3HHVA

The crystal structure of the thioredoxin a2 from sulfolobus solfataricus
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
103
structure length
103
Chain Sequence
PVKHLNSKNFDEFITKNKIVVVDFWAEWCAPCLILAPVIEELANDYPQVAFGKLNTEESQDIAMRYGIMSLPTIMFFKNGELVDQILGAVPREEIEVRLKSLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Thioredoxin (TrxA-2)
publication title The dimeric structure of Sulfolobus solfataricus thioredoxin A2 and the basis of its thermostability
pubmed doi rcsb
source organism Sulfolobus solfataricus
total genus 29
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2009-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3hhvA00
3KMNA 4OO5A 1XCCA 4KDXA 2HRNA 1FVKA 3D0ZA 2E2MA 3PH9A 4HZ2A 5D9WA 2D2ZA 3HZ4A 2HZEB 1NSWA 4K2DA 2N5AA 2OADA 2IMEA 3CMIA 4LL4B 1WP0A 4EDZA 2YOIA 2ON5A 1DE1A 2B3SA 20GSA 3ZYWA 5DAKB 5B8AA 1A8LA 4FIWA 1T4YA 1AQVA 5F06A 1OE8A 3FR6A 3GKXA 4AJ8A 1K0AA 2LRTA 4YQMA 3NIVA 4K0GA 2H1BA 2AYTA 2V32A 1S3CA 2PPTA 1K0CA 3A5WA 3QAVA 4MZCA 3F6FA 1Z6MA 2H73A 4GWRA 2IN3A 4DEJA 2HYXA 3BD2A 2H1AA 4YQVA 4XCSA 1SL2B 2IMFA 1TU7A 1S3AA 3TJKA 2PWJA 1TW9A 2CX3A 11GSA 4MPGA 5DCGA 4WR5A 1GTAA 4ZL8A 5J9CA 1K0NA 3O6TA 4HJMA 3GRXA 1TKDB 3ME8A 3HY2A 2V41A 1E6BA 4NV5A 5B8BA 3TJBA 1CQGA 4EUYA 1QQ2A 3LWAA 1O73A 4IHUA 1TXXA 1A8YA 1Y25A 2HSHA 5EL8A 5HR3A 4XHMA 1YY7A 4KDYA 1M99A 3BOAA 2CVBA 1AQXA 3VPQA 3FW2A 1XIYA 1M9BA 3M1GA 4ECBA 2FCHA 1F37A 3UVHA 2HLSA 1PL2A 2CAQA 1VF1A 1K3OA 3EYTA 1J9BA 4V2MA 3C1SA 5F0GA 4X1UA 4EVMA 1SKRB 1H75A 3GN3A 2H1GA 3IBHA 1OKDA 3RHBA 4KW6A 5A4UA 3F6DA 4MPFA 3F4RA 1VGLA 3I6AA 1HNAA 4BL7A 2DJJA 1CQHA 2OA7A 2B7JA 2LJRA 1SENA 2WCIA 4PX1A 2CQ9A 1AC1A 5KN1A 2A2RA 2QKEA 1Z9HA 3BCKA 5KN0A 2OKAA 3EURA 3HDCA 2C0EA 1QUWA 5G30A 2EIOA 1ZOFA 5IMDA 5D9XA 4I97A 3TRQA 5DCHA 4IQAA 1WIKA 3VPTA 2B5YA 5AIVA 1M2BA 5A4VA 2YANA 5LNKe 1G7OA 1QMVA 3M9JA 3GIXA 1FAAA 4L8EA 3SBCA 3UOMA 3TKSE 2M80A 2PBJA 1WPIA 2C80A 2HT9A 3HD5A 5E59A 2VCQA 2PGTA 4TR4A 3IHQA 2G0FA 1E2YA 2HXKA 2E2GA 2P5RA 3UVTA 2YV9A 1XZOA 4G9HA 2GZYA 4NHZA 1B9XC 2F3MA 1R26A 4JR4A 3QOUA 1A2MA 3VLNA 4IP6A 4MH2A 3CSIA 2N5BA 6GSUA 1GULA 3ZTLA 3IAM2 5JCWA 5D9VA 5CRGA 3GMFA 6GSWA 5ABRA 1K0OA 5HR2A 5CRHA 3ZIJA 2WGRA 2R5GA 3F4SA 2RUFA 1SL1B 3KEBA 3WYWA 1HYUA 3TKSA 1YZXA 2VCZA 3FHKA 1J0FA 4POMA 2DBCA 4I6XA 4MF7A 2VCVA 3MNGA 3CRTA 1SKWB 2LTKA 5DQSA 2EC4A 1ZZYA 2LEGA 5CP1A 1ERUA 4GCIA 5IMFA 3GTUB 1KBNA 1EZKA 1YEXA 4FO5A 3TRPA 2YZUA 2HFDA 3GKNA 4XS6A 13GSA 5D93A 5IPHA 3GA4A 2FD3A 5ENUA 5DALB 2FWFA 4K0NA 2VOCA 2OBIA 4EXJA 3KCMA 1N2AA 1K3LA 3ED3A 1FB6A 2VD0A 3ZIVA 4KE3A 1TDIA 2GZPA 1ILOA 4TR0A 2VM2A 2K6VA 1KTEA 5CAXA 4V1Ag 5AIXA 2GVPA 2X99A 4ISDA 1HNBA 4KUNA 5ECNB 3WT2A 2GQLA 2ZNMA 5FT3A 2R4VA 2R3XA 3QFBC 1GTUA 2YP6A 3D22A 4IVFA 2GSRA 2C8UA 1F6MC 16GSA 4DSRA 2I4AA 3TDGA 4TOPA 4F82A 5IIZA 2X8GA 3A2XA 4KH7A 4HUAA 1U87A 4ZL7A 2VM1A 3W8JA 2CT6A 2ZCTA 3Q19A 3KJYA 3Q18A 1DE2A 4IN0A 3I43A 3GX8A 5F05A 1HQOA 4HS1A 1GUHA 1PMTA 2K9FA 3CSJA 1WJKA 4TN8A 3O3TA 4PNFA 2L4CA 3ZLPA 5KN2A 3A3TA 4IS0A 3APOA 3WGXA 4MA9A 1UC7A 2L59A 1ACVA 1F3BA 4PQHA 3ZVJD 4MJEA 3KTLA 1PN9A 2JL4A 1VF2A 1JZDA 2P5QA 2CVDA 1GSSA 3ZFBA 4NXIA 4TRXA 2HI7A 3GH6A 4JEDA 12GSA 1YF0A 4XS1A 2VIMA 1YKCA 3I9V2 2CVKA 5B7CA 2N5FA 3I69A 3UMAA 4O92A 1T1VA 4ML1A 1BX9A 4MJBA 5JCUA 3FZ4A 2GSQA 1XWAA 3HHVA 1FO5A 2X8CA 4LMVA 1XBSA 3P2AA 2HZFA 2MYGA 2DMMA 4OD7A 1URMA 3WGEA 1UN2A 2RIIA 4TR1A 2GLRA 3U5RE 5KN3A 4QL9A 4XRDA 3L9VA 2A2SA 4IELA 3VWUA 18GSA 2IMIA 3C8EA 2AHEA 2OJLA 4BWQA 3KIJA 4POKA 2PU9C 3ZMLA 3HXSA 3EE2A 3DVXA 3M0FA 3HVXA 1V57A 3PR8A 2XBIA 2FWHA 2NDOA 3L9UA 4WEYA 2R37A 1SL0B 3DGQA 2M46A 4ZBDA 1SYRA 1W89A 5AN1A 3US3A 4POBA 1EP8A 2LRCA 3BJ5A 1ZMAA 2YN1A 2WDUA 3L78A 2VL9A 1TK5B 2V6KA 1XXUA 1GTIA 3GH9A 5JWOB 2H70A 1YF1A 3PINA 2IFQB 1RW1A 4XS4A 4BWSA 2B5XA 3IPZA 4ZB8A 2B5EA 1O6JA 3KH7A 1X5CA 3MDKA 3IE3A 2DMLA 1GNEA 3WT1A 4ECIA 2H0HA 2GTUA 1GSQA 4PURA 4MP4A 3M9KA 3QDNA 5D73A 3P8WA 2B1KA 3F8UA 2HRFA 2I1UA 5DJLA 3ZZXA 5HR1A 2BMXA 2H72A 1EGRA 1V2AA 1A0RP 10GSA 1SU9A 1KEBA 3N5OA 1MEKA 1PA3A 2YNXA 3APQA 4TR3A 3G7JA 2JU5A 2Z9SA 3GX0A 2HE3A 2YZHA 4K1FA 3TUEA 1T8EB 3E9JB 2YCDA 3BCIA 1K3YA 1U3AA 1V9WA 2H01A 2PN8A 4CW9A 4E8HA 4I8BA 4IQ1A 4JZQA 4YQUA 2NBSA 4HOJA 5LD0A 5ECLB 4XTSA 3HJPA 1Z6NA 1AXDA 2AAWA 3H1NA 3NZNA 3GHAA 1JZOA 1BG5A 2H74A 1O8XA 3U6VA 1Y6EA 2C1YA 4NMUA 1EEJA 1F3AA 1JFUA 4MCUA 2OACA 2O85A 4GTUA 3GKMA 1GTBA 3ZVJA 3F4TA 1WWJA 3FZAA 1MDJA 3P7XA 2L4QA 1MTCA 4MLYA 2ALBA 1OE7A 2IPAA 3OR5A 1V40A 4TXVA 4YH2A 1W4VA 2LQOA 4LL1B 1X9SB 1USBA 4WF5A 2I81A 4KNDA 1M9AA 1EWXA 4KSOA 3N9JA 5EVOA 2P31A 2K8VA 1FOVA 2VUPA 2YV7A 2IMKA 2WJUA 3V1WA 2TRCP 1BJXA 5D96A 4MJCA 1GH2A 3UBKA 4EC0A 5HR0A 4MF6A 4MF5A 2ZUPA 6GSSA 4GQCA 4WR4A 4XRAA 3F63A 1UVZA 5DDLA 3GUSA 2JSYA 4PUFC 2IMDA 2FWEA 4KGIA 1M2AA 1FG4A 3A2WA 4ID0A 1JZRA 5ECHB 2L6DA 1TK8B 2AUVA 1PKZA 4PXOA 1EV9A 5EPFA 2YPMA 5IOXA 4ULXA 5F07A 3TJJA 2KOKA 5AGYA 2H1DA 4NHWA 1FW1A 2J23A 4DSSA 1AQWA 4K7OA 1T3BA 1XVQA 4ACSA 1H4OA 5A4WA 5IOWA 3H8QA 3DIEA 1HNCA 3C7MA 3RBTA 2CAIA 2B7KA 5CO3A 4JBBA 5CNWA 4WF4A 3CRUA 3FEUA 3VK9A 1JLWA 5G5FA 4IW9A 2FUG2 3QR6A 1M7TA 1XOBA 1LU4A 2DJ2A 2I3YA 4X43A 5ELGA 1EEMA 4WBRD 2FA4A 4J57E 2VCWA 1AAZA 1U6TA 1GSYA 3L9SA 4IP1A 1N8JA 1YKAA 3TRXA 3DXBA 4I2TA 5DVBA 1XWCA 2L6CA 1A0FA 4N10A 1B4PA 2YWMA 3VI7A 1NHYA 1XFLA 4BPYA 3SWLA 1YEPA 5D8IA 2DJ3A 3CTFA 3C1RA 3J7Yb 1TU8A 1R5AA 3RPNA 2MMAA 4KA0A 3KD0A 3IV4A 3QCPA 1THOA 4ECJA 2I9HA 2RM6A 2QGVA 1AW9A 1X5EA 2FNOA 2DIZA 1F9MA 4EKZA 2A4VA 4K7IA 5C00A 2LNSA 4IJ3A 2WZ9A 14GSA 1NW2A 2MBTA 3HVSA 4JRRA 2JZRA 5GSSA 1SKSB 1A23A 1C72A 1ERWA 3MSZA 1NM3A 4KB3A 3ZREA 2ON7A 2V1MA 1QFNA 4HU7A 4F0BA 22GSA 1SYXA 3DYRA 5J41A 1G6WA 5IMVA 2L5LA 3APSA 3WD6A 3CXGA 2KHPA 4MMMA 4MABA 4PGTA 4XIHA 2G2QA 4GRFA 3FR3A 4NPBA 3O76A 4L0UA 4TVEA 5INYA 1B48A 3UARA 1OC9A 1XPVA 2F8AA 1TRVA 1M2DA 5IPGA 3R2QA 3QD9A 4G10A 2LKUA 3VWVA 3C71A 1Z7PA 5ECSA 1VRSD 3GL5A 2O7KA 2VLTA 3DRNA 1PD21 1OC8A 2RUEA 3ZRDA 5LCZA 4PNGA 3ME7A 1MDKA 4D73A 3HCZA 4MH3A 1GWCA 4Q5RA 4HI7A 5ID2A 4E8EA 1LJRA 3GKKA 3FR9A 1MDIA 1ZCPA 4AJ6A 6GSXA 3KP9A 4FYBA 1JLVA 1ERTA 4KAEA 4QQ7A 3VWWA 5E4WA 2H8LA 2MZCA 2C0FA 2VL3A 2YJHA 4JE1A 4ILFA 1YQ1A 5A5KA 1ZYEA 4JU5A 1LBKA 3LFLA 4I2UA 4J2FA 3EC3A 3HYPA 5DBQA 3G7YA 3W8SA 4AF2A 1BYEA 3ERGA 1ZL9A 1XWBA 3H79A 4OWYA 3DVWA 2KLXA 4ML6A 3WGDA 1X9MB 2TIRA 5ID2B 1ML6A 5G2ZA 5ECOB 1O7UA 2JZSA 3DMLA 4IBPA 4ZB9A 3GFKA 2DSAA 5KEJA 2PVOC 5ECMB 5ELAA 2H19A 1ST9A 1BEDA 2GGTA 4GXZA 3P90A 2VL2C 1SD9A 1OYJA 1Q98A 4ECCA 3VURA 1PX7A 2IWTA 4OFNA 1XW9A 2LRNA 2VD1A 2FGXA 4Q5NA 1SK0A 5GAPD 1K0BA 1GUMA 4IKHA 2WS2A 2BJXA 3FZ5A 4N30A 4ZIJA 5GAND 4V2NA 2JZTA 5ECRB 2K8SA 3LYKA 4V2LA 2XC2A 2CA8A 3HKRA 1ERVA 5HFKA 3EMPA 3HJMA 4ZBAA 3F3RA 4PQIA 2IIYA 2PERA 3KZQA 2HZEA 4GSSA 2XPDA 1S3DA 4KCEA 2FA8A 3FZ9A 2PMTA 1PRXA 4Q5FA 4MZBA 2H6YA 3QFAC 3M8NA 3D5JA 5COHA 5DAKA 5ECPB 3AY8A 2XHFA 4J56E 3W6GA 1BQ7A 4CDOA 1GSEA 1YJ6A 2VLVA 4TR1B 5D9TA 1ZYQB 2HNLA 3DWVA 4O7HA 1VF4A 4KDUA 4BVXA 2REMA 3ERWA 3ISOA 1TI3A 4GQFA 1TRSA 4MJAA 3D4TA 2LUSA 2MBSA 1IYHA 3FRCA 4YAVA 2O8VB 5JWRB 1EOGA 4K8MA 2C0GA 1XW5A 3D4MA 2H66A 1B4QA 4WXTA 3RPPA 2VCTA 3UEMA 4FYCA 4GSTA 3KXOA 3IDVA 4TKYA 2IJYA 1FB0A 1EGOA 4EO3A 2F9SA 7GSSA 5IQYA 2NPBA 1TRUA 5G31A 5FWGA 2TRXA 1K0MA 4HJ2A 4EE0A 3TJFA 5IMCA 4XS4B 1K0DA 2NTOA 4DVCA 4CHSA 1R7HA 1GSDA 3QMXA 5AISA 1XVWA 3TGZA 4LMWA 2QC7A 1GLQA 3L0HA 3F9UA 3F0IA 2YWIA 3GNJA 1IYIA 2M72A 2L57A 1T00A 4HQZA 3Q6OA 1QXHA 2DLXA 5CREA 4ZXGA 3LXZA 1V98A 2H30A 3GURA 5H5QA 1QGVA 2NVLA 1OAZA 4K9ZA 17GSA 4QL7A 1ZGNA 4WETA 3DEXA 3GSTA 3KMOA 4ZB6A 4P3YB 3QAWA 4JR6A 3IK9A 3UJ1A 3VWXA 2KP2A 1PKWA 1V58A 3IAS2 3D6IA 3LEFA 2LV3A 2DJ0A 1GLPA 1GUKA 1Z7RA 3EVIA 3F3QA 4KX4A 1G6YA 1TK0B 1GSUA 1O81A 1KNGA 1EP7A 5G5EA 2EIRA 3CBUA 1GL8A 3IXRA 1OVNA 1EOHA 3IOSA 3K8NA 4GF0A 5IO0A 4AJ7A 4EL1A 4I5QA 3LGCA 2RM5A 1I9DA 2KUCA 4RQXA 1U3IA 2DJ1A 2R6KA 4H86A 4HU9A 4ZL9A 1FHEA 4KCAA 2PVQA 1M0UA 3UAPA 3BBYA 4L5LA 2VCXA 2O87A 3D21A 2MMNA 3IRAA 5JWQB 4X0XA 3RHCA 5JCGA 3TCOA 3RAZA 3EU4A 5G1KA 3CYNA 3ZL5A 5B6MA 3TB2A 1TI1A 3EU3A 2OBKA 4F9ZA 1A2LA 3KTBA 5H5RA 3LG6A 2JADA 3LQ7A 3IR4A 1SJIA 2B6MA 5CRWA 1A2JA 3TJGA 4RI6A 3QAGA 3HJOA 3EINA 3TKRA 2YJ7A 5J3RA 2DC5A 4F0CA 1TOFA 5DQYA 3GL3A 3HA9A 2FWGA 5F8BA 1GNWA 5CYYA 4O32A 2H71A 2C0DA 3E0UA 5IMAA 2VLUA 4L0WA 2WULA 2B1LA 3UL3A 4EDYA 2DJKA 1B8XA 1SJZA 2LJKA 3ERFA 3VFIA 1MD3A 1WMJA 3EMXA 4MDCA 1OKTA 2YWNA 1TTZA 2V2GA 2HSYA 2LJAA 1OC3A 2GQKA 1GRXA 4F2IA 1UA5A 4DSSB 3FK8A 1DBYA 5FHIA 2C3QA 4RI7A 2WFCA 3S9FA 2VAFA 3TKSC 3GTUA 4OCEA 1U88A 2E7PA 6GSVA 4OFTA 3LYPA 3GYKA 1SK2A 2GS3A 2GQMA 1NHOA 1R5PA 6GSTA 3IA1A 3IC4A 4PQ1A 1F2EA 1X9WB 4TXOA 4NWYA 4HDEA 4KSMA 1PL1A 2GT6A 1SJ6A 2OE0A 2O89A 3GSSA 2MMOA 5DALA 1EV4A 2KP1A 1VF3A 3FYGA 2YWOA 2XBQA 3CTGA 1T7PB 2GDRA 3NOFA 4GLTA 2GT5A 1TP9A 4V1Ap 3KP8A 5L71A 2GSTA 1O8WA 2F51A 3MAKA 3TOUA 4RUVA 4RQRA 4G19A 3LJRA 5IO2A 1MD4A 1Z3EA 2CV4A 5IMZA 1AIUA 1DSBA 4MK3A 5ECQB 5G1LA 1TJDA 4TXOB 2QSIA 3Q74A 3UIWA 4FYUA 4L5OA 5H5SA 2LSTA 2CX4A 5ECIB 3TOTA 2DIYA 3DD3A 2ES7A 2P0GA 1AUCA 1RQMA 2AV4A 3M3MA 2H6ZA 1TRWA 2EIQA 2E0QA 3CSHA 5ECKB 3L4NA 1FVJA 2BTOT 2X8HA 3LXTA 1SD8A 4NV2A 4LA1A 4OFMA 1G0TA 2C3TA 2AJQB 3KGKA 5B6NA 2XPEA 2L5OA 5C04A 1JHBA 3G7IA 4PUAA 3FKFA 3G9BA 1WOUA 1XWKA 1HD2A 3HVVA 5IM9A 5J5NA 3IK7A 1R4WA 6GSYA 4OO4A 1SK1A 1DUGA 8GSSA 1RK4A 3HZ8A 3KM6A 4GSNA 1O85A 2FY6A 4WKWA 4N0ZA 1XOAA 3KH9A 1Q4JA 2J9HA 2R2JA 1G7EA 1ON4A 1PQNA 1THXA 2H0GA 2PUKC 4K7NA 4EF0A 3A2VA 1OC9B 9GSSA 3MWHA 19GSA 2H0IA 3QPMA 3LSZA 5HQPA 2LS5A 2C3NA 2JSZA 4IGJA 3J7Yk 2H75A 1PX6A 3FY7A 4LLRA 3H93A 4Q5QA 4BA7A 3E3EA 4D73B 4DSQA 1X5DA 2MMZA 2GSSA 2K18A 3PGTA 2H6XA 1WRYA 4TW5A 3JCML 1A24A 4MZWA 5J9BA 4O5RA 2JACA 1ABAA 3RDWA 4BVYA 4HEA2 4ZILA 2GZZA 5HFGA 2WB9A 4AGSA 2VO4A 4Z7XA 2C4JA 3UBLA 3TKPA 1QK8A 3DKSA 2FLSA 2LNTA 3ZFLA 1XW6A 1PGTA 1YDKA 2F8FA 4HZ4A 1B9YC 2FHEA 4N11A 1XWGA 4IJIA 4NAXA 4POLA 4HQSA 4K6XA 2IL3A 2VL2A 2IFQA 1T4ZA 5CRDA 3LORA 2CZ3A 4YAPA 4N0VA 1J08A 1GSFA 4G2EA 2AB6A 1GP1A 4F03A 5GSTA 3ZITA 2RLIA 2LQQA 5DJMA 1BAYA 3ZMKA 3TKQA 5J4UA 2OE1A 3H4KA 2OE3A 2WRTA 1PSQA 4FH8A 5EY6A 4OMVA 5HFIA 3EWLA 1X0RA 1I5GA 2H76A 5GZZB 4ZBBA 1Z5YE 3GV1A 2V6OA 2X64A 4WBJA 4OCFA 1JZWA 3C73A 2CZ2A 1WE0A 3VI5A
