3HHVA

The crystal structure of the thioredoxin a2 from sulfolobus solfataricus
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
103
structure length
103
Chain Sequence
PVKHLNSKNFDEFITKNKIVVVDFWAEWCAPCLILAPVIEELANDYPQVAFGKLNTEESQDIAMRYGIMSLPTIMFFKNGELVDQILGAVPREEIEVRLKSLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thioredoxin (TrxA-2)
publication title The dimeric structure of Sulfolobus solfataricus thioredoxin A2 and the basis of its thermostability
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Oxidoreductase
total genus 29
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2009-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3hhvA00
3L9UA 4KUNA 4KB3A 2KLXA 2H66A 4AJ6A 2V41A 2V2GA 2DSAA 2HZEA 3MNGA 3EMXA 2V6KA 3JCML 5G2ZA 1O85A 5B6MA 1UN2A 2VL9A 4GRFA 3TKSC 1FG4A 4HQSA 1HQOA 3G7IA 4ZL9A 1KNGA 3RPNA 5IMVA 2H6YA 3MSZA 1GSDA 1TJDA 6GSVA 1K0MA 2PU9C 3GFKA 2HLSA 1Z5YE 2PWJA 3W8JA 2XHFA 5HFIA 3NIVA 3TKRA 3CTFA 1BX9A 2NTOA 4BPYA 1B48A 2JADA 1XZOA 5COHA 1GTBA 4IKHA 1AQWA 5ECIB 1ZL9A 2OADA 1UA5A 3IHQA 2HRFA 2OE0A 1AIUA 2L59A 3CMIA 2AJQB 4ZL8A 5FWGA 4I5QA 1K0NA 2H1GA 5F05A 1ILOA 2AYTA 2V32A 3UAPA 1XW9A 1DE2A 4HI7A 2B3SA 4YH2A 4XS6A 1BJXA 4FYCA 5F0GA 4K8MA 1BEDA 4EDZA 1FW1A 3CBUA 2PBJA 1OYJA 1TI3A 1XWBA 5IO0A 1FVJA 3FKFA 3WT2A 4YAPA 2HSYA 1F2EA 1GTIA 1TKDB 5DALA 5LCZA 4DSQA 4EC0A 3GSSA 3VK9A 1RK4A 3QFBC 4KSOA 1S3AA 5IM9A 2GQKA 4GSTA 1XWAA 3DWVA 1SYXA 3MWHA 3ZTLA 2X64A 3QAVA 3HA9A 4CHSA 4AJ7A 3UVTA 2H73A 5ECLB 3PR8A 2LS5A 3P90A 2YCDA 3C7MA 2KHPA 2VAFA 1OKTA 3GX8A 5J4UA 2HI7A 1X5EA 5EY6A 4BVYA 1GNEA 1FAAA 2EC4A 1ZOFA 2IN3A 4PGTA 1X9WB 2ES7A 2EIQA 3A3TA 3CYNA 2H30A 11GSA 5F07A 2HYXA 4IELA 1QFNA 3GKMA 5GZZB 2H0GA 1SJZA 4ZIJA 2X99A 1PA3A 2X8HA 4RI7A 1KBNA 4MF6A 2TIRA 3TKSA 2X8GA 1EOGA 1ST9A 2WZ9A 2P0GA 1SL0B 2YJ7A 3IE3A 3O3TA 3KM6A 3FR6A 3UMAA 4GQFA 1TRVA 5DDLA 4D73A 5J9BA 3TDGA 2VOCA 1O7UA 3RBTA 13GSA 1PKZA 1TK0B 4ZILA 1GUHA 1HD2A 1EEMA 1LBKA 1TDIA 3PINA 4TKYA 3QAGA 4TR3A 2B5XA 4IW9A 2H76A 3APQA 1I5GA 3VI7A 4WR5A 2B7KA 1W89A 4MPFA 2A4VA 1WE0A 1TRUA 2PMTA 3BOAA 3F3RA 4IP1A 2YWIA 4K6XA 4OFMA 5CRDA 4BL7A 3NOFA 1V98A 5B6NA 4DSSB 4K7IA 2NDOA 3DIEA 2HNLA 4ZB8A 3BD2A 2WB9A 3GL3A 3Q74A 4IJ3A 5DQSA 2B6MA 2K18A 3UIWA 4GCIA 3IC4A 3IAS2 3TJGA 1B9XC 4GTUA 2X8CA 4E8EA 3N5OA 4NMUA 2R37A 5J3RA 5B7CA 4ISDA 5G1LA 3RHBA 3KCMA 5ECPB 1YZXA 2GZYA 1FB6A 1V9WA 5DALB 1EZKA 3TJBA 4DVCA 2LJKA 4KCEA 3AY8A 3WGDA 5HFKA 3A2XA 1VF1A 1AC1A 1ZCPA 2DIYA 1V2AA 3PH9A 2GZZA 4HEA2 1A24A 1EV4A 2LRNA 3LXTA 4J2FA 5AN1A 5A5KA 5GAND 4KH7A 3VWVA 1GSSA 2GT6A 3RHCA 3MDKA 5IIZA 1EOHA 1RW1A 3DYRA 4OCFA 1OAZA 2OBKA 1ACVA 2FWGA 4HDEA 4K0NA 4KDUA 4V1Ag 2GGTA 3J7Yk 3TKSE 5AISA 3VWUA 4HU7A 3EE2A 3EINA 4LMVA 12GSA 3TJKA 2R5GA 4XS4A 2CVDA 2H1BA 4XS1A 5ID2B 3HJPA 1EGRA 4EKZA 1FHEA 3ME7A 5HQPA 5DJLA 2MZCA 2DLXA 3L9SA 2FNOA 1K0OA 1THXA 1S3DA 3VFIA 1VF4A 2C3QA 4XRDA 3J7Yb 1SK2A 1LJRA 1ZYEA 3QCPA 2M72A 2CQ9A 3FHKA 2OA7A 1HNAA 4N0ZA 4HOJA 1XFLA 4V2MA 2MYGA 1A2MA 5DJMA 4RQXA 1K3LA 4N30A 2A2SA 1VGLA 2C0GA 1YKCA 3U6VA 4CDOA 6GSTA 4NV5A 3E3EA 5ECMB 3FZ5A 5IQYA 4GLTA 4OWYA 4GWRA 3GN3A 3CXGA 3HHVA 1Z6MA 2CZ3A 5D93A 4MH2A 1V57A 3GYKA 4YQMA 4FIWA 4IHUA 2LV3A 3LQ7A 3BBYA 2ON5A 4OCEA 2WGRA 3LG6A 4NHWA 6GSUA 5A4UA 4WBRD 2HT9A 3ZYWA 1TK8B 4OFNA 2PVOC 5CREA 2BTOT 4L5OA 3TRPA 1JHBA 2ALBA 5ECOB 4EDYA 2FA8A 2HFDA 3CSHA 1MTCA 6GSXA 1UVZA 1GUMA 3GX0A 3QMXA 5ECNB 5B8AA 2IJYA 4ACSA 3TRQA 3TOTA 2JU5A 3HJMA 4K7NA 1DBYA 4POLA 2LKUA 2LNSA 1ERVA 2KOKA 2HZFA 2F8AA 3UL3A 4JBBA 1O8XA 2NVLA 1SENA 2K8SA 2JSYA 2DJ3A 4PUFC 1GH2A 3APOA 2CVBA 5JCWA 1SJIA 4KDXA 1WIKA 3TB2A 1THOA 1V58A 3HJOA 4O92A 2OE1A 1Y6EA 1XVQA 1OKDA 2B1LA 3G7JA 4TXOB 4FYUA 4QL7A 3ED3A 4JU5A 3EURA 1R26A 1USBA 3EU4A 1PD21 2CV4A 5CO3A 4LLRA 3FZ4A 2XC2A 1SL1B 2OE3A 20GSA 2O7KA 2PERA 3C71A 1ON4A 4EE0A 5H5QA 1A0RP 2MBTA 1E2YA 2MBSA 3BCIA 4K2DA 4POMA 1F3AA 2C0EA 5GSTA 4QL9A 3Q19A 3GMFA 4PQ1A 2YV9A 3E0UA 1GWCA 1WRYA 2AB6A 3DXBA 5CP1A 2N5AA 4KW6A 2JSZA 3FY7A 4HUAA 2I81A 1SKWB 1YF0A 2WRTA 3UBLA 4JEDA 1N8JA 1XWGA 2M80A 4P3YB 1J08A 3ZIVA 3IV4A 3LFLA 2L5OA 4EUYA 3WYWA 1BYEA 2B5YA 2JL4A 2AUVA 2RLIA 4MDCA 3M9JA 4IQ1A 4KNDA 2CT6A 2VIMA 1SKRB 5HR2A 3I6AA 4BWQA 1TRSA 5F8BA 4DEJA 5J41A 1LU4A 8GSSA 4MJEA 3ME8A 1O6JA 4NPBA 22GSA 3UEMA 5G1KA 3LGCA 2V1MA 4HQZA 4HU9A 3GTUB 1YY7A 3F0IA 2GSTA 2PUKC 3TRXA 4IJIA 1QMVA 1T7PB 5D73A 5IO2A 4PQHA 5LD0A 1A2LA 4EF0A 4F0BA 2JZTA 1AXDA 1CQHA 1M7TA 3HXSA 1GTUA 2YP6A 1A0FA 3FRCA 5DQYA 5DBQA 1JZOA 2JZRA 4MP4A 5ABRA 5CRHA 1YF1A 3APSA 3KTBA 1MDKA 2H72A 1NHOA 3SWLA 3VPQA 4FH8A 4KGIA 5G30A 2PGTA 4Z7XA 4ML1A 1X9SB 3GRXA 1E6BA 4MZCA 5DAKA 5DCGA 4ZB6A 2F9SA 4ZXGA 5JCGA 4L0UA 1WPIA 1QQ2A 3D0ZA 4TR4A 2R2JA 3DGQA 2KP2A 2VM1A 5AGYA 1YJ6A 1K0CA 4EXJA 1TU8A 2YANA 1VF3A 1GTAA 3GKXA 4N0VA 4O32A 3TOUA 3D6IA 5KN1A 2YZHA 3DEXA 2FA4A 2LEGA 1K0AA 1T3BA 3C1SA 1EEJA 2A2RA 1ZYQB 4TN8A 3GKNA 3L78A 2HRNA 2IMIA 3ZITA 3DD3A 1HYUA 3GHAA 2VLTA 4ZBAA 10GSA 3TKQA 1XOAA 4E8HA 1U3AA 5IOWA 2VO4A 4WETA 2GSSA 3KH9A 5HR3A 1G7OA 4MF7A 2XPDA 2OJLA 4X43A 3M9KA 4WEYA 2HZEB 4GSSA 3DKSA 3P7XA 2LTKA 3HKRA 3MAKA 3ERWA 4IP6A 2RUFA 1TXXA 3F3QA 2FD3A 5D9TA 4G9HA 3A2WA 1Z9HA 4HS1A 5ECHB 4KE3A 3IBHA 2GSRA 2C8UA 2MMOA 19GSA 4OO4A 5GAPD 3L4NA 2WULA 2ON7A 1BQ7A 2H75A 1PKWA 1IYHA 4JRRA 6GSYA 3DMLA 3RPPA 2LUSA 3KH7A 1G6YA 4G2EA 1F6MC 3F4SA 1ERWA 1WWJA 3DVXA 1B8XA 3GA4A 1K3OA 2VCVA 1MD4A 2LNTA 4RI6A 3GV1A 2XBIA 3GH6A 3KP8A 2AAWA 1MEKA 3HCZA 5CYYA 5F06A 5LNKe 3OR5A 1Y25A 5D9VA 2CAIA 2H70A 3QD9A 5KN2A 2MMAA 4V2NA 2R4VA 3QPMA 3HY2A 2H1AA 2C3TA 2CX4A 1K0BA 1Z6NA 3ZVJA 2OACA 1XBSA 3L9VA 5EL8A 2GDRA 4KAEA 2H01A 1G7EA 2I9HA 3IA1A 5L71A 4XCSA 2VD0A 2GQLA 4HZ4A 5CNWA 2H19A 3HVXA 2RM6A 5D9WA 4K7OA 4NHZA 1T8EB 1XWCA 5KN0A 1XCCA 2VUPA 2LRCA 2NPBA 2GTUA 4MABA 3F63A 3IPZA 4J57E 4Q5QA 2REMA 3UBKA 5ECKB 1R7HA 2LQOA 4YQVA 5IMCA 3ZREA 1A8LA 4IGJA 2FHEA 1VF2A 2F3MA 5IPGA 5HR1A 4EVMA 3D4MA 1UC7A 3HVVA 4ECCA 4H86A 2N5BA 4BA7A 3FZAA 5EPFA 4PURA 4ECIA 1AW9A 1X9MB 3ZZXA 1QGVA 3ZLPA 1GSQA 2E0QA 3ZIJA 4KCAA 5DVBA 17GSA 5ELAA 3US3A 1XVWA 1O81A 1U87A 5G31A 5C04A 2DC5A 2WS2A 3F6DA 3KJYA 5KEJA 1OE7A 4POBA 2QKEA 4N11A 1TP9A 4HJMA 3KGKA 4D73B 3D22A 1ERUA 3ZFLA 4HZ2A 3HZ4A 1PX7A 3LEFA 1EGOA 5HFGA 2K8VA 3IOSA 16GSA 3EYTA 6GSSA 1OC8A 1Z7RA 5JWOB 4WXTA 4JR4A 4ZBBA 3GL5A 3PGTA 2FCHA 3NZNA 4GSNA 3M3MA 4I8BA 4AGSA 3F6FA 3CSJA 1EWXA 4NV2A 4CW9A 2F8FA 1JLVA 3CSIA 4OO5A 1ERTA 1OC9A 3HVSA 1ABAA 3KTLA 4DSRA 1XW6A 4TXVA 4IBPA 2VM2A 3VWXA 4F03A 4YAVA 1G6WA 3TGZA 1I9DA 2RIIA 4K9ZA 2L57A 2CAQA 2BJXA 2AHEA 2DJ1A 3RAZA 2OBIA 1GSEA 4OMVA 2YWMA 2O8VB 2NBSA 2P5RA 4ILFA 3VPTA 3VLNA 5GSSA 3LWAA 5ECSA 3L0HA 2E2GA 3V1WA 3ZL5A 1PL1A 2DMLA 4MMMA 1T1VA 1JZRA 1Z3EA 4G19A 4KA0A 3F9UA 3LYKA 3ERFA 2JACA 3A2VA 2L6CA 4Q5FA 4I6XA 5C00A 2F51A 3QFAC 5AIXA 2KP1A 1FOVA 1PRXA 1M9BA 2DJJA 4NWYA 4GF0A 4X1UA 4KSMA 2EIRA 1RQMA 3I9V2 2B7JA 2J23A 4OD7A 1VRSD 3TUEA 1O73A 4V2LA 3I69A 2ZNMA 2E2MA 2GQMA 5ECRB 1OE8A 4XS4B 2GT5A 1KTEA 5IMDA 2LJRA 4FO5A 2IMKA 4MF5A 5B8BA 2VL2C 1TRWA 2AV4A 4F2IA 1GUKA 1MD3A 1FO5A 1OC3A 2PVQA 1J0FA 1AUCA 5JWRB 5D9XA 5IOXA 1DE1A 2I1UA 2LSTA 4I2UA 5A4VA 1XIYA 3H93A 2LRTA 1JFUA 1SU9A 2ZCTA 4ECJA 3QOUA 3EWLA 1K0DA 3TKPA 3O76A 2C4JA 3FW2A 1HNCA 4K1FA 1XPVA 4TRXA 14GSA 1B9YC 4O7HA 1B4QA 2HE3A 4F9ZA 2DJKA 2L5LA 3LORA 1OC9B 2YPMA 1TU7A 4XRAA 4ECBA 3KIJA 2C0DA 3QR6A 2XBQA 1GSYA 3WD6A 4EL1A 1X5DA 4MH3A 5ENUA 5JWQB 4DSSA 1M0UA 2VCTA 2LJAA 2G0FA 1X0RA 2V6OA 1DSBA 1V40A 3FEUA 2QGVA 1GLQA 2CZ2A 4TVEA 3H4KA 3FZ9A 4LL4B 4QQ7A 3BJ5A 4V1Ap 3IDVA 2VCWA 2IMDA 4FYBA 4GQCA 2P31A 3G9BA 3GUSA 3HD5A 1N2AA 2FWFA 4MPGA 3WT1A 1ML6A 3O6TA 4ULXA 1F37A 2VLUA 1SJ6A 3ZMKA 3LXZA 2YNXA 4IN0A 1C72A 3W8SA 3FR3A 3Q6OA 1ZZYA 5IMZA 5IPHA 1K3YA 2OKAA 3UARA 3H1NA 4EO3A 2YWOA 3KMOA 2VL2A 1JZWA 2G2QA 2HXKA 2H8LA 2MMZA 3VI5A 4ML6A 3ZFBA 1R4WA 3M0FA 1CQGA 1BAYA 2QC7A 2XPEA 4PNGA 2IIYA 3IRAA 2RM5A 2RUEA 3H79A 3WGEA 1OVNA 1GULA 1GSUA 4TR1A 3EU3A 4NAXA 2IPAA 2E7PA 4JR6A 5KN3A 1YEPA 2FWEA 4XHMA 2ZUPA 2O87A 3F4RA 3W6GA 1TI1A 4O5RA 4ZL7A 4N10A 5JCUA 1X5CA 2DBCA 3GKKA 3H8QA 2GVPA 3D5JA 5ELGA 1Q4JA 1DUGA 5ID2A 1A8YA 3LSZA 1NHYA 1TOFA 2R3XA 4XIHA 5IMAA 1O8WA 3G7YA 5H5SA 4KX4A 5INYA 2I3YA 4WF5A 3QDNA 1U88A 1JLWA 3KXOA 3CRUA 3TCOA 2TRCP 4PXOA 1URMA 2FUG2 2K9FA 1ZMAA 1FB0A 1SD8A 4GXZA 1ZGNA 4LL1B 1AAZA 2FLSA 3GURA 1XWKA 3RDWA 5A4WA 1YKAA 4JE1A 2VD1A 1SK1A 4ZBDA 4F0CA 4WKWA 1H75A 4MZWA 5CRGA 2DIZA 3KMNA 2YOIA 1M99A 2YJHA 3KP9A 2IFQA 1XW5A 4KDYA 5CRWA 1Z7PA 2JZSA 2K6VA 3LYPA 4X0XA 4NXIA 2VL3A 2YN1A 3IAM2 2PN8A 1H4OA 3P8WA 2IWTA 5H5RA 4Q5RA 2YZUA 3IK7A 1B4PA 4AJ8A 3ZVJD 2WDUA 2H71A 3TJFA 1GLPA 5AIVA 1YQ1A 3UJ1A 5D8IA 5DAKB 4MJAA 5J5NA 3R2QA 1XXUA 2VLVA 2VCXA 4WBJA 1A2JA 4TOPA 3WGXA 2Z9SA 1R5AA 3N9JA 4LMWA 3S9FA 2VCZA 2C1YA 2H0HA 2O85A 2PPTA 1PL2A 1WMJA 1WOUA 5IMFA 3C1RA 2L4QA 1SYRA 2WCIA 4YQUA 5D96A 1M9AA 4RQRA 3F8UA 4BWSA 3GSTA 3U5RE 3ZMLA 4MLYA 4MCUA 2DMMA 1TK5B 2GZPA 2GS3A 1MDIA 4WR4A 1NW2A 1SD9A 1GNWA 4LA1A 1F9MA 3BCKA 3K8NA 3DVWA 2H1DA 5FT3A 2H0IA 2TRXA 3DRNA 2FY6A 3HYPA 1YDKA 4TXOA 1PQNA 4TR1B 4MK3A 4AF2A 1Q98A 3UOMA 1GRXA 3VWWA 1BG5A 1XOBA 3KD0A 2WJUA 4J56E 4IS0A 1GP1A 2H74A 2GSQA 1WJKA 5G5EA 3HDCA 4TR0A 2MMNA 3GH9A 5G5FA 2N5FA 1U6TA 2M46A 4JZQA 4PQIA 3I43A 1SK0A 2C3NA 4L5LA 3HZ8A 2LQQA 4HJ2A 1NSWA 1S3CA 3A5WA 3Q18A 2L6DA 3M8NA 3FR9A 2FGXA 3ISOA 2CVKA 4WF4A 2IMEA 3CRTA 1EV9A 1F3BA 3ERGA 1NM3A 1MDJA 4Q5NA 1SL2B 2R6KA 1U3IA 3QAWA 2H6XA 3F4TA 3FYGA 1PSQA 5FHIA 1AQXA 4G10A 4IQAA 4PNFA 2EIOA 4L8EA 2IFQB 1PN9A 4ZB9A 1T4YA 2DJ2A 2BMXA 5E59A 2B1KA 3C73A 3IXRA 1W4VA 1T00A 1G0TA 2GLRA 1WP0A 7GSSA 3EMPA 2L4CA 4PX1A 5E4WA 3GTUA 1M2BA 2H6ZA 3VURA 5HR0A 2CX3A 1QXHA 3SBCA 1TW9A 1R5PA 4MZBA 3EVIA 5ECQB 1HNBA 1EP7A 4MJBA 1A23A 2IL3A 5DCHA 4K0GA 4IVFA 3KZQA 1EP8A 2YWNA 1GL8A 4OFTA 3E9JB 2VCQA 3ZRDA 3D4TA 4POKA 5J9CA 3GIXA 3GNJA 1IYIA 2C0FA 2B5EA 4F82A 3M1GA 4MJCA 3LJRA 4I97A 1M2DA 2QSIA 3EC3A 3UVHA 2P5QA 3IR4A 4PUAA 2HSHA 2O89A 1M2AA 3KEBA 2C80A 1TTZA 2J9HA 2DJ0A 2WFCA 2KUCA 4L0WA 3TJJA 3D21A 3IK9A 2YV7A 4ID0A 2D2ZA 4TW5A 2CA8A 6GSWA 5CAXA 1AQVA 3FK8A 2IMFA 2FWHA 3CTGA 1T4ZA 1KEBA 4I2TA 4RUVA 1PX6A 18GSA 1QUWA 9GSSA 4BVXA 1SKSB 4XTSA 3C8EA 1JZDA 1PGTA 2I4AA 1YEXA 1PMTA 4MA9A 1J9BA 1GSFA 5EVOA 1QK8A 3P2AA 1FVKA
