1KNGA

Crystal structure of ccmg reducing oxidoreductase at 1.14 a
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
144
structure length
144
Chain Sequence
RPAPQTALPPLEGLQADNVQVPGLDPAAFKGKVSLVNVWASWCVPCHDEAPLLTELGKDKRFQLVGINYKDAADNARRFLGRYGNPFGRVGVDANGRASIEWGVYGVPETFVVGREGTIVYKLVGPITPDNLRSVLLPQMEKAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords THIOL:DISULFIDE INTERCHANGE PROTEIN CYCY
publication title Structure of CcmG/DsbE at 1.14 A resolution: high-fidelity reducing activity in an indiscriminately oxidizing environment
pubmed doi rcsb
source organism Bradyrhizobium japonicum
total genus 46
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 2001-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08534 Redoxin Redoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1kngA00
2H1AA 4KDXA 1T00A 1G7EA 4J57E 4IS0A 3CYNA 5A5KA 1WOUA 3TRPA 3WYWA 1GL8A 4RUVA 4PUFC 3L0HA 2GSSA 3I43A 4EKZA 3ZIVA 5JCGA 1GH2A 4NV5A 2HYXA 1GNEA 2ON7A 1X9SB 2ES7A 2PU9C 2PWJA 3ZFBA 2RM6A 1YF1A 4V2LA 1KEBA 5HFIA 2DC5A 2H8LA 3C1SA 4XCSA 1AQVA 3L4NA 3MDKA 3TDGA 1GTBA 2H66A 2JZTA 2ZCTA 1WWJA 4KDUA 2CT6A 4CDOA 4NV2A 3IAS2 3MWHA 4GSSA 1HQOA 3HY2A 4LL4B 1GRXA 5DAKA 3TKSA 4EC0A 5C04A 1JFUA 2J23A 2JACA 5DALA 4XS4B 1FB0A 5AN1A 2JL4A 2O85A 2VM2A 1OC3A 3KH9A 4XRAA 3D22A 2GZZA 2FA8A 3EMXA 3EYTA 4AJ6A 1X0RA 5ECHB 3GV1A 1DUGA 1O85A 1Y25A 1JZWA 1G0TA 4OMVA 3FZ4A 4D73A 1B9YC 5DCGA 5HR2A 2H1GA 2HT9A 4Q5FA 1QGVA 2H71A 5H5RA 1R4WA 2MMNA 4TR1A 1OC9B 2IMDA 4IHUA 1T1VA 1WJKA 1SYXA 4N0VA 3A2WA 2GZYA 1B9XC 3TJKA 1PKWA 4ZXGA 1NW2A 4F03A 2I1UA 2H1DA 4TXVA 6GSTA 1XXUA 1AQWA 1JZDA 4WXTA 1EGRA 3FZAA 4V1Ap 2F3MA 2K9FA 4I8BA 2AHEA 1E2YA 3LXTA 3BJ5A 2MMAA 4MH3A 2DMMA 1TK8B 4ISDA 3KXOA 1K0AA 4GF0A 2CV4A 1XOBA 1X5EA 2O87A 3Q6OA 3LXZA 2F9SA 3QAWA 1A2JA 2K8VA 4YQVA 1M9BA 4HOJA 1SKRB 3VI5A 3NOFA 4FYCA 1QMVA 3ZFLA 3UVTA 2C3NA 3DWVA 1U3AA 5J4UA 4FO5A 4GQFA 2X8HA 2GGTA 5IO2A 2I3YA 2WB9A 1K0DA 4OFNA 1SU9A 1E6BA 4IP6A 2QGVA 4N10A 1MTCA 2YJ7A 1USBA 3W8JA 1B8XA 3ZZXA 2ON5A 4V2MA 2C1YA 4TW5A 4JEDA 4OCEA 2YOIA 4HJ2A 4HUAA 5GSSA 2QSIA 4BWSA 2E2MA 2IPAA 2CAQA 3I9V2 5CP1A 1J08A 3LSZA 4MDCA 1SYRA 3GKNA 1QXHA 2IN3A 3ME8A 5L71A 2V6KA 3GUSA 2MZCA 1Z7RA 3HHVA 3G7YA 3WGDA 5EPFA 4L8EA 3HD5A 4ZB8A 1GTIA 1HD2A 1O8WA 3WD6A 1WE0A 5JWQB 1EWXA 4QL9A 3TKQA 2BJXA 4AJ7A 1O6JA 5IMDA 4OD7A 1EP7A 1WMJA 2K18A 1K0CA 4MMMA 2PERA 2FLSA 2B5XA 3TB2A 3ZREA 3CRUA 2VO4A 3M9KA 2KHPA 1J9BA 3F4RA 2TRCP 3ZMLA 2HZEB 7GSSA 5ECKB 4I97A 1N8JA 4EO3A 3M3MA 5IMZA 5JWRB 1VF2A 5CYYA 4F0CA 2FGXA 3DIEA 1B4QA 1M2BA 1LJRA 3KCMA 4ZBDA 1SJZA 1TXXA 3RPNA 4V2NA 3D0ZA 2NBSA 2LQOA 1TKDB 5KN1A 2IMKA 1UA5A 5IQYA 3O3TA 3BD2A 5IOWA 2G2QA 3C71A 2QKEA 6GSUA 2H0GA 1PX7A 1T4YA 1W4VA 3VPQA 5A4VA 3IR4A 5G30A 3FHKA 4LLRA 2OACA 5DJMA 3GNJA 4OCFA 1KNGA 2M46A 1VF4A 5JCWA 4MH2A 2ZNMA 1WP0A 1BQ7A 4HQZA 1K0BA 4K0NA 4KCAA 1EOHA 1RQMA 1RW1A 4IVFA 2VLUA 1T8EB 3SBCA 1XWKA 5J5NA 4GSNA 1BYEA 10GSA 4NXIA 2J9HA 2YWNA 3ZMKA 2FWFA 3F63A 4JR4A 3TRQA 4GXZA 2HE3A 4YAPA 1QFNA 2YWOA 2CAIA 1FG4A 4AJ8A 1T4ZA 3IXRA 5G5EA 8GSSA 1PSQA 3BCKA 5CRGA 4YH2A 1ZZYA 3P8WA 4MF7A 2VUPA 2LUSA 5KEJA 3FKFA 4NMUA 3VK9A 3TCOA 3U6VA 5LD0A 3GX8A 5KN3A 3KP9A 4LMWA 3WT1A 4KB3A 1GUKA 1PL1A 2EC4A 3FK8A 2AUVA 3KTLA 3QAVA 3GSTA 4ZB9A 3DXBA 4F2IA 4RQXA 2GT5A 1OKTA 1M2AA 1ZMAA 4GCIA 3LGCA 2N5BA 1TRVA 4TOPA 5EL8A 1ILOA 1T3BA 14GSA 1MDIA 1A24A 3TJJA 5DJLA 3KTBA 3P2AA 2OKAA 1Z3EA 1SL1B 1YEPA 2PMTA 4NWYA 4JZQA 3QDNA 4ZBAA 4Z7XA 1SK2A 4HU9A 1ERWA 1SL0B 2V2GA 4POKA 4ECCA 2V1MA 1FO5A 2R37A 1M7TA 2LJAA 5G31A 1HNBA 1MD4A 2M80A 1OC8A 4ML6A 3CTGA 2HSHA 2N5FA 1AW9A 20GSA 1HNAA 2GVPA 5D9XA 3IPZA 1A8LA 1A0FA 2O89A 1THXA 1OYJA 2OBIA 5KN2A 3MAKA 3CSHA 3EU4A 3TKRA 3H79A 1U88A 3LYKA 5ID2A 2L6CA 4EL1A 2IFQB 4YAVA 1G6YA 2VCZA 1V57A 1O81A 3EINA 2HRFA 1DBYA 4JBBA 5ELGA 2E2GA 3H4KA 4EUYA 4YQUA 4ML1A 2H6ZA 4NPBA 5ECLB 3C73A 13GSA 1K3YA 2L5LA 3F8UA 1TK5B 2PUKC 2E0QA 1VF3A 1YEXA 2E7PA 3UMAA 3ZIJA 2LS5A 1DE2A 1C72A 5F8BA 1EZKA 1DE1A 2H74A 3LJRA 4HS1A 3CTFA 2H73A 2A4VA 4ID0A 5G5FA 2JADA 4Q5QA 5AIVA 3IK7A 3M9JA 22GSA 1GSSA 4OFTA 3CBUA 5FHIA 16GSA 3QR6A 3GH9A 3QD9A 3JCML 3QOUA 4OO5A 2YZHA 4DSSA 2KOKA 3IBHA 5HQPA 2FA4A 1EEMA 2PBJA 3HKRA 6GSWA 1B4PA 1V2AA 3LG6A 3J7Yb 1PD21 1YZXA 1XPVA 2CX4A 5C00A 2LTKA 4G9HA 2C3QA 1GTUA 5DCHA 3KMOA 3KH7A 4BWQA 4QQ7A 1QK8A 3FR6A 3AY8A 3A2VA 3W8SA 3IV4A 4LL1B 2HFDA 4HZ2A 1ZL9A 1AIUA 1TOFA 4MJBA 2LJKA 5G1LA 3VWXA 2LEGA 4KA0A 18GSA 1ON4A 2YJHA 1FVJA 3DRNA 2B6MA 1Q98A 4NHWA 3DKSA 2JSYA 3MNGA 3HJPA 1AXDA 2WDUA 5FWGA 1JLWA 1CQHA 4JR6A 1K0MA 3L9VA 5HFGA 4DVCA 4MABA 3OR5A 5DALB 3D4TA 3HDCA 5IMVA 2PVOC 4TRXA 2L4CA 3RHCA 2XBQA 3IA1A 4WR4A 2G0FA 1FW1A 1H75A 3K8NA 1ZYEA 2H6XA 1K3OA 1TW9A 5EY6A 3E0UA 3A5WA 3SWLA 4KX4A 2VCTA 2MMZA 3ME7A 3ZYWA 2GQKA 3IDVA 2GQMA 1UC7A 4TR1B 4MJCA 5JWOB 1A8YA 4TXOB 2B1LA 3GTUA 3QFAC 2H01A 1WPIA 1Z6MA 1SENA 2YZUA 1I9DA 5JCUA 2VL9A 3HJOA 3C7MA 2H0IA 5J41A 3GRXA 4KW6A 4ZIJA 3DYRA 3PGTA 1R7HA 1S3AA 1K3LA 1R5PA 3GURA 1A0RP 5KN0A 1KBNA 2TRXA 2C0FA 2PVQA 1SJIA 3TRXA 1A2LA 1HNCA 3F3RA 1PQNA 5IMAA 3GL5A 2REMA 5DQSA 2L4QA 5F06A 4N0ZA 3FYGA 1XW6A 4IN0A 2ALBA 1MDKA 1SK1A 3GX0A 1V40A 1AAZA 3QPMA 3IE3A 1XWBA 3CSJA 2GSTA 2VD1A 3DVXA 3MSZA 4PURA 2N5AA 5GZZB 1EEJA 2H72A 1V9WA 3HZ4A 2NVLA 3E3EA 2YWIA 4WF4A 1JZRA 4KNDA 4FIWA 2KUCA 5J9CA 5CO3A 2DBCA 4GRFA 1J0FA 1TU7A 2DLXA 3UL3A 1PKZA 3TKSC 4HI7A 2B7KA 4MF5A 1XWGA 4F0BA 2DSAA 3PR8A 5F07A 4LA1A 4WF5A 2R6KA 2OA7A 1ZYQB 3TUEA 2LRNA 5IPHA 1V58A 1XW5A 1CQGA 4L5LA 4MPFA 4V1Ag 12GSA 4PNGA 2GTUA 3GHAA 4PNFA 3E9JB 1FVKA 2B7JA 4K7OA 4FYBA 3TGZA 3GH6A 1F3BA 2C8UA 1GSDA 1OVNA 3FY7A 4RI6A 2V41A 5ELAA 4MP4A 2OE0A 2GQLA 2FHEA 2HI7A 1Y6EA 5ECRB 1XCCA 1YDKA 3CSIA 3DMLA 2K8SA 1EOGA 1PMTA 2LRTA 5D9TA 3EMPA 3WGXA 4F9ZA 1F3AA 2GDRA 3GFKA 3KJYA 1H4OA 2V32A 3HZ8A 4L5OA 2VL2C 4JU5A 4LMVA 3R2QA 1JHBA 1T7PB 1NHOA 4POLA 4K1FA 3WGEA 5D9WA 3TKSE 2P5QA 2LJRA 4G19A 3TJFA 2YANA 1YJ6A 2M72A 2B5YA 1EP8A 3UAPA 3I69A 5CRHA 3UBLA 2XBIA 2EIQA 3UBKA 2VM1A 3GYKA 3ZRDA 1GSQA 2I4AA 2WJUA 2VLVA 3L9SA 1QUWA 2H6YA 1UN2A 4KCEA 1F37A 4WR5A 3C8EA 2JZRA 1TJDA 1BG5A 2X64A 4CHSA 4MK3A 4DEJA 2VLTA 3G7JA 2DIZA 4IW9A 2BTOT 3RBTA 2FUG2 1FAAA 1U6TA 3C1RA 3HA9A 1NSWA 2DJKA 4NAXA 3D6IA 2R3XA 3F4TA 2YNXA 3D21A 3APOA 1PX6A 4POMA 2HSYA 1YQ1A 1Z9HA 2FWEA 2CVKA 1SD8A 3IC4A 5IPGA 1M0UA 5F0GA 4ECJA 2X8CA 3GKKA 5IOXA 4X43A 3VI7A 1SK0A 5AISA 4KE3A 3UARA 6GSSA 1GWCA 4K2DA 2XC2A 4TN8A 2B3SA 3IAM2 4OO4A 1LBKA 2YV9A 1OE8A 3IK9A 2IJYA 5COHA 4L0UA 2WGRA 4ZBBA 3LORA 3N5OA 5IO0A 1R26A 3GL3A 6GSXA 4MCUA 4IGJA 1XBSA 4POBA 2GZPA 3D4MA 1S3DA 4BA7A 2OE3A 2O7KA 5B8BA 4KDYA 2IMEA 4MZCA 2AB6A 3L9UA 3LEFA 3M0FA 5DVBA 2JSZA 2WCIA 5HR1A 3F6FA 2YPMA 2FCHA 2B5EA 3KMNA 1TP9A 3UOMA 4XHMA 2C80A 2AAWA 2CX3A 2FWHA 2BMXA 4GQCA 4OFMA 3ZVJD 4WEYA 2RIIA 3G9BA 4BPYA 2WZ9A 4ULXA 3S9FA 3GSSA 2OJLA 4FYUA 2CVDA 2VCWA 5CNWA 2WULA 2DJ2A 2R2JA 4WBJA 2NPBA 3FR3A 3A3TA 4MPGA 3Q19A 3KD0A 1X5DA 2H76A 4XTSA 5GAPD 3LYPA 6GSVA 3KP8A 1ML6A 3HCZA 3ZTLA 2VCVA 4MZBA 4RI7A 1G6WA 1F2EA 1FHEA 4IBPA 3VFIA 2IMIA 3GMFA 2FY6A 4I6XA 5J9BA 5INYA 1F6MC 9GSSA 1FB6A 5CAXA 1V98A 1M99A 4G2EA 4PXOA 2WRTA 1DSBA 2GLRA 3EVIA 1W89A 4K8MA 3GKXA 1JLVA 4PUAA 3H93A 2O8VB 2C0EA 4ZL8A 3NIVA 5HR3A 3IRAA 2AV4A 1F9MA 1YY7A 1X9WB 2MBSA 3HJMA 1ZCPA 2XPDA 5ID2B 3GN3A 2JU5A 2FD3A 1GSFA 2GSRA 2OE1A 2L57A 1PL2A 1SKWB 3CRTA 1O7UA 4EF0A 3DVWA 5DBQA 3H1NA 4GLTA 4TR3A 4XRDA 2F8AA 4XS4A 5ECIB 2IL3A 4PGTA 1Z7PA 5H5QA 3TJGA 3FZ9A 3P7XA 3FW2A 3PINA 3RDWA 2F8FA 3KGKA 1YKAA 5DDLA 1XFLA 1WIKA 3DGQA 3UIWA 1SKSB 5B7CA 1G7OA 4PX1A 5B6NA 4X0XA 1OC9A 2L6DA 5ENUA 1M9AA 4KH7A 1TI3A 2HRNA 1URMA 2EIRA 3WT2A 2C0GA 4OWYA 2LKUA 1BEDA 2X8GA 5IM9A 3EE2A 2LSTA 3L78A 5B8AA 1EV4A 2IWTA 2C3TA 2CA8A 3D5JA 4ZILA 1AC1A 1ERTA 3FRCA 2MYGA 2DJ1A 2PPTA 5D96A 1TRSA 4DSSB 1BX9A 1LU4A 2A2RA 2LRCA 2OBKA 5J3RA 1SJ6A 3NZNA 1UVZA 4N11A 4ZB6A 2DJ3A 2CZ3A 4KSOA 5DAKB 1VRSD 1U87A 4IP1A 5EVOA 2F51A 4TXOA 4PQIA 4HU7A 5D9VA 1U3IA 3J7Yk 1XOAA 3FR9A 4D73B 1A23A 4L0WA 1TTZA 1MEKA 4ZL7A 2VOCA 2KP1A 4DSRA 2VL2A 3BOAA 3KZQA 5ABRA 4IKHA 4E8HA 3UVHA 4MF6A 2VCQA 3GKMA 4BVXA 17GSA 4PQ1A 1EV9A 1VGLA 1Z6NA 5FT3A 1MDJA 2KP2A 1NHYA 1XVQA 5G1KA 1BAYA 1IYHA 3US3A 19GSA 1K0NA 3G7IA 2TIRA 4GSTA 2V6OA 1XZOA 1ERUA 3GIXA 2FNOA 3PH9A 4ILFA 3BCIA 5E59A 11GSA 3ERFA 2NDOA 4RQRA 1TRWA 4HQSA 2VCXA 4EXJA 3F0IA 3TOTA 5HR0A 3N9JA 5G2ZA 2L59A 3GTUB 3I6AA 2P5RA 2HNLA 3M8NA 3QAGA 2CQ9A 2D2ZA 4KSMA 1THOA 1XW9A 2H70A 3F4SA 5D93A 1HYUA 3KIJA 1ERVA 1QQ2A 2DIYA 3ERWA 2RLIA 1BJXA 3DEXA 1TI1A 2JZSA 5IMCA 5IIZA 3UJ1A 5IMFA 3W6GA 1Z5YE 2IMFA 2RUEA 4TR0A 4Q5RA 5ECPB 2PGTA 3ZLPA 1GTAA 2OADA 2HZEA 2RUFA 1YF0A 4IJ3A 4QL7A 5H5SA 5CRDA 4K0GA 1KTEA 3ED3A 2R5GA 3ZL5A 4BL7A 4IQ1A 3RPPA 1PA3A 1PRXA 3U5RE 1A2MA 3HVVA 2B1KA 1B48A 4EDYA 3HXSA 2L5OA 1ZGNA 3UEMA 2H0HA 4HDEA 5GSTA 5AGYA 5D73A 1GNWA 4J2FA 2YV7A 4H86A 1N2AA 4F82A 2AYTA 4AGSA 2VL3A 2CZ2A 4JE1A 4KUNA 3GA4A 1OAZA 2YCDA 4XS6A 3FEUA 2Z9SA 3EC3A 5E4WA 2PN8A 3EWLA 5LCZA 1GSEA 4FH8A 4HZ4A 4I5QA 1S3CA 4E8EA 3H8QA 3VPTA 2EIOA 2WS2A 3HVSA 4I2UA 3LFLA 5A4UA 2CVBA 1YKCA 2LQQA 2R4VA 2DMLA 4XS1A 2MBTA 1GP1A 4N30A 1SD9A 4IELA 5HFKA 3IHQA 2GS3A 5ECQB 5CREA 4DSQA 5ECSA 1M2DA 3HYPA 1Q4JA 3BBYA 4JRRA 4GWRA 3TOUA 3VURA 3TJBA 4TR4A 4MLYA 2LNTA 3QCPA 2WFCA 1PGTA 3APSA 1GSYA 4IQAA 1GUMA 2RM5A 5ECMB 3HVXA 1RK4A 4BVYA 4NHZA 1XVWA 3ZITA 1TK0B 2FWGA 4WBRD 1PN9A 3F9UA 4EDZA 1EGOA 2ZUPA 3A2XA 2VD0A 2VAFA 2LV3A 1X9MB 2H75A 1FOVA 4AF2A 4O32A 1GLQA 2YN1A 1GSUA 5DQYA 1AUCA 4ZL9A 1GULA 4KAEA 3IOSA 3P90A 1MD3A 2AJQB 1IYIA 4WKWA 3O76A 4HEA2 3Q74A 4X1UA 3DD3A 3RHBA 2QC7A 4I2TA 4PQHA 1TDIA 4K9ZA 2XPEA 2DJ0A 2YWMA 2C0DA 5F05A 3Q18A 4Q5NA 4XIHA 2YP6A 2H1BA 2GT6A 3V1WA 1XWAA 2LNSA 4WETA 2HLSA 4G10A 1O73A 3QFBC 4YQMA 4ECIA 3KM6A 1NM3A 5AIXA 2KLXA 1GLPA 2DJJA 1ST9A 1R5AA 1WRYA 3F6DA 1ZOFA 4MJAA 2I81A 1X5CA 5ECNB 5ECOB 4ECBA 3KEBA 2VIMA 5GAND 3LWAA 2H19A 1JZOA 2IFQA 1K0OA 1XWCA 2HXKA 4K6XA 1SL2B 1VF1A 3RAZA 1TRUA 4K7IA 4GTUA 1XIYA 2P31A 2X99A 5CRWA 4EE0A 3APQA 4O5RA 4HJMA 4MJEA 2K6VA 2XHFA 1O8XA 3CXGA 2A2SA 2P0GA 5LNKe 1TU8A 2H30A 1GUHA 3VWVA 1I5GA 2NTOA 4J56E 4TVEA 3ZVJA 3EURA 4MZWA 2GSQA 1ABAA 3QMXA 5B6MA 4K7NA 2C4JA 4EVMA 1OE7A 1AQXA 3ERGA 5A4WA 4CW9A 1ACVA 3VLNA 5D8IA 4MA9A 3M1GA 4IJIA 2I9HA 3EU3A 4P3YB 4KGIA 1OKDA 2HZFA 3ISOA 2MMOA 2IIYA 3CMIA 3F3QA 6GSYA 4O92A 3O6TA 3LQ7A 3VWUA 4ACSA 4TKYA 3TKPA 4O7HA 3FZ5A 3VWWA