chains in the Genus database with same CATH superfamily
3KMNA 4OO5A 1XCCA 4KDXA 2HRNA 1FVKA 3D0ZA 2E2MA 3PH9A 4HZ2A 5D9WA 2D2ZA 3HZ4A 2HZEB 1NSWA 4K2DA 2N5AA 2OADA 2IMEA 3CMIA 4LL4B 1WP0A 4EDZA 2YOIA 2ON5A 1DE1A 2B3SA 20GSA 3ZYWA 5DAKB 5B8AA 1A8LA 4FIWA 1T4YA 1AQVA 5F06A 1OE8A 3FR6A 3GKXA 4AJ8A 1K0AA 2LRTA 4YQMA 3NIVA 4K0GA 2H1BA 2AYTA 2V32A 1S3CA 2PPTA 1K0CA 4BVXB 3A5WA 3QAVA 4MZCA 3F6FA 1Z6MA 2H73A 4GWRA 2IN3A 4DEJA 2HYXA 3BD2A 2H1AA 4YQVA 4XCSA 1SL2B 2IMFA 1TU7A 1S3AA 3TJKA 5KOXA 2PWJA 1TW9A 2CX3A 11GSA 4MPGA 5DCGA 4WR5A 1GTAA 4ZL8A 5J9CA 1K0NA 3O6TA 4HJMA 4O5UA 2R0GA 3GRXA 1TKDB 3ME8A 3HY2A 2V41A 1E6BA 4NV5A 5B8BA 3TJBA 1CQGA 4EUYA 1QQ2A 3LWAA 1O73A 4IHUA 1TXXA 1A8YA 1Y25A 2HSHA 5EL8A 5HR3A 4XHMA 1YY7A 4KDYA 1M99A 3BOAA 2CVBA 1AQXA 3VPQA 3FW2A 1XIYA 1M9BA 3M1GA 4ECBA 2FCHA 1F37A 3UVHA 2HLSA 1PL2A 2CAQA 1VF1A 1K3OA 3EYTA 1J9BA 4V2MA 3C1SA 5F0GA 4X1UA 4EVMA 1SKRB 1H75A 3GN3A 2H1GA 3IBHA 1OKDA 3RHBA 4KW6A 5A4UA 3F6DA 4MPFA 3F4RA 1VGLA 3I6AA 1HNAA 4BL7A 2DJJA 1CQHA 2OA7A 2B7JA 2LJRA 1SENA 2WCIA 4PX1A 2CQ9A 1AC1A 5KN1A 2A2RA 2QKEA 1Z9HA 3BCKA 5KN0A 2OKAA 3EURA 3HDCA 2C0EA 1QUWA 5G30A 2EIOA 1ZOFA 5IMDA 5D9XA 4I97A 3TRQA 5DCHA 4IQAA 1WIKA 3VPTA 2B5YA 5AIVA 1M2BA 5A4VA 2YANA 5LNKe 1G7OA 1QMVA 3M9JA 3GIXA 1FAAA 4L8EA 3SBCA 3UOMA 4K2XA 3TKSE 2M80A 2PBJA 1WPIA 2C80A 2HT9A 3HD5A 5E59A 2VCQA 2PGTA 4TR4A 3IHQA 2G0FA 1E2YA 2HXKA 2E2GA 2P5RA 3UVTA 2YV9A 1XZOA 4G9HA 2GZYA 4NHZA 1B9XC 2F3MA 1R26A 4JR4A 3QOUA 1A2MA 3VLNA 4IP6A 4MH2A 3CSIA 2N5BA 6GSUA 1GULA 3ZTLA 3IAM2 5JCWA 5D9VA 5CRGA 3GMFA 6GSWA 5ABRA 1K0OA 5HR2A 5CRHA 3ZIJA 2WGRA 2R5GA 3F4SA 2RUFA 1SL1B 3KEBA 3WYWA 1HYUA 3TKSA 1YZXA 2VCZA 3FHKA 1J0FA 4POMA 1M3IA 2DBCA 4I6XA 4MF7A 2DKIA 2VCVA 3MNGA 3CRTA 1SKWB 2LTKA 5DQSA 2EC4A 1ZZYA 2LEGA 5CP1A 1ERUA 4GCIA 5IMFA 3MYDA 3GTUB 1KBNA 1EZKA 1YEXA 4FO5A 3TRPA 2YZUA 2HFDA 4YKFA 3GKNA 4XS6A 13GSA 1PN0A 5D93A 3GA4A 5IPHA 2HRKA 2FD3A 5ENUA 5DALB 2FWFA 4K0NA 2VOCA 4X4JA 2OBIA 4EXJA 3MIXA 3KCMA 1N2AA 1K3LA 3ED3A 1FB6A 2VD0A 3ZIVA 4KE3A 1TDIA 2GZPA 1ILOA 4TR0A 2VM2A 2K6VA 1KTEA 5CAXA 4V1Ag 5AIXA 2GVPA 2X99A 4ISDA 1HNBA 4KUNA 5ECNB 3WT2A 2GQLA 2ZNMA 5FT3A 2R4VA 2R3XA 3QFBC 1GTUA 2YP6A 3D22A 4IVFA 2GSRA 2C8UA 1F6MC 16GSA 3PPUA 4DSRA 2I4AA 3TDGA 4TOPA 4F82A 5IIZA 2X8GA 3A2XA 4KH7A 4HUAA 1U87A 4ZL7A 2VM1A 3W8JA 2CT6A 2ZCTA 3Q19A 3KJYA 3Q18A 4Z2RA 1DE2A 4IN0A 3I43A 3GX8A 5F05A 1HQOA 4HS1A 1GUHA 1PMTA 2K9FA 3CSJA 1WJKA 4TN8A 3O3TA 4PNFA 2L4CA 3ZLPA 5KN2A 3A3TA 4IS0A 3APOA 3WGXA 4MA9A 1UC7A 2L59A 1ACVA 1F3BA 4PQHA 3ZVJD 4MJEA 3KTLA 1PN9A 2JL4A 1VF2A 4EIQA 1JZDA 2P5QA 2CVDA 1GSSA 3ZFBA 4NXIA 4TRXA 2HI7A 3GH6A 4JEDA 12GSA 1YF0A 4XS1A 2VIMA 1YKCA 3I9V2 2CVKA 5B7CA 2N5FA 3I69A 3UMAA 4O92A 1T1VA 4ML1A 1BX9A 4MJBA 5JCUA 3FZ4A 2GSQA 1XWAA 3HHVA 1FO5A 2X8CA 4LMVA 1XBSA 3P2AA 2HZFA 2MYGA 2DMMA 4OD7A 1URMA 3WGEA 1UN2A 2RIIA 4TR1A 2GLRA 3U5RE 5KN3A 4QL9A 4XRDA 3L9VA 2A2SA 4IELA 3VWUA 18GSA 2IMIA 4BVYB 3C8EA 2AHEA 2OJLA 4BWQA 3KIJA 4POKA 2PU9C 3ZMLA 3HXSA 3EE2A 3DVXA 3M0FA 3HVXA 1V57A 3PR8A 2XBIA 2FWHA 2NDOA 3L9UA 4WEYA 2R37A 1SL0B 3DGQA 2M46A 4ZBDA 1SYRA 1W89A 5AN1A 3US3A 4POBA 1EP8A 2LRCA 3BJ5A 1ZMAA 2YN1A 2WDUA 3L78A 2VL9A 1TK5B 2V6KA 1XXUA 1GTIA 3GH9A 5JWOB 2H70A 1YF1A 3PINA 2IFQB 1RW1A 4XS4A 4BWSA 2B5XA 2X4AA 3IPZA 4ZB8A 3IHGA 2B5EA 1O6JA 3KH7A 1X5CA 3MDKA 3IE3A 2DMLA 1GNEA 3WT1A 4ECIA 2H0HA 2GTUA 1GSQA 4PURA 4MP4A 3M9KA 3QDNA 2QA1A 5D73A 3P8WA 2B1KA 3F8UA 2HRFA 2I1UA 5DJLA 3ZZXA 5HR1A 2BMXA 2H72A 1EGRA 1V2AA 1A0RP 10GSA 1SU9A 1KEBA 3N5OA 1MEKA 1PA3A 2YNXA 3APQA 4TR3A 3G7JA 2JU5A 2Z9SA 3GX0A 2HE3A 2YZHA 4K1FA 3TUEA 1T8EB 3E9JB 2YCDA 3BCIA 1K3YA 1U3AA 1V9WA 2H01A 2PN8A 4CW9A 4E8HA 4I8BA 4IQ1A 4JZQA 4YQUA 2NBSA 4HOJA 5LD0A 5ECLB 4XTSA 3HJPA 1Z6NA 1AXDA 2AAWA 3H1NA 3NZNA 3GHAA 1JZOA 1BG5A 2H74A 1O8XA 3U6VA 1Y6EA 2C1YA 4NMUA 1EEJA 1F3AA 1JFUA 4MCUA 2OACA 2O85A 4GTUA 3GKMA 1GTBA 3ZVJA 3F4TA 1WWJA 3FZAA 1MDJA 3P7XA 2L4QA 1MTCA 2A2PA 4MLYA 2ALBA 1OE7A 2IPAA 3OR5A 1M3JA 1V40A 4TXVA 4YH2A 1W4VA 2LQOA 4LL1B 1X9SB 1USBA 5BMUA 4WF5A 2I81A 4KNDA 1M9AA 1EWXA 4KSOA 3N9JA 5EVOA 2P31A 2K8VA 1FOVA 2VUPA 4G0IA 2YV7A 2IMKA 2WJUA 3V1WA 2TRCP 1BJXA 5D96A 4MJCA 1GH2A 3UBKA 4EC0A 5HR0A 4MF6A 4MF5A 2ZUPA 6GSSA 4GQCA 4WR4A 4XRAA 3F63A 1UVZA 5DDLA 3GUSA 2JSYA 4PUFC 2IMDA 2FWEA 4KGIA 1M2AA 1FG4A 3A2WA 1PFOA 4ID0A 1JZRA 5ECHB 2L6DA 1TK8B 2AUVA 1PKZA 4PXOA 4Z2TA 1EV9A 5EPFA 2YPMA 5IOXA 4ULXA 5F07A 3TJJA 2KOKA 4CY8A 5AGYA 2H1DA 4NHWA 1FW1A 2J23A 4DSSA 1AQWA 4K7OA 1T3BA 1XVQA 4ACSA 1H4OA 5A4WA 5IOWA 3H8QA 3DIEA 4BL7B 1HNCA 3C7MA 3RBTA 2CAIA 2B7KA 5CO3A 4JBBA 5CNWA 4WF4A 3CRUA 3FEUA 3VK9A 1JLWA 5G5FA 4IW9A 2FUG2 3QR6A 1M7TA 1XOBA 1LU4A 2DJ2A 2I3YA 4X43A 5ELGA 1EEMA 4WBRD 2FA4A 4J57E 2VCWA 1AAZA 1U6TA 1GSYA 3L9SA 4IP1A 1N8JA 1YKAA 3TRXA 3DXBA 4I2TA 5DVBA 1XWCA 2L6CA 1A0FA 4N10A 1B4PA 2YWMA 3VI7A 1NHYA 1XFLA 4BPYA 3SWLA 1YEPA 5D8IA 2DJ3A 3CTFA 3C1RA 3J7Yb 1TU8A 1R5AA 3RPNA 2MMAA 4KA0A 3KD0A 3IV4A 3QCPA 4USSA 1THOA 4ECJA 2I9HA 2RM6A 2QGVA 1AW9A 1X5EA 2FNOA 2DIZA 1F9MA 4EKZA 2A4VA 4K7IA 5C00A 2LNSA 4IJ3A 2WZ9A 14GSA 1NW2A 2MBTA 3HVSA 4JRRA 2JZRA 5GSSA 1SKSB 1A23A 1C72A 1ERWA 3MSZA 1NM3A 2HRAA 4KB3A 3ZREA 2ON7A 2V1MA 3R3EA 1QFNA 4HU7A 4F0BA 22GSA 2R0PA 1SYXA 3DYRA 5J41A 1G6WA 5IMVA 2L5LA 3APSA 3WD6A 3CXGA 2KHPA 4MMMA 4MABA 4PGTA 4XIHA 2G2QA 4GRFA 3FR3A 4NPBA 3O76A 4L0UA 4TVEA 5INYA 1B48A 3UARA 1OC9A 1XPVA 2F8AA 5BRTA 1TRVA 1M2DA 5IPGA 3R2QA 3QD9A 4G10A 2LKUA 3VWVA 3C71A 1Z7PA 5ECSA 1VRSD 3GL5A 2O7KA 2VLTA 3DRNA 1PD21 1OC8A 2RUEA 3ZRDA 5LCZA 4PNGA 3ME7A 1MDKA 4D73A 3HCZA 4MH3A 1GWCA 4Q5RA 4HI7A 5ID2A 4E8EA 1LJRA 3GKKA 3FR9A 1MDIA 1ZCPA 4AJ6A 6GSXA 3KP9A 4FYBA 1JLVA 1ERTA 4KAEA 4QQ7A 3VWWA 5E4WA 2H8LA 4MNNA 2MZCA 2C0FA 2VL3A 2YJHA 4JE1A 4ILFA 1YQ1A 5A5KA 4G0LA 1ZYEA 4JU5A 1LBKA 3LFLA 4I2UA 4J2FA 3EC3A 3HYPA 5DBQA 2X49A 3G7YA 3W8SA 4AF2A 1BYEA 3ERGA 1ZL9A 1XWBA 3H79A 4OWYA 3DVWA 2KLXA 4ML6A 3WGDA 1X9MB 2TIRA 5ID2B 1ML6A 5G2ZA 5ECOB 1O7UA 2JZSA 3DMLA 4IBPA 4ZB9A 3GFKA 2DSAA 5KEJA 2PVOC 5ECMB 5ELAA 2H19A 1ST9A 1BEDA 2GGTA 4GXZA 3P90A 2VL2C 1SD9A 1OYJA 1Q98A 4ECCA 3VURA 1PX7A 2IWTA 4OFNA 1XW9A 2LRNA 2VD1A 2FGXA 4Q5NA 1SK0A 5GAPD 1K0BA 1GUMA 4IKHA 2WS2A 2BJXA 3FZ5A 4N30A 4ZIJA 5GAND 4V2NA 2JZTA 5ECRB 2K8SA 3LYKA 4V2LA 2XC2A 2CA8A 3HKRA 1ERVA 5HFKA 3EMPA 3HJMA 4CY6A 4ZBAA 3F3RA 4PQIA 2IIYA 2PERA 3KZQA 2HZEA 4GSSA 2XPDA 1S3DA 4KCEA 2FA8A 3FZ9A 2PMTA 1PRXA 4Q5FA 4MZBA 2H6YA 1ZYNA 3QFAC 3M8NA 3D5JA 5COHA 5DAKA 5ECPB 3AY8A 2XHFA 4J56E 3W6GA 1BQ7A 4CDOA 1GSEA 1YJ6A 2VLVA 4TR1B 5D9TA 1ZYQB 2HNLA 3DWVA 4O7HA 1VF4A 4G0KA 4KDUA 4BVXA 2REMA 3ERWA 3ISOA 1TI3A 4GQFA 1TRSA 4MJAA 3D4TA 2LUSA 2MBSA 1IYHA 3FRCA 4YAVA 2O8VB 5JWRB 1EOGA 4K8MA 2C0GA 2HSMA 1XW5A 3D4MA 2H66A 1B4QA 4WXTA 3RPPA 2VCTA 3UEMA 4FYCA 4GSTA 3KXOA 3IDVA 4TKYA 2IJYA 1FB0A 1EGOA 4EO3A 2F9SA 7GSSA 5IQYA 2NPBA 1TRUA 5G31A 5FWGA 2TRXA 1K0MA 4HJ2A 4EE0A 3TJFA 5IMCA 4XS4B 1K0DA 2NTOA 4DVCA 4CHSA 1R7HA 1GSDA 3QMXA 5AISA 1XVWA 3TGZA 4LMWA 2QC7A 1GLQA 3L0HA 3F9UA 3F0IA 2YWIA 3GNJA 1IYIA 2M72A 2L57A 1T00A 4HQZA 3Q6OA 1QXHA 2DLXA 5CREA 4ZXGA 3LXZA 4FQUA 1V98A 2H30A 3GURA 5H5QA 1QGVA 2NVLA 1OAZA 4K9ZA 17GSA 4QL7A 1ZGNA 4WETA 3DEXA 3GSTA 3KMOA 4ZB6A 4P3YB 3QAWA 4JR6A 3IK9A 3UJ1A 3VWXA 2KP2A 1PKWA 1V58A 3IAS2 3D6IA 3LEFA 2LV3A 4PTSA 2DJ0A 1GLPA 1GUKA 1Z7RA 3EVIA 3F3QA 4KX4A 1G6YA 1TK0B 3EPTA 1GSUA 1O81A 1KNGA 1EP7A 5G5EA 2EIRA 3CBUA 1GL8A 3IXRA 1OVNA 1EOHA 3IOSA 3K8NA 4GF0A 5IO0A 4AJ7A 4EL1A 4I5QA 3LGCA 2RM5A 1I9DA 2KUCA 4RQXA 1U3IA 2DJ1A 2R6KA 4H86A 4HU9A 4ZL9A 1FHEA 4KCAA 2PVQA 1M0UA 3UAPA 3BBYA 4L5LA 2VCXA 2O87A 3D21A 2MMNA 3IRAA 5JWQB 4X0XA 3RHCA 5JCGA 3TCOA 3RAZA 3EU4A 5G1KA 3CYNA 3ZL5A 5B6MA 3TB2A 1TI1A 3EU3A 2OBKA 4F9ZA 1A2LA 3KTBA 5H5RA 3LW9A 3LG6A 2JADA 3LQ7A 4K5RA 3IR4A 1SJIA 2B6MA 5CRWA 1A2JA 3TJGA 3HVNA 4RI6A 3QAGA 3HJOA 3EINA 3TKRA 2YJ7A 5J3RA 4O5QA 2DC5A 4F0CA 1TOFA 5DQYA 3GL3A 3HA9A 2FWGA 5F8BA 1GNWA 5CYYA 4O32A 2H71A 2C0DA 3E0UA 5IMAA 2VLUA 4L0WA 2WULA 2DKHA 2B1LA 3UL3A 4EDYA 2DJKA 1B8XA 1SJZA 2LJKA 3ERFA 3VFIA 1MD3A 1WMJA 3FMWA 3EMXA 4MDCA 1OKTA 2YWNA 1TTZA 2V2GA 2HSYA 2LJAA 1OC3A 2GQKA 1GRXA 4F2IA 1UA5A 4DSSB 3FK8A 1DBYA 4BIKA 5FHIA 2C3QA 4RI7A 2WFCA 3S9FA 2VAFA 3TKSC 3GTUA 4OCEA 1U88A 2E7PA 6GSVA 4OFTA 3LYPA 3GYKA 1SK2A 2GS3A 2GQMA 1NHOA 1R5PA 6GSTA 3IA1A 3IC4A 4PQ1A 1F2EA 1X9WB 4TXOA 4NWYA 4HDEA 4KSMA 1PL1A 2GT6A 1SJ6A 2OE0A 2O89A 3GSSA 2MMOA 5DALA 1EV4A 2KP1A 1VF3A 