2I4AA

Crystal structure of thioredoxin from the acidophile acetobacter aceti
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
107
structure length
107
Chain Sequence
SEHTLAVSDSSFDQDVLKASGLVLVDFWAEWCGPCKMIGPALGEIGKEFAGKVTVAKVNIDDNPETPNAYQVRSIPTLMLVRDGKVIDKKVGALPKSQLKAWVESAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords thioredoxin
publication title Atomic-resolution crystal structure of thioredoxin from the acidophilic bacterium Acetobacter aceti.
pubmed doi rcsb
source organism Acetobacter aceti
total genus 33
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2006-08-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2i4aA00
2VCWA 3AY8A 2EIQA 2H70A 1K0CA 4E8EA 1UVZA 3ISOA 17GSA 2PVQA 4ZBBA 1M2DA 3KJYA 2GSSA 1O7UA 2I81A 3LXZA 2OE1A 4HU9A 5J9CA 1X9WB 2H1DA 1FB0A 2V41A 1TRVA 3QAGA 1J9BA 5EPFA 2NDOA 4HQSA 4F0CA 4L5OA 5AN1A 2VO4A 1VRSD 1PMTA 5IPHA 3F4RA 3HDCA 3ZLPA 3ZYWA 3UAPA 3LEFA 2L4CA 4TW5A 19GSA 1KEBA 2GTUA 1AW9A 1B8XA 2PGTA 5KN2A 1FAAA 4KDXA 5D8IA 3ERGA 1JLWA 5D9WA 4DVCA 4MH2A 3VK9A 3APQA 5GAPD 2M46A 1XBSA 4IQ1A 4P3YB 1XWCA 1TI1A 3K8NA 4BWSA 2N5FA 3LQ7A 3ME8A 3BOAA 3G7JA 3HCZA 1ABAA 4J56E 4F82A 4G10A 4IJIA 4JR4A 4QQ7A 1U3IA 4WETA 2B1KA 4WR4A 2YJ7A 1AAZA 4PQIA 5D9TA 4PQHA 1YEXA 3FY7A 2HNLA 4I2UA 4V1Ap 1M2BA 2ZCTA 2CQ9A 1X5DA 3A2WA 1O73A 4D73B 1A2LA 1DSBA 2L57A 2IPAA 1JLVA 2YWOA 3D6IA 2TRXA 4K7NA 2AV4A 2I4AA 2DMLA 1IYHA 2BMXA 4JZQA 3QFAC 5IMDA 12GSA 2X8CA 1V40A 4LLRA 2IMEA 3F8UA 4POKA 2MMOA 4NV5A 5CRWA 4WBRD 1Z9HA 4GQFA 2GT6A 3H93A 3I69A 4DSRA 2DJ0A 3ZRDA 5G2ZA 4MA9A 4MF6A 1OC8A 1FB6A 1MD3A 3J7Yb 4MF5A 1OC9B 2FGXA 5CNWA 1FVKA 2PUKC 2H8LA 4HJ2A 3VFIA 5H5QA 1SL1B 2DBCA 1SENA 1V9WA 2GSQA 1GTBA 3L9SA 2L5LA 1SU9A 4GSSA 4ZB8A 3L0HA 3CTFA 2VCQA 4DSSB 1OKTA 1YKAA 5IMZA 4MMMA 3TKSA 2JZRA 3KM6A 2FLSA 4K0NA 3HA9A 1F37A 2YN1A 2F3MA 4XIHA 4EO3A 2WULA 5ECKB 2K8VA 1VF4A 1GP1A 3ED3A 1ZMAA 1ILOA 5L71A 3M8NA 4ZIJA 1SD8A 5ID2B 2N5BA 5ECLB 2YANA 4MPGA 4YQUA 3ZVJD 2B5YA 2CAQA 4ECCA 4NHZA 2MBTA 2O8VB 2F51A 3KP9A 5IQYA 1PL2A 3EC3A 4V2LA 2H0HA 2A2RA 2LJRA 5H5RA 1XZOA 3D21A 2MMZA 4ISDA 1CQGA 1KNGA 3GNJA 2C3TA 