chains in the Genus database with same CATH superfamily
2H1AA 4KDXA 1T00A 1G7EA 4J57E 4IS0A 3CYNA 5A5KA 1WOUA 3TRPA 3WYWA 1GL8A 4RUVA 4PUFC 3L0HA 2GSSA 3I43A 4EKZA 3ZIVA 5JCGA 1GH2A 4NV5A 2HYXA 1GNEA 2ON7A 1X9SB 2ES7A 2PU9C 2PWJA 3ZFBA 2RM6A 1M3IA 1YF1A 4V2LA 1KEBA 5HFIA 2DC5A 2H8LA 3C1SA 4XCSA 2DKHA 1AQVA 3L4NA 3MDKA 3TDGA 1GTBA 2H66A 2JZTA 2ZCTA 1WWJA 5BRTA 4KDUA 2R0CA 2CT6A 4CDOA 4NV2A 3IAS2 3MWHA 4GSSA 1HQOA 3HY2A 4LL4B 1GRXA 5DAKA 3TKSA 4EC0A 5C04A 1JFUA 2J23A 2JACA 5DALA 2HRKA 4XS4B 1FB0A 5AN1A 2JL4A 2O85A 2VM2A 1OC3A 3KH9A 2X4AA 2X49A 4XRAA 3D22A 2GZZA 2FA8A 3EMXA 3EYTA 4AJ6A 1X0RA 5ECHB 3GV1A 1DUGA 1O85A 1Y25A 1JZWA 1G0TA 4OMVA 3FZ4A 4D73A 1B9YC 5DCGA 5HR2A 2H1GA 2HT9A 4Q5FA 1QGVA 2H71A 5H5RA 1R4WA 2MMNA 4TR1A 1OC9B 2IMDA 4IHUA 1T1VA 1WJKA 1SYXA 4N0VA 3A2WA 2GZYA 1B9XC 3MYDA 4K2XA 3TJKA 1PKWA 4ZXGA 1NW2A 4F03A 2I1UA 2H1DA 4TXVA 4G0KA 6GSTA 1XXUA 1AQWA 4BIKA 1JZDA 4WXTA 1EGRA 3FZAA 4V1Ap 2F3MA 2K9FA 4I8BA 2AHEA 1E2YA 3LXTA 3BJ5A 2MMAA 4MH3A 2DMMA 1TK8B 4ISDA 3KXOA 1K0AA 4GF0A 2CV4A 1XOBA 1X5EA 2O87A 3Q6OA 3LXZA 2F9SA 3QAWA 1A2JA 2K8VA 4YQVA 1M9BA 4HOJA 1SKRB 3VI5A 3NOFA 4FYCA 1QMVA 3ZFLA 3UVTA 2C3NA 3DWVA 1U3AA 5J4UA 1FOHA 4FO5A 4GQFA 2X8HA 2GGTA 5IO2A 4X4JA 2I3YA 2WB9A 1K0DA 4OFNA 1SU9A 1E6BA 4IP6A 2QGVA 4N10A 1MTCA 2HRAA 2YJ7A 4Z2RA 1USBA 3W8JA 1B8XA 3ZZXA 2ON5A 4V2MA 2C1YA 4TW5A 4JEDA 4OCEA 2YOIA 4HJ2A 4HUAA 5GSSA 2QSIA 4BWSA 2E2MA 2IPAA 2CAQA 3I9V2 5CP1A 1J08A 3LSZA 4MDCA 1SYRA 3GKNA 1QXHA 3EPTA 2IN3A 3ME8A 5L71A 2V6KA 3GUSA 2MZCA 1Z7RA 3HHVA 3G7YA 3WGDA 5EPFA 4L8EA 3HD5A 4ZB8A 1GTIA 1HD2A 1O8WA 3WD6A 1WE0A 5JWQB 1EWXA 4QL9A 3TKQA 2BJXA 4AJ7A 1O6JA 5IMDA 4OD7A 1EP7A 1WMJA 2K18A 4O5QA 3CQFA 1K0CA 4MMMA 2PERA 2FLSA 2B5XA 3TB2A 3ZREA 3CRUA 2VO4A 3M9KA 2KHPA 1J9BA 3F4RA 2TRCP 3FMWA 3ZMLA 2HZEB 7GSSA 5ECKB 4I97A 1N8JA 4EO3A 3M3MA 4CY6A 5IMZA 5JWRB 1VF2A 5CYYA 4F0CA 2FGXA 3DIEA 1B4QA 1M2BA 1LJRA 3KCMA 4ZBDA 1SJZA 2R0GA 1TXXA 3RPNA 4V2NA 3D0ZA 2NBSA 2LQOA 1TKDB 5KN1A 2IMKA 1UA5A 5IQYA 3O3TA 3BD2A 5IOWA 2G2QA 3C71A 2QKEA 6GSUA 2H0GA 4Z2UA 1PX7A 1T4YA 1W4VA 3VPQA 5A4VA 3IR4A 5G30A 3FHKA 4LLRA 2OACA 5DJMA 3GNJA 4OCFA 1KNGA 2M46A 1VF4A 5JCWA 4MH2A 2ZNMA 1WP0A 1BQ7A 4HQZA 1K0BA 4K0NA 4KCAA 1EOHA 1RQMA 1RW1A 4IVFA 2VLUA 1T8EB 3SBCA 1XWKA 5J5NA 4GSNA 1BYEA 10GSA 4NXIA 4O5UA 2J9HA 2YWNA 3ZMKA 2FWFA 3F63A 4JR4A 3TRQA 4GXZA 2HE3A 4YAPA 1QFNA 2YWOA 2CAIA 1FG4A 4AJ8A 1T4ZA 3IXRA 5G5EA 8GSSA 1PSQA 3BCKA 5CRGA 4YH2A 1ZZYA 3P8WA 4MF7A 2VUPA 1M3JA 2LUSA 5KEJA 3FKFA 4NMUA 3VK9A 3TCOA 3U6VA 5LD0A 3GX8A 5KN3A 3KP9A 4LMWA 3WT1A 4KB3A 3R3EA 1GUKA 1PL1A 2EC4A 3FK8A 2AUVA 3KTLA 3QAVA 3GSTA 4ZB9A 3DXBA 4F2IA 4RQXA 2GT5A 1OKTA 1M2AA 1ZMAA 4GCIA 3LGCA 2N5BA 1TRVA 4TOPA 5EL8A 1ILOA 1T3BA 14GSA 1MDIA 1A24A 3TJJA 5DJLA 3KTBA 3P2AA 2OKAA 1Z3EA 1SL1B 1YEPA 2PMTA 4NWYA 4JZQA 3QDNA 4ZBAA 4Z7XA 1SK2A 4HU9A 1ERWA 1SL0B 2V2GA 4POKA 4ECCA 2V1MA 1FO5A 2R37A 1M7TA 2LJAA 5G31A 1HNBA 1MD4A 2M80A 1OC8A 4ML6A 3CTGA 2HSHA 2N5FA 1AW9A 20GSA 1HNAA 2GVPA 5D9XA 3IPZA 1A8LA 1A0FA 2O89A 1THXA 1OYJA 2OBIA 5KN2A 3MAKA 3CSHA 3EU4A 3TKRA 3H79A 1U88A 3LYKA 5ID2A 2L6CA 4EL1A 2IFQB 4YAVA 1G6YA 2VCZA 1V57A 1O81A 3EINA 2HRFA 1DBYA 4JBBA 5ELGA 2E2GA 3H4KA 4EUYA 4YQUA 2R0PA 4ML1A 2H6ZA 4NPBA 5ECLB 3C73A 13GSA 1K3YA 2L5LA 3F8UA 1TK5B 3MIXA 2PUKC 2E0QA 1VF3A 1YEXA 2E7PA 3UMAA 3ZIJA 2LS5A 1DE2A 1C72A 5F8BA 1EZKA 1DE1A 2H74A 3LJRA 4HS1A 3CTFA 2H73A 2A4VA 4ID0A 5G5FA 2JADA 4Q5QA 5AIVA 3IK7A 3M9JA 22GSA 1GSSA 4OFTA 3CBUA 5FHIA 16GSA 2QA2A 3QR6A 3GH9A 3QD9A 3JCML 3QOUA 4OO5A 2YZHA 4DSSA 2KOKA 3IBHA 5HQPA 2FA4A 1EEMA 2PBJA 2A4HA 3HKRA 6GSWA 1B4PA 1V2AA 3LG6A 3J7Yb 1PD21 1YZXA 1XPVA 2CX4A 5C00A 2LTKA 4G9HA 2C3QA 1GTUA 5DCHA 3KMOA 3KH7A 4BWQA 4QQ7A 1QK8A 3FR6A 3AY8A 3A2VA 3W8SA 3IV4A 4LL1B 2HFDA 4HZ2A 1ZL9A 1AIUA 1TOFA 4MJBA 2LJKA 5G1LA 3VWXA 2LEGA 4KA0A 18GSA 1ON4A 2YJHA 1FVJA 3DRNA 2B6MA 1Q98A 4NHWA 3DKSA 2JSYA 3MNGA 3HJPA 1AXDA 2WDUA 5FWGA 1JLWA 1CQHA 4JR6A 1K0MA 3L9VA 5HFGA 4DVCA 4MABA 3OR5A 5DALB 3D4TA 3HDCA 5IMVA 2PVOC 4TRXA 2L4CA 5KOWA 3RHCA 2XBQA 3IA1A 4WR4A 2G0FA 1FW1A 1H75A 3K8NA 1ZYEA 2H6XA 1K3OA 1TW9A 5EY6A 3E0UA 3A5WA 3SWLA 4KX4A 2VCTA 2MMZA 3ME7A 3ZYWA 2GQKA 3IDVA 2GQMA 1UC7A 4TR1B 4MJCA 5JWOB 1A8YA 4TXOB 2B1LA 3GTUA 3QFAC 2H01A 1WPIA 1Z6MA 1SENA 2YZUA 1I9DA 5JCUA 4ICYA 2VL9A 3HJOA 3C7MA 2H0IA 5J41A 3GRXA 4KW6A 4EIQA 4ZIJA 3DYRA 3PGTA 1R7HA 1S3AA 1K3LA 1R5PA 3GURA 1A0RP 5KN0A 1KBNA 2TRXA 2C0FA 2PVQA 1SJIA 3TRXA 1A2LA 1HNCA 3F3RA 1PQNA 5IMAA 3GL5A 4BVXB 4EIPA 2REMA 5DQSA 2L4QA 5F06A 4N0ZA 3FYGA 1XW6A 4IN0A 4YKGA 2ALBA 1MDKA 1SK1A 3GX0A 1V40A 1AAZA 3QPMA 3IE3A 1XWBA 3CSJA 2GSTA 2VD1A 3DVXA 3MSZA 4PURA 2N5AA 5GZZB 1EEJA 2H72A 4K5SA 1V9WA 3HZ4A 2NVLA 3E3EA 2DKIA 2YWIA 4WF4A 1JZRA 4KNDA 4FIWA 2KUCA 5J9CA 5CO3A 2DBCA 4GRFA 1J0FA 1TU7A 2DLXA 3UL3A 1PKZA 3TKSC 4HI7A 2B7KA 4MF5A 1XWGA 4F0BA 2DSAA 3PR8A 2A2PA 5F07A 4LA1A 4WF5A 2R6KA 2OA7A 1ZYQB 4PTSA 2LRNA 3TUEA 5IPHA 1V58A 1XW5A 1CQGA 4L5LA 4MPFA 5KOXA 4V1Ag 12GSA 4K5RA 4PNGA 2GTUA 3GHAA 4PNFA 3E9JB 1FVKA 2B7JA 4K7OA 4FYBA 3TGZA 3GH6A 1F3BA 2C8UA 1GSDA 1OVNA 3FY7A 4RI6A 2V41A 5ELAA 4MP4A 2OE0A 2GQLA 2FHEA 4Z2TA 2HI7A 1Y6EA 5ECRB 1XCCA 1YDKA 3CSIA 3DMLA 2K8SA 1EOGA 1PMTA 2LRTA 5D9TA 3EMPA 3WGXA 4F9ZA 1F3AA 2GDRA 4BL7B 3GFKA 3KJYA 1H4OA 2V32A 3HZ8A 4L5OA 2VL2C 4JU5A 3LW9A 4LMVA 3R2QA 1JHBA 1T7PB 1NHOA 4POLA 4K1FA 2HSMA 3WGEA 3PPUA 5D9WA 3TKSE 2P5QA 2LJRA 4G19A 3TJFA 2YANA 1YJ6A 2M72A 2B5YA 1EP8A 3UAPA 3I69A 5CRHA 3UBLA 2XBIA 2EIQA 3UBKA 2VM1A 3GYKA 3ZRDA 1GSQA 2I4AA 2WJUA 2VLVA 3L9SA 1QUWA 2H6YA 1UN2A 4KCEA 1F37A 4WR5A 3C8EA 2JZRA 1TJDA 1BG5A 4USSA 2X64A 4CHSA 4MK3A 4DEJA 2VLTA 3G7JA 2DIZA 4IW9A 2BTOT 3RBTA 2FUG2 1FAAA 1U6TA 3C1RA 4A5PA 3HA9A 1NSWA 2DJKA 4NAXA 3D6IA 2R3XA 3F4TA 2YNXA 3D21A 3APOA 1PX6A 4POMA 2HSYA 1YQ1A 1Z9HA 2FWEA 2CVKA 1SD8A 3IC4A 4BVYB 5IPGA 1M0UA 5F0GA 4ECJA 2X8CA 3GKKA 5IOXA 4X43A 3VI7A 1SK0A 5AISA 4KE3A 3UARA 6GSSA 1GWCA 4K2DA 2XC2A 4TN8A 2B3SA 3IAM2 4OO4A 1LBKA 2YV9A 1OE8A 3IK9A 4HSCX 2IJYA 5COHA 4L0UA 2WGRA 4ZBBA 3LORA 3N5OA 5IO0A 1R26A 3GL3A 6GSXA 4MCUA 4IGJA 1XBSA 4POBA 2GZPA 3D4MA 1S3DA 4BA7A 2OE3A 2O7KA 5B8BA 4KDYA 2IMEA 4MZCA 2AB6A 3L9UA 3LEFA 3M0FA 5DVBA 2JSZA 2WCIA 4FQUA 5HR1A 3F6FA 2YPMA 2FCHA 2B5EA 3KMNA 1TP9A 3UOMA 4XHMA 2C80A 2AAWA 2CX3A 3A5IA 2FWHA 2BMXA 4GQCA 4OFMA 3ZVJD 4WEYA 2RIIA 3G9BA 4BPYA 2WZ9A 4ULXA 3S9FA 3GSSA 2OJLA 4FYUA 2CVDA 2VCWA 5CNWA 2WULA 2DJ2A 2R2JA 4WBJA 2NPBA 3FR3A 3A3TA 4MPGA 3Q19A 3KD0A 1X5DA 2H76A 4XTSA 5GAPD 3LYPA 6GSVA 3KP8A 1ML6A 3HCZA 3ZTLA 2VCVA 4MZBA 4RI7A 1G6WA 1F2EA 1FHEA 4IBPA 3VFIA 2IMIA 3GMFA 2FY6A 4I6XA 5J9BA 5INYA 1F6MC 9GSSA 1FB6A 5CAXA 1V98A 1M99A 4G2EA 4PXOA 2WRTA 1DSBA 2GLRA 3EVIA 1W89A 4K8MA 3GKXA 1JLVA 4PUAA 3H93A 2O8VB 2C0EA 4ZL8A 3NIVA 5HR3A 3IRAA 2AV4A 1F9MA 1YY7A 1X9WB 2MBSA 3HJMA 1ZCPA 2XPDA 5ID2B 3GN3A 2JU5A 2FD3A 1ZYNA 1GSFA 2GSRA 2OE1A 2L57A 1PL2A 1SKWB 3CRTA 1O7UA 4EF0A 3DVWA 5DBQA 3H1NA 4GLTA 4TR3A 4XRDA 2F8AA 4XS4A 5ECIB 2IL3A 4PGTA 1Z7PA 5H5QA 3TJGA 3FZ9A 3P7XA 3FW2A 3PINA 3RDWA 2F8FA 3KGKA 1YKAA 5DDLA 1XFLA 1WIKA 3DGQA 3UIWA 1SKSB 5B7CA 1G7OA 4PX1A 5B6NA 4X0XA 1OC9A 2L6DA 5ENUA 1M9AA 4KH7A 1TI3A 2HRNA 1URMA 1PFOA 2EIRA 3WT2A 2C0GA 4OWYA 2LKUA 1BEDA 2X8GA 5IM9A 3EE2A 2LSTA 3L78A 5B8AA 1EV4A 2IWTA 2C3TA 2CA8A 3D5JA 4ZILA 1AC1A 1ERTA 3FRCA 2MYGA 2DJ1A 2PPTA 5D96A 1TRSA 4DSSB 1BX9A 1LU4A 2A2RA 2LRCA 2OBKA 5J3RA 1SJ6A 3NZNA 1UVZA 4N11A 4ZB6A 2DJ3A 2CZ3A 4KSOA 5DAKB 1VRSD 1U87A 4IP1A 5EVOA 2F51A 4TXOA 4PQIA 4HU7A 5D9VA 1U3IA 3J7Yk 1XOAA 3FR9A 4D73B 1A23A 4L0WA 1TTZA 1MEKA 5BMUA 4ZL7A 2VOCA 2KP1A 4DSRA 1S3RA 4G0LA 2VL2A 3BOAA 3KZQA 5ABRA 4IKHA 4E8HA 3UVHA 4MF6A 1ZYPA 2VCQA 3GKMA 4BVXA 17GSA 4PQ1A 1EV9A 1VGLA 1Z6NA 4MNNA 5FT3A 1MDJA 2KP2A 1NHYA 1XVQA 5G1KA 1BAYA 1IYHA 3US3A 19GSA 1K0NA 3G7IA 2TIRA 4GSTA 2V6OA 1XZOA 1ERUA 3GIXA 2FNOA 3PH9A 4ILFA 3BCIA 3IC8A 5E59A 11GSA 3ERFA 2NDOA 4RQRA 1TRWA 4HQSA 2VCXA 4EXJA 3F0IA 3TOTA 5HR0A 3N9JA 5G2ZA 2L59A 3GTUB 3I6AA 2P5RA 2HNLA 3M8NA 3QAGA 2CQ9A 2D2ZA 4KSMA 1THOA 1XW9A 2H70A 3F4SA 5D93A 1HYUA 1XG8A 3KIJA 1ERVA 1QQ2A 2DIYA 3ERWA 2RLIA 1BJXA 3DEXA 1TI1A 2JZSA 5IMCA 5IIZA 3UJ1A 5IMFA 3W6GA 1Z5YE 2IMFA 2RUEA 4TR0A 4Q5RA 5ECPB 2PGTA 3ZLPA 1GTAA 2OADA 2HZEA 2RUFA 1YF0A 4IJ3A 4QL7A 5H5SA 5CRDA 4K0GA 1KTEA 3ED3A 2R5GA 3ZL5A 4BL7A 4IQ1A 