3FYGA 2YWOA 2XBQA 3CTGA 1T7PB 2GDRA 3NOFA 4GLTA 2GT5A 1TP9A 4V1Ap 3KP8A 4KF9A 5L71A 2GSTA 1O8WA 2F51A 3MAKA 3TOUA 4RUVA 4HSCX 4RQRA 3A5IA 5KOWA 4G19A 3LJRA 5IO2A 1MD4A 1Z3EA 2CV4A 5IMZA 1AIUA 1DSBA 4MK3A 5ECQB 5G1LA 1TJDA 4TXOB 2QSIA 3Q74A 3UIWA 4FYUA 4L5OA 5H5SA 2LSTA 2CX4A 4ICYA 5ECIB 3TOTA 2DIYA 4YKGA 3DD3A 2ES7A 2P0GA 1AUCA 1RQMA 2AV4A 3M3MA 2H6ZA 1TRWA 2EIQA 2E0QA 3CSHA 5ECKB 4Z2UA 3L4NA 1FVJA 2BTOT 2X8HA 3LXTA 1SD8A 4NV2A 4LA1A 4OFMA 1G0TA 2C3TA 2AJQB 3KGKA 5B6NA 2XPEA 2L5OA 5C04A 1JHBA 3G7IA 4PUAA 3FKFA 3G9BA 1WOUA 2UZ8A 1XWKA 1HD2A 3HVVA 5IM9A 5J5NA 3IK7A 1R4WA 6GSYA 4OO4A 1SK1A 1DUGA 8GSSA 1RK4A 3HZ8A 2R0CA 3KM6A 4GSNA 2QA2A 1O85A 2FY6A 4WKWA 4N0ZA 1XOAA 3KH9A 1Q4JA 2J9HA 2R2JA 4A5PA 1G7EA 1ON4A 1PQNA 1THXA 2H0GA 2PUKC 4K7NA 4EF0A 3A2VA 1FOHA 1OC9B 9GSSA 3MWHA 19GSA 2H0IA 3QPMA 3LSZA 5HQPA 2LS5A 2C3NA 2JSZA 4IGJA 3J7Yk 2H75A 1PX6A 3FY7A 4LLRA 3H93A 4Q5QA 4BA7A 3E3EA 4D73B 4DSQA 1X5DA 2MMZA 2GSSA 2K18A 3PGTA 2H6XA 1WRYA 4TW5A 3JCML 1A24A 4MZWA 5J9BA 2A4HA 4O5RA 2JACA 1ABAA 3RDWA 4BVYA 4HEA2 4ZILA 2GZZA 5HFGA 2WB9A 4AGSA 3IC8A 2VO4A 4Z7XA 2C4JA 3UBLA 3TKPA 1QK8A 3DKSA 2FLSA 2LNTA 3ZFLA 1XW6A 1PGTA 1S3RA 1YDKA 1ZYPA 2F8FA 4HZ4A 1B9YC 2FHEA 4N11A 1XWGA 4IJIA 4EIPA 4NAXA 4POLA 4HQSA 4K6XA 2IL3A 2VL2A 2IFQA 1T4ZA 5CRDA 3LORA 2CZ3A 4YAPA 4N0VA 1J08A 1GSFA 4G2EA 2AB6A 1GP1A 4F03A 4K5SA 5GSTA 3ZITA 2RLIA 2LQQA 5DJMA 1BAYA 3ZMKA 1XG8A 3TKQA 5J4UA 2OE1A 3H4KA 2OE3A 2WRTA 1PSQA 4FH8A 5EY6A 4OMVA 5HFIA 3EWLA 1X0RA 1I5GA 2H76A 5GZZB 4ZBBA 1Z5YE 3GV1A 3CQFA 2V6OA 2X64A 4WBJA 4OCFA 1JZWA 3C73A 2CZ2A 1WE0A 3VI5A
chains in the Genus database with same CATH topology
3KMNA 4OO5A 1XCCA 4KDXA 2HRNA 1FVKA 3D0ZA 2E2MA 3PH9A 4HZ2A 5D9WA 2D2ZA 3HZ4A 2HZEB 1NSWA 4K2DA 2N5AA 2OADA 2IMEA 3CMIA 4LL4B 1WP0A 4EDZA 2YOIA 2ON5A 1DE1A 2B3SA 20GSA 3ZYWA 5DAKB 5B8AA 1A8LA 4FIWA 1T4YA 1AQVA 5F06A 1OE8A 3FR6A 3GKXA 4AJ8A 1K0AA 2LRTA 4YQMA 3NIVA 4K0GA 2H1BA 2AYTA 2V32A 1S3CA 2PPTA 1K0CA 4BVXB 3A5WA 3QAVA 4MZCA 3F6FA 1Z6MA 2H73A 4GWRA 2IN3A 4DEJA 2HYXA 3BD2A 2H1AA 4YQVA 4XCSA 1SL2B 2IMFA 1TU7A 1S3AA 3TJKA 5KOXA 2PWJA 1TW9A 2CX3A 11GSA 4MPGA 5DCGA 4WR5A 1GTAA 4ZL8A 5J9CA 1K0NA 3O6TA 4HJMA 4O5UA 2R0GA 3GRXA 1TKDB 3ME8A 3HY2A 2V41A 1E6BA 4NV5A 5B8BA 3TJBA 1CQGA 4EUYA 1QQ2A 3LWAA 1O73A 4IHUA 1TXXA 1A8YA 1Y25A 2HSHA 5EL8A 5HR3A 4XHMA 1YY7A 4KDYA 1M99A 3BOAA 2CVBA 1AQXA 3VPQA 3FW2A 1XIYA 1M9BA 3M1GA 4ECBA 2FCHA 1F37A 3UVHA 2HLSA 1PL2A 2CAQA 1VF1A 1K3OA 3EYTA 1J9BA 4V2MA 3C1SA 5F0GA 4X1UA 4EVMA 1SKRB 1H75A 3GN3A 2H1GA 3IBHA 1OKDA 3RHBA 4KW6A 5A4UA 3F6DA 4MPFA 3F4RA 1VGLA 3I6AA 1HNAA 4BL7A 2DJJA 1CQHA 2OA7A 2B7JA 2LJRA 1SENA 2WCIA 4PX1A 2CQ9A 1AC1A 5KN1A 2A2RA 2QKEA 1Z9HA 3BCKA 5KN0A 2OKAA 3EURA 3HDCA 2C0EA 1QUWA 5G30A 2EIOA 1ZOFA 5IMDA 5D9XA 4I97A 3TRQA 5DCHA 4IQAA 1WIKA 3VPTA 2B5YA 5AIVA 1M2BA 5A4VA 2YANA 5LNKe 1G7OA 1QMVA 3M9JA 3GIXA 1FAAA 4L8EA 3SBCA 3UOMA 4K2XA 3TKSE 2M80A 2PBJA 1WPIA 2C80A 2HT9A 3HD5A 5E59A 2VCQA 2PGTA 4TR4A 3IHQA 2G0FA 1E2YA 2HXKA 2E2GA 2P5RA 3UVTA 2YV9A 1XZOA 4G9HA 2GZYA 4NHZA 1B9XC 2F3MA 1R26A 4JR4A 3QOUA 1A2MA 3VLNA 4IP6A 4MH2A 3CSIA 2N5BA 6GSUA 1GULA 3ZTLA 3IAM2 5JCWA 5D9VA 5CRGA 3GMFA 6GSWA 5ABRA 1K0OA 5HR2A 5CRHA 3ZIJA 2WGRA 2R5GA 3F4SA 2RUFA 1SL1B 3KEBA 3WYWA 1HYUA 3TKSA 1YZXA 2VCZA 3FHKA 1J0FA 4POMA 2DBCA 4I6XA 4MF7A 2DKIA 2VCVA 3MNGA 3CRTA 1SKWB 2LTKA 5DQSA 2EC4A 1ZZYA 2LEGA 5CP1A 1ERUA 4GCIA 5IMFA 3MYDA 3GTUB 1KBNA 1EZKA 1YEXA 4FO5A 3TRPA 2YZUA 2HFDA 4YKFA 3GKNA 4XS6A 13GSA 1PN0A 5D93A 3GA4A 5IPHA 2HRKA 2FD3A 5ENUA 5DALB 2FWFA 4K0NA 2VOCA 4X4JA 2OBIA 4EXJA 3MIXA 3KCMA 1N2AA 1K3LA 3ED3A 1FB6A 2VD0A 3ZIVA 4KE3A 1TDIA 2GZPA 1ILOA 4TR0A 2VM2A 2K6VA 1KTEA 5CAXA 4V1Ag 5AIXA 2GVPA 2X99A 4ISDA 1HNBA 4KUNA 5ECNB 3WT2A 2GQLA 2ZNMA 5FT3A 2R4VA 2R3XA 3QFBC 1GTUA 2YP6A 3D22A 4IVFA 2GSRA 2C8UA 1F6MC 16GSA 3PPUA 4DSRA 2I4AA 3TDGA 4TOPA 4F82A 5IIZA 2X8GA 3A2XA 4KH7A 4HUAA 1U87A 4ZL7A 2VM1A 3W8JA 2CT6A 2ZCTA 3Q19A 3KJYA 3Q18A 4Z2RA 1DE2A 4IN0A 3I43A 3GX8A 5F05A 1HQOA 4HS1A 1GUHA 1PMTA 2K9FA 3CSJA 1WJKA 4TN8A 3O3TA 4PNFA 2L4CA 3ZLPA 5KN2A 3A3TA 4IS0A 3APOA 3WGXA 4MA9A 1UC7A 2L59A 1ACVA 1F3BA 4PQHA 3ZVJD 4MJEA 3KTLA 1PN9A 2JL4A 1VF2A 4EIQA 1JZDA 2P5QA 2CVDA 1GSSA 3ZFBA 4NXIA 4TRXA 2HI7A 3GH6A 4JEDA 12GSA 1YF0A 4XS1A 2VIMA 1YKCA 3I9V2 2CVKA 5B7CA 2N5FA 3I69A 3UMAA 4O92A 1T1VA 4ML1A 1BX9A 4MJBA 5JCUA 3FZ4A 2GSQA 1XWAA 3HHVA 1FO5A 2X8CA 4LMVA 1XBSA 3P2AA 2HZFA 2MYGA 2DMMA 4OD7A 1URMA 3WGEA 1UN2A 2RIIA 4TR1A 2GLRA 3U5RE 5KN3A 4QL9A 4XRDA 3L9VA 2A2SA 4IELA 3VWUA 18GSA 2IMIA 4BVYB 3C8EA 2AHEA 2OJLA 4BWQA 3KIJA 4POKA 2PU9C 3ZMLA 3HXSA 3EE2A 3DVXA 3M0FA 3HVXA 1V57A 3PR8A 2XBIA 2FWHA 2NDOA 3L9UA 4WEYA 2R37A 1SL0B 3DGQA 2M46A 4ZBDA 1SYRA 1W89A 5AN1A 3US3A 4POBA 1EP8A 2LRCA 3BJ5A 1ZMAA 2YN1A 2WDUA 3L78A 2VL9A 1TK5B 2V6KA 1XXUA 1GTIA 3GH9A 5JWOB 2H70A 1YF1A 3PINA 2IFQB 1RW1A 4XS4A 4BWSA 2B5XA 2X4AA 3IPZA 4ZB8A 3IHGA 2B5EA 1O6JA 3KH7A 1X5CA 3MDKA 3IE3A 2DMLA 1GNEA 3WT1A 4ECIA 2H0HA 2GTUA 1GSQA 4PURA 4MP4A 3M9KA 3QDNA 2QA1A 5D73A 3P8WA 2B1KA 3F8UA 2HRFA 2I1UA 5DJLA 3ZZXA 5HR1A 2BMXA 2H72A 1EGRA 1V2AA 1A0RP 10GSA 1SU9A 1KEBA 3N5OA 1MEKA 1PA3A 2YNXA 3APQA 4TR3A 3G7JA 2JU5A 2Z9SA 3GX0A 2HE3A 2YZHA 4K1FA 3TUEA 1T8EB 3E9JB 2YCDA 3BCIA 1K3YA 1U3AA 1V9WA 2H01A 2PN8A 4CW9A 4E8HA 4I8BA 4IQ1A 4JZQA 4YQUA 2NBSA 4HOJA 5LD0A 5ECLB 4XTSA 3HJPA 1Z6NA 1AXDA 2AAWA 3H1NA 3NZNA 3GHAA 1JZOA 1BG5A 2H74A 1O8XA 3U6VA 1Y6EA 2C1YA 4NMUA 1EEJA 1F3AA 1JFUA 4MCUA 2OACA 2O85A 4GTUA 3GKMA 1GTBA 3ZVJA 3F4TA 1WWJA 3FZAA 1MDJA 3P7XA 2L4QA 1MTCA 2A2PA 4MLYA 2ALBA 1OE7A 2IPAA 3OR5A 1V40A 4TXVA 4YH2A 1W4VA 2LQOA 4LL1B 1X9SB 1USBA 5BMUA 4WF5A 2I81A 4KNDA 1M9AA 1EWXA 4KSOA 3N9JA 5EVOA 2P31A 2K8VA 1FOVA 2VUPA 4G0IA 2YV7A 2IMKA 2WJUA 3V1WA 2TRCP 1BJXA 5D96A 4MJCA 1GH2A 3UBKA 4EC0A 5HR0A 4MF6A 4MF5A 2ZUPA 6GSSA 4GQCA 4WR4A 4XRAA 3F63A 1UVZA 5DDLA 3GUSA 2JSYA 4PUFC 2IMDA 2FWEA 4KGIA 1M2AA 1FG4A 3A2WA 4ID0A 1JZRA 5ECHB 2L6DA 1TK8B 2AUVA 1PKZA 4PXOA 4Z2TA 1EV9A 5EPFA 2YPMA 5IOXA 4ULXA 5F07A 3TJJA 2KOKA 4CY8A 5AGYA 2H1DA 4NHWA 1FW1A 2J23A 4DSSA 1AQWA 4K7OA 1T3BA 1XVQA 4ACSA 1H4OA 5A4WA 5IOWA 3H8QA 3DIEA 4BL7B 1HNCA 3C7MA 3RBTA 2CAIA 2B7KA 5CO3A 4JBBA 5CNWA 4WF4A 3CRUA 3FEUA 3VK9A 1JLWA 5G5FA 4IW9A 2FUG2 3QR6A 1M7TA 1XOBA 1LU4A 2DJ2A 2I3YA 4X43A 5ELGA 1EEMA 4WBRD 2FA4A 4J57E 2VCWA 1AAZA 1U6TA 1GSYA 3L9SA 4IP1A 1N8JA 1YKAA 3TRXA 3DXBA 4I2TA 5DVBA 1XWCA 2L6CA 1A0FA 4N10A 1B4PA 2YWMA 3VI7A 1NHYA 1XFLA 4BPYA 3SWLA 1YEPA 5D8IA 2DJ3A 3CTFA 3C1RA 3J7Yb 1TU8A 1R5AA 3RPNA 2MMAA 4KA0A 3KD0A 3IV4A 3QCPA 4USSA 1THOA 4ECJA 2I9HA 2RM6A 2QGVA 1AW9A 1X5EA 2FNOA 2DIZA 1F9MA 4EKZA 2A4VA 4K7IA 5C00A 2LNSA 4IJ3A 2WZ9A 14GSA 1NW2A 2MBTA 3HVSA 4JRRA 2JZRA 5GSSA 1SKSB 1A23A 1C72A 1ERWA 3MSZA 1NM3A 2HRAA 4KB3A 3ZREA 2ON7A 2V1MA 3R3EA 1QFNA 4HU7A 4F0BA 22GSA 2R0PA 1SYXA 3DYRA 5J41A 1G6WA 5IMVA 2L5LA 3APSA 3WD6A 3CXGA 2KHPA 4MMMA 4MABA 4PGTA 4XIHA 2G2QA 4GRFA 3FR3A 4NPBA 3O76A 4L0UA 4TVEA 5INYA 1B48A 3UARA 1OC9A 1XPVA 2F8AA 5BRTA 1TRVA 1M2DA 5IPGA 3R2QA 3QD9A 4G10A 2LKUA 3VWVA 3C71A 1Z7PA 5ECSA 1VRSD 3GL5A 2O7KA 2VLTA 3DRNA 1PD21 1OC8A 2RUEA 3ZRDA 5LCZA 4PNGA 3ME7A 1MDKA 4D73A 3HCZA 4MH3A 1GWCA 4Q5RA 4HI7A 5ID2A 4E8EA 1LJRA 3GKKA 3FR9A 1MDIA 1ZCPA 4AJ6A 6GSXA 3KP9A 4FYBA 1JLVA 1ERTA 4KAEA 4QQ7A 3VWWA 5E4WA 2H8LA 4MNNA 2MZCA 2C0FA 2VL3A 2YJHA 4JE1A 4ILFA 1YQ1A 5A5KA 4G0LA 1ZYEA 4JU5A 1LBKA 3LFLA 4I2UA 4J2FA 3EC3A 3HYPA 5DBQA 2X49A 3G7YA 3W8SA 4AF2A 1BYEA 3ERGA 1ZL9A 1XWBA 3H79A 4OWYA 3DVWA 2KLXA 4ML6A 3WGDA 1X9MB 2TIRA 5ID2B 1ML6A 5G2ZA 5ECOB 1O7UA 2JZSA 3DMLA 4IBPA 4ZB9A 3GFKA 2DSAA 5KEJA 2PVOC 5ECMB 5ELAA 2H19A 1ST9A 1BEDA 2GGTA 4GXZA 3P90A 2VL2C 1SD9A 1OYJA 1Q98A 4ECCA 3VURA 1PX7A 2IWTA 4OFNA 1XW9A 2LRNA 2VD1A 2FGXA 4Q5NA 1SK0A 5GAPD 1K0BA 1GUMA 4IKHA 2WS2A 2BJXA 3FZ5A 4N30A 4ZIJA 5GAND 4V2NA 2JZTA 5ECRB 2K8SA 3LYKA 4V2LA 2XC2A 2CA8A 3HKRA 1ERVA 5HFKA 3EMPA 3HJMA 4CY6A 4ZBAA 3F3RA 4PQIA 2IIYA 2PERA 3KZQA 2HZEA 4GSSA 2XPDA 1S3DA 4KCEA 2FA8A 3FZ9A 2PMTA 1PRXA 4Q5FA 4MZBA 2H6YA 1ZYNA 3QFAC 3M8NA 3D5JA 5COHA 5DAKA 5ECPB 3AY8A 2XHFA 4J56E 3W6GA 1BQ7A 4CDOA 1GSEA 1YJ6A 2VLVA 4TR1B 5D9TA 1ZYQB 2HNLA 3DWVA 4O7HA 1VF4A 4G0KA 4KDUA 4BVXA 2REMA 3ERWA 3ISOA 1TI3A 4GQFA 1TRSA 4MJAA 3D4TA 2LUSA 2MBSA 1IYHA 3FRCA 4YAVA 2O8VB 5JWRB 1EOGA 4K8MA 2C0GA 2HSMA 1XW5A 3D4MA 2H66A 1B4QA 4WXTA 3RPPA 2VCTA 3UEMA 4FYCA 4GSTA 3KXOA 3IDVA 4TKYA 2IJYA 1FB0A 1EGOA 4EO3A 2F9SA 7GSSA 5IQYA 2NPBA 1TRUA 5G31A 5FWGA 2TRXA 1K0MA 4HJ2A 4EE0A 3TJFA 5IMCA 4XS4B 1K0DA 2NTOA 4DVCA 4CHSA 1R7HA 1GSDA 3QMXA 5AISA 1XVWA 3TGZA 4LMWA 2QC7A 1GLQA 3L0HA 3F9UA 3F0IA 2YWIA 3GNJA 1IYIA 2M72A 2L57A 1T00A 4HQZA 3Q6OA 1QXHA 2DLXA 5CREA 4ZXGA 3LXZA 4FQUA 1V98A 2H30A 3GURA 5H5QA 1QGVA 2NVLA 1OAZA 4K9ZA 17GSA 4QL7A 1ZGNA 4WETA 3DEXA 3GSTA 3KMOA 4ZB6A 4P3YB 3QAWA 4JR6A 3IK9A 3UJ1A 3VWXA 2KP2A 1PKWA 1V58A 3IAS2 3D6IA 3LEFA 2LV3A 4PTSA 2DJ0A 1GLPA 1GUKA 1Z7RA 3EVIA 3F3QA 4KX4A 1G6YA 1TK0B 3EPTA 1GSUA 1O81A 1KNGA 1EP7A 5G5EA 2EIRA 3CBUA 1GL8A 3IXRA 1OVNA 1EOHA 3IOSA 3K8NA 4GF0A 5IO0A 4AJ7A 4EL1A 4I5QA 3LGCA 2RM5A 1I9DA 2KUCA 4RQXA 1U3IA 2DJ1A 2R6KA 4H86A 4HU9A 4ZL9A 1FHEA 4KCAA 2PVQA 1M0UA 3UAPA 3BBYA 4L5LA 2VCXA 2O87A 3D21A 2MMNA 3IRAA 5JWQB 4X0XA 3RHCA 5JCGA 3TCOA 3RAZA 3EU4A 5G1KA 3CYNA 3ZL5A 5B6MA 3TB2A 1TI1A 3EU3A 2OBKA 4F9ZA 1A2LA 3KTBA 5H5RA 