chains in the Genus database with same CATH superfamily
3L9UA 4KUNA 4KB3A 2KLXA 3MIXA 2H66A 4AJ6A 2V41A 2V2GA 2DSAA 2HZEA 3MNGA 3EMXA 2DKIA 2V6KA 5G2ZA 3JCML 1O85A 5B6MA 1UN2A 3CQFA 2VL9A 4GRFA 3TKSC 1FG4A 4HQSA 1HQOA 3G7IA 4ZL9A 1KNGA 3RPNA 5IMVA 2H6YA 3MSZA 1GSDA 1TJDA 6GSVA 1K0MA 2PU9C 3GFKA 2HLSA 1Z5YE 2PWJA 3W8JA 2XHFA 5HFIA 3NIVA 1S3RA 3TKRA 3CTFA 1FOHA 1BX9A 2NTOA 4BPYA 1B48A 2JADA 1XZOA 5COHA 1GTBA 4IKHA 1AQWA 5ECIB 1ZL9A 2OADA 1UA5A 4CY6A 3IHQA 2HRFA 2OE0A 1AIUA 2L59A 3CMIA 4Z2UA 2AJQB 4ZL8A 5FWGA 4I5QA 1K0NA 2H1GA 5F05A 1ILOA 2AYTA 2V32A 3UAPA 1XW9A 1DE2A 4BIKA 4HI7A 2B3SA 4YH2A 3LW9A 4XS6A 1BJXA 4FYCA 5F0GA 4K8MA 1BEDA 4EDZA 1FW1A 3CBUA 2PBJA 1OYJA 1TI3A 1XWBA 5IO0A 1FVJA 3FKFA 3WT2A 4YAPA 2HSYA 1F2EA 1GTIA 1TKDB 5DALA 5LCZA 4DSQA 4EC0A 3GSSA 3VK9A 1RK4A 3QFBC 4KSOA 1S3AA 5IM9A 2GQKA 4GSTA 2HRKA 1XWAA 3DWVA 1SYXA 3MWHA 3ZTLA 2X64A 3QAVA 3HA9A 4CHSA 4AJ7A 3UVTA 2H73A 5ECLB 3PR8A 3P90A 2LS5A 3IHGA 2YCDA 3C7MA 2KHPA 2VAFA 1OKTA 3GX8A 5J4UA 2HI7A 1X5EA 5EY6A 4BVYA 1GNEA 1FAAA 2EC4A 1ZOFA 2IN3A 4PGTA 1X9WB 2ES7A 2EIQA 3A3TA 3CYNA 2H30A 11GSA 5F07A 2HYXA 4IELA 1QFNA 3GKMA 5GZZB 2H0GA 1SJZA 4ZIJA 2X99A 1PA3A 2X8HA 4RI7A 1KBNA 4MF6A 2TIRA 3TKSA 2X8GA 1EOGA 1ST9A 2WZ9A 2P0GA 1SL0B 4K5SA 2YJ7A 3IE3A 3O3TA 3KM6A 3FR6A 3UMAA 4GQFA 1TRVA 5DDLA 4D73A 5J9BA 3TDGA 2VOCA 1O7UA 3RBTA 13GSA 1PKZA 1TK0B 4ZILA 1GUHA 1HD2A 1EEMA 1LBKA 1TDIA 3PINA 4TKYA 3QAGA 4TR3A 2B5XA 4IW9A 2H76A 3APQA 1I5GA 3VI7A 4WR5A 2B7KA 1W89A 4MPFA 2A4VA 1WE0A 1TRUA 2PMTA 3BOAA 3F3RA 4IP1A 2YWIA 4K6XA 4OFMA 5CRDA 4BL7A 3NOFA 1V98A 5B6NA 4DSSB 4K7IA 2NDOA 3DIEA 2HNLA 4ZB8A 3EPTA 2R0GA 3BD2A 2WB9A 3GL3A 3Q74A 4IJ3A 5DQSA 2B6MA 2K18A 3UIWA 4GCIA 3IC4A 3IAS2 3TJGA 1B9XC 2X49A 4GTUA 2X8CA 4E8EA 3N5OA 4NMUA 2R37A 5J3RA 5B7CA 4ISDA 5G1LA 3RHBA 3KCMA 5ECPB 1YZXA 2GZYA 1FB6A 1V9WA 5DALB 1EZKA 3TJBA 4DVCA 2LJKA 4KCEA 2HRAA 3AY8A 3WGDA 5HFKA 3A2XA 1VF1A 1AC1A 2UZ8A 1ZCPA 2DIYA 1V2AA 3PH9A 2GZZA 4HEA2 4A5PA 1A24A 1EV4A 2LRNA 3LXTA 4J2FA 5AN1A 5A5KA 5GAND 4KH7A 3VWVA 1GSSA 2GT6A 3RHCA 3MDKA 5IIZA 1EOHA 1RW1A 4Z2RA 4Z2TA 3DYRA 4OCFA 1OAZA 2OBKA 1ACVA 2FWGA 4HDEA 4K0NA 4KDUA 4V1Ag 2GGTA 3J7Yk 3TKSE 5AISA 3VWUA 4HU7A 3EE2A 3EINA 4LMVA 12GSA 3TJKA 2R5GA 4XS4A 2CVDA 2H1BA 4XS1A 5ID2B 3HJPA 1EGRA 4EKZA 1FHEA 3ME7A 5HQPA 5DJLA 2MZCA 2DLXA 3L9SA 2FNOA 1K0OA 1THXA 1S3DA 3VFIA 1VF4A 2C3QA 4XRDA 3J7Yb 1SK2A 1LJRA 1ZYEA 3QCPA 2M72A 2CQ9A 3FHKA 2OA7A 4EIPA 1HNAA 4N0ZA 4HOJA 1XFLA 4V2MA 2MYGA 1A2MA 5DJMA 4RQXA 1K3LA 4N30A 2A2SA 1VGLA 2C0GA 1YKCA 3U6VA 4CDOA 6GSTA 4NV5A 3E3EA 5ECMB 3FZ5A 5IQYA 4GLTA 4OWYA 4GWRA 3GN3A 3CXGA 3HHVA 1Z6MA 2CZ3A 5D93A 4MH2A 1V57A 3GYKA 4YQMA 4FIWA 4IHUA 2LV3A 3LQ7A 3BBYA 2ON5A 4OCEA 2WGRA 3LG6A 4NHWA 6GSUA 5A4UA 4WBRD 2HT9A 3ZYWA 1TK8B 4OFNA 2PVOC 5CREA 2BTOT 4L5OA 3TRPA 1JHBA 2ALBA 5ECOB 4EDYA 2FA8A 2HFDA 3CSHA 1MTCA 6GSXA 1UVZA 1GUMA 3GX0A 3QMXA 5ECNB 5B8AA 2IJYA 4ACSA 3TRQA 3TOTA 2JU5A 3HJMA 4K7NA 1DBYA 4POLA 2LKUA 2LNSA 1ERVA 2KOKA 2HZFA 2F8AA 3UL3A 4JBBA 1O8XA 2NVLA 1SENA 2K8SA 2JSYA 2DJ3A 1PFOA 1GH2A 4PUFC 3APOA 2CVBA 5JCWA 1SJIA 4KDXA 1WIKA 3TB2A 4YKGA 1THOA 1V58A 3HJOA 4O92A 2OE1A 1Y6EA 1XVQA 1OKDA 2B1LA 3G7JA 4TXOB 4FYUA 4QL7A 3ED3A 4JU5A 3EURA 1R26A 1USBA 3EU4A 1PD21 2CV4A 5CO3A 4LLRA 3FZ4A 2R0CA 2XC2A 1SL1B 2OE3A 20GSA 2O7KA 2PERA 3C71A 1ON4A 4EE0A 5H5QA 1A0RP 2MBTA 1E2YA 2MBSA 3BCIA 4K2DA 4POMA 1F3AA 2C0EA 5GSTA 4QL9A 3Q19A 3GMFA 4PQ1A 2YV9A 3E0UA 1GWCA 1WRYA 2AB6A 3DXBA 5CP1A 2N5AA 4KW6A 2JSZA 3FY7A 4HUAA 2I81A 1SKWB 1YF0A 2WRTA 3UBLA 4JEDA 1N8JA 1XWGA 2M80A 4P3YB 1J08A 3ZIVA 3IV4A 3LFLA 2L5OA 4EUYA 3WYWA 1BYEA 2B5YA 2JL4A 2AUVA 2RLIA 4MDCA 3M9JA 4IQ1A 4KNDA 2CT6A 2VIMA 1SKRB 5HR2A 3I6AA 4BWQA 1TRSA 5F8BA 4DEJA 5J41A 1LU4A 8GSSA 4MJEA 3ME8A 1O6JA 4NPBA 22GSA 3UEMA 5G1KA 3LGCA 2V1MA 4HQZA 4HU9A 3GTUB 1YY7A 3F0IA 2GSTA 2PUKC 3TRXA 4IJIA 1QMVA 1T7PB 5D73A 5IO2A 4PQHA 5LD0A 1A2LA 4EF0A 4F0BA 2JZTA 1AXDA 1CQHA 1M7TA 3HXSA 1GTUA 5BRTA 2YP6A 1A0FA 3FRCA 5DQYA 5DBQA 1JZOA 2JZRA 4MP4A 5ABRA 5CRHA 1YF1A 3APSA 3KTBA 1MDKA 2H72A 1NHOA 3SWLA 3VPQA 4FH8A 4KGIA 5G30A 2PGTA 4Z7XA 4ML1A 1X9SB 3GRXA 1E6BA 4MZCA 5DAKA 5DCGA 4ZB6A 2F9SA 4ZXGA 5JCGA 4L0UA 1WPIA 1QQ2A 3D0ZA 4TR4A 1M3JA 2R2JA 3DGQA 2KP2A 2VM1A 5AGYA 1YJ6A 1K0CA 4EXJA 1TU8A 2YANA 1VF3A 1GTAA 3GKXA 4N0VA 4O32A 3TOUA 3D6IA 5KN1A 1ZYNA 2YZHA 3DEXA 2FA4A 2LEGA 1K0AA 1T3BA 3C1SA 1EEJA 2A2RA 4O5UA 1ZYQB 4TN8A 3GKNA 3L78A 4G0LA 2HRNA 2IMIA 3ZITA 4BVXB 3DD3A 1HYUA 3GHAA 2VLTA 4ZBAA 10GSA 3TKQA 1XOAA 4E8HA 1U3AA 5IOWA 2VO4A 4WETA 2GSSA 3KH9A 5HR3A 1G7OA 4MF7A 2XPDA 2OJLA 4X43A 3M9KA 4WEYA 2HZEB 4GSSA 3DKSA 3P7XA 2LTKA 3HKRA 3MAKA 3R3EA 3ERWA 4IP6A 2RUFA 1TXXA 3F3QA 2FD3A 5D9TA 4G9HA 5BMUA 3A2WA 1Z9HA 4HS1A 5ECHB 4KE3A 3IBHA 2GSRA 2C8UA 2QA2A 2MMOA 19GSA 4OO4A 5GAPD 3L4NA 2WULA 2ON7A 1BQ7A 2H75A 1PKWA 1IYHA 4JRRA 6GSYA 3DMLA 3RPPA 2LUSA 3KH7A 1G6YA 4G2EA 1F6MC 3F4SA 1ERWA 1WWJA 3DVXA 1B8XA 3GA4A 1K3OA 2VCVA 1MD4A 2LNTA 4RI6A 3GV1A 2XBIA 3GH6A 3KP8A 2AAWA 1MEKA 3HCZA 5CYYA 5F06A 5LNKe 3OR5A 1Y25A 5D9VA 2CAIA 2H70A 3QD9A 5KN2A 2MMAA 4V2NA 2R4VA 3QPMA 3HY2A 2H1AA 2C3TA 2CX4A 1K0BA 1Z6NA 3ZVJA 2OACA 1XBSA 4X4JA 3L9VA 5EL8A 2GDRA 4KAEA 2H01A 4YKFA 1G7EA 2I9HA 3IA1A 5L71A 4XCSA 2VD0A 2GQLA 4USSA 1M3IA 4HZ4A 5CNWA 2H19A 3HVXA 2RM6A 5D9WA 2DKHA 4K7OA 4NHZA 1T8EB 1XWCA 5KN0A 1XCCA 2VUPA 2LRCA 2NPBA 2GTUA 4MABA 3F63A 3IPZA 4J57E 4Q5QA 2REMA 3UBKA 5ECKB 1R7HA 2LQOA 4YQVA 5IMCA 3ZREA 1A8LA 4IGJA 2FHEA 1VF2A 2F3MA 5IPGA 5HR1A 4EVMA 3D4MA 4BVYB 1UC7A 3HVVA 4ECCA 4H86A 2N5BA 4BA7A 3FZAA 5EPFA 4PURA 4ECIA 1AW9A 1X9MB 3ZZXA 1QGVA 3ZLPA 1GSQA 2E0QA 3ZIJA 4KCAA 5DVBA 17GSA 5ELAA 3US3A 1XVWA 1O81A 1PN0A 1U87A 5G31A 5C04A 2DC5A 2WS2A 3F6DA 3KJYA 5KEJA 1OE7A 4POBA 2QKEA 4N11A 1TP9A 4HJMA 3KGKA 4D73B 3D22A 1ERUA 3ZFLA 3HVNA 4HZ2A 4HSCX 3HZ4A 1PX7A 3LEFA 1EGOA 5HFGA 2K8VA 3IOSA 16GSA 3EYTA 6GSSA 1OC8A 1Z7RA 5JWOB 4WXTA 4JR4A 4ZBBA 3GL5A 3PGTA 2FCHA 3NZNA 4GSNA 3M3MA 5KOXA 4I8BA 4AGSA 3F6FA 3CSJA 1EWXA 4NV2A 4CW9A 2F8FA 4BL7B 4MNNA 1JLVA 3CSIA 4OO5A 1ERTA 1OC9A 3HVSA 1ABAA 3KTLA 4DSRA 4CY8A 1XW6A 4TXVA 4IBPA 2VM2A 3VWXA 4F03A 4YAVA 1G6WA 3TGZA 1I9DA 2RIIA 3FMWA 4K9ZA 2L57A 2CAQA 2BJXA 2AHEA 2DJ1A 3RAZA 2OBIA 1GSEA 4OMVA 2YWMA 2O8VB 2NBSA 2P5RA 4ILFA 3VPTA 3VLNA 5GSSA 3LWAA 5ECSA 3L0HA 2E2GA 3V1WA 3ZL5A 1PL1A 2DMLA 4MMMA 1T1VA 4FQUA 1JZRA 1Z3EA 4ICYA 4G19A 4KA0A 3F9UA 3LYKA 3ERFA 2JACA 3A2VA 2L6CA 4Q5FA 4I6XA 5C00A 2F51A 3QFAC 5AIXA 2KP1A 1FOVA 1PRXA 1M9BA 2DJJA 4NWYA 4GF0A 4X1UA 4KSMA 2EIRA 1RQMA 3I9V2 2B7JA 2J23A 4OD7A 1VRSD 3A5IA 3TUEA 1O73A 4V2LA 3I69A 2ZNMA 2E2MA 2GQMA 3PPUA 5ECRB 1OE8A 4XS4B 2GT5A 1KTEA 5IMDA 2LJRA 4FO5A 2IMKA 4MF5A 5B8BA 2VL2C 1TRWA 2AV4A 4F2IA 1GUKA 1MD3A 1FO5A 1OC3A 2PVQA 1J0FA 1AUCA 5JWRB 5D9XA 5IOXA 1DE1A 2I1UA 2LSTA 4I2UA 5A4VA 1XIYA 4G0KA 3H93A 2LRTA 1JFUA 1SU9A 2ZCTA 4ECJA 3QOUA 3EWLA 1K0DA 3TKPA 2A4HA 3O76A 2C4JA 3FW2A 1HNCA 4K1FA 1XPVA 4TRXA 14GSA 1B9YC 4O7HA 1B4QA 2HE3A 4F9ZA 2DJKA 2L5LA 3LORA 1OC9B 2YPMA 1TU7A 4XRAA 4ECBA 3KIJA 2C0DA 3QR6A 2XBQA 1GSYA 3WD6A 4EL1A 1X5DA 4MH3A 5ENUA 5JWQB 4DSSA 1M0UA 2VCTA 2LJAA 2G0FA 1X0RA 2V6OA 1DSBA 1V40A 3FEUA 2QGVA 1GLQA 2CZ2A 4TVEA 3H4KA 3FZ9A 4LL4B 4QQ7A 3BJ5A 4V1Ap 3IDVA 2VCWA 2IMDA 4FYBA 4GQCA 2P31A 3G9BA 3GUSA 3HD5A 1N2AA 2FWFA 4MPGA 3WT1A 1ML6A 3O6TA 4ULXA 1F37A 2VLUA 1SJ6A 3ZMKA 3LXZA 2YNXA 4IN0A 1C72A 3W8SA 3FR3A 3Q6OA 1ZZYA 5IMZA 5IPHA 1K3YA 2OKAA 3UARA 3H1NA 4EO3A 2YWOA 3KMOA 2VL2A 1JZWA 2G2QA 2HXKA 2H8LA 2MMZA 3VI5A 4ML6A 3ZFBA 1R4WA 3M0FA 1CQGA 1BAYA 2QC7A 2XPEA 1XG8A 4PNGA 2IIYA 5KOWA 3IRAA 2RM5A 2RUEA 3H79A 3WGEA 1OVNA 1GULA 1GSUA 4TR1A 3EU3A 4NAXA 2IPAA 2E7PA 4JR6A 5KN3A 1YEPA 2FWEA 4XHMA 2ZUPA 2O87A 3F4RA 3W6GA 1TI1A 4O5RA 4ZL7A 4N10A 5JCUA 1X5CA 2DBCA 3GKKA 3H8QA 2GVPA 3D5JA 5ELGA 1Q4JA 1DUGA 4K2XA 5ID2A 1A8YA 3LSZA 1NHYA 1TOFA 2R3XA 4XIHA 5IMAA 1O8WA 3G7YA 5H5SA 4KX4A 5INYA 2I3YA 4WF5A 3QDNA 1U88A 1JLWA 3KXOA 3CRUA 3TCOA 2TRCP 4PXOA 1URMA 2FUG2 2K9FA 1ZMAA 1FB0A 1SD8A 4GXZA 1ZGNA 4LL1B 1AAZA 2FLSA 3GURA 1XWKA 3RDWA 5A4WA 1YKAA 4JE1A 2VD1A 1SK1A 4ZBDA 4F0CA 4EIQA 4WKWA 1H75A 4MZWA 5CRGA 2DIZA 3KMNA 2YOIA 1M99A 2YJHA 3KP9A 2IFQA 1XW5A 4KDYA 5CRWA 1Z7PA 2JZSA 2K6VA 3LYPA 4X0XA 4NXIA 2VL3A 2YN1A 3IAM2 2PN8A 1H4OA 3P8WA 2IWTA 5H5RA 4Q5RA 2YZUA 3IK7A 1B4PA 2A2PA 4AJ8A 2HSMA 3ZVJD 2WDUA 2H71A 3TJFA 1GLPA 5AIVA 1YQ1A 3UJ1A 2R0PA 5D8IA 5DAKB 4MJAA 5J5NA 3R2QA 4KF9A 