA 4MZCA 5GAPD 1BG5A 3DYRA 3L9VA 2H8LA 4K1FA 5EVOA 1T1VA 1GSFA 2V41A 1O6JA 4KB3A 4F2IA 22GSA 1TOFA 5D96A 1EOGA 2WRTA 1B4PA 5AISA 3GURA 3P90A 3F8UA 5IMFA 2BJXA 2LTKA 1V9WA 3FEUA 4AJ8A 4YQMA 5JCUA 3IAM2 3F3RA 1U88A 3GV1A 1YEPA 2C80A 3UL3A 2RM6A 3IHQA 2A4VA 3UEMA 1UA5A 2O85A 3KZQA 2DMMA 4MP4A 2C3QA 1GUKA 4LLRA 4ZIJA 4OO5A 8GSSA 1SKWB 1EOHA 2YV9A 3C1SA 2DIZA 4ZL8A 3UMAA 3LYKA 1OVNA 3FYGA 2YJHA 2VIMA 2DJ1A 3J7Yb 4RI7A 3CBUA 3CSJA 5IQYA 4K7IA 1AIUA 4XHMA 4ZL9A 4V2MA 4QL9A 2C3NA 2H6ZA 2MMAA 2ZNMA 3I6AA 4YQVA 1X5EA 4N0VA 2GTUA 4TW5A 1PKZA 4YH2A 2GQKA 4K0NA 1YF0A 2JZRA 2IMFA 2DC5A 5D73A 1HD2A 2JU5A 1EV4A 4IP1A 4OFNA 5JWRB 2NTOA 3TRXA 3ZVJA 5GSSA 1T7PB 1R26A 2YJ7A 2X99A 1SKRB 1G7EA 4PQIA 3GX8A 4HU7A 1AW9A 3NZNA 4EC0A 2VM2A 4KX4A 4GQFA 3KM6A 2DSAA 4IBPA 2DIYA 2HT9A 2VLVA 4DSSA 1XWAA 4KE3A 4IJ3A 1M99A 5D9XA 4ZB9A 2F51A 2LQQA 4GCIA 4K8MA 1XVQA 4LA1A 3D22A 2VM1A 3CTGA 4G10A 5IMAA 3DKSA 4ZL7A 2BTOT 4K6XA 1XFLA 2A2SA 1G6WA 1TKDB 1BAYA 3EWLA 1AXDA 1YKCA 2IMIA 2H30A 1YEXA 1F37A 4TN8A 1RW1A 5HFIA 1PSQA 2LV3A 5A4WA 2MBSA 2R5GA 3WD6A 2B7KA 3L9UA 1KTEA 1AQWA 3JCML 4IJIA 3RHBA 2PERA 4IP6A 2VD1A 4HZ4A 1SENA 5ECQB 2N5FA 3HHVA 3ZVJD 4DSSB 1QFNA 2VOCA 5ECSA 3O3TA 4DSQA 3I9V2 3I69A 3F4SA 3W6GA 2L59A 5FHIA 3H8QA 3GKKA 3LWAA 2OBIA 4O5RA 3BOAA 1XVWA 3LORA 2EIQA 2WZ9A 5ID2A 3GKNA 3NOFA 4GSNA 1WP0A 1SYXA 4EUYA 1IYIA 4AJ7A 3RPPA 5IMVA 2VCWA 2ES7A 2I3YA 1DE1A 2KP2A 2XPDA 1UC7A 2YWNA 1OAZA 2JZSA 2WULA 1X5CA 3IPZA 4DSRA 3TOTA 4L0WA 3TKRA 3DMLA 3BCIA 1A2JA 4I97A 4G19A 3F0IA 5ECKB 2QSIA 4F82A 3D4TA 4N30A 3FR9A 1H4OA 3P7XA 2HYXA 1ST9A 4NAXA 3IK9A 1B4QA 3HDCA 2K8SA 3GSTA 1GWCA 3ZREA 2VD0A 4Q5QA 1TP9A 5D9TA 2B7JA 3QCPA 2L6CA 4N10A 3IE3A 1GULA 1W89A 4MJEA 3HZ4A 4ZILA 2L5LA 4EVMA 2B5XA 2VCVA 1YY7A 5ID2B 5CNWA 4TKYA 6GSUA 2GSTA 3LXTA 1OE7A 4NV5A 3DXBA 4TR1B 4EL1A 1FB0A 1U3IA 1M7TA 4FO5A 4IVFA 4ACSA 2TRXA 1NHOA 1KEBA 2Z9SA 5JCWA 4ZXGA 2I9HA 3US3A 1A2LA 5HR2A 4EO3A 2GLRA 2B1LA 3HD5A 5G2ZA 5J4UA 1FW1A 4XIHA 2MYGA 5DCHA 1O8XA 1O81A 3QFAC 4V2NA 2K6VA 3TKSA 4KAEA 5CRHA 3BCKA 4KNDA 5AN1A 3C71A 4ISDA 5D9WA 1O7UA 3QAWA 1SK2A 1K0DA 2WB9A 1SL1B 1X0RA 3KEBA 4Z7XA 1U87A 1V98A 1PL1A 5ECHB 1R4WA 3VFIA 3UVHA 1HNAA 3QFBC 3IBHA 1Z5YE 1THOA 2FNOA 1GLPA 1GL8A 2IJYA 2I81A 2OJLA 3LGCA 1U6TA 3G7JA 4HI7A 4V2LA 3FZ9A 3VPTA 1F9MA 4Q5NA 2GDRA 4HZ2A 2NDOA 4HOJA 4IW9A 2KUCA 2LRNA 1NW2A 3H79A 3RBTA 4ULXA 6GSWA 5CP1A 2X8CA 5DQYA 6GSTA 2HFDA 4TXVA 2ON5A 3Q19A 4MZWA 2VL3A 1T3BA 4RQRA 5ABRA 2E2GA 2GT6A 4ECBA 1F3BA 1B9XC 2C8UA 4DVCA 5IIZA 2WCIA 4KDXA 4TXOA 2MBTA 4V1Ag 1V40A 1Z7RA 5HR1A 4HDEA 1ERWA 3UVTA 4ZBDA 3EU4A 2IMDA 2LJAA 4TR3A 1AQVA 1MD4A 1JLWA 1MDKA 2LNSA 3DRNA 1EZKA 3WGEA 5J41A 1QK8A 4ILFA 1PL2A 2R2JA 1EEJA 5HR3A 1K0MA 4KSMA 2FGXA 5KN0A 2LUSA 1VF1A 4X0XA 4LMVA 5E59A 3KJYA 3QAVA 2C4JA 2RM5A 2OE0A 1WE0A 1ACVA 1OYJA 2MZCA 3E0UA 3KIJA 2V6KA 3APOA 5F05A 1K0AA 3F3QA 2NPBA 4PUFC 1KNGA 3ZL5A 4I2UA 5IMZA 1TI3A 3H1NA 3IXRA 3RHCA 5CO3A 4OO4A 2KHPA 4POMA 5CRDA 4ID0A 1FVJA 5GAND 2NVLA 2CAQA 1ZMAA 3EINA 1A8LA 1JHBA 5KEJA 2YWIA 5HFKA 4PUAA 1EEMA 4GTUA 1GSSA 1SJ6A 3HVSA 1K0BA 5LCZA 3FZ4A 1PKWA 4BL7A 5D8IA 5H5QA 4K7OA 2FLSA 2EC4A 2LSTA 5HFGA 2L4CA 2IIYA 4NMUA 2L5OA 2PMTA 1DUGA 4PX1A 3ERGA 4PXOA 4O92A 3HVXA 4OFMA 3ZYWA 2HE3A 4IS0A 4BWQA 1B48A 3TB2A 3FK8A 2F9SA 2VCQA 1BQ7A 1J0FA 3PR8A 4MMMA 4NXIA 2H1BA 3TKSE 2I4AA 3TDGA 4K9ZA 1UN2A 2PUKC 1TK0B 1T00A 2F8AA 2VCTA 4MCUA 2WS2A 1RK4A 3PINA 1AQXA 5INYA 1XIYA 3IV4A 4O32A 1VGLA 3VURA 2O7KA 4EXJA 2TRCP 4MH2A 3VWXA 1ZZYA 1O73A 2CA8A 2LEGA 5KN1A 2M72A 3Q6OA 1WJKA 5CAXA 3C1RA 2DJ0A 1A23A 2AB6A 2YV7A 1V57A 3F6FA 3HCZA 13GSA 2HI7A 2H71A 4FYBA 1HYUA 1J9BA 4BA7A 1TJDA 4K0GA 2DJJA 3V1WA 3CYNA 3H4KA 1E6BA 1A0FA 2M80A 4HJMA 1N8JA 19GSA 3HA9A 4OCFA 1S3AA 2H1DA 5COHA 2YN1A 4ZBAA 1B8XA 5GZZB 3QOUA 1F2EA 1TU7A 3HYPA 2O87A 1XWGA 5E4WA 1FVKA 4ML1A 3WGXA 2OA7A 1G7OA 4GXZA 5CRWA 5DJMA 2K8VA 3CXGA 2H0IA 3EE2A 2HLSA 3WT2A 3GH6A 1XW6A 1ZGNA 1SU9A 3GN3A 3TJKA 5G5FA 5IMCA 17GSA 3GTUA 5AIVA 2B1KA 4IHUA 2N5BA 4PQHA 3HJMA 3EU3A 5H5SA 4HQZA 1WPIA 2V1MA 3ED3A 1GTIA 4WBRD 2MMOA 3RAZA 4PNGA 5L71A 4MH3A 4FYUA 5B6MA 5DJLA 3P8WA 2VAFA 1K3OA 3VPQA 1OC3A 1GSDA 2GQLA 1ML6A 4CW9A 5CRGA 2XHFA 1MDIA 3FRCA 1B9YC 3I43A 5IOWA 2PGTA 2RUFA 2PBJA 3APSA 1EGOA 3RDWA 2H0GA 1S3DA 3DEXA 4KA0A 1BYEA 3UOMA 3KH9A 4WF5A 5FT3A 2R37A 1GNEA 3M1GA 3GTUB 4WEYA 1TRVA 1MD3A 4OWYA 5DDLA 1YQ1A 4ML6A 3ZFLA 3G9BA 2OE1A 2CV4A 3APQA 1M2DA 1JZRA 2LJRA 3TJFA 4BVXA 14GSA 1XOBA 5FWGA 3AY8A 5GSTA 4L5OA 4F0BA 4JE1A 3C73A 3ZTLA 3FKFA 2FCHA 2E0QA 5B7CA 1ILOA 2LQOA 1OC8A 3ME8A 1GTUA 1R5PA 4PGTA 2P31A 1MEKA 2C0DA 3WYWA 3VWVA 1GTAA 6GSXA 1N2AA 4I8BA 4MA9A 2X64A 4TR1A 5J5NA 1Y25A 4OFTA 5ECLB 4FYCA 1G0TA 1FB6A 3ERFA 5C00A 2HZFA 1YF1A 4ECCA 4I5QA 1SKSB 1XOAA 3GIXA 3LFLA 2LNTA 1FAAA 1T4YA 5B8AA 4JU5A 4IQ1A 2OACA 3TOUA 3CRTA 5DQSA 1OE8A 2H1GA 4JEDA 1XW9A 1JLVA 1I9DA 2FY6A 2VUPA 4YAVA 1TXXA 2PN8A 2YOIA 3FR6A 4EF0A 3VI5A 3D5JA 4QL7A 3ERWA 1T4ZA 4K2DA 3LG6A 1SD9A 2YP6A 1K0CA 3TRQA 3M9KA 3GL3A 1U3AA 3OR5A 5ECMB 2CT6A 1SK1A 2H73A 3VWUA 2MMZA 1I5GA 1JZWA 5A5KA 3EVIA 4XRDA 2BMXA 2ZCTA 3A2XA 2PWJA 2FHEA 3ZMLA 4XS4A 3M9JA 5ECPB 2GZPA 1SYRA 1XWCA 4E8EA 2V2GA 3KCMA 2GZZA 3MDKA 3VLNA 4I6XA 5F06A 3TCOA 3IAS2 3M3MA 3U6VA 2G0FA 1FG4A 4G9HA 3S9FA 1GUMA 11GSA 4RI6A 2GS3A 3CTFA 1WRYA 4MPFA 2VL9A 5G31A 1O85A 1MTCA 4MLYA 3L78A 3VWWA 1QMVA 4V1Ap 2H72A 2KLXA 1TK8B 1TTZA 4KCEA 1URMA 2GT5A 1X5DA 3FY7A 3F6DA 1G6YA 1SJIA 1R5AA 4LL1B 3EMXA 4BWSA 4XS4B 3G7YA 1AC1A 3Q18A 2B5YA 1NM3A 5JWQB 2PVOC 1M2AA 3D21A 4WF4A 2VL2A 2K18A 5G1LA 1BJXA 5CREA 3GX0A 3IRAA 1PX7A 4D73A 4KUNA 4TR4A 2WJUA 1Q4JA 1PGTA 2OADA 3QR6A 2CVKA 2XPEA 4XS1A 1LJRA 1FOVA 3QPMA 5ECIB 2H6XA 1MDJA 1R7HA 1TRWA 5HR0A 3GUSA 4WR4A 1ERTA 1AAZA 5CYYA 5HQPA 1ZYQB 1NHYA 1IYHA 3R2QA 3KTLA 3KD0A 2PU9C 1QUWA 2HSYA 2C0GA 3BBYA 1PN9A 2VCZA 1K3YA 4X43A 1JZOA 1X9WB 1ZL9A 4OMVA 1EV9A 2DMLA 4I2TA 2FA4A 1XCCA 3DVXA 4XCSA 1Z6MA 3FR3A 1GTBA 2R4VA 3VK9A 3MSZA 2DJ3A 1EP7A 1O8WA 5DBQA 3IA1A 3ZFBA 4O7HA 3GYKA 2HRNA 3SBCA 4D73B 1LU4A 1YZXA 3CSHA 2DJKA 2HXKA 1ZCPA 4L0UA 3GH9A 1WIKA 4JZQA 4J2FA 4CDOA 1A0RP 2B3SA 3NIVA 1TK5B 2C0EA 1CQHA 4XS6A 1OC9B 3UBLA 4ZBBA 4JR4A 1JZDA 3HJOA 4EDZA 2GSQA 4HUAA 2H70A 2CX3A 2VLTA 2WGRA 1M9AA 2P0GA 2FD3A 4GSTA 4HS1A 3DD3A 1GP1A 16GSA 2FWHA 4KDYA 4JRRA 1T8EB 2V32A 1NSWA 1USBA 4JBBA 1XWKA 2MMNA 2B5EA 4WETA 1WMJA 1GNWA 2YWMA 2N5AA 1XXUA 2C1YA 4IELA 3DIEA 2RUEA 4MJBA 1GSUA 1GSEA 1WWJA 2F3MA 1M2BA 5EY6A 3CMIA 2H76A 2DJ2A 4J57E 4LL4B 2FWGA 4N0ZA 1DSBA 3M0FA 4NPBA 5F8BA 3A2VA 1TRSA 1HNBA 4MJAA 1A8YA 4TR0A 3KMNA 1F3AA 5ENUA 2OBKA 3UAPA 2ON7A 3QDNA 1M0UA 4KGIA 3F9UA 5D9VA 4PURA 2P5RA 3IDVA 1GH2A 2YWOA 3L4NA 3GSSA 1ERVA 3PH9A 3UJ1A 1S3CA 3UARA 1EP8A 2C3TA 3MWHA 1YKAA 2FA8A 2JSZA 3QMXA 5KN3A 2IL3A 1F6MC 2H19A 1XZOA 3G7IA 2DBCA 2X8GA 2AHEA 3GNJA 4PNFA 4OD7A 3H93A 2TIRA 2AYTA 2R3XA 1YDKA 4KCAA 5F0GA 1FO5A 4F9ZA 4GRFA 2I1UA 2XBQA 4XTSA 4MF7A 4MZBA 4ECJA 3A5WA 4GF0A 1CQGA 2QC7A 4NHWA 1Y6EA 2RLIA 1WOUA 3MAKA 4TRXA 3FZ5A 2L57A 2YANA 2AAWA 2JSYA 4ECIA 1E2YA 3IOSA 2FWFA 1ZYEA 2GVPA 1YJ6A 2G2QA 1Z9HA 2J23A 3HJPA 2O89A 3GA4A 5G1KA 5G30A 3TJJA 2ALBA 3C8EA 3HKRA 2GQMA 1PA3A 4FH8A
chains in the Genus database with same CATH superfamily
3TUEA 2O8VB 2LKUA 3E3EA 3P2AA 3HZ8A 3O6TA 4G0KA 6GSVA 4MABA 2X8HA 1TU8A 5DCGA 2CVDA 3N9JA 3QAGA 5AIXA 3DVWA 4HEA2 1GSYA 2IWTA 3N5OA 3F63A 4GWRA 4TVEA 2LJKA 3W8JA 1HNCA 5EL8A 4AGSA 4RUVA 1A2MA 1GUHA 2H1AA 3ZITA 2KOKA 4WR5A 5IMDA 4GQCA 5J9CA 2HRFA 3MNGA 4MPGA 1RQMA 1PMTA 5EPFA 4E8HA 4CY8A 1W4VA 1XW5A 1ZOFA 4L5LA 2VCXA 2P5QA 1K0NA 2DKHA 2H66A 2YPMA 1TW9A 2PPTA 3F4RA 4YQUA 1A24A 4EKZA 1ABAA 4EDYA 1JFUA 2GGTA 2GZYA 3EPTA 3BD2A 4POLA 4NV2A 3LYPA 5ELAA 1VRSD 5F07A 1QGVA 3U5RE 2CVBA 1X9SB 5A4UA 1LBKA 2AV4A 4MK3A 3PGTA 3KP9A 4FQUA 5IM9A 1ON4A 2HRAA 2K9FA 3BJ5A 2YNXA 3R3EA 4GSSA 1FHEA 2HSHA 3C7MA 4NHZA 2VLUA 2CZ3A 3A2WA 1K3LA 4G2EA 5ECNB 1X9MB 4MDCA 2HZEA 3L9SA 1OKDA 1Z6NA 2H01A 4BVYA 1SK0A 1UVZA 3IC4A 4IQAA 3IR4A 4TOPA 9GSSA 4X4JA 4WBJA 2XBIA 5LNKe 3HVVA 4POKA 3FW2A 3D6IA 5AGYA 2JL4A 4POBA 5IO2A 3ZLPA 4HQSA 1V2AA 3EYTA 1TRUA 2R6KA 6GSSA 2H6YA 1AUCA 2H0HA 4O5UA 5ECOB 2D2ZA 3GMFA 2XC2A 4HU9A 5KN2A 5B6NA 4QQ7A 2H75A 3D0ZA 1BX9A 1VF4A 3GFKA 3ZRDA 3L0HA 4HJ2A 2CZ2A 5JCGA 4P3YB 2HZEB 2OE3A 5DALA 5C04A 1SL0B 2LRTA 4WKWA 2LRCA 4AJ6A 3TRPA 4LMWA 2IPAA 2OKAA 4KH7A 3ZMKA 2YZHA 3KGKA 2J9HA 3Q74A 1SJZA 2C0FA 2E2MA 1PQNA 20GSA 3DGQA 4NWYA 2L6DA 3LSZA 3E9JB 3GKXA 4AF2A 5IO0A 2FWEA 5D93A 3CRUA 4YKFA 3SWLA 2H74A 3O76A 3EMPA 3EURA 3LEFA 2PVQA 2FUG2 1GRXA 1BEDA 1XPVA 3EC3A 3GL5A 3TKQA 3ZIVA 1K0OA 5ELGA 1M9BA 3FHKA 1ZYPA 2JACA 2REMA 2JZTA 5ECRB 2CQ9A 4EE0A 4MJCA 12GSA 3KTBA 1HQOA 3KH7A 2A2RA 4BPYA 3QD9A 5DALB 2GSRA 1GSQA 3DWVA 1THXA 4ZB6A 3CSIA 2GSSA 5J9BA 1C72A 10GSA 3HXSA 3VI7A 1EGRA 1TDIA 5IOXA 3FZAA 4IKHA 1GLQA 5A4VA 2B6MA 1J08A 3D4MA 1PD21 4RQXA 3FMWA 4CHSA 4MF6A 7GSSA 3TKSC 2ZUPA 3GKMA 3LQ7A 3ISOA 3K8NA 4KW6A 4N11A 3GHAA 2QGVA 2EIRA 