3LW9A 3LG6A 2JADA 3LQ7A 4K5RA 3IR4A 1SJIA 2B6MA 5CRWA 1A2JA 3TJGA 4RI6A 3QAGA 3HJOA 3EINA 3TKRA 2YJ7A 5J3RA 4O5QA 2DC5A 4F0CA 1TOFA 5DQYA 3GL3A 3HA9A 2FWGA 5F8BA 1GNWA 5CYYA 4O32A 2H71A 2C0DA 3E0UA 5IMAA 2VLUA 4L0WA 2WULA 2DKHA 2B1LA 3UL3A 4EDYA 2DJKA 1B8XA 1SJZA 2LJKA 3ERFA 3VFIA 1MD3A 1WMJA 3FMWA 3EMXA 4MDCA 1OKTA 2YWNA 1TTZA 2V2GA 2HSYA 2LJAA 1OC3A 2GQKA 1GRXA 4F2IA 1UA5A 4DSSB 3FK8A 1DBYA 5FHIA 2C3QA 4RI7A 2WFCA 3S9FA 2VAFA 3TKSC 3GTUA 4OCEA 1U88A 2E7PA 6GSVA 4OFTA 3LYPA 3GYKA 1SK2A 2GS3A 2GQMA 1NHOA 1R5PA 6GSTA 3IA1A 3IC4A 4PQ1A 1F2EA 1X9WB 4TXOA 4NWYA 4HDEA 4KSMA 1PL1A 2GT6A 1SJ6A 2OE0A 2O89A 3GSSA 2MMOA 5DALA 1EV4A 2KP1A 1VF3A 3FYGA 2YWOA 2XBQA 3CTGA 1T7PB 2GDRA 3NOFA 4GLTA 2GT5A 1TP9A 4V1Ap 3KP8A 4KF9A 5L71A 2GSTA 1O8WA 2F51A 3MAKA 3TOUA 4RUVA 4RQRA 3A5IA 5KOWA 4G19A 3LJRA 5IO2A 1MD4A 1Z3EA 2CV4A 5IMZA 1AIUA 1DSBA 4MK3A 5ECQB 5G1LA 1TJDA 4TXOB 2QSIA 3Q74A 3UIWA 4FYUA 4L5OA 5H5SA 2LSTA 2CX4A 4ICYA 5ECIB 3TOTA 2DIYA 4YKGA 3DD3A 2ES7A 2P0GA 1AUCA 1RQMA 2AV4A 3M3MA 2H6ZA 1TRWA 2EIQA 2E0QA 3CSHA 5ECKB 4Z2UA 3L4NA 1FVJA 2BTOT 2X8HA 3LXTA 1SD8A 4NV2A 4LA1A 4OFMA 1G0TA 2C3TA 2AJQB 3KGKA 5B6NA 2XPEA 2L5OA 5C04A 1JHBA 3G7IA 4PUAA 3FKFA 3G9BA 1WOUA 2UZ8A 1XWKA 1HD2A 3HVVA 5IM9A 5J5NA 3IK7A 1R4WA 6GSYA 4OO4A 1SK1A 1DUGA 8GSSA 1RK4A 3HZ8A 2R0CA 3KM6A 4GSNA 2QA2A 1O85A 2FY6A 4WKWA 4N0ZA 1XOAA 3KH9A 1Q4JA 2J9HA 2R2JA 4A5PA 1G7EA 1ON4A 1PQNA 1THXA 2H0GA 2PUKC 4K7NA 4EF0A 3A2VA 1FOHA 1OC9B 9GSSA 3MWHA 19GSA 2H0IA 3QPMA 3LSZA 5HQPA 2LS5A 2C3NA 2JSZA 4IGJA 3J7Yk 2H75A 1PX6A 3FY7A 4LLRA 3H93A 4Q5QA 4BA7A 3E3EA 4D73B 4DSQA 1X5DA 2MMZA 2GSSA 2K18A 3PGTA 2H6XA 1WRYA 4TW5A 3JCML 1A24A 4MZWA 5J9BA 2A4HA 4O5RA 2JACA 1ABAA 3RDWA 4BVYA 4HEA2 4ZILA 2GZZA 5HFGA 2WB9A 4AGSA 3IC8A 2VO4A 4Z7XA 2C4JA 3UBLA 3TKPA 1QK8A 3DKSA 2FLSA 2LNTA 3ZFLA 1XW6A 1PGTA 1YDKA 1ZYPA 2F8FA 4HZ4A 1B9YC 2FHEA 4N11A 1XWGA 4IJIA 4EIPA 4NAXA 4POLA 4HQSA 4K6XA 2IL3A 2VL2A 2IFQA 1T4ZA 5CRDA 3LORA 2CZ3A 4YAPA 4N0VA 1J08A 1GSFA 4G2EA 2AB6A 1GP1A 4F03A 4K5SA 5GSTA 3ZITA 2RLIA 2LQQA 5DJMA 1BAYA 3ZMKA 3TKQA 5J4UA 2OE1A 3H4KA 2OE3A 2WRTA 1PSQA 4FH8A 5EY6A 4OMVA 5HFIA 3EWLA 1X0RA 1I5GA 2H76A 5GZZB 4ZBBA 1Z5YE 3GV1A 2V6OA 2X64A 4WBJA 4OCFA 1JZWA 3C73A 2CZ2A 1WE0A 3VI5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KMN A;  4OO5 A;  1XCC A;  4KDX A;  2HRN A;  1FVK A;  3D0Z A;  2E2M A;  3PH9 A;  4HZ2 A;  5D9W A;  2D2Z A;  3HZ4 A;  2HZE B;  1NSW A;  4K2D A;  2N5A A;  2OAD A;  2IME A;  3CMI A;  4LL4 B;  1WP0 A;  4EDZ A;  2YOI A;  2ON5 A;  1DE1 A;  2B3S A;  20GS A;  3ZYW A;  5DAK B;  5B8A A;  1A8L A;  4FIW A;  1T4Y A;  1AQV A;  5F06 A;  1OE8 A;  3FR6 A;  3GKX A;  4AJ8 A;  1K0A A;  2LRT A;  4YQM A;  3NIV A;  4K0G A;  2H1B A;  2AYT A;  2V32 A;  1S3C A;  2PPT A;  1K0C A;  3A5W A;  3QAV A;  4MZC A;  3F6F A;  1Z6M A;  2H73 A;  4GWR A;  2IN3 A;  4DEJ A;  2HYX A;  3BD2 A;  2H1A A;  4YQV A;  4XCS A;  1SL2 B;  2IMF A;  1TU7 A;  1S3A A;  3TJK A;  2PWJ A;  1TW9 A;  2CX3 A;  11GS A;  4MPG A;  5DCG A;  4WR5 A;  1GTA A;  4ZL8 A;  5J9C A;  1K0N A;  3O6T A;  4HJM A;  3GRX A;  1TKD B;  3ME8 A;  3HY2 A;  2V41 A;  1E6B A;  4NV5 A;  5B8B A;  3TJB A;  1CQG A;  4EUY A;  1QQ2 A;  3LWA A;  1O73 A;  4IHU A;  1TXX A;  1A8Y A;  1Y25 A;  2HSH A;  5EL8 A;  5HR3 A;  4XHM A;  1YY7 A;  4KDY A;  1M99 A;  3BOA A;  2CVB A;  1AQX A;  3VPQ A;  3FW2 A;  1XIY A;  1M9B A;  3M1G A;  4ECB A;  2FCH A;  1F37 A;  3UVH A;  2HLS A;  1PL2 A;  2CAQ A;  1VF1 A;  1K3O A;  3EYT A;  1J9B A;  4V2M A;  3C1S A;  5F0G A;  4X1U A;  4EVM A;  1SKR B;  1H75 A;  3GN3 A;  2H1G A;  3IBH A;  1OKD A;  3RHB A;  4KW6 A;  5A4U A;  3F6D A;  4MPF A;  3F4R A;  1VGL A;  3I6A A;  1HNA A;  4BL7 A;  2DJJ A;  1CQH A;  2OA7 A;  2B7J A;  2LJR A;  1SEN A;  2WCI A;  4PX1 A;  2CQ9 A;  1AC1 A;  5KN1 A;  2A2R A;  2QKE A;  1Z9H A;  3BCK A;  5KN0 A;  2OKA A;  3EUR A;  3HDC A;  2C0E A;  1QUW A;  5G30 A;  2EIO A;  1ZOF A;  5IMD A;  5D9X A;  4I97 A;  3TRQ A;  5DCH A;  4IQA A;  1WIK A;  3VPT A;  2B5Y A;  5AIV A;  1M2B A;  5A4V A;  2YAN A;  5LNK e;  1G7O A;  1QMV A;  3M9J A;  3GIX A;  1FAA A;  4L8E A;  3SBC A;  3UOM A;  3TKS E;  2M80 A;  2PBJ A;  1WPI A;  2C80 A;  2HT9 A;  3HD5 A;  5E59 A;  2VCQ A;  2PGT A;  4TR4 A;  3IHQ A;  2G0F A;  1E2Y A;  2HXK A;  2E2G A;  2P5R A;  3UVT A;  2YV9 A;  1XZO A;  4G9H A;  2GZY A;  4NHZ A;  1B9X C;  2F3M A;  1R26 A;  4JR4 A;  3QOU A;  1A2M A;  3VLN A;  4IP6 A;  4MH2 A;  3CSI A;  2N5B A;  6GSU A;  1GUL A;  3ZTL A;  3IAM 2;  5JCW A;  5D9V A;  5CRG A;  3GMF A;  6GSW A;  5ABR A;  1K0O A;  5HR2 A;  5CRH A;  3ZIJ A;  2WGR A;  2R5G A;  3F4S A;  2RUF A;  1SL1 B;  3KEB A;  3WYW A;  1HYU A;  3TKS A;  1YZX A;  2VCZ A;  3FHK A;  1J0F A;  4POM A;  2DBC A;  4I6X A;  4MF7 A;  2VCV A;  3MNG A;  3CRT A;  1SKW B;  2LTK A;  5DQS A;  2EC4 A;  1ZZY A;  2LEG A;  5CP1 A;  1ERU A;  4GCI A;  5IMF A;  3GTU B;  1KBN A;  1EZK A;  1YEX A;  4FO5 A;  3TRP A;  2YZU A;  2HFD A;  3GKN A;  4XS6 A;  13GS A;  5D93 A;  5IPH A;  3GA4 A;  2FD3 A;  5ENU A;  5DAL B;  2FWF A;  4K0N A;  2VOC A;  2OBI A;  4EXJ A;  3KCM A;  1N2A A;  1K3L A;  3ED3 A;  1FB6 A;  2VD0 A;  3ZIV A;  4KE3 A;  1TDI A;  2GZP A;  1ILO A;  4TR0 A;  2VM2 A;  2K6V A;  1KTE A;  5CAX A;  4V1A g;  5AIX A;  2GVP A;  2X99 A;  4ISD A;  1HNB A;  4KUN A;  5ECN B;  3WT2 A;  2GQL A;  2ZNM A;  5FT3 A;  2R4V A;  2R3X A;  3QFB C;  1GTU A;  2YP6 A;  3D22 A;  4IVF A;  2GSR A;  2C8U A;  1F6M C;  16GS A;  4DSR A;  2I4A A;  3TDG A;  4TOP A;  4F82 A;  5IIZ A;  2X8G A;  3A2X A;  4KH7 A;  4HUA A;  1U87 A;  4ZL7 A;  2VM1 A;  3W8J A;  2CT6 A;  2ZCT A;  3Q19 A;  3KJY A;  3Q18 A;  1DE2 A;  4IN0 A;  3I43 A;  3GX8 A;  5F05 A;  1HQO A;  4HS1 A;  1GUH A;  1PMT A;  2K9F A;  3CSJ A;  1WJK A;  4TN8 A;  3O3T A;  4PNF A;  2L4C A;  3ZLP A;  5KN2 A;  3A3T A;  4IS0 A;  3APO A;  3WGX A;  4MA9 A;  1UC7 A;  2L59 A;  1ACV A;  1F3B A;  4PQH A;  3ZVJ D;  4MJE A;  3KTL A;  1PN9 A;  2JL4 A;  1VF2 A;  1JZD A;  2P5Q A;  2CVD A;  1GSS A;  3ZFB A;  4NXI A;  4TRX A;  2HI7 A;  3GH6 A;  4JED A;  12GS A;  1YF0 A;  4XS1 A;  2VIM A;  1YKC A;  3I9V 2;  2CVK A;  5B7C A;  2N5F A;  3I69 A;  3UMA A;  4O92 A;  1T1V A;  4ML1 A;  1BX9 A;  4MJB A;  5JCU A;  3FZ4 A;  2GSQ A;  1XWA A;  3HHV A;  1FO5 A;  2X8C A;  4LMV A;  1XBS A;  3P2A A;  2HZF A;  2MYG A;  2DMM A;  4OD7 A;  1URM A;  3WGE A;  1UN2 A;  2RII A;  4TR1 A;  2GLR A;  3U5R E;  5KN3 A;  4QL9 A;  4XRD A;  3L9V A;  2A2S A;  4IEL A;  3VWU A;  18GS A;  2IMI A;  3C8E A;  2AHE A;  2OJL A;  4BWQ A;  3KIJ A;  4POK A;  2PU9 C;  3ZML A;  3HXS A;  3EE2 A;  3DVX A;  3M0F A;  3HVX A;  1V57 A;  3PR8 A;  2XBI A;  2FWH A;  2NDO A;  3L9U A;  4WEY A;  2R37 A;  1SL0 B;  3DGQ A;  2M46 A;  4ZBD A;  1SYR A;  1W89 A;  5AN1 A;  3US3 A;  4POB A;  1EP8 A;  2LRC A;  3BJ5 A;  1ZMA A;  2YN1 A;  2WDU A;  3L78 A;  2VL9 A;  1TK5 B;  2V6K A;  1XXU A;  1GTI A;  3GH9 A;  5JWO B;  2H70 A;  1YF1 A;  3PIN A;  2IFQ B;  1RW1 A;  4XS4 A;  4BWS A;  2B5X A;  3IPZ A;  4ZB8 A;  2B5E A;  1O6J A;  3KH7 A;  1X5C A;  3MDK A;  3IE3 A;  2DML A;  1GNE A;  3WT1 A;  4ECI A;  2H0H A;  2GTU A;  1GSQ A;  4PUR A;  4MP4 A;  3M9K A;  3QDN A;  5D73 A;  3P8W A;  2B1K A;  3F8U A;  2HRF A;  2I1U A;  5DJL A;  3ZZX A;  5HR1 A;  2BMX A;  2H72 A;  1EGR A;  1V2A A;  1A0R P;  10GS A;  1SU9 A;  1KEB A;  3N5O A;  1MEK A;  1PA3 A;  2YNX A;  3APQ A;  4TR3 A;  3G7J A;  2JU5 A;  2Z9S A;  3GX0 A;  2HE3 A;  2YZH A;  4K1F A;  3TUE A;  1T8E B;  3E9J B;  2YCD A;  3BCI A;  1K3Y A;  1U3A A;  1V9W A;  2H01 A;  2PN8 A;  4CW9 A;  4E8H A;  4I8B A;  4IQ1 A;  4JZQ A;  4YQU A;  2NBS A;  4HOJ A;  5LD0 A;  5ECL B;  4XTS A;  3HJP A;  1Z6N A;  1AXD A;  2AAW A;  3H1N A;  3NZN A;  3GHA A;  1JZO A;  1BG5 A;  2H74 A;  1O8X A;  3U6V A;  1Y6E A;  2C1Y A;  4NMU A;  1EEJ A;  1F3A A;  1JFU A;  4MCU A;  2OAC A;  2O85 A;  4GTU A;  3GKM A;  1GTB A;  3ZVJ A;  3F4T A;  1WWJ A;  3FZA A;  1MDJ A;  3P7X A;  2L4Q A;  1MTC A;  4MLY A;  2ALB A;  1OE7 A;  2IPA A;  3OR5 A;  1V40 A;  4TXV A;  4YH2 A;  1W4V A;  2LQO A;  4LL1 B;  1X9S B;  1USB A;  4WF5 A;  2I81 A;  4KND A;  1M9A A;  1EWX A;  4KSO A;  3N9J A;  5EVO A;  2P31 A;  2K8V A;  1FOV A;  2VUP A;  2YV7 A;  2IMK A;  2WJU A;  3V1W A;  2TRC P;  1BJX A;  5D96 A;  4MJC A;  1GH2 A;  3UBK A;  4EC0 A;  5HR0 A;  4MF6 A;  4MF5 A;  2ZUP A;  6GSS A;  4GQC A;  4WR4 A;  4XRA A;  3F63 A;  1UVZ A;  5DDL A;  3GUS A;  2JSY A;  4PUF C;  2IMD A;  2FWE A;  4KGI A;  1M2A A;  1FG4 A;  3A2W A;  4ID0 A;  1JZR A;  5ECH B;  2L6D A;  1TK8 B;  2AUV A;  1PKZ A;  4PXO A;  1EV9 A;  5EPF A;  2YPM A;  5IOX A;  4ULX A;  5F07 A;  3TJJ A;  2KOK A;  5AGY A;  2H1D A;  4NHW A;  1FW1 A;  2J23 A;  4DSS A;  1AQW A;  4K7O A;  1T3B A;  1XVQ A;  4ACS A;  1H4O A;  5A4W A;  5IOW A;  3H8Q A;  3DIE A;  1HNC A;  3C7M A;  3RBT A;  2CAI A;  2B7K A;  5CO3 A;  4JBB A;  5CNW A;  4WF4 A;  3CRU A;  3FEU A;  3VK9 A;  1JLW A;  5G5F A;  4IW9 A;  2FUG 2;  3QR6 A;  1M7T A;  1XOB A;  1LU4 A;  2DJ2 A;  2I3Y A;  4X43 A;  5ELG A;  1EEM A;  4WBR D;  2FA4 A;  4J57 E;  2VCW A;  1AAZ A;  1U6T A;  1GSY A;  3L9S A;  4IP1 A;  1N8J A;  1YKA A;  3TRX A;  3DXB A;  4I2T A;  5DVB A;  1XWC A;  2L6C A;  1A0F A;  4N10 A;  1B4P A;  2YWM A;  3VI7 A;  1NHY A;  1XFL A;  4BPY A;  3SWL A;  1YEP A;  5D8I A;  2DJ3 A;  3CTF A;  3C1R