4PTSA 1XXUA 2VLVA 2VCXA 4WBJA 1A2JA 4TOPA 3WGXA 2Z9SA 1R5AA 3N9JA 4LMWA 3S9FA 2VCZA 2C1YA 2H0HA 2O85A 2PPTA 1PL2A 1WMJA 1WOUA 5IMFA 3C1RA 2L4QA 1SYRA 2WCIA 4G0IA 4YQUA 5D96A 1M9AA 4RQRA 3F8UA 4BWSA 3GSTA 3U5RE 3ZMLA 4MLYA 4MCUA 2DMMA 1TK5B 2GZPA 2GS3A 1MDIA 4WR4A 1NW2A 1SD9A 1GNWA 4LA1A 1ZYPA 1F9MA 3BCKA 3K8NA 3DVWA 2H1DA 5FT3A 2H0IA 2QA1A 2TRXA 3DRNA 2FY6A 3HYPA 1YDKA 4TXOA 1PQNA 4TR1B 4MK3A 4AF2A 1Q98A 3UOMA 1GRXA 3VWWA 1BG5A 1XOBA 3KD0A 2WJUA 4J56E 4IS0A 3MYDA 1GP1A 2H74A 2GSQA 1WJKA 5G5EA 3HDCA 4TR0A 2MMNA 3GH9A 5G5FA 2N5FA 1U6TA 2M46A 4JZQA 4PQIA 3I43A 1SK0A 2C3NA 4L5LA 4O5QA 3HZ8A 2LQQA 4HJ2A 1NSWA 1S3CA 3A5WA 3Q18A 2L6DA 3M8NA 3FR9A 2FGXA 3ISOA 2CVKA 4WF4A 2IMEA 3CRTA 1EV9A 2X4AA 1F3BA 3ERGA 1NM3A 1MDJA 4Q5NA 1SL2B 2R6KA 1U3IA 3QAWA 2H6XA 3F4TA 3FYGA 1PSQA 5FHIA 1AQXA 4G10A 4PNFA 4IQAA 2EIOA 4L8EA 2IFQB 1PN9A 4ZB9A 1T4YA 2DJ2A 2BMXA 5E59A 2B1KA 3C73A 3IXRA 1W4VA 1T00A 1G0TA 2GLRA 1WP0A 7GSSA 3EMPA 2L4CA 4PX1A 5E4WA 3GTUA 1M2BA 2H6ZA 3VURA 5HR0A 2CX3A 3IC8A 1QXHA 3SBCA 1TW9A 1R5PA 4MZBA 3EVIA 5ECQB 1HNBA 4K5RA 1EP7A 4MJBA 1A23A 2IL3A 5DCHA 4K0GA 4IVFA 3KZQA 1EP8A 2YWNA 1GL8A 4OFTA 3E9JB 2VCQA 3ZRDA 3D4TA 4POKA 5J9CA 3GIXA 3GNJA 1IYIA 2C0FA 2B5EA 4F82A 3M1GA 4MJCA 3LJRA 4I97A 1M2DA 2QSIA 3EC3A 3UVHA 2P5QA 3IR4A 4PUAA 2HSHA 2O89A 1M2AA 3KEBA 2C80A 1TTZA 2J9HA 2DJ0A 2WFCA 2KUCA 4L0WA 3TJJA 3D21A 3IK9A 2YV7A 4ID0A 2D2ZA 4TW5A 2CA8A 6GSWA 5CAXA 1AQVA 3FK8A 2IMFA 2FWHA 3CTGA 1T4ZA 1KEBA 4I2TA 4RUVA 1PX6A 18GSA 1QUWA 9GSSA 4BVXA 1SKSB 4XTSA 3C8EA 1JZDA 1PGTA 2I4AA 1YEXA 1PMTA 4MA9A 1J9BA 1GSFA 5EVOA 1QK8A 3P2AA 1FVKA
chains in the Genus database with same CATH topology
3L9UA 4KUNA 4KB3A 2KLXA 3MIXA 2H66A 4AJ6A 2V41A 2V2GA 2DSAA 2HZEA 3MNGA 3EMXA 2DKIA 2V6KA 5G2ZA 3JCML 1O85A 5B6MA 1UN2A 2VL9A 4GRFA 3TKSC 1FG4A 4HQSA 1HQOA 3G7IA 4ZL9A 1KNGA 3RPNA 5IMVA 2H6YA 3MSZA 1GSDA 1TJDA 6GSVA 1K0MA 2PU9C 3GFKA 2HLSA 1Z5YE 2PWJA 3W8JA 2XHFA 5HFIA 3NIVA 3TKRA 3CTFA 1FOHA 1BX9A 2NTOA 4BPYA 1B48A 2JADA 1XZOA 5COHA 1GTBA 4IKHA 1AQWA 5ECIB 1ZL9A 2OADA 1UA5A 4CY6A 3IHQA 2HRFA 2OE0A 1AIUA 2L59A 3CMIA 4Z2UA 2AJQB 4ZL8A 5FWGA 4I5QA 1K0NA 2H1GA 5F05A 1ILOA 2AYTA 2V32A 3UAPA 1XW9A 1DE2A 4HI7A 2B3SA 4YH2A 3LW9A 4XS6A 1BJXA 4FYCA 5F0GA 4K8MA 1BEDA 4EDZA 1FW1A 3CBUA 2PBJA 1OYJA 1TI3A 1XWBA 5IO0A 1FVJA 3FKFA 3WT2A 4YAPA 2HSYA 1F2EA 1GTIA 1TKDB 5DALA 5LCZA 4DSQA 4EC0A 3GSSA 3VK9A 1RK4A 3QFBC 4KSOA 1S3AA 5IM9A 2GQKA 4GSTA 2HRKA 1XWAA 3DWVA 1SYXA 3MWHA 3ZTLA 2X64A 3QAVA 3HA9A 4CHSA 4AJ7A 3UVTA 2H73A 5ECLB 3PR8A 3P90A 2LS5A 3IHGA 2YCDA 3C7MA 2KHPA 2VAFA 1OKTA 3GX8A 5J4UA 2HI7A 1X5EA 5EY6A 4BVYA 1GNEA 1FAAA 2EC4A 1ZOFA 2IN3A 4PGTA 1X9WB 2ES7A 2EIQA 3A3TA 3CYNA 2H30A 11GSA 5F07A 2HYXA 4IELA 1QFNA 3GKMA 5GZZB 2H0GA 1SJZA 4ZIJA 2X99A 1PA3A 2X8HA 4RI7A 1KBNA 4MF6A 2TIRA 3TKSA 2X8GA 1EOGA 1ST9A 2WZ9A 2P0GA 1SL0B 4K5SA 2YJ7A 3IE3A 3O3TA 3KM6A 3FR6A 3UMAA 4GQFA 1TRVA 5DDLA 4D73A 5J9BA 3TDGA 2VOCA 1O7UA 3RBTA 13GSA 1PKZA 1TK0B 4ZILA 1GUHA 1HD2A 1EEMA 1LBKA 1TDIA 3PINA 4TKYA 3QAGA 4TR3A 2B5XA 4IW9A 2H76A 3APQA 1I5GA 3VI7A 4WR5A 2B7KA 1W89A 4MPFA 2A4VA 1WE0A 1TRUA 2PMTA 3BOAA 3F3RA 4IP1A 2YWIA 4K6XA 4OFMA 5CRDA 4BL7A 3NOFA 1V98A 5B6NA 4DSSB 4K7IA 2NDOA 3DIEA 2HNLA 4ZB8A 3EPTA 2R0GA 3BD2A 2WB9A 3GL3A 3Q74A 4IJ3A 5DQSA 2B6MA 2K18A 3UIWA 4GCIA 3IC4A 3IAS2 3TJGA 1B9XC 2X49A 4GTUA 2X8CA 4E8EA 3N5OA 4NMUA 2R37A 5J3RA 5B7CA 4ISDA 5G1LA 3RHBA 3KCMA 5ECPB 1YZXA 2GZYA 1FB6A 1V9WA 5DALB 1EZKA 3TJBA 4DVCA 2LJKA 4KCEA 2HRAA 3AY8A 3WGDA 5HFKA 3A2XA 1VF1A 1AC1A 2UZ8A 1ZCPA 2DIYA 1V2AA 3PH9A 2GZZA 4HEA2 4A5PA 1A24A 1EV4A 2LRNA 3LXTA 4J2FA 5AN1A 5A5KA 5GAND 4KH7A 3VWVA 1GSSA 2GT6A 3RHCA 3MDKA 5IIZA 1EOHA 1RW1A 4Z2RA 4Z2TA 3DYRA 4OCFA 1OAZA 2OBKA 1ACVA 2FWGA 4HDEA 4K0NA 4KDUA 4V1Ag 2GGTA 3J7Yk 3TKSE 5AISA 3VWUA 4HU7A 3EE2A 3EINA 4LMVA 12GSA 3TJKA 2R5GA 4XS4A 2CVDA 2H1BA 4XS1A 5ID2B 3HJPA 1EGRA 4EKZA 1FHEA 3ME7A 5HQPA 5DJLA 2MZCA 2DLXA 3L9SA 2FNOA 1K0OA 1THXA 1S3DA 3VFIA 1VF4A 2C3QA 4XRDA 3J7Yb 1SK2A 1LJRA 1ZYEA 3QCPA 2M72A 2CQ9A 3FHKA 2OA7A 4EIPA 1HNAA 4N0ZA 4HOJA 1XFLA 4V2MA 2MYGA 1A2MA 5DJMA 4RQXA 1K3LA 4N30A 2A2SA 1VGLA 2C0GA 1YKCA 3U6VA 4CDOA 6GSTA 4NV5A 3E3EA 5ECMB 3FZ5A 5IQYA 4GLTA 4OWYA 4GWRA 3GN3A 3CXGA 3HHVA 1Z6MA 2CZ3A 5D93A 4MH2A 1V57A 3GYKA 4YQMA 4FIWA 4IHUA 2LV3A 3LQ7A 3BBYA 2ON5A 4OCEA 2WGRA 3LG6A 4NHWA 6GSUA 5A4UA 4WBRD 2HT9A 3ZYWA 1TK8B 4OFNA 2PVOC 5CREA 2BTOT 4L5OA 3TRPA 1JHBA 2ALBA 5ECOB 4EDYA 2FA8A 2HFDA 3CSHA 1MTCA 6GSXA 1UVZA 1GUMA 3GX0A 3QMXA 5ECNB 5B8AA 2IJYA 4ACSA 3TRQA 3TOTA 2JU5A 3HJMA 4K7NA 1DBYA 4POLA 2LKUA 2LNSA 1ERVA 2KOKA 2HZFA 2F8AA 3UL3A 4JBBA 1O8XA 2NVLA 1SENA 2K8SA 2JSYA 2DJ3A 4PUFC 1GH2A 3APOA 2CVBA 5JCWA 1SJIA 4KDXA 1WIKA 3TB2A 4YKGA 1THOA 1V58A 3HJOA 4O92A 2OE1A 1Y6EA 1XVQA 1OKDA 2B1LA 3G7JA 4TXOB 4FYUA 4QL7A 3ED3A 4JU5A 3EURA 1R26A 1USBA 3EU4A 1PD21 2CV4A 5CO3A 4LLRA 3FZ4A 2R0CA 2XC2A 1SL1B 2OE3A 20GSA 2O7KA 2PERA 3C71A 1ON4A 4EE0A 5H5QA 1A0RP 2MBTA 1E2YA 2MBSA 3BCIA 4K2DA 4POMA 1F3AA 2C0EA 5GSTA 4QL9A 3Q19A 3GMFA 4PQ1A 2YV9A 3E0UA 1GWCA 1WRYA 2AB6A 3DXBA 5CP1A 2N5AA 4KW6A 2JSZA 3FY7A 4HUAA 2I81A 1SKWB 1YF0A 2WRTA 3UBLA 4JEDA 1N8JA 1XWGA 2M80A 4P3YB 1J08A 3ZIVA 3IV4A 3LFLA 2L5OA 4EUYA 3WYWA 1BYEA 2B5YA 2JL4A 2AUVA 2RLIA 4MDCA 3M9JA 4IQ1A 4KNDA 2CT6A 2VIMA 1SKRB 5HR2A 3I6AA 4BWQA 1TRSA 5F8BA 4DEJA 5J41A 1LU4A 8GSSA 4MJEA 3ME8A 1O6JA 4NPBA 22GSA 3UEMA 5G1KA 3LGCA 2V1MA 4HQZA 4HU9A 3GTUB 1YY7A 3F0IA 2GSTA 2PUKC 3TRXA 4IJIA 1QMVA 1T7PB 5D73A 5IO2A 4PQHA 5LD0A 1A2LA 4EF0A 4F0BA 2JZTA 1AXDA 1CQHA 1M7TA 3HXSA 1GTUA 5BRTA 2YP6A 1A0FA 3FRCA 5DQYA 5DBQA 1JZOA 2JZRA 4MP4A 5ABRA 5CRHA 1YF1A 3APSA 3KTBA 1MDKA 2H72A 1NHOA 3SWLA 3VPQA 4FH8A 4KGIA 5G30A 2PGTA 4Z7XA 4ML1A 1X9SB 3GRXA 1E6BA 4MZCA 5DAKA 5DCGA 4ZB6A 2F9SA 4ZXGA 5JCGA 4L0UA 1WPIA 1QQ2A 3D0ZA 4TR4A 2R2JA 3DGQA 2KP2A 2VM1A 5AGYA 1YJ6A 1K0CA 4EXJA 1TU8A 2YANA 1VF3A 1GTAA 3GKXA 4N0VA 4O32A 3TOUA 3D6IA 5KN1A 1ZYNA 2YZHA 3DEXA 2FA4A 2LEGA 1K0AA 1T3BA 3C1SA 1EEJA 2A2RA 4O5UA 1ZYQB 4TN8A 3GKNA 3L78A 4G0LA 2HRNA 2IMIA 3ZITA 4BVXB 3DD3A 1HYUA 3GHAA 2VLTA 4ZBAA 10GSA 3TKQA 1XOAA 4E8HA 1U3AA 5IOWA 2VO4A 4WETA 2GSSA 3KH9A 5HR3A 1G7OA 4MF7A 2XPDA 2OJLA 4X43A 3M9KA 4WEYA 2HZEB 4GSSA 3DKSA 3P7XA 2LTKA 3HKRA 3MAKA 3R3EA 3ERWA 4IP6A 2RUFA 1TXXA 3F3QA 2FD3A 5D9TA 4G9HA 5BMUA 3A2WA 1Z9HA 4HS1A 5ECHB 4KE3A 3IBHA 2GSRA 2C8UA 2QA2A 2MMOA 19GSA 4OO4A 5GAPD 3L4NA 2WULA 2ON7A 1BQ7A 2H75A 1PKWA 1IYHA 4JRRA 6GSYA 3DMLA 3RPPA 2LUSA 3KH7A 1G6YA 4G2EA 1F6MC 3F4SA 1ERWA 1WWJA 3DVXA 1B8XA 3GA4A 1K3OA 2VCVA 1MD4A 2LNTA 4RI6A 3GV1A 2XBIA 3GH6A 3KP8A 2AAWA 1MEKA 3HCZA 5CYYA 5F06A 5LNKe 3OR5A 1Y25A 5D9VA 2CAIA 2H70A 3QD9A 5KN2A 2MMAA 4V2NA 2R4VA 3QPMA 3HY2A 2H1AA 2C3TA 2CX4A 1K0BA 1Z6NA 3ZVJA 2OACA 1XBSA 4X4JA 3L9VA 5EL8A 2GDRA 4KAEA 2H01A 4YKFA 1G7EA 2I9HA 3IA1A 5L71A 4XCSA 2VD0A 2GQLA 4USSA 4HZ4A 5CNWA 2H19A 3HVXA 2RM6A 5D9WA 2DKHA 4K7OA 4NHZA 1T8EB 1XWCA 5KN0A 1XCCA 2VUPA 2LRCA 2NPBA 2GTUA 4MABA 3F63A 3IPZA 4J57E 4Q5QA 2REMA 3UBKA 5ECKB 1R7HA 2LQOA 4YQVA 5IMCA 3ZREA 1A8LA 4IGJA 2FHEA 1VF2A 2F3MA 5IPGA 5HR1A 4EVMA 3D4MA 4BVYB 1UC7A 3HVVA 4ECCA 4H86A 2N5BA 4BA7A 3FZAA 5EPFA 4PURA 4ECIA 1AW9A 1X9MB 3ZZXA 1QGVA 3ZLPA 1GSQA 2E0QA 3ZIJA 4KCAA 5DVBA 17GSA 5ELAA 3US3A 1XVWA 1O81A 1PN0A 1U87A 5G31A 5C04A 2DC5A 2WS2A 3F6DA 3KJYA 5KEJA 1OE7A 4POBA 2QKEA 4N11A 1TP9A 4HJMA 3KGKA 4D73B 3D22A 1ERUA 3ZFLA 4HZ2A 3HZ4A 1PX7A 3LEFA 1EGOA 5HFGA 2K8VA 3IOSA 16GSA 3EYTA 6GSSA 1OC8A 1Z7RA 5JWOB 4WXTA 4JR4A 4ZBBA 3GL5A 3PGTA 2FCHA 3NZNA 4GSNA 3M3MA 5KOXA 4I8BA 4AGSA 3F6FA 3CSJA 1EWXA 4NV2A 4CW9A 2F8FA 4BL7B 4MNNA 1JLVA 3CSIA 4OO5A 1ERTA 1OC9A 3HVSA 1ABAA 3KTLA 4DSRA 4CY8A 1XW6A 4TXVA 4IBPA 2VM2A 3VWXA 4F03A 4YAVA 1G6WA 3TGZA 1I9DA 2RIIA 3FMWA 4K9ZA 2L57A 2CAQA 2BJXA 2AHEA 2DJ1A 3RAZA 2OBIA 1GSEA 4OMVA 2YWMA 2O8VB 2NBSA 2P5RA 4ILFA 3VPTA 3VLNA 5GSSA 3LWAA 5ECSA 3L0HA 2E2GA 3V1WA 3ZL5A 1PL1A 2DMLA 4MMMA 1T1VA 4FQUA 1JZRA 1Z3EA 4ICYA 4G19A 4KA0A 3F9UA 3LYKA 3ERFA 2JACA 3A2VA 2L6CA 4Q5FA 4I6XA 5C00A 2F51A 3QFAC 5AIXA 2KP1A 1FOVA 1PRXA 1M9BA 2DJJA 4NWYA 4GF0A 4X1UA 4KSMA 2EIRA 1RQMA 3I9V2 2B7JA 2J23A 4OD7A 1VRSD 3A5IA 3TUEA 1O73A 4V2LA 3I69A 2ZNMA 2E2MA 2GQMA 3PPUA 5ECRB 1OE8A 4XS4B 2GT5A 1KTEA 5IMDA 2LJRA 4FO5A 2IMKA 4MF5A 5B8BA 2VL2C 1TRWA 2AV4A 4F2IA 1GUKA 1MD3A 1FO5A 1OC3A 2PVQA 1J0FA 1AUCA 5JWRB 5D9XA 5IOXA 1DE1A 2I1UA 2LSTA 4I2UA 5A4VA 1XIYA 4G0KA 3H93A 2LRTA 1JFUA 1SU9A 2ZCTA 4ECJA 3QOUA 3EWLA 1K0DA 3TKPA 2A4HA 3O76A 2C4JA 3FW2A 1HNCA 4K1FA 1XPVA 4TRXA 14GSA 1B9YC 4O7HA 1B4QA 2HE3A 4F9ZA 2DJKA 2L5LA 3LORA 1OC9B 2YPMA 1TU7A 4XRAA 4ECBA 3KIJA 2C0DA 3QR6A 2XBQA 1GSYA 3WD6A 4EL1A 1X5DA 4MH3A 5ENUA 5JWQB 4DSSA 1M0UA 2VCTA 2LJAA 2G0FA 1X0RA 2V6OA 1DSBA 1V40A 3FEUA 2QGVA 1GLQA 2CZ2A 4TVEA 3H4KA 3FZ9A 4LL4B 4QQ7A 3BJ5A 4V1Ap 3IDVA 2VCWA 2IMDA 4FYBA 4GQCA 2P31A 3G9BA 3GUSA 3HD5A 1N2AA 2FWFA 4MPGA 3WT1A 1ML6A 3O6TA 4ULXA 1F37A 2VLUA 1SJ6A 3ZMKA 3LXZA 2YNXA 4IN0A 1C72A 3W8SA 3FR3A 3Q6OA 1ZZYA 5IMZA 5IPHA 1K3YA 2OKAA 3UARA 3H1NA 4EO3A 2YWOA 3KMOA 2VL2A 1JZWA 2G2QA 2HXKA 2H8LA 2MMZA 3VI5A 4ML6A 3ZFBA 1R4WA 3M0FA 1CQGA 1BAYA 2QC7A 2XPEA 4PNGA 2IIYA 5KOWA 3IRAA 2RM5A 2RUEA 3H79A 3WGEA 1OVNA 1GULA 1GSUA 4TR1A 3EU3A 4NAXA 2IPAA 2E7PA 4JR6A 5KN3A 1YEPA 2FWEA 4XHMA 2ZUPA 2O87A 3F4RA 3W6GA 1TI1A 4O5RA 4ZL7A 4N10A 5JCUA 1X5CA 2DBCA 3GKKA 