1V58A 5JWOB 1SL2B 4JR6A 1H75A 1SD8A 4IGJA 4FIWA 4KDUA 3M8NA 2EIOA 1ERUA 3ZZXA 2YZUA 4ZB8A 2YCDA 2E7PA 2F8FA 4F03A 2NBSA 4XRAA 1OC9A 5DAKA 1DE2A 2IMEA 4H86A 3F4TA 3TJGA 2M46A 5B8BA 4WXTA 1Q98A 2DLXA 2JADA 3IHGA 3ME7A 2IFQA 3HY2A 6GSYA 4PQ1A 3WT1A 4OCEA 5IPGA 1PRXA 18GSA 3W8SA 2WDUA 4O5QA 5IPHA 4F0CA 5LD0A 2LS5A 3WGDA 3RPNA 5H5RA 4K7NA 3KP8A 3IK7A 2WFCA 2AJQB 3UBKA 4MF5A 1PX6A 4X1UA 2HNLA 2HSMA 2RIIA 1OKTA 2KP1A 4YAPA 4Q5FA 3LJRA 2IN3A 2VL2C 2VO4A 5J3RA 1QQ2A 3LXZA 3TJBA 1Z7PA 4J56E 4KSOA 2IMKA 4IN0A 1EWXA 4TXOB 3KXOA 4GLTA 2V6OA 2CAIA 1TI1A 3KMOA 5DAKB 1VF2A 2L4QA 1Z3EA 3ZIJA 5DVBA 2AUVA 3TKPA 2IFQB 3LW9A 2QKEA 3TGZA 4Z2UA 1VF3A 5G5EA 1QXHA 4DEJA 2CX4A 1DBYA 3A3TA 4Q5RA 3J7Yk 3GRXA 3UIWA 1XWBA 4L8EA 1KBNA 4EIQA 1XBSA 4MZCA 5GAPD 1BG5A 3DYRA 3L9VA 2H8LA 4K1FA 5EVOA 1T1VA 1GSFA 2V41A 1O6JA 4KB3A 4F2IA 22GSA 1TOFA 5D96A 1EOGA 2WRTA 1B4PA 5AISA 3GURA 3P90A 3F8UA 5IMFA 2BJXA 2LTKA 1V9WA 3FEUA 4AJ8A 4YQMA 5JCUA 3IAM2 3F3RA 1U88A 3GV1A 1YEPA 2C80A 3UL3A 2RM6A 3IHQA 2A4VA 3UEMA 1UA5A 2O85A 3KZQA 2DMMA 4MP4A 2C3QA 1GUKA 4LLRA 4ZIJA 4OO5A 8GSSA 1SKWB 1EOHA 2YV9A 3C1SA 2DIZA 4PTSA 4ZL8A 3UMAA 3LYKA 1OVNA 3FYGA 2YJHA 2VIMA 2DJ1A 3J7Yb 4RI7A 3CBUA 3CSJA 5IQYA 4K7IA 1AIUA 4XHMA 4ZL9A 4V2MA 4QL9A 2C3NA 2H6ZA 2MMAA 2ZNMA 3I6AA 4YQVA 1X5EA 4N0VA 2GTUA 4TW5A 1PKZA 4YH2A 2GQKA 4K0NA 1YF0A 2JZRA 4Z2TA 2IMFA 2DC5A 5D73A 1HD2A 3CQFA 2JU5A 1EV4A 4IP1A 4OFNA 5JWRB 2NTOA 3TRXA 3ZVJA 5GSSA 1T7PB 1R26A 2YJ7A 2X99A 1SKRB 1G7EA 4PQIA 3GX8A 4HU7A 1AW9A 3NZNA 4EC0A 2VM2A 1PN0A 4KX4A 4GQFA 3KM6A 2DSAA 4IBPA 2DIYA 2HT9A 2VLVA 4DSSA 1XWAA 4KE3A 4IJ3A 1M99A 5D9XA 4ZB9A 2F51A 2LQQA 4GCIA 4K8MA 1XVQA 4LA1A 3D22A 2VM1A 3CTGA 4G10A 5IMAA 3DKSA 4ZL7A 2BTOT 4K6XA 1XFLA 2A2SA 1G6WA 1TKDB 1BAYA 3EWLA 1AXDA 1YKCA 2IMIA 2H30A 1YEXA 1F37A 4TN8A 1RW1A 5HFIA 1PSQA 2LV3A 5A4WA 2MBSA 2R5GA 3WD6A 2B7KA 3L9UA 1KTEA 1AQWA 3JCML 4IJIA 3RHBA 2PERA 4IP6A 2VD1A 4HZ4A 1SENA 5ECQB 2N5FA 3HHVA 3ZVJD 4DSSB 1QFNA 2VOCA 5ECSA 3O3TA 4DSQA 3I9V2 3I69A 3F4SA 3W6GA 2L59A 5FHIA 3H8QA 3GKKA 3LWAA 2OBIA 4O5RA 3BOAA 1XVWA 3LORA 2EIQA 2WZ9A 2DKIA 5ID2A 3GKNA 3NOFA 4GSNA 1WP0A 1SYXA 4EUYA 1IYIA 4AJ7A 3RPPA 5IMVA 2VCWA 2ES7A 2I3YA 1DE1A 2KP2A 2XPDA 1UC7A 2YWNA 1OAZA 2JZSA 2WULA 1X5CA 3IPZA 4DSRA 3TOTA 4L0WA 3TKRA 3DMLA 3BCIA 1A2JA 4I97A 4G19A 3F0IA 5ECKB 2QSIA 4F82A 3D4TA 4N30A 3FR9A 1H4OA 3P7XA 2HYXA 1ST9A 4NAXA 3IK9A 1B4QA 5KOWA 3HDCA 2K8SA 3GSTA 1GWCA 3ZREA 2VD0A 4Q5QA 1TP9A 5D9TA 2B7JA 3QCPA 2L6CA 4N10A 3IE3A 1GULA 1W89A 4MJEA 3HZ4A 4ZILA 2L5LA 4EVMA 2B5XA 2VCVA 1YY7A 5ID2B 5CNWA 4TKYA 6GSUA 2GSTA 3LXTA 1OE7A 4NV5A 3DXBA 4TR1B 4EL1A 1FB0A 1U3IA 1M7TA 4FO5A 4IVFA 4ACSA 2TRXA 1NHOA 1KEBA 2Z9SA 5JCWA 4ZXGA 2I9HA 2UZ8A 3US3A 1A2LA 5HR2A 4EO3A 2GLRA 2B1LA 3HD5A 5G2ZA 5J4UA 1FW1A 4A5PA 4XIHA 2MYGA 5DCHA 1O8XA 1O81A 3QFAC 4V2NA 2K6VA 3TKSA 4KAEA 5CRHA 3BCKA 4KNDA 5AN1A 3C71A 4ISDA 5D9WA 1O7UA 3QAWA 1SK2A 1K0DA 2WB9A 1SL1B 1X0RA 3KEBA 4Z7XA 1U87A 1V98A 1PL1A 5ECHB 1R4WA 3VFIA 3UVHA 1HNAA 3QFBC 3IBHA 1Z5YE 1THOA 2FNOA 1GLPA 1GL8A 2IJYA 2I81A 2OJLA 3LGCA 1U6TA 3G7JA 4HI7A 4V2LA 2R0GA 3FZ9A 3VPTA 1F9MA 4Q5NA 2GDRA 4ICYA 4HZ2A 2NDOA 4HOJA 4IW9A 2KUCA 4HSCX 2LRNA 1NW2A 3H79A 3RBTA 4ULXA 6GSWA 5CP1A 2X8CA 5DQYA 6GSTA 2HFDA 4TXVA 2ON5A 3Q19A 4MZWA 2VL3A 1T3BA 4RQRA 5ABRA 2E2GA 2GT6A 4ECBA 1F3BA 1B9XC 2C8UA 4DVCA 5IIZA 2WCIA 4KDXA 4TXOA 2MBTA 4V1Ag 1V40A 1Z7RA 5HR1A 4HDEA 1ERWA 3UVTA 4ZBDA 3EU4A 5BRTA 2IMDA 2LJAA 4TR3A 1AQVA 1MD4A 1JLWA 1MDKA 2LNSA 3DRNA 1EZKA 3WGEA 5J41A 1QK8A 4ILFA 1PL2A 2R2JA 1EEJA 5HR3A 1K0MA 4KSMA 2FGXA 5KN0A 2LUSA 1VF1A 4X0XA 4LMVA 5E59A 3KJYA 4EIPA 3QAVA 2C4JA 2RM5A 2OE0A 1WE0A 1ACVA 1OYJA 1ZYNA 2MZCA 3E0UA 3KIJA 2V6KA 3APOA 5F05A 1K0AA 3F3QA 2NPBA 4PUFC 1KNGA 3ZL5A 4I2UA 5IMZA 1TI3A 3H1NA 3IXRA 3RHCA 5CO3A 4OO4A 2KHPA 4POMA 5CRDA 4ID0A 4USSA 1FVJA 5GAND 2A2PA 2NVLA 2CAQA 1ZMAA 3EINA 1A8LA 1JHBA 5KEJA 2YWIA 5HFKA 4PUAA 1EEMA 4GTUA 1GSSA 1SJ6A 3HVSA 1K0BA 5LCZA 3FZ4A 1PKWA 4BL7A 5D8IA 5H5QA 4K7OA 2FLSA 2EC4A 2LSTA 5HFGA 2L4CA 2IIYA 4NMUA 2R0CA 2L5OA 2PMTA 1DUGA 4PX1A 3ERGA 4PXOA 4O92A 3HVXA 4OFMA 3ZYWA 2HE3A 4IS0A 4BWQA 1B48A 3TB2A 3FK8A 2F9SA 2VCQA 1BQ7A 1J0FA 3PR8A 4MMMA 4NXIA 2H1BA 3TKSE 2I4AA 3TDGA 4K9ZA 1UN2A 2PUKC 1TK0B 1T00A 2F8AA 2VCTA 4MCUA 2WS2A 1RK4A 3PINA 1AQXA 5INYA 1XIYA 3IV4A 4O32A 1VGLA 3VURA 2O7KA 4EXJA 2TRCP 4BL7B 4MH2A 3VWXA 1ZZYA 1O73A 2CA8A 2LEGA 5KN1A 2M72A 3Q6OA 1WJKA 5CAXA 3C1RA 2DJ0A 1A23A 2AB6A 2YV7A 1V57A 3F6FA 3HCZA 13GSA 2HI7A 2H71A 4FYBA 1HYUA 1J9BA 4BA7A 1M3IA 1TJDA 4K0GA 2DJJA 3V1WA 3CYNA 3H4KA 1E6BA 1A0FA 4G0LA 2M80A 3A5IA 4HJMA 1N8JA 19GSA 3HA9A 4OCFA 1S3AA 2H1DA 5COHA 2YN1A 4ZBAA 1XG8A 1B8XA 5GZZB 3QOUA 1F2EA 1TU7A 3HYPA 2O87A 1XWGA 5E4WA 1FVKA 4ML1A 3WGXA 2OA7A 1G7OA 4GXZA 5CRWA 5DJMA 2K8VA 3CXGA 2H0IA 3EE2A 2HLSA 3WT2A 3GH6A 1XW6A 1ZGNA 1SU9A 3GN3A 3TJKA 5G5FA 5IMCA 17GSA 3GTUA 5AIVA 2B1KA 4IHUA 2N5BA 4PQHA 3HJMA 3EU3A 5H5SA 4HQZA 1WPIA 2V1MA 3ED3A 1GTIA 4WBRD 2MMOA 3RAZA 4PNGA 5L71A 2A4HA 4MH3A 4FYUA 5B6MA 5DJLA 3P8WA 2VAFA 4G0IA 1K3OA 3VPQA 1OC3A 1GSDA 2GQLA 1M3JA 1ML6A 4CW9A 5CRGA 2XHFA 1MDIA 3FRCA 1B9YC 3I43A 5IOWA 2PGTA 2RUFA 2PBJA 3APSA 1EGOA 3RDWA 2H0GA 1S3DA 3DEXA 4Z2RA 4KA0A 1BYEA 3UOMA 3KH9A 4WF5A 5FT3A 2R37A 1GNEA 3M1GA 3GTUB 4WEYA 1TRVA 1MD3A 4OWYA 5DDLA 1YQ1A 4ML6A 3ZFLA 3G9BA 4CY6A 2OE1A 2CV4A 3APQA 1M2DA 1JZRA 2LJRA 3TJFA 4BVXA 14GSA 1XOBA 5FWGA 3AY8A 5GSTA 4L5OA 4F0BA 4K5SA 4JE1A 3C73A 3ZTLA 3FKFA 2FCHA 3MYDA 2E0QA 5B7CA 1ILOA 2LQOA 1OC8A 3ME8A 1GTUA 1R5PA 4PGTA 2P31A 1MEKA 2C0DA 3WYWA 3VWVA 1GTAA 4MNNA 6GSXA 1N2AA 4I8BA 4MA9A 2X64A 4TR1A 5J5NA 1Y25A 4OFTA 5ECLB 4FYCA 1G0TA 1FB6A 3ERFA 5C00A 4YKGA 2HZFA 1YF1A 4ECCA 4I5QA 1SKSB 1XOAA 3GIXA 3LFLA 2LNTA 1FAAA 1T4YA 5B8AA 4JU5A 4IQ1A 2OACA 3TOUA 3CRTA 5DQSA 1OE8A 4BVXB 2H1GA 4JEDA 1XW9A 1JLVA 1I9DA 2FY6A 2VUPA 4YAVA 1TXXA 2PN8A 2YOIA 3FR6A 4EF0A 3VI5A 3D5JA 4QL7A 3ERWA 1T4ZA 4K2DA 3LG6A 1SD9A 2YP6A 1K0CA 3TRQA 3M9KA 3GL3A 1U3AA 3OR5A 5ECMB 2CT6A 1SK1A 2H73A 3VWUA 2MMZA 1I5GA 4BVYB 1JZWA 5A5KA 3EVIA 4XRDA 2BMXA 2ZCTA 3A2XA 2PWJA 2FHEA 3IC8A 3ZMLA 4XS4A 3M9JA 5ECPB 2GZPA 1SYRA 1XWCA 4E8EA 2V2GA 3KCMA 2GZZA 3MDKA 3VLNA 4I6XA 5F06A 3TCOA 3IAS2 3M3MA 3U6VA 4BIKA 2G0FA 1FG4A 4G9HA 3S9FA 1GUMA 11GSA 4RI6A 2GS3A 3CTFA 1WRYA 4MPFA 2VL9A 5G31A 1O85A 1MTCA 4MLYA 3L78A 3VWWA 1QMVA 4V1Ap 2H72A 2KLXA 3MIXA 1TK8B 1TTZA 4KCEA 1URMA 2GT5A 1X5DA 3FY7A 3F6DA 1G6YA 1SJIA 1R5AA 4LL1B 2X4AA 3EMXA 4KF9A 4BWSA 4XS4B 3G7YA 1AC1A 3Q18A 2B5YA 1NM3A 5JWQB 2PVOC 4K2XA 1M2AA 3D21A 4WF4A 2VL2A 2K18A 5G1LA 1BJXA 5CREA 3GX0A 3IRAA 1PX7A 4D73A 4KUNA 4TR4A 2WJUA 1Q4JA 1PGTA 2OADA 3QR6A 2CVKA 2XPEA 4XS1A 1LJRA 1FOVA 3QPMA 5ECIB 2H6XA 2HRKA 1MDJA 1R7HA 1TRWA 5HR0A 3GUSA 4WR4A 1ERTA 1AAZA 5CYYA 5HQPA 1ZYQB 1NHYA 1IYHA 3R2QA 3KTLA 3KD0A 2PU9C 1QUWA 2HSYA 2C0GA 3BBYA 1PN9A 2VCZA 1K3YA 4X43A 1JZOA 1X9WB 1ZL9A 4OMVA 1EV9A 2DMLA 4I2TA 2FA4A 1XCCA 3DVXA 4XCSA 1Z6MA 3FR3A 1GTBA 2R4VA 3VK9A 3MSZA 2DJ3A 1EP7A 1O8WA 5DBQA 3IA1A 3ZFBA 4O7HA 3GYKA 2HRNA 3SBCA 4D73B 1LU4A 1YZXA 3CSHA 2DJKA 2HXKA 1ZCPA 4L0UA 3GH9A 1WIKA 4JZQA 4J2FA 4CDOA 1A0RP 2B3SA 3NIVA 1TK5B 2C0EA 1CQHA 4XS6A 1OC9B 3UBLA 4ZBBA 4JR4A 1JZDA 3HJOA 4EDZA 2GSQA 2X49A 4HUAA 2H70A 2CX3A 2VLTA 2WGRA 1M9AA 2P0GA 2FD3A 4GSTA 4HS1A 3DD3A 1GP1A 16GSA 2FWHA 4KDYA 4JRRA 1T8EB 2V32A 1NSWA 1USBA 4JBBA 1XWKA 2MMNA 2B5EA 4WETA 1WMJA 1GNWA 2YWMA 2N5AA 1XXUA 2C1YA 4IELA 3DIEA 2RUEA 4MJBA 1GSUA 1GSEA 1WWJA 2F3MA 1M2BA 5EY6A 3CMIA 2H76A 2DJ2A 4J57E 4LL4B 2FWGA 4N0ZA 1DSBA 3M0FA 4NPBA 5F8BA 3A2VA 1TRSA 1HNBA 4MJAA 1A8YA 4TR0A 3KMNA 1F3AA 2QA2A 5ENUA 1S3RA 2OBKA 3UAPA 2ON7A 3QDNA 1M0UA 4KGIA 3F9UA 5D9VA 4PURA 2P5RA 3IDVA 1GH2A 5KOXA 2YWOA 3L4NA 3GSSA 1ERVA 3PH9A 3UJ1A 1S3CA 3UARA 1EP8A 2C3TA 3MWHA 1YKAA 2FA8A 2JSZA 3QMXA 5KN3A 2IL3A 1F6MC 1FOHA 2H19A 1XZOA 3G7IA 5BMUA 2DBCA 2X8GA 2AHEA 3GNJA 4PNFA 4OD7A 3H93A 2TIRA 2AYTA 2R3XA 1YDKA 4KCAA 5F0GA 1FO5A 4F9ZA 4GRFA 2I1UA 2XBQA 4XTSA 2QA1A 4MF7A 4MZBA 4ECJA 3A5WA 4GF0A 1CQGA 2QC7A 4NHWA 1Y6EA 2RLIA 1WOUA 3MAKA 4TRXA 3FZ5A 2L57A 2YANA 1PFOA 2AAWA 2JSYA 4ECIA 1E2YA 3IOSA 3PPUA 2FWFA 1ZYEA 4K5RA 3HVNA 2GVPA 1YJ6A 2G2QA 2R0PA 1Z9HA 2J23A 3HJPA 2O89A 3GA4A 5G1KA 5G30A 3TJJA 2ALBA 3C8EA 3HKRA 2GQMA 1PA3A 4FH8A
chains in the Genus database with same CATH topology