A;  3J7Y b;  1TU8 A;  1R5A A;  3RPN A;  2MMA A;  4KA0 A;  3KD0 A;  3IV4 A;  3QCP A;  1THO A;  4ECJ A;  2I9H A;  2RM6 A;  2QGV A;  1AW9 A;  1X5E A;  2FNO A;  2DIZ A;  1F9M A;  4EKZ A;  2A4V A;  4K7I A;  5C00 A;  2LNS A;  4IJ3 A;  2WZ9 A;  14GS A;  1NW2 A;  2MBT A;  3HVS A;  4JRR A;  2JZR A;  5GSS A;  1SKS B;  1A23 A;  1C72 A;  1ERW A;  3MSZ A;  1NM3 A;  4KB3 A;  3ZRE A;  2ON7 A;  2V1M A;  1QFN A;  4HU7 A;  4F0B A;  22GS A;  1SYX A;  3DYR A;  5J41 A;  1G6W A;  5IMV A;  2L5L A;  3APS A;  3WD6 A;  3CXG A;  2KHP A;  4MMM A;  4MAB A;  4PGT A;  4XIH A;  2G2Q A;  4GRF A;  3FR3 A;  4NPB A;  3O76 A;  4L0U A;  4TVE A;  5INY A;  1B48 A;  3UAR A;  1OC9 A;  1XPV A;  2F8A A;  1TRV A;  1M2D A;  5IPG A;  3R2Q A;  3QD9 A;  4G10 A;  2LKU A;  3VWV A;  3C71 A;  1Z7P A;  5ECS A;  1VRS D;  3GL5 A;  2O7K A;  2VLT A;  3DRN A;  1PD2 1;  1OC8 A;  2RUE A;  3ZRD A;  5LCZ A;  4PNG A;  3ME7 A;  1MDK A;  4D73 A;  3HCZ A;  4MH3 A;  1GWC A;  4Q5R A;  4HI7 A;  5ID2 A;  4E8E A;  1LJR A;  3GKK A;  3FR9 A;  1MDI A;  1ZCP A;  4AJ6 A;  6GSX A;  3KP9 A;  4FYB A;  1JLV A;  1ERT A;  4KAE A;  4QQ7 A;  3VWW A;  5E4W A;  2H8L A;  2MZC A;  2C0F A;  2VL3 A;  2YJH A;  4JE1 A;  4ILF A;  1YQ1 A;  5A5K A;  1ZYE A;  4JU5 A;  1LBK A;  3LFL A;  4I2U A;  4J2F A;  3EC3 A;  3HYP A;  5DBQ A;  3G7Y A;  3W8S A;  4AF2 A;  1BYE A;  3ERG A;  1ZL9 A;  1XWB A;  3H79 A;  4OWY A;  3DVW A;  2KLX A;  4ML6 A;  3WGD A;  1X9M B;  2TIR A;  5ID2 B;  1ML6 A;  5G2Z A;  5ECO B;  1O7U A;  2JZS A;  3DML A;  4IBP A;  4ZB9 A;  3GFK A;  2DSA A;  5KEJ A;  2PVO C;  5ECM B;  5ELA A;  2H19 A;  1ST9 A;  1BED A;  2GGT A;  4GXZ A;  3P90 A;  2VL2 C;  1SD9 A;  1OYJ A;  1Q98 A;  4ECC A;  3VUR A;  1PX7 A;  2IWT A;  4OFN A;  1XW9 A;  2LRN A;  2VD1 A;  2FGX A;  4Q5N A;  1SK0 A;  5GAP D;  1K0B A;  1GUM A;  4IKH A;  2WS2 A;  2BJX A;  3FZ5 A;  4N30 A;  4ZIJ A;  5GAN D;  4V2N A;  2JZT A;  5ECR B;  2K8S A;  3LYK A;  4V2L A;  2XC2 A;  2CA8 A;  3HKR A;  1ERV A;  5HFK A;  3EMP A;  3HJM A;  4ZBA A;  3F3R A;  4PQI A;  2IIY A;  2PER A;  3KZQ A;  2HZE A;  4GSS A;  2XPD A;  1S3D A;  4KCE A;  2FA8 A;  3FZ9 A;  2PMT A;  1PRX A;  4Q5F A;  4MZB A;  2H6Y A;  3QFA C;  3M8N A;  3D5J A;  5COH A;  5DAK A;  5ECP B;  3AY8 A;  2XHF A;  4J56 E;  3W6G A;  1BQ7 A;  4CDO A;  1GSE A;  1YJ6 A;  2VLV A;  4TR1 B;  5D9T A;  1ZYQ B;  2HNL A;  3DWV A;  4O7H A;  1VF4 A;  4KDU A;  4BVX A;  2REM A;  3ERW A;  3ISO A;  1TI3 A;  4GQF A;  1TRS A;  4MJA A;  3D4T A;  2LUS A;  2MBS A;  1IYH A;  3FRC A;  4YAV A;  2O8V B;  5JWR B;  1EOG A;  4K8M A;  2C0G A;  1XW5 A;  3D4M A;  2H66 A;  1B4Q A;  4WXT A;  3RPP A;  2VCT A;  3UEM A;  4FYC A;  4GST A;  3KXO A;  3IDV A;  4TKY A;  2IJY A;  1FB0 A;  1EGO A;  4EO3 A;  2F9S A;  7GSS A;  5IQY A;  2NPB A;  1TRU A;  5G31 A;  5FWG A;  2TRX A;  1K0M A;  4HJ2 A;  4EE0 A;  3TJF A;  5IMC A;  4XS4 B;  1K0D A;  2NTO A;  4DVC A;  4CHS A;  1R7H A;  1GSD A;  3QMX A;  5AIS A;  1XVW A;  3TGZ A;  4LMW A;  2QC7 A;  1GLQ A;  3L0H A;  3F9U A;  3F0I A;  2YWI A;  3GNJ A;  1IYI A;  2M72 A;  2L57 A;  1T00 A;  4HQZ A;  3Q6O A;  1QXH A;  2DLX A;  5CRE A;  4ZXG A;  3LXZ A;  1V98 A;  2H30 A;  3GUR A;  5H5Q A;  1QGV A;  2NVL A;  1OAZ A;  4K9Z A;  17GS A;  4QL7 A;  1ZGN A;  4WET A;  3DEX A;  3GST A;  3KMO A;  4ZB6 A;  4P3Y B;  3QAW A;  4JR6 A;  3IK9 A;  3UJ1 A;  3VWX A;  2KP2 A;  1PKW A;  1V58 A;  3IAS 2;  3D6I A;  3LEF A;  2LV3 A;  2DJ0 A;  1GLP A;  1GUK A;  1Z7R A;  3EVI A;  3F3Q A;  4KX4 A;  1G6Y A;  1TK0 B;  1GSU A;  1O81 A;  1KNG A;  1EP7 A;  5G5E A;  2EIR A;  3CBU A;  1GL8 A;  3IXR A;  1OVN A;  1EOH A;  3IOS A;  3K8N A;  4GF0 A;  5IO0 A;  4AJ7 A;  4EL1 A;  4I5Q A;  3LGC A;  2RM5 A;  1I9D A;  2KUC A;  4RQX A;  1U3I A;  2DJ1 A;  2R6K A;  4H86 A;  4HU9 A;  4ZL9 A;  1FHE A;  4KCA A;  2PVQ A;  1M0U A;  3UAP A;  3BBY A;  4L5L A;  2VCX A;  2O87 A;  3D21 A;  2MMN A;  3IRA A;  5JWQ B;  4X0X A;  3RHC A;  5JCG A;  3TCO A;  3RAZ A;  3EU4 A;  5G1K A;  3CYN A;  3ZL5 A;  5B6M A;  3TB2 A;  1TI1 A;  3EU3 A;  2OBK A;  4F9Z A;  1A2L A;  3KTB A;  5H5R A;  3LG6 A;  2JAD A;  3LQ7 A;  3IR4 A;  1SJI A;  2B6M A;  5CRW A;  1A2J A;  3TJG A;  4RI6 A;  3QAG A;  3HJO A;  3EIN A;  3TKR A;  2YJ7 A;  5J3R A;  2DC5 A;  4F0C A;  1TOF A;  5DQY A;  3GL3 A;  3HA9 A;  2FWG A;  5F8B A;  1GNW A;  5CYY A;  4O32 A;  2H71 A;  2C0D A;  3E0U A;  5IMA A;  2VLU A;  4L0W A;  2WUL A;  2B1L A;  3UL3 A;  4EDY A;  2DJK A;  1B8X A;  1SJZ A;  2LJK A;  3ERF A;  3VFI A;  1MD3 A;  1WMJ A;  3EMX A;  4MDC A;  1OKT A;  2YWN A;  1TTZ A;  2V2G A;  2HSY A;  2LJA A;  1OC3 A;  2GQK A;  1GRX A;  4F2I A;  1UA5 A;  4DSS B;  3FK8 A;  1DBY A;  5FHI A;  2C3Q A;  4RI7 A;  2WFC A;  3S9F A;  2VAF A;  3TKS C;  3GTU A;  4OCE A;  1U88 A;  2E7P A;  6GSV A;  4OFT A;  3LYP A;  3GYK A;  1SK2 A;  2GS3 A;  2GQM A;  1NHO A;  1R5P A;  6GST A;  3IA1 A;  3IC4 A;  4PQ1 A;  1F2E A;  1X9W B;  4TXO A;  4NWY A;  4HDE A;  4KSM A;  1PL1 A;  2GT6 A;  1SJ6 A;  2OE0 A;  2O89 A;  3GSS A;  2MMO A;  5DAL A;  1EV4 A;  2KP1 A;  1VF3 A;  3FYG A;  2YWO A;  2XBQ A;  3CTG A;  1T7P B;  2GDR A;  3NOF A;  4GLT A;  2GT5 A;  1TP9 A;  4V1A p;  3KP8 A;  5L71 A;  2GST A;  1O8W A;  2F51 A;  3MAK A;  3TOU A;  4RUV A;  4RQR A;  4G19 A;  3LJR A;  5IO2 A;  1MD4 A;  1Z3E A;  2CV4 A;  5IMZ A;  1AIU A;  1DSB A;  4MK3 A;  5ECQ B;  5G1L A;  1TJD A;  4TXO B;  2QSI A;  3Q74 A;  3UIW A;  4FYU A;  4L5O A;  5H5S A;  2LST A;  2CX4 A;  5ECI B;  3TOT A;  2DIY A;  3DD3 A;  2ES7 A;  2P0G A;  1AUC A;  1RQM A;  2AV4 A;  3M3M A;  2H6Z A;  1TRW A;  2EIQ A;  2E0Q A;  3CSH A;  5ECK B;  3L4N A;  1FVJ A;  2BTO T;  2X8H A;  3LXT A;  1SD8 A;  4NV2 A;  4LA1 A;  4OFM A;  1G0T A;  2C3T A;  2AJQ B;  3KGK A;  5B6N A;  2XPE A;  2L5O A;  5C04 A;  1JHB A;  3G7I A;  4PUA A;  3FKF A;  3G9B A;  1WOU A;  1XWK A;  1HD2 A;  3HVV A;  5IM9 A;  5J5N A;  3IK7 A;  1R4W A;  6GSY A;  4OO4 A;  1SK1 A;  1DUG A;  8GSS A;  1RK4 A;  3HZ8 A;  3KM6 A;  4GSN A;  1O85 A;  2FY6 A;  4WKW A;  4N0Z A;  1XOA A;  3KH9 A;  1Q4J A;  2J9H A;  2R2J A;  1G7E A;  1ON4 A;  1PQN A;  1THX A;  2H0G A;  2PUK C;  4K7N A;  4EF0 A;  3A2V A;  1OC9 B;  9GSS A;  3MWH A;  19GS A;  2H0I A;  3QPM A;  3LSZ A;  5HQP A;  2LS5 A;  2C3N A;  2JSZ A;  4IGJ A;  3J7Y k;  2H75 A;  1PX6 A;  3FY7 A;  4LLR A;  3H93 A;  4Q5Q A;  4BA7 A;  3E3E A;  4D73 B;  4DSQ A;  1X5D A;  2MMZ A;  2GSS A;  2K18 A;  3PGT A;  2H6X A;  1WRY A;  4TW5 A;  3JCM L;  1A24 A;  4MZW A;  5J9B A;  4O5R A;  2JAC A;  1ABA A;  3RDW A;  4BVY A;  4HEA 2;  4ZIL A;  2GZZ A;  5HFG A;  2WB9 A;  4AGS A;  2VO4 A;  4Z7X A;  2C4J A;  3UBL A;  3TKP A;  1QK8 A;  3DKS A;  2FLS A;  2LNT A;  3ZFL A;  1XW6 A;  1PGT A;  1YDK A;  2F8F A;  4HZ4 A;  1B9Y C;  2FHE A;  4N11 A;  1XWG A;  4IJI A;  4NAX A;  4POL A;  4HQS A;  4K6X A;  2IL3 A;  2VL2 A;  2IFQ A;  1T4Z A;  5CRD A;  3LOR A;  2CZ3 A;  4YAP A;  4N0V A;  1J08 A;  1GSF A;  4G2E A;  2AB6 A;  1GP1 A;  4F03 A;  5GST A;  3ZIT A;  2RLI A;  2LQQ A;  5DJM A;  1BAY A;  3ZMK A;  3TKQ A;  5J4U A;  2OE1 A;  3H4K A;  2OE3 A;  2WRT A;  1PSQ A;  4FH8 A;  5EY6 A;  4OMV A;  5HFI A;  3EWL A;  1X0R A;  1I5G A;  2H76 A;  5GZZ B;  4ZBB A;  1Z5Y E;  3GV1 A;  2V6O A;  2X64 A;  4WBJ A;  4OCF A;  1JZW A;  3C73 A;  2CZ2 A;  1WE0 A;  3VI5 A; 
#chains in the Genus database with same CATH topology
 3KMN A;  4OO5 A;  1XCC A;  4KDX A;  2HRN A;  1FVK A;  3D0Z A;  2E2M A;  3PH9 A;  4HZ2 A;  5D9W A;  2D2Z A;  3HZ4 A;  2HZE B;  1NSW A;  4K2D A;  2N5A A;  2OAD A;  2IME A;  3CMI A;  4LL4 B;  1WP0 A;  4EDZ A;  2YOI A;  2ON5 A;  1DE1 A;  2B3S A;  20GS A;  3ZYW A;  5DAK B;  5B8A A;  1A8L A;  4FIW A;  1T4Y A;  1AQV A;  5F06 A;  1OE8 A;  3FR6 A;  3GKX A;  4AJ8 A;  1K0A A;  2LRT A;  4YQM A;  3NIV A;  4K0G A;  2H1B A;  2AYT A;  2V32 A;  1S3C A;  2PPT A;  1K0C A;  4BVX B;  3A5W A;  3QAV A;  4MZC A;  3F6F A;  1Z6M A;  2H73 A;  4GWR A;  2IN3 A;  4DEJ A;  2HYX A;  3BD2 A;  2H1A A;  4YQV A;  4XCS A;  1SL2 B;  2IMF A;  1TU7 A;  1S3A A;  3TJK A;  5KOX A;  2PWJ A;  1TW9 A;  2CX3 A;  11GS A;  4MPG A;  5DCG A;  4WR5 A;  1GTA A;  4ZL8 A;  5J9C A;  1K0N A;  3O6T A;  4HJM A;  4O5U A;  2R0G A;  3GRX A;  1TKD B;  3ME8 A;  3HY2 A;  2V41 A;  1E6B A;  4NV5 A;  5B8B A;  3TJB A;  1CQG A;  4EUY A;  1QQ2 A;  3LWA A;  1O73 A;  4IHU A;  1TXX A;  1A8Y A;  1Y25 A;  2HSH A;  5EL8 A;  5HR3 A;  4XHM A;  1YY7 A;  4KDY A;  1M99 A;  3BOA A;  2CVB A;  1AQX A;  3VPQ A;  3FW2 A;  1XIY A;  1M9B A;  3M1G A;  4ECB A;  2FCH A;  1F37 A;  3UVH A;  2HLS A;  1PL2 A;  2CAQ A;  1VF1 A;  1K3O A;  3EYT A;  1J9B A;  4V2M A;  3C1S A;  5F0G A;  4X1U A;  4EVM A;  1SKR B;  1H75 A;  3GN3 A;  2H1G A;  3IBH A;  1OKD A;  3RHB A;  4KW6 A;  5A4U A;  3F6D A;  4MPF A;  3F4R A;  1VGL A;  3I6A A;  1HNA A;  4BL7 A;  2DJJ A;  1CQH A;  2OA7 A;  2B7J A;  2LJR A;  1SEN A;  2WCI A;  4PX1 A;  2CQ9 A;  1AC1 A;  5KN1 A;  2A2R A;  2QKE A;  1Z9H A;  3BCK A;  5KN0 A;  2OKA A;  3EUR A;  3HDC A;  2C0E A;  1QUW A;  5G30 A;  2EIO A;  1ZOF A;  5IMD A;  5D9X A;  4I97 A;  3TRQ A;  5DCH A;  4IQA A;  1WIK A;  3VPT A;  2B5Y A;  5AIV A;  1M2B A;  5A4V A;  2YAN A;  5LNK e;  1G7O A;  1QMV A;  3M9J A;  3GIX A;  1FAA A;  4L8E A;  3SBC A;  3UOM A;  4K2X A;  3TKS E;  2M80 A;  2PBJ A;  1WPI A;  2C80 A;  2HT9 A;  3HD5 A;  5E59 A;  2VCQ A;  2PGT