3TJBA 1W89A 3DIEA 4JE1A 1S3AA 4FYUA 2C0GA 1BJXA 1A8LA 3APOA 1PGTA 2RM6A 1SKSB 1NHYA 3HKRA 2O89A 5LD0A 4HOJA 1CQHA 1O6JA 4WR5A 1UA5A 3PH9A 1THXA 3GKNA 5B8AA 1F6MC 2WFCA 5HR3A 5J3RA 2G2QA 1TK8B 3E9JB 2K6VA 4L0UA 1U87A 3L78A 1GSDA 2GSTA 1S3CA 1GLPA 3GURA 4BVYA 1OC3A 3UIWA 1GSEA 2LJAA 4RUVA 3IV4A 3CYNA 1GTAA 3O6TA 1GSYA 1DE2A 5INYA 2XBQA 1QK8A 4MZCA 1FG4A 1GSUA 2H0GA 4HDEA 1HNBA 2IMDA 2WCIA 1SD9A 4FYBA 1PQNA 5G31A 3F0IA 4PXOA 2LEGA 3KH9A 3IXRA 4BVXA 2DLXA 3I43A 2C4JA 1HD2A 3TKPA 1U6TA 4F03A 3IK7A 2J9HA 4Z7XA 4I5QA 4IELA 1XWKA 2M80A 4POLA 3L4NA 3ZTLA 1XVQA 4TR1B 1R7HA 4JBBA 3GMFA 2HLSA 5F05A 4KAEA 6GSTA 4GQCA 1NW2A 1Z6MA 3L9VA 1ERTA 4KB3A 2K8SA 1LU4A 5DVBA 5G1LA 2OADA 3Q18A 3FKFA 5IMVA 4ZBDA 2GVPA 3VI5A 4FIWA 2FD3A 1EZKA 4KCAA 3DD3A 4HS1A 1EEMA 1MDJA 2WRTA 2IMKA 1MDKA 3GH9A 6GSWA 16GSA 3JCML 3IHQA 2MMNA 1BX9A 2LUSA 1T4YA 2JZTA 1WJKA 4CDOA 1BEDA 2IWTA 1TTZA 1TP9A 4MZWA 2YJHA 3UEMA 5G30A 1FHEA 5LNKe 1WP0A 3CRUA 3U6VA 4EDYA 4EVMA 3DRNA 2VCZA 4OCFA 2QKEA 3O3TA 4IS0A 1K0BA 3RDWA 1RW1A 1XXUA 1H4OA 3H79A 4KW6A 1HYUA 4K0GA 1AQVA 22GSA 3V1WA 2DIZA 2YZHA 2WJUA 3P2AA 3HJMA 1EP8A 1FOVA 3GX8A 3WD6A 1V57A 1GLQA 2L4QA 4I8BA 1EWXA 2HZEB 1OE7A 5J41A 3C1RA 4K2DA 2F8AA 3GN3A 5CRHA 3TKSE 1SL2B 2IJYA 1SYRA 5G1KA 4EC0A 3A2XA 5ECSA 2C0DA 4MJBA 4KE3A 1WOUA 3ZFLA 3HVVA 1V98A 5B7CA 2L59A 2HT9A 2IIYA 3F6DA 4V2NA 4Q5QA 2FA8A 2NVLA 5ECNB 5B8BA 2HRNA 3GTUB 3GKMA 4NPBA 1K0DA 2O87A 5D96A 4NHWA 1ZYEA 2EC4A 5KN3A 3P7XA 5HQPA 1I9DA 4MK3A 4OO5A 5GZZB 2R37A 3Q19A 4HQZA 4KGIA 3DVXA 3W6GA 1X9SB 4OFMA 5ECPB 4DSQA 4I6XA 5IIZA 1JFUA 2YCDA 4CHSA 3IOSA 3ZVJA 5DCGA 2HRFA 4N0ZA 1EGOA 3J7Yk 4ZB9A 3H1NA 4XS1A 5EL8A 4TOPA 5DQSA 2E0QA 4FH8A 2J23A 3F3RA 1NM3A 4DEJA 3GH6A 5DALB 4O7HA 1AQWA 2VAFA 2LS5A 2RLIA 2CZ3A 3C71A 3BCIA 3CSJA 4WKWA 2N5AA 2R5GA 3IA1A 2JSYA 1ZL9A 1VGLA 2X8HA 2H6XA 4IKHA 1SKWB 2B1LA 2B3SA 2C3QA 2H73A 3DMLA 3M3MA 4K9ZA 4X0XA 3QAVA 4EKZA 1ZOFA 3VPQA 5ECQB 1B48A 1O85A 1PKZA 3GX0A 4N30A 4BA7A 4AJ6A 3D4TA 4HUAA 2H71A 2R4VA 1URMA 2WS2A 1K3YA 1XCCA 5ENUA 2IFQB 1U3AA 4G9HA 4LL1B 3WT2A 3IPZA 4KA0A 1MEKA 1F3BA 1G0TA 3C8EA 4J2FA 3UOMA 3EWLA 3LSZA 3D0ZA 