3TUEA 2O8VB 2LKUA 3E3EA 3P2AA 3HZ8A 3O6TA 4G0KA 6GSVA 4MABA 2X8HA 1TU8A 5DCGA 2CVDA 3N9JA 3QAGA 5AIXA 3DVWA 4HEA2 1GSYA 2IWTA 3N5OA 3F63A 4GWRA 4TVEA 2LJKA 3W8JA 1HNCA 5EL8A 4AGSA 4RUVA 1A2MA 1GUHA 2H1AA 3ZITA 2KOKA 4WR5A 5IMDA 4GQCA 5J9CA 2HRFA 3MNGA 4MPGA 1RQMA 1PMTA 5EPFA 4E8HA 4CY8A 1W4VA 1XW5A 1ZOFA 4L5LA 2VCXA 2P5QA 1K0NA 2DKHA 2H66A 2YPMA 1TW9A 2PPTA 3F4RA 4YQUA 1A24A 4EKZA 1ABAA 4EDYA 1JFUA 2GGTA 2GZYA 3EPTA 3BD2A 4POLA 4NV2A 3LYPA 5ELAA 1VRSD 5F07A 1QGVA 3U5RE 2CVBA 1X9SB 5A4UA 1LBKA 2AV4A 4MK3A 3PGTA 3KP9A 4FQUA 5IM9A 1ON4A 2HRAA 2K9FA 3BJ5A 2YNXA 3R3EA 4GSSA 1FHEA 2HSHA 3C7MA 4NHZA 2VLUA 2CZ3A 3A2WA 1K3LA 4G2EA 5ECNB 1X9MB 4MDCA 2HZEA 3L9SA 1OKDA 1Z6NA 2H01A 4BVYA 1SK0A 1UVZA 3IC4A 4IQAA 3IR4A 4TOPA 9GSSA 4X4JA 4WBJA 2XBIA 5LNKe 3HVVA 4POKA 3FW2A 3D6IA 5AGYA 2JL4A 4POBA 5IO2A 3ZLPA 4HQSA 1V2AA 3EYTA 1TRUA 2R6KA 6GSSA 2H6YA 1AUCA 2H0HA 4O5UA 5ECOB 2D2ZA 3GMFA 2XC2A 4HU9A 5KN2A 5B6NA 4QQ7A 2H75A 3D0ZA 1BX9A 1VF4A 3GFKA 3ZRDA 3L0HA 4HJ2A 2CZ2A 5JCGA 4P3YB 2HZEB 2OE3A 5DALA 5C04A 1SL0B 2LRTA 4WKWA 2LRCA 4AJ6A 3TRPA 4LMWA 2IPAA 2OKAA 4KH7A 3ZMKA 2YZHA 3KGKA 2J9HA 3Q74A 1SJZA 2C0FA 2E2MA 1PQNA 20GSA 3DGQA 4NWYA 2L6DA 3LSZA 3E9JB 3GKXA 4AF2A 5IO0A 2FWEA 5D93A 3CRUA 4YKFA 3SWLA 2H74A 3O76A 3EMPA 3EURA 3LEFA 2PVQA 2FUG2 1GRXA 1BEDA 1XPVA 3EC3A 3GL5A 3TKQA 3ZIVA 1K0OA 5ELGA 1M9BA 3FHKA 1ZYPA 2JACA 2REMA 2JZTA 5ECRB 2CQ9A 4EE0A 4MJCA 12GSA 3KTBA 1HQOA 3KH7A 2A2RA 4BPYA 3QD9A 5DALB 2GSRA 1GSQA 3DWVA 1THXA 4ZB6A 3CSIA 2GSSA 5J9BA 1C72A 10GSA 3HXSA 3VI7A 1EGRA 1TDIA 5IOXA 3FZAA 4IKHA 1GLQA 5A4VA 2B6MA 1J08A 3D4MA 1PD21 4RQXA 3FMWA 4CHSA 4MF6A 7GSSA 3TKSC 2ZUPA 3GKMA 3LQ7A 3ISOA 3K8NA 4KW6A 4N11A 3GHAA 2QGVA 2EIRA 1V58A 5JWOB 1SL2B 4JR6A 1H75A 1SD8A 4IGJA 4FIWA 4KDUA 3M8NA 2EIOA 1ERUA 3ZZXA 2YZUA 4ZB8A 2YCDA 2E7PA 2F8FA 4F03A 2NBSA 4XRAA 1OC9A 5DAKA 1DE2A 2IMEA 4H86A 3F4TA 3TJGA 2M46A 5B8BA 4WXTA 1Q98A 2DLXA 2JADA 3IHGA 3ME7A 2IFQA 3HY2A 6GSYA 4PQ1A 3WT1A 4OCEA 5IPGA 1PRXA 18GSA 3W8SA 2WDUA 4O5QA 5IPHA 4F0CA 5LD0A 2LS5A 3WGDA 3RPNA 5H5RA 4K7NA 3KP8A 3IK7A 2WFCA 2AJQB 3UBKA 4MF5A 1PX6A 4X1UA 2HNLA 2HSMA 2RIIA 1OKTA 2KP1A 4YAPA 4Q5FA 3LJRA 2IN3A 2VL2C 2VO4A 5J3RA 1QQ2A 3LXZA 3TJBA 1Z7PA 4J56E 4KSOA 2IMKA 4IN0A 1EWXA 4TXOB 3KXOA 4GLTA 2V6OA 2CAIA 1TI1A 3KMOA 5DAKB 1VF2A 2L4QA 1Z3EA 3ZIJA 5DVBA 2AUVA 3TKPA 2IFQB 3LW9A 2QKEA 3TGZA 4Z2UA 1VF3A 5G5EA 1QXHA 4DEJA 2CX4A 1DBYA 3A3TA 4Q5RA 3J7Yk 3GRXA 3UIWA 1XWBA 4L8EA 1KBNA 4EIQA 1XBSA 4MZCA 5GAPD 1BG5A 3DYRA 3L9VA 2H8LA 4K1FA 5EVOA 1T1VA 1GSFA 2V41A 1O6JA 4KB3A 4F2IA 22GSA 1TOFA 5D96A 1EOGA 2WRTA 1B4PA 5AISA 3GURA 3P90A 3F8UA 5IMFA 2BJXA 2LTKA 1V9WA 3FEUA 4AJ8A 4YQMA 5JCUA 3IAM2 3F3RA 1U88A 3GV1A 1YEPA 2C80A 3UL3A 2RM6A 3IHQA 2A4VA 3UEMA 1UA5A 2O85A 3KZQA 2DMMA 4MP4A 2C3QA 1GUKA 4LLRA 4ZIJA 4OO5A 8GSSA 1SKWB 1EOHA 2YV9A 3C1SA 2DIZA 4PTSA 4ZL8A 3UMAA 3LYKA 1OVNA 3FYGA 2YJHA 2VIMA 2DJ1A 3J7Yb 4RI7A 3CBUA 3CSJA 5IQYA 4K7IA 1AIUA 4XHMA 4ZL9A 4V2MA 4QL9A 2C3NA 2H6ZA 2MMAA 2ZNMA 3I6AA 4YQVA 1X5EA 4N0VA 2GTUA 4TW5A 1PKZA 4YH2A 2GQKA 4K0NA 1YF0A 2JZRA 4Z2TA 2IMFA 2DC5A 5D73A 1HD2A 2JU5A 1EV4A 4IP1A 4OFNA 5JWRB 2NTOA 3TRXA 3ZVJA 5GSSA 1T7PB 1R26A 2YJ7A 2X99A 1SKRB 1G7EA 4PQIA 3GX8A 4HU7A 1AW9A 3NZNA 4EC0A 2VM2A 1PN0A 4KX4A 4GQFA 3KM6A 2DSAA 4IBPA 2DIYA 2HT9A 2VLVA 4DSSA 1XWAA 4KE3A 4IJ3A 1M99A 5D9XA 4ZB9A 2F51A 2LQQA 4GCIA 4K8MA 1XVQA 4LA1A 3D22A 2VM1A 3CTGA 4G10A 5IMAA 3DKSA 4ZL7A 2BTOT 4K6XA 1XFLA 2A2SA 1G6WA 1TKDB 1BAYA 3EWLA 1AXDA 1YKCA 2IMIA 2H30A 1YEXA 1F37A 4TN8A 1RW1A 5HFIA 1PSQA 2LV3A 5A4WA 2MBSA 2R5GA 3WD6A 2B7KA 3L9UA 1KTEA 1AQWA 3JCML 4IJIA 3RHBA 2PERA 4IP6A 2VD1A 4HZ4A 1SENA 5ECQB 2N5FA 3HHVA 3ZVJD 4DSSB 1QFNA 2VOCA 5ECSA 3O3TA 4DSQA 3I9V2 3I69A 3F4SA 3W6GA 2L59A 5FHIA 3H8QA 3GKKA 3LWAA 2OBIA 4O5RA 3BOAA 1XVWA 3LORA 2EIQA 2WZ9A 2DKIA 5ID2A 3GKNA 3NOFA 4GSNA 1WP0A 1SYXA 4EUYA 1IYIA 4AJ7A 3RPPA 5IMVA 2VCWA 2ES7A 2I3YA 1DE1A 2KP2A 2XPDA 1UC7A 2YWNA 1OAZA 2JZSA 2WULA 1X5CA 3IPZA 4DSRA 3TOTA 4L0WA 3TKRA 3DMLA 3BCIA 1A2JA 4I97A 4G19A 3F0IA 5ECKB 2QSIA 4F82A 3D4TA 4N30A 3FR9A 1H4OA 3P7XA 2HYXA 1ST9A 4NAXA 3IK9A 1B4QA 5KOWA 3HDCA 2K8SA 3GSTA 1GWCA 3ZREA 2VD0A 4Q5QA 1TP9A 5D9TA 2B7JA 3QCPA 2L6CA 4N10A 3IE3A 1GULA 1W89A 4MJEA 3HZ4A 4ZILA 2L5LA 4EVMA 2B5XA 2VCVA 1YY7A 5ID2B 5CNWA 4TKYA 6GSUA 2GSTA 3LXTA 1OE7A 4NV5A 3DXBA 4TR1B 4EL1A 1FB0A 1U3IA 1M7TA 4FO5A 4IVFA 4ACSA 2TRXA 1NHOA 1KEBA 2Z9SA 5JCWA 4ZXGA 2I9HA 2UZ8A 3US3A 1A2LA 5HR2A 4EO3A 2GLRA 2B1LA 3HD5A 5G2ZA 5J4UA 1FW1A 4A5PA 4XIHA 2MYGA 5DCHA 1O8XA 1O81A 3QFAC 4V2NA 2K6VA 3TKSA 4KAEA 5CRHA 3BCKA 4KNDA 5AN1A 3C71A 4ISDA 5D9WA 1O7UA 3QAWA 1SK2A 1K0DA 2WB9A 1SL1B 1X0RA 3KEBA 4Z7XA 1U87A 1V98A 1PL1A 5ECHB 1R4WA 3VFIA 3UVHA 1HNAA 3QFBC 3IBHA 1Z5YE 1THOA 2FNOA 1GLPA 1GL8A 2IJYA 2I81A 2OJLA 3LGCA 1U6TA 3G7JA 4HI7A 4V2LA 2R0GA 3FZ9A 3VPTA 1F9MA 4Q5NA 2GDRA 4ICYA 4HZ2A 2NDOA 4HOJA 4IW9A 2KUCA 2LRNA 1NW2A 3H79A 3RBTA 4ULXA 6GSWA 5CP1A 2X8CA 5DQYA 6GSTA 2HFDA 4TXVA 2ON5A 3Q19A 4MZWA 2VL3A 1T3BA 4RQRA 5ABRA 2E2GA 2GT6A 4ECBA 1F3BA 1B9XC 2C8UA 4DVCA 5IIZA 2WCIA 4KDXA 4TXOA 2MBTA 4V1Ag 1V40A 1Z7RA 5HR1A 4HDEA 1ERWA 3UVTA 4ZBDA 3EU4A 5BRTA 2IMDA 2LJAA 4TR3A 1AQVA 1MD4A 1JLWA 1MDKA 2LNSA 3DRNA 1EZKA 3WGEA 5J41A 1QK8A 4ILFA 1PL2A 2R2JA 1EEJA 5HR3A 1K0MA 4KSMA 2FGXA 5KN0A 2LUSA 1VF1A 4X0XA 4LMVA 5E59A 3KJYA 4EIPA 3QAVA 2C4JA 2RM5A 2OE0A 1WE0A 1ACVA 1OYJA 1ZYNA 2MZCA 3E0UA 3KIJA 2V6KA 3APOA 5F05A 1K0AA 3F3QA 2NPBA 4PUFC 1KNGA 3ZL5A 4I2UA 5IMZA 1TI3A 3H1NA 3IXRA 3RHCA 5CO3A 4OO4A 2KHPA 4POMA 5CRDA 4ID0A 4USSA 1FVJA 5GAND 2A2PA 2NVLA 2CAQA 1ZMAA 3EINA 1A8LA 1JHBA 5KEJA 2YWIA 5HFKA 4PUAA 1EEMA 4GTUA 1GSSA 1SJ6A 3HVSA 1K0BA 5LCZA 3FZ4A 1PKWA 4BL7A 5D8IA 5H5QA 4K7OA 2FLSA 2EC4A 2LSTA 5HFGA 2L4CA 2IIYA 4NMUA 2R0CA 2L5OA 2PMTA 1DUGA 4PX1A 3ERGA 4PXOA 4O92A 3HVXA 4OFMA 3ZYWA 2HE3A 4IS0A 4BWQA 1B48A 3TB2A 3FK8A 2F9SA 2VCQA 1BQ7A 1J0FA 3PR8A 4MMMA 4NXIA 2H1BA 3TKSE 2I4AA 3TDGA 4K9ZA 1UN2A 2PUKC 1TK0B 1T00A 2F8AA 2VCTA 4MCUA 2WS2A 1RK4A 3PINA 1AQXA 5INYA 1XIYA 3IV4A 4O32A 1VGLA 3VURA 2O7KA 4EXJA 2TRCP 4BL7B 4MH2A 3VWXA 1ZZYA 1O73A 2CA8A 2LEGA 5KN1A 2M72A 3Q6OA 1WJKA 5CAXA 3C1RA 2DJ0A 1A23A 2AB6A 2YV7A 1V57A 3F6FA 3HCZA 13GSA 2HI7A 2H71A 4FYBA 1HYUA 1J9BA 4BA7A 1TJDA 4K0GA 2DJJA 3V1WA 3CYNA 3H4KA 1E6BA 1A0FA 4G0LA 2M80A 3A5IA 4HJMA 1N8JA 19GSA 3HA9A 4OCFA 1S3AA 2H1DA 5COHA 2YN1A 4ZBAA 1B8XA 5GZZB 3QOUA 1F2EA 1TU7A 3HYPA 2O87A 1XWGA 5E4WA 1FVKA 4ML1A 3WGXA 2OA7A 1G7OA 4GXZA 5CRWA 5DJMA 2K8VA 3CXGA 2H0IA 3EE2A 2HLSA 3WT2A 3GH6A 1XW6A 1ZGNA 1SU9A 3GN3A 3TJKA 5G5FA 5IMCA 17GSA 3GTUA 5AIVA 2B1KA 4IHUA 2N5BA 4PQHA 3HJMA 3EU3A 5H5SA 4HQZA 1WPIA 2V1MA 3ED3A 1GTIA 4WBRD 2MMOA 3RAZA 4PNGA 5L71A 2A4HA 4MH3A 4FYUA 5B6MA 5DJLA 3P8WA 2VAFA 4G0IA 1K3OA 3VPQA 1OC3A 1GSDA 2GQLA 1ML6A 4CW9A 5CRGA 2XHFA 1MDIA 3FRCA 1B9YC 3I43A 5IOWA 2PGTA 2RUFA 2PBJA 3APSA 1EGOA 3RDWA 2H0GA 1S3DA 3DEXA 4Z2RA 4KA0A 1BYEA 3UOMA 3KH9A 4WF5A 5FT3A 2R37A 1GNEA 3M1GA 3GTUB 4WEYA 1TRVA 1MD3A 4OWYA 5DDLA 1YQ1A 4ML6A 3ZFLA 3G9BA 4CY6A 2OE1A 2CV4A 3APQA 1M2DA 1JZRA 2LJRA 3TJFA 4BVXA 14GSA 1XOBA 5FWGA 3AY8A 5GSTA 4L5OA 4F0BA 4K5SA 4JE1A 3C73A 3ZTLA 3FKFA 2FCHA 3MYDA 2E0QA 5B7CA 1ILOA 2LQOA 1OC8A 3ME8A 1GTUA 1R5PA 4PGTA 2P31A 1MEKA 2C0DA 3WYWA 3VWVA 1GTAA 4MNNA 6GSXA 1N2AA 4I8BA 4MA9A 2X64A 4TR1A 5J5NA 1Y25A 4OFTA 5ECLB 4FYCA 1G0TA 1FB6A 3ERFA 5C00A 4YKGA 2HZFA 1YF1A 4ECCA 4I5QA 1SKSB 1XOAA 3GIXA 3LFLA 2LNTA 1FAAA 1T4YA 5B8AA 4JU5A 4IQ1A 2OACA 3TOUA 3CRTA 5DQSA 1OE8A 4BVXB 2H1GA 4JEDA 1XW9A 1JLVA 1I9DA 2FY6A 2VUPA 4YAVA 1TXXA 2PN8A 2YOIA 3FR6A 4EF0A 3VI5A 3D5JA 4QL7A 3ERWA 1T4ZA 4K2DA 3LG6A 1SD9A 2YP6A 1K0CA 3TRQA 3M9KA 3GL3A 1U3AA 3OR5A 5ECMB 2CT6A 1SK1A 2H73A 3VWUA 2MMZA 1I5GA 4BVYB 1JZWA 5A5KA 3EVIA 4XRDA 2BMXA 2ZCTA 3A2XA 2PWJA 2FHEA 3IC8A 3ZMLA 4XS4A 3M9JA 5ECPB 2GZPA 1SYRA 1XWCA 4E8EA 2V2GA 3KCMA 2GZZA 3MDKA 3VLNA 4I6XA 5F06A 3TCOA 3IAS2 3M3MA 3U6VA 2G0FA 1FG4A 4G9HA 3S9FA 1GUMA 11GSA 4RI6A 2GS3A 3CTFA 1WRYA 4MPFA 2VL9A 5G31A 1O85A 1MTCA 4MLYA 3L78A 3VWWA 1QMVA 4V1Ap 2H72A 2KLXA 3MIXA 1TK8B 1TTZA 4KCEA 1URMA 2GT5A 1X5DA 3FY7A 3F6DA 1G6YA 1SJIA 1R5AA 4LL1B 2X4AA 3EMXA 4KF9A 4BWSA 4XS4B 3G7YA 1AC1A 3Q18A 2B5YA 1NM3A 5JWQB 2PVOC 4K2XA 1M2AA 3D21A 4WF4A 2VL2A 2K18A 5G1LA 1BJXA 5CREA 3GX0A 3IRAA 1PX7A 4D73A 4KUNA 4TR4A 2WJUA 1Q4JA 1PGTA 2OADA 3QR6A 2CVKA 2XPEA 4XS1A 1LJRA 1FOVA 3QPMA 5ECIB 2H6XA 2HRKA 1MDJA 1R7HA 1TRWA 5HR0A 3GUSA 4WR4A 1ERTA 1AAZA 5CYYA 5HQPA 1ZYQB 1NHYA 1IYHA 3R2QA 3KTLA 3KD0A 2PU9C 1QUWA 2HSYA 2C0GA 3BBYA 1PN9A 2VCZA 1K3YA 4X43A 1JZOA 1X9WB 1ZL9A 4OMVA 1EV9A 2DMLA 4I2TA 2FA4A 1XCCA 3DVXA 4XCSA 1Z6MA 3FR3A 1GTBA 2R4VA 3VK9A 3MSZA 2DJ3A 1EP7A 1O8WA 5DBQA 3IA1A 3ZFBA 4O7HA 3GYKA 2HRNA 3SBCA 4D73B 1LU4A 1YZXA 3CSHA 2DJKA 2HXKA 1ZCPA 4L0UA 3GH9A 1WIKA 4JZQA 4J2FA 4CDOA 1A0RP 2B3SA 3NIVA 1TK5B 2C0EA 1CQHA 4XS6A 1OC9B 3UBLA 4ZBBA 4JR4A 1JZDA 3HJOA 4EDZA 2GSQA 2X49A 4HUAA 2H70A 2CX3A 2VLTA 2WGRA 1M9AA 2P0GA 2FD3A 4GSTA 4HS1A 3DD3A 1GP1A 16GSA 2FWHA 4KDYA 4JRRA 1T8EB 2V32A 1NSWA 1USBA 4JBBA 1XWKA 2MMNA 2B5EA 4WETA 1WMJA 1GNWA 2YWMA 2N5AA 1XXUA 2C1YA 4IELA 3DIEA 2RUEA 4MJBA 1GSUA 1GSEA 1WWJA 2F3MA 1M2BA 5EY6A 3CMIA 2H76A 2DJ2A 4J57E 4LL4B 2FWGA 4N0ZA 1DSBA 3M0FA 4NPBA 5F8BA 3A2VA 1TRSA 1HNBA 4MJAA 1A8YA 4TR0A 3KMNA 1F3AA 2QA2A 5ENUA 2OBKA 3UAPA 2ON7A 3QDNA 1M0UA 4KGIA 3F9UA 5D9VA 4PURA 2P5RA 3IDVA 1GH2A 5KOXA 2YWOA 3L4NA 3GSSA 1ERVA 3PH9A 3UJ1A 1S3CA 3UARA 1EP8A 2C3TA 3MWHA 1YKAA 2FA8A 2JSZA 3QMXA 5KN3A 2IL3A 1F6MC 1FOHA 2H19A 1XZOA 3G7IA 5BMUA 2DBCA 2X8GA 2AHEA 3GNJA 4PNFA 4OD7A 3H93A 2TIRA 2AYTA 