3RPPA 1PA3A 1PRXA 3U5RE 1A2MA 3HVVA 2B1KA 1B48A 4EDYA 3HXSA 2L5OA 1ZGNA 3UEMA 2H0HA 4G0IA 4HDEA 5GSTA 5AGYA 5D73A 1GNWA 4J2FA 2YV7A 4H86A 1N2AA 4F82A 2AYTA 4AGSA 2VL3A 2CZ2A 4JE1A 4KUNA 3GA4A 1OAZA 2YCDA 4XS6A 3FEUA 4CY8A 2Z9SA 3EC3A 5E4WA 2PN8A 2QA1A 3EWLA 5LCZA 1GSEA 4FH8A 4HZ4A 4I5QA 1S3CA 4E8EA 3H8QA 3VPTA 2EIOA 2WS2A 3HVSA 4I2UA 3LFLA 5A4UA 2CVBA 1YKCA 2LQQA 2R4VA 2DMLA 4XS1A 2MBTA 1GP1A 4N30A 1SD9A 4IELA 5HFKA 3IHQA 2GS3A 5ECQB 5CREA 4DSQA 5ECSA 1M2DA 3HYPA 3IHGA 1Q4JA 3BBYA 4JRRA 4GWRA 3TOUA 3VURA 3TJBA 4TR4A 4MLYA 2LNTA 3QCPA 2WFCA 1PGTA 3APSA 1GSYA 4IQAA 1GUMA 2RM5A 5ECMB 3HVXA 1RK4A 4BVYA 4NHZA 1XVWA 3ZITA 1TK0B 2FWGA 4WBRD 1PN9A 3F9UA 4EDZA 1EGOA 2ZUPA 3A2XA 2VD0A 2VAFA 2LV3A 1X9MB 2H75A 1FOVA 4AF2A 4O32A 1GLQA 2YN1A 1GSUA 5DQYA 1AUCA 4ZL9A 1GULA 1PN0A 4KAEA 3IOSA 3P90A 1MD3A 2AJQB 1IYIA 4WKWA 3O76A 4HEA2 3Q74A 4X1UA 3DD3A 3RHBA 2QC7A 4I2TA 4PQHA 1TDIA 4K9ZA 2XPEA 2DJ0A 2YWMA 2C0DA 3Q18A 4Q5NA 5F05A 4XIHA 2YP6A 2H1BA 2GT6A 3V1WA 1XWAA 2LNSA 4YKFA 4WETA 2HLSA 4KF9A 4G10A 1O73A 3QFBC 4YQMA 4ECIA 3KM6A 1NM3A 5AIXA 2KLXA 1GLPA 2DJJA 3HVNA 1ST9A 1R5AA 1WRYA 3F6DA 1ZOFA 4MJAA 2I81A 1X5CA 5ECNB 5ECOB 4ECBA 3KEBA 2VIMA 5GAND 3LWAA 2H19A 1JZOA 2IFQA 1K0OA 1XWCA 2HXKA 4K6XA 1SL2B 1VF1A 3RAZA 1TRUA 4K7IA 4GTUA 1XIYA 2P31A 2X99A 5CRWA 4EE0A 3APQA 4O5RA 4HJMA 4MJEA 2K6VA 2XHFA 1O8XA 3CXGA 2A2SA 2P0GA 5LNKe 1TU8A 2H30A 1GUHA 3VWVA 1I5GA 2NTOA 4J56E 4TVEA 3ZVJA 3EURA 4MZWA 2GSQA 1ABAA 3QMXA 5B6MA 4K7NA 2C4JA 4EVMA 1OE7A 1AQXA 3ERGA 5A4WA 4CW9A 1ACVA 3VLNA 5D8IA 4MA9A 3M1GA 4IJIA 2I9HA 3EU3A 4P3YB 4KGIA 1OKDA 2HZFA 3ISOA 2MMOA 2IIYA 3CMIA 3F3QA 6GSYA 4O92A 3O6TA 3LQ7A 3VWUA 4ACSA 4TKYA 2UZ8A 3TKPA 4O7HA 3FZ5A 3VWWA
chains in the Genus database with same CATH topology
2H1AA 4KDXA 1T00A 1G7EA 4J57E 4IS0A 3CYNA 5A5KA 1WOUA 3TRPA 3WYWA 1GL8A 4RUVA 4PUFC 3L0HA 2GSSA 3I43A 4EKZA 3ZIVA 5JCGA 1GH2A 4NV5A 2HYXA 1GNEA 2ON7A 1X9SB 2ES7A 2PU9C 2PWJA 3ZFBA 2RM6A 1YF1A 4V2LA 1KEBA 5HFIA 2DC5A 2H8LA 3C1SA 4XCSA 2DKHA 1AQVA 3L4NA 3MDKA 3TDGA 1GTBA 2H66A 2JZTA 2ZCTA 1WWJA 5BRTA 4KDUA 2R0CA 2CT6A 4CDOA 4NV2A 3IAS2 3MWHA 4GSSA 1HQOA 3HY2A 4LL4B 1GRXA 5DAKA 3TKSA 4EC0A 5C04A 1JFUA 2J23A 2JACA 5DALA 2HRKA 4XS4B 1FB0A 5AN1A 2JL4A 2O85A 2VM2A 1OC3A 3KH9A 2X4AA 2X49A 4XRAA 3D22A 2GZZA 2FA8A 3EMXA 3EYTA 4AJ6A 1X0RA 5ECHB 3GV1A 1DUGA 1O85A 1Y25A 1JZWA 1G0TA 4OMVA 3FZ4A 4D73A 1B9YC 5DCGA 5HR2A 2H1GA 2HT9A 4Q5FA 1QGVA 2H71A 5H5RA 1R4WA 2MMNA 4TR1A 1OC9B 2IMDA 4IHUA 1T1VA 1WJKA 1SYXA 4N0VA 3A2WA 2GZYA 1B9XC 3MYDA 4K2XA 3TJKA 1PKWA 4ZXGA 1NW2A 4F03A 2I1UA 2H1DA 4TXVA 4G0KA 6GSTA 1XXUA 1AQWA 1JZDA 4WXTA 1EGRA 3FZAA 4V1Ap 2F3MA 2K9FA 4I8BA 2AHEA 1E2YA 3LXTA 3BJ5A 2MMAA 4MH3A 2DMMA 1TK8B 4ISDA 3KXOA 1K0AA 4GF0A 2CV4A 1XOBA 1X5EA 2O87A 3Q6OA 3LXZA 2F9SA 3QAWA 1A2JA 2K8VA 4YQVA 1M9BA 4HOJA 1SKRB 3VI5A 3NOFA 4FYCA 1QMVA 3ZFLA 3UVTA 2C3NA 3DWVA 1U3AA 5J4UA 1FOHA 4FO5A 4GQFA 2X8HA 2GGTA 5IO2A 4X4JA 2I3YA 2WB9A 1K0DA 4OFNA 1SU9A 1E6BA 4IP6A 2QGVA 4N10A 1MTCA 2HRAA 2YJ7A 4Z2RA 1USBA 3W8JA 1B8XA 3ZZXA 2ON5A 4V2MA 2C1YA 4TW5A 4JEDA 4OCEA 2YOIA 4HJ2A 4HUAA 5GSSA 2QSIA 4BWSA 2E2MA 2IPAA 2CAQA 3I9V2 5CP1A 1J08A 3LSZA 4MDCA 1SYRA 3GKNA 1QXHA 3EPTA 2IN3A 3ME8A 5L71A 2V6KA 3GUSA 2MZCA 1Z7RA 3HHVA 3G7YA 3WGDA 5EPFA 4L8EA 3HD5A 4ZB8A 1GTIA 1HD2A 1O8WA 3WD6A 1WE0A 5JWQB 1EWXA 4QL9A 3TKQA 2BJXA 4AJ7A 1O6JA 5IMDA 4OD7A 1EP7A 1WMJA 2K18A 4O5QA 1K0CA 4MMMA 2PERA 2FLSA 2B5XA 3TB2A 3ZREA 3CRUA 2VO4A 3M9KA 2KHPA 1J9BA 3F4RA 2TRCP 3FMWA 3ZMLA 2HZEB 7GSSA 5ECKB 4I97A 1N8JA 4EO3A 3M3MA 4CY6A 5IMZA 5JWRB 1VF2A 5CYYA 4F0CA 2FGXA 3DIEA 1B4QA 1M2BA 1LJRA 3KCMA 4ZBDA 1SJZA 2R0GA 1TXXA 3RPNA 4V2NA 3D0ZA 2NBSA 2LQOA 1TKDB 5KN1A 2IMKA 1UA5A 5IQYA 3O3TA 3BD2A 5IOWA 2G2QA 3C71A 2QKEA 6GSUA 2H0GA 4Z2UA 1PX7A 1T4YA 1W4VA 3VPQA 5A4VA 3IR4A 5G30A 3FHKA 4LLRA 2OACA 5DJMA 3GNJA 4OCFA 1KNGA 2M46A 1VF4A 5JCWA 4MH2A 2ZNMA 1WP0A 1BQ7A 4HQZA 1K0BA 4K0NA 4KCAA 1EOHA 1RQMA 1RW1A 4IVFA 2VLUA 1T8EB 3SBCA 1XWKA 5J5NA 4GSNA 1BYEA 10GSA 4NXIA 4O5UA 2J9HA 2YWNA 3ZMKA 2FWFA 3F63A 4JR4A 3TRQA 4GXZA 2HE3A 4YAPA 1QFNA 2YWOA 2CAIA 1FG4A 4AJ8A 1T4ZA 3IXRA 5G5EA 8GSSA 1PSQA 3BCKA 5CRGA 4YH2A 1ZZYA 3P8WA 4MF7A 2VUPA 2LUSA 5KEJA 3FKFA 4NMUA 3VK9A 3TCOA 3U6VA 5LD0A 3GX8A 5KN3A 3KP9A 4LMWA 3WT1A 4KB3A 3R3EA 1GUKA 1PL1A 2EC4A 3FK8A 2AUVA 3KTLA 3QAVA 3GSTA 4ZB9A 3DXBA 4F2IA 4RQXA 2GT5A 1OKTA 1M2AA 1ZMAA 4GCIA 3LGCA 2N5BA 1TRVA 4TOPA 5EL8A 1ILOA 1T3BA 14GSA 1MDIA 1A24A 3TJJA 5DJLA 3KTBA 3P2AA 2OKAA 1Z3EA 1SL1B 1YEPA 2PMTA 4NWYA 4JZQA 3QDNA 4ZBAA 4Z7XA 1SK2A 4HU9A 1ERWA 1SL0B 2V2GA 4POKA 4ECCA 2V1MA 1FO5A 2R37A 1M7TA 2LJAA 5G31A 1HNBA 1MD4A 2M80A 1OC8A 4ML6A 3CTGA 2HSHA 2N5FA 1AW9A 20GSA 1HNAA 2GVPA 5D9XA 3IPZA 1A8LA 1A0FA 2O89A 1THXA 1OYJA 2OBIA 5KN2A 3MAKA 3CSHA 3EU4A 3TKRA 3H79A 1U88A 3LYKA 5ID2A 2L6CA 4EL1A 2IFQB 4YAVA 1G6YA 2VCZA 1V57A 1O81A 3EINA 2HRFA 1DBYA 4JBBA 5ELGA 2E2GA 3H4KA 4EUYA 4YQUA 2R0PA 4ML1A 2H6ZA 4NPBA 5ECLB 3C73A 13GSA 1K3YA 2L5LA 3F8UA 1TK5B 3MIXA 2PUKC 2E0QA 1VF3A 1YEXA 2E7PA 3UMAA 3ZIJA 2LS5A 1DE2A 1C72A 5F8BA 1EZKA 1DE1A 2H74A 3LJRA 4HS1A 3CTFA 2H73A 2A4VA 4ID0A 5G5FA 2JADA 4Q5QA 5AIVA 3IK7A 3M9JA 22GSA 1GSSA 4OFTA 3CBUA 5FHIA 16GSA 2QA2A 3QR6A 3GH9A 3QD9A 3JCML 3QOUA 4OO5A 2YZHA 4DSSA 2KOKA 3IBHA 5HQPA 2FA4A 1EEMA 2PBJA 2A4HA 3HKRA 6GSWA 1B4PA 1V2AA 3LG6A 3J7Yb 1PD21 1YZXA 1XPVA 2CX4A 5C00A 2LTKA 4G9HA 2C3QA 1GTUA 5DCHA 3KMOA 3KH7A 4BWQA 4QQ7A 1QK8A 3FR6A 3AY8A 3A2VA 3W8SA 3IV4A 4LL1B 2HFDA 4HZ2A 1ZL9A 1AIUA 1TOFA 4MJBA 2LJKA 5G1LA 3VWXA 2LEGA 4KA0A 18GSA 1ON4A 2YJHA 1FVJA 3DRNA 2B6MA 1Q98A 4NHWA 3DKSA 2JSYA 3MNGA 3HJPA 1AXDA 2WDUA 5FWGA 1JLWA 1CQHA 4JR6A 1K0MA 3L9VA 5HFGA 4DVCA 4MABA 3OR5A 5DALB 3D4TA 3HDCA 5IMVA 2PVOC 4TRXA 2L4CA 5KOWA 3RHCA 2XBQA 3IA1A 4WR4A 2G0FA 1FW1A 1H75A 3K8NA 1ZYEA 2H6XA 1K3OA 1TW9A 5EY6A 3E0UA 3A5WA 3SWLA 4KX4A 2VCTA 2MMZA 3ME7A 3ZYWA 2GQKA 3IDVA 2GQMA 1UC7A 4TR1B 4MJCA 5JWOB 1A8YA 4TXOB 2B1LA 3GTUA 3QFAC 2H01A 1WPIA 1Z6MA 1SENA 2YZUA 1I9DA 5JCUA 4ICYA 2VL9A 3HJOA 3C7MA 2H0IA 5J41A 3GRXA 4KW6A 4EIQA 4ZIJA 3DYRA 3PGTA 1R7HA 1S3AA 1K3LA 1R5PA 3GURA 1A0RP 5KN0A 1KBNA 2TRXA 2C0FA 2PVQA 1SJIA 3TRXA 1A2LA 1HNCA 3F3RA 1PQNA 5IMAA 3GL5A 4BVXB 4EIPA 2REMA 5DQSA 2L4QA 5F06A 4N0ZA 3FYGA 1XW6A 4IN0A 4YKGA 2ALBA 1MDKA 1SK1A 3GX0A 1V40A 1AAZA 3QPMA 3IE3A 1XWBA 3CSJA 2GSTA 2VD1A 3DVXA 3MSZA 4PURA 2N5AA 5GZZB 1EEJA 2H72A 4K5SA 1V9WA 3HZ4A 2NVLA 3E3EA 2DKIA 2YWIA 4WF4A 1JZRA 4KNDA 4FIWA 2KUCA 5J9CA 5CO3A 2DBCA 4GRFA 1J0FA 1TU7A 2DLXA 3UL3A 1PKZA 3TKSC 4HI7A 2B7KA 4MF5A 1XWGA 4F0BA 2DSAA 3PR8A 2A2PA 5F07A 4LA1A 4WF5A 2R6KA 2OA7A 1ZYQB 4PTSA 2LRNA 3TUEA 5IPHA 1V58A 1XW5A 1CQGA 4L5LA 4MPFA 5KOXA 4V1Ag 12GSA 4K5RA 4PNGA 2GTUA 3GHAA 4PNFA 3E9JB 1FVKA 2B7JA 4K7OA 4FYBA 3TGZA 3GH6A 1F3BA 2C8UA 1GSDA 1OVNA 3FY7A 4RI6A 2V41A 5ELAA 4MP4A 2OE0A 2GQLA 2FHEA 4Z2TA 2HI7A 1Y6EA 5ECRB 1XCCA 1YDKA 3CSIA 3DMLA 2K8SA 1EOGA 1PMTA 2LRTA 5D9TA 3EMPA 3WGXA 4F9ZA 1F3AA 2GDRA 4BL7B 3GFKA 3KJYA 1H4OA 2V32A 3HZ8A 4L5OA 2VL2C 4JU5A 3LW9A 4LMVA 3R2QA 1JHBA 1T7PB 1NHOA 4POLA 4K1FA 2HSMA 3WGEA 3PPUA 5D9WA 3TKSE 2P5QA 2LJRA 4G19A 3TJFA 2YANA 1YJ6A 2M72A 2B5YA 1EP8A 3UAPA 3I69A 5CRHA 3UBLA 2XBIA 2EIQA 3UBKA 2VM1A 3GYKA 3ZRDA 1GSQA 2I4AA 2WJUA 2VLVA 3L9SA 1QUWA 2H6YA 1UN2A 4KCEA 1F37A 4WR5A 3C8EA 2JZRA 1TJDA 1BG5A 4USSA 2X64A 4CHSA 4MK3A 4DEJA 2VLTA 3G7JA 2DIZA 4IW9A 2BTOT 3RBTA 2FUG2 1FAAA 1U6TA 3C1RA 4A5PA 3HA9A 1NSWA 2DJKA 4NAXA 3D6IA 2R3XA 3F4TA 2YNXA 3D21A 3APOA 1PX6A 4POMA 2HSYA 1YQ1A 1Z9HA 2FWEA 2CVKA 1SD8A 3IC4A 4BVYB 5IPGA 1M0UA 5F0GA 4ECJA 2X8CA 3GKKA 5IOXA 4X43A 3VI7A 1SK0A 5AISA 4KE3A 3UARA 6GSSA 1GWCA 4K2DA 2XC2A 4TN8A 2B3SA 3IAM2 4OO4A 1LBKA 2YV9A 1OE8A 3IK9A 2IJYA 5COHA 4L0UA 2WGRA 4ZBBA 3LORA 3N5OA 5IO0A 1R26A 3GL3A 6GSXA 4MCUA 4IGJA 1XBSA 4POBA 2GZPA 3D4MA 1S3DA 4BA7A 2OE3A 2O7KA 5B8BA 4KDYA 2IMEA 4MZCA 2AB6A 3L9UA 3LEFA 3M0FA 5DVBA 2JSZA 2WCIA 4FQUA 5HR1A 3F6FA 2YPMA 2FCHA 2B5EA 3KMNA 1TP9A 3UOMA 4XHMA 2C80A 2AAWA 2CX3A 3A5IA 2FWHA 2BMXA 4GQCA 4OFMA 3ZVJD 4WEYA 2RIIA 3G9BA 4BPYA 2WZ9A 4ULXA 3S9FA 3GSSA 2OJLA 4FYUA 2CVDA 2VCWA 5CNWA 2WULA 2DJ2A 2R2JA 4WBJA 2NPBA 3FR3A 3A3TA 4MPGA 3Q19A 3KD0A 1X5DA 2H76A 4XTSA 5GAPD 3LYPA 6GSVA 3KP8A 1ML6A 3HCZA 3ZTLA 2VCVA 4MZBA 4RI7A 1G6WA 1F2EA 1FHEA 4IBPA 3VFIA 2IMIA 3GMFA 2FY6A 4I6XA 5J9BA 5INYA 1F6MC 9GSSA 1FB6A 5CAXA 1V98A 1M99A 4G2EA 4PXOA 2WRTA 1DSBA 2GLRA 3EVIA 1W89A 4K8MA 3GKXA 1JLVA 4PUAA 3H93A 2O8VB 2C0EA 4ZL8A 3NIVA 5HR3A 3IRAA 2AV4A 1F9MA 1YY7A 1X9WB 2MBSA 3HJMA 1ZCPA 2XPDA 5ID2B 3GN3A 2JU5A 2FD3A 1ZYNA 1GSFA 2GSRA 2OE1A 2L57A 1PL2A 1SKWB 3CRTA 1O7UA 4EF0A 3DVWA 5DBQA 3H1NA 4GLTA 4TR3A 4XRDA 2F8AA 4XS4A 5ECIB 2IL3A 4PGTA 1Z7PA 5H5QA 3TJGA 3FZ9A 3P7XA 3FW2A 3PINA 3RDWA 2F8FA 3KGKA 1YKAA 5DDLA 1XFLA 1WIKA 3DGQA 3UIWA 1SKSB 5B7CA 1G7OA 4PX1A 5B6NA 4X0XA 1OC9A 2L6DA 5ENUA 1M9AA 4KH7A 1TI3A 2HRNA 1URMA 2EIRA 3WT2A 2C0GA 4OWYA 2LKUA 1BEDA 2X8GA 5IM9A 3EE2A 2LSTA 3L78A 5B8AA 1EV4A 2IWTA 2C3TA 2CA8A 3D5JA 4ZILA 1AC1A 1ERTA 3FRCA 2MYGA 2DJ1A 2PPTA 5D96A 1TRSA 4DSSB 1BX9A 1LU4A 2A2RA 2LRCA 2OBKA 5J3RA 1SJ6A 3NZNA 1UVZA 4N11A 4ZB6A 2DJ3A 2CZ3A 4KSOA 5DAKB 1VRSD 1U87A 4IP1A 5EVOA 2F51A 4TXOA 4PQIA 4HU7A 5D9VA 1U3IA 3J7Yk 1XOAA 3FR9A 4D73B 1A23A 4L0WA 1TTZA 1MEKA 5BMUA 4ZL7A 2VOCA 2KP1A 4DSRA 4G0LA 2VL2A 3BOAA 3KZQA 5ABRA 4IKHA 4E8HA 3UVHA 4MF6A 1ZYPA 