4TXOA 2ES7A 1M99A 3VI7A 2CX4A 3UBLA 2GT5A 4KSMA 2H01A 1TRWA 4TRXA 2KOKA 2FY6A 1B9XC 5IOWA 2GDRA 2HFDA 1HNCA 3TJKA 5J4UA 2B5XA 2P5RA 2H0IA 1PKWA 2LJKA 2LRNA 2MYGA 3HY2A 3TDGA 4TR3A 3LYKA 5DBQA 1T00A 1G7OA 2H72A 2P31A 4ACSA 1B4PA 5AGYA 3TRPA 3GKKA 3QDNA 2Z9SA 2VCTA 2VOCA 2VLUA 2FA4A 2DIYA 1EOGA 3KTBA 5C00A 2OJLA 2L5OA 3ZREA 3TCOA 4IQAA 1Z5YE 4J57E 2FWHA 1SKRB 1TKDB 1TK0B 2V6KA 2DJ2A 2OBIA 3F9UA 1G6WA 1AUCA 2CVKA 2YWIA 2HYXA 4EF0A 3FZ4A 4L8EA 2WZ9A 5JWRB 2HI7A 1YY7A 4POMA 4Q5NA 3LYPA 3FZAA 3G9BA 1N8JA 4X43A 2P5QA 1QQ2A 1SYXA 5KEJA 2E2GA 2WGRA 2FNOA 2VD0A 2B6MA 1Z6NA 1R5AA 2OACA 4KSOA 4OCEA 1ST9A 4IJ3A 3QOUA 1F9MA 2H30A 4O92A 2D2ZA 1XFLA 3SBCA 2DJKA 2OKAA 2MMAA 2REMA 1X9MB 2KHPA 1R5PA 4GSNA 2LRCA 2V1MA 4TR0A 3FR6A 1TRSA 4OFTA 3PINA 4YQMA 3VWUA 1DE1A 5EVOA 1KTEA 2HZFA 2A2SA 2GS3A 4HZ4A 4GLTA 2JSZA 3ZITA 5IPGA 4ILFA 1FVJA 2IL3A 3F4SA 2E2MA 5FT3A 3ZMLA 5DAKB 5ELGA 1BYEA 3EURA 3RBTA 2ON7A 3D5JA 3FHKA 4K7OA 1XOAA 4ECJA 4XCSA 4F0BA 2VL9A 4D73A 1TI3A 3MAKA 4O5RA 3IE3A 2IMIA 1WWJA 3DKSA 2QC7A 4NAXA 2C80A 1T7PB 4PX1A 1GULA 2LKUA 3ERWA 1K0NA 3HJOA 5ECHB 3GHAA 1M9AA 5F0GA 5A5KA 2CV4A 2C3NA 4GXZA 3KMNA 1Y25A 3HVXA 2PMTA 1B4QA 1GUMA 5AIVA 3W8JA 3E0UA 4KUNA 4MCUA 4PNGA 3QAWA 4JEDA 3FYGA 4LA1A 4XHMA 1EEJA 2JL4A 3BBYA 4GF0A 1GSFA 4BL7A 2CX3A 2H6YA 3IAS2 4JRRA 4LMWA 1Q98A 2KP1A 5GAND 3GIXA 4QL7A 4ML6A 4RI7A 3CBUA 1UN2A 2ON5A 3W8SA 1BQ7A 2NPBA 4AF2A 3A5WA 2RUEA 5JCWA 4AJ8A 4TVEA 2VD1A 3FR9A 4EDZA 1AC1A 2HSYA 5ID2A 1G6YA 2PBJA 4BPYA 3HZ8A 4IN0A 2YZUA 4WEYA 1J0FA 1I5GA 4ID0A 4EL1A 5J9BA 4WXTA 2ZUPA 1ERWA 4ECIA 1K3OA 2GQMA 3F4TA 1GNEA 1WRYA 3MNGA 4OFNA 5DDLA 4KDUA 1EP7A 4I2TA 3KTLA 4G2EA 3TOTA 1Z3EA 5DJMA 5CP1A 4O32A 5JWOB 3C73A 1SK2A 2WDUA 3MSZA 2LTKA 5CYYA 1K0AA 2QGVA 3PR8A 3U5RE 2FUG2 1SJ6A 1ERVA 3WGEA 4QL9A 4GSTA 3WYWA 1WIKA 4RI6A 2BJXA 2LV3A 3CSIA 1A0RP 4N11A 20GSA 2XC2A 5G5EA 2VUPA 1LBKA 3VURA 2XBIA 2B7JA 1TW9A 2VM2A 5HFIA 3LGCA 3P8WA 1EV4A 2AAWA 4L5LA 1V58A 5JCUA 4MPFA 4ECBA 5CRGA 1RK4A 3FR3A 1TK5B 3LFLA 1IYIA 4ZXGA 3TKRA 1OVNA 4TXVA 1QUWA 1MDIA 3GSSA 4HU7A 2MZCA 1H75A 1SK0A 3APSA 2OE0A 4GCIA 4K7IA 4HJMA 2VIMA 1X0RA 3OR5A 