2R3XA 1YDKA 4KCAA 5F0GA 1FO5A 4F9ZA 4GRFA 2I1UA 2XBQA 4XTSA 2QA1A 4MF7A 4MZBA 4ECJA 3A5WA 4GF0A 1CQGA 2QC7A 4NHWA 1Y6EA 2RLIA 1WOUA 3MAKA 4TRXA 3FZ5A 2L57A 2YANA 2AAWA 2JSYA 4ECIA 1E2YA 3IOSA 3PPUA 2FWFA 1ZYEA 4K5RA 2GVPA 1YJ6A 2G2QA 2R0PA 1Z9HA 2J23A 3HJPA 2O89A 3GA4A 5G1KA 5G30A 3TJJA 2ALBA 3C8EA 3HKRA 2GQMA 1PA3A 4FH8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TUE A;  2O8V B;  2LKU A;  3E3E A;  3P2A A;  3HZ8 A;  3O6T A;  6GSV A;  4MAB A;  2X8H A;  1TU8 A;  5DCG A;  2CVD A;  3N9J A;  3QAG A;  5AIX A;  3DVW A;  4HEA 2;  1GSY A;  2IWT A;  3N5O A;  3F63 A;  4GWR A;  4TVE A;  2LJK A;  3W8J A;  1HNC A;  5EL8 A;  4AGS A;  4RUV A;  1A2M A;  1GUH A;  2H1A A;  3ZIT A;  2KOK A;  4WR5 A;  5IMD A;  4GQC A;  5J9C A;  2HRF A;  3MNG A;  4MPG A;  1RQM A;  1PMT A;  5EPF A;  4E8H A;  1W4V A;  1XW5 A;  1ZOF A;  4L5L A;  2VCX A;  2P5Q A;  1K0N A;  2H66 A;  2YPM A;  1TW9 A;  2PPT A;  3F4R A;  4YQU A;  1A24 A;  4EKZ A;  1ABA A;  4EDY A;  1JFU A;  2GGT A;  2GZY A;  3BD2 A;  4POL A;  4NV2 A;  3LYP A;  5ELA A;  1VRS D;  5F07 A;  1QGV A;  3U5R E;  2CVB A;  1X9S B;  5A4U A;  1LBK A;  2AV4 A;  4MK3 A;  3PGT A;  3KP9 A;  5IM9 A;  1ON4 A;  2K9F A;  3BJ5 A;  2YNX A;  4GSS A;  1FHE A;  2HSH A;  3C7M A;  4NHZ A;  2VLU A;  2CZ3 A;  3A2W A;  1K3L A;  4G2E A;  5ECN B;  1X9M B;  4MDC A;  2HZE A;  3L9S A;  1OKD A;  1Z6N A;  2H01 A;  4BVY A;  1SK0 A;  1UVZ A;  3IC4 A;  4IQA A;  3IR4 A;  4TOP A;  9GSS A;  4WBJ A;  2XBI A;  5LNK e;  3HVV A;  4POK A;  3FW2 A;  3D6I A;  5AGY A;  2JL4 A;  4POB A;  5IO2 A;  3ZLP A;  4HQS A;  1V2A A;  3EYT A;  1TRU A;  2R6K A;  6GSS A;  2H6Y A;  1AUC A;  2H0H A;  5ECO B;  2D2Z A;  3GMF A;  2XC2 A;  4HU9 A;  5KN2 A;  5B6N A;  4QQ7 A;  2H75 A;  3D0Z A;  1BX9 A;  1VF4 A;  3GFK A;  3ZRD A;  3L0H A;  4HJ2 A;  2CZ2 A;  5JCG A;  4P3Y B;  2HZE B;  2OE3 A;  5DAL A;  5C04 A;  1SL0 B;  2LRT A;  4WKW A;  2LRC A;  4AJ6 A;  3TRP A;  4LMW A;  2IPA A;  2OKA A;  4KH7 A;  3ZMK A;  2YZH A;  3KGK A;  2J9H A;  3Q74 A;  1SJZ A;  2C0F A;  2E2M A;  1PQN A;  20GS A;  3DGQ A;  4NWY A;  2L6D A;  3LSZ A;  3E9J B;  3GKX A;  4AF2 A;  5IO0 A;  2FWE A;  5D93 A;  3CRU A;  3SWL A;  2H74 A;  3O76 A;  3EMP A;  3EUR A;  3LEF A;  2PVQ A;  2FUG 2;  1GRX A;  1BED A;  1XPV A;  3EC3 A;  3GL5 A;  3TKQ A;  3ZIV A;  1K0O A;  5ELG A;  1M9B A;  3FHK A;  2JAC A;  2REM A;  2JZT A;  5ECR B;  2CQ9 A;  4EE0 A;  4MJC A;  12GS A;  3KTB A;  1HQO A;  3KH7 A;  2A2R A;  4BPY A;  3QD9 A;  5DAL B;  2GSR A;  1GSQ A;  3DWV A;  1THX A;  4ZB6 A;  3CSI A;  2GSS A;  5J9B A;  1C72 A;  10GS A;  3HXS A;  3VI7 A;  1EGR A;  1TDI A;  5IOX A;  3FZA A;  4IKH A;  1GLQ A;  5A4V A;  2B6M A;  1J08 A;  3D4M A;  1PD2 1;  4RQX A;  4CHS A;  4MF6 A;  7GSS A;  3TKS C;  2ZUP A;  3GKM A;  3LQ7 A;  3ISO A;  3K8N A;  4KW6 A;  4N11 A;  3GHA A;  2QGV A;  2EIR A;  1V58 A;  5JWO B;  1SL2 B;  4JR6 A;  1H75 A;  1SD8 A;  4IGJ A;  4FIW A;  4KDU A;  3M8N A;  2EIO A;  1ERU A;  3ZZX A;  2YZU A;  4ZB8 A;  2YCD A;  2E7P A;  2F8F A;  4F03 A;  2NBS A;  4XRA A;  1OC9 A;  5DAK A;  1DE2 A;  2IME A;  4H86 A;  3F4T A;  3TJG A;  2M46 A;  5B8B A;  4WXT A;  1Q98 A;  2DLX A;  2JAD A;  3ME7 A;  2IFQ A;  3HY2 A;  6GSY A;  4PQ1 A;  3WT1 A;  4OCE A;  5IPG A;  1PRX A;  18GS A;  3W8S A;  2WDU A;  5IPH A;  4F0C A;  5LD0 A;  2LS5 A;  3WGD A;  3RPN A;  5H5R A;  4K7N A;  3KP8 A;  3IK7 A;  2WFC A;  2AJQ B;  3UBK A;  4MF5 A;  1PX6 A;  4X1U A;  2HNL A;  2RII A;  1OKT A;  2KP1 A;  4YAP A;  4Q5F A;  3LJR A;  2IN3 A;  2VL2 C;  2VO4 A;  5J3R A;  1QQ2 A;  3LXZ A;  3TJB A;  1Z7P A;  4J56 E;  4KSO A;  2IMK A;  4IN0 A;  1EWX A;  4TXO B;  3KXO A;  4GLT A;  2V6O A;  2CAI A;  1TI1 A;  3KMO A;  5DAK B;  1VF2 A;  2L4Q A;  1Z3E A;  3ZIJ A;  5DVB A;  2AUV A;  3TKP A;  2IFQ B;  2QKE A;  3TGZ A;  1VF3 A;  5G5E A;  1QXH A;  4DEJ A;  2CX4 A;  1DBY A;  3A3T A;  4Q5R A;  3J7Y k;  3GRX A;  3UIW A;  1XWB A;  4L8E A;  1KBN A;  1XBS A;  4MZC A;  5GAP D;  1BG5 A;  3DYR A;  3L9V A;  2H8L A;  4K1F A;  5EVO A;  1T1V A;  1GSF A;  2V41 A;  1O6J A;  4KB3 A;  4F2I A;  22GS A;  1TOF A;  5D96 A;  1EOG A;  2WRT A;  1B4P A;  5AIS A;  3GUR A;  3P90 A;  3F8U A;  5IMF A;  2BJX A;  2LTK A;  1V9W A;  3FEU A;  4AJ8 A;  4YQM A;  5JCU A;  3IAM 2;  3F3R A;  1U88 A;  3GV1 A;  1YEP A;  2C80 A;  3UL3 A;  2RM6 A;  3IHQ A;  2A4V A;  3UEM A;  1UA5 A;  2O85 A;  3KZQ A;  2DMM A;  4MP4 A;  2C3Q A;  1GUK A;  4LLR A;  4ZIJ A;  4OO5 A;  8GSS A;  1SKW B;  1EOH A;  2YV9 A;  3C1S A;  2DIZ A;  4ZL8 A;  3UMA A;  3LYK A;  1OVN A;  3FYG A;  2YJH A;  2VIM A;  2DJ1 A;  3J7Y b;  4RI7 A;  3CBU A;  3CSJ A;  5IQY A;  4K7I A;  1AIU A;  4XHM A;  4ZL9 A;  4V2M A;  4QL9 A;  2C3N A;  2H6Z A;  2MMA A;  2ZNM A;  3I6A A;  4YQV A;  1X5E A;  4N0V A;  2GTU A;  4TW5 A;  1PKZ A;  4YH2 A;  2GQK A;  4K0N A;  1YF0 A;  2JZR A;  2IMF A;  2DC5 A;  5D73 A;  1HD2 A;  2JU5 A;  1EV4 A;  4IP1 A;  4OFN A;  5JWR B;  2NTO A;  3TRX A;  3ZVJ A;  5GSS A;  1T7P B;  1R26 A;  2YJ7 A;  2X99 A;  1SKR B;  1G7E A;  4PQI A;  3GX8 A;  4HU7 A;  1AW9 A;  3NZN A;  4EC0 A;  2VM2 A;  4KX4 A;  4GQF A;  3KM6 A;  2DSA A;  4IBP A;  2DIY A;  2HT9 A;  2VLV A;  4DSS A;  1XWA A;  4KE3 A;  4IJ3 A;  1M99 A;  5D9X A;  4ZB9 A;  2F51 A;  2LQQ A;  4GCI A;  4K8M A;  1XVQ A;  4LA1 A;  3D22 A;  2VM1 A;  3CTG A;  4G10 A;  5IMA A;  3DKS A;  4ZL7 A;  2BTO T;  4K6X A;  1XFL A;  2A2S A;  1G6W A;  1TKD B;  1BAY A;  3EWL A;  1AXD A;  1YKC A;  2IMI A;  2H30 A;  1YEX A;  1F37 A;  4TN8 A;  1RW1 A;  5HFI A;  1PSQ A;  2LV3 A;  5A4W A;  2MBS A;  2R5G A;  3WD6 A;  2B7K A;  3L9U A;  1KTE A;  1AQW A;  3JCM L;  4IJI A;  3RHB A;  2PER A;  4IP6 A;  2VD1 A;  4HZ4 A;  1SEN A;  5ECQ B;  2N5F A;  3HHV A;  3ZVJ D;  4DSS B;  1QFN A;  2VOC A;  5ECS A;  3O3T A;  4DSQ A;  3I9V 2;  3I69 A;  3F4S A;  3W6G A;  2L59 A;  5FHI A;  3H8Q A;  3GKK A;  3LWA A;  2OBI A;  4O5R A;  3BOA A;  1XVW A;  3LOR A;  2EIQ A;  2WZ9 A;  5ID2 A;  3GKN A;  3NOF A;  4GSN A;  1WP0 A;  1SYX A;  4EUY A;  1IYI A;  4AJ7 A;  3RPP A;  5IMV A;  2VCW A;  2ES7 A;  2I3Y A;  1DE1 A;  2KP2 A;  2XPD A;  1UC7 A;  2YWN A;  1OAZ A;  2JZS A;  2WUL A;  1X5C A;  3IPZ A;  4DSR A;  3TOT A;  4L0W A;  3TKR A;  3DML A;  3BCI A;  1A2J A;  4I97 A;  4G19 A;  3F0I A;  5ECK B;  2QSI A;  4F82 A;  3D4T A;  4N30 A;  3FR9 A;  1H4O A;  3P7X A;  2HYX A;  1ST9 A;  4NAX A;  3IK9 A;  1B4Q A;  3HDC A;  2K8S A;  3GST A;  1GWC A;  3ZRE A;  2VD0 A;  4Q5Q A;  1TP9 A;  5D9T A;  2B7J A;  3QCP A;  2L6C A;  4N10 A;  3IE3 A;  1GUL A;  1W89 A;  4MJE A;  3HZ4 A;  4ZIL A;  2L5L A;  4EVM A;  2B5X A;  2VCV A;  1YY7 A;  5ID2 B;  5CNW A;  4TKY A;  6GSU A;  2GST A;  3LXT A;  1OE7 A;  4NV5 A;  3DXB A;  4TR1 B;  4EL1 A;  1FB0 A;  1U3I A;  1M7T A;  4FO5 A;  4IVF A;  4ACS A;  2TRX A;  1NHO A;  1KEB A;  2Z9S A;  5JCW A;  4ZXG A;  2I9H A;  3US3 A;  1A2L A;  5HR2 A;  4EO3 A;  2GLR A;  2B1L A;  3HD5 A;  5G2Z A;  5J4U A;  1FW1 A;  4XIH A;  2MYG A;  5DCH A;  1O8X A;  1O81 A;  3QFA C;  4V2N A;  2K6V A;  3TKS A;  4KAE A;  5CRH A;  3BCK A;  4KND A;  5AN1 A;  3C71 A;  4ISD A;  5D9W A;  1O7U A;  3QAW A;  1SK2 A;  1K0D A;  2WB9 A;  1SL1 B;  1X0R A;  3KEB A;  4Z7X A;  1U87 A;  1V98 A;  1PL1 A;  5ECH B;  1R4W A;  3VFI A;  3UVH A;  1HNA A;  3QFB C;  3IBH A;  1Z5Y E;  1THO A;  2FNO A;  1GLP A;  1GL8 A;  2IJY A;  2I81 A;  2OJL A;  3LGC A;  1U6T A;  3G7J A;  4HI7 A;  4V2L A;  3FZ9 A;  3VPT A;  1F9M A;  4Q5N A;  2GDR A;  4HZ2 A;  2NDO A;  4HOJ A;  4IW9 A;  2KUC A;  2LRN A;  1NW2 A;  3H79 A;  3RBT A;  4ULX A;  6GSW A;  5CP1 A;  2X8C A;  5DQY A;  6GST A;  2HFD A;  4TXV A;  2ON5 A;  3Q19 A;  4MZW A;  2VL3 A;  1T3B A;  4RQR A;  5ABR A;  2E2G A;  2GT6 A;  4ECB A;  1F3B A;  1B9X C;  2C8U A;  4DVC A;  5IIZ A;  2WCI A;  4KDX A;  4TXO A;  2MBT A;  4V1A g;  1V40 A;  1Z7R A;  5HR1 A;  4HDE A;  1ERW A;  3UVT A;  4ZBD A;  3EU4 A;  2IMD A;  2LJA A;  4TR3 A;  1AQV A;  1MD4 A;  1JLW A;  1MDK A;  2LNS A;  3DRN A;  1EZK A;  3WGE A;  5J41 A;  1QK8 A;  4ILF A;  1PL2 A;  2R2J A;  1EEJ A;  5HR3 A;  1K0M A;  4KSM A;  2FGX A;  5KN0 A;  2LUS A;  1VF1 A;  4X0X A;  4LMV A;  5E59 A;  3KJY A;  3QAV A;  2C4J A;  2RM5 A;  2OE0 A;  1WE0 A;  1ACV A;  1OYJ A;  2MZC A;  3E0U A;  3KIJ A;  2V6K A;  3APO A;  5F05 A;  1K0A A;  3F3Q A;  2NPB A;  4PUF C;  1KNG A;  3ZL5 A;  4I2U A;  5IMZ A;  1TI3 A;  3H1N A;  3IXR A;  3RHC A;  5CO3 A;  4OO4 A;  2KHP A;  4POM A;  5CRD A;  4ID0 A;  1FVJ A;  5GAN D;  2NVL A;  2CAQ A;  1ZMA A;  3EIN A;  1A8L A;  1JHB A;  5KEJ A;  2YWI A;  5HFK A;  4PUA A;  1EEM A;  4GTU A;  1GSS A;  1SJ6 A;  3HVS A;  1K0B A;  5LCZ A;  3FZ4 A;  1PKW A;  4BL7 A;  5D8I A;  5H5Q A;  4K7O A;  2FLS A;  2EC4 A;  2LST A;  5HFG A;  2L4C A;  2IIY A;  4NMU A;  2L5O A;  2PMT A;  1DUG A;  4PX1 A;  3ERG A;  4PXO A;  4O92 A;  3HVX A;  4OFM A;  3ZYW A;  2HE3 A;  4IS0 A;  4BWQ A;  1B48 A;  3TB2 A;  3FK8 A;  2F9S A;  2VCQ A;  1BQ7 A;  1J0F A;  3PR8 A;  