3H8QA 2GVPA 3D5JA 5ELGA 1Q4JA 1DUGA 4K2XA 5ID2A 1A8YA 3LSZA 1NHYA 1TOFA 2R3XA 4XIHA 5IMAA 1O8WA 3G7YA 5H5SA 4KX4A 5INYA 2I3YA 4WF5A 3QDNA 1U88A 1JLWA 3KXOA 3CRUA 3TCOA 2TRCP 4PXOA 1URMA 2FUG2 2K9FA 1ZMAA 1FB0A 1SD8A 4GXZA 1ZGNA 4LL1B 1AAZA 2FLSA 3GURA 1XWKA 3RDWA 5A4WA 1YKAA 4JE1A 2VD1A 1SK1A 4ZBDA 4F0CA 4EIQA 4WKWA 1H75A 4MZWA 5CRGA 2DIZA 3KMNA 2YOIA 1M99A 2YJHA 3KP9A 2IFQA 1XW5A 4KDYA 5CRWA 1Z7PA 2JZSA 2K6VA 3LYPA 4X0XA 4NXIA 2VL3A 2YN1A 3IAM2 2PN8A 1H4OA 3P8WA 2IWTA 5H5RA 4Q5RA 2YZUA 3IK7A 1B4PA 2A2PA 4AJ8A 2HSMA 3ZVJD 2WDUA 2H71A 3TJFA 1GLPA 5AIVA 1YQ1A 3UJ1A 2R0PA 5D8IA 5DAKB 4MJAA 5J5NA 3R2QA 4KF9A 4PTSA 1XXUA 2VLVA 2VCXA 4WBJA 1A2JA 4TOPA 3WGXA 2Z9SA 1R5AA 3N9JA 4LMWA 3S9FA 2VCZA 2C1YA 2H0HA 2O85A 2PPTA 1PL2A 1WMJA 1WOUA 5IMFA 3C1RA 2L4QA 1SYRA 2WCIA 4G0IA 4YQUA 5D96A 1M9AA 4RQRA 3F8UA 4BWSA 3GSTA 3U5RE 3ZMLA 4MLYA 4MCUA 2DMMA 1TK5B 2GZPA 2GS3A 1MDIA 4WR4A 1NW2A 1SD9A 1GNWA 4LA1A 1ZYPA 1F9MA 3BCKA 3K8NA 3DVWA 2H1DA 5FT3A 2H0IA 2QA1A 2TRXA 3DRNA 2FY6A 3HYPA 1YDKA 4TXOA 1PQNA 4TR1B 4MK3A 4AF2A 1Q98A 3UOMA 1GRXA 3VWWA 1BG5A 1XOBA 3KD0A 2WJUA 4J56E 4IS0A 3MYDA 1GP1A 2H74A 2GSQA 1WJKA 5G5EA 3HDCA 4TR0A 2MMNA 3GH9A 5G5FA 2N5FA 1U6TA 2M46A 4JZQA 4PQIA 3I43A 1SK0A 2C3NA 4L5LA 4O5QA 3HZ8A 2LQQA 4HJ2A 1NSWA 1S3CA 3A5WA 3Q18A 2L6DA 3M8NA 3FR9A 2FGXA 3ISOA 2CVKA 4WF4A 2IMEA 3CRTA 1EV9A 2X4AA 1F3BA 3ERGA 1NM3A 1MDJA 4Q5NA 1SL2B 2R6KA 1U3IA 3QAWA 2H6XA 3F4TA 3FYGA 1PSQA 5FHIA 1AQXA 4G10A 4PNFA 4IQAA 2EIOA 4L8EA 2IFQB 1PN9A 4ZB9A 1T4YA 2DJ2A 2BMXA 5E59A 2B1KA 3C73A 3IXRA 1W4VA 1T00A 1G0TA 2GLRA 1WP0A 7GSSA 3EMPA 2L4CA 4PX1A 5E4WA 3GTUA 1M2BA 2H6ZA 3VURA 5HR0A 2CX3A 3IC8A 1QXHA 3SBCA 1TW9A 1R5PA 4MZBA 3EVIA 5ECQB 1HNBA 4K5RA 1EP7A 4MJBA 1A23A 2IL3A 5DCHA 4K0GA 4IVFA 3KZQA 1EP8A 2YWNA 1GL8A 4OFTA 3E9JB 2VCQA 3ZRDA 3D4TA 4POKA 5J9CA 3GIXA 3GNJA 1IYIA 2C0FA 2B5EA 4F82A 3M1GA 4MJCA 3LJRA 4I97A 1M2DA 2QSIA 3EC3A 3UVHA 2P5QA 3IR4A 4PUAA 2HSHA 2O89A 1M2AA 3KEBA 2C80A 1TTZA 2J9HA 2DJ0A 2WFCA 2KUCA 4L0WA 3TJJA 3D21A 3IK9A 2YV7A 4ID0A 2D2ZA 4TW5A 2CA8A 6GSWA 5CAXA 1AQVA 3FK8A 2IMFA 2FWHA 3CTGA 1T4ZA 1KEBA 4I2TA 4RUVA 1PX6A 18GSA 1QUWA 9GSSA 4BVXA 1SKSB 4XTSA 3C8EA 1JZDA 1PGTA 2I4AA 1YEXA 1PMTA 4MA9A 1J9BA 1GSFA 5EVOA 1QK8A 3P2AA 1FVKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L9U A;  4KUN A;  4KB3 A;  2KLX A;  2H66 A;  4AJ6 A;  2V41 A;  2V2G A;  2DSA A;  2HZE A;  3MNG A;  3EMX A;  2V6K A;  3JCM L;  5G2Z A;  1O85 A;  5B6M A;  1UN2 A;  2VL9 A;  4GRF A;  3TKS C;  1FG4 A;  4HQS A;  1HQO A;  3G7I A;  4ZL9 A;  1KNG A;  3RPN A;  5IMV A;  2H6Y A;  3MSZ A;  1GSD A;  1TJD A;  6GSV A;  1K0M A;  2PU9 C;  3GFK A;  2HLS A;  1Z5Y E;  2PWJ A;  3W8J A;  2XHF A;  5HFI A;  3NIV A;  3TKR A;  3CTF A;  1BX9 A;  2NTO A;  4BPY A;  1B48 A;  2JAD A;  1XZO A;  5COH A;  1GTB A;  4IKH A;  1AQW A;  5ECI B;  1ZL9 A;  2OAD A;  1UA5 A;  3IHQ A;  2HRF A;  2OE0 A;  1AIU A;  2L59 A;  3CMI A;  2AJQ B;  4ZL8 A;  5FWG A;  4I5Q A;  1K0N A;  2H1G A;  5F05 A;  1ILO A;  2AYT A;  2V32 A;  3UAP A;  1XW9 A;  1DE2 A;  4HI7 A;  2B3S A;  4YH2 A;  4XS6 A;  1BJX A;  4FYC A;  5F0G A;  4K8M A;  1BED A;  4EDZ A;  1FW1 A;  3CBU A;  2PBJ A;  1OYJ A;  1TI3 A;  1XWB A;  5IO0 A;  1FVJ A;  3FKF A;  3WT2 A;  4YAP A;  2HSY A;  1F2E A;  1GTI A;  1TKD B;  5DAL A;  5LCZ A;  4DSQ A;  4EC0 A;  3GSS A;  3VK9 A;  1RK4 A;  3QFB C;  4KSO A;  1S3A A;  5IM9 A;  2GQK A;  4GST A;  1XWA A;  3DWV A;  1SYX A;  3MWH A;  3ZTL A;  2X64 A;  3QAV A;  3HA9 A;  4CHS A;  4AJ7 A;  3UVT A;  2H73 A;  5ECL B;  3PR8 A;  2LS5 A;  3P90 A;  2YCD A;  3C7M A;  2KHP A;  2VAF A;  1OKT A;  3GX8 A;  5J4U A;  2HI7 A;  1X5E A;  5EY6 A;  4BVY A;  1GNE A;  1FAA A;  2EC4 A;  1ZOF A;  2IN3 A;  4PGT A;  1X9W B;  2ES7 A;  2EIQ A;  3A3T A;  3CYN A;  2H30 A;  11GS A;  5F07 A;  2HYX A;  4IEL A;  1QFN A;  3GKM A;  5GZZ B;  2H0G A;  1SJZ A;  4ZIJ A;  2X99 A;  1PA3 A;  2X8H A;  4RI7 A;  1KBN A;  4MF6 A;  2TIR A;  3TKS A;  2X8G A;  1EOG A;  1ST9 A;  2WZ9 A;  2P0G A;  1SL0 B;  2YJ7 A;  3IE3 A;  3O3T A;  3KM6 A;  3FR6 A;  3UMA A;  4GQF A;  1TRV A;  5DDL A;  4D73 A;  5J9B A;  3TDG A;  2VOC A;  1O7U A;  3RBT A;  13GS A;  1PKZ A;  1TK0 B;  4ZIL A;  1GUH A;  1HD2 A;  1EEM A;  1LBK A;  1TDI A;  3PIN A;  4TKY A;  3QAG A;  4TR3 A;  2B5X A;  4IW9 A;  2H76 A;  3APQ A;  1I5G A;  3VI7 A;  4WR5 A;  2B7K A;  1W89 A;  4MPF A;  2A4V A;  1WE0 A;  1TRU A;  2PMT A;  3BOA A;  3F3R A;  4IP1 A;  2YWI A;  4K6X A;  4OFM A;  5CRD A;  4BL7 A;  3NOF A;  1V98 A;  5B6N A;  4DSS B;  4K7I A;  2NDO A;  3DIE A;  2HNL A;  4ZB8 A;  3BD2 A;  2WB9 A;  3GL3 A;  3Q74 A;  4IJ3 A;  5DQS A;  2B6M A;  2K18 A;  3UIW A;  4GCI A;  3IC4 A;  3IAS 2;  3TJG A;  1B9X C;  4GTU A;  2X8C A;  4E8E A;  3N5O A;  4NMU A;  2R37 A;  5J3R A;  5B7C A;  4ISD A;  5G1L A;  3RHB A;  3KCM A;  5ECP B;  1YZX A;  2GZY A;  1FB6 A;  1V9W A;  5DAL B;  1EZK A;  3TJB A;  4DVC A;  2LJK A;  4KCE A;  3AY8 A;  3WGD A;  5HFK A;  3A2X A;  1VF1 A;  1AC1 A;  1ZCP A;  2DIY A;  1V2A A;  3PH9 A;  2GZZ A;  4HEA 2;  1A24 A;  1EV4 A;  2LRN A;  3LXT A;  4J2F A;  5AN1 A;  5A5K A;  5GAN D;  4KH7 A;  3VWV A;  1GSS A;  2GT6 A;  3RHC A;  3MDK A;  5IIZ A;  1EOH A;  1RW1 A;  3DYR A;  4OCF A;  1OAZ A;  2OBK A;  1ACV A;  2FWG A;  4HDE A;  4K0N A;  4KDU A;  4V1A g;  2GGT A;  3J7Y k;  3TKS E;  5AIS A;  3VWU A;  4HU7 A;  3EE2 A;  3EIN A;  4LMV A;  12GS A;  3TJK A;  2R5G A;  4XS4 A;  2CVD A;  2H1B A;  4XS1 A;  5ID2 B;  3HJP A;  1EGR A;  4EKZ A;  1FHE A;  3ME7 A;  5HQP A;  5DJL A;  2MZC A;  2DLX A;  3L9S A;  2FNO A;  1K0O A;  1THX A;  1S3D A;  3VFI A;  1VF4 A;  2C3Q A;  4XRD A;  3J7Y b;  1SK2 A;  1LJR A;  1ZYE A;  3QCP A;  2M72 A;  2CQ9 A;  3FHK A;  2OA7 A;  1HNA A;  4N0Z A;  4HOJ A;  1XFL A;  4V2M A;  2MYG A;  1A2M A;  5DJM A;  4RQX A;  1K3L A;  4N30 A;  2A2S A;  1VGL A;  2C0G A;  1YKC A;  3U6V A;  4CDO A;  6GST A;  4NV5 A;  3E3E A;  5ECM B;  3FZ5 A;  5IQY A;  4GLT A;  4OWY A;  4GWR A;  3GN3 A;  3CXG A;  3HHV A;  1Z6M A;  2CZ3 A;  5D93 A;  4MH2 A;  1V57 A;  3GYK A;  4YQM A;  4FIW A;  4IHU A;  2LV3 A;  3LQ7 A;  3BBY A;  2ON5 A;  4OCE A;  2WGR A;  3LG6 A;  4NHW A;  6GSU A;  5A4U A;  4WBR D;  2HT9 A;  3ZYW A;  1TK8 B;  4OFN A;  2PVO C;  5CRE A;  2BTO T;  4L5O A;  3TRP A;  1JHB A;  2ALB A;  5ECO B;  4EDY A;  2FA8 A;  2HFD A;  3CSH A;  1MTC A;  6GSX A;  1UVZ A;  1GUM A;  3GX0 A;  3QMX A;  5ECN B;  5B8A A;  2IJY A;  4ACS A;  3TRQ A;  3TOT A;  2JU5 A;  3HJM A;  4K7N A;  1DBY A;  4POL A;  2LKU A;  2LNS A;  1ERV A;  2KOK A;  2HZF A;  2F8A A;  3UL3 A;  4JBB A;  1O8X A;  2NVL A;  1SEN A;  2K8S A;  2JSY A;  2DJ3 A;  4PUF C;  1GH2 A;  3APO A;  2CVB A;  5JCW A;  1SJI A;  4KDX A;  1WIK A;  3TB2 A;  1THO A;  1V58 A;  3HJO A;  4O92 A;  2OE1 A;  1Y6E A;  1XVQ A;  1OKD A;  2B1L A;  3G7J A;  4TXO B;  4FYU A;  4QL7 A;  3ED3 A;  4JU5 A;  3EUR A;  1R26 A;  1USB A;  3EU4 A;  1PD2 1;  2CV4 A;  5CO3 A;  4LLR A;  3FZ4 A;  2XC2 A;  1SL1 B;  2OE3 A;  20GS A;  2O7K A;  2PER A;  3C71 A;  1ON4 A;  4EE0 A;  5H5Q A;  1A0R P;  2MBT A;  1E2Y A;  2MBS A;  3BCI A;  4K2D A;  4POM A;  1F3A A;  2C0E A;  5GST A;  4QL9 A;  3Q19 A;  3GMF A;  4PQ1 A;  2YV9 A;  3E0U A;  1GWC A;  1WRY A;  2AB6 A;  3DXB A;  5CP1 A;  2N5A A;  4KW6 A;  2JSZ A;  3FY7 A;  4HUA A;  2I81 A;  1SKW B;  1YF0 A;  2WRT A;  3UBL A;  4JED A;  1N8J A;  1XWG A;  2M80 A;  4P3Y B;  1J08 A;  3ZIV A;  3IV4 A;  3LFL A;  2L5O A;  4EUY A;  3WYW A;  1BYE A;  2B5Y A;  2JL4 A;  2AUV A;  2RLI A;  4MDC A;  3M9J A;  4IQ1 A;  4KND A;  2CT6 A;  2VIM A;  1SKR B;  5HR2 A;  3I6A A;  4BWQ A;  1TRS A;  5F8B A;  4DEJ A;  5J41 A;  1LU4 A;  8GSS A;  4MJE A;  3ME8 A;  1O6J A;  4NPB A;  22GS A;  3UEM A;  5G1K A;  3LGC A;  2V1M A;  4HQZ A;  4HU9 A;  3GTU B;  1YY7 A;  3F0I A;  2GST A;  2PUK C;  3TRX A;  4IJI A;  1QMV A;  1T7P B;  5D73 A;  5IO2 A;  4PQH A;  5LD0 A;  1A2L A;  4EF0 A;  4F0B A;  2JZT A;  1AXD A;  1CQH A;  1M7T A;  3HXS A;  1GTU A;  2YP6 A;  1A0F A;  3FRC A;  5DQY A;  5DBQ A;  1JZO A;  2JZR A;  4MP4 A;  5ABR A;  5CRH A;  1YF1 A;  3APS A;  3KTB A;  1MDK A;  2H72 A;  1NHO A;  3SWL A;  3VPQ A;  4FH8 A;  4KGI A;  5G30 A;  2PGT A;  4Z7X A;  4ML1 A;  1X9S B;  3GRX A;  1E6B A;  4MZC A;  5DAK A;  5DCG A;  4ZB6 A;  2F9S A;  4ZXG A;  5JCG A;  4L0U A;  1WPI A;  1QQ2 A;  3D0Z A;  4TR4 A;  2R2J A;  3DGQ A;  2KP2 A;  2VM1 A;  5AGY A;  1YJ6 A;  1K0C A;  4EXJ A;  1TU8 A;  2YAN A;  1VF3 A;  1GTA A;  3GKX A;  4N0V A;  4O32 A;  3TOU A;  3D6I A;  5KN1 A;  2YZH A;  3DEX A;  2FA4 A;  2LEG A;  1K0A A;  1T3B A;  3C1S A;  1EEJ A;  2A2R A;  1ZYQ B;  4TN8 A;  3GKN A;  3L78 A;  2HRN A;  2IMI A;  3ZIT A;  3DD3 A;  1HYU A;  3GHA A;  2VLT A;  4ZBA A;  10GS A;  3TKQ A;  1XOA A;  4E8H A;  1U3A A;  5IOW A;  2VO4 A;  4WET A;  2GSS A;  3KH9 A;  5HR3 A;  1G7O A;  4MF7 A;  2XPD A;  2OJL A;  4X43 A;  3M9K A;  4WEY A;  2HZE B;  4GSS A;  3DKS A;  3P7X A;  2LTK A;  3HKR A;  3MAK A;  3ERW A;  4IP6 A;  2RUF A;  1TXX A;  3F3Q A;  2FD3 A;  5D9T A;  4G9H A;  3A2W A;  1Z9H A;  4HS1 A;  5ECH B;  4KE3 A;  3IBH A;  2GSR A;  2C8U A;  2MMO A;  19GS A;  4OO4 A;  5GAP D;  3L4N A;  2WUL A;  2ON7 A;  1BQ7 A;  2H75 A;  1PKW A;  1IYH A;  4JRR A;  6GSY A;  3DML A;  3RPP A;  2LUS A;  3KH7 A;  1G6Y A;  4G2E A;  1F6M C;  3F4S A;  1ERW A;  1WWJ A;  3DVX A;  1B8X