2TRCP 1QFNA 1JHBA 3RPPA 3MWHA 1TU8A 1FW1A 1GH2A 2L6CA 5JCGA 1KBNA 6GSSA 2RM5A 3TB2A 1SJIA 4ZBAA 2H75A 3HHVA 4KNDA 1PSQA 6GSVA 3GRXA 3BJ5A 3A3TA 1XVWA 1GUKA 3EYTA 4PURA 4FYCA 2JACA 2IMFA 5ABRA 5DJLA 2DJ3A 1JZWA 1E2YA 4XS4A 4MJAA 2KUCA 5D93A 3ZMKA 3GUSA 2KLXA 3KIJA 1S3DA 2EIRA 3PGTA 2VL3A 1R26A 2R6KA 3RAZA 5IO2A 1X5CA 1F2EA 3F63A 1O81A 1TU7A 3LG6A 2M72A 11GSA 3MDKA 5D9VA 1YJ6A 1SK1A 2EIOA 2GQLA 3NZNA 3ZIVA 2I1UA 5IOXA 4NXIA 3HD5A 1OKDA 4AJ7A 4OMVA 1B9YC 3GSTA 3ZFBA 5HR0A 1ERUA 1VF2A 1OE8A 3VPTA 5ECMB 2E7PA 3KCMA 4ZL9A 1GTIA 2DC5A 4Q5RA 5D9XA 2R3XA 4ZL7A 1XWBA 2NTOA 2OA7A 3M0FA 3D4MA 1M7TA 3ZIJA 2LSTA 4PUAA 4RQRA 3M9JA 4TR4A 1PD21 2O7KA 2F9SA 3GKXA 2XPEA 1O8WA 1BG5A 3EMPA 5B6NA 4IP1A 1Z7PA 3BCKA 1QXHA 3KEBA 2CT6A 5J5NA 3N9JA 5JWQB 4H86A 1YF0A 3EE2A 1UC7A 4MABA 6GSUA 3UVHA 5GSTA 5IO0A 2GZYA 5F07A 3QMXA 5AISA 2HZEA 2YNXA 5B6MA 1WE0A 3R2QA 5E59A 3KP8A 5A4UA 5CAXA 5HR2A 1XW9A 3KMOA 3UBKA 3EINA 2A4VA 4IW9A 5COHA 3LXTA 1V2AA 1YZXA 3ZZXA 1T3BA 2FWFA 4G19A 5FWGA 2OE3A 3GTUA 3G7YA 3IDVA 1AXDA 2YV9A 3IC4A 3UMAA 1C72A 3A2VA 3P90A 2YWNA 10GSA 3KXOA 5H5SA 1ML6A 2X8GA 3KD0A 3UL3A 1EOHA 1M2AA 3QFBC 1QMVA 1A2JA 4LMVA 4CW9A 4KCEA 2CVBA 4XS6A 1JZRA 4ZB6A 3DEXA 4NMUA 2PWJA 4F9ZA 3RHCA 4MDCA 4N0VA 2F8FA 3FW2A 1TDIA 2ALBA 1VF1A 1GNWA 4YAVA 4FO5A 4TKYA 1QGVA 1TJDA 2AYTA 4ULXA 1K0MA 1MD4A 2JADA 2FWEA 2X99A 5HFGA 5DALA 1PL1A 3IRAA 3EVIA 3FZ9A 4MH3A 3QPMA 3TRXA 4KDYA 5F06A 2HE3A 13GSA 2P0GA 1A2MA 1T4ZA 4YQVA 3DWVA 3E3EA 1OAZA 1MTCA 2YPMA 5EY6A 1GSSA 3HXSA 3US3A 7GSSA 2VL2A 1GTUA 5HR1A 3H8QA 2CAIA 3F3QA 1Q4JA 2IFQA 3TGZA 1GL8A 2CVDA 4WF5A 5IMAA 4K8MA 1BAYA 4JU5A 4EXJA 3DVWA 5A4VA 4AGSA 5CRDA 5CO3A 4I97A 1ZYQB 4EUYA 1PN9A 5CREA 1ZGNA 2AUVA 1XOBA 5IMCA 3TRQA 1W4VA 4MP4A 1J08A 3C1SA 3GL3A 2I9HA 3ERFA 1EGRA 5F8BA 4F2IA 4N10A 3DGQA 4K6XA 6GSXA 3CXGA 3KH7A 4YH2A 3CSHA 2GGTA 3GA4A 3TUEA 3UVTA 2G0FA 2VL2C 2FWGA 3DXBA 3HJPA 2HSHA 2VCVA 4NV2A 1GRXA 2AJQB 1YF1A 1HNAA 3UARA 3BD2A 2FHEA 4POBA 3TKSC 2ZNMA 3H4KA 1SL0B 3IR4A 3D22A 2GLRA 1NSWA 3N5OA 2IN3A 1F3AA 2V32A 2DJJA 3VWXA 4MZBA 4KH7A 1O8XA 1YEPA 1VF3A 2K18A 2VLVA 1XW5A 1ACVA 3FRCA 5D73A 2I3YA 