4MMM A;  4NXI A;  2H1B A;  3TKS E;  2I4A A;  3TDG A;  4K9Z A;  1UN2 A;  2PUK C;  1TK0 B;  1T00 A;  2F8A A;  2VCT A;  4MCU A;  2WS2 A;  1RK4 A;  3PIN A;  1AQX A;  5INY A;  1XIY A;  3IV4 A;  4O32 A;  1VGL A;  3VUR A;  2O7K A;  4EXJ A;  2TRC P;  4MH2 A;  3VWX A;  1ZZY A;  1O73 A;  2CA8 A;  2LEG A;  5KN1 A;  2M72 A;  3Q6O A;  1WJK A;  5CAX A;  3C1R A;  2DJ0 A;  1A23 A;  2AB6 A;  2YV7 A;  1V57 A;  3F6F A;  3HCZ A;  13GS A;  2HI7 A;  2H71 A;  4FYB A;  1HYU A;  1J9B A;  4BA7 A;  1TJD A;  4K0G A;  2DJJ A;  3V1W A;  3CYN A;  3H4K A;  1E6B A;  1A0F A;  2M80 A;  4HJM A;  1N8J A;  19GS A;  3HA9 A;  4OCF A;  1S3A A;  2H1D A;  5COH A;  2YN1 A;  4ZBA A;  1B8X A;  5GZZ B;  3QOU A;  1F2E A;  1TU7 A;  3HYP A;  2O87 A;  1XWG A;  5E4W A;  1FVK A;  4ML1 A;  3WGX A;  2OA7 A;  1G7O A;  4GXZ A;  5CRW A;  5DJM A;  2K8V A;  3CXG A;  2H0I A;  3EE2 A;  2HLS A;  3WT2 A;  3GH6 A;  1XW6 A;  1ZGN A;  1SU9 A;  3GN3 A;  3TJK A;  5G5F A;  5IMC A;  17GS A;  3GTU A;  5AIV A;  2B1K A;  4IHU A;  2N5B A;  4PQH A;  3HJM A;  3EU3 A;  5H5S A;  4HQZ A;  1WPI A;  2V1M A;  3ED3 A;  1GTI A;  4WBR D;  2MMO A;  3RAZ A;  4PNG A;  5L71 A;  4MH3 A;  4FYU A;  5B6M A;  5DJL A;  3P8W A;  2VAF A;  1K3O A;  3VPQ A;  1OC3 A;  1GSD A;  2GQL A;  1ML6 A;  4CW9 A;  5CRG A;  2XHF A;  1MDI A;  3FRC A;  1B9Y C;  3I43 A;  5IOW A;  2PGT A;  2RUF A;  2PBJ A;  3APS A;  1EGO A;  3RDW A;  2H0G A;  1S3D A;  3DEX A;  4KA0 A;  1BYE A;  3UOM A;  3KH9 A;  4WF5 A;  5FT3 A;  2R37 A;  1GNE A;  3M1G A;  3GTU B;  4WEY A;  1TRV A;  1MD3 A;  4OWY A;  5DDL A;  1YQ1 A;  4ML6 A;  3ZFL A;  3G9B A;  2OE1 A;  2CV4 A;  3APQ A;  1M2D A;  1JZR A;  2LJR A;  3TJF A;  4BVX A;  14GS A;  1XOB A;  5FWG A;  3AY8 A;  5GST A;  4L5O A;  4F0B A;  4JE1 A;  3C73 A;  3ZTL A;  3FKF A;  2FCH A;  2E0Q A;  5B7C A;  1ILO A;  2LQO A;  1OC8 A;  3ME8 A;  1GTU A;  1R5P A;  4PGT A;  2P31 A;  1MEK A;  2C0D A;  3WYW A;  3VWV A;  1GTA A;  6GSX A;  1N2A A;  4I8B A;  4MA9 A;  2X64 A;  4TR1 A;  5J5N A;  1Y25 A;  4OFT A;  5ECL B;  4FYC A;  1G0T A;  1FB6 A;  3ERF A;  5C00 A;  2HZF A;  1YF1 A;  4ECC A;  4I5Q A;  1SKS B;  1XOA A;  3GIX A;  3LFL A;  2LNT A;  1FAA A;  1T4Y A;  5B8A A;  4JU5 A;  4IQ1 A;  2OAC A;  3TOU A;  3CRT A;  5DQS A;  1OE8 A;  2H1G A;  4JED A;  1XW9 A;  1JLV A;  1I9D A;  2FY6 A;  2VUP A;  4YAV A;  1TXX A;  2PN8 A;  2YOI A;  3FR6 A;  4EF0 A;  3VI5 A;  3D5J A;  4QL7 A;  3ERW A;  1T4Z A;  4K2D A;  3LG6 A;  1SD9 A;  2YP6 A;  1K0C A;  3TRQ A;  3M9K A;  3GL3 A;  1U3A A;  3OR5 A;  5ECM B;  2CT6 A;  1SK1 A;  2H73 A;  3VWU A;  2MMZ A;  1I5G A;  1JZW A;  5A5K A;  3EVI A;  4XRD A;  2BMX A;  2ZCT A;  3A2X A;  2PWJ A;  2FHE A;  3ZML A;  4XS4 A;  3M9J A;  5ECP B;  2GZP A;  1SYR A;  1XWC A;  4E8E A;  2V2G A;  3KCM A;  2GZZ A;  3MDK A;  3VLN A;  4I6X A;  5F06 A;  3TCO A;  3IAS 2;  3M3M A;  3U6V A;  2G0F A;  1FG4 A;  4G9H A;  3S9F A;  1GUM A;  11GS A;  4RI6 A;  2GS3 A;  3CTF A;  1WRY A;  4MPF A;  2VL9 A;  5G31 A;  1O85 A;  1MTC A;  4MLY A;  3L78 A;  3VWW A;  1QMV A;  4V1A p;  2H72 A;  2KLX A;  1TK8 B;  1TTZ A;  4KCE A;  1URM A;  2GT5 A;  1X5D A;  3FY7 A;  3F6D A;  1G6Y A;  1SJI A;  1R5A A;  4LL1 B;  3EMX A;  4BWS A;  4XS4 B;  3G7Y A;  1AC1 A;  3Q18 A;  2B5Y A;  1NM3 A;  5JWQ B;  2PVO C;  1M2A A;  3D21 A;  4WF4 A;  2VL2 A;  2K18 A;  5G1L A;  1BJX A;  5CRE A;  3GX0 A;  3IRA A;  1PX7 A;  4D73 A;  4KUN A;  4TR4 A;  2WJU A;  1Q4J A;  1PGT A;  2OAD A;  3QR6 A;  2CVK A;  2XPE A;  4XS1 A;  1LJR A;  1FOV A;  3QPM A;  5ECI B;  2H6X A;  1MDJ A;  1R7H A;  1TRW A;  5HR0 A;  3GUS A;  4WR4 A;  1ERT A;  1AAZ A;  5CYY A;  5HQP A;  1ZYQ B;  1NHY A;  1IYH A;  3R2Q A;  3KTL A;  3KD0 A;  2PU9 C;  1QUW A;  2HSY A;  2C0G A;  3BBY A;  1PN9 A;  2VCZ A;  1K3Y A;  4X43 A;  1JZO A;  1X9W B;  1ZL9 A;  4OMV A;  1EV9 A;  2DML A;  4I2T A;  2FA4 A;  1XCC A;  3DVX A;  4XCS A;  1Z6M A;  3FR3 A;  1GTB A;  2R4V A;  3VK9 A;  3MSZ A;  2DJ3 A;  1EP7 A;  1O8W A;  5DBQ A;  3IA1 A;  3ZFB A;  4O7H A;  3GYK A;  2HRN A;  3SBC A;  4D73 B;  1LU4 A;  1YZX A;  3CSH A;  2DJK A;  2HXK A;  1ZCP A;  4L0U A;  3GH9 A;  1WIK A;  4JZQ A;  4J2F A;  4CDO A;  1A0R P;  2B3S A;  3NIV A;  1TK5 B;  2C0E A;  1CQH A;  4XS6 A;  1OC9 B;  3UBL A;  4ZBB A;  4JR4 A;  1JZD A;  3HJO A;  4EDZ A;  2GSQ A;  4HUA A;  2H70 A;  2CX3 A;  2VLT A;  2WGR A;  1M9A A;  2P0G A;  2FD3 A;  4GST A;  4HS1 A;  3DD3 A;  1GP1 A;  16GS A;  2FWH A;  4KDY A;  4JRR A;  1T8E B;  2V32 A;  1NSW A;  1USB A;  4JBB A;  1XWK A;  2MMN A;  2B5E A;  4WET A;  1WMJ A;  1GNW A;  2YWM A;  2N5A A;  1XXU A;  2C1Y A;  4IEL A;  3DIE A;  2RUE A;  4MJB A;  1GSU A;  1GSE A;  1WWJ A;  2F3M A;  1M2B A;  5EY6 A;  3CMI A;  2H76 A;  2DJ2 A;  4J57 E;  4LL4 B;  2FWG A;  4N0Z A;  1DSB A;  3M0F A;  4NPB A;  5F8B A;  3A2V A;  1TRS A;  1HNB A;  4MJA A;  1A8Y A;  4TR0 A;  3KMN A;  1F3A A;  5ENU A;  2OBK A;  3UAP A;  2ON7 A;  3QDN A;  1M0U A;  4KGI A;  3F9U A;  5D9V A;  4PUR A;  2P5R A;  3IDV A;  1GH2 A;  2YWO A;  3L4N A;  3GSS A;  1ERV A;  3PH9 A;  3UJ1 A;  1S3C A;  3UAR A;  1EP8 A;  2C3T A;  3MWH A;  1YKA A;  2FA8 A;  2JSZ A;  3QMX A;  5KN3 A;  2IL3 A;  1F6M C;  2H19 A;  1XZO A;  3G7I A;  2DBC A;  2X8G A;  2AHE A;  3GNJ A;  4PNF A;  4OD7 A;  3H93 A;  2TIR A;  2AYT A;  2R3X A;  1YDK A;  4KCA A;  5F0G A;  1FO5 A;  4F9Z A;  4GRF A;  2I1U A;  2XBQ A;  4XTS A;  4MF7 A;  4MZB A;  4ECJ A;  3A5W A;  4GF0 A;  1CQG A;  2QC7 A;  4NHW A;  1Y6E A;  2RLI A;  1WOU A;  3MAK A;  4TRX A;  3FZ5 A;  2L57 A;  2YAN A;  2AAW A;  2JSY A;  4ECI A;  1E2Y A;  3IOS A;  2FWF A;  1ZYE A;  2GVP A;  1YJ6 A;  2G2Q A;  1Z9H A;  2J23 A;  3HJP A;  2O89 A;  3GA4 A;  5G1K A;  5G30 A;  3TJJ A;  2ALB A;  3C8E A;  3HKR A;  2GQM A;  1PA3 A;  4FH8 A; 
#chains in the Genus database with same CATH topology
 3TUE A;  2O8V B;  2LKU A;  3E3E A;  3P2A A;  3HZ8 A;  3O6T A;  4G0K A;  6GSV A;  4MAB A;  2X8H A;  1TU8 A;  5DCG A;  2CVD A;  3N9J A;  3QAG A;  5AIX A;  3DVW A;  4HEA 2;  1GSY A;  2IWT A;  3N5O A;  3F63 A;  4GWR A;  4TVE A;  2LJK A;  3W8J A;  1HNC A;  5EL8 A;  4AGS A;  4RUV A;  1A2M A;  1GUH A;  2H1A A;  3ZIT A;  2KOK A;  4WR5 A;  5IMD A;  4GQC A;  5J9C A;  2HRF A;  3MNG A;  4MPG A;  1RQM A;  1PMT A;  5EPF A;  4E8H A;  4CY8 A;  1W4V A;  1XW5 A;  1ZOF A;  4L5L A;  2VCX A;  2P5Q A;  1K0N A;  2DKH A;  2H66 A;  2YPM A;  1TW9 A;  2PPT A;  3F4R A;  4YQU A;  1A24 A;  4EKZ A;  1ABA A;  4EDY A;  1JFU A;  2GGT A;  2GZY A;  3EPT A;  3BD2 A;  4POL A;  4NV2 A;  3LYP A;  5ELA A;  1VRS D;  5F07 A;  1QGV A;  3U5R E;  2CVB A;  1X9S B;  5A4U A;  1LBK A;  2AV4 A;  4MK3 A;  3PGT A;  3KP9 A;  4FQU A;  5IM9 A;  1ON4 A;  2HRA A;  2K9F A;  3BJ5 A;  2YNX A;  3R3E A;  4GSS A;  1FHE A;  2HSH A;  3C7M A;  4NHZ A;  2VLU A;  2CZ3 A;  3A2W A;  1K3L A;  4G2E A;  5ECN B;  1X9M B;  4MDC A;  2HZE A;  3L9S A;  1OKD A;  1Z6N A;  2H01 A;  4BVY A;  1SK0 A;  1UVZ A;  3IC4 A;  4IQA A;  3IR4 A;  4TOP A;  9GSS A;  4X4J A;  4WBJ A;  2XBI A;  5LNK e;  3HVV A;  4POK A;  3FW2 A;  3D6I A;  5AGY A;  2JL4 A;  4POB A;  5IO2 A;  3ZLP A;  4HQS A;  1V2A A;  3EYT A;  1TRU A;  2R6K A;  6GSS A;  2H6Y A;  1AUC A;  2H0H A;  4O5U A;  5ECO B;  2D2Z A;  3GMF A;  2XC2 A;  4HU9 A;  5KN2 A;  5B6N A;  4QQ7 A;  2H75 A;  3D0Z A;  1BX9 A;  1VF4 A;  3GFK A;  3ZRD A;  3L0H A;  4HJ2 A;  2CZ2 A;  5JCG A;  4P3Y B;  2HZE B;  2OE3 A;  5DAL A;  5C04 A;  1SL0 B;  2LRT A;  4WKW A;  2LRC A;  4AJ6 A;  3TRP A;  4LMW A;  2IPA A;  2OKA A;  4KH7 A;  3ZMK A;  2YZH A;  3KGK A;  2J9H A;  3Q74 A;  1SJZ A;  2C0F A;  2E2M A;  1PQN A;  20GS A;  3DGQ A;  4NWY A;  2L6D A;  3LSZ A;  3E9J B;  3GKX A;  4AF2 A;  5IO0 A;  2FWE A;  5D93 A;  3CRU A;  4YKF A;  3SWL A;  2H74 A;  3O76 A;  3EMP A;  3EUR A;  3LEF A;  2PVQ A;  2FUG 2;  1GRX A;  1BED A;  1XPV A;  3EC3 A;  3GL5 A;  3TKQ A;  3ZIV A;  1K0O A;  5ELG A;  1M9B A;  3FHK A;  1ZYP A;  2JAC A;  2REM A;  2JZT A;  5ECR B;  2CQ9 A;  4EE0 A;  4MJC A;  12GS A;  3KTB A;  1HQO A;  3KH7 A;  2A2R A;  4BPY A;  3QD9 A;  5DAL B;  2GSR A;  1GSQ A;  3DWV A;  1THX A;  4ZB6 A;  3CSI A;  2GSS A;  5J9B A;  1C72 A;  10GS A;  3HXS A;  3VI7 A;  1EGR A;  1TDI A;  5IOX A;  3FZA A;  4IKH A;  1GLQ A;  5A4V A;  2B6M A;  1J08 A;  3D4M A;  1PD2 1;  4RQX A;  3FMW A;  4CHS A;  4MF6 A;  7GSS A;  3TKS C;  2ZUP A;  3GKM A;  3LQ7 A;  3ISO A;  3K8N A;  4KW6 A;  4N11 A;  3GHA A;  2QGV A;  2EIR A;  1V58 A;  5JWO B;  1SL2 B;  4JR6 A;  1H75 A;  1SD8 A;  4IGJ A;  4FIW A;  4KDU A;  3M8N A;  2EIO A;  1ERU A;  3ZZX A;  2YZU A;  4ZB8 A;  2YCD A;  2E7P A;  2F8F A;  4F03 A;  2NBS A;  4XRA A;  1OC9 A;  5DAK A;  1DE2 A;  2IME A;  4H86 A;  3F4T A;  3TJG A;  2M46 A;  5B8B A;  4WXT A;  1Q98 A;  2DLX A;  2JAD A;  3IHG A;  3ME7 A;  2IFQ A;  3HY2 A;  6GSY A;  4PQ1 A;  3WT1 A;  4OCE A;  5IPG A;  1PRX A;  18GS A;  3W8S A;  2WDU A;  4O5Q A;  5IPH A;  4F0C A;  5LD0 A;  2LS5 A;  3WGD A;  3RPN A;  5H5R A;  4K7N A;  3KP8 A;  