2VCQA 3GKMA 4BVXA 17GSA 4PQ1A 1EV9A 1VGLA 1Z6NA 4MNNA 5FT3A 1MDJA 2KP2A 1NHYA 1XVQA 5G1KA 1BAYA 1IYHA 3US3A 19GSA 1K0NA 3G7IA 2TIRA 4GSTA 2V6OA 1XZOA 1ERUA 3GIXA 2FNOA 3PH9A 4ILFA 3BCIA 3IC8A 5E59A 11GSA 3ERFA 2NDOA 4RQRA 1TRWA 4HQSA 2VCXA 4EXJA 3F0IA 3TOTA 5HR0A 3N9JA 5G2ZA 2L59A 3GTUB 3I6AA 2P5RA 2HNLA 3M8NA 3QAGA 2CQ9A 2D2ZA 4KSMA 1THOA 1XW9A 2H70A 3F4SA 5D93A 1HYUA 3KIJA 1ERVA 1QQ2A 2DIYA 3ERWA 2RLIA 1BJXA 3DEXA 1TI1A 2JZSA 5IMCA 5IIZA 3UJ1A 5IMFA 3W6GA 1Z5YE 2IMFA 2RUEA 4TR0A 4Q5RA 5ECPB 2PGTA 3ZLPA 1GTAA 2OADA 2HZEA 2RUFA 1YF0A 4IJ3A 4QL7A 5H5SA 5CRDA 4K0GA 1KTEA 3ED3A 2R5GA 3ZL5A 4BL7A 4IQ1A 3RPPA 1PA3A 1PRXA 3U5RE 1A2MA 3HVVA 2B1KA 1B48A 4EDYA 3HXSA 2L5OA 1ZGNA 3UEMA 2H0HA 4G0IA 4HDEA 5GSTA 5AGYA 5D73A 1GNWA 4J2FA 2YV7A 4H86A 1N2AA 4F82A 2AYTA 4AGSA 2VL3A 2CZ2A 4JE1A 4KUNA 3GA4A 1OAZA 2YCDA 4XS6A 3FEUA 4CY8A 2Z9SA 3EC3A 5E4WA 2PN8A 2QA1A 3EWLA 5LCZA 1GSEA 4FH8A 4HZ4A 4I5QA 1S3CA 4E8EA 3H8QA 3VPTA 2EIOA 2WS2A 3HVSA 4I2UA 3LFLA 5A4UA 2CVBA 1YKCA 2LQQA 2R4VA 2DMLA 4XS1A 2MBTA 1GP1A 4N30A 1SD9A 4IELA 5HFKA 3IHQA 2GS3A 5ECQB 5CREA 4DSQA 5ECSA 1M2DA 3HYPA 3IHGA 1Q4JA 3BBYA 4JRRA 4GWRA 3TOUA 3VURA 3TJBA 4TR4A 4MLYA 2LNTA 3QCPA 2WFCA 1PGTA 3APSA 1GSYA 4IQAA 1GUMA 2RM5A 5ECMB 3HVXA 1RK4A 4BVYA 4NHZA 1XVWA 3ZITA 1TK0B 2FWGA 4WBRD 1PN9A 3F9UA 4EDZA 1EGOA 2ZUPA 3A2XA 2VD0A 2VAFA 2LV3A 1X9MB 2H75A 1FOVA 4AF2A 4O32A 1GLQA 2YN1A 1GSUA 5DQYA 1AUCA 4ZL9A 1GULA 1PN0A 4KAEA 3IOSA 3P90A 1MD3A 2AJQB 1IYIA 4WKWA 3O76A 4HEA2 3Q74A 4X1UA 3DD3A 3RHBA 2QC7A 4I2TA 4PQHA 1TDIA 4K9ZA 2XPEA 2DJ0A 2YWMA 2C0DA 3Q18A 4Q5NA 5F05A 4XIHA 2YP6A 2H1BA 2GT6A 3V1WA 1XWAA 2LNSA 4YKFA 4WETA 2HLSA 4KF9A 4G10A 1O73A 3QFBC 4YQMA 4ECIA 3KM6A 1NM3A 5AIXA 2KLXA 1GLPA 2DJJA 1ST9A 1R5AA 1WRYA 3F6DA 1ZOFA 4MJAA 2I81A 1X5CA 5ECNB 5ECOB 4ECBA 3KEBA 2VIMA 5GAND 3LWAA 2H19A 1JZOA 2IFQA 1K0OA 1XWCA 2HXKA 4K6XA 1SL2B 1VF1A 3RAZA 1TRUA 4K7IA 4GTUA 1XIYA 2P31A 2X99A 5CRWA 4EE0A 3APQA 4O5RA 4HJMA 4MJEA 2K6VA 2XHFA 1O8XA 3CXGA 2A2SA 2P0GA 5LNKe 1TU8A 2H30A 1GUHA 3VWVA 1I5GA 2NTOA 4J56E 4TVEA 3ZVJA 3EURA 4MZWA 2GSQA 1ABAA 3QMXA 5B6MA 4K7NA 2C4JA 4EVMA 1OE7A 1AQXA 3ERGA 5A4WA 4CW9A 1ACVA 3VLNA 5D8IA 4MA9A 3M1GA 4IJIA 2I9HA 3EU3A 4P3YB 4KGIA 1OKDA 2HZFA 3ISOA 2MMOA 2IIYA 3CMIA 3F3QA 6GSYA 4O92A 3O6TA 3LQ7A 3VWUA 4ACSA 4TKYA 2UZ8A 3TKPA 4O7HA 3FZ5A 3VWWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H1A A;  4KDX A;  1T00 A;  1G7E A;  4J57 E;  4IS0 A;  3CYN A;  5A5K A;  1WOU A;  3TRP A;  3WYW A;  1GL8 A;  4RUV A;  4PUF C;  3L0H A;  2GSS A;  3I43 A;  4EKZ A;  3ZIV A;  5JCG A;  1GH2 A;  4NV5 A;  2HYX A;  1GNE A;  2ON7 A;  1X9S B;  2ES7 A;  2PU9 C;  2PWJ A;  3ZFB A;  2RM6 A;  1YF1 A;  4V2L A;  1KEB A;  5HFI A;  2DC5 A;  2H8L A;  3C1S A;  4XCS A;  1AQV A;  3L4N A;  3MDK A;  3TDG A;  1GTB A;  2H66 A;  2JZT A;  2ZCT A;  1WWJ A;  4KDU A;  2CT6 A;  4CDO A;  4NV2 A;  3IAS 2;  3MWH A;  4GSS A;  1HQO A;  3HY2 A;  4LL4 B;  1GRX A;  5DAK A;  3TKS A;  4EC0 A;  5C04 A;  1JFU A;  2J23 A;  2JAC A;  5DAL A;  4XS4 B;  1FB0 A;  5AN1 A;  2JL4 A;  2O85 A;  2VM2 A;  1OC3 A;  3KH9 A;  4XRA A;  3D22 A;  2GZZ A;  2FA8 A;  3EMX A;  3EYT A;  4AJ6 A;  1X0R A;  5ECH B;  3GV1 A;  1DUG A;  1O85 A;  1Y25 A;  1JZW A;  1G0T A;  4OMV A;  3FZ4 A;  4D73 A;  1B9Y C;  5DCG A;  5HR2 A;  2H1G A;  2HT9 A;  4Q5F A;  1QGV A;  2H71 A;  5H5R A;  1R4W A;  2MMN A;  4TR1 A;  1OC9 B;  2IMD A;  4IHU A;  1T1V A;  1WJK A;  1SYX A;  4N0V A;  3A2W A;  2GZY A;  1B9X C;  3TJK A;  1PKW A;  4ZXG A;  1NW2 A;  4F03 A;  2I1U A;  2H1D A;  4TXV A;  6GST A;  1XXU A;  1AQW A;  1JZD A;  4WXT A;  1EGR A;  3FZA A;  4V1A p;  2F3M A;  2K9F A;  4I8B A;  2AHE A;  1E2Y A;  3LXT A;  3BJ5 A;  2MMA A;  4MH3 A;  2DMM A;  1TK8 B;  4ISD A;  3KXO A;  1K0A A;  4GF0 A;  2CV4 A;  1XOB A;  1X5E A;  2O87 A;  3Q6O A;  3LXZ A;  2F9S A;  3QAW A;  1A2J A;  2K8V A;  4YQV A;  1M9B A;  4HOJ A;  1SKR B;  3VI5 A;  3NOF A;  4FYC A;  1QMV A;  3ZFL A;  3UVT A;  2C3N A;  3DWV A;  1U3A A;  5J4U A;  4FO5 A;  4GQF A;  2X8H A;  2GGT A;  5IO2 A;  2I3Y A;  2WB9 A;  1K0D A;  4OFN A;  1SU9 A;  1E6B A;  4IP6 A;  2QGV A;  4N10 A;  1MTC A;  2YJ7 A;  1USB A;  3W8J A;  1B8X A;  3ZZX A;  2ON5 A;  4V2M A;  2C1Y A;  4TW5 A;  4JED A;  4OCE A;  2YOI A;  4HJ2 A;  4HUA A;  5GSS A;  2QSI A;  4BWS A;  2E2M A;  2IPA A;  2CAQ A;  3I9V 2;  5CP1 A;  1J08 A;  3LSZ A;  4MDC A;  1SYR A;  3GKN A;  1QXH A;  2IN3 A;  3ME8 A;  5L71 A;  2V6K A;  3GUS A;  2MZC A;  1Z7R A;  3HHV A;  3G7Y A;  3WGD A;  5EPF A;  4L8E A;  3HD5 A;  4ZB8 A;  1GTI A;  1HD2 A;  1O8W A;  3WD6 A;  1WE0 A;  5JWQ B;  1EWX A;  4QL9 A;  3TKQ A;  2BJX A;  4AJ7 A;  1O6J A;  5IMD A;  4OD7 A;  1EP7 A;  1WMJ A;  2K18 A;  1K0C A;  4MMM A;  2PER A;  2FLS A;  2B5X A;  3TB2 A;  3ZRE A;  3CRU A;  2VO4 A;  3M9K A;  2KHP A;  1J9B A;  3F4R A;  2TRC P;  3ZML A;  2HZE B;  7GSS A;  5ECK B;  4I97 A;  1N8J A;  4EO3 A;  3M3M A;  5IMZ A;  5JWR B;  1VF2 A;  5CYY A;  4F0C A;  2FGX A;  3DIE A;  1B4Q A;  1M2B A;  1LJR A;  3KCM A;  4ZBD A;  1SJZ A;  1TXX A;  3RPN A;  4V2N A;  3D0Z A;  2NBS A;  2LQO A;  1TKD B;  5KN1 A;  2IMK A;  1UA5 A;  5IQY A;  3O3T A;  3BD2 A;  5IOW A;  2G2Q A;  3C71 A;  2QKE A;  6GSU A;  2H0G A;  1PX7 A;  1T4Y A;  1W4V A;  3VPQ A;  5A4V A;  3IR4 A;  5G30 A;  3FHK A;  4LLR A;  2OAC A;  5DJM A;  3GNJ A;  4OCF A;  1KNG A;  2M46 A;  1VF4 A;  5JCW A;  4MH2 A;  2ZNM A;  1WP0 A;  1BQ7 A;  4HQZ A;  1K0B A;  4K0N A;  4KCA A;  1EOH A;  1RQM A;  1RW1 A;  4IVF A;  2VLU A;  1T8E B;  3SBC A;  1XWK A;  5J5N A;  4GSN A;  1BYE A;  10GS A;  4NXI A;  2J9H A;  2YWN A;  3ZMK A;  2FWF A;  3F63 A;  4JR4 A;  3TRQ A;  4GXZ A;  2HE3 A;  4YAP A;  1QFN A;  2YWO A;  2CAI A;  1FG4 A;  4AJ8 A;  1T4Z A;  3IXR A;  5G5E A;  8GSS A;  1PSQ A;  3BCK A;  5CRG A;  4YH2 A;  1ZZY A;  3P8W A;  4MF7 A;  2VUP A;  2LUS A;  5KEJ A;  3FKF A;  4NMU A;  3VK9 A;  3TCO A;  3U6V A;  5LD0 A;  3GX8 A;  5KN3 A;  3KP9 A;  4LMW A;  3WT1 A;  4KB3 A;  1GUK A;  1PL1 A;  2EC4 A;  3FK8 A;  2AUV A;  3KTL A;  3QAV A;  3GST A;  4ZB9 A;  3DXB A;  4F2I A;  4RQX A;  2GT5 A;  1OKT A;  1M2A A;  1ZMA A;  4GCI A;  3LGC A;  2N5B A;  1TRV A;  4TOP A;  5EL8 A;  1ILO A;  1T3B A;  14GS A;  1MDI A;  1A24 A;  3TJJ A;  5DJL A;  3KTB A;  3P2A A;  2OKA A;  1Z3E A;  1SL1 B;  1YEP A;  2PMT A;  4NWY A;  4JZQ A;  3QDN A;  4ZBA A;  4Z7X A;  1SK2 A;  4HU9 A;  1ERW A;  1SL0 B;  2V2G A;  4POK A;  4ECC A;  2V1M A;  1FO5 A;  2R37 A;  1M7T A;  2LJA A;  5G31 A;  1HNB A;  1MD4 A;  2M80 A;  1OC8 A;  4ML6 A;  3CTG A;  2HSH A;  2N5F A;  1AW9 A;  20GS A;  1HNA A;  2GVP A;  5D9X A;  3IPZ A;  1A8L A;  1A0F A;  2O89 A;  1THX A;  1OYJ A;  2OBI A;  5KN2 A;  3MAK A;  3CSH A;  3EU4 A;  3TKR A;  3H79 A;  1U88 A;  3LYK A;  5ID2 A;  2L6C A;  4EL1 A;  2IFQ B;  4YAV A;  1G6Y A;  2VCZ A;  1V57 A;  1O81 A;  3EIN A;  2HRF A;  1DBY A;  4JBB A;  5ELG A;  2E2G A;  3H4K A;  4EUY A;  4YQU A;  4ML1 A;  2H6Z A;  4NPB A;  5ECL B;  3C73 A;  13GS A;  1K3Y A;  2L5L A;  3F8U A;  1TK5 B;  2PUK C;  2E0Q A;  1VF3 A;  1YEX A;  2E7P A;  3UMA A;  3ZIJ A;  2LS5 A;  1DE2 A;  1C72 A;  5F8B A;  1EZK A;  1DE1 A;  2H74 A;  3LJR A;  4HS1 A;  3CTF A;  2H73 A;  2A4V A;  4ID0 A;  5G5F A;  2JAD A;  4Q5Q A;  5AIV A;  3IK7 A;  3M9J A;  22GS A;  1GSS A;  4OFT A;  3CBU A;  5FHI A;  16GS A;  3QR6 A;  3GH9 A;  3QD9 A;  3JCM L;  3QOU A;  4OO5 A;  2YZH A;  4DSS A;  2KOK A;  3IBH A;  5HQP A;  2FA4 A;  1EEM A;  2PBJ A;  3HKR A;  6GSW A;  1B4P A;  1V2A A;  3LG6 A;  3J7Y b;  1PD2 1;  1YZX A;  1XPV A;  2CX4 A;  5C00 A;  2LTK A;  4G9H A;  2C3Q A;  1GTU A;  5DCH A;  3KMO A;  3KH7 A;  4BWQ A;  4QQ7 A;  1QK8 A;  3FR6 A;  3AY8 A;  3A2V A;  3W8S A;  3IV4 A;  4LL1 B;  2HFD A;  4HZ2 A;  1ZL9 A;  1AIU A;  1TOF A;  4MJB A;  2LJK A;  5G1L A;  3VWX A;  2LEG A;  4KA0 A;  18GS A;  1ON4 A;  2YJH A;  1FVJ A;  3DRN A;  2B6M A;  1Q98 A;  4NHW A;  3DKS A;  2JSY A;  3MNG A;  3HJP A;  1AXD A;  2WDU A;  5FWG A;  1JLW A;  1CQH A;  4JR6 A;  1K0M A;  3L9V A;  5HFG A;  4DVC A;  4MAB A;  3OR5 A;  5DAL B;  3D4T A;  3HDC A;  5IMV A;  2PVO C;  4TRX A;  2L4C A;  3RHC A;  2XBQ A;  3IA1 A;  4WR4 A;  2G0F A;  1FW1 A;  1H75 A;  3K8N A;  1ZYE A;  2H6X A;  1K3O A;  1TW9 A;  5EY6 A;  3E0U A;  3A5W A;  3SWL A;  4KX4 A;  2VCT A;  2MMZ A;  3ME7 A;  3ZYW A;  2GQK A;  3IDV A;  2GQM A;  1UC7 A;  4TR1 B;  4MJC A;  5JWO B;  1A8Y A;  4TXO B;  2B1L A;  3GTU A;  3QFA C;  2H01 A;  1WPI A;  1Z6M A;  1SEN A;  2YZU A;  1I9D A;  5JCU A;  2VL9 A;  3HJO A;  3C7M A;  2H0I A;  5J41 A;  3GRX A;  4KW6 A;  4ZIJ A;  3DYR A;  3PGT A;  1R7H A;  1S3A A;  1K3L A;  1R5P A;  3GUR A;  1A0R P;  5KN0 A;  1KBN A;  2TRX A;  2C0F A;  2PVQ A;  1SJI A;  3TRX A;  1A2L A;  1HNC A;  3F3R A;  1PQN A;  5IMA A;  3GL5 A;  2REM A;  5DQS A;  2L4Q A;  5F06 A;  4N0Z A;  3FYG A;  1XW6 A;  4IN0 A;  2ALB A;  1MDK A;  1SK1 A;  3GX0 A;  1V40 A;  1AAZ A;  3QPM A;  3IE3 A;  1XWB A;  3CSJ A;  2GST A;  2VD1 A;  3DVX A;  3MSZ A;  4PUR A;  2N5A A;  5GZZ B;  1EEJ A;  2H72 A;  1V9W A;  3HZ4 A;  2NVL A;  3E3E A;  2YWI A;  4WF4 A;  1JZR A;  4KND A;  4FIW A;  2KUC A;  5J9C A;  5CO3 A;  2DBC A;  4GRF A;  1J0F A;  1TU7 A;  2DLX A;  3UL3 A;  1PKZ A;  3TKS C;  4HI7 A;  2B7K A;  4MF5 A;  1XWG A;  4F0B A;  2DSA A;  3PR8 A;  5F07 A;  4LA1 A;  4WF5 A;  2R6K A;  2OA7 A;  1ZYQ B;  