A;  3GA4 A;  1K3O A;  2VCV A;  1MD4 A;  2LNT A;  4RI6 A;  3GV1 A;  2XBI A;  3GH6 A;  3KP8 A;  2AAW A;  1MEK A;  3HCZ A;  5CYY A;  5F06 A;  5LNK e;  3OR5 A;  1Y25 A;  5D9V A;  2CAI A;  2H70 A;  3QD9 A;  5KN2 A;  2MMA A;  4V2N A;  2R4V A;  3QPM A;  3HY2 A;  2H1A A;  2C3T A;  2CX4 A;  1K0B A;  1Z6N A;  3ZVJ A;  2OAC A;  1XBS A;  3L9V A;  5EL8 A;  2GDR A;  4KAE A;  2H01 A;  1G7E A;  2I9H A;  3IA1 A;  5L71 A;  4XCS A;  2VD0 A;  2GQL A;  4HZ4 A;  5CNW A;  2H19 A;  3HVX A;  2RM6 A;  5D9W A;  4K7O A;  4NHZ A;  1T8E B;  1XWC A;  5KN0 A;  1XCC A;  2VUP A;  2LRC A;  2NPB A;  2GTU A;  4MAB A;  3F63 A;  3IPZ A;  4J57 E;  4Q5Q A;  2REM A;  3UBK A;  5ECK B;  1R7H A;  2LQO A;  4YQV A;  5IMC A;  3ZRE A;  1A8L A;  4IGJ A;  2FHE A;  1VF2 A;  2F3M A;  5IPG A;  5HR1 A;  4EVM A;  3D4M A;  1UC7 A;  3HVV A;  4ECC A;  4H86 A;  2N5B A;  4BA7 A;  3FZA A;  5EPF A;  4PUR A;  4ECI A;  1AW9 A;  1X9M B;  3ZZX A;  1QGV A;  3ZLP A;  1GSQ A;  2E0Q A;  3ZIJ A;  4KCA A;  5DVB A;  17GS A;  5ELA A;  3US3 A;  1XVW A;  1O81 A;  1U87 A;  5G31 A;  5C04 A;  2DC5 A;  2WS2 A;  3F6D A;  3KJY A;  5KEJ A;  1OE7 A;  4POB A;  2QKE A;  4N11 A;  1TP9 A;  4HJM A;  3KGK A;  4D73 B;  3D22 A;  1ERU A;  3ZFL A;  4HZ2 A;  3HZ4 A;  1PX7 A;  3LEF A;  1EGO A;  5HFG A;  2K8V A;  3IOS A;  16GS A;  3EYT A;  6GSS A;  1OC8 A;  1Z7R A;  5JWO B;  4WXT A;  4JR4 A;  4ZBB A;  3GL5 A;  3PGT A;  2FCH A;  3NZN A;  4GSN A;  3M3M A;  4I8B A;  4AGS A;  3F6F A;  3CSJ A;  1EWX A;  4NV2 A;  4CW9 A;  2F8F A;  1JLV A;  3CSI A;  4OO5 A;  1ERT A;  1OC9 A;  3HVS A;  1ABA A;  3KTL A;  4DSR A;  1XW6 A;  4TXV A;  4IBP A;  2VM2 A;  3VWX A;  4F03 A;  4YAV A;  1G6W A;  3TGZ A;  1I9D A;  2RII A;  4K9Z A;  2L57 A;  2CAQ A;  2BJX A;  2AHE A;  2DJ1 A;  3RAZ A;  2OBI A;  1GSE A;  4OMV A;  2YWM A;  2O8V B;  2NBS A;  2P5R A;  4ILF A;  3VPT A;  3VLN A;  5GSS A;  3LWA A;  5ECS A;  3L0H A;  2E2G A;  3V1W A;  3ZL5 A;  1PL1 A;  2DML A;  4MMM A;  1T1V A;  1JZR A;  1Z3E A;  4G19 A;  4KA0 A;  3F9U A;  3LYK A;  3ERF A;  2JAC A;  3A2V A;  2L6C A;  4Q5F A;  4I6X A;  5C00 A;  2F51 A;  3QFA C;  5AIX A;  2KP1 A;  1FOV A;  1PRX A;  1M9B A;  2DJJ A;  4NWY A;  4GF0 A;  4X1U A;  4KSM A;  2EIR A;  1RQM A;  3I9V 2;  2B7J A;  2J23 A;  4OD7 A;  1VRS D;  3TUE A;  1O73 A;  4V2L A;  3I69 A;  2ZNM A;  2E2M A;  2GQM A;  5ECR B;  1OE8 A;  4XS4 B;  2GT5 A;  1KTE A;  5IMD A;  2LJR A;  4FO5 A;  2IMK A;  4MF5 A;  5B8B A;  2VL2 C;  1TRW A;  2AV4 A;  4F2I A;  1GUK A;  1MD3 A;  1FO5 A;  1OC3 A;  2PVQ A;  1J0F A;  1AUC A;  5JWR B;  5D9X A;  5IOX A;  1DE1 A;  2I1U A;  2LST A;  4I2U A;  5A4V A;  1XIY A;  3H93 A;  2LRT A;  1JFU A;  1SU9 A;  2ZCT A;  4ECJ A;  3QOU A;  3EWL A;  1K0D A;  3TKP A;  3O76 A;  2C4J A;  3FW2 A;  1HNC A;  4K1F A;  1XPV A;  4TRX A;  14GS A;  1B9Y C;  4O7H A;  1B4Q A;  2HE3 A;  4F9Z A;  2DJK A;  2L5L A;  3LOR A;  1OC9 B;  2YPM A;  1TU7 A;  4XRA A;  4ECB A;  3KIJ A;  2C0D A;  3QR6 A;  2XBQ A;  1GSY A;  3WD6 A;  4EL1 A;  1X5D A;  4MH3 A;  5ENU A;  5JWQ B;  4DSS A;  1M0U A;  2VCT A;  2LJA A;  2G0F A;  1X0R A;  2V6O A;  1DSB A;  1V40 A;  3FEU A;  2QGV A;  1GLQ A;  2CZ2 A;  4TVE A;  3H4K A;  3FZ9 A;  4LL4 B;  4QQ7 A;  3BJ5 A;  4V1A p;  3IDV A;  2VCW A;  2IMD A;  4FYB A;  4GQC A;  2P31 A;  3G9B A;  3GUS A;  3HD5 A;  1N2A A;  2FWF A;  4MPG A;  3WT1 A;  1ML6 A;  3O6T A;  4ULX A;  1F37 A;  2VLU A;  1SJ6 A;  3ZMK A;  3LXZ A;  2YNX A;  4IN0 A;  1C72 A;  3W8S A;  3FR3 A;  3Q6O A;  1ZZY A;  5IMZ A;  5IPH A;  1K3Y A;  2OKA A;  3UAR A;  3H1N A;  4EO3 A;  2YWO A;  3KMO A;  2VL2 A;  1JZW A;  2G2Q A;  2HXK A;  2H8L A;  2MMZ A;  3VI5 A;  4ML6 A;  3ZFB A;  1R4W A;  3M0F A;  1CQG A;  1BAY A;  2QC7 A;  2XPE A;  4PNG A;  2IIY A;  3IRA A;  2RM5 A;  2RUE A;  3H79 A;  3WGE A;  1OVN A;  1GUL A;  1GSU A;  4TR1 A;  3EU3 A;  4NAX A;  2IPA A;  2E7P A;  4JR6 A;  5KN3 A;  1YEP A;  2FWE A;  4XHM A;  2ZUP A;  2O87 A;  3F4R A;  3W6G A;  1TI1 A;  4O5R A;  4ZL7 A;  4N10 A;  5JCU A;  1X5C A;  2DBC A;  3GKK A;  3H8Q A;  2GVP A;  3D5J A;  5ELG A;  1Q4J A;  1DUG A;  5ID2 A;  1A8Y A;  3LSZ A;  1NHY A;  1TOF A;  2R3X A;  4XIH A;  5IMA A;  1O8W A;  3G7Y A;  5H5S A;  4KX4 A;  5INY A;  2I3Y A;  4WF5 A;  3QDN A;  1U88 A;  1JLW A;  3KXO A;  3CRU A;  3TCO A;  2TRC P;  4PXO A;  1URM A;  2FUG 2;  2K9F A;  1ZMA A;  1FB0 A;  1SD8 A;  4GXZ A;  1ZGN A;  4LL1 B;  1AAZ A;  2FLS A;  3GUR A;  1XWK A;  3RDW A;  5A4W A;  1YKA A;  4JE1 A;  2VD1 A;  1SK1 A;  4ZBD A;  4F0C A;  4WKW A;  1H75 A;  4MZW A;  5CRG A;  2DIZ A;  3KMN A;  2YOI A;  1M99 A;  2YJH A;  3KP9 A;  2IFQ A;  1XW5 A;  4KDY A;  5CRW A;  1Z7P A;  2JZS A;  2K6V A;  3LYP A;  4X0X A;  4NXI A;  2VL3 A;  2YN1 A;  3IAM 2;  2PN8 A;  1H4O A;  3P8W A;  2IWT A;  5H5R A;  4Q5R A;  2YZU A;  3IK7 A;  1B4P A;  4AJ8 A;  3ZVJ D;  2WDU A;  2H71 A;  3TJF A;  1GLP A;  5AIV A;  1YQ1 A;  3UJ1 A;  5D8I A;  5DAK B;  4MJA A;  5J5N A;  3R2Q A;  1XXU A;  2VLV A;  2VCX A;  4WBJ A;  1A2J A;  4TOP A;  3WGX A;  2Z9S A;  1R5A A;  3N9J A;  4LMW A;  3S9F A;  2VCZ A;  2C1Y A;  2H0H A;  2O85 A;  2PPT A;  1PL2 A;  1WMJ A;  1WOU A;  5IMF A;  3C1R A;  2L4Q A;  1SYR A;  2WCI A;  4YQU A;  5D96 A;  1M9A A;  4RQR A;  3F8U A;  4BWS A;  3GST A;  3U5R E;  3ZML A;  4MLY A;  4MCU A;  2DMM A;  1TK5 B;  2GZP A;  2GS3 A;  1MDI A;  4WR4 A;  1NW2 A;  1SD9 A;  1GNW A;  4LA1 A;  1F9M A;  3BCK A;  3K8N A;  3DVW A;  2H1D A;  5FT3 A;  2H0I A;  2TRX A;  3DRN A;  2FY6 A;  3HYP A;  1YDK A;  4TXO A;  1PQN A;  4TR1 B;  4MK3 A;  4AF2 A;  1Q98 A;  3UOM A;  1GRX A;  3VWW A;  1BG5 A;  1XOB A;  3KD0 A;  2WJU A;  4J56 E;  4IS0 A;  1GP1 A;  2H74 A;  2GSQ A;  1WJK A;  5G5E A;  3HDC A;  4TR0 A;  2MMN A;  3GH9 A;  5G5F A;  2N5F A;  1U6T A;  2M46 A;  4JZQ A;  4PQI A;  3I43 A;  1SK0 A;  2C3N A;  4L5L A;  3HZ8 A;  2LQQ A;  4HJ2 A;  1NSW A;  1S3C A;  3A5W A;  3Q18 A;  2L6D A;  3M8N A;  3FR9 A;  2FGX A;  3ISO A;  2CVK A;  4WF4 A;  2IME A;  3CRT A;  1EV9 A;  1F3B A;  3ERG A;  1NM3 A;  1MDJ A;  4Q5N A;  1SL2 B;  2R6K A;  1U3I A;  3QAW A;  2H6X A;  3F4T A;  3FYG A;  1PSQ A;  5FHI A;  1AQX A;  4G10 A;  4IQA A;  4PNF A;  2EIO A;  4L8E A;  2IFQ B;  1PN9 A;  4ZB9 A;  1T4Y A;  2DJ2 A;  2BMX A;  5E59 A;  2B1K A;  3C73 A;  3IXR A;  1W4V A;  1T00 A;  1G0T A;  2GLR A;  1WP0 A;  7GSS A;  3EMP A;  2L4C A;  4PX1 A;  5E4W A;  3GTU A;  1M2B A;  2H6Z A;  3VUR A;  5HR0 A;  2CX3 A;  1QXH A;  3SBC A;  1TW9 A;  1R5P A;  4MZB A;  3EVI A;  5ECQ B;  1HNB A;  1EP7 A;  4MJB A;  1A23 A;  2IL3 A;  5DCH A;  4K0G A;  4IVF A;  3KZQ A;  1EP8 A;  2YWN A;  1GL8 A;  4OFT A;  3E9J B;  2VCQ A;  3ZRD A;  3D4T A;  4POK A;  5J9C A;  3GIX A;  3GNJ A;  1IYI A;  2C0F A;  2B5E A;  4F82 A;  3M1G A;  4MJC A;  3LJR A;  4I97 A;  1M2D A;  2QSI A;  3EC3 A;  3UVH A;  2P5Q A;  3IR4 A;  4PUA A;  2HSH A;  2O89 A;  1M2A A;  3KEB A;  2C80 A;  1TTZ A;  2J9H A;  2DJ0 A;  2WFC A;  2KUC A;  4L0W A;  3TJJ A;  3D21 A;  3IK9 A;  2YV7 A;  4ID0 A;  2D2Z A;  4TW5 A;  2CA8 A;  6GSW A;  5CAX A;  1AQV A;  3FK8 A;  2IMF A;  2FWH A;  3CTG A;  1T4Z A;  1KEB A;  4I2T A;  4RUV A;  1PX6 A;  18GS A;  1QUW A;  9GSS A;  4BVX A;  1SKS B;  4XTS A;  3C8E A;  1JZD A;  1PGT A;  2I4A A;  1YEX A;  1PMT A;  4MA9 A;  1J9B A;  1GSF A;  5EVO A;  1QK8 A;  3P2A A;  1FVK A; 
#chains in the Genus database with same CATH topology
 3L9U A;  4KUN A;  4KB3 A;  2KLX A;  3MIX A;  2H66 A;  4AJ6 A;  2V41 A;  2V2G A;  2DSA A;  2HZE A;  3MNG A;  3EMX A;  2DKI A;  2V6K A;  5G2Z A;  3JCM L;  1O85 A;  5B6M A;  1UN2 A;  3CQF A;  2VL9 A;  4GRF A;  3TKS C;  1FG4 A;  4HQS A;  1HQO A;  3G7I A;  4ZL9 A;  1KNG A;  3RPN A;  5IMV A;  2H6Y A;  3MSZ A;  1GSD A;  1TJD A;  6GSV A;  1K0M A;  2PU9 C;  3GFK A;  2HLS A;  1Z5Y E;  2PWJ A;  3W8J A;  2XHF A;  5HFI A;  3NIV A;  1S3R A;  3TKR A;  3CTF A;  1FOH A;  1BX9 A;  2NTO A;  4BPY A;  1B48 A;  2JAD A;  1XZO A;  5COH A;  1GTB A;  4IKH A;  1AQW A;  5ECI B;  1ZL9 A;  2OAD A;  1UA5 A;  4CY6 A;  3IHQ A;  2HRF A;  2OE0 A;  1AIU A;  2L59 A;  3CMI A;  4Z2U A;  2AJQ B;  4ZL8 A;  5FWG A;  4I5Q A;  1K0N A;  2H1G A;  5F05 A;  1ILO A;  2AYT A;  2V32 A;  3UAP A;  1XW9 A;  1DE2 A;  4BIK A;  4HI7 A;  2B3S A;  4YH2 A;  3LW9 A;  4XS6 A;  1BJX A;  4FYC A;  5F0G A;  4K8M A;  1BED A;  4EDZ A;  1FW1 A;  3CBU A;  2PBJ A;  1OYJ A;  1TI3 A;  1XWB A;  5IO0 A;  1FVJ A;  3FKF A;  3WT2 A;  4YAP A;  2HSY A;  1F2E A;  1GTI A;  1TKD B;  5DAL A;  5LCZ A;  4DSQ A;  4EC0 A;  3GSS A;  3VK9 A;  1RK4 A;  3QFB C;  4KSO A;  1S3A A;  5IM9 A;  2GQK A;  4GST A;  2HRK A;  1XWA A;  3DWV A;  1SYX A;  3MWH A;  3ZTL A;  2X64 A;  3QAV A;  3HA9 A;  4CHS A;  4AJ7 A;  3UVT A;  2H73 A;  5ECL B;  3PR8 A;  3P90 A;  2LS5 A;  3IHG A;  2YCD A;  3C7M A;  2KHP A;  2VAF A;  1OKT A;  3GX8 A;  5J4U A;  2HI7 A;  1X5E A;  5EY6 A;  4BVY A;  1GNE A;  1FAA A;  2EC4 A;  1ZOF A;  2IN3 A;  4PGT A;  1X9W B;  2ES7 A;  2EIQ A;  3A3T A;  3CYN A;  2H30 A;  11GS A;  5F07 A;  2HYX A;  4IEL A;  1QFN A;  3GKM A;  5GZZ B;  2H0G A;  1SJZ A;  4ZIJ A;  2X99 A;  1PA3 A;  2X8H A;  4RI7 A;  1KBN A;  4MF6 A;  2TIR A;  3TKS A;  2X8G A;  1EOG A;  1ST9 A;  2WZ9 A;  2P0G A;  1SL0 B;  4K5S A;  2YJ7 A;  3IE3 A;  3O3T A;  3KM6 A;  3FR6 A;  3UMA A;  4GQF A;  1TRV A;  5DDL A;  4D73 A;  5J9B A;  3TDG A;  2VOC A;  1O7U A;  3RBT A;  13GS A;  