1JZOA 3EU3A 1AQXA 3NOFA 4IP6A 3G7IA 8GSSA 2VCXA 1X5EA 1RQMA 1G7EA 4HEA2 1OC9A 5E4WA 3IK9A 1Z7RA 3VLNA 18GSA 2DJ1A 2TIRA 5AIXA 2B5EA 5DCHA 1YDKA 4X1UA 1XWGA 1XIYA 4ZILA 2V6OA 1XWAA 3QCPA 2DMMA 2FCHA 4DSSA 3ZL5A 2H6ZA 3CMIA 4HZ2A 3NIVA 4WBJA 5A4WA 3UJ1A 4OO4A 4MJCA 3M9KA 4KX4A 4L0WA 2H19A 1E6BA 1M9BA 1ON4A 2XHFA 4MLYA 2R2JA 3L9UA 1ZCPA 2H1AA 2LQOA 1A0FA 1WPIA 3GV1A 2H1GA 2K9FA 1USBA 2YP6A 1WMJA 3VWVA 2C1YA 2DSAA 3KZQA 3I6AA 1FO5A 4YAPA 4IVFA 3HZ4A 2C8UA 4GRFA 2PPTA 2PERA 2PU9C 4ML1A 5GSSA 3IBHA 3VWWA 4RQXA 1TXXA 5ECOB 4XS4B 5KN1A 1M0UA 2X64A 3TJJA 4E8HA 1NHOA 3GL5A 2RIIA 2YWMA 3F6FA 2O85A 3QD9A 5DAKA 3TJGA 1GSQA 4TN8A 2JZSA 2LRTA 3S9FA 5KN0A 3Q74A 4NWYA 2PVOC 5C04A 1HQOA 3TJFA 1T8EB 3WGDA 1A24A 3GFKA 4IGJA 4V1Ag 1YKCA 4Q5FA 1TOFA 1T1VA 3ME7A 1U88A 2MBSA 1SJZA 4JR6A 5ECIB 3KGKA 3LORA 3M1GA 4OWYA 1N2AA 2CA8A 3RHBA 2H1BA 3HYPA 3C7MA 4ZL8A 4IHUA 4MF7A 1XW6A 5HFKA 4BWQA 1PX6A 2AB6A 1EV9A 2CZ2A 3I9V2 3FK8A 5ELAA 1K0OA 5IMFA 1XPVA 1PRXA 2B7KA 6GSYA 2BTOT 1R4WA 4IBPA 3HVSA 3FZ5A 2H74A 3LJRA 2HXKA 1ZZYA 3CRTA 1TRUA 2AHEA 2RUFA 4PNFA 2NBSA 4XRDA 4V2MA 3TOUA 2H76A 2GQKA 4LL4B 2KP2A 4K1FA 1Y6EA 3EMXA 3O76A 2V2GA 5G5FA 5FHIA 1AIUA 2VLTA 14GSA 4GTUA 1GWCA 1THOA 4XTSA 5ECRB 2GZPA 2VM1A 1YQ1A 3SWLA 2PN8A 2LQQA 2C0FA 2YV7A 2WB9A 4TXOB 2C0EA 1PA3A 2GZZA 2LNSA 1A8YA 3GYKA 2L6DA 2YOIA 4OD7A 3CTGA 1K3LA 5LCZA 2H66A 4TR1A 3Q6OA 4PQ1A 3QR6A 1GUHA 5IM9A 3WT1A 4EE0A 2LNTA 2QSIA 1DBYA 1PX7A 2XPDA 5DQYA 4WF4A 1LJRA 3TKQA 4XRAA 2JU5A 1JZDA 4PGTA 4HI7A 3RPNA 3EU4A 3FEUA 3LWAA 2OBKA 3DYRA 3WGXA 1DUGA 2GSRA 1A23A 1OYJA 4GWRA 9GSSA 3IAM2 4MJEA 4PUFC
chains in the Genus database with same CATH superfamily
2VCWA 3IC8A 3AY8A 2EIQA 2H70A 1K0CA 4E8EA 1UVZA 3ISOA 17GSA 2PVQA 4ZBBA 1M2DA 3KJYA 2GSSA 1O7UA 2I81A 3LXZA 2OE1A 4HU9A 5J9CA 1X9WB 2H1DA 1FB0A 2V41A 1TRVA 3QAGA 1J9BA 5EPFA 2NDOA 4HQSA 4F0CA 4L5OA 5AN1A 2VO4A 1VRSD 1PMTA 5IPHA 3F4RA 3HDCA 3ZLPA 3ZYWA 3UAPA 3LEFA 2L4CA 4TW5A 19GSA 1KEBA 2GTUA 1AW9A 1B8XA 2PGTA 5KN2A 1FAAA 4KDXA 5D8IA 3ERGA 1JLWA 5D9WA 4DVCA 4MH2A 3VK9A 3APQA 5GAPD 2M46A 1XBSA 4IQ1A 4P3YB 1XWCA 1TI1A 3K8NA 4BWSA 2N5FA 3LQ7A 