A;  4TR4 A;  3IHQ A;  2G0F A;  1E2Y A;  2HXK A;  2E2G A;  2P5R A;  3UVT A;  2YV9 A;  1XZO A;  4G9H A;  2GZY A;  4NHZ A;  1B9X C;  2F3M A;  1R26 A;  4JR4 A;  3QOU A;  1A2M A;  3VLN A;  4IP6 A;  4MH2 A;  3CSI A;  2N5B A;  6GSU A;  1GUL A;  3ZTL A;  3IAM 2;  5JCW A;  5D9V A;  5CRG A;  3GMF A;  6GSW A;  5ABR A;  1K0O A;  5HR2 A;  5CRH A;  3ZIJ A;  2WGR A;  2R5G A;  3F4S A;  2RUF A;  1SL1 B;  3KEB A;  3WYW A;  1HYU A;  3TKS A;  1YZX A;  2VCZ A;  3FHK A;  1J0F A;  4POM A;  1M3I A;  2DBC A;  4I6X A;  4MF7 A;  2DKI A;  2VCV A;  3MNG A;  3CRT A;  1SKW B;  2LTK A;  5DQS A;  2EC4 A;  1ZZY A;  2LEG A;  5CP1 A;  1ERU A;  4GCI A;  5IMF A;  3MYD A;  3GTU B;  1KBN A;  1EZK A;  1YEX A;  4FO5 A;  3TRP A;  2YZU A;  2HFD A;  4YKF A;  3GKN A;  4XS6 A;  13GS A;  1PN0 A;  5D93 A;  3GA4 A;  5IPH A;  2HRK A;  2FD3 A;  5ENU A;  5DAL B;  2FWF A;  4K0N A;  2VOC A;  4X4J A;  2OBI A;  4EXJ A;  3MIX A;  3KCM A;  1N2A A;  1K3L A;  3ED3 A;  1FB6 A;  2VD0 A;  3ZIV A;  4KE3 A;  1TDI A;  2GZP A;  1ILO A;  4TR0 A;  2VM2 A;  2K6V A;  1KTE A;  5CAX A;  4V1A g;  5AIX A;  2GVP A;  2X99 A;  4ISD A;  1HNB A;  4KUN A;  5ECN B;  3WT2 A;  2GQL A;  2ZNM A;  5FT3 A;  2R4V A;  2R3X A;  3QFB C;  1GTU A;  2YP6 A;  3D22 A;  4IVF A;  2GSR A;  2C8U A;  1F6M C;  16GS A;  3PPU A;  4DSR A;  2I4A A;  3TDG A;  4TOP A;  4F82 A;  5IIZ A;  2X8G A;  3A2X A;  4KH7 A;  4HUA A;  1U87 A;  4ZL7 A;  2VM1 A;  3W8J A;  2CT6 A;  2ZCT A;  3Q19 A;  3KJY A;  3Q18 A;  4Z2R A;  1DE2 A;  4IN0 A;  3I43 A;  3GX8 A;  5F05 A;  1HQO A;  4HS1 A;  1GUH A;  1PMT A;  2K9F A;  3CSJ A;  1WJK A;  4TN8 A;  3O3T A;  4PNF A;  2L4C A;  3ZLP A;  5KN2 A;  3A3T A;  4IS0 A;  3APO A;  3WGX A;  4MA9 A;  1UC7 A;  2L59 A;  1ACV A;  1F3B A;  4PQH A;  3ZVJ D;  4MJE A;  3KTL A;  1PN9 A;  2JL4 A;  1VF2 A;  4EIQ A;  1JZD A;  2P5Q A;  2CVD A;  1GSS A;  3ZFB A;  4NXI A;  4TRX A;  2HI7 A;  3GH6 A;  4JED A;  12GS A;  1YF0 A;  4XS1 A;  2VIM A;  1YKC A;  3I9V 2;  2CVK A;  5B7C A;  2N5F A;  3I69 A;  3UMA A;  4O92 A;  1T1V A;  4ML1 A;  1BX9 A;  4MJB A;  5JCU A;  3FZ4 A;  2GSQ A;  1XWA A;  3HHV A;  1FO5 A;  2X8C A;  4LMV A;  1XBS A;  3P2A A;  2HZF A;  2MYG A;  2DMM A;  4OD7 A;  1URM A;  3WGE A;  1UN2 A;  2RII A;  4TR1 A;  2GLR A;  3U5R E;  5KN3 A;  4QL9 A;  4XRD A;  3L9V A;  2A2S A;  4IEL A;  3VWU A;  18GS A;  2IMI A;  4BVY B;  3C8E A;  2AHE A;  2OJL A;  4BWQ A;  3KIJ A;  4POK A;  2PU9 C;  3ZML A;  3HXS A;  3EE2 A;  3DVX A;  3M0F A;  3HVX A;  1V57 A;  3PR8 A;  2XBI A;  2FWH A;  2NDO A;  3L9U A;  4WEY A;  2R37 A;  1SL0 B;  3DGQ A;  2M46 A;  4ZBD A;  1SYR A;  1W89 A;  5AN1 A;  3US3 A;  4POB A;  1EP8 A;  2LRC A;  3BJ5 A;  1ZMA A;  2YN1 A;  2WDU A;  3L78 A;  2VL9 A;  1TK5 B;  2V6K A;  1XXU A;  1GTI A;  3GH9 A;  5JWO B;  2H70 A;  1YF1 A;  3PIN A;  2IFQ B;  1RW1 A;  4XS4 A;  4BWS A;  2B5X A;  2X4A A;  3IPZ A;  4ZB8 A;  3IHG A;  2B5E A;  1O6J A;  3KH7 A;  1X5C A;  3MDK A;  3IE3 A;  2DML A;  1GNE A;  3WT1 A;  4ECI A;  2H0H A;  2GTU A;  1GSQ A;  4PUR A;  4MP4 A;  3M9K A;  3QDN A;  2QA1 A;  5D73 A;  3P8W A;  2B1K A;  3F8U A;  2HRF A;  2I1U A;  5DJL A;  3ZZX A;  5HR1 A;  2BMX A;  2H72 A;  1EGR A;  1V2A A;  1A0R P;  10GS A;  1SU9 A;  1KEB A;  3N5O A;  1MEK A;  1PA3 A;  2YNX A;  3APQ A;  4TR3 A;  3G7J A;  2JU5 A;  2Z9S A;  3GX0 A;  2HE3 A;  2YZH A;  4K1F A;  3TUE A;  1T8E B;  3E9J B;  2YCD A;  3BCI A;  1K3Y A;  1U3A A;  1V9W A;  2H01 A;  2PN8 A;  4CW9 A;  4E8H A;  4I8B A;  4IQ1 A;  4JZQ A;  4YQU A;  2NBS A;  4HOJ A;  5LD0 A;  5ECL B;  4XTS A;  3HJP A;  1Z6N A;  1AXD A;  2AAW A;  3H1N A;  3NZN A;  3GHA A;  1JZO A;  1BG5 A;  2H74 A;  1O8X A;  3U6V A;  1Y6E A;  2C1Y A;  4NMU A;  1EEJ A;  1F3A A;  1JFU A;  4MCU A;  2OAC A;  2O85 A;  4GTU A;  3GKM A;  1GTB A;  3ZVJ A;  3F4T A;  1WWJ A;  3FZA A;  1MDJ A;  3P7X A;  2L4Q A;  1MTC A;  2A2P A;  4MLY A;  2ALB A;  1OE7 A;  2IPA A;  3OR5 A;  1M3J A;  1V40 A;  4TXV A;  4YH2 A;  1W4V A;  2LQO A;  4LL1 B;  1X9S B;  1USB A;  5BMU A;  4WF5 A;  2I81 A;  4KND A;  1M9A A;  1EWX A;  4KSO A;  3N9J A;  5EVO A;  2P31 A;  2K8V A;  1FOV A;  2VUP A;  4G0I A;  2YV7 A;  2IMK A;  2WJU A;  3V1W A;  2TRC P;  1BJX A;  5D96 A;  4MJC A;  1GH2 A;  3UBK A;  4EC0 A;  5HR0 A;  4MF6 A;  4MF5 A;  2ZUP A;  6GSS A;  4GQC A;  4WR4 A;  4XRA A;  3F63 A;  1UVZ A;  5DDL A;  3GUS A;  2JSY A;  4PUF C;  2IMD A;  2FWE A;  4KGI A;  1M2A A;  1FG4 A;  3A2W A;  1PFO A;  4ID0 A;  1JZR A;  5ECH B;  2L6D A;  1TK8 B;  2AUV A;  1PKZ A;  4PXO A;  4Z2T A;  1EV9 A;  5EPF A;  2YPM A;  5IOX A;  4ULX A;  5F07 A;  3TJJ A;  2KOK A;  4CY8 A;  5AGY A;  2H1D A;  4NHW A;  1FW1 A;  2J23 A;  4DSS A;  1AQW A;  4K7O A;  1T3B A;  1XVQ A;  4ACS A;  1H4O A;  5A4W A;  5IOW A;  3H8Q A;  3DIE A;  4BL7 B;  1HNC A;  3C7M A;  3RBT A;  2CAI A;  2B7K A;  5CO3 A;  4JBB A;  5CNW A;  4WF4 A;  3CRU A;  3FEU A;  3VK9 A;  1JLW A;  5G5F A;  4IW9 A;  2FUG 2;  3QR6 A;  1M7T A;  1XOB A;  1LU4 A;  2DJ2 A;  2I3Y A;  4X43 A;  5ELG A;  1EEM A;  4WBR D;  2FA4 A;  4J57 E;  2VCW A;  1AAZ A;  1U6T A;  1GSY A;  3L9S A;  4IP1 A;  1N8J A;  1YKA A;  3TRX A;  3DXB A;  4I2T A;  5DVB A;  1XWC A;  2L6C A;  1A0F A;  4N10 A;  1B4P A;  2YWM A;  3VI7 A;  1NHY A;  1XFL A;  4BPY A;  3SWL A;  1YEP A;  5D8I A;  2DJ3 A;  3CTF A;  3C1R A;  3J7Y b;  1TU8 A;  1R5A A;  3RPN A;  2MMA A;  4KA0 A;  3KD0 A;  3IV4 A;  3QCP A;  4USS A;  1THO A;  4ECJ A;  2I9H A;  2RM6 A;  2QGV A;  1AW9 A;  1X5E A;  2FNO A;  2DIZ A;  1F9M A;  4EKZ A;  2A4V A;  4K7I A;  5C00 A;  2LNS A;  4IJ3 A;  2WZ9 A;  14GS A;  1NW2 A;  2MBT A;  3HVS A;  4JRR A;  2JZR A;  5GSS A;  1SKS B;  1A23 A;  1C72 A;  1ERW A;  3MSZ A;  1NM3 A;  2HRA A;  4KB3 A;  3ZRE A;  2ON7 A;  2V1M A;  3R3E A;  1QFN A;  4HU7 A;  4F0B A;  22GS A;  2R0P A;  1SYX A;  3DYR A;  5J41 A;  1G6W A;  5IMV A;  2L5L A;  3APS A;  3WD6 A;  3CXG A;  2KHP A;  4MMM A;  4MAB A;  4PGT A;  4XIH A;  2G2Q A;  4GRF A;  3FR3 A;  4NPB A;  3O76 A;  4L0U A;  4TVE A;  5INY A;  1B48 A;  3UAR A;  1OC9 A;  1XPV A;  2F8A A;  5BRT A;  1TRV A;  1M2D A;  5IPG A;  3R2Q A;  3QD9 A;  4G10 A;  2LKU A;  3VWV A;  3C71 A;  1Z7P A;  5ECS A;  1VRS D;  3GL5 A;  2O7K A;  2VLT A;  3DRN A;  1PD2 1;  1OC8 A;  2RUE A;  3ZRD A;  5LCZ A;  4PNG A;  3ME7 A;  1MDK A;  4D73 A;  3HCZ A;  4MH3 A;  1GWC A;  4Q5R A;  4HI7 A;  5ID2 A;  4E8E A;  1LJR A;  3GKK A;  3FR9 A;  1MDI A;  1ZCP A;  4AJ6 A;  6GSX A;  3KP9 A;  4FYB A;  1JLV A;  1ERT A;  4KAE A;  4QQ7 A;  3VWW A;  5E4W A;  2H8L A;  4MNN A;  2MZC A;  2C0F A;  2VL3 A;  2YJH A;  4JE1 A;  4ILF A;  1YQ1 A;  5A5K A;  4G0L A;  1ZYE A;  4JU5 A;  1LBK A;  3LFL A;  4I2U A;  4J2F A;  3EC3 A;  3HYP A;  5DBQ A;  2X49 A;  3G7Y A;  3W8S A;  4AF2 A;  1BYE A;  3ERG A;  1ZL9 A;  1XWB A;  3H79 A;  4OWY A;  3DVW A;  2KLX A;  4ML6 A;  3WGD A;  1X9M B;  2TIR A;  5ID2 B;  1ML6 A;  5G2Z A;  5ECO B;  1O7U A;  2JZS A;  3DML A;  4IBP A;  4ZB9 A;  3GFK A;  2DSA A;  5KEJ A;  2PVO C;  5ECM B;  5ELA A;  2H19 A;  1ST9 A;  1BED A;  2GGT A;  4GXZ A;  3P90 A;  2VL2 C;  1SD9 A;  1OYJ A;  1Q98 A;  4ECC A;  3VUR A;  1PX7 A;  2IWT A;  4OFN A;  1XW9 A;  2LRN A;  2VD1 A;  2FGX A;  4Q5N A;  1SK0 A;  5GAP D;  1K0B A;  1GUM A;  4IKH A;  2WS2 A;  2BJX A;  3FZ5 A;  4N30 A;  4ZIJ A;  5GAN D;  4V2N A;  2JZT A;  5ECR B;  2K8S A;  3LYK A;  4V2L A;  2XC2 A;  2CA8 A;  3HKR A;  1ERV A;  5HFK A;  3EMP A;  3HJM A;  4CY6 A;  4ZBA A;  3F3R A;  4PQI A;  2IIY A;  2PER A;  3KZQ A;  2HZE A;  4GSS A;  2XPD A;  1S3D A;  4KCE A;  2FA8 A;  3FZ9 A;  2PMT A;  1PRX A;  4Q5F A;  4MZB A;  2H6Y A;  1ZYN A;  3QFA C;  3M8N A;  3D5J A;  5COH A;  5DAK A;  5ECP B;  3AY8 A;  2XHF A;  4J56 E;  3W6G A;  1BQ7 A;  4CDO A;  1GSE A;  1YJ6 A;  2VLV A;  4TR1 B;  5D9T A;  1ZYQ B;  2HNL A;  3DWV A;  4O7H A;  1VF4 A;  4G0K A;  4KDU A;  4BVX A;  2REM A;  3ERW A;  3ISO A;  1TI3 A;  4GQF A;  1TRS A;  4MJA A;  3D4T A;  2LUS A;  2MBS A;  1IYH A;  3FRC A;  4YAV A;  2O8V B;  5JWR B;  1EOG A;  4K8M A;  2C0G A;  2HSM A;  1XW5 A;  3D4M A;  2H66 A;  1B4Q A;  4WXT A;  3RPP A;  2VCT A;  3UEM A;  4FYC A;  4GST A;  3KXO A;  3IDV A;  4TKY A;  2IJY A;  1FB0 A;  1EGO A;  4EO3 A;  2F9S A;  7GSS A;  5IQY A;  2NPB A;  1TRU A;  5G31 A;  5FWG A;  2TRX A;  1K0M A;  4HJ2 A;  4EE0 A;  3TJF A;  5IMC A;  4XS4 B;  1K0D A;  2NTO A;  4DVC A;  4CHS A;  1R7H A;  1GSD A;  3QMX A;  5AIS A;  1XVW A;  3TGZ A;  4LMW A;  2QC7 A;  1GLQ A;  3L0H A;  3F9U A;  3F0I A;  2YWI A;  3GNJ A;  1IYI A;  2M72 A;  2L57 A;  1T00 A;  4HQZ A;  3Q6O A;  1QXH A;  2DLX A;  5CRE A;  4ZXG A;  3LXZ A;  4FQU A;  1V98 A;  2H30 A;  3GUR A;  5H5Q A;  1QGV A;  2NVL A;  1OAZ A;  4K9Z A;  17GS A;  4QL7 A;  1ZGN A;  4WET A;  3DEX A;  3GST A;  3KMO A;  4ZB6 A;  4P3Y B;  3QAW A;  4JR6 A;  3IK9 A;  3UJ1 A;  3VWX A;  2KP2 A;  1PKW A;  1V58 A;  3IAS 2;  3D6I A;  3LEF A;  2LV3 A;  4PTS A;  2DJ0 A;  1GLP A;  1GUK A;  1Z7R A;  3EVI A;  3F3Q A;  4KX4 A;  1G6Y A;  1TK0 B;  3EPT A;  1GSU A;  1O81 A;  1KNG A;  1EP7 A;  5G5E A;  2EIR A;  3CBU A;  1GL8 A;  3IXR A;  1OVN A;  1EOH A;  3IOS A;  3K8N A;  4GF0 A;  5IO0 A;  4AJ7 A;  4EL1 A;  4I5Q A;  3LGC A;  2RM5 A;  1I9D A;  2KUC A;  4RQX A;  1U3I A;  2DJ1 A;  2R6K A;  4H86 A;  4HU9 A;  4ZL9 A;  1FHE A;  4KCA A;  2PVQ A;  1M0U A;  3UAP A;  3BBY A;  4L5L A;  2VCX A;  2O87 A;  