3TUE A;  2LRN A;  5IPH A;  1V58 A;  1XW5 A;  1CQG A;  4L5L A;  4MPF A;  4V1A g;  12GS A;  4PNG A;  2GTU A;  3GHA A;  4PNF A;  3E9J B;  1FVK A;  2B7J A;  4K7O A;  4FYB A;  3TGZ A;  3GH6 A;  1F3B A;  2C8U A;  1GSD A;  1OVN A;  3FY7 A;  4RI6 A;  2V41 A;  5ELA A;  4MP4 A;  2OE0 A;  2GQL A;  2FHE A;  2HI7 A;  1Y6E A;  5ECR B;  1XCC A;  1YDK A;  3CSI A;  3DML A;  2K8S A;  1EOG A;  1PMT A;  2LRT A;  5D9T A;  3EMP A;  3WGX A;  4F9Z A;  1F3A A;  2GDR A;  3GFK A;  3KJY A;  1H4O A;  2V32 A;  3HZ8 A;  4L5O A;  2VL2 C;  4JU5 A;  4LMV A;  3R2Q A;  1JHB A;  1T7P B;  1NHO A;  4POL A;  4K1F A;  3WGE A;  5D9W A;  3TKS E;  2P5Q A;  2LJR A;  4G19 A;  3TJF A;  2YAN A;  1YJ6 A;  2M72 A;  2B5Y A;  1EP8 A;  3UAP A;  3I69 A;  5CRH A;  3UBL A;  2XBI A;  2EIQ A;  3UBK A;  2VM1 A;  3GYK A;  3ZRD A;  1GSQ A;  2I4A A;  2WJU A;  2VLV A;  3L9S A;  1QUW A;  2H6Y A;  1UN2 A;  4KCE A;  1F37 A;  4WR5 A;  3C8E A;  2JZR A;  1TJD A;  1BG5 A;  2X64 A;  4CHS A;  4MK3 A;  4DEJ A;  2VLT A;  3G7J A;  2DIZ A;  4IW9 A;  2BTO T;  3RBT A;  2FUG 2;  1FAA A;  1U6T A;  3C1R A;  3HA9 A;  1NSW A;  2DJK A;  4NAX A;  3D6I A;  2R3X A;  3F4T A;  2YNX A;  3D21 A;  3APO A;  1PX6 A;  4POM A;  2HSY A;  1YQ1 A;  1Z9H A;  2FWE A;  2CVK A;  1SD8 A;  3IC4 A;  5IPG A;  1M0U A;  5F0G A;  4ECJ A;  2X8C A;  3GKK A;  5IOX A;  4X43 A;  3VI7 A;  1SK0 A;  5AIS A;  4KE3 A;  3UAR A;  6GSS A;  1GWC A;  4K2D A;  2XC2 A;  4TN8 A;  2B3S A;  3IAM 2;  4OO4 A;  1LBK A;  2YV9 A;  1OE8 A;  3IK9 A;  2IJY A;  5COH A;  4L0U A;  2WGR A;  4ZBB A;  3LOR A;  3N5O A;  5IO0 A;  1R26 A;  3GL3 A;  6GSX A;  4MCU A;  4IGJ A;  1XBS A;  4POB A;  2GZP A;  3D4M A;  1S3D A;  4BA7 A;  2OE3 A;  2O7K A;  5B8B A;  4KDY A;  2IME A;  4MZC A;  2AB6 A;  3L9U A;  3LEF A;  3M0F A;  5DVB A;  2JSZ A;  2WCI A;  5HR1 A;  3F6F A;  2YPM A;  2FCH A;  2B5E A;  3KMN A;  1TP9 A;  3UOM A;  4XHM A;  2C80 A;  2AAW A;  2CX3 A;  2FWH A;  2BMX A;  4GQC A;  4OFM A;  3ZVJ D;  4WEY A;  2RII A;  3G9B A;  4BPY A;  2WZ9 A;  4ULX A;  3S9F A;  3GSS A;  2OJL A;  4FYU A;  2CVD A;  2VCW A;  5CNW A;  2WUL A;  2DJ2 A;  2R2J A;  4WBJ A;  2NPB A;  3FR3 A;  3A3T A;  4MPG A;  3Q19 A;  3KD0 A;  1X5D A;  2H76 A;  4XTS A;  5GAP D;  3LYP A;  6GSV A;  3KP8 A;  1ML6 A;  3HCZ A;  3ZTL A;  2VCV A;  4MZB A;  4RI7 A;  1G6W A;  1F2E A;  1FHE A;  4IBP A;  3VFI A;  2IMI A;  3GMF A;  2FY6 A;  4I6X A;  5J9B A;  5INY A;  1F6M C;  9GSS A;  1FB6 A;  5CAX A;  1V98 A;  1M99 A;  4G2E A;  4PXO A;  2WRT A;  1DSB A;  2GLR A;  3EVI A;  1W89 A;  4K8M A;  3GKX A;  1JLV A;  4PUA A;  3H93 A;  2O8V B;  2C0E A;  4ZL8 A;  3NIV A;  5HR3 A;  3IRA A;  2AV4 A;  1F9M A;  1YY7 A;  1X9W B;  2MBS A;  3HJM A;  1ZCP A;  2XPD A;  5ID2 B;  3GN3 A;  2JU5 A;  2FD3 A;  1GSF A;  2GSR A;  2OE1 A;  2L57 A;  1PL2 A;  1SKW B;  3CRT A;  1O7U A;  4EF0 A;  3DVW A;  5DBQ A;  3H1N A;  4GLT A;  4TR3 A;  4XRD A;  2F8A A;  4XS4 A;  5ECI B;  2IL3 A;  4PGT A;  1Z7P A;  5H5Q A;  3TJG A;  3FZ9 A;  3P7X A;  3FW2 A;  3PIN A;  3RDW A;  2F8F A;  3KGK A;  1YKA A;  5DDL A;  1XFL A;  1WIK A;  3DGQ A;  3UIW A;  1SKS B;  5B7C A;  1G7O A;  4PX1 A;  5B6N A;  4X0X A;  1OC9 A;  2L6D A;  5ENU A;  1M9A A;  4KH7 A;  1TI3 A;  2HRN A;  1URM A;  2EIR A;  3WT2 A;  2C0G A;  4OWY A;  2LKU A;  1BED A;  2X8G A;  5IM9 A;  3EE2 A;  2LST A;  3L78 A;  5B8A A;  1EV4 A;  2IWT A;  2C3T A;  2CA8 A;  3D5J A;  4ZIL A;  1AC1 A;  1ERT A;  3FRC A;  2MYG A;  2DJ1 A;  2PPT A;  5D96 A;  1TRS A;  4DSS B;  1BX9 A;  1LU4 A;  2A2R A;  2LRC A;  2OBK A;  5J3R A;  1SJ6 A;  3NZN A;  1UVZ A;  4N11 A;  4ZB6 A;  2DJ3 A;  2CZ3 A;  4KSO A;  5DAK B;  1VRS D;  1U87 A;  4IP1 A;  5EVO A;  2F51 A;  4TXO A;  4PQI A;  4HU7 A;  5D9V A;  1U3I A;  3J7Y k;  1XOA A;  3FR9 A;  4D73 B;  1A23 A;  4L0W A;  1TTZ A;  1MEK A;  4ZL7 A;  2VOC A;  2KP1 A;  4DSR A;  2VL2 A;  3BOA A;  3KZQ A;  5ABR A;  4IKH A;  4E8H A;  3UVH A;  4MF6 A;  2VCQ A;  3GKM A;  4BVX A;  17GS A;  4PQ1 A;  1EV9 A;  1VGL A;  1Z6N A;  5FT3 A;  1MDJ A;  2KP2 A;  1NHY A;  1XVQ A;  5G1K A;  1BAY A;  1IYH A;  3US3 A;  19GS A;  1K0N A;  3G7I A;  2TIR A;  4GST A;  2V6O A;  1XZO A;  1ERU A;  3GIX A;  2FNO A;  3PH9 A;  4ILF A;  3BCI A;  5E59 A;  11GS A;  3ERF A;  2NDO A;  4RQR A;  1TRW A;  4HQS A;  2VCX A;  4EXJ A;  3F0I A;  3TOT A;  5HR0 A;  3N9J A;  5G2Z A;  2L59 A;  3GTU B;  3I6A A;  2P5R A;  2HNL A;  3M8N A;  3QAG A;  2CQ9 A;  2D2Z A;  4KSM A;  1THO A;  1XW9 A;  2H70 A;  3F4S A;  5D93 A;  1HYU A;  3KIJ A;  1ERV A;  1QQ2 A;  2DIY A;  3ERW A;  2RLI A;  1BJX A;  3DEX A;  1TI1 A;  2JZS A;  5IMC A;  5IIZ A;  3UJ1 A;  5IMF A;  3W6G A;  1Z5Y E;  2IMF A;  2RUE A;  4TR0 A;  4Q5R A;  5ECP B;  2PGT A;  3ZLP A;  1GTA A;  2OAD A;  2HZE A;  2RUF A;  1YF0 A;  4IJ3 A;  4QL7 A;  5H5S A;  5CRD A;  4K0G A;  1KTE A;  3ED3 A;  2R5G A;  3ZL5 A;  4BL7 A;  4IQ1 A;  3RPP A;  1PA3 A;  1PRX A;  3U5R E;  1A2M A;  3HVV A;  2B1K A;  1B48 A;  4EDY A;  3HXS A;  2L5O A;  1ZGN A;  3UEM A;  2H0H A;  4HDE A;  5GST A;  5AGY A;  5D73 A;  1GNW A;  4J2F A;  2YV7 A;  4H86 A;  1N2A A;  4F82 A;  2AYT A;  4AGS A;  2VL3 A;  2CZ2 A;  4JE1 A;  4KUN A;  3GA4 A;  1OAZ A;  2YCD A;  4XS6 A;  3FEU A;  2Z9S A;  3EC3 A;  5E4W A;  2PN8 A;  3EWL A;  5LCZ A;  1GSE A;  4FH8 A;  4HZ4 A;  4I5Q A;  1S3C A;  4E8E A;  3H8Q A;  3VPT A;  2EIO A;  2WS2 A;  3HVS A;  4I2U A;  3LFL A;  5A4U A;  2CVB A;  1YKC A;  2LQQ A;  2R4V A;  2DML A;  4XS1 A;  2MBT A;  1GP1 A;  4N30 A;  1SD9 A;  4IEL A;  5HFK A;  3IHQ A;  2GS3 A;  5ECQ B;  5CRE A;  4DSQ A;  5ECS A;  1M2D A;  3HYP A;  1Q4J A;  3BBY A;  4JRR A;  4GWR A;  3TOU A;  3VUR A;  3TJB A;  4TR4 A;  4MLY A;  2LNT A;  3QCP A;  2WFC A;  1PGT A;  3APS A;  1GSY A;  4IQA A;  1GUM A;  2RM5 A;  5ECM B;  3HVX A;  1RK4 A;  4BVY A;  4NHZ A;  1XVW A;  3ZIT A;  1TK0 B;  2FWG A;  4WBR D;  1PN9 A;  3F9U A;  4EDZ A;  1EGO A;  2ZUP A;  3A2X A;  2VD0 A;  2VAF A;  2LV3 A;  1X9M B;  2H75 A;  1FOV A;  4AF2 A;  4O32 A;  1GLQ A;  2YN1 A;  1GSU A;  5DQY A;  1AUC A;  4ZL9 A;  1GUL A;  4KAE A;  3IOS A;  3P90 A;  1MD3 A;  2AJQ B;  1IYI A;  4WKW A;  3O76 A;  4HEA 2;  3Q74 A;  4X1U A;  3DD3 A;  3RHB A;  2QC7 A;  4I2T A;  4PQH A;  1TDI A;  4K9Z A;  2XPE A;  2DJ0 A;  2YWM A;  2C0D A;  5F05 A;  3Q18 A;  4Q5N A;  4XIH A;  2YP6 A;  2H1B A;  2GT6 A;  3V1W A;  1XWA A;  2LNS A;  4WET A;  2HLS A;  4G10 A;  1O73 A;  3QFB C;  4YQM A;  4ECI A;  3KM6 A;  1NM3 A;  5AIX A;  2KLX A;  1GLP A;  2DJJ A;  1ST9 A;  1R5A A;  1WRY A;  3F6D A;  1ZOF A;  4MJA A;  2I81 A;  1X5C A;  5ECN B;  5ECO B;  4ECB A;  3KEB A;  2VIM A;  5GAN D;  3LWA A;  2H19 A;  1JZO A;  2IFQ A;  1K0O A;  1XWC A;  2HXK A;  4K6X A;  1SL2 B;  1VF1 A;  3RAZ A;  1TRU A;  4K7I A;  4GTU A;  1XIY A;  2P31 A;  2X99 A;  5CRW A;  4EE0 A;  3APQ A;  4O5R A;  4HJM A;  4MJE A;  2K6V A;  2XHF A;  1O8X A;  3CXG A;  2A2S A;  2P0G A;  5LNK e;  1TU8 A;  2H30 A;  1GUH A;  3VWV A;  1I5G A;  2NTO A;  4J56 E;  4TVE A;  3ZVJ A;  3EUR A;  4MZW A;  2GSQ A;  1ABA A;  3QMX A;  5B6M A;  4K7N A;  2C4J A;  4EVM A;  1OE7 A;  1AQX A;  3ERG A;  5A4W A;  4CW9 A;  1ACV A;  3VLN A;  5D8I A;  4MA9 A;  3M1G A;  4IJI A;  2I9H A;  3EU3 A;  4P3Y B;  4KGI A;  1OKD A;  2HZF A;  3ISO A;  2MMO A;  2IIY A;  3CMI A;  3F3Q A;  6GSY A;  4O92 A;  3O6T A;  3LQ7 A;  3VWU A;  4ACS A;  4TKY A;  3TKP A;  4O7H A;  3FZ5 A;  3VWW A; 
#chains in the Genus database with same CATH topology
 2H1A A;  4KDX A;  1T00 A;  1G7E A;  4J57 E;  4IS0 A;  3CYN A;  5A5K A;  1WOU A;  3TRP A;  3WYW A;  1GL8 A;  4RUV A;  4PUF C;  3L0H A;  2GSS A;  3I43 A;  4EKZ A;  3ZIV A;  5JCG A;  1GH2 A;  4NV5 A;  2HYX A;  1GNE A;  2ON7 A;  1X9S B;  2ES7 A;  2PU9 C;  2PWJ A;  3ZFB A;  2RM6 A;  1M3I A;  1YF1 A;  4V2L A;  1KEB A;  5HFI A;  2DC5 A;  2H8L A;  3C1S A;  4XCS A;  2DKH A;  1AQV A;  3L4N A;  3MDK A;  3TDG A;  1GTB A;  2H66 A;  2JZT A;  2ZCT A;  1WWJ A;  5BRT A;  4KDU A;  2R0C A;  2CT6 A;  4CDO A;  4NV2 A;  3IAS 2;  3MWH A;  4GSS A;  1HQO A;  3HY2 A;  4LL4 B;  1GRX A;  5DAK A;  3TKS A;  4EC0 A;  5C04 A;  1JFU A;  2J23 A;  2JAC A;  5DAL A;  2HRK A;  4XS4 B;  1FB0 A;  5AN1 A;  2JL4 A;  2O85 A;  2VM2 A;  1OC3 A;  3KH9 A;  2X4A A;  2X49 A;  4XRA A;  3D22 A;  2GZZ A;  2FA8 A;  3EMX A;  3EYT A;  4AJ6 A;  1X0R A;  5ECH B;  3GV1 A;  1DUG A;  1O85 A;  1Y25 A;  1JZW A;  1G0T A;  4OMV A;  3FZ4 A;  4D73 A;  1B9Y C;  5DCG A;  5HR2 A;  2H1G A;  2HT9 A;  4Q5F A;  1QGV A;  2H71 A;  5H5R A;  1R4W A;  2MMN A;  4TR1 A;  1OC9 B;  2IMD A;  4IHU A;  1T1V A;  1WJK A;  1SYX A;  4N0V A;  3A2W A;  2GZY A;  1B9X C;  3MYD A;  4K2X A;  3TJK A;  1PKW A;  4ZXG A;  1NW2 A;  4F03 A;  2I1U A;  2H1D A;  4TXV A;  4G0K A;  6GST A;  1XXU A;  1AQW A;  4BIK A;  1JZD A;  4WXT A;  1EGR A;  3FZA A;  4V1A p;  2F3M A;  2K9F A;  4I8B A;  2AHE A;  1E2Y A;  3LXT A;  3BJ5 A;  2MMA A;  4MH3 A;  2DMM A;  1TK8 B;  4ISD A;  3KXO A;  1K0A A;  4GF0 A;  2CV4 A;  1XOB A;  1X5E A;  2O87 A;  3Q6O A;  3LXZ A;  2F9S A;  3QAW A;  1A2J A;  2K8V A;  4YQV A;  1M9B A;  4HOJ A;  1SKR B;  3VI5 A;  3NOF A;  4FYC A;  1QMV A;  3ZFL A;  3UVT A;  2C3N A;  3DWV A;  1U3A A;  5J4U A;  1FOH A;  4FO5 A;  4GQF A;  2X8H A;  2GGT A;  5IO2 A;  4X4J A;  2I3Y A;  2WB9 A;  1K0D A;  4OFN A;  1SU9 A;  1E6B A;  4IP6 A;  2QGV A;  4N10 A;  1MTC A;  2HRA A;  2YJ7 A;  4Z2R A;  1USB A;  3W8J