3IK7 A;  2WFC A;  2AJQ B;  3UBK A;  4MF5 A;  1PX6 A;  4X1U A;  2HNL A;  2HSM A;  2RII A;  1OKT A;  2KP1 A;  4YAP A;  4Q5F A;  3LJR A;  2IN3 A;  2VL2 C;  2VO4 A;  5J3R A;  1QQ2 A;  3LXZ A;  3TJB A;  1Z7P A;  4J56 E;  4KSO A;  2IMK A;  4IN0 A;  1EWX A;  4TXO B;  3KXO A;  4GLT A;  2V6O A;  2CAI A;  1TI1 A;  3KMO A;  5DAK B;  1VF2 A;  2L4Q A;  1Z3E A;  3ZIJ A;  5DVB A;  2AUV A;  3TKP A;  2IFQ B;  3LW9 A;  2QKE A;  3TGZ A;  4Z2U A;  1VF3 A;  5G5E A;  1QXH A;  4DEJ A;  2CX4 A;  1DBY A;  3A3T A;  4Q5R A;  3J7Y k;  3GRX A;  3UIW A;  1XWB A;  4L8E A;  1KBN A;  4EIQ A;  1XBS A;  4MZC A;  5GAP D;  1BG5 A;  3DYR A;  3L9V A;  2H8L A;  4K1F A;  5EVO A;  1T1V A;  1GSF A;  2V41 A;  1O6J A;  4KB3 A;  4F2I A;  22GS A;  1TOF A;  5D96 A;  1EOG A;  2WRT A;  1B4P A;  5AIS A;  3GUR A;  3P90 A;  3F8U A;  5IMF A;  2BJX A;  2LTK A;  1V9W A;  3FEU A;  4AJ8 A;  4YQM A;  5JCU A;  3IAM 2;  3F3R A;  1U88 A;  3GV1 A;  1YEP A;  2C80 A;  3UL3 A;  2RM6 A;  3IHQ A;  2A4V A;  3UEM A;  1UA5 A;  2O85 A;  3KZQ A;  2DMM A;  4MP4 A;  2C3Q A;  1GUK A;  4LLR A;  4ZIJ A;  4OO5 A;  8GSS A;  1SKW B;  1EOH A;  2YV9 A;  3C1S A;  2DIZ A;  4PTS A;  4ZL8 A;  3UMA A;  3LYK A;  1OVN A;  3FYG A;  2YJH A;  2VIM A;  2DJ1 A;  3J7Y b;  4RI7 A;  3CBU A;  3CSJ A;  5IQY A;  4K7I A;  1AIU A;  4XHM A;  4ZL9 A;  4V2M A;  4QL9 A;  2C3N A;  2H6Z A;  2MMA A;  2ZNM A;  3I6A A;  4YQV A;  1X5E A;  4N0V A;  2GTU A;  4TW5 A;  1PKZ A;  4YH2 A;  2GQK A;  4K0N A;  1YF0 A;  2JZR A;  4Z2T A;  2IMF A;  2DC5 A;  5D73 A;  1HD2 A;  3CQF A;  2JU5 A;  1EV4 A;  4IP1 A;  4OFN A;  5JWR B;  2NTO A;  3TRX A;  3ZVJ A;  5GSS A;  1T7P B;  1R26 A;  2YJ7 A;  2X99 A;  1SKR B;  1G7E A;  4PQI A;  3GX8 A;  4HU7 A;  1AW9 A;  3NZN A;  4EC0 A;  2VM2 A;  1PN0 A;  4KX4 A;  4GQF A;  3KM6 A;  2DSA A;  4IBP A;  2DIY A;  2HT9 A;  2VLV A;  4DSS A;  1XWA A;  4KE3 A;  4IJ3 A;  1M99 A;  5D9X A;  4ZB9 A;  2F51 A;  2LQQ A;  4GCI A;  4K8M A;  1XVQ A;  4LA1 A;  3D22 A;  2VM1 A;  3CTG A;  4G10 A;  5IMA A;  3DKS A;  4ZL7 A;  2BTO T;  4K6X A;  1XFL A;  2A2S A;  1G6W A;  1TKD B;  1BAY A;  3EWL A;  1AXD A;  1YKC A;  2IMI A;  2H30 A;  1YEX A;  1F37 A;  4TN8 A;  1RW1 A;  5HFI A;  1PSQ A;  2LV3 A;  5A4W A;  2MBS A;  2R5G A;  3WD6 A;  2B7K A;  3L9U A;  1KTE A;  1AQW A;  3JCM L;  4IJI A;  3RHB A;  2PER A;  4IP6 A;  2VD1 A;  4HZ4 A;  1SEN A;  5ECQ B;  2N5F A;  3HHV A;  3ZVJ D;  4DSS B;  1QFN A;  2VOC A;  5ECS A;  3O3T A;  4DSQ A;  3I9V 2;  3I69 A;  3F4S A;  3W6G A;  2L59 A;  5FHI A;  3H8Q A;  3GKK A;  3LWA A;  2OBI A;  4O5R A;  3BOA A;  1XVW A;  3LOR A;  2EIQ A;  2WZ9 A;  2DKI A;  5ID2 A;  3GKN A;  3NOF A;  4GSN A;  1WP0 A;  1SYX A;  4EUY A;  1IYI A;  4AJ7 A;  3RPP A;  5IMV A;  2VCW A;  2ES7 A;  2I3Y A;  1DE1 A;  2KP2 A;  2XPD A;  1UC7 A;  2YWN A;  1OAZ A;  2JZS A;  2WUL A;  1X5C A;  3IPZ A;  4DSR A;  3TOT A;  4L0W A;  3TKR A;  3DML A;  3BCI A;  1A2J A;  4I97 A;  4G19 A;  3F0I A;  5ECK B;  2QSI A;  4F82 A;  3D4T A;  4N30 A;  3FR9 A;  1H4O A;  3P7X A;  2HYX A;  1ST9 A;  4NAX A;  3IK9 A;  1B4Q A;  5KOW A;  3HDC A;  2K8S A;  3GST A;  1GWC A;  3ZRE A;  2VD0 A;  4Q5Q A;  1TP9 A;  5D9T A;  2B7J A;  3QCP A;  2L6C A;  4N10 A;  3IE3 A;  1GUL A;  1W89 A;  4MJE A;  3HZ4 A;  4ZIL A;  2L5L A;  4EVM A;  2B5X A;  2VCV A;  1YY7 A;  5ID2 B;  5CNW A;  4TKY A;  6GSU A;  2GST A;  3LXT A;  1OE7 A;  4NV5 A;  3DXB A;  4TR1 B;  4EL1 A;  1FB0 A;  1U3I A;  1M7T A;  4FO5 A;  4IVF A;  4ACS A;  2TRX A;  1NHO A;  1KEB A;  2Z9S A;  5JCW A;  4ZXG A;  2I9H A;  2UZ8 A;  3US3 A;  1A2L A;  5HR2 A;  4EO3 A;  2GLR A;  2B1L A;  3HD5 A;  5G2Z A;  5J4U A;  1FW1 A;  4A5P A;  4XIH A;  2MYG A;  5DCH A;  1O8X A;  1O81 A;  3QFA C;  4V2N A;  2K6V A;  3TKS A;  4KAE A;  5CRH A;  3BCK A;  4KND A;  5AN1 A;  3C71 A;  4ISD A;  5D9W A;  1O7U A;  3QAW A;  1SK2 A;  1K0D A;  2WB9 A;  1SL1 B;  1X0R A;  3KEB A;  4Z7X A;  1U87 A;  1V98 A;  1PL1 A;  5ECH B;  1R4W A;  3VFI A;  3UVH A;  1HNA A;  3QFB C;  3IBH A;  1Z5Y E;  1THO A;  2FNO A;  1GLP A;  1GL8 A;  2IJY A;  2I81 A;  2OJL A;  3LGC A;  1U6T A;  3G7J A;  4HI7 A;  4V2L A;  2R0G A;  3FZ9 A;  3VPT A;  1F9M A;  4Q5N A;  2GDR A;  4ICY A;  4HZ2 A;  2NDO A;  4HOJ A;  4IW9 A;  2KUC A;  4HSC X;  2LRN A;  1NW2 A;  3H79 A;  3RBT A;  4ULX A;  6GSW A;  5CP1 A;  2X8C A;  5DQY A;  6GST A;  2HFD A;  4TXV A;  2ON5 A;  3Q19 A;  4MZW A;  2VL3 A;  1T3B A;  4RQR A;  5ABR A;  2E2G A;  2GT6 A;  4ECB A;  1F3B A;  1B9X C;  2C8U A;  4DVC A;  5IIZ A;  2WCI A;  4KDX A;  4TXO A;  2MBT A;  4V1A g;  1V40 A;  1Z7R A;  5HR1 A;  4HDE A;  1ERW A;  3UVT A;  4ZBD A;  3EU4 A;  5BRT A;  2IMD A;  2LJA A;  4TR3 A;  1AQV A;  1MD4 A;  1JLW A;  1MDK A;  2LNS A;  3DRN A;  1EZK A;  3WGE A;  5J41 A;  1QK8 A;  4ILF A;  1PL2 A;  2R2J A;  1EEJ A;  5HR3 A;  1K0M A;  4KSM A;  2FGX A;  5KN0 A;  2LUS A;  1VF1 A;  4X0X A;  4LMV A;  5E59 A;  3KJY A;  4EIP A;  3QAV A;  2C4J A;  2RM5 A;  2OE0 A;  1WE0 A;  1ACV A;  1OYJ A;  1ZYN A;  2MZC A;  3E0U A;  3KIJ A;  2V6K A;  3APO A;  5F05 A;  1K0A A;  3F3Q A;  2NPB A;  4PUF C;  1KNG A;  3ZL5 A;  4I2U A;  5IMZ A;  1TI3 A;  3H1N A;  3IXR A;  3RHC A;  5CO3 A;  4OO4 A;  2KHP A;  4POM A;  5CRD A;  4ID0 A;  4USS A;  1FVJ A;  5GAN D;  2A2P A;  2NVL A;  2CAQ A;  1ZMA A;  3EIN A;  1A8L A;  1JHB A;  5KEJ A;  2YWI A;  5HFK A;  4PUA A;  1EEM A;  4GTU A;  1GSS A;  1SJ6 A;  3HVS A;  1K0B A;  5LCZ A;  3FZ4 A;  1PKW A;  4BL7 A;  5D8I A;  5H5Q A;  4K7O A;  2FLS A;  2EC4 A;  2LST A;  5HFG A;  2L4C A;  2IIY A;  4NMU A;  2R0C A;  2L5O A;  2PMT A;  1DUG A;  4PX1 A;  3ERG A;  4PXO A;  4O92 A;  3HVX A;  4OFM A;  3ZYW A;  2HE3 A;  4IS0 A;  4BWQ A;  1B48 A;  3TB2 A;  3FK8 A;  2F9S A;  2VCQ A;  1BQ7 A;  1J0F A;  3PR8 A;  4MMM A;  4NXI A;  2H1B A;  3TKS E;  2I4A A;  3TDG A;  4K9Z A;  1UN2 A;  2PUK C;  1TK0 B;  1T00 A;  2F8A A;  2VCT A;  4MCU A;  2WS2 A;  1RK4 A;  3PIN A;  1AQX A;  5INY A;  1XIY A;  3IV4 A;  4O32 A;  1VGL A;  3VUR A;  2O7K A;  4EXJ A;  2TRC P;  4BL7 B;  4MH2 A;  3VWX A;  1ZZY A;  1O73 A;  2CA8 A;  2LEG A;  5KN1 A;  2M72 A;  3Q6O A;  1WJK A;  5CAX A;  3C1R A;  2DJ0 A;  1A23 A;  2AB6 A;  2YV7 A;  1V57 A;  3F6F A;  3HCZ A;  13GS A;  2HI7 A;  2H71 A;  4FYB A;  1HYU A;  1J9B A;  4BA7 A;  1M3I A;  1TJD A;  4K0G A;  2DJJ A;  3V1W A;  3CYN A;  3H4K A;  1E6B A;  1A0F A;  4G0L A;  2M80 A;  3A5I A;  4HJM A;  1N8J A;  19GS A;  3HA9 A;  4OCF A;  1S3A A;  2H1D A;  5COH A;  2YN1 A;  4ZBA A;  1XG8 A;  1B8X A;  5GZZ B;  3QOU A;  1F2E A;  1TU7 A;  3HYP A;  2O87 A;  1XWG A;  5E4W A;  1FVK A;  4ML1 A;  3WGX A;  2OA7 A;  1G7O A;  4GXZ A;  5CRW A;  5DJM A;  2K8V A;  3CXG A;  2H0I A;  3EE2 A;  2HLS A;  3WT2 A;  3GH6 A;  1XW6 A;  1ZGN A;  1SU9 A;  3GN3 A;  3TJK A;  5G5F A;  5IMC A;  17GS A;  3GTU A;  5AIV A;  2B1K A;  4IHU A;  2N5B A;  4PQH A;  3HJM A;  3EU3 A;  5H5S A;  4HQZ A;  1WPI A;  2V1M A;  3ED3 A;  1GTI A;  4WBR D;  2MMO A;  3RAZ A;  4PNG A;  5L71 A;  2A4H A;  4MH3 A;  4FYU A;  5B6M A;  5DJL A;  3P8W A;  2VAF A;  4G0I A;  1K3O A;  3VPQ A;  1OC3 A;  1GSD A;  2GQL A;  1M3J A;  1ML6 A;  4CW9 A;  5CRG A;  2XHF A;  1MDI A;  3FRC A;  1B9Y C;  3I43 A;  5IOW A;  2PGT A;  2RUF A;  2PBJ A;  3APS A;  1EGO A;  3RDW A;  2H0G A;  1S3D A;  3DEX A;  4Z2R A;  4KA0 A;  1BYE A;  3UOM A;  3KH9 A;  4WF5 A;  5FT3 A;  2R37 A;  1GNE A;  3M1G A;  3GTU B;  4WEY A;  1TRV A;  1MD3 A;  4OWY A;  5DDL A;  1YQ1 A;  4ML6 A;  3ZFL A;  3G9B A;  4CY6 A;  2OE1 A;  2CV4 A;  3APQ A;  1M2D A;  1JZR A;  2LJR A;  3TJF A;  4BVX A;  14GS A;  1XOB A;  5FWG A;  3AY8 A;  5GST A;  4L5O A;  4F0B A;  4K5S A;  4JE1 A;  3C73 A;  3ZTL A;  3FKF A;  2FCH A;  3MYD A;  2E0Q A;  5B7C A;  1ILO A;  2LQO A;  1OC8 A;  3ME8 A;  1GTU A;  1R5P A;  4PGT A;  2P31 A;  1MEK A;  2C0D A;  3WYW A;  3VWV A;  1GTA A;  4MNN A;  6GSX A;  1N2A A;  4I8B A;  4MA9 A;  2X64 A;  4TR1 A;  5J5N A;  1Y25 A;  4OFT A;  5ECL B;  4FYC A;  1G0T A;  1FB6 A;  3ERF A;  5C00 A;  4YKG A;  2HZF A;  1YF1 A;  4ECC A;  4I5Q A;  1SKS B;  1XOA A;  3GIX A;  3LFL A;  2LNT A;  1FAA A;  1T4Y A;  5B8A A;  4JU5 A;  4IQ1 A;  2OAC A;  3TOU A;  3CRT A;  5DQS A;  1OE8 A;  4BVX B;  2H1G A;  4JED A;  1XW9 A;  1JLV A;  1I9D A;  2FY6 A;  2VUP A;  4YAV A;  1TXX A;  2PN8 A;  2YOI A;  3FR6 A;  4EF0 A;  3VI5 A;  3D5J A;  4QL7 A;  3ERW A;  1T4Z A;  4K2D A;  3LG6 A;  1SD9 A;  2YP6 A;  1K0C A;  3TRQ A;  3M9K A;  3GL3 A;  1U3A A;  3OR5 A;  5ECM B;  2CT6 A;  1SK1 A;  2H73 A;  3VWU A;  2MMZ A;  1I5G A;  4BVY B;  1JZW A;  5A5K A;  3EVI A;  4XRD A;  2BMX A;  2ZCT A;  3A2X A;  2PWJ A;  2FHE A;  3IC8 A;  3ZML A;  4XS4 A;  3M9J A;  5ECP B;  2GZP A;  1SYR A;  1XWC A;  4E8E A;  2V2G A;  3KCM A;  2GZZ A;  3MDK A;  3VLN A;  4I6X A;  5F06 A;  3TCO A;  3IAS 2;  3M3M A;  3U6V A;  4BIK A;  2G0F A;  1FG4 A;  4G9H A;  3S9F A;  1GUM A;  11GS A;  4RI6 A;  2GS3 A;  3CTF A;  1WRY A;  4MPF A;  2VL9 A;  5G31 A;  1O85 A;  1MTC A;  4MLY A;  