3ME8A 3BOAA 3G7JA 3HCZA 1ABAA 4J56E 4F82A 4G10A 4IJIA 4JR4A 4QQ7A 1U3IA 4WETA 2B1KA 4WR4A 2YJ7A 1AAZA 4PQIA 5D9TA 4PQHA 1YEXA 3FY7A 3LW9A 2HNLA 4I2UA 4V1Ap 1M2BA 2ZCTA 2CQ9A 1X5DA 3A2WA 1O73A 4D73B 1A2LA 1DSBA 2L57A 2IPAA 4EIQA 1JLVA 3FMWA 2YWOA 3D6IA 2TRXA 4K7NA 2AV4A 2X4AA 2I4AA 2DMLA 1IYHA 2BMXA 4JZQA 3QFAC 4G0LA 5IMDA 12GSA 2X8CA 1V40A 4LLRA 2IMEA 3F8UA 4POKA 2MMOA 4NV5A 5CRWA 4WBRD 1Z9HA 4GQFA 3MYDA 2GT6A 3H93A 3I69A 4DSRA 2DJ0A 3ZRDA 5G2ZA 4MA9A 4MF6A 1OC8A 1FB6A 1MD3A 3J7Yb 4MF5A 1OC9B 2FGXA 5CNWA 1FVKA 2PUKC 2H8LA 4HJ2A 3VFIA 5H5QA 1SL1B 2DBCA 1SENA 1V9WA 2GSQA 1GTBA 3L9SA 2L5LA 1SU9A 4GSSA 4ZB8A 3L0HA 3CTFA 2VCQA 4DSSB 1OKTA 1YKAA 5IMZA 4MMMA 3TKSA 2JZRA 3KM6A 2FLSA 4K0NA 3HA9A 1F37A 2YN1A 2F3MA 4XIHA 4EO3A 2WULA 5ECKB 2K8VA 1VF4A 1GP1A 3ED3A 1ZMAA 1ILOA 5L71A 1S3RA 3M8NA 4ZIJA 1SD8A 5ID2B 2N5BA 5ECLB 2YANA 4MPGA 4YQUA 3ZVJD 1PFOA 2B5YA 2CAQA 3HVNA 4ECCA 4NHZA 2MBTA 2R0GA 2O8VB 2F51A 3KP9A 2HRAA 5IQYA 1PL2A 3EC3A 4V2LA 2H0HA 4K5RA 2A2RA 2LJRA 5H5RA 1XZOA 3D21A 2MMZA 4ISDA 1CQGA 1KNGA 3GNJA 2C3TA 3TJBA 1W89A 1M3JA 3DIEA 4JE1A 1S3AA 4K5SA 4FYUA 2C0GA 1BJXA 1A8LA 3APOA 1PGTA 2RM6A 1SKSB 1NHYA 3HKRA 2O89A 5LD0A 4HOJA 1CQHA 1O6JA 4WR5A 1UA5A 3PH9A 1THXA 3GKNA 5B8AA 1F6MC 2WFCA 5HR3A 5J3RA 2G2QA 1TK8B 3E9JB 2K6VA 4L0UA 1U87A 3L78A 1GSDA 2GSTA 1S3CA 1GLPA 3GURA 4BVYA 3R3EA 1OC3A 3UIWA 1GSEA 2LJAA 4RUVA 3IV4A 3CYNA 1GTAA 3O6TA 1GSYA 1DE2A 5INYA 3MIXA 2XBQA 1QK8A 4MZCA 1FG4A 1GSUA 2H0GA 4HDEA 1HNBA 2IMDA 2WCIA 1SD9A 4FYBA 1PQNA 5G31A 3F0IA 4PXOA 2LEGA 3KH9A 3IXRA 4BVXA 2DLXA 3I43A 2C4JA 1HD2A 3TKPA 1U6TA 4F03A 3IK7A 2J9HA 4Z7XA 4I5QA 4IELA 1XWKA 2M80A 4POLA 3L4NA 3ZTLA 1XVQA 4TR1B 1R7HA 4JBBA 3GMFA 2HLSA 5F05A 4KAEA 6GSTA 4GQCA 1NW2A 1Z6MA 3L9VA 1ERTA 4KB3A 2K8SA 1LU4A 5DVBA 5G1LA 2OADA 3Q18A 3FKFA 5IMVA 4ZBDA 2GVPA 3VI5A 4FIWA 2FD3A 1EZKA 4KCAA 3DD3A 4HS1A 1EEMA 1MDJA 2WRTA 2IMKA 1MDKA 3GH9A 6GSWA 16GSA 3JCML 3IHQA 2MMNA 1BX9A 2LUSA 1T4YA 2JZTA 1WJKA 4CDOA 1BEDA 2IWTA 1TTZA 1TP9A 4MZWA 2YJHA 3UEMA 5G30A 1FHEA 5LNKe 1WP0A 3CRUA 3U6VA 4EDYA 4EVMA 3DRNA 2VCZA 4OCFA 2QKEA 4KF9A 3O3TA 4IS0A 1K0BA 3RDWA 1RW1A 