1PKZ A;  1TK0 B;  4ZIL A;  1GUH A;  1HD2 A;  1EEM A;  1LBK A;  1TDI A;  3PIN A;  4TKY A;  3QAG A;  4TR3 A;  2B5X A;  4IW9 A;  2H76 A;  3APQ A;  1I5G A;  3VI7 A;  4WR5 A;  2B7K A;  1W89 A;  4MPF A;  2A4V A;  1WE0 A;  1TRU A;  2PMT A;  3BOA A;  3F3R A;  4IP1 A;  2YWI A;  4K6X A;  4OFM A;  5CRD A;  4BL7 A;  3NOF A;  1V98 A;  5B6N A;  4DSS B;  4K7I A;  2NDO A;  3DIE A;  2HNL A;  4ZB8 A;  3EPT A;  2R0G A;  3BD2 A;  2WB9 A;  3GL3 A;  3Q74 A;  4IJ3 A;  5DQS A;  2B6M A;  2K18 A;  3UIW A;  4GCI A;  3IC4 A;  3IAS 2;  3TJG A;  1B9X C;  2X49 A;  4GTU A;  2X8C A;  4E8E A;  3N5O A;  4NMU A;  2R37 A;  5J3R A;  5B7C A;  4ISD A;  5G1L A;  3RHB A;  3KCM A;  5ECP B;  1YZX A;  2GZY A;  1FB6 A;  1V9W A;  5DAL B;  1EZK A;  3TJB A;  4DVC A;  2LJK A;  4KCE A;  2HRA A;  3AY8 A;  3WGD A;  5HFK A;  3A2X A;  1VF1 A;  1AC1 A;  2UZ8 A;  1ZCP A;  2DIY A;  1V2A A;  3PH9 A;  2GZZ A;  4HEA 2;  4A5P A;  1A24 A;  1EV4 A;  2LRN A;  3LXT A;  4J2F A;  5AN1 A;  5A5K A;  5GAN D;  4KH7 A;  3VWV A;  1GSS A;  2GT6 A;  3RHC A;  3MDK A;  5IIZ A;  1EOH A;  1RW1 A;  4Z2R A;  4Z2T A;  3DYR A;  4OCF A;  1OAZ A;  2OBK A;  1ACV A;  2FWG A;  4HDE A;  4K0N A;  4KDU A;  4V1A g;  2GGT A;  3J7Y k;  3TKS E;  5AIS A;  3VWU A;  4HU7 A;  3EE2 A;  3EIN A;  4LMV A;  12GS A;  3TJK A;  2R5G A;  4XS4 A;  2CVD A;  2H1B A;  4XS1 A;  5ID2 B;  3HJP A;  1EGR A;  4EKZ A;  1FHE A;  3ME7 A;  5HQP A;  5DJL A;  2MZC A;  2DLX A;  3L9S A;  2FNO A;  1K0O A;  1THX A;  1S3D A;  3VFI A;  1VF4 A;  2C3Q A;  4XRD A;  3J7Y b;  1SK2 A;  1LJR A;  1ZYE A;  3QCP A;  2M72 A;  2CQ9 A;  3FHK A;  2OA7 A;  4EIP A;  1HNA A;  4N0Z A;  4HOJ A;  1XFL A;  4V2M A;  2MYG A;  1A2M A;  5DJM A;  4RQX A;  1K3L A;  4N30 A;  2A2S A;  1VGL A;  2C0G A;  1YKC A;  3U6V A;  4CDO A;  6GST A;  4NV5 A;  3E3E A;  5ECM B;  3FZ5 A;  5IQY A;  4GLT A;  4OWY A;  4GWR A;  3GN3 A;  3CXG A;  3HHV A;  1Z6M A;  2CZ3 A;  5D93 A;  4MH2 A;  1V57 A;  3GYK A;  4YQM A;  4FIW A;  4IHU A;  2LV3 A;  3LQ7 A;  3BBY A;  2ON5 A;  4OCE A;  2WGR A;  3LG6 A;  4NHW A;  6GSU A;  5A4U A;  4WBR D;  2HT9 A;  3ZYW A;  1TK8 B;  4OFN A;  2PVO C;  5CRE A;  2BTO T;  4L5O A;  3TRP A;  1JHB A;  2ALB A;  5ECO B;  4EDY A;  2FA8 A;  2HFD A;  3CSH A;  1MTC A;  6GSX A;  1UVZ A;  1GUM A;  3GX0 A;  3QMX A;  5ECN B;  5B8A A;  2IJY A;  4ACS A;  3TRQ A;  3TOT A;  2JU5 A;  3HJM A;  4K7N A;  1DBY A;  4POL A;  2LKU A;  2LNS A;  1ERV A;  2KOK A;  2HZF A;  2F8A A;  3UL3 A;  4JBB A;  1O8X A;  2NVL A;  1SEN A;  2K8S A;  2JSY A;  2DJ3 A;  1PFO A;  1GH2 A;  4PUF C;  3APO A;  2CVB A;  5JCW A;  1SJI A;  4KDX A;  1WIK A;  3TB2 A;  4YKG A;  1THO A;  1V58 A;  3HJO A;  4O92 A;  2OE1 A;  1Y6E A;  1XVQ A;  1OKD A;  2B1L A;  3G7J A;  4TXO B;  4FYU A;  4QL7 A;  3ED3 A;  4JU5 A;  3EUR A;  1R26 A;  1USB A;  3EU4 A;  1PD2 1;  2CV4 A;  5CO3 A;  4LLR A;  3FZ4 A;  2R0C A;  2XC2 A;  1SL1 B;  2OE3 A;  20GS A;  2O7K A;  2PER A;  3C71 A;  1ON4 A;  4EE0 A;  5H5Q A;  1A0R P;  2MBT A;  1E2Y A;  2MBS A;  3BCI A;  4K2D A;  4POM A;  1F3A A;  2C0E A;  5GST A;  4QL9 A;  3Q19 A;  3GMF A;  4PQ1 A;  2YV9 A;  3E0U A;  1GWC A;  1WRY A;  2AB6 A;  3DXB A;  5CP1 A;  2N5A A;  4KW6 A;  2JSZ A;  3FY7 A;  4HUA A;  2I81 A;  1SKW B;  1YF0 A;  2WRT A;  3UBL A;  4JED A;  1N8J A;  1XWG A;  2M80 A;  4P3Y B;  1J08 A;  3ZIV A;  3IV4 A;  3LFL A;  2L5O A;  4EUY A;  3WYW A;  1BYE A;  2B5Y A;  2JL4 A;  2AUV A;  2RLI A;  4MDC A;  3M9J A;  4IQ1 A;  4KND A;  2CT6 A;  2VIM A;  1SKR B;  5HR2 A;  3I6A A;  4BWQ A;  1TRS A;  5F8B A;  4DEJ A;  5J41 A;  1LU4 A;  8GSS A;  4MJE A;  3ME8 A;  1O6J A;  4NPB A;  22GS A;  3UEM A;  5G1K A;  3LGC A;  2V1M A;  4HQZ A;  4HU9 A;  3GTU B;  1YY7 A;  3F0I A;  2GST A;  2PUK C;  3TRX A;  4IJI A;  1QMV A;  1T7P B;  5D73 A;  5IO2 A;  4PQH A;  5LD0 A;  1A2L A;  4EF0 A;  4F0B A;  2JZT A;  1AXD A;  1CQH A;  1M7T A;  3HXS A;  1GTU A;  5BRT A;  2YP6 A;  1A0F A;  3FRC A;  5DQY A;  5DBQ A;  1JZO A;  2JZR A;  4MP4 A;  5ABR A;  5CRH A;  1YF1 A;  3APS A;  3KTB A;  1MDK A;  2H72 A;  1NHO A;  3SWL A;  3VPQ A;  4FH8 A;  4KGI A;  5G30 A;  2PGT A;  4Z7X A;  4ML1 A;  1X9S B;  3GRX A;  1E6B A;  4MZC A;  5DAK A;  5DCG A;  4ZB6 A;  2F9S A;  4ZXG A;  5JCG A;  4L0U A;  1WPI A;  1QQ2 A;  3D0Z A;  4TR4 A;  1M3J A;  2R2J A;  3DGQ A;  2KP2 A;  2VM1 A;  5AGY A;  1YJ6 A;  1K0C A;  4EXJ A;  1TU8 A;  2YAN A;  1VF3 A;  1GTA A;  3GKX A;  4N0V A;  4O32 A;  3TOU A;  3D6I A;  5KN1 A;  1ZYN A;  2YZH A;  3DEX A;  2FA4 A;  2LEG A;  1K0A A;  1T3B A;  3C1S A;  1EEJ A;  2A2R A;  4O5U A;  1ZYQ B;  4TN8 A;  3GKN A;  3L78 A;  4G0L A;  2HRN A;  2IMI A;  3ZIT A;  4BVX B;  3DD3 A;  1HYU A;  3GHA A;  2VLT A;  4ZBA A;  10GS A;  3TKQ A;  1XOA A;  4E8H A;  1U3A A;  5IOW A;  2VO4 A;  4WET A;  2GSS A;  3KH9 A;  5HR3 A;  1G7O A;  4MF7 A;  2XPD A;  2OJL A;  4X43 A;  3M9K A;  4WEY A;  2HZE B;  4GSS A;  3DKS A;  3P7X A;  2LTK A;  3HKR A;  3MAK A;  3R3E A;  3ERW A;  4IP6 A;  2RUF A;  1TXX A;  3F3Q A;  2FD3 A;  5D9T A;  4G9H A;  5BMU A;  3A2W A;  1Z9H A;  4HS1 A;  5ECH B;  4KE3 A;  3IBH A;  2GSR A;  2C8U A;  2QA2 A;  2MMO A;  19GS A;  4OO4 A;  5GAP D;  3L4N A;  2WUL A;  2ON7 A;  1BQ7 A;  2H75 A;  1PKW A;  1IYH A;  4JRR A;  6GSY A;  3DML A;  3RPP A;  2LUS A;  3KH7 A;  1G6Y A;  4G2E A;  1F6M C;  3F4S A;  1ERW A;  1WWJ A;  3DVX A;  1B8X A;  3GA4 A;  1K3O A;  2VCV A;  1MD4 A;  2LNT A;  4RI6 A;  3GV1 A;  2XBI A;  3GH6 A;  3KP8 A;  2AAW A;  1MEK A;  3HCZ A;  5CYY A;  5F06 A;  5LNK e;  3OR5 A;  1Y25 A;  5D9V A;  2CAI A;  2H70 A;  3QD9 A;  5KN2 A;  2MMA A;  4V2N A;  2R4V A;  3QPM A;  3HY2 A;  2H1A A;  2C3T A;  2CX4 A;  1K0B A;  1Z6N A;  3ZVJ A;  2OAC A;  1XBS A;  4X4J A;  3L9V A;  5EL8 A;  2GDR A;  4KAE A;  2H01 A;  4YKF A;  1G7E A;  2I9H A;  3IA1 A;  5L71 A;  4XCS A;  2VD0 A;  2GQL A;  4USS A;  1M3I A;  4HZ4 A;  5CNW A;  2H19 A;  3HVX A;  2RM6 A;  5D9W A;  2DKH A;  4K7O A;  4NHZ A;  1T8E B;  1XWC A;  5KN0 A;  1XCC A;  2VUP A;  2LRC A;  2NPB A;  2GTU A;  4MAB A;  3F63 A;  3IPZ A;  4J57 E;  4Q5Q A;  2REM A;  3UBK A;  5ECK B;  1R7H A;  2LQO A;  4YQV A;  5IMC A;  3ZRE A;  1A8L A;  4IGJ A;  2FHE A;  1VF2 A;  2F3M A;  5IPG A;  5HR1 A;  4EVM A;  3D4M A;  4BVY B;  1UC7 A;  3HVV A;  4ECC A;  4H86 A;  2N5B A;  4BA7 A;  3FZA A;  5EPF A;  4PUR A;  4ECI A;  1AW9 A;  1X9M B;  3ZZX A;  1QGV A;  3ZLP A;  1GSQ A;  2E0Q A;  3ZIJ A;  4KCA A;  5DVB A;  17GS A;  5ELA A;  3US3 A;  1XVW A;  1O81 A;  1PN0 A;  1U87 A;  5G31 A;  5C04 A;  2DC5 A;  2WS2 A;  3F6D A;  3KJY A;  5KEJ A;  1OE7 A;  4POB A;  2QKE A;  4N11 A;  1TP9 A;  4HJM A;  3KGK A;  4D73 B;  3D22 A;  1ERU A;  3ZFL A;  3HVN A;  4HZ2 A;  4HSC X;  3HZ4 A;  1PX7 A;  3LEF A;  1EGO A;  5HFG A;  2K8V A;  3IOS A;  16GS A;  3EYT A;  6GSS A;  1OC8 A;  1Z7R A;  5JWO B;  4WXT A;  4JR4 A;  4ZBB A;  3GL5 A;  3PGT A;  2FCH A;  3NZN A;  4GSN A;  3M3M A;  5KOX A;  4I8B A;  4AGS A;  3F6F A;  3CSJ A;  1EWX A;  4NV2 A;  4CW9 A;  2F8F A;  4BL7 B;  4MNN A;  1JLV A;  3CSI A;  4OO5 A;  1ERT A;  1OC9 A;  3HVS A;  1ABA A;  3KTL A;  4DSR A;  4CY8 A;  1XW6 A;  4TXV A;  4IBP A;  2VM2 A;  3VWX A;  4F03 A;  4YAV A;  1G6W A;  3TGZ A;  1I9D A;  2RII A;  3FMW A;  4K9Z A;  2L57 A;  2CAQ A;  2BJX A;  2AHE A;  2DJ1 A;  3RAZ A;  2OBI A;  1GSE A;  4OMV A;  2YWM A;  2O8V B;  2NBS A;  2P5R A;  4ILF A;  3VPT A;  3VLN A;  5GSS A;  3LWA A;  5ECS A;  3L0H A;  2E2G A;  3V1W A;  3ZL5 A;  1PL1 A;  2DML A;  4MMM A;  1T1V A;  4FQU A;  1JZR A;  1Z3E A;  4ICY A;  4G19 A;  4KA0 A;  3F9U A;  3LYK A;  3ERF A;  2JAC A;  3A2V A;  2L6C A;  4Q5F A;  4I6X A;  5C00 A;  2F51 A;  3QFA C;  5AIX A;  2KP1 A;  1FOV A;  1PRX A;  1M9B A;  2DJJ A;  4NWY A;  4GF0 A;  4X1U A;  4KSM A;  2EIR A;  1RQM A;  3I9V 2;  2B7J A;  2J23 A;  4OD7 A;  1VRS D;  3A5I A;  3TUE A;  1O73 A;  4V2L A;  3I69 A;  2ZNM A;  2E2M A;  2GQM A;  3PPU A;  5ECR B;  1OE8 A;  4XS4 B;  2GT5 A;  1KTE A;  5IMD A;  2LJR A;  4FO5 A;  2IMK A;  4MF5 A;  5B8B A;  2VL2 C;  1TRW A;  2AV4 A;  4F2I A;  1GUK A;  1MD3 A;  1FO5 A;  1OC3 A;  2PVQ A;  1J0F A;  1AUC A;  5JWR B;  5D9X A;  5IOX A;  1DE1 A;  2I1U A;  2LST A;  4I2U A;  5A4V A;  1XIY A;  4G0K A;  3H93 A;  2LRT A;  1JFU A;  1SU9 A;  2ZCT A;  4ECJ A;  3QOU A;  3EWL A;  1K0D A;  3TKP A;  2A4H A;  3O76 A;  2C4J A;  3FW2 A;  1HNC A;  4K1F A;  1XPV A;  4TRX A;  14GS A;  1B9Y C;  4O7H A;  1B4Q A;  2HE3 A;  4F9Z A;  2DJK A;  2L5L A;  3LOR A;  1OC9 B;  2YPM A;  1TU7 A;  4XRA A;  4ECB A;  3KIJ A;  2C0D A;  3QR6 A;  2XBQ A;  1GSY A;  3WD6 A;  4EL1 A;  1X5D A;  4MH3 A;  5ENU A;  5JWQ B;  4DSS A;  1M0U A;  2VCT A;  2LJA A;  2G0F A;  1X0R A;  2V6O A;  1DSB A;  1V40 A;  3FEU A;  2QGV A;  1GLQ A;  2CZ2 A;  4TVE A;  3H4K A;  3FZ9 A;  4LL4 B;  4QQ7 A;  3BJ5 A;  4V1A p;  3IDV A;  2VCW A;  2IMD A;  4FYB A;  4GQC A;  2P31 A;  3G9B A;  3GUS A;  3HD5 A;  1N2A A;  2FWF A;  4MPG A;  3WT1 A;  1ML6 A;  3O6T A;  4ULX A;  1F37 A;  2VLU A;  1SJ6 A;  3ZMK A;  3LXZ A;  2YNX A;  4IN0 A;  1C72 A;  3W8S A;  3FR3 A;  3Q6O A;  1ZZY A;  5IMZ A;  5IPH A;  1K3Y A;  2OKA A;  3UAR A;  3H1N A;  4EO3 A;  2YWO A;  3KMO A;  2VL2 A;  1JZW A;  2G2Q A;  2HXK A;  2H8L A;  2MMZ A;  3VI5 A;  4ML6 A;  3ZFB A;  1R4W A;  3M0F A;  1CQG A;  1BAY A;  2QC7 A;  2XPE A;  1XG8 A;  4PNG A;  2IIY A;  5KOW A;  3IRA A;  2RM5 A;  2RUE