A;  1B8X A;  3ZZX A;  2ON5 A;  4V2M A;  2C1Y A;  4TW5 A;  4JED A;  4OCE A;  2YOI A;  4HJ2 A;  4HUA A;  5GSS A;  2QSI A;  4BWS A;  2E2M A;  2IPA A;  2CAQ A;  3I9V 2;  5CP1 A;  1J08 A;  3LSZ A;  4MDC A;  1SYR A;  3GKN A;  1QXH A;  3EPT A;  2IN3 A;  3ME8 A;  5L71 A;  2V6K A;  3GUS A;  2MZC A;  1Z7R A;  3HHV A;  3G7Y A;  3WGD A;  5EPF A;  4L8E A;  3HD5 A;  4ZB8 A;  1GTI A;  1HD2 A;  1O8W A;  3WD6 A;  1WE0 A;  5JWQ B;  1EWX A;  4QL9 A;  3TKQ A;  2BJX A;  4AJ7 A;  1O6J A;  5IMD A;  4OD7 A;  1EP7 A;  1WMJ A;  2K18 A;  4O5Q A;  3CQF A;  1K0C A;  4MMM A;  2PER A;  2FLS A;  2B5X A;  3TB2 A;  3ZRE A;  3CRU A;  2VO4 A;  3M9K A;  2KHP A;  1J9B A;  3F4R A;  2TRC P;  3FMW A;  3ZML A;  2HZE B;  7GSS A;  5ECK B;  4I97 A;  1N8J A;  4EO3 A;  3M3M A;  4CY6 A;  5IMZ A;  5JWR B;  1VF2 A;  5CYY A;  4F0C A;  2FGX A;  3DIE A;  1B4Q A;  1M2B A;  1LJR A;  3KCM A;  4ZBD A;  1SJZ A;  2R0G A;  1TXX A;  3RPN A;  4V2N A;  3D0Z A;  2NBS A;  2LQO A;  1TKD B;  5KN1 A;  2IMK A;  1UA5 A;  5IQY A;  3O3T A;  3BD2 A;  5IOW A;  2G2Q A;  3C71 A;  2QKE A;  6GSU A;  2H0G A;  4Z2U A;  1PX7 A;  1T4Y A;  1W4V A;  3VPQ A;  5A4V A;  3IR4 A;  5G30 A;  3FHK A;  4LLR A;  2OAC A;  5DJM A;  3GNJ A;  4OCF A;  1KNG A;  2M46 A;  1VF4 A;  5JCW A;  4MH2 A;  2ZNM A;  1WP0 A;  1BQ7 A;  4HQZ A;  1K0B A;  4K0N A;  4KCA A;  1EOH A;  1RQM A;  1RW1 A;  4IVF A;  2VLU A;  1T8E B;  3SBC A;  1XWK A;  5J5N A;  4GSN A;  1BYE A;  10GS A;  4NXI A;  4O5U A;  2J9H A;  2YWN A;  3ZMK A;  2FWF A;  3F63 A;  4JR4 A;  3TRQ A;  4GXZ A;  2HE3 A;  4YAP A;  1QFN A;  2YWO A;  2CAI A;  1FG4 A;  4AJ8 A;  1T4Z A;  3IXR A;  5G5E A;  8GSS A;  1PSQ A;  3BCK A;  5CRG A;  4YH2 A;  1ZZY A;  3P8W A;  4MF7 A;  2VUP A;  1M3J A;  2LUS A;  5KEJ A;  3FKF A;  4NMU A;  3VK9 A;  3TCO A;  3U6V A;  5LD0 A;  3GX8 A;  5KN3 A;  3KP9 A;  4LMW A;  3WT1 A;  4KB3 A;  3R3E A;  1GUK A;  1PL1 A;  2EC4 A;  3FK8 A;  2AUV A;  3KTL A;  3QAV A;  3GST A;  4ZB9 A;  3DXB A;  4F2I A;  4RQX A;  2GT5 A;  1OKT A;  1M2A A;  1ZMA A;  4GCI A;  3LGC A;  2N5B A;  1TRV A;  4TOP A;  5EL8 A;  1ILO A;  1T3B A;  14GS A;  1MDI A;  1A24 A;  3TJJ A;  5DJL A;  3KTB A;  3P2A A;  2OKA A;  1Z3E A;  1SL1 B;  1YEP A;  2PMT A;  4NWY A;  4JZQ A;  3QDN A;  4ZBA A;  4Z7X A;  1SK2 A;  4HU9 A;  1ERW A;  1SL0 B;  2V2G A;  4POK A;  4ECC A;  2V1M A;  1FO5 A;  2R37 A;  1M7T A;  2LJA A;  5G31 A;  1HNB A;  1MD4 A;  2M80 A;  1OC8 A;  4ML6 A;  3CTG A;  2HSH A;  2N5F A;  1AW9 A;  20GS A;  1HNA A;  2GVP A;  5D9X A;  3IPZ A;  1A8L A;  1A0F A;  2O89 A;  1THX A;  1OYJ A;  2OBI A;  5KN2 A;  3MAK A;  3CSH A;  3EU4 A;  3TKR A;  3H79 A;  1U88 A;  3LYK A;  5ID2 A;  2L6C A;  4EL1 A;  2IFQ B;  4YAV A;  1G6Y A;  2VCZ A;  1V57 A;  1O81 A;  3EIN A;  2HRF A;  1DBY A;  4JBB A;  5ELG A;  2E2G A;  3H4K A;  4EUY A;  4YQU A;  2R0P A;  4ML1 A;  2H6Z A;  4NPB A;  5ECL B;  3C73 A;  13GS A;  1K3Y A;  2L5L A;  3F8U A;  1TK5 B;  3MIX A;  2PUK C;  2E0Q A;  1VF3 A;  1YEX A;  2E7P A;  3UMA A;  3ZIJ A;  2LS5 A;  1DE2 A;  1C72 A;  5F8B A;  1EZK A;  1DE1 A;  2H74 A;  3LJR A;  4HS1 A;  3CTF A;  2H73 A;  2A4V A;  4ID0 A;  5G5F A;  2JAD A;  4Q5Q A;  5AIV A;  3IK7 A;  3M9J A;  22GS A;  1GSS A;  4OFT A;  3CBU A;  5FHI A;  16GS A;  2QA2 A;  3QR6 A;  3GH9 A;  3QD9 A;  3JCM L;  3QOU A;  4OO5 A;  2YZH A;  4DSS A;  2KOK A;  3IBH A;  5HQP A;  2FA4 A;  1EEM A;  2PBJ A;  2A4H A;  3HKR A;  6GSW A;  1B4P A;  1V2A A;  3LG6 A;  3J7Y b;  1PD2 1;  1YZX A;  1XPV A;  2CX4 A;  5C00 A;  2LTK A;  4G9H A;  2C3Q A;  1GTU A;  5DCH A;  3KMO A;  3KH7 A;  4BWQ A;  4QQ7 A;  1QK8 A;  3FR6 A;  3AY8 A;  3A2V A;  3W8S A;  3IV4 A;  4LL1 B;  2HFD A;  4HZ2 A;  1ZL9 A;  1AIU A;  1TOF A;  4MJB A;  2LJK A;  5G1L A;  3VWX A;  2LEG A;  4KA0 A;  18GS A;  1ON4 A;  2YJH A;  1FVJ A;  3DRN A;  2B6M A;  1Q98 A;  4NHW A;  3DKS A;  2JSY A;  3MNG A;  3HJP A;  1AXD A;  2WDU A;  5FWG A;  1JLW A;  1CQH A;  4JR6 A;  1K0M A;  3L9V A;  5HFG A;  4DVC A;  4MAB A;  3OR5 A;  5DAL B;  3D4T A;  3HDC A;  5IMV A;  2PVO C;  4TRX A;  2L4C A;  5KOW A;  3RHC A;  2XBQ A;  3IA1 A;  4WR4 A;  2G0F A;  1FW1 A;  1H75 A;  3K8N A;  1ZYE A;  2H6X A;  1K3O A;  1TW9 A;  5EY6 A;  3E0U A;  3A5W A;  3SWL A;  4KX4 A;  2VCT A;  2MMZ A;  3ME7 A;  3ZYW A;  2GQK A;  3IDV A;  2GQM A;  1UC7 A;  4TR1 B;  4MJC A;  5JWO B;  1A8Y A;  4TXO B;  2B1L A;  3GTU A;  3QFA C;  2H01 A;  1WPI A;  1Z6M A;  1SEN A;  2YZU A;  1I9D A;  5JCU A;  4ICY A;  2VL9 A;  3HJO A;  3C7M A;  2H0I A;  5J41 A;  3GRX A;  4KW6 A;  4EIQ A;  4ZIJ A;  3DYR A;  3PGT A;  1R7H A;  1S3A A;  1K3L A;  1R5P A;  3GUR A;  1A0R P;  5KN0 A;  1KBN A;  2TRX A;  2C0F A;  2PVQ A;  1SJI A;  3TRX A;  1A2L A;  1HNC A;  3F3R A;  1PQN A;  5IMA A;  3GL5 A;  4BVX B;  4EIP A;  2REM A;  5DQS A;  2L4Q A;  5F06 A;  4N0Z A;  3FYG A;  1XW6 A;  4IN0 A;  4YKG A;  2ALB A;  1MDK A;  1SK1 A;  3GX0 A;  1V40 A;  1AAZ A;  3QPM A;  3IE3 A;  1XWB A;  3CSJ A;  2GST A;  2VD1 A;  3DVX A;  3MSZ A;  4PUR A;  2N5A A;  5GZZ B;  1EEJ A;  2H72 A;  4K5S A;  1V9W A;  3HZ4 A;  2NVL A;  3E3E A;  2DKI A;  2YWI A;  4WF4 A;  1JZR A;  4KND A;  4FIW A;  2KUC A;  5J9C A;  5CO3 A;  2DBC A;  4GRF A;  1J0F A;  1TU7 A;  2DLX A;  3UL3 A;  1PKZ A;  3TKS C;  4HI7 A;  2B7K A;  4MF5 A;  1XWG A;  4F0B A;  2DSA A;  3PR8 A;  2A2P A;  5F07 A;  4LA1 A;  4WF5 A;  2R6K A;  2OA7 A;  1ZYQ B;  4PTS A;  2LRN A;  3TUE A;  5IPH A;  1V58 A;  1XW5 A;  1CQG A;  4L5L A;  4MPF A;  5KOX A;  4V1A g;  12GS A;  4K5R A;  4PNG A;  2GTU A;  3GHA A;  4PNF A;  3E9J B;  1FVK A;  2B7J A;  4K7O A;  4FYB A;  3TGZ A;  3GH6 A;  1F3B A;  2C8U A;  1GSD A;  1OVN A;  3FY7 A;  4RI6 A;  2V41 A;  5ELA A;  4MP4 A;  2OE0 A;  2GQL A;  2FHE A;  4Z2T A;  2HI7 A;  1Y6E A;  5ECR B;  1XCC A;  1YDK A;  3CSI A;  3DML A;  2K8S A;  1EOG A;  1PMT A;  2LRT A;  5D9T A;  3EMP A;  3WGX A;  4F9Z A;  1F3A A;  2GDR A;  4BL7 B;  3GFK A;  3KJY A;  1H4O A;  2V32 A;  3HZ8 A;  4L5O A;  2VL2 C;  4JU5 A;  3LW9 A;  4LMV A;  3R2Q A;  1JHB A;  1T7P B;  1NHO A;  4POL A;  4K1F A;  2HSM A;  3WGE A;  3PPU A;  5D9W A;  3TKS E;  2P5Q A;  2LJR A;  4G19 A;  3TJF A;  2YAN A;  1YJ6 A;  2M72 A;  2B5Y A;  1EP8 A;  3UAP A;  3I69 A;  5CRH A;  3UBL A;  2XBI A;  2EIQ A;  3UBK A;  2VM1 A;  3GYK A;  3ZRD A;  1GSQ A;  2I4A A;  2WJU A;  2VLV A;  3L9S A;  1QUW A;  2H6Y A;  1UN2 A;  4KCE A;  1F37 A;  4WR5 A;  3C8E A;  2JZR A;  1TJD A;  1BG5 A;  4USS A;  2X64 A;  4CHS A;  4MK3 A;  4DEJ A;  2VLT A;  3G7J A;  2DIZ A;  4IW9 A;  2BTO T;  3RBT A;  2FUG 2;  1FAA A;  1U6T A;  3C1R A;  4A5P A;  3HA9 A;  1NSW A;  2DJK A;  4NAX A;  3D6I A;  2R3X A;  3F4T A;  2YNX A;  3D21 A;  3APO A;  1PX6 A;  4POM A;  2HSY A;  1YQ1 A;  1Z9H A;  2FWE A;  2CVK A;  1SD8 A;  3IC4 A;  4BVY B;  5IPG A;  1M0U A;  5F0G A;  4ECJ A;  2X8C A;  3GKK A;  5IOX A;  4X43 A;  3VI7 A;  1SK0 A;  5AIS A;  4KE3 A;  3UAR A;  6GSS A;  1GWC A;  4K2D A;  2XC2 A;  4TN8 A;  2B3S A;  3IAM 2;  4OO4 A;  1LBK A;  2YV9 A;  1OE8 A;  3IK9 A;  4HSC X;  2IJY A;  5COH A;  4L0U A;  2WGR A;  4ZBB A;  3LOR A;  3N5O A;  5IO0 A;  1R26 A;  3GL3 A;  6GSX A;  4MCU A;  4IGJ A;  1XBS A;  4POB A;  2GZP A;  3D4M A;  1S3D A;  4BA7 A;  2OE3 A;  2O7K A;  5B8B A;  4KDY A;  2IME A;  4MZC A;  2AB6 A;  3L9U A;  3LEF A;  3M0F A;  5DVB A;  2JSZ A;  2WCI A;  4FQU A;  5HR1 A;  3F6F A;  2YPM A;  2FCH A;  2B5E A;  3KMN A;  1TP9 A;  3UOM A;  4XHM A;  2C80 A;  2AAW A;  2CX3 A;  3A5I A;  2FWH A;  2BMX A;  4GQC A;  4OFM A;  3ZVJ D;  4WEY A;  2RII A;  3G9B A;  4BPY A;  2WZ9 A;  4ULX A;  3S9F A;  3GSS A;  2OJL A;  4FYU A;  2CVD A;  2VCW A;  5CNW A;  2WUL A;  2DJ2 A;  2R2J A;  4WBJ A;  2NPB A;  3FR3 A;  3A3T A;  4MPG A;  3Q19 A;  3KD0 A;  1X5D A;  2H76 A;  4XTS A;  5GAP D;  3LYP A;  6GSV A;  3KP8 A;  1ML6 A;  3HCZ A;  3ZTL A;  2VCV A;  4MZB A;  4RI7 A;  1G6W A;  1F2E A;  1FHE A;  4IBP A;  3VFI A;  2IMI A;  3GMF A;  2FY6 A;  4I6X A;  5J9B A;  5INY A;  1F6M C;  9GSS A;  1FB6 A;  5CAX A;  1V98 A;  1M99 A;  4G2E A;  4PXO A;  2WRT A;  1DSB A;  2GLR A;  3EVI A;  1W89 A;  4K8M A;  3GKX A;  1JLV A;  4PUA A;  3H93 A;  2O8V B;  2C0E A;  4ZL8 A;  3NIV A;  5HR3 A;  3IRA A;  2AV4 A;  1F9M A;  1YY7 A;  1X9W B;  2MBS A;  3HJM A;  1ZCP A;  2XPD A;  5ID2 B;  3GN3 A;  2JU5 A;  2FD3 A;  1ZYN A;  1GSF A;  2GSR A;  2OE1 A;  2L57 A;  1PL2 A;  1SKW B;  3CRT A;  1O7U A;  4EF0 A;  3DVW A;  5DBQ A;  3H1N A;  4GLT A;  4TR3 A;  4XRD A;  2F8A A;  4XS4 A;  5ECI B;  2IL3 A;  4PGT A;  1Z7P A;  5H5Q A;  3TJG A;  3FZ9 A;  3P7X A;  3FW2 A;  3PIN A;  3RDW A;  2F8F A;  3KGK A;  1YKA A;  5DDL A;  1XFL A;  1WIK A;  3DGQ A;  3UIW A;  1SKS B;  5B7C A;  1G7O A;  4PX1 A;  5B6N A;  4X0X A;  1OC9 A;  2L6D A;  5ENU A;  1M9A A;  4KH7 A;  1TI3 A;  2HRN A;  1URM A;  1PFO A;  2EIR A;  3WT2 A;  2C0G A;  4OWY A;  2LKU A;  1BED A;  2X8G A;  5IM9 A;  3EE2 A;  2LST A;  3L78 A;  5B8A A;  1EV4 A;  2IWT A;  2C3T A;  2CA8 A;  3D5J A;  4ZIL A;  1AC1 A;  1ERT A;  3FRC A;  2MYG A;  2DJ1 A;  2PPT A;  5D96 A;  1TRS A;  4DSS B;  1BX9 A;  1LU4 A;  2A2R A;  2LRC A;  2OBK A;  5J3R A;  1SJ6 A;  3NZN A;  1UVZ A;  4N11 A;  4ZB6 A;  2DJ3 A;  2CZ3 A;  4KSO A;  5DAK B;  1VRS D;  1U87 A;  4IP1 A;  5EVO A;  2F51 A;  4TXO A;  4PQI A;  4HU7 A;  5D9V A;  1U3I A;  3J7Y k;  1XOA A;  3FR9 A;  4D73 B;  1A23 A;  4L0W A;  1TTZ A;  1MEK A;  5BMU A;  