1XXUA 1H4OA 3H79A 4KW6A 1HYUA 4K0GA 1AQVA 22GSA 3V1WA 2DIZA 2YZHA 2WJUA 3P2AA 3HJMA 1EP8A 1FOVA 3GX8A 3WD6A 1V57A 1GLQA 2L4QA 4I8BA 1EWXA 2HZEB 1OE7A 5J41A 3C1RA 4K2DA 2F8AA 3GN3A 5CRHA 3TKSE 1SL2B 5KOXA 2IJYA 1SYRA 5G1KA 4EC0A 3A2XA 5ECSA 2C0DA 4MJBA 4KE3A 1WOUA 3ZFLA 3HVVA 1V98A 5B7CA 2L59A 2HT9A 2IIYA 3F6DA 4V2NA 4Q5QA 2FA8A 2NVLA 5ECNB 5B8BA 2HRNA 3GTUB 3GKMA 2UZ8A 4NPBA 1K0DA 2O87A 5D96A 4NHWA 1ZYEA 2EC4A 5KN3A 3P7XA 5HQPA 1I9DA 4MK3A 4OO5A 5GZZB 2R37A 3Q19A 4HQZA 4KGIA 3DVXA 3W6GA 1X9SB 4OFMA 5ECPB 4DSQA 2R0CA 4I6XA 5IIZA 1JFUA 2YCDA 4CHSA 3IOSA 3ZVJA 5DCGA 2HRFA 4N0ZA 1EGOA 3J7Yk 4ZB9A 3H1NA 4XS1A 5EL8A 4TOPA 1XG8A 5DQSA 2E0QA 4FH8A 2J23A 3F3RA 1NM3A 4DEJA 3GH6A 5DALB 4CY8A 4O7HA 1AQWA 2VAFA 2LS5A 2RLIA 2CZ3A 3C71A 3BCIA 3CSJA 4WKWA 2N5AA 2R5GA 3IA1A 2JSYA 1ZL9A 1VGLA 2X8HA 2H6XA 4IKHA 1SKWB 2B1LA 2B3SA 2C3QA 2H73A 3DMLA 3M3MA 4K9ZA 4X0XA 3QAVA 4EKZA 1ZOFA 3VPQA 1PN0A 5ECQB 1B48A 1O85A 1PKZA 3GX0A 4N30A 4BA7A 5BRTA 4AJ6A 3D4TA 4HUAA 2H71A 2R4VA 1URMA 2WS2A 1K3YA 1XCCA 5ENUA 2IFQB 4CY6A 1U3AA 4G9HA 4LL1B 3WT2A 3IPZA 4KA0A 1MEKA 1F3BA 2A2PA 1G0TA 3C8EA 4J2FA 3UOMA 3EWLA 3LSZA 3D0ZA 4TXOA 2ES7A 1M99A 3VI7A 2CX4A 3UBLA 2A4HA 2GT5A 4KSMA 2H01A 1TRWA 4TRXA 2KOKA 2FY6A 1B9XC 5IOWA 2GDRA 2HFDA 1HNCA 3TJKA 5J4UA 2B5XA 2P5RA 2H0IA 1PKWA 2HSMA 2LJKA 2LRNA 2MYGA 3HY2A 3TDGA 4TR3A 3LYKA 5DBQA 1T00A 1G7OA 2H72A 2P31A 4ACSA 1ZYPA 1B4PA 5AGYA 3TRPA 3GKKA 3QDNA 2Z9SA 2VCTA 2VOCA 2VLUA 2FA4A 2DIYA 1EOGA 3KTBA 5C00A 2OJLA 2L5OA 3ZREA 3TCOA 4IQAA 1Z5YE 4J57E 2FWHA 1SKRB 1TKDB 1TK0B 2V6KA 2DJ2A 2OBIA 3F9UA 1G6WA 1AUCA 2CVKA 2YWIA 2HYXA 4EF0A 3FZ4A 4L8EA 2WZ9A 5JWRB 2HI7A 1YY7A 4POMA 4Q5NA 3LYPA 3PPUA 3FZAA 3G9BA 1N8JA 4X43A 2P5QA 1QQ2A 1SYXA 5KEJA 2E2GA 2WGRA 2FNOA 2VD0A 2B6MA 1Z6NA 1R5AA 2OACA 4KSOA 4OCEA 1ST9A 4BVYB 4IJ3A 3QOUA 1F9MA 2H30A 4O92A 4USSA 2D2ZA 1XFLA 3SBCA 2DJKA 2OKAA 2MMAA 2REMA 1X9MB 2KHPA 1R5PA 4GSNA 2LRCA 2V1MA 4TR0A 4O5QA 3FR6A 1TRSA 4OFTA 3PINA 4YQMA 3VWUA 1DE1A 5EVOA 1KTEA 2HZFA 2A2SA 2GS3A 4HZ4A 4BVXB 4GLTA 2JSZA 3ZITA 5IPGA 4ILFA 1FVJA 2IL3A 3F4SA 2E2MA 5FT3A 3ZMLA 5DAKB 5ELGA 1BYEA 3EURA 3RBTA 