A;  3H79 A;  3WGE A;  1OVN A;  1GUL A;  1GSU A;  4TR1 A;  3EU3 A;  4NAX A;  2IPA A;  2E7P A;  4JR6 A;  5KN3 A;  1YEP A;  2FWE A;  4XHM A;  2ZUP A;  2O87 A;  3F4R A;  3W6G A;  1TI1 A;  4O5R A;  4ZL7 A;  4N10 A;  5JCU A;  1X5C A;  2DBC A;  3GKK A;  3H8Q A;  2GVP A;  3D5J A;  5ELG A;  1Q4J A;  1DUG A;  4K2X A;  5ID2 A;  1A8Y A;  3LSZ A;  1NHY A;  1TOF A;  2R3X A;  4XIH A;  5IMA A;  1O8W A;  3G7Y A;  5H5S A;  4KX4 A;  5INY A;  2I3Y A;  4WF5 A;  3QDN A;  1U88 A;  1JLW A;  3KXO A;  3CRU A;  3TCO A;  2TRC P;  4PXO A;  1URM A;  2FUG 2;  2K9F A;  1ZMA A;  1FB0 A;  1SD8 A;  4GXZ A;  1ZGN A;  4LL1 B;  1AAZ A;  2FLS A;  3GUR A;  1XWK A;  3RDW A;  5A4W A;  1YKA A;  4JE1 A;  2VD1 A;  1SK1 A;  4ZBD A;  4F0C A;  4EIQ A;  4WKW A;  1H75 A;  4MZW A;  5CRG A;  2DIZ A;  3KMN A;  2YOI A;  1M99 A;  2YJH A;  3KP9 A;  2IFQ A;  1XW5 A;  4KDY A;  5CRW A;  1Z7P A;  2JZS A;  2K6V A;  3LYP A;  4X0X A;  4NXI A;  2VL3 A;  2YN1 A;  3IAM 2;  2PN8 A;  1H4O A;  3P8W A;  2IWT A;  5H5R A;  4Q5R A;  2YZU A;  3IK7 A;  1B4P A;  2A2P A;  4AJ8 A;  2HSM A;  3ZVJ D;  2WDU A;  2H71 A;  3TJF A;  1GLP A;  5AIV A;  1YQ1 A;  3UJ1 A;  2R0P A;  5D8I A;  5DAK B;  4MJA A;  5J5N A;  3R2Q A;  4KF9 A;  4PTS A;  1XXU A;  2VLV A;  2VCX A;  4WBJ A;  1A2J A;  4TOP A;  3WGX A;  2Z9S A;  1R5A A;  3N9J A;  4LMW A;  3S9F A;  2VCZ A;  2C1Y A;  2H0H A;  2O85 A;  2PPT A;  1PL2 A;  1WMJ A;  1WOU A;  5IMF A;  3C1R A;  2L4Q A;  1SYR A;  2WCI A;  4G0I A;  4YQU A;  5D96 A;  1M9A A;  4RQR A;  3F8U A;  4BWS A;  3GST A;  3U5R E;  3ZML A;  4MLY A;  4MCU A;  2DMM A;  1TK5 B;  2GZP A;  2GS3 A;  1MDI A;  4WR4 A;  1NW2 A;  1SD9 A;  1GNW A;  4LA1 A;  1ZYP A;  1F9M A;  3BCK A;  3K8N A;  3DVW A;  2H1D A;  5FT3 A;  2H0I A;  2QA1 A;  2TRX A;  3DRN A;  2FY6 A;  3HYP A;  1YDK A;  4TXO A;  1PQN A;  4TR1 B;  4MK3 A;  4AF2 A;  1Q98 A;  3UOM A;  1GRX A;  3VWW A;  1BG5 A;  1XOB A;  3KD0 A;  2WJU A;  4J56 E;  4IS0 A;  3MYD A;  1GP1 A;  2H74 A;  2GSQ A;  1WJK A;  5G5E A;  3HDC A;  4TR0 A;  2MMN A;  3GH9 A;  5G5F A;  2N5F A;  1U6T A;  2M46 A;  4JZQ A;  4PQI A;  3I43 A;  1SK0 A;  2C3N A;  4L5L A;  4O5Q A;  3HZ8 A;  2LQQ A;  4HJ2 A;  1NSW A;  1S3C A;  3A5W A;  3Q18 A;  2L6D A;  3M8N A;  3FR9 A;  2FGX A;  3ISO A;  2CVK A;  4WF4 A;  2IME A;  3CRT A;  1EV9 A;  2X4A A;  1F3B A;  3ERG A;  1NM3 A;  1MDJ A;  4Q5N A;  1SL2 B;  2R6K A;  1U3I A;  3QAW A;  2H6X A;  3F4T A;  3FYG A;  1PSQ A;  5FHI A;  1AQX A;  4G10 A;  4PNF A;  4IQA A;  2EIO A;  4L8E A;  2IFQ B;  1PN9 A;  4ZB9 A;  1T4Y A;  2DJ2 A;  2BMX A;  5E59 A;  2B1K A;  3C73 A;  3IXR A;  1W4V A;  1T00 A;  1G0T A;  2GLR A;  1WP0 A;  7GSS A;  3EMP A;  2L4C A;  4PX1 A;  5E4W A;  3GTU A;  1M2B A;  2H6Z A;  3VUR A;  5HR0 A;  2CX3 A;  3IC8 A;  1QXH A;  3SBC A;  1TW9 A;  1R5P A;  4MZB A;  3EVI A;  5ECQ B;  1HNB A;  4K5R A;  1EP7 A;  4MJB A;  1A23 A;  2IL3 A;  5DCH A;  4K0G A;  4IVF A;  3KZQ A;  1EP8 A;  2YWN A;  1GL8 A;  4OFT A;  3E9J B;  2VCQ A;  3ZRD A;  3D4T A;  4POK A;  5J9C A;  3GIX A;  3GNJ A;  1IYI A;  2C0F A;  2B5E A;  4F82 A;  3M1G A;  4MJC A;  3LJR A;  4I97 A;  1M2D A;  2QSI A;  3EC3 A;  3UVH A;  2P5Q A;  3IR4 A;  4PUA A;  2HSH A;  2O89 A;  1M2A A;  3KEB A;  2C80 A;  1TTZ A;  2J9H A;  2DJ0 A;  2WFC A;  2KUC A;  4L0W A;  3TJJ A;  3D21 A;  3IK9 A;  2YV7 A;  4ID0 A;  2D2Z A;  4TW5 A;  2CA8 A;  6GSW A;  5CAX A;  1AQV A;  3FK8 A;  2IMF A;  2FWH A;  3CTG A;  1T4Z A;  1KEB A;  4I2T A;  4RUV A;  1PX6 A;  18GS A;  1QUW A;  9GSS A;  4BVX A;  1SKS B;  4XTS A;  3C8E A;  1JZD A;  1PGT A;  2I4A A;  1YEX A;  1PMT A;  4MA9 A;  1J9B A;  1GSF A;  5EVO A;  1QK8 A;  3P2A A;  1FVK A; 
#chains in the Genus database with same CATH homology
 3L9U A;  4KUN A;  4KB3 A;  2KLX A;  3MIX A;  2H66 A;  4AJ6 A;  2V41 A;  2V2G A;  2DSA A;  2HZE A;  3MNG A;  3EMX A;  2DKI A;  2V6K A;  5G2Z A;  3JCM L;  1O85 A;  5B6M A;  1UN2 A;  2VL9 A;  4GRF A;  3TKS C;  1FG4 A;  4HQS A;  1HQO A;  3G7I A;  4ZL9 A;  1KNG A;  3RPN A;  5IMV A;  2H6Y A;  3MSZ A;  1GSD A;  1TJD A;  6GSV A;  1K0M A;  2PU9 C;  3GFK A;  2HLS A;  1Z5Y E;  2PWJ A;  3W8J A;  2XHF A;  5HFI A;  3NIV A;  3TKR A;  3CTF A;  1FOH A;  1BX9 A;  2NTO A;  4BPY A;  1B48 A;  2JAD A;  1XZO A;  5COH A;  1GTB A;  4IKH A;  1AQW A;  5ECI B;  1ZL9 A;  2OAD A;  1UA5 A;  4CY6 A;  3IHQ A;  2HRF A;  2OE0 A;  1AIU A;  2L59 A;  3CMI A;  4Z2U A;  2AJQ B;  4ZL8 A;  5FWG A;  4I5Q A;  1K0N A;  2H1G A;  5F05 A;  1ILO A;  2AYT A;  2V32 A;  3UAP A;  1XW9 A;  1DE2 A;  4HI7 A;  2B3S A;  4YH2 A;  3LW9 A;  4XS6 A;  1BJX A;  4FYC A;  5F0G A;  4K8M A;  1BED A;  4EDZ A;  1FW1 A;  3CBU A;  2PBJ A;  1OYJ A;  1TI3 A;  1XWB A;  5IO0 A;  1FVJ A;  3FKF A;  3WT2 A;  4YAP A;  2HSY A;  1F2E A;  1GTI A;  1TKD B;  5DAL A;  5LCZ A;  4DSQ A;  4EC0 A;  3GSS A;  3VK9 A;  1RK4 A;  3QFB C;  4KSO A;  1S3A A;  5IM9 A;  2GQK A;  4GST A;  2HRK A;  1XWA A;  3DWV A;  1SYX A;  3MWH A;  3ZTL A;  2X64 A;  3QAV A;  3HA9 A;  4CHS A;  4AJ7 A;  3UVT A;  2H73 A;  5ECL B;  3PR8 A;  3P90 A;  2LS5 A;  3IHG A;  2YCD A;  3C7M A;  2KHP A;  2VAF A;  1OKT A;  3GX8 A;  5J4U A;  2HI7 A;  1X5E A;  5EY6 A;  4BVY A;  1GNE A;  1FAA A;  2EC4 A;  1ZOF A;  2IN3 A;  4PGT A;  1X9W B;  2ES7 A;  2EIQ A;  3A3T A;  3CYN A;  2H30 A;  11GS A;  5F07 A;  2HYX A;  4IEL A;  1QFN A;  3GKM A;  5GZZ B;  2H0G A;  1SJZ A;  4ZIJ A;  2X99 A;  1PA3 A;  2X8H A;  4RI7 A;  1KBN A;  4MF6 A;  2TIR A;  3TKS A;  2X8G A;  1EOG A;  1ST9 A;  2WZ9 A;  2P0G A;  1SL0 B;  4K5S A;  2YJ7 A;  3IE3 A;  3O3T A;  3KM6 A;  3FR6 A;  3UMA A;  4GQF A;  1TRV A;  5DDL A;  4D73 A;  5J9B A;  3TDG A;  2VOC A;  1O7U A;  3RBT A;  13GS A;  1PKZ A;  1TK0 B;  4ZIL A;  1GUH A;  1HD2 A;  1EEM A;  1LBK A;  1TDI A;  3PIN A;  4TKY A;  3QAG A;  4TR3 A;  2B5X A;  4IW9 A;  2H76 A;  3APQ A;  1I5G A;  3VI7 A;  4WR5 A;  2B7K A;  1W89 A;  4MPF A;  2A4V A;  1WE0 A;  1TRU A;  2PMT A;  3BOA A;  3F3R A;  4IP1 A;  2YWI A;  4K6X A;  4OFM A;  5CRD A;  4BL7 A;  3NOF A;  1V98 A;  5B6N A;  4DSS B;  4K7I A;  2NDO A;  3DIE A;  2HNL A;  4ZB8 A;  3EPT A;  2R0G A;  3BD2 A;  2WB9 A;  3GL3 A;  3Q74 A;  4IJ3 A;  5DQS A;  2B6M A;  2K18 A;  3UIW A;  4GCI A;  3IC4 A;  3IAS 2;  3TJG A;  1B9X C;  2X49 A;  4GTU A;  2X8C A;  4E8E A;  3N5O A;  4NMU A;  2R37 A;  5J3R A;  5B7C A;  4ISD A;  5G1L A;  3RHB A;  3KCM A;  5ECP B;  1YZX A;  2GZY A;  1FB6 A;  1V9W A;  5DAL B;  1EZK A;  3TJB A;  4DVC A;  2LJK A;  4KCE A;  2HRA A;  3AY8 A;  3WGD A;  5HFK A;  3A2X A;  1VF1 A;  1AC1 A;  2UZ8 A;  1ZCP A;  2DIY A;  1V2A A;  3PH9 A;  2GZZ A;  4HEA 2;  4A5P A;  1A24 A;  1EV4 A;  2LRN A;  3LXT A;  4J2F A;  5AN1 A;  5A5K A;  5GAN D;  4KH7 A;  3VWV A;  1GSS A;  2GT6 A;  3RHC A;  3MDK A;  5IIZ A;  1EOH A;  1RW1 A;  4Z2R A;  4Z2T A;  3DYR A;  4OCF A;  1OAZ A;  2OBK A;  1ACV A;  2FWG A;  4HDE A;  4K0N A;  4KDU A;  4V1A g;  2GGT A;  3J7Y k;  3TKS E;  5AIS A;  3VWU A;  4HU7 A;  3EE2 A;  3EIN A;  4LMV A;  12GS A;  3TJK A;  2R5G A;  4XS4 A;  2CVD A;  2H1B A;  4XS1 A;  5ID2 B;  3HJP A;  1EGR A;  4EKZ A;  1FHE A;  3ME7 A;  5HQP A;  5DJL A;  2MZC A;  2DLX A;  3L9S A;  2FNO A;  1K0O A;  1THX A;  1S3D A;  3VFI A;  1VF4 A;  2C3Q A;  4XRD A;  3J7Y b;  1SK2 A;  1LJR A;  1ZYE A;  3QCP A;  2M72 A;  2CQ9 A;  3FHK A;  2OA7 A;  4EIP A;  1HNA A;  4N0Z A;  4HOJ A;  1XFL A;  4V2M A;  2MYG A;  1A2M A;  5DJM A;  4RQX A;  1K3L A;  4N30 A;  2A2S A;  1VGL A;  2C0G A;  1YKC A;  3U6V A;  4CDO A;  6GST A;  4NV5 A;  3E3E A;  5ECM B;  3FZ5 A;  5IQY A;  4GLT A;  4OWY A;  4GWR A;  3GN3 A;  3CXG A;  3HHV A;  1Z6M A;  2CZ3 A;  5D93 A;  4MH2 A;  1V57 A;  3GYK A;  4YQM A;  4FIW A;  4IHU A;  2LV3 A;  3LQ7 A;  3BBY A;  2ON5 A;  4OCE A;  2WGR A;  3LG6 A;  4NHW A;  6GSU A;  5A4U A;  4WBR D;  2HT9 A;  3ZYW A;  1TK8 B;  4OFN A;  2PVO C;  5CRE A;  2BTO T;  4L5O A;  3TRP A;  1JHB A;  2ALB A;  5ECO B;  4EDY A;  2FA8 A;  2HFD A;  3CSH A;  1MTC A;  6GSX A;  1UVZ A;  1GUM A;  3GX0 A;  3QMX A;  5ECN B;  5B8A A;  2IJY A;  4ACS A;  3TRQ A;  3TOT A;  2JU5 A;  3HJM A;  4K7N A;  1DBY A;  4POL A;  2LKU A;  2LNS A;  1ERV A;  2KOK A;  2HZF A;  2F8A A;  3UL3 A;  4JBB A;  1O8X A;  2NVL A;  1SEN A;  2K8S A;  2JSY A;  2DJ3 A;  4PUF C;  1GH2 A;  3APO A;  2CVB A;  5JCW A;  1SJI A;  4KDX A;  1WIK A;  3TB2 A;  4YKG A;  1THO A;  1V58 A;  3HJO A;  4O92 A;  2OE1 A;  1Y6E A;  1XVQ A;  1OKD A;  2B1L A;  3G7J A;  4TXO B;  4FYU A;  4QL7 A;  3ED3 A;  4JU5 A;  3EUR A;  1R26 A;  1USB A;  3EU4 A;  1PD2 1;  2CV4 A;  5CO3 A;  4LLR A;  3FZ4 A;  2R0C A;  2XC2 A;  1SL1 B;  2OE3 A;  20GS A;  2O7K A;  2PER A;  3C71 A;  1ON4 A;  4EE0 A;  5H5Q A;  1A0R P;  2MBT A;  1E2Y A;  2MBS A;  3BCI A;  4K2D A;  4POM A;  1F3A A;  2C0E A;  5GST A;  4QL9 A;  3Q19 A;  3GMF A;  4PQ1 A;  2YV9 A;  3E0U A;  1GWC A;  1WRY A;  2AB6 A;  3DXB A;  5CP1 A;  2N5A A;  4KW6 A;  2JSZ A;  3FY7 A;  4HUA A;  2I81 A;  1SKW B;  1YF0 A;  2WRT A;  3UBL A;  4JED A;  1N8J A;  1XWG A;  2M80 A;  4P3Y B;  1J08 A;  3ZIV A;  3IV4 A;  3LFL A;  2L5O A;  4EUY A;  3WYW A;  1BYE A;  2B5Y A;  2JL4 A;  2AUV A;  2RLI A;  4MDC A;  3M9J A;  4IQ1 A;  4KND A;  2CT6 A;  2VIM A;  1SKR B;  5HR2 A;  3I6A A;  4BWQ A;  1TRS A;  5F8B A;  4DEJ A;  5J41 A;  1LU4 A;  8GSS A;  4MJE A;  3ME8 A;  1O6J A;  4NPB A;  22GS A;  3UEM A;  5G1K A;  3LGC A;  2V1M A;  