3L78 A;  3VWW A;  1QMV A;  4V1A p;  2H72 A;  2KLX A;  3MIX A;  1TK8 B;  1TTZ A;  4KCE A;  1URM A;  2GT5 A;  1X5D A;  3FY7 A;  3F6D A;  1G6Y A;  1SJI A;  1R5A A;  4LL1 B;  2X4A A;  3EMX A;  4KF9 A;  4BWS A;  4XS4 B;  3G7Y A;  1AC1 A;  3Q18 A;  2B5Y A;  1NM3 A;  5JWQ B;  2PVO C;  4K2X A;  1M2A A;  3D21 A;  4WF4 A;  2VL2 A;  2K18 A;  5G1L A;  1BJX A;  5CRE A;  3GX0 A;  3IRA A;  1PX7 A;  4D73 A;  4KUN A;  4TR4 A;  2WJU A;  1Q4J A;  1PGT A;  2OAD A;  3QR6 A;  2CVK A;  2XPE A;  4XS1 A;  1LJR A;  1FOV A;  3QPM A;  5ECI B;  2H6X A;  2HRK A;  1MDJ A;  1R7H A;  1TRW A;  5HR0 A;  3GUS A;  4WR4 A;  1ERT A;  1AAZ A;  5CYY A;  5HQP A;  1ZYQ B;  1NHY A;  1IYH A;  3R2Q A;  3KTL A;  3KD0 A;  2PU9 C;  1QUW A;  2HSY A;  2C0G A;  3BBY A;  1PN9 A;  2VCZ A;  1K3Y A;  4X43 A;  1JZO A;  1X9W B;  1ZL9 A;  4OMV A;  1EV9 A;  2DML A;  4I2T A;  2FA4 A;  1XCC A;  3DVX A;  4XCS A;  1Z6M A;  3FR3 A;  1GTB A;  2R4V A;  3VK9 A;  3MSZ A;  2DJ3 A;  1EP7 A;  1O8W A;  5DBQ A;  3IA1 A;  3ZFB A;  4O7H A;  3GYK A;  2HRN A;  3SBC A;  4D73 B;  1LU4 A;  1YZX A;  3CSH A;  2DJK A;  2HXK A;  1ZCP A;  4L0U A;  3GH9 A;  1WIK A;  4JZQ A;  4J2F A;  4CDO A;  1A0R P;  2B3S A;  3NIV A;  1TK5 B;  2C0E A;  1CQH A;  4XS6 A;  1OC9 B;  3UBL A;  4ZBB A;  4JR4 A;  1JZD A;  3HJO A;  4EDZ A;  2GSQ A;  2X49 A;  4HUA A;  2H70 A;  2CX3 A;  2VLT A;  2WGR A;  1M9A A;  2P0G A;  2FD3 A;  4GST A;  4HS1 A;  3DD3 A;  1GP1 A;  16GS A;  2FWH A;  4KDY A;  4JRR A;  1T8E B;  2V32 A;  1NSW A;  1USB A;  4JBB A;  1XWK A;  2MMN A;  2B5E A;  4WET A;  1WMJ A;  1GNW A;  2YWM A;  2N5A A;  1XXU A;  2C1Y A;  4IEL A;  3DIE A;  2RUE A;  4MJB A;  1GSU A;  1GSE A;  1WWJ A;  2F3M A;  1M2B A;  5EY6 A;  3CMI A;  2H76 A;  2DJ2 A;  4J57 E;  4LL4 B;  2FWG A;  4N0Z A;  1DSB A;  3M0F A;  4NPB A;  5F8B A;  3A2V A;  1TRS A;  1HNB A;  4MJA A;  1A8Y A;  4TR0 A;  3KMN A;  1F3A A;  2QA2 A;  5ENU A;  1S3R A;  2OBK A;  3UAP A;  2ON7 A;  3QDN A;  1M0U A;  4KGI A;  3F9U A;  5D9V A;  4PUR A;  2P5R A;  3IDV A;  1GH2 A;  5KOX A;  2YWO A;  3L4N A;  3GSS A;  1ERV A;  3PH9 A;  3UJ1 A;  1S3C A;  3UAR A;  1EP8 A;  2C3T A;  3MWH A;  1YKA A;  2FA8 A;  2JSZ A;  3QMX A;  5KN3 A;  2IL3 A;  1F6M C;  1FOH A;  2H19 A;  1XZO A;  3G7I A;  5BMU A;  2DBC A;  2X8G A;  2AHE A;  3GNJ A;  4PNF A;  4OD7 A;  3H93 A;  2TIR A;  2AYT A;  2R3X A;  1YDK A;  4KCA A;  5F0G A;  1FO5 A;  4F9Z A;  4GRF A;  2I1U A;  2XBQ A;  4XTS A;  2QA1 A;  4MF7 A;  4MZB A;  4ECJ A;  3A5W A;  4GF0 A;  1CQG A;  2QC7 A;  4NHW A;  1Y6E A;  2RLI A;  1WOU A;  3MAK A;  4TRX A;  3FZ5 A;  2L57 A;  2YAN A;  1PFO A;  2AAW A;  2JSY A;  4ECI A;  1E2Y A;  3IOS A;  3PPU A;  2FWF A;  1ZYE A;  4K5R A;  3HVN A;  2GVP A;  1YJ6 A;  2G2Q A;  2R0P A;  1Z9H A;  2J23 A;  3HJP A;  2O89 A;  3GA4 A;  5G1K A;  5G30 A;  3TJJ A;  2ALB A;  3C8E A;  3HKR A;  2GQM A;  1PA3 A;  4FH8 A; 
#chains in the Genus database with same CATH homology
 3TUE A;  2O8V B;  2LKU A;  3E3E A;  3P2A A;  3HZ8 A;  3O6T A;  4G0K A;  6GSV A;  4MAB A;  2X8H A;  1TU8 A;  5DCG A;  2CVD A;  3N9J A;  3QAG A;  5AIX A;  3DVW A;  4HEA 2;  1GSY A;  2IWT A;  3N5O A;  3F63 A;  4GWR A;  4TVE A;  2LJK A;  3W8J A;  1HNC A;  5EL8 A;  4AGS A;  4RUV A;  1A2M A;  1GUH A;  2H1A A;  3ZIT A;  2KOK A;  4WR5 A;  5IMD A;  4GQC A;  5J9C A;  2HRF A;  3MNG A;  4MPG A;  1RQM A;  1PMT A;  5EPF A;  4E8H A;  4CY8 A;  1W4V A;  1XW5 A;  1ZOF A;  4L5L A;  2VCX A;  2P5Q A;  1K0N A;  2DKH A;  2H66 A;  2YPM A;  1TW9 A;  2PPT A;  3F4R A;  4YQU A;  1A24 A;  4EKZ A;  1ABA A;  4EDY A;  1JFU A;  2GGT A;  2GZY A;  3EPT A;  3BD2 A;  4POL A;  4NV2 A;  3LYP A;  5ELA A;  1VRS D;  5F07 A;  1QGV A;  3U5R E;  2CVB A;  1X9S B;  5A4U A;  1LBK A;  2AV4 A;  4MK3 A;  3PGT A;  3KP9 A;  4FQU A;  5IM9 A;  1ON4 A;  2HRA A;  2K9F A;  3BJ5 A;  2YNX A;  3R3E A;  4GSS A;  1FHE A;  2HSH A;  3C7M A;  4NHZ A;  2VLU A;  2CZ3 A;  3A2W A;  1K3L A;  4G2E A;  5ECN B;  1X9M B;  4MDC A;  2HZE A;  3L9S A;  1OKD A;  1Z6N A;  2H01 A;  4BVY A;  1SK0 A;  1UVZ A;  3IC4 A;  4IQA A;  3IR4 A;  4TOP A;  9GSS A;  4X4J A;  4WBJ A;  2XBI A;  5LNK e;  3HVV A;  4POK A;  3FW2 A;  3D6I A;  5AGY A;  2JL4 A;  4POB A;  5IO2 A;  3ZLP A;  4HQS A;  1V2A A;  3EYT A;  1TRU A;  2R6K A;  6GSS A;  2H6Y A;  1AUC A;  2H0H A;  4O5U A;  5ECO B;  2D2Z A;  3GMF A;  2XC2 A;  4HU9 A;  5KN2 A;  5B6N A;  4QQ7 A;  2H75 A;  3D0Z A;  1BX9 A;  1VF4 A;  3GFK A;  3ZRD A;  3L0H A;  4HJ2 A;  2CZ2 A;  5JCG A;  4P3Y B;  2HZE B;  2OE3 A;  5DAL A;  5C04 A;  1SL0 B;  2LRT A;  4WKW A;  2LRC A;  4AJ6 A;  3TRP A;  4LMW A;  2IPA A;  2OKA A;  4KH7 A;  3ZMK A;  2YZH A;  3KGK A;  2J9H A;  3Q74 A;  1SJZ A;  2C0F A;  2E2M A;  1PQN A;  20GS A;  3DGQ A;  4NWY A;  2L6D A;  3LSZ A;  3E9J B;  3GKX A;  4AF2 A;  5IO0 A;  2FWE A;  5D93 A;  3CRU A;  4YKF A;  3SWL A;  2H74 A;  3O76 A;  3EMP A;  3EUR A;  3LEF A;  2PVQ A;  2FUG 2;  1GRX A;  1BED A;  1XPV A;  3EC3 A;  3GL5 A;  3TKQ A;  3ZIV A;  1K0O A;  5ELG A;  1M9B A;  3FHK A;  1ZYP A;  2JAC A;  2REM A;  2JZT A;  5ECR B;  2CQ9 A;  4EE0 A;  4MJC A;  12GS A;  3KTB A;  1HQO A;  3KH7 A;  2A2R A;  4BPY A;  3QD9 A;  5DAL B;  2GSR A;  1GSQ A;  3DWV A;  1THX A;  4ZB6 A;  3CSI A;  2GSS A;  5J9B A;  1C72 A;  10GS A;  3HXS A;  3VI7 A;  1EGR A;  1TDI A;  5IOX A;  3FZA A;  4IKH A;  1GLQ A;  5A4V A;  2B6M A;  1J08 A;  3D4M A;  1PD2 1;  4RQX A;  3FMW A;  4CHS A;  4MF6 A;  7GSS A;  3TKS C;  2ZUP A;  3GKM A;  3LQ7 A;  3ISO A;  3K8N A;  4KW6 A;  4N11 A;  3GHA A;  2QGV A;  2EIR A;  1V58 A;  5JWO B;  1SL2 B;  4JR6 A;  1H75 A;  1SD8 A;  4IGJ A;  4FIW A;  4KDU A;  3M8N A;  2EIO A;  1ERU A;  3ZZX A;  2YZU A;  4ZB8 A;  2YCD A;  2E7P A;  2F8F A;  4F03 A;  2NBS A;  4XRA A;  1OC9 A;  5DAK A;  1DE2 A;  2IME A;  4H86 A;  3F4T A;  3TJG A;  2M46 A;  5B8B A;  4WXT A;  1Q98 A;  2DLX A;  2JAD A;  3IHG A;  3ME7 A;  2IFQ A;  3HY2 A;  6GSY A;  4PQ1 A;  3WT1 A;  4OCE A;  5IPG A;  1PRX A;  18GS A;  3W8S A;  2WDU A;  4O5Q A;  5IPH A;  4F0C A;  5LD0 A;  2LS5 A;  3WGD A;  3RPN A;  5H5R A;  4K7N A;  3KP8 A;  3IK7 A;  2WFC A;  2AJQ B;  3UBK A;  4MF5 A;  1PX6 A;  4X1U A;  2HNL A;  2HSM A;  2RII A;  1OKT A;  2KP1 A;  4YAP A;  4Q5F A;  3LJR A;  2IN3 A;  2VL2 C;  2VO4 A;  5J3R A;  1QQ2 A;  3LXZ A;  3TJB A;  1Z7P A;  4J56 E;  4KSO A;  2IMK A;  4IN0 A;  1EWX A;  4TXO B;  3KXO A;  4GLT A;  2V6O A;  2CAI A;  1TI1 A;  3KMO A;  5DAK B;  1VF2 A;  2L4Q A;  1Z3E A;  3ZIJ A;  5DVB A;  2AUV A;  3TKP A;  2IFQ B;  3LW9 A;  2QKE A;  3TGZ A;  4Z2U A;  1VF3 A;  5G5E A;  1QXH A;  4DEJ A;  2CX4 A;  1DBY A;  3A3T A;  4Q5R A;  3J7Y k;  3GRX A;  3UIW A;  1XWB A;  4L8E A;  1KBN A;  4EIQ A;  1XBS A;  4MZC A;  5GAP D;  1BG5 A;  3DYR A;  3L9V A;  2H8L A;  4K1F A;  5EVO A;  1T1V A;  1GSF A;  2V41 A;  1O6J A;  4KB3 A;  4F2I A;  22GS A;  1TOF A;  5D96 A;  1EOG A;  2WRT A;  1B4P A;  5AIS A;  3GUR A;  3P90 A;  3F8U A;  5IMF A;  2BJX A;  2LTK A;  1V9W A;  3FEU A;  4AJ8 A;  4YQM A;  5JCU A;  3IAM 2;  3F3R A;  1U88 A;  3GV1 A;  1YEP A;  2C80 A;  3UL3 A;  2RM6 A;  3IHQ A;  2A4V A;  3UEM A;  1UA5 A;  2O85 A;  3KZQ A;  2DMM A;  4MP4 A;  2C3Q A;  1GUK A;  4LLR A;  4ZIJ A;  4OO5 A;  8GSS A;  1SKW B;  1EOH A;  2YV9 A;  3C1S A;  2DIZ A;  4PTS A;  4ZL8 A;  3UMA A;  3LYK A;  1OVN A;  3FYG A;  2YJH A;  2VIM A;  2DJ1 A;  3J7Y b;  4RI7 A;  3CBU A;  3CSJ A;  5IQY A;  4K7I A;  1AIU A;  4XHM A;  4ZL9 A;  4V2M A;  4QL9 A;  2C3N A;  2H6Z A;  2MMA A;  2ZNM A;  3I6A A;  4YQV A;  1X5E A;  4N0V A;  2GTU A;  4TW5 A;  1PKZ A;  4YH2 A;  2GQK A;  4K0N A;  1YF0 A;  2JZR A;  4Z2T A;  2IMF A;  2DC5 A;  5D73 A;  1HD2 A;  2JU5 A;  1EV4 A;  4IP1 A;  4OFN A;  5JWR B;  2NTO A;  3TRX A;  3ZVJ A;  5GSS A;  1T7P B;  1R26 A;  2YJ7 A;  2X99 A;  1SKR B;  1G7E A;  4PQI A;  3GX8 A;  4HU7 A;  1AW9 A;  3NZN A;  4EC0 A;  2VM2 A;  1PN0 A;  4KX4 A;  4GQF A;  3KM6 A;  2DSA A;  4IBP A;  2DIY A;  2HT9 A;  2VLV A;  4DSS A;  1XWA A;  4KE3 A;  4IJ3 A;  1M99 A;  5D9X A;  4ZB9 A;  2F51 A;  2LQQ A;  4GCI A;  4K8M A;  1XVQ A;  4LA1 A;  3D22 A;  2VM1 A;  3CTG A;  4G10 A;  5IMA A;  3DKS A;  4ZL7 A;  2BTO T;  4K6X A;  1XFL A;  2A2S A;  1G6W A;  1TKD B;  1BAY A;  3EWL A;  1AXD A;  1YKC A;  2IMI A;  2H30 A;  1YEX A;  1F37 A;  4TN8 A;  1RW1 A;  5HFI A;  1PSQ A;  2LV3 A;  5A4W A;  2MBS A;  2R5G A;  3WD6 A;  2B7K A;  3L9U A;  1KTE A;  1AQW A;  3JCM L;  4IJI A;  3RHB A;  2PER A;  4IP6 A;  2VD1 A;  4HZ4 A;  1SEN A;  5ECQ B;  2N5F A;  3HHV A;  3ZVJ D;  4DSS B;  1QFN A;  2VOC A;  5ECS A;  3O3T A;  4DSQ A;  3I9V 2;  3I69 A;  3F4S A;  3W6G A;  2L59 A;  5FHI A;  3H8Q A;  3GKK A;  3LWA A;  2OBI A;  4O5R A;  3BOA A;  1XVW A;  3LOR A;  2EIQ A;  2WZ9 A;  2DKI A;  5ID2 A;  3GKN A;  3NOF A;  4GSN A;  1WP0 A;  1SYX A;  4EUY A;  1IYI A;  4AJ7 A;  3RPP A;  5IMV A;  2VCW A;  2ES7 A;  2I3Y A;  1DE1 A;  2KP2 A;  2XPD A;  1UC7 A;  2YWN A;  1OAZ A;  2JZS A;  2WUL A;  1X5C A;  3IPZ A;  4DSR