3D21 A;  2MMN A;  3IRA A;  5JWQ B;  4X0X A;  3RHC A;  5JCG A;  3TCO A;  3RAZ A;  3EU4 A;  5G1K A;  3CYN A;  3ZL5 A;  5B6M A;  3TB2 A;  1TI1 A;  3EU3 A;  2OBK A;  4F9Z A;  1A2L A;  3KTB A;  5H5R A;  3LW9 A;  3LG6 A;  2JAD A;  3LQ7 A;  4K5R A;  3IR4 A;  1SJI A;  2B6M A;  5CRW A;  1A2J A;  3TJG A;  3HVN A;  4RI6 A;  3QAG A;  3HJO A;  3EIN A;  3TKR A;  2YJ7 A;  5J3R A;  4O5Q A;  2DC5 A;  4F0C A;  1TOF A;  5DQY A;  3GL3 A;  3HA9 A;  2FWG A;  5F8B A;  1GNW A;  5CYY A;  4O32 A;  2H71 A;  2C0D A;  3E0U A;  5IMA A;  2VLU A;  4L0W A;  2WUL A;  2DKH A;  2B1L A;  3UL3 A;  4EDY A;  2DJK A;  1B8X A;  1SJZ A;  2LJK A;  3ERF A;  3VFI A;  1MD3 A;  1WMJ A;  3FMW A;  3EMX A;  4MDC A;  1OKT A;  2YWN A;  1TTZ A;  2V2G A;  2HSY A;  2LJA A;  1OC3 A;  2GQK A;  1GRX A;  4F2I A;  1UA5 A;  4DSS B;  3FK8 A;  1DBY A;  4BIK A;  5FHI A;  2C3Q A;  4RI7 A;  2WFC A;  3S9F A;  2VAF A;  3TKS C;  3GTU A;  4OCE A;  1U88 A;  2E7P A;  6GSV A;  4OFT A;  3LYP A;  3GYK A;  1SK2 A;  2GS3 A;  2GQM A;  1NHO A;  1R5P A;  6GST A;  3IA1 A;  3IC4 A;  4PQ1 A;  1F2E A;  1X9W B;  4TXO A;  4NWY A;  4HDE A;  4KSM A;  1PL1 A;  2GT6 A;  1SJ6 A;  2OE0 A;  2O89 A;  3GSS A;  2MMO A;  5DAL A;  1EV4 A;  2KP1 A;  1VF3 A;  3FYG A;  2YWO A;  2XBQ A;  3CTG A;  1T7P B;  2GDR A;  3NOF A;  4GLT A;  2GT5 A;  1TP9 A;  4V1A p;  3KP8 A;  4KF9 A;  5L71 A;  2GST A;  1O8W A;  2F51 A;  3MAK A;  3TOU A;  4RUV A;  4HSC X;  4RQR A;  3A5I A;  5KOW A;  4G19 A;  3LJR A;  5IO2 A;  1MD4 A;  1Z3E A;  2CV4 A;  5IMZ A;  1AIU A;  1DSB A;  4MK3 A;  5ECQ B;  5G1L A;  1TJD A;  4TXO B;  2QSI A;  3Q74 A;  3UIW A;  4FYU A;  4L5O A;  5H5S A;  2LST A;  2CX4 A;  4ICY A;  5ECI B;  3TOT A;  2DIY A;  4YKG A;  3DD3 A;  2ES7 A;  2P0G A;  1AUC A;  1RQM A;  2AV4 A;  3M3M A;  2H6Z A;  1TRW A;  2EIQ A;  2E0Q A;  3CSH A;  5ECK B;  4Z2U A;  3L4N A;  1FVJ A;  2BTO T;  2X8H A;  3LXT A;  1SD8 A;  4NV2 A;  4LA1 A;  4OFM A;  1G0T A;  2C3T A;  2AJQ B;  3KGK A;  5B6N A;  2XPE A;  2L5O A;  5C04 A;  1JHB A;  3G7I A;  4PUA A;  3FKF A;  3G9B A;  1WOU A;  2UZ8 A;  1XWK A;  1HD2 A;  3HVV A;  5IM9 A;  5J5N A;  3IK7 A;  1R4W A;  6GSY A;  4OO4 A;  1SK1 A;  1DUG A;  8GSS A;  1RK4 A;  3HZ8 A;  2R0C A;  3KM6 A;  4GSN A;  2QA2 A;  1O85 A;  2FY6 A;  4WKW A;  4N0Z A;  1XOA A;  3KH9 A;  1Q4J A;  2J9H A;  2R2J A;  4A5P A;  1G7E A;  1ON4 A;  1PQN A;  1THX A;  2H0G A;  2PUK C;  4K7N A;  4EF0 A;  3A2V A;  1FOH A;  1OC9 B;  9GSS A;  3MWH A;  19GS A;  2H0I A;  3QPM A;  3LSZ A;  5HQP A;  2LS5 A;  2C3N A;  2JSZ A;  4IGJ A;  3J7Y k;  2H75 A;  1PX6 A;  3FY7 A;  4LLR A;  3H93 A;  4Q5Q A;  4BA7 A;  3E3E A;  4D73 B;  4DSQ A;  1X5D A;  2MMZ A;  2GSS A;  2K18 A;  3PGT A;  2H6X A;  1WRY A;  4TW5 A;  3JCM L;  1A24 A;  4MZW A;  5J9B A;  2A4H A;  4O5R A;  2JAC A;  1ABA A;  3RDW A;  4BVY A;  4HEA 2;  4ZIL A;  2GZZ A;  5HFG A;  2WB9 A;  4AGS A;  3IC8 A;  2VO4 A;  4Z7X A;  2C4J A;  3UBL A;  3TKP A;  1QK8 A;  3DKS A;  2FLS A;  2LNT A;  3ZFL A;  1XW6 A;  1PGT A;  1S3R A;  1YDK A;  1ZYP A;  2F8F A;  4HZ4 A;  1B9Y C;  2FHE A;  4N11 A;  1XWG A;  4IJI A;  4EIP A;  4NAX A;  4POL A;  4HQS A;  4K6X A;  2IL3 A;  2VL2 A;  2IFQ A;  1T4Z A;  5CRD A;  3LOR A;  2CZ3 A;  4YAP A;  4N0V A;  1J08 A;  1GSF A;  4G2E A;  2AB6 A;  1GP1 A;  4F03 A;  4K5S A;  5GST A;  3ZIT A;  2RLI A;  2LQQ A;  5DJM A;  1BAY A;  3ZMK A;  1XG8 A;  3TKQ A;  5J4U A;  2OE1 A;  3H4K A;  2OE3 A;  2WRT A;  1PSQ A;  4FH8 A;  5EY6 A;  4OMV A;  5HFI A;  3EWL A;  1X0R A;  1I5G A;  2H76 A;  5GZZ B;  4ZBB A;  1Z5Y E;  3GV1 A;  3CQF A;  2V6O A;  2X64 A;  4WBJ A;  4OCF A;  1JZW A;  3C73 A;  2CZ2 A;  1WE0 A;  3VI5 A; 
#chains in the Genus database with same CATH homology
 3KMN A;  4OO5 A;  1XCC A;  4KDX A;  2HRN A;  1FVK A;  3D0Z A;  2E2M A;  3PH9 A;  4HZ2 A;  5D9W A;  2D2Z A;  3HZ4 A;  2HZE B;  1NSW A;  4K2D A;  2N5A A;  2OAD A;  2IME A;  3CMI A;  4LL4 B;  1WP0 A;  4EDZ A;  2YOI A;  2ON5 A;  1DE1 A;  2B3S A;  20GS A;  3ZYW A;  5DAK B;  5B8A A;  1A8L A;  4FIW A;  1T4Y A;  1AQV A;  5F06 A;  1OE8 A;  3FR6 A;  3GKX A;  4AJ8 A;  1K0A A;  2LRT A;  4YQM A;  3NIV A;  4K0G A;  2H1B A;  2AYT A;  2V32 A;  1S3C A;  2PPT A;  1K0C A;  4BVX B;  3A5W A;  3QAV A;  4MZC A;  3F6F A;  1Z6M A;  2H73 A;  4GWR A;  2IN3 A;  4DEJ A;  2HYX A;  3BD2 A;  2H1A A;  4YQV A;  4XCS A;  1SL2 B;  2IMF A;  1TU7 A;  1S3A A;  3TJK A;  5KOX A;  2PWJ A;  1TW9 A;  2CX3 A;  11GS A;  4MPG A;  5DCG A;  4WR5 A;  1GTA A;  4ZL8 A;  5J9C A;  1K0N A;  3O6T A;  4HJM A;  4O5U A;  2R0G A;  3GRX A;  1TKD B;  3ME8 A;  3HY2 A;  2V41 A;  1E6B A;  4NV5 A;  5B8B A;  3TJB A;  1CQG A;  4EUY A;  1QQ2 A;  3LWA A;  1O73 A;  4IHU A;  1TXX A;  1A8Y A;  1Y25 A;  2HSH A;  5EL8 A;  5HR3 A;  4XHM A;  1YY7 A;  4KDY A;  1M99 A;  3BOA A;  2CVB A;  1AQX A;  3VPQ A;  3FW2 A;  1XIY A;  1M9B A;  3M1G A;  4ECB A;  2FCH A;  1F37 A;  3UVH A;  2HLS A;  1PL2 A;  2CAQ A;  1VF1 A;  1K3O A;  3EYT A;  1J9B A;  4V2M A;  3C1S A;  5F0G A;  4X1U A;  4EVM A;  1SKR B;  1H75 A;  3GN3 A;  2H1G A;  3IBH A;  1OKD A;  3RHB A;  4KW6 A;  5A4U A;  3F6D A;  4MPF A;  3F4R A;  1VGL A;  3I6A A;  1HNA A;  4BL7 A;  2DJJ A;  1CQH A;  2OA7 A;  2B7J A;  2LJR A;  1SEN A;  2WCI A;  4PX1 A;  2CQ9 A;  1AC1 A;  5KN1 A;  2A2R A;  2QKE A;  1Z9H A;  3BCK A;  5KN0 A;  2OKA A;  3EUR A;  3HDC A;  2C0E A;  1QUW A;  5G30 A;  2EIO A;  1ZOF A;  5IMD A;  5D9X A;  4I97 A;  3TRQ A;  5DCH A;  4IQA A;  1WIK A;  3VPT A;  2B5Y A;  5AIV A;  1M2B A;  5A4V A;  2YAN A;  5LNK e;  1G7O A;  1QMV A;  3M9J A;  3GIX A;  1FAA A;  4L8E A;  3SBC A;  3UOM A;  4K2X A;  3TKS E;  2M80 A;  2PBJ A;  1WPI A;  2C80 A;  2HT9 A;  3HD5 A;  5E59 A;  2VCQ A;  2PGT A;  4TR4 A;  3IHQ A;  2G0F A;  1E2Y A;  2HXK A;  2E2G A;  2P5R A;  3UVT A;  2YV9 A;  1XZO A;  4G9H A;  2GZY A;  4NHZ A;  1B9X C;  2F3M A;  1R26 A;  4JR4 A;  3QOU A;  1A2M A;  3VLN A;  4IP6 A;  4MH2 A;  3CSI A;  2N5B A;  6GSU A;  1GUL A;  3ZTL A;  3IAM 2;  5JCW A;  5D9V A;  5CRG A;  3GMF A;  6GSW A;  5ABR A;  1K0O A;  5HR2 A;  5CRH A;  3ZIJ A;  2WGR A;  2R5G A;  3F4S A;  2RUF A;  1SL1 B;  3KEB A;  3WYW A;  1HYU A;  3TKS A;  1YZX A;  2VCZ A;  3FHK A;  1J0F A;  4POM A;  2DBC A;  4I6X A;  4MF7 A;  2DKI A;  2VCV A;  3MNG A;  3CRT A;  1SKW B;  2LTK A;  5DQS A;  2EC4 A;  1ZZY A;  2LEG A;  5CP1 A;  1ERU A;  4GCI A;  5IMF A;  3MYD A;  3GTU B;  1KBN A;  1EZK A;  1YEX A;  4FO5 A;  3TRP A;  2YZU A;  2HFD A;  4YKF A;  3GKN A;  4XS6 A;  13GS A;  1PN0 A;  5D93 A;  3GA4 A;  5IPH A;  2HRK A;  2FD3 A;  5ENU A;  5DAL B;  2FWF A;  4K0N A;  2VOC A;  4X4J A;  2OBI A;  4EXJ A;  3MIX A;  3KCM A;  1N2A A;  1K3L A;  3ED3 A;  1FB6 A;  2VD0 A;  3ZIV A;  4KE3 A;  1TDI A;  2GZP A;  1ILO A;  4TR0 A;  2VM2 A;  2K6V A;  1KTE A;  5CAX A;  4V1A g;  5AIX A;  2GVP A;  2X99 A;  4ISD A;  1HNB A;  4KUN A;  5ECN B;  3WT2 A;  2GQL A;  2ZNM A;  5FT3 A;  2R4V A;  2R3X A;  3QFB C;  1GTU A;  2YP6 A;  3D22 A;  4IVF A;  2GSR A;  2C8U A;  1F6M C;  16GS A;  3PPU A;  4DSR A;  2I4A A;  3TDG A;  4TOP A;  4F82 A;  5IIZ A;  2X8G A;  3A2X A;  4KH7 A;  4HUA A;  1U87 A;  4ZL7 A;  2VM1 A;  3W8J A;  2CT6 A;  2ZCT A;  3Q19 A;  3KJY A;  3Q18 A;  4Z2R A;  1DE2 A;  4IN0 A;  3I43 A;  3GX8 A;  5F05 A;  1HQO A;  4HS1 A;  1GUH A;  1PMT A;  2K9F A;  3CSJ A;  1WJK A;  4TN8 A;  3O3T A;  4PNF A;  2L4C A;  3ZLP A;  5KN2 A;  3A3T A;  4IS0 A;  3APO A;  3WGX A;  4MA9 A;  1UC7 A;  2L59 A;  1ACV A;  1F3B A;  4PQH A;  3ZVJ D;  4MJE A;  3KTL A;  1PN9 A;  2JL4 A;  1VF2 A;  4EIQ A;  1JZD A;  2P5Q A;  2CVD A;  1GSS A;  3ZFB A;  4NXI A;  4TRX A;  2HI7 A;  3GH6 A;  4JED A;  12GS A;  1YF0 A;  4XS1 A;  2VIM A;  1YKC A;  3I9V 2;  2CVK A;  5B7C A;  2N5F A;  3I69 A;  3UMA A;  4O92 A;  1T1V A;  4ML1 A;  1BX9 A;  4MJB A;  5JCU A;  3FZ4 A;  2GSQ A;  1XWA A;  3HHV A;  1FO5 A;  2X8C A;  4LMV A;  1XBS A;  3P2A A;  2HZF A;  2MYG A;  2DMM A;  4OD7 A;  1URM A;  3WGE A;  1UN2 A;  2RII A;  4TR1 A;  2GLR A;  3U5R E;  5KN3 A;  4QL9 A;  4XRD A;  3L9V A;  2A2S A;  4IEL A;  3VWU A;  18GS A;  2IMI A;  4BVY B;  3C8E A;  2AHE A;  2OJL A;  4BWQ A;  3KIJ A;  4POK A;  2PU9 C;  3ZML A;  3HXS A;  3EE2 A;  3DVX A;  3M0F A;  3HVX A;  1V57 A;  3PR8 A;  2XBI A;  2FWH A;  2NDO A;  3L9U A;  4WEY A;  2R37 A;  1SL0 B;  3DGQ A;  2M46 A;  4ZBD A;  1SYR A;  1W89 A;  5AN1 A;  3US3 A;  4POB A;  1EP8 A;  2LRC A;  3BJ5 A;  1ZMA A;  2YN1 A;  2WDU A;  3L78 A;  2VL9 A;  1TK5 B;  2V6K A;  1XXU A;  1GTI A;  3GH9 A;  5JWO B;  2H70 A;  1YF1 A;  3PIN A;  2IFQ B;  1RW1 A;  4XS4 A;  4BWS A;  2B5X A;  2X4A A;  3IPZ A;  4ZB8 A;  3IHG A;  2B5E A;  1O6J A;  3KH7 A;  1X5C A;  3MDK A;  3IE3 A;  2DML A;  1GNE A;  3WT1 A;  4ECI A;  2H0H A;  2GTU A;  1GSQ A;  4PUR A;  4MP4 A;  3M9K A;  3QDN A;  2QA1 A;  5D73 A;  3P8W A;  2B1K A;  3F8U A;  2HRF A;  2I1U A;  5DJL A;  3ZZX A;  5HR1 A;  2BMX A;  2H72 A;  1EGR A;  1V2A A;  1A0R P;  10GS A;  1SU9 A;  1KEB A;  3N5O A;  1MEK A;  1PA3 A;  2YNX A;  3APQ A;  4TR3 A;  3G7J A;  2JU5 A;  2Z9S A;  3GX0 A;  2HE3 A;  2YZH A;  4K1F A;  3TUE A;  1T8E B;  3E9J B;  2YCD A;  3BCI A;  1K3Y A;  1U3A A;  1V9W A;  2H01 A;  2PN8 A;  4CW9 A;  4E8H A;  4I8B A;  4IQ1 A;  4JZQ A;  4YQU A;  2NBS A;  4HOJ A;  5LD0 A;  5ECL B;  4XTS A;  3HJP A;  1Z6N A;  1AXD A;  2AAW A;  3H1N A;  3NZN A;  3GHA A;  1JZO A;  