4ZL7 A;  2VOC A;  2KP1 A;  4DSR A;  1S3R A;  4G0L A;  2VL2 A;  3BOA A;  3KZQ A;  5ABR A;  4IKH A;  4E8H A;  3UVH A;  4MF6 A;  1ZYP A;  2VCQ A;  3GKM A;  4BVX A;  17GS A;  4PQ1 A;  1EV9 A;  1VGL A;  1Z6N A;  4MNN A;  5FT3 A;  1MDJ A;  2KP2 A;  1NHY A;  1XVQ A;  5G1K A;  1BAY A;  1IYH A;  3US3 A;  19GS A;  1K0N A;  3G7I A;  2TIR A;  4GST A;  2V6O A;  1XZO A;  1ERU A;  3GIX A;  2FNO A;  3PH9 A;  4ILF A;  3BCI A;  3IC8 A;  5E59 A;  11GS A;  3ERF A;  2NDO A;  4RQR A;  1TRW A;  4HQS A;  2VCX A;  4EXJ A;  3F0I A;  3TOT A;  5HR0 A;  3N9J A;  5G2Z A;  2L59 A;  3GTU B;  3I6A A;  2P5R A;  2HNL A;  3M8N A;  3QAG A;  2CQ9 A;  2D2Z A;  4KSM A;  1THO A;  1XW9 A;  2H70 A;  3F4S A;  5D93 A;  1HYU A;  1XG8 A;  3KIJ A;  1ERV A;  1QQ2 A;  2DIY A;  3ERW A;  2RLI A;  1BJX A;  3DEX A;  1TI1 A;  2JZS A;  5IMC A;  5IIZ A;  3UJ1 A;  5IMF A;  3W6G A;  1Z5Y E;  2IMF A;  2RUE A;  4TR0 A;  4Q5R A;  5ECP B;  2PGT A;  3ZLP A;  1GTA A;  2OAD A;  2HZE A;  2RUF A;  1YF0 A;  4IJ3 A;  4QL7 A;  5H5S A;  5CRD A;  4K0G A;  1KTE A;  3ED3 A;  2R5G A;  3ZL5 A;  4BL7 A;  4IQ1 A;  3RPP A;  1PA3 A;  1PRX A;  3U5R E;  1A2M A;  3HVV A;  2B1K A;  1B48 A;  4EDY A;  3HXS A;  2L5O A;  1ZGN A;  3UEM A;  2H0H A;  4G0I A;  4HDE A;  5GST A;  5AGY A;  5D73 A;  1GNW A;  4J2F A;  2YV7 A;  4H86 A;  1N2A A;  4F82 A;  2AYT A;  4AGS A;  2VL3 A;  2CZ2 A;  4JE1 A;  4KUN A;  3GA4 A;  1OAZ A;  2YCD A;  4XS6 A;  3FEU A;  4CY8 A;  2Z9S A;  3EC3 A;  5E4W A;  2PN8 A;  2QA1 A;  3EWL A;  5LCZ A;  1GSE A;  4FH8 A;  4HZ4 A;  4I5Q A;  1S3C A;  4E8E A;  3H8Q A;  3VPT A;  2EIO A;  2WS2 A;  3HVS A;  4I2U A;  3LFL A;  5A4U A;  2CVB A;  1YKC A;  2LQQ A;  2R4V A;  2DML A;  4XS1 A;  2MBT A;  1GP1 A;  4N30 A;  1SD9 A;  4IEL A;  5HFK A;  3IHQ A;  2GS3 A;  5ECQ B;  5CRE A;  4DSQ A;  5ECS A;  1M2D A;  3HYP A;  3IHG A;  1Q4J A;  3BBY A;  4JRR A;  4GWR A;  3TOU A;  3VUR A;  3TJB A;  4TR4 A;  4MLY A;  2LNT A;  3QCP A;  2WFC A;  1PGT A;  3APS A;  1GSY A;  4IQA A;  1GUM A;  2RM5 A;  5ECM B;  3HVX A;  1RK4 A;  4BVY A;  4NHZ A;  1XVW A;  3ZIT A;  1TK0 B;  2FWG A;  4WBR D;  1PN9 A;  3F9U A;  4EDZ A;  1EGO A;  2ZUP A;  3A2X A;  2VD0 A;  2VAF A;  2LV3 A;  1X9M B;  2H75 A;  1FOV A;  4AF2 A;  4O32 A;  1GLQ A;  2YN1 A;  1GSU A;  5DQY A;  1AUC A;  4ZL9 A;  1GUL A;  1PN0 A;  4KAE A;  3IOS A;  3P90 A;  1MD3 A;  2AJQ B;  1IYI A;  4WKW A;  3O76 A;  4HEA 2;  3Q74 A;  4X1U A;  3DD3 A;  3RHB A;  2QC7 A;  4I2T A;  4PQH A;  1TDI A;  4K9Z A;  2XPE A;  2DJ0 A;  2YWM A;  2C0D A;  3Q18 A;  4Q5N A;  5F05 A;  4XIH A;  2YP6 A;  2H1B A;  2GT6 A;  3V1W A;  1XWA A;  2LNS A;  4YKF A;  4WET A;  2HLS A;  4KF9 A;  4G10 A;  1O73 A;  3QFB C;  4YQM A;  4ECI A;  3KM6 A;  1NM3 A;  5AIX A;  2KLX A;  1GLP A;  2DJJ A;  3HVN A;  1ST9 A;  1R5A A;  1WRY A;  3F6D A;  1ZOF A;  4MJA A;  2I81 A;  1X5C A;  5ECN B;  5ECO B;  4ECB A;  3KEB A;  2VIM A;  5GAN D;  3LWA A;  2H19 A;  1JZO A;  2IFQ A;  1K0O A;  1XWC A;  2HXK A;  4K6X A;  1SL2 B;  1VF1 A;  3RAZ A;  1TRU A;  4K7I A;  4GTU A;  1XIY A;  2P31 A;  2X99 A;  5CRW A;  4EE0 A;  3APQ A;  4O5R A;  4HJM A;  4MJE A;  2K6V A;  2XHF A;  1O8X A;  3CXG A;  2A2S A;  2P0G A;  5LNK e;  1TU8 A;  2H30 A;  1GUH A;  3VWV A;  1I5G A;  2NTO A;  4J56 E;  4TVE A;  3ZVJ A;  3EUR A;  4MZW A;  2GSQ A;  1ABA A;  3QMX A;  5B6M A;  4K7N A;  2C4J A;  4EVM A;  1OE7 A;  1AQX A;  3ERG A;  5A4W A;  4CW9 A;  1ACV A;  3VLN A;  5D8I A;  4MA9 A;  3M1G A;  4IJI A;  2I9H A;  3EU3 A;  4P3Y B;  4KGI A;  1OKD A;  2HZF A;  3ISO A;  2MMO A;  2IIY A;  3CMI A;  3F3Q A;  6GSY A;  4O92 A;  3O6T A;  3LQ7 A;  3VWU A;  4ACS A;  4TKY A;  2UZ8 A;  3TKP A;  4O7H A;  3FZ5 A;  3VWW A; 
#chains in the Genus database with same CATH homology
 2H1A A;  4KDX A;  1T00 A;  1G7E A;  4J57 E;  4IS0 A;  3CYN A;  5A5K A;  1WOU A;  3TRP A;  3WYW A;  1GL8 A;  4RUV A;  4PUF C;  3L0H A;  2GSS A;  3I43 A;  4EKZ A;  3ZIV A;  5JCG A;  1GH2 A;  4NV5 A;  2HYX A;  1GNE A;  2ON7 A;  1X9S B;  2ES7 A;  2PU9 C;  2PWJ A;  3ZFB A;  2RM6 A;  1YF1 A;  4V2L A;  1KEB A;  5HFI A;  2DC5 A;  2H8L A;  3C1S A;  4XCS A;  2DKH A;  1AQV A;  3L4N A;  3MDK A;  3TDG A;  1GTB A;  2H66 A;  2JZT A;  2ZCT A;  1WWJ A;  5BRT A;  4KDU A;  2R0C A;  2CT6 A;  4CDO A;  4NV2 A;  3IAS 2;  3MWH A;  4GSS A;  1HQO A;  3HY2 A;  4LL4 B;  1GRX A;  5DAK A;  3TKS A;  4EC0 A;  5C04 A;  1JFU A;  2J23 A;  2JAC A;  5DAL A;  2HRK A;  4XS4 B;  1FB0 A;  5AN1 A;  2JL4 A;  2O85 A;  2VM2 A;  1OC3 A;  3KH9 A;  2X4A A;  2X49 A;  4XRA A;  3D22 A;  2GZZ A;  2FA8 A;  3EMX A;  3EYT A;  4AJ6 A;  1X0R A;  5ECH B;  3GV1 A;  1DUG A;  1O85 A;  1Y25 A;  1JZW A;  1G0T A;  4OMV A;  3FZ4 A;  4D73 A;  1B9Y C;  5DCG A;  5HR2 A;  2H1G A;  2HT9 A;  4Q5F A;  1QGV A;  2H71 A;  5H5R A;  1R4W A;  2MMN A;  4TR1 A;  1OC9 B;  2IMD A;  4IHU A;  1T1V A;  1WJK A;  1SYX A;  4N0V A;  3A2W A;  2GZY A;  1B9X C;  3MYD A;  4K2X A;  3TJK A;  1PKW A;  4ZXG A;  1NW2 A;  4F03 A;  2I1U A;  2H1D A;  4TXV A;  4G0K A;  6GST A;  1XXU A;  1AQW A;  1JZD A;  4WXT A;  1EGR A;  3FZA A;  4V1A p;  2F3M A;  2K9F A;  4I8B A;  2AHE A;  1E2Y A;  3LXT A;  3BJ5 A;  2MMA A;  4MH3 A;  2DMM A;  1TK8 B;  4ISD A;  3KXO A;  1K0A A;  4GF0 A;  2CV4 A;  1XOB A;  1X5E A;  2O87 A;  3Q6O A;  3LXZ A;  2F9S A;  3QAW A;  1A2J A;  2K8V A;  4YQV A;  1M9B A;  4HOJ A;  1SKR B;  3VI5 A;  3NOF A;  4FYC A;  1QMV A;  3ZFL A;  3UVT A;  2C3N A;  3DWV A;  1U3A A;  5J4U A;  1FOH A;  4FO5 A;  4GQF A;  2X8H A;  2GGT A;  5IO2 A;  4X4J A;  2I3Y A;  2WB9 A;  1K0D A;  4OFN A;  1SU9 A;  1E6B A;  4IP6 A;  2QGV A;  4N10 A;  1MTC A;  2HRA A;  2YJ7 A;  4Z2R A;  1USB A;  3W8J A;  1B8X A;  3ZZX A;  2ON5 A;  4V2M A;  2C1Y A;  4TW5 A;  4JED A;  4OCE A;  2YOI A;  4HJ2 A;  4HUA A;  5GSS A;  2QSI A;  4BWS A;  2E2M A;  2IPA A;  2CAQ A;  3I9V 2;  5CP1 A;  1J08 A;  3LSZ A;  4MDC A;  1SYR A;  3GKN A;  1QXH A;  3EPT A;  2IN3 A;  3ME8 A;  5L71 A;  2V6K A;  3GUS A;  2MZC A;  1Z7R A;  3HHV A;  3G7Y A;  3WGD A;  5EPF A;  4L8E A;  3HD5 A;  4ZB8 A;  1GTI A;  1HD2 A;  1O8W A;  3WD6 A;  1WE0 A;  5JWQ B;  1EWX A;  4QL9 A;  3TKQ A;  2BJX A;  4AJ7 A;  1O6J A;  5IMD A;  4OD7 A;  1EP7 A;  1WMJ A;  2K18 A;  4O5Q A;  1K0C A;  4MMM A;  2PER A;  2FLS A;  2B5X A;  3TB2 A;  3ZRE A;  3CRU A;  2VO4 A;  3M9K A;  2KHP A;  1J9B A;  3F4R A;  2TRC P;  3FMW A;  3ZML A;  2HZE B;  7GSS A;  5ECK B;  4I97 A;  1N8J A;  4EO3 A;  3M3M A;  4CY6 A;  5IMZ A;  5JWR B;  1VF2 A;  5CYY A;  4F0C A;  2FGX A;  3DIE A;  1B4Q A;  1M2B A;  1LJR A;  3KCM A;  4ZBD A;  1SJZ A;  2R0G A;  1TXX A;  3RPN A;  4V2N A;  3D0Z A;  2NBS A;  2LQO A;  1TKD B;  5KN1 A;  2IMK A;  1UA5 A;  5IQY A;  3O3T A;  3BD2 A;  5IOW A;  2G2Q A;  3C71 A;  2QKE A;  6GSU A;  2H0G A;  4Z2U A;  1PX7 A;  1T4Y A;  1W4V A;  3VPQ A;  5A4V A;  3IR4 A;  5G30 A;  3FHK A;  4LLR A;  2OAC A;  5DJM A;  3GNJ A;  4OCF A;  1KNG A;  2M46 A;  1VF4 A;  5JCW A;  4MH2 A;  2ZNM A;  1WP0 A;  1BQ7 A;  4HQZ A;  1K0B A;  4K0N A;  4KCA A;  1EOH A;  1RQM A;  1RW1 A;  4IVF A;  2VLU A;  1T8E B;  3SBC A;  1XWK A;  5J5N A;  4GSN A;  1BYE A;  10GS A;  4NXI A;  4O5U A;  2J9H A;  2YWN A;  3ZMK A;  2FWF A;  3F63 A;  4JR4 A;  3TRQ A;  4GXZ A;  2HE3 A;  4YAP A;  1QFN A;  2YWO A;  2CAI A;  1FG4 A;  4AJ8 A;  1T4Z A;  3IXR A;  5G5E A;  8GSS A;  1PSQ A;  3BCK A;  5CRG A;  4YH2 A;  1ZZY A;  3P8W A;  4MF7 A;  2VUP A;  2LUS A;  5KEJ A;  3FKF A;  4NMU A;  3VK9 A;  3TCO A;  3U6V A;  5LD0 A;  3GX8 A;  5KN3 A;  3KP9 A;  4LMW A;  3WT1 A;  4KB3 A;  3R3E A;  1GUK A;  1PL1 A;  2EC4 A;  3FK8 A;  2AUV A;  3KTL A;  3QAV A;  3GST A;  4ZB9 A;  3DXB A;  4F2I A;  4RQX A;  2GT5 A;  1OKT A;  1M2A A;  1ZMA A;  4GCI A;  3LGC A;  2N5B A;  1TRV A;  4TOP A;  5EL8 A;  1ILO A;  1T3B A;  14GS A;  1MDI A;  1A24 A;  3TJJ A;  5DJL A;  3KTB A;  3P2A A;  2OKA A;  1Z3E A;  1SL1 B;  1YEP A;  2PMT A;  4NWY A;  4JZQ A;  3QDN A;  4ZBA A;  4Z7X A;  1SK2 A;  4HU9 A;  1ERW A;  1SL0 B;  2V2G A;  4POK A;  4ECC A;  2V1M A;  1FO5 A;  2R37 A;  1M7T A;  2LJA A;  5G31 A;  1HNB A;  1MD4 A;  2M80 A;  1OC8 A;  4ML6 A;  3CTG A;  2HSH A;  2N5F A;  1AW9 A;  20GS A;  1HNA A;  2GVP A;  5D9X A;  3IPZ A;  1A8L A;  1A0F A;  2O89 A;  1THX A;  1OYJ A;  2OBI A;  5KN2 A;  3MAK A;  3CSH A;  3EU4 A;  3TKR A;  3H79 A;  1U88 A;  3LYK A;  5ID2 A;  2L6C A;  4EL1 A;  2IFQ B;  4YAV A;  1G6Y A;  2VCZ A;  1V57 A;  1O81 A;  3EIN A;  2HRF A;  1DBY A;  4JBB A;  5ELG A;  2E2G A;  3H4K A;  4EUY A;  4YQU A;  2R0P A;  4ML1 A;  2H6Z A;  4NPB A;  5ECL B;  3C73 A;  13GS A;  1K3Y A;  2L5L A;  3F8U A;  1TK5 B;  3MIX A;  2PUK C;  2E0Q A;  1VF3 A;  1YEX A;  2E7P A;  3UMA A;  3ZIJ A;  2LS5 A;  1DE2 A;  1C72 A;  5F8B A;  1EZK A;  1DE1 A;  2H74 A;  3LJR A;  4HS1 A;  3CTF A;  2H73 A;  2A4V A;  4ID0 A;  5G5F A;  2JAD A;  4Q5Q A;  5AIV A;  3IK7 A;  3M9J A;  22GS A;  1GSS A;  4OFT A;  3CBU A;  5FHI A;  16GS A;  2QA2 A;  3QR6 A;  3GH9 A;  3QD9 A;  3JCM L;  3QOU A;  4OO5 A;  2YZH A;  4DSS A;  2KOK A;  3IBH A;  5HQP A;  2FA4 A;  1EEM A;  2PBJ A;  2A4H A;  3HKR A;  6GSW A;  1B4P A;  1V2A A;  3LG6 A;  3J7Y b;  1PD2 1;  1YZX A;  1XPV A;  2CX4 A;  5C00 A;  2LTK A;  4G9H A;  2C3Q A;  1GTU A;  5DCH A;  3KMO A;  3KH7 A;  4BWQ A;  4QQ7 A;  1QK8 A;  3FR6 A;  3AY8 A;  3A2V A;  3W8S A;  3IV4 A;  4LL1 B;  2HFD A;  4HZ2 A;  1ZL9 A;  1AIU A;  