4HQZ A;  4HU9 A;  3GTU B;  1YY7 A;  3F0I A;  2GST A;  2PUK C;  3TRX A;  4IJI A;  1QMV A;  1T7P B;  5D73 A;  5IO2 A;  4PQH A;  5LD0 A;  1A2L A;  4EF0 A;  4F0B A;  2JZT A;  1AXD A;  1CQH A;  1M7T A;  3HXS A;  1GTU A;  5BRT A;  2YP6 A;  1A0F A;  3FRC A;  5DQY A;  5DBQ A;  1JZO A;  2JZR A;  4MP4 A;  5ABR A;  5CRH A;  1YF1 A;  3APS A;  3KTB A;  1MDK A;  2H72 A;  1NHO A;  3SWL A;  3VPQ A;  4FH8 A;  4KGI A;  5G30 A;  2PGT A;  4Z7X A;  4ML1 A;  1X9S B;  3GRX A;  1E6B A;  4MZC A;  5DAK A;  5DCG A;  4ZB6 A;  2F9S A;  4ZXG A;  5JCG A;  4L0U A;  1WPI A;  1QQ2 A;  3D0Z A;  4TR4 A;  2R2J A;  3DGQ A;  2KP2 A;  2VM1 A;  5AGY A;  1YJ6 A;  1K0C A;  4EXJ A;  1TU8 A;  2YAN A;  1VF3 A;  1GTA A;  3GKX A;  4N0V A;  4O32 A;  3TOU A;  3D6I A;  5KN1 A;  1ZYN A;  2YZH A;  3DEX A;  2FA4 A;  2LEG A;  1K0A A;  1T3B A;  3C1S A;  1EEJ A;  2A2R A;  4O5U A;  1ZYQ B;  4TN8 A;  3GKN A;  3L78 A;  4G0L A;  2HRN A;  2IMI A;  3ZIT A;  4BVX B;  3DD3 A;  1HYU A;  3GHA A;  2VLT A;  4ZBA A;  10GS A;  3TKQ A;  1XOA A;  4E8H A;  1U3A A;  5IOW A;  2VO4 A;  4WET A;  2GSS A;  3KH9 A;  5HR3 A;  1G7O A;  4MF7 A;  2XPD A;  2OJL A;  4X43 A;  3M9K A;  4WEY A;  2HZE B;  4GSS A;  3DKS A;  3P7X A;  2LTK A;  3HKR A;  3MAK A;  3R3E A;  3ERW A;  4IP6 A;  2RUF A;  1TXX A;  3F3Q A;  2FD3 A;  5D9T A;  4G9H A;  5BMU A;  3A2W A;  1Z9H A;  4HS1 A;  5ECH B;  4KE3 A;  3IBH A;  2GSR A;  2C8U A;  2QA2 A;  2MMO A;  19GS A;  4OO4 A;  5GAP D;  3L4N A;  2WUL A;  2ON7 A;  1BQ7 A;  2H75 A;  1PKW A;  1IYH A;  4JRR A;  6GSY A;  3DML A;  3RPP A;  2LUS A;  3KH7 A;  1G6Y A;  4G2E A;  1F6M C;  3F4S A;  1ERW A;  1WWJ A;  3DVX A;  1B8X A;  3GA4 A;  1K3O A;  2VCV A;  1MD4 A;  2LNT A;  4RI6 A;  3GV1 A;  2XBI A;  3GH6 A;  3KP8 A;  2AAW A;  1MEK A;  3HCZ A;  5CYY A;  5F06 A;  5LNK e;  3OR5 A;  1Y25 A;  5D9V A;  2CAI A;  2H70 A;  3QD9 A;  5KN2 A;  2MMA A;  4V2N A;  2R4V A;  3QPM A;  3HY2 A;  2H1A A;  2C3T A;  2CX4 A;  1K0B A;  1Z6N A;  3ZVJ A;  2OAC A;  1XBS A;  4X4J A;  3L9V A;  5EL8 A;  2GDR A;  4KAE A;  2H01 A;  4YKF A;  1G7E A;  2I9H A;  3IA1 A;  5L71 A;  4XCS A;  2VD0 A;  2GQL A;  4USS A;  4HZ4 A;  5CNW A;  2H19 A;  3HVX A;  2RM6 A;  5D9W A;  2DKH A;  4K7O A;  4NHZ A;  1T8E B;  1XWC A;  5KN0 A;  1XCC A;  2VUP A;  2LRC A;  2NPB A;  2GTU A;  4MAB A;  3F63 A;  3IPZ A;  4J57 E;  4Q5Q A;  2REM A;  3UBK A;  5ECK B;  1R7H A;  2LQO A;  4YQV A;  5IMC A;  3ZRE A;  1A8L A;  4IGJ A;  2FHE A;  1VF2 A;  2F3M A;  5IPG A;  5HR1 A;  4EVM A;  3D4M A;  4BVY B;  1UC7 A;  3HVV A;  4ECC A;  4H86 A;  2N5B A;  4BA7 A;  3FZA A;  5EPF A;  4PUR A;  4ECI A;  1AW9 A;  1X9M B;  3ZZX A;  1QGV A;  3ZLP A;  1GSQ A;  2E0Q A;  3ZIJ A;  4KCA A;  5DVB A;  17GS A;  5ELA A;  3US3 A;  1XVW A;  1O81 A;  1PN0 A;  1U87 A;  5G31 A;  5C04 A;  2DC5 A;  2WS2 A;  3F6D A;  3KJY A;  5KEJ A;  1OE7 A;  4POB A;  2QKE A;  4N11 A;  1TP9 A;  4HJM A;  3KGK A;  4D73 B;  3D22 A;  1ERU A;  3ZFL A;  4HZ2 A;  3HZ4 A;  1PX7 A;  3LEF A;  1EGO A;  5HFG A;  2K8V A;  3IOS A;  16GS A;  3EYT A;  6GSS A;  1OC8 A;  1Z7R A;  5JWO B;  4WXT A;  4JR4 A;  4ZBB A;  3GL5 A;  3PGT A;  2FCH A;  3NZN A;  4GSN A;  3M3M A;  5KOX A;  4I8B A;  4AGS A;  3F6F A;  3CSJ A;  1EWX A;  4NV2 A;  4CW9 A;  2F8F A;  4BL7 B;  4MNN A;  1JLV A;  3CSI A;  4OO5 A;  1ERT A;  1OC9 A;  3HVS A;  1ABA A;  3KTL A;  4DSR A;  4CY8 A;  1XW6 A;  4TXV A;  4IBP A;  2VM2 A;  3VWX A;  4F03 A;  4YAV A;  1G6W A;  3TGZ A;  1I9D A;  2RII A;  3FMW A;  4K9Z A;  2L57 A;  2CAQ A;  2BJX A;  2AHE A;  2DJ1 A;  3RAZ A;  2OBI A;  1GSE A;  4OMV A;  2YWM A;  2O8V B;  2NBS A;  2P5R A;  4ILF A;  3VPT A;  3VLN A;  5GSS A;  3LWA A;  5ECS A;  3L0H A;  2E2G A;  3V1W A;  3ZL5 A;  1PL1 A;  2DML A;  4MMM A;  1T1V A;  4FQU A;  1JZR A;  1Z3E A;  4ICY A;  4G19 A;  4KA0 A;  3F9U A;  3LYK A;  3ERF A;  2JAC A;  3A2V A;  2L6C A;  4Q5F A;  4I6X A;  5C00 A;  2F51 A;  3QFA C;  5AIX A;  2KP1 A;  1FOV A;  1PRX A;  1M9B A;  2DJJ A;  4NWY A;  4GF0 A;  4X1U A;  4KSM A;  2EIR A;  1RQM A;  3I9V 2;  2B7J A;  2J23 A;  4OD7 A;  1VRS D;  3A5I A;  3TUE A;  1O73 A;  4V2L A;  3I69 A;  2ZNM A;  2E2M A;  2GQM A;  3PPU A;  5ECR B;  1OE8 A;  4XS4 B;  2GT5 A;  1KTE A;  5IMD A;  2LJR A;  4FO5 A;  2IMK A;  4MF5 A;  5B8B A;  2VL2 C;  1TRW A;  2AV4 A;  4F2I A;  1GUK A;  1MD3 A;  1FO5 A;  1OC3 A;  2PVQ A;  1J0F A;  1AUC A;  5JWR B;  5D9X A;  5IOX A;  1DE1 A;  2I1U A;  2LST A;  4I2U A;  5A4V A;  1XIY A;  4G0K A;  3H93 A;  2LRT A;  1JFU A;  1SU9 A;  2ZCT A;  4ECJ A;  3QOU A;  3EWL A;  1K0D A;  3TKP A;  2A4H A;  3O76 A;  2C4J A;  3FW2 A;  1HNC A;  4K1F A;  1XPV A;  4TRX A;  14GS A;  1B9Y C;  4O7H A;  1B4Q A;  2HE3 A;  4F9Z A;  2DJK A;  2L5L A;  3LOR A;  1OC9 B;  2YPM A;  1TU7 A;  4XRA A;  4ECB A;  3KIJ A;  2C0D A;  3QR6 A;  2XBQ A;  1GSY A;  3WD6 A;  4EL1 A;  1X5D A;  4MH3 A;  5ENU A;  5JWQ B;  4DSS A;  1M0U A;  2VCT A;  2LJA A;  2G0F A;  1X0R A;  2V6O A;  1DSB A;  1V40 A;  3FEU A;  2QGV A;  1GLQ A;  2CZ2 A;  4TVE A;  3H4K A;  3FZ9 A;  4LL4 B;  4QQ7 A;  3BJ5 A;  4V1A p;  3IDV A;  2VCW A;  2IMD A;  4FYB A;  4GQC A;  2P31 A;  3G9B A;  3GUS A;  3HD5 A;  1N2A A;  2FWF A;  4MPG A;  3WT1 A;  1ML6 A;  3O6T A;  4ULX A;  1F37 A;  2VLU A;  1SJ6 A;  3ZMK A;  3LXZ A;  2YNX A;  4IN0 A;  1C72 A;  3W8S A;  3FR3 A;  3Q6O A;  1ZZY A;  5IMZ A;  5IPH A;  1K3Y A;  2OKA A;  3UAR A;  3H1N A;  4EO3 A;  2YWO A;  3KMO A;  2VL2 A;  1JZW A;  2G2Q A;  2HXK A;  2H8L A;  2MMZ A;  3VI5 A;  4ML6 A;  3ZFB A;  1R4W A;  3M0F A;  1CQG A;  1BAY A;  2QC7 A;  2XPE A;  4PNG A;  2IIY A;  5KOW A;  3IRA A;  2RM5 A;  2RUE A;  3H79 A;  3WGE A;  1OVN A;  1GUL A;  1GSU A;  4TR1 A;  3EU3 A;  4NAX A;  2IPA A;  2E7P A;  4JR6 A;  5KN3 A;  1YEP A;  2FWE A;  4XHM A;  2ZUP A;  2O87 A;  3F4R A;  3W6G A;  1TI1 A;  4O5R A;  4ZL7 A;  4N10 A;  5JCU A;  1X5C A;  2DBC A;  3GKK A;  3H8Q A;  2GVP A;  3D5J A;  5ELG A;  1Q4J A;  1DUG A;  4K2X A;  5ID2 A;  1A8Y A;  3LSZ A;  1NHY A;  1TOF A;  2R3X A;  4XIH A;  5IMA A;  1O8W A;  3G7Y A;  5H5S A;  4KX4 A;  5INY A;  2I3Y A;  4WF5 A;  3QDN A;  1U88 A;  1JLW A;  3KXO A;  3CRU A;  3TCO A;  2TRC P;  4PXO A;  1URM A;  2FUG 2;  2K9F A;  1ZMA A;  1FB0 A;  1SD8 A;  4GXZ A;  1ZGN A;  4LL1 B;  1AAZ A;  2FLS A;  3GUR A;  1XWK A;  3RDW A;  5A4W A;  1YKA A;  4JE1 A;  2VD1 A;  1SK1 A;  4ZBD A;  4F0C A;  4EIQ A;  4WKW A;  1H75 A;  4MZW A;  5CRG A;  2DIZ A;  3KMN A;  2YOI A;  1M99 A;  2YJH A;  3KP9 A;  2IFQ A;  1XW5 A;  4KDY A;  5CRW A;  1Z7P A;  2JZS A;  2K6V A;  3LYP A;  4X0X A;  4NXI A;  2VL3 A;  2YN1 A;  3IAM 2;  2PN8 A;  1H4O A;  3P8W A;  2IWT A;  5H5R A;  4Q5R A;  2YZU A;  3IK7 A;  1B4P A;  2A2P A;  4AJ8 A;  2HSM A;  3ZVJ D;  2WDU A;  2H71 A;  3TJF A;  1GLP A;  5AIV A;  1YQ1 A;  3UJ1 A;  2R0P A;  5D8I A;  5DAK B;  4MJA A;  5J5N A;  3R2Q A;  4KF9 A;  4PTS A;  1XXU A;  2VLV A;  2VCX A;  4WBJ A;  1A2J A;  4TOP A;  3WGX A;  2Z9S A;  1R5A A;  3N9J A;  4LMW A;  3S9F A;  2VCZ A;  2C1Y A;  2H0H A;  2O85 A;  2PPT A;  1PL2 A;  1WMJ A;  1WOU A;  5IMF A;  3C1R A;  2L4Q A;  1SYR A;  2WCI A;  4G0I A;  4YQU A;  5D96 A;  1M9A A;  4RQR A;  3F8U A;  4BWS A;  3GST A;  3U5R E;  3ZML A;  4MLY A;  4MCU A;  2DMM A;  1TK5 B;  2GZP A;  2GS3 A;  1MDI A;  4WR4 A;  1NW2 A;  1SD9 A;  1GNW A;  4LA1 A;  1ZYP A;  1F9M A;  3BCK A;  3K8N A;  3DVW A;  2H1D A;  5FT3 A;  2H0I A;  2QA1 A;  2TRX A;  3DRN A;  2FY6 A;  3HYP A;  1YDK A;  4TXO A;  1PQN A;  4TR1 B;  4MK3 A;  4AF2 A;  1Q98 A;  3UOM A;  1GRX A;  3VWW A;  1BG5 A;  1XOB A;  3KD0 A;  2WJU A;  4J56 E;  4IS0 A;  3MYD A;  1GP1 A;  2H74 A;  2GSQ A;  1WJK A;  5G5E A;  3HDC A;  4TR0 A;  2MMN A;  3GH9 A;  5G5F A;  2N5F A;  1U6T A;  2M46 A;  4JZQ A;  4PQI A;  3I43 A;  1SK0 A;  2C3N A;  4L5L A;  4O5Q A;  3HZ8 A;  2LQQ A;  4HJ2 A;  1NSW A;  1S3C A;  3A5W A;  3Q18 A;  2L6D A;  3M8N A;  3FR9 A;  2FGX A;  3ISO A;  2CVK A;  4WF4 A;  2IME A;  3CRT A;  1EV9 A;  2X4A A;  1F3B A;  3ERG A;  1NM3 A;  1MDJ A;  4Q5N A;  1SL2 B;  2R6K A;  1U3I A;  3QAW A;  2H6X A;  3F4T A;  3FYG A;  1PSQ A;  5FHI A;  1AQX A;  4G10 A;  4PNF A;  4IQA A;  2EIO A;  4L8E A;  2IFQ B;  1PN9 A;  4ZB9 A;  1T4Y A;  2DJ2 A;  2BMX A;  5E59 A;  2B1K A;  3C73 A;  3IXR A;  1W4V A;  1T00 A;  1G0T A;  2GLR A;  1WP0 A;  7GSS A;  3EMP A;  2L4C A;  4PX1 A;  5E4W A;  3GTU A;  1M2B A;  2H6Z A;  3VUR A;  5HR0 A;  2CX3 A;  3IC8 A;  1QXH A;  3SBC A;  1TW9 A;  1R5P A;  4MZB A;  3EVI A;  5ECQ B;  1HNB A;  4K5R A;  1EP7 A;  4MJB A;  1A23 A;  2IL3 A;  5DCH A;  4K0G A;  4IVF A;  3KZQ A;  1EP8 A;  2YWN A;  1GL8 A;  4OFT A;  3E9J B;  2VCQ A;  3ZRD A;  3D4T A;  4POK A;  5J9C A;  3GIX A;  3GNJ A;  1IYI A;  2C0F A;  2B5E A;  4F82 A;  3M1G A;  4MJC A;  3LJR A;  4I97 A;  1M2D A;  2QSI A;  3EC3 A;  3UVH A;  2P5Q A;  3IR4 A;  4PUA A;  2HSH A;  2O89 A;  1M2A A;  3KEB A;  2C80 A;  1TTZ A;  2J9H A;  2DJ0 A;  2WFC A;  2KUC A;  4L0W A;  3TJJ A;  3D21 A;  3IK9 A;  2YV7 A;  4ID0 A;  2D2Z A;  4TW5 A;  2CA8 A;  6GSW A;  5CAX A;  1AQV A;  3FK8 A;  2IMF A;  2FWH A;  3CTG A;  1T4Z A;  1KEB A;  4I2T A;  4RUV A;  1PX6 A;  18GS A;  1QUW A;  9GSS A;  4BVX A;  1SKS B;  4XTS A;  3C8E A;  1JZD A;  1PGT A;  2I4A A;  1YEX A;  1PMT A;  4MA9 A;  1J9B A;  1GSF A;  5EVO A;  1QK8 A;  3P2A A;  1FVK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...