1BG5 A;  2H74 A;  1O8X A;  3U6V A;  1Y6E A;  2C1Y A;  4NMU A;  1EEJ A;  1F3A A;  1JFU A;  4MCU A;  2OAC A;  2O85 A;  4GTU A;  3GKM A;  1GTB A;  3ZVJ A;  3F4T A;  1WWJ A;  3FZA A;  1MDJ A;  3P7X A;  2L4Q A;  1MTC A;  2A2P A;  4MLY A;  2ALB A;  1OE7 A;  2IPA A;  3OR5 A;  1V40 A;  4TXV A;  4YH2 A;  1W4V A;  2LQO A;  4LL1 B;  1X9S B;  1USB A;  5BMU A;  4WF5 A;  2I81 A;  4KND A;  1M9A A;  1EWX A;  4KSO A;  3N9J A;  5EVO A;  2P31 A;  2K8V A;  1FOV A;  2VUP A;  4G0I A;  2YV7 A;  2IMK A;  2WJU A;  3V1W A;  2TRC P;  1BJX A;  5D96 A;  4MJC A;  1GH2 A;  3UBK A;  4EC0 A;  5HR0 A;  4MF6 A;  4MF5 A;  2ZUP A;  6GSS A;  4GQC A;  4WR4 A;  4XRA A;  3F63 A;  1UVZ A;  5DDL A;  3GUS A;  2JSY A;  4PUF C;  2IMD A;  2FWE A;  4KGI A;  1M2A A;  1FG4 A;  3A2W A;  4ID0 A;  1JZR A;  5ECH B;  2L6D A;  1TK8 B;  2AUV A;  1PKZ A;  4PXO A;  4Z2T A;  1EV9 A;  5EPF A;  2YPM A;  5IOX A;  4ULX A;  5F07 A;  3TJJ A;  2KOK A;  4CY8 A;  5AGY A;  2H1D A;  4NHW A;  1FW1 A;  2J23 A;  4DSS A;  1AQW A;  4K7O A;  1T3B A;  1XVQ A;  4ACS A;  1H4O A;  5A4W A;  5IOW A;  3H8Q A;  3DIE A;  4BL7 B;  1HNC A;  3C7M A;  3RBT A;  2CAI A;  2B7K A;  5CO3 A;  4JBB A;  5CNW A;  4WF4 A;  3CRU A;  3FEU A;  3VK9 A;  1JLW A;  5G5F A;  4IW9 A;  2FUG 2;  3QR6 A;  1M7T A;  1XOB A;  1LU4 A;  2DJ2 A;  2I3Y A;  4X43 A;  5ELG A;  1EEM A;  4WBR D;  2FA4 A;  4J57 E;  2VCW A;  1AAZ A;  1U6T A;  1GSY A;  3L9S A;  4IP1 A;  1N8J A;  1YKA A;  3TRX A;  3DXB A;  4I2T A;  5DVB A;  1XWC A;  2L6C A;  1A0F A;  4N10 A;  1B4P A;  2YWM A;  3VI7 A;  1NHY A;  1XFL A;  4BPY A;  3SWL A;  1YEP A;  5D8I A;  2DJ3 A;  3CTF A;  3C1R A;  3J7Y b;  1TU8 A;  1R5A A;  3RPN A;  2MMA A;  4KA0 A;  3KD0 A;  3IV4 A;  3QCP A;  4USS A;  1THO A;  4ECJ A;  2I9H A;  2RM6 A;  2QGV A;  1AW9 A;  1X5E A;  2FNO A;  2DIZ A;  1F9M A;  4EKZ A;  2A4V A;  4K7I A;  5C00 A;  2LNS A;  4IJ3 A;  2WZ9 A;  14GS A;  1NW2 A;  2MBT A;  3HVS A;  4JRR A;  2JZR A;  5GSS A;  1SKS B;  1A23 A;  1C72 A;  1ERW A;  3MSZ A;  1NM3 A;  2HRA A;  4KB3 A;  3ZRE A;  2ON7 A;  2V1M A;  3R3E A;  1QFN A;  4HU7 A;  4F0B A;  22GS A;  2R0P A;  1SYX A;  3DYR A;  5J41 A;  1G6W A;  5IMV A;  2L5L A;  3APS A;  3WD6 A;  3CXG A;  2KHP A;  4MMM A;  4MAB A;  4PGT A;  4XIH A;  2G2Q A;  4GRF A;  3FR3 A;  4NPB A;  3O76 A;  4L0U A;  4TVE A;  5INY A;  1B48 A;  3UAR A;  1OC9 A;  1XPV A;  2F8A A;  5BRT A;  1TRV A;  1M2D A;  5IPG A;  3R2Q A;  3QD9 A;  4G10 A;  2LKU A;  3VWV A;  3C71 A;  1Z7P A;  5ECS A;  1VRS D;  3GL5 A;  2O7K A;  2VLT A;  3DRN A;  1PD2 1;  1OC8 A;  2RUE A;  3ZRD A;  5LCZ A;  4PNG A;  3ME7 A;  1MDK A;  4D73 A;  3HCZ A;  4MH3 A;  1GWC A;  4Q5R A;  4HI7 A;  5ID2 A;  4E8E A;  1LJR A;  3GKK A;  3FR9 A;  1MDI A;  1ZCP A;  4AJ6 A;  6GSX A;  3KP9 A;  4FYB A;  1JLV A;  1ERT A;  4KAE A;  4QQ7 A;  3VWW A;  5E4W A;  2H8L A;  4MNN A;  2MZC A;  2C0F A;  2VL3 A;  2YJH A;  4JE1 A;  4ILF A;  1YQ1 A;  5A5K A;  4G0L A;  1ZYE A;  4JU5 A;  1LBK A;  3LFL A;  4I2U A;  4J2F A;  3EC3 A;  3HYP A;  5DBQ A;  2X49 A;  3G7Y A;  3W8S A;  4AF2 A;  1BYE A;  3ERG A;  1ZL9 A;  1XWB A;  3H79 A;  4OWY A;  3DVW A;  2KLX A;  4ML6 A;  3WGD A;  1X9M B;  2TIR A;  5ID2 B;  1ML6 A;  5G2Z A;  5ECO B;  1O7U A;  2JZS A;  3DML A;  4IBP A;  4ZB9 A;  3GFK A;  2DSA A;  5KEJ A;  2PVO C;  5ECM B;  5ELA A;  2H19 A;  1ST9 A;  1BED A;  2GGT A;  4GXZ A;  3P90 A;  2VL2 C;  1SD9 A;  1OYJ A;  1Q98 A;  4ECC A;  3VUR A;  1PX7 A;  2IWT A;  4OFN A;  1XW9 A;  2LRN A;  2VD1 A;  2FGX A;  4Q5N A;  1SK0 A;  5GAP D;  1K0B A;  1GUM A;  4IKH A;  2WS2 A;  2BJX A;  3FZ5 A;  4N30 A;  4ZIJ A;  5GAN D;  4V2N A;  2JZT A;  5ECR B;  2K8S A;  3LYK A;  4V2L A;  2XC2 A;  2CA8 A;  3HKR A;  1ERV A;  5HFK A;  3EMP A;  3HJM A;  4CY6 A;  4ZBA A;  3F3R A;  4PQI A;  2IIY A;  2PER A;  3KZQ A;  2HZE A;  4GSS A;  2XPD A;  1S3D A;  4KCE A;  2FA8 A;  3FZ9 A;  2PMT A;  1PRX A;  4Q5F A;  4MZB A;  2H6Y A;  1ZYN A;  3QFA C;  3M8N A;  3D5J A;  5COH A;  5DAK A;  5ECP B;  3AY8 A;  2XHF A;  4J56 E;  3W6G A;  1BQ7 A;  4CDO A;  1GSE A;  1YJ6 A;  2VLV A;  4TR1 B;  5D9T A;  1ZYQ B;  2HNL A;  3DWV A;  4O7H A;  1VF4 A;  4G0K A;  4KDU A;  4BVX A;  2REM A;  3ERW A;  3ISO A;  1TI3 A;  4GQF A;  1TRS A;  4MJA A;  3D4T A;  2LUS A;  2MBS A;  1IYH A;  3FRC A;  4YAV A;  2O8V B;  5JWR B;  1EOG A;  4K8M A;  2C0G A;  2HSM A;  1XW5 A;  3D4M A;  2H66 A;  1B4Q A;  4WXT A;  3RPP A;  2VCT A;  3UEM A;  4FYC A;  4GST A;  3KXO A;  3IDV A;  4TKY A;  2IJY A;  1FB0 A;  1EGO A;  4EO3 A;  2F9S A;  7GSS A;  5IQY A;  2NPB A;  1TRU A;  5G31 A;  5FWG A;  2TRX A;  1K0M A;  4HJ2 A;  4EE0 A;  3TJF A;  5IMC A;  4XS4 B;  1K0D A;  2NTO A;  4DVC A;  4CHS A;  1R7H A;  1GSD A;  3QMX A;  5AIS A;  1XVW A;  3TGZ A;  4LMW A;  2QC7 A;  1GLQ A;  3L0H A;  3F9U A;  3F0I A;  2YWI A;  3GNJ A;  1IYI A;  2M72 A;  2L57 A;  1T00 A;  4HQZ A;  3Q6O A;  1QXH A;  2DLX A;  5CRE A;  4ZXG A;  3LXZ A;  4FQU A;  1V98 A;  2H30 A;  3GUR A;  5H5Q A;  1QGV A;  2NVL A;  1OAZ A;  4K9Z A;  17GS A;  4QL7 A;  1ZGN A;  4WET A;  3DEX A;  3GST A;  3KMO A;  4ZB6 A;  4P3Y B;  3QAW A;  4JR6 A;  3IK9 A;  3UJ1 A;  3VWX A;  2KP2 A;  1PKW A;  1V58 A;  3IAS 2;  3D6I A;  3LEF A;  2LV3 A;  4PTS A;  2DJ0 A;  1GLP A;  1GUK A;  1Z7R A;  3EVI A;  3F3Q A;  4KX4 A;  1G6Y A;  1TK0 B;  3EPT A;  1GSU A;  1O81 A;  1KNG A;  1EP7 A;  5G5E A;  2EIR A;  3CBU A;  1GL8 A;  3IXR A;  1OVN A;  1EOH A;  3IOS A;  3K8N A;  4GF0 A;  5IO0 A;  4AJ7 A;  4EL1 A;  4I5Q A;  3LGC A;  2RM5 A;  1I9D A;  2KUC A;  4RQX A;  1U3I A;  2DJ1 A;  2R6K A;  4H86 A;  4HU9 A;  4ZL9 A;  1FHE A;  4KCA A;  2PVQ A;  1M0U A;  3UAP A;  3BBY A;  4L5L A;  2VCX A;  2O87 A;  3D21 A;  2MMN A;  3IRA A;  5JWQ B;  4X0X A;  3RHC A;  5JCG A;  3TCO A;  3RAZ A;  3EU4 A;  5G1K A;  3CYN A;  3ZL5 A;  5B6M A;  3TB2 A;  1TI1 A;  3EU3 A;  2OBK A;  4F9Z A;  1A2L A;  3KTB A;  5H5R A;  3LW9 A;  3LG6 A;  2JAD A;  3LQ7 A;  4K5R A;  3IR4 A;  1SJI A;  2B6M A;  5CRW A;  1A2J A;  3TJG A;  4RI6 A;  3QAG A;  3HJO A;  3EIN A;  3TKR A;  2YJ7 A;  5J3R A;  4O5Q A;  2DC5 A;  4F0C A;  1TOF A;  5DQY A;  3GL3 A;  3HA9 A;  2FWG A;  5F8B A;  1GNW A;  5CYY A;  4O32 A;  2H71 A;  2C0D A;  3E0U A;  5IMA A;  2VLU A;  4L0W A;  2WUL A;  2DKH A;  2B1L A;  3UL3 A;  4EDY A;  2DJK A;  1B8X A;  1SJZ A;  2LJK A;  3ERF A;  3VFI A;  1MD3 A;  1WMJ A;  3FMW A;  3EMX A;  4MDC A;  1OKT A;  2YWN A;  1TTZ A;  2V2G A;  2HSY A;  2LJA A;  1OC3 A;  2GQK A;  1GRX A;  4F2I A;  1UA5 A;  4DSS B;  3FK8 A;  1DBY A;  5FHI A;  2C3Q A;  4RI7 A;  2WFC A;  3S9F A;  2VAF A;  3TKS C;  3GTU A;  4OCE A;  1U88 A;  2E7P A;  6GSV A;  4OFT A;  3LYP A;  3GYK A;  1SK2 A;  2GS3 A;  2GQM A;  1NHO A;  1R5P A;  6GST A;  3IA1 A;  3IC4 A;  4PQ1 A;  1F2E A;  1X9W B;  4TXO A;  4NWY A;  4HDE A;  4KSM A;  1PL1 A;  2GT6 A;  1SJ6 A;  2OE0 A;  2O89 A;  3GSS A;  2MMO A;  5DAL A;  1EV4 A;  2KP1 A;  1VF3 A;  3FYG A;  2YWO A;  2XBQ A;  3CTG A;  1T7P B;  2GDR A;  3NOF A;  4GLT A;  2GT5 A;  1TP9 A;  4V1A p;  3KP8 A;  4KF9 A;  5L71 A;  2GST A;  1O8W A;  2F51 A;  3MAK A;  3TOU A;  4RUV A;  4RQR A;  3A5I A;  5KOW A;  4G19 A;  3LJR A;  5IO2 A;  1MD4 A;  1Z3E A;  2CV4 A;  5IMZ A;  1AIU A;  1DSB A;  4MK3 A;  5ECQ B;  5G1L A;  1TJD A;  4TXO B;  2QSI A;  3Q74 A;  3UIW A;  4FYU A;  4L5O A;  5H5S A;  2LST A;  2CX4 A;  4ICY A;  5ECI B;  3TOT A;  2DIY A;  4YKG A;  3DD3 A;  2ES7 A;  2P0G A;  1AUC A;  1RQM A;  2AV4 A;  3M3M A;  2H6Z A;  1TRW A;  2EIQ A;  2E0Q A;  3CSH A;  5ECK B;  4Z2U A;  3L4N A;  1FVJ A;  2BTO T;  2X8H A;  3LXT A;  1SD8 A;  4NV2 A;  4LA1 A;  4OFM A;  1G0T A;  2C3T A;  2AJQ B;  3KGK A;  5B6N A;  2XPE A;  2L5O A;  5C04 A;  1JHB A;  3G7I A;  4PUA A;  3FKF A;  3G9B A;  1WOU A;  2UZ8 A;  1XWK A;  1HD2 A;  3HVV A;  5IM9 A;  5J5N A;  3IK7 A;  1R4W A;  6GSY A;  4OO4 A;  1SK1 A;  1DUG A;  8GSS A;  1RK4 A;  3HZ8 A;  2R0C A;  3KM6 A;  4GSN A;  2QA2 A;  1O85 A;  2FY6 A;  4WKW A;  4N0Z A;  1XOA A;  3KH9 A;  1Q4J A;  2J9H A;  2R2J A;  4A5P A;  1G7E A;  1ON4 A;  1PQN A;  1THX A;  2H0G A;  2PUK C;  4K7N A;  4EF0 A;  3A2V A;  1FOH A;  1OC9 B;  9GSS A;  3MWH A;  19GS A;  2H0I A;  3QPM A;  3LSZ A;  5HQP A;  2LS5 A;  2C3N A;  2JSZ A;  4IGJ A;  3J7Y k;  2H75 A;  1PX6 A;  3FY7 A;  4LLR A;  3H93 A;  4Q5Q A;  4BA7 A;  3E3E A;  4D73 B;  4DSQ A;  1X5D A;  2MMZ A;  2GSS A;  2K18 A;  3PGT A;  2H6X A;  1WRY A;  4TW5 A;  3JCM L;  1A24 A;  4MZW A;  5J9B A;  2A4H A;  4O5R A;  2JAC A;  1ABA A;  3RDW A;  4BVY A;  4HEA 2;  4ZIL A;  2GZZ A;  5HFG A;  2WB9 A;  4AGS A;  3IC8 A;  2VO4 A;  4Z7X A;  2C4J A;  3UBL A;  3TKP A;  1QK8 A;  3DKS A;  2FLS A;  2LNT A;  3ZFL A;  1XW6 A;  1PGT A;  1YDK A;  1ZYP A;  2F8F A;  4HZ4 A;  1B9Y C;  2FHE A;  4N11 A;  1XWG A;  4IJI A;  4EIP A;  4NAX A;  4POL A;  4HQS A;  4K6X A;  2IL3 A;  2VL2 A;  2IFQ A;  1T4Z A;  5CRD A;  3LOR A;  2CZ3 A;  4YAP A;  4N0V A;  1J08 A;  1GSF A;  4G2E A;  2AB6 A;  1GP1 A;  4F03 A;  4K5S A;  5GST A;  3ZIT A;  2RLI A;  2LQQ A;  5DJM A;  1BAY A;  3ZMK A;  3TKQ A;  5J4U A;  2OE1 A;  3H4K A;  2OE3 A;  2WRT A;  1PSQ A;  4FH8 A;  5EY6 A;  4OMV A;  5HFI A;  3EWL A;  1X0R A;  1I5G A;  2H76 A;  5GZZ B;  4ZBB A;  1Z5Y E;  3GV1 A;  2V6O A;  2X64 A;  4WBJ A;  4OCF A;  1JZW A;  3C73 A;  2CZ2 A;  1WE0 A;  3VI5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...