1TOF A;  4MJB A;  2LJK A;  5G1L A;  3VWX A;  2LEG A;  4KA0 A;  18GS A;  1ON4 A;  2YJH A;  1FVJ A;  3DRN A;  2B6M A;  1Q98 A;  4NHW A;  3DKS A;  2JSY A;  3MNG A;  3HJP A;  1AXD A;  2WDU A;  5FWG A;  1JLW A;  1CQH A;  4JR6 A;  1K0M A;  3L9V A;  5HFG A;  4DVC A;  4MAB A;  3OR5 A;  5DAL B;  3D4T A;  3HDC A;  5IMV A;  2PVO C;  4TRX A;  2L4C A;  5KOW A;  3RHC A;  2XBQ A;  3IA1 A;  4WR4 A;  2G0F A;  1FW1 A;  1H75 A;  3K8N A;  1ZYE A;  2H6X A;  1K3O A;  1TW9 A;  5EY6 A;  3E0U A;  3A5W A;  3SWL A;  4KX4 A;  2VCT A;  2MMZ A;  3ME7 A;  3ZYW A;  2GQK A;  3IDV A;  2GQM A;  1UC7 A;  4TR1 B;  4MJC A;  5JWO B;  1A8Y A;  4TXO B;  2B1L A;  3GTU A;  3QFA C;  2H01 A;  1WPI A;  1Z6M A;  1SEN A;  2YZU A;  1I9D A;  5JCU A;  4ICY A;  2VL9 A;  3HJO A;  3C7M A;  2H0I A;  5J41 A;  3GRX A;  4KW6 A;  4EIQ A;  4ZIJ A;  3DYR A;  3PGT A;  1R7H A;  1S3A A;  1K3L A;  1R5P A;  3GUR A;  1A0R P;  5KN0 A;  1KBN A;  2TRX A;  2C0F A;  2PVQ A;  1SJI A;  3TRX A;  1A2L A;  1HNC A;  3F3R A;  1PQN A;  5IMA A;  3GL5 A;  4BVX B;  4EIP A;  2REM A;  5DQS A;  2L4Q A;  5F06 A;  4N0Z A;  3FYG A;  1XW6 A;  4IN0 A;  4YKG A;  2ALB A;  1MDK A;  1SK1 A;  3GX0 A;  1V40 A;  1AAZ A;  3QPM A;  3IE3 A;  1XWB A;  3CSJ A;  2GST A;  2VD1 A;  3DVX A;  3MSZ A;  4PUR A;  2N5A A;  5GZZ B;  1EEJ A;  2H72 A;  4K5S A;  1V9W A;  3HZ4 A;  2NVL A;  3E3E A;  2DKI A;  2YWI A;  4WF4 A;  1JZR A;  4KND A;  4FIW A;  2KUC A;  5J9C A;  5CO3 A;  2DBC A;  4GRF A;  1J0F A;  1TU7 A;  2DLX A;  3UL3 A;  1PKZ A;  3TKS C;  4HI7 A;  2B7K A;  4MF5 A;  1XWG A;  4F0B A;  2DSA A;  3PR8 A;  2A2P A;  5F07 A;  4LA1 A;  4WF5 A;  2R6K A;  2OA7 A;  1ZYQ B;  4PTS A;  2LRN A;  3TUE A;  5IPH A;  1V58 A;  1XW5 A;  1CQG A;  4L5L A;  4MPF A;  5KOX A;  4V1A g;  12GS A;  4K5R A;  4PNG A;  2GTU A;  3GHA A;  4PNF A;  3E9J B;  1FVK A;  2B7J A;  4K7O A;  4FYB A;  3TGZ A;  3GH6 A;  1F3B A;  2C8U A;  1GSD A;  1OVN A;  3FY7 A;  4RI6 A;  2V41 A;  5ELA A;  4MP4 A;  2OE0 A;  2GQL A;  2FHE A;  4Z2T A;  2HI7 A;  1Y6E A;  5ECR B;  1XCC A;  1YDK A;  3CSI A;  3DML A;  2K8S A;  1EOG A;  1PMT A;  2LRT A;  5D9T A;  3EMP A;  3WGX A;  4F9Z A;  1F3A A;  2GDR A;  4BL7 B;  3GFK A;  3KJY A;  1H4O A;  2V32 A;  3HZ8 A;  4L5O A;  2VL2 C;  4JU5 A;  3LW9 A;  4LMV A;  3R2Q A;  1JHB A;  1T7P B;  1NHO A;  4POL A;  4K1F A;  2HSM A;  3WGE A;  3PPU A;  5D9W A;  3TKS E;  2P5Q A;  2LJR A;  4G19 A;  3TJF A;  2YAN A;  1YJ6 A;  2M72 A;  2B5Y A;  1EP8 A;  3UAP A;  3I69 A;  5CRH A;  3UBL A;  2XBI A;  2EIQ A;  3UBK A;  2VM1 A;  3GYK A;  3ZRD A;  1GSQ A;  2I4A A;  2WJU A;  2VLV A;  3L9S A;  1QUW A;  2H6Y A;  1UN2 A;  4KCE A;  1F37 A;  4WR5 A;  3C8E A;  2JZR A;  1TJD A;  1BG5 A;  4USS A;  2X64 A;  4CHS A;  4MK3 A;  4DEJ A;  2VLT A;  3G7J A;  2DIZ A;  4IW9 A;  2BTO T;  3RBT A;  2FUG 2;  1FAA A;  1U6T A;  3C1R A;  4A5P A;  3HA9 A;  1NSW A;  2DJK A;  4NAX A;  3D6I A;  2R3X A;  3F4T A;  2YNX A;  3D21 A;  3APO A;  1PX6 A;  4POM A;  2HSY A;  1YQ1 A;  1Z9H A;  2FWE A;  2CVK A;  1SD8 A;  3IC4 A;  4BVY B;  5IPG A;  1M0U A;  5F0G A;  4ECJ A;  2X8C A;  3GKK A;  5IOX A;  4X43 A;  3VI7 A;  1SK0 A;  5AIS A;  4KE3 A;  3UAR A;  6GSS A;  1GWC A;  4K2D A;  2XC2 A;  4TN8 A;  2B3S A;  3IAM 2;  4OO4 A;  1LBK A;  2YV9 A;  1OE8 A;  3IK9 A;  2IJY A;  5COH A;  4L0U A;  2WGR A;  4ZBB A;  3LOR A;  3N5O A;  5IO0 A;  1R26 A;  3GL3 A;  6GSX A;  4MCU A;  4IGJ A;  1XBS A;  4POB A;  2GZP A;  3D4M A;  1S3D A;  4BA7 A;  2OE3 A;  2O7K A;  5B8B A;  4KDY A;  2IME A;  4MZC A;  2AB6 A;  3L9U A;  3LEF A;  3M0F A;  5DVB A;  2JSZ A;  2WCI A;  4FQU A;  5HR1 A;  3F6F A;  2YPM A;  2FCH A;  2B5E A;  3KMN A;  1TP9 A;  3UOM A;  4XHM A;  2C80 A;  2AAW A;  2CX3 A;  3A5I A;  2FWH A;  2BMX A;  4GQC A;  4OFM A;  3ZVJ D;  4WEY A;  2RII A;  3G9B A;  4BPY A;  2WZ9 A;  4ULX A;  3S9F A;  3GSS A;  2OJL A;  4FYU A;  2CVD A;  2VCW A;  5CNW A;  2WUL A;  2DJ2 A;  2R2J A;  4WBJ A;  2NPB A;  3FR3 A;  3A3T A;  4MPG A;  3Q19 A;  3KD0 A;  1X5D A;  2H76 A;  4XTS A;  5GAP D;  3LYP A;  6GSV A;  3KP8 A;  1ML6 A;  3HCZ A;  3ZTL A;  2VCV A;  4MZB A;  4RI7 A;  1G6W A;  1F2E A;  1FHE A;  4IBP A;  3VFI A;  2IMI A;  3GMF A;  2FY6 A;  4I6X A;  5J9B A;  5INY A;  1F6M C;  9GSS A;  1FB6 A;  5CAX A;  1V98 A;  1M99 A;  4G2E A;  4PXO A;  2WRT A;  1DSB A;  2GLR A;  3EVI A;  1W89 A;  4K8M A;  3GKX A;  1JLV A;  4PUA A;  3H93 A;  2O8V B;  2C0E A;  4ZL8 A;  3NIV A;  5HR3 A;  3IRA A;  2AV4 A;  1F9M A;  1YY7 A;  1X9W B;  2MBS A;  3HJM A;  1ZCP A;  2XPD A;  5ID2 B;  3GN3 A;  2JU5 A;  2FD3 A;  1ZYN A;  1GSF A;  2GSR A;  2OE1 A;  2L57 A;  1PL2 A;  1SKW B;  3CRT A;  1O7U A;  4EF0 A;  3DVW A;  5DBQ A;  3H1N A;  4GLT A;  4TR3 A;  4XRD A;  2F8A A;  4XS4 A;  5ECI B;  2IL3 A;  4PGT A;  1Z7P A;  5H5Q A;  3TJG A;  3FZ9 A;  3P7X A;  3FW2 A;  3PIN A;  3RDW A;  2F8F A;  3KGK A;  1YKA A;  5DDL A;  1XFL A;  1WIK A;  3DGQ A;  3UIW A;  1SKS B;  5B7C A;  1G7O A;  4PX1 A;  5B6N A;  4X0X A;  1OC9 A;  2L6D A;  5ENU A;  1M9A A;  4KH7 A;  1TI3 A;  2HRN A;  1URM A;  2EIR A;  3WT2 A;  2C0G A;  4OWY A;  2LKU A;  1BED A;  2X8G A;  5IM9 A;  3EE2 A;  2LST A;  3L78 A;  5B8A A;  1EV4 A;  2IWT A;  2C3T A;  2CA8 A;  3D5J A;  4ZIL A;  1AC1 A;  1ERT A;  3FRC A;  2MYG A;  2DJ1 A;  2PPT A;  5D96 A;  1TRS A;  4DSS B;  1BX9 A;  1LU4 A;  2A2R A;  2LRC A;  2OBK A;  5J3R A;  1SJ6 A;  3NZN A;  1UVZ A;  4N11 A;  4ZB6 A;  2DJ3 A;  2CZ3 A;  4KSO A;  5DAK B;  1VRS D;  1U87 A;  4IP1 A;  5EVO A;  2F51 A;  4TXO A;  4PQI A;  4HU7 A;  5D9V A;  1U3I A;  3J7Y k;  1XOA A;  3FR9 A;  4D73 B;  1A23 A;  4L0W A;  1TTZ A;  1MEK A;  5BMU A;  4ZL7 A;  2VOC A;  2KP1 A;  4DSR A;  4G0L A;  2VL2 A;  3BOA A;  3KZQ A;  5ABR A;  4IKH A;  4E8H A;  3UVH A;  4MF6 A;  1ZYP A;  2VCQ A;  3GKM A;  4BVX A;  17GS A;  4PQ1 A;  1EV9 A;  1VGL A;  1Z6N A;  4MNN A;  5FT3 A;  1MDJ A;  2KP2 A;  1NHY A;  1XVQ A;  5G1K A;  1BAY A;  1IYH A;  3US3 A;  19GS A;  1K0N A;  3G7I A;  2TIR A;  4GST A;  2V6O A;  1XZO A;  1ERU A;  3GIX A;  2FNO A;  3PH9 A;  4ILF A;  3BCI A;  3IC8 A;  5E59 A;  11GS A;  3ERF A;  2NDO A;  4RQR A;  1TRW A;  4HQS A;  2VCX A;  4EXJ A;  3F0I A;  3TOT A;  5HR0 A;  3N9J A;  5G2Z A;  2L59 A;  3GTU B;  3I6A A;  2P5R A;  2HNL A;  3M8N A;  3QAG A;  2CQ9 A;  2D2Z A;  4KSM A;  1THO A;  1XW9 A;  2H70 A;  3F4S A;  5D93 A;  1HYU A;  3KIJ A;  1ERV A;  1QQ2 A;  2DIY A;  3ERW A;  2RLI A;  1BJX A;  3DEX A;  1TI1 A;  2JZS A;  5IMC A;  5IIZ A;  3UJ1 A;  5IMF A;  3W6G A;  1Z5Y E;  2IMF A;  2RUE A;  4TR0 A;  4Q5R A;  5ECP B;  2PGT A;  3ZLP A;  1GTA A;  2OAD A;  2HZE A;  2RUF A;  1YF0 A;  4IJ3 A;  4QL7 A;  5H5S A;  5CRD A;  4K0G A;  1KTE A;  3ED3 A;  2R5G A;  3ZL5 A;  4BL7 A;  4IQ1 A;  3RPP A;  1PA3 A;  1PRX A;  3U5R E;  1A2M A;  3HVV A;  2B1K A;  1B48 A;  4EDY A;  3HXS A;  2L5O A;  1ZGN A;  3UEM A;  2H0H A;  4G0I A;  4HDE A;  5GST A;  5AGY A;  5D73 A;  1GNW A;  4J2F A;  2YV7 A;  4H86 A;  1N2A A;  4F82 A;  2AYT A;  4AGS A;  2VL3 A;  2CZ2 A;  4JE1 A;  4KUN A;  3GA4 A;  1OAZ A;  2YCD A;  4XS6 A;  3FEU A;  4CY8 A;  2Z9S A;  3EC3 A;  5E4W A;  2PN8 A;  2QA1 A;  3EWL A;  5LCZ A;  1GSE A;  4FH8 A;  4HZ4 A;  4I5Q A;  1S3C A;  4E8E A;  3H8Q A;  3VPT A;  2EIO A;  2WS2 A;  3HVS A;  4I2U A;  3LFL A;  5A4U A;  2CVB A;  1YKC A;  2LQQ A;  2R4V A;  2DML A;  4XS1 A;  2MBT A;  1GP1 A;  4N30 A;  1SD9 A;  4IEL A;  5HFK A;  3IHQ A;  2GS3 A;  5ECQ B;  5CRE A;  4DSQ A;  5ECS A;  1M2D A;  3HYP A;  3IHG A;  1Q4J A;  3BBY A;  4JRR A;  4GWR A;  3TOU A;  3VUR A;  3TJB A;  4TR4 A;  4MLY A;  2LNT A;  3QCP A;  2WFC A;  1PGT A;  3APS A;  1GSY A;  4IQA A;  1GUM A;  2RM5 A;  5ECM B;  3HVX A;  1RK4 A;  4BVY A;  4NHZ A;  1XVW A;  3ZIT A;  1TK0 B;  2FWG A;  4WBR D;  1PN9 A;  3F9U A;  4EDZ A;  1EGO A;  2ZUP A;  3A2X A;  2VD0 A;  2VAF A;  2LV3 A;  1X9M B;  2H75 A;  1FOV A;  4AF2 A;  4O32 A;  1GLQ A;  2YN1 A;  1GSU A;  5DQY A;  1AUC A;  4ZL9 A;  1GUL A;  1PN0 A;  4KAE A;  3IOS A;  3P90 A;  1MD3 A;  2AJQ B;  1IYI A;  4WKW A;  3O76 A;  4HEA 2;  3Q74 A;  4X1U A;  3DD3 A;  3RHB A;  2QC7 A;  4I2T A;  4PQH A;  1TDI A;  4K9Z A;  2XPE A;  2DJ0 A;  2YWM A;  2C0D A;  3Q18 A;  4Q5N A;  5F05 A;  4XIH A;  2YP6 A;  2H1B A;  2GT6 A;  3V1W A;  1XWA A;  2LNS A;  4YKF A;  4WET A;  2HLS A;  4KF9 A;  4G10 A;  1O73 A;  3QFB C;  4YQM A;  4ECI A;  3KM6 A;  1NM3 A;  5AIX A;  2KLX A;  1GLP A;  2DJJ A;  1ST9 A;  1R5A A;  1WRY A;  3F6D A;  1ZOF A;  4MJA A;  2I81 A;  1X5C A;  5ECN B;  5ECO B;  4ECB A;  3KEB A;  2VIM A;  5GAN D;  3LWA A;  2H19 A;  1JZO A;  2IFQ A;  1K0O A;  1XWC A;  2HXK A;  4K6X A;  1SL2 B;  1VF1 A;  3RAZ A;  1TRU A;  4K7I A;  4GTU A;  1XIY A;  2P31 A;  2X99 A;  5CRW A;  4EE0 A;  3APQ A;  4O5R A;  4HJM A;  4MJE A;  2K6V A;  2XHF A;  1O8X A;  3CXG A;  2A2S A;  2P0G A;  5LNK e;  1TU8 A;  2H30 A;  1GUH A;  3VWV A;  1I5G A;  2NTO A;  4J56 E;  4TVE A;  3ZVJ A;  3EUR A;  4MZW A;  2GSQ A;  1ABA A;  3QMX A;  5B6M A;  4K7N A;  2C4J A;  4EVM A;  1OE7 A;  1AQX A;  3ERG A;  5A4W A;  4CW9 A;  1ACV A;  3VLN A;  5D8I A;  4MA9 A;  3M1G A;  4IJI A;  2I9H A;  3EU3 A;  4P3Y B;  4KGI A;  1OKD A;  2HZF A;  3ISO A;  2MMO A;  2IIY A;  3CMI A;  3F3Q A;  6GSY A;  4O92 A;  3O6T A;  3LQ7 A;  3VWU A;  4ACS A;  4TKY A;  2UZ8 A;  3TKP A;  4O7H A;  3FZ5 A;  3VWW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...