A;  3TOT A;  4L0W A;  3TKR A;  3DML A;  3BCI A;  1A2J A;  4I97 A;  4G19 A;  3F0I A;  5ECK B;  2QSI A;  4F82 A;  3D4T A;  4N30 A;  3FR9 A;  1H4O A;  3P7X A;  2HYX A;  1ST9 A;  4NAX A;  3IK9 A;  1B4Q A;  5KOW A;  3HDC A;  2K8S A;  3GST A;  1GWC A;  3ZRE A;  2VD0 A;  4Q5Q A;  1TP9 A;  5D9T A;  2B7J A;  3QCP A;  2L6C A;  4N10 A;  3IE3 A;  1GUL A;  1W89 A;  4MJE A;  3HZ4 A;  4ZIL A;  2L5L A;  4EVM A;  2B5X A;  2VCV A;  1YY7 A;  5ID2 B;  5CNW A;  4TKY A;  6GSU A;  2GST A;  3LXT A;  1OE7 A;  4NV5 A;  3DXB A;  4TR1 B;  4EL1 A;  1FB0 A;  1U3I A;  1M7T A;  4FO5 A;  4IVF A;  4ACS A;  2TRX A;  1NHO A;  1KEB A;  2Z9S A;  5JCW A;  4ZXG A;  2I9H A;  2UZ8 A;  3US3 A;  1A2L A;  5HR2 A;  4EO3 A;  2GLR A;  2B1L A;  3HD5 A;  5G2Z A;  5J4U A;  1FW1 A;  4A5P A;  4XIH A;  2MYG A;  5DCH A;  1O8X A;  1O81 A;  3QFA C;  4V2N A;  2K6V A;  3TKS A;  4KAE A;  5CRH A;  3BCK A;  4KND A;  5AN1 A;  3C71 A;  4ISD A;  5D9W A;  1O7U A;  3QAW A;  1SK2 A;  1K0D A;  2WB9 A;  1SL1 B;  1X0R A;  3KEB A;  4Z7X A;  1U87 A;  1V98 A;  1PL1 A;  5ECH B;  1R4W A;  3VFI A;  3UVH A;  1HNA A;  3QFB C;  3IBH A;  1Z5Y E;  1THO A;  2FNO A;  1GLP A;  1GL8 A;  2IJY A;  2I81 A;  2OJL A;  3LGC A;  1U6T A;  3G7J A;  4HI7 A;  4V2L A;  2R0G A;  3FZ9 A;  3VPT A;  1F9M A;  4Q5N A;  2GDR A;  4ICY A;  4HZ2 A;  2NDO A;  4HOJ A;  4IW9 A;  2KUC A;  2LRN A;  1NW2 A;  3H79 A;  3RBT A;  4ULX A;  6GSW A;  5CP1 A;  2X8C A;  5DQY A;  6GST A;  2HFD A;  4TXV A;  2ON5 A;  3Q19 A;  4MZW A;  2VL3 A;  1T3B A;  4RQR A;  5ABR A;  2E2G A;  2GT6 A;  4ECB A;  1F3B A;  1B9X C;  2C8U A;  4DVC A;  5IIZ A;  2WCI A;  4KDX A;  4TXO A;  2MBT A;  4V1A g;  1V40 A;  1Z7R A;  5HR1 A;  4HDE A;  1ERW A;  3UVT A;  4ZBD A;  3EU4 A;  5BRT A;  2IMD A;  2LJA A;  4TR3 A;  1AQV A;  1MD4 A;  1JLW A;  1MDK A;  2LNS A;  3DRN A;  1EZK A;  3WGE A;  5J41 A;  1QK8 A;  4ILF A;  1PL2 A;  2R2J A;  1EEJ A;  5HR3 A;  1K0M A;  4KSM A;  2FGX A;  5KN0 A;  2LUS A;  1VF1 A;  4X0X A;  4LMV A;  5E59 A;  3KJY A;  4EIP A;  3QAV A;  2C4J A;  2RM5 A;  2OE0 A;  1WE0 A;  1ACV A;  1OYJ A;  1ZYN A;  2MZC A;  3E0U A;  3KIJ A;  2V6K A;  3APO A;  5F05 A;  1K0A A;  3F3Q A;  2NPB A;  4PUF C;  1KNG A;  3ZL5 A;  4I2U A;  5IMZ A;  1TI3 A;  3H1N A;  3IXR A;  3RHC A;  5CO3 A;  4OO4 A;  2KHP A;  4POM A;  5CRD A;  4ID0 A;  4USS A;  1FVJ A;  5GAN D;  2A2P A;  2NVL A;  2CAQ A;  1ZMA A;  3EIN A;  1A8L A;  1JHB A;  5KEJ A;  2YWI A;  5HFK A;  4PUA A;  1EEM A;  4GTU A;  1GSS A;  1SJ6 A;  3HVS A;  1K0B A;  5LCZ A;  3FZ4 A;  1PKW A;  4BL7 A;  5D8I A;  5H5Q A;  4K7O A;  2FLS A;  2EC4 A;  2LST A;  5HFG A;  2L4C A;  2IIY A;  4NMU A;  2R0C A;  2L5O A;  2PMT A;  1DUG A;  4PX1 A;  3ERG A;  4PXO A;  4O92 A;  3HVX A;  4OFM A;  3ZYW A;  2HE3 A;  4IS0 A;  4BWQ A;  1B48 A;  3TB2 A;  3FK8 A;  2F9S A;  2VCQ A;  1BQ7 A;  1J0F A;  3PR8 A;  4MMM A;  4NXI A;  2H1B A;  3TKS E;  2I4A A;  3TDG A;  4K9Z A;  1UN2 A;  2PUK C;  1TK0 B;  1T00 A;  2F8A A;  2VCT A;  4MCU A;  2WS2 A;  1RK4 A;  3PIN A;  1AQX A;  5INY A;  1XIY A;  3IV4 A;  4O32 A;  1VGL A;  3VUR A;  2O7K A;  4EXJ A;  2TRC P;  4BL7 B;  4MH2 A;  3VWX A;  1ZZY A;  1O73 A;  2CA8 A;  2LEG A;  5KN1 A;  2M72 A;  3Q6O A;  1WJK A;  5CAX A;  3C1R A;  2DJ0 A;  1A23 A;  2AB6 A;  2YV7 A;  1V57 A;  3F6F A;  3HCZ A;  13GS A;  2HI7 A;  2H71 A;  4FYB A;  1HYU A;  1J9B A;  4BA7 A;  1TJD A;  4K0G A;  2DJJ A;  3V1W A;  3CYN A;  3H4K A;  1E6B A;  1A0F A;  4G0L A;  2M80 A;  3A5I A;  4HJM A;  1N8J A;  19GS A;  3HA9 A;  4OCF A;  1S3A A;  2H1D A;  5COH A;  2YN1 A;  4ZBA A;  1B8X A;  5GZZ B;  3QOU A;  1F2E A;  1TU7 A;  3HYP A;  2O87 A;  1XWG A;  5E4W A;  1FVK A;  4ML1 A;  3WGX A;  2OA7 A;  1G7O A;  4GXZ A;  5CRW A;  5DJM A;  2K8V A;  3CXG A;  2H0I A;  3EE2 A;  2HLS A;  3WT2 A;  3GH6 A;  1XW6 A;  1ZGN A;  1SU9 A;  3GN3 A;  3TJK A;  5G5F A;  5IMC A;  17GS A;  3GTU A;  5AIV A;  2B1K A;  4IHU A;  2N5B A;  4PQH A;  3HJM A;  3EU3 A;  5H5S A;  4HQZ A;  1WPI A;  2V1M A;  3ED3 A;  1GTI A;  4WBR D;  2MMO A;  3RAZ A;  4PNG A;  5L71 A;  2A4H A;  4MH3 A;  4FYU A;  5B6M A;  5DJL A;  3P8W A;  2VAF A;  4G0I A;  1K3O A;  3VPQ A;  1OC3 A;  1GSD A;  2GQL A;  1ML6 A;  4CW9 A;  5CRG A;  2XHF A;  1MDI A;  3FRC A;  1B9Y C;  3I43 A;  5IOW A;  2PGT A;  2RUF A;  2PBJ A;  3APS A;  1EGO A;  3RDW A;  2H0G A;  1S3D A;  3DEX A;  4Z2R A;  4KA0 A;  1BYE A;  3UOM A;  3KH9 A;  4WF5 A;  5FT3 A;  2R37 A;  1GNE A;  3M1G A;  3GTU B;  4WEY A;  1TRV A;  1MD3 A;  4OWY A;  5DDL A;  1YQ1 A;  4ML6 A;  3ZFL A;  3G9B A;  4CY6 A;  2OE1 A;  2CV4 A;  3APQ A;  1M2D A;  1JZR A;  2LJR A;  3TJF A;  4BVX A;  14GS A;  1XOB A;  5FWG A;  3AY8 A;  5GST A;  4L5O A;  4F0B A;  4K5S A;  4JE1 A;  3C73 A;  3ZTL A;  3FKF A;  2FCH A;  3MYD A;  2E0Q A;  5B7C A;  1ILO A;  2LQO A;  1OC8 A;  3ME8 A;  1GTU A;  1R5P A;  4PGT A;  2P31 A;  1MEK A;  2C0D A;  3WYW A;  3VWV A;  1GTA A;  4MNN A;  6GSX A;  1N2A A;  4I8B A;  4MA9 A;  2X64 A;  4TR1 A;  5J5N A;  1Y25 A;  4OFT A;  5ECL B;  4FYC A;  1G0T A;  1FB6 A;  3ERF A;  5C00 A;  4YKG A;  2HZF A;  1YF1 A;  4ECC A;  4I5Q A;  1SKS B;  1XOA A;  3GIX A;  3LFL A;  2LNT A;  1FAA A;  1T4Y A;  5B8A A;  4JU5 A;  4IQ1 A;  2OAC A;  3TOU A;  3CRT A;  5DQS A;  1OE8 A;  4BVX B;  2H1G A;  4JED A;  1XW9 A;  1JLV A;  1I9D A;  2FY6 A;  2VUP A;  4YAV A;  1TXX A;  2PN8 A;  2YOI A;  3FR6 A;  4EF0 A;  3VI5 A;  3D5J A;  4QL7 A;  3ERW A;  1T4Z A;  4K2D A;  3LG6 A;  1SD9 A;  2YP6 A;  1K0C A;  3TRQ A;  3M9K A;  3GL3 A;  1U3A A;  3OR5 A;  5ECM B;  2CT6 A;  1SK1 A;  2H73 A;  3VWU A;  2MMZ A;  1I5G A;  4BVY B;  1JZW A;  5A5K A;  3EVI A;  4XRD A;  2BMX A;  2ZCT A;  3A2X A;  2PWJ A;  2FHE A;  3IC8 A;  3ZML A;  4XS4 A;  3M9J A;  5ECP B;  2GZP A;  1SYR A;  1XWC A;  4E8E A;  2V2G A;  3KCM A;  2GZZ A;  3MDK A;  3VLN A;  4I6X A;  5F06 A;  3TCO A;  3IAS 2;  3M3M A;  3U6V A;  2G0F A;  1FG4 A;  4G9H A;  3S9F A;  1GUM A;  11GS A;  4RI6 A;  2GS3 A;  3CTF A;  1WRY A;  4MPF A;  2VL9 A;  5G31 A;  1O85 A;  1MTC A;  4MLY A;  3L78 A;  3VWW A;  1QMV A;  4V1A p;  2H72 A;  2KLX A;  3MIX A;  1TK8 B;  1TTZ A;  4KCE A;  1URM A;  2GT5 A;  1X5D A;  3FY7 A;  3F6D A;  1G6Y A;  1SJI A;  1R5A A;  4LL1 B;  2X4A A;  3EMX A;  4KF9 A;  4BWS A;  4XS4 B;  3G7Y A;  1AC1 A;  3Q18 A;  2B5Y A;  1NM3 A;  5JWQ B;  2PVO C;  4K2X A;  1M2A A;  3D21 A;  4WF4 A;  2VL2 A;  2K18 A;  5G1L A;  1BJX A;  5CRE A;  3GX0 A;  3IRA A;  1PX7 A;  4D73 A;  4KUN A;  4TR4 A;  2WJU A;  1Q4J A;  1PGT A;  2OAD A;  3QR6 A;  2CVK A;  2XPE A;  4XS1 A;  1LJR A;  1FOV A;  3QPM A;  5ECI B;  2H6X A;  2HRK A;  1MDJ A;  1R7H A;  1TRW A;  5HR0 A;  3GUS A;  4WR4 A;  1ERT A;  1AAZ A;  5CYY A;  5HQP A;  1ZYQ B;  1NHY A;  1IYH A;  3R2Q A;  3KTL A;  3KD0 A;  2PU9 C;  1QUW A;  2HSY A;  2C0G A;  3BBY A;  1PN9 A;  2VCZ A;  1K3Y A;  4X43 A;  1JZO A;  1X9W B;  1ZL9 A;  4OMV A;  1EV9 A;  2DML A;  4I2T A;  2FA4 A;  1XCC A;  3DVX A;  4XCS A;  1Z6M A;  3FR3 A;  1GTB A;  2R4V A;  3VK9 A;  3MSZ A;  2DJ3 A;  1EP7 A;  1O8W A;  5DBQ A;  3IA1 A;  3ZFB A;  4O7H A;  3GYK A;  2HRN A;  3SBC A;  4D73 B;  1LU4 A;  1YZX A;  3CSH A;  2DJK A;  2HXK A;  1ZCP A;  4L0U A;  3GH9 A;  1WIK A;  4JZQ A;  4J2F A;  4CDO A;  1A0R P;  2B3S A;  3NIV A;  1TK5 B;  2C0E A;  1CQH A;  4XS6 A;  1OC9 B;  3UBL A;  4ZBB A;  4JR4 A;  1JZD A;  3HJO A;  4EDZ A;  2GSQ A;  2X49 A;  4HUA A;  2H70 A;  2CX3 A;  2VLT A;  2WGR A;  1M9A A;  2P0G A;  2FD3 A;  4GST A;  4HS1 A;  3DD3 A;  1GP1 A;  16GS A;  2FWH A;  4KDY A;  4JRR A;  1T8E B;  2V32 A;  1NSW A;  1USB A;  4JBB A;  1XWK A;  2MMN A;  2B5E A;  4WET A;  1WMJ A;  1GNW A;  2YWM A;  2N5A A;  1XXU A;  2C1Y A;  4IEL A;  3DIE A;  2RUE A;  4MJB A;  1GSU A;  1GSE A;  1WWJ A;  2F3M A;  1M2B A;  5EY6 A;  3CMI A;  2H76 A;  2DJ2 A;  4J57 E;  4LL4 B;  2FWG A;  4N0Z A;  1DSB A;  3M0F A;  4NPB A;  5F8B A;  3A2V A;  1TRS A;  1HNB A;  4MJA A;  1A8Y A;  4TR0 A;  3KMN A;  1F3A A;  2QA2 A;  5ENU A;  2OBK A;  3UAP A;  2ON7 A;  3QDN A;  1M0U A;  4KGI A;  3F9U A;  5D9V A;  4PUR A;  2P5R A;  3IDV A;  1GH2 A;  5KOX A;  2YWO A;  3L4N A;  3GSS A;  1ERV A;  3PH9 A;  3UJ1 A;  1S3C A;  3UAR A;  1EP8 A;  2C3T A;  3MWH A;  1YKA A;  2FA8 A;  2JSZ A;  3QMX A;  5KN3 A;  2IL3 A;  1F6M C;  1FOH A;  2H19 A;  1XZO A;  3G7I A;  5BMU A;  2DBC A;  2X8G A;  2AHE A;  3GNJ A;  4PNF A;  4OD7 A;  3H93 A;  2TIR A;  2AYT A;  2R3X A;  1YDK A;  4KCA A;  5F0G A;  1FO5 A;  4F9Z A;  4GRF A;  2I1U A;  2XBQ A;  4XTS A;  2QA1 A;  4MF7 A;  4MZB A;  4ECJ A;  3A5W A;  4GF0 A;  1CQG A;  2QC7 A;  4NHW A;  1Y6E A;  2RLI A;  1WOU A;  3MAK A;  4TRX A;  3FZ5 A;  2L57 A;  2YAN A;  2AAW A;  2JSY A;  4ECI A;  1E2Y A;  3IOS A;  3PPU A;  2FWF A;  1ZYE A;  4K5R A;  2GVP A;  1YJ6 A;  2G2Q A;  2R0P A;  1Z9H A;  2J23 A;  3HJP A;  2O89 A;  3GA4 A;  5G1K A;  5G30 A;  3TJJ A;  2ALB A;  3C8E A;  3HKR A;  2GQM A;  1PA3 A;  4FH8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...