2ON7A 3D5JA 3FHKA 4K7OA 1XOAA 4ECJA 4XCSA 4F0BA 2VL9A 4D73A 1TI3A 3MAKA 4O5RA 3IE3A 2IMIA 1WWJA 3DKSA 2QC7A 4NAXA 2C80A 1T7PB 4PX1A 1GULA 2LKUA 3A5IA 3ERWA 1K0NA 3HJOA 5ECHB 3GHAA 1M9AA 5F0GA 5A5KA 3EPTA 2CV4A 2C3NA 4GXZA 3KMNA 1Y25A 3HVXA 2PMTA 1B4QA 1GUMA 5AIVA 3W8JA 3E0UA 4KUNA 4MNNA 4MCUA 4PNGA 3QAWA 4JEDA 3FYGA 4LA1A 4XHMA 1EEJA 2JL4A 3BBYA 4GF0A 2DKIA 1GSFA 4BL7A 2CX3A 2H6YA 3IAS2 4JRRA 4LMWA 1Q98A 2KP1A 5GAND 3GIXA 4QL7A 4ML6A 4RI7A 3CBUA 1UN2A 2ON5A 3W8SA 1BQ7A 2NPBA 4AF2A 3A5WA 2RUEA 5JCWA 4AJ8A 4TVEA 2VD1A 3FR9A 4EDZA 1AC1A 2HSYA 5ID2A 1G6YA 2PBJA 4BPYA 3HZ8A 4IN0A 4G0IA 2YZUA 4WEYA 1J0FA 1I5GA 4ID0A 4EL1A 5J9BA 4WXTA 2ZUPA 1ERWA 4ECIA 1K3OA 2GQMA 3F4TA 1GNEA 1WRYA 3MNGA 4OFNA 4A5PA 5DDLA 4KDUA 1EP7A 4I2TA 3KTLA 4G2EA 3TOTA 1Z3EA 5DJMA 5CP1A 4O32A 5JWOB 3C73A 1SK2A 2WDUA 3MSZA 2LTKA 5CYYA 1K0AA 2QGVA 3PR8A 3U5RE 2FUG2 1SJ6A 1ERVA 3WGEA 4QL9A 4GSTA 3WYWA 1WIKA 4RI6A 2BJXA 2LV3A 3CSIA 1A0RP 4N11A 20GSA 2XC2A 5G5EA 2VUPA 1LBKA 4O5UA 2XBIA 3VURA 2B7JA 1TW9A 2VM2A 5HFIA 3LGCA 3P8WA 1EV4A 2AAWA 4L5LA 1V58A 5JCUA 4MPFA 4ECBA 5CRGA 1RK4A 3FR3A 1TK5B 3LFLA 1IYIA 4ZXGA 3TKRA 4EIPA 1OVNA 4TXVA 1QUWA 1MDIA 3GSSA 4HU7A 2MZCA 1H75A 1SK0A 3APSA 2OE0A 4GCIA 4K7IA 4HJMA 2VIMA 1X0RA 3OR5A 2TRCP 1QFNA 1JHBA 3RPPA 3MWHA 1TU8A 1FW1A 1GH2A 2L6CA 5JCGA 1KBNA 6GSSA 2RM5A 3TB2A 1SJIA 4ZBAA 2H75A 3HHVA 4KNDA 1PSQA 6GSVA 3GRXA 3BJ5A 3A3TA 1XVWA 1GUKA 3EYTA 4PURA 4FYCA 2JACA 2IMFA 5ABRA 5DJLA 2DJ3A 1JZWA 1E2YA 4XS4A 4MJAA 2KUCA 5D93A 3ZMKA 3GUSA 2KLXA 3KIJA 1S3DA 2EIRA 3PGTA 2VL3A 1R26A 2R6KA 3RAZA 5IO2A 1X5CA 1F2EA 3F63A 1O81A 1TU7A 3LG6A 2M72A 11GSA 3MDKA 5D9VA 1YJ6A 1SK1A 2EIOA 2GQLA 3NZNA 3ZIVA 2I1UA 5IOXA 4NXIA 3HD5A 1OKDA 4AJ7A 4OMVA 1B9YC 3GSTA 3ZFBA 5HR0A 1ERUA 1VF2A 1OE8A 3VPTA 5ECMB 2E7PA 3KCMA 4ZL9A 1GTIA 2DC5A 4Q5RA 5D9XA 2R3XA 4ZL7A 1XWBA 2DKHA 2NTOA 2HRKA 2OA7A 3M0FA 3D4MA 5BMUA 1M7TA 3ZIJA 2LSTA 4PUAA 4RQRA 3M9JA 4TR4A 1PD21 2O7KA 2F9SA 3GKXA 2XPEA 1O8WA 1BG5A 2R0PA 3EMPA 5B6NA 4IP1A 1Z7PA 3BCKA 1QXHA 3KEBA 2CT6A 5J5NA 3N9JA 5JWQB 4H86A 1YF0A 3EE2A 1UC7A 4MABA 6GSUA 3UVHA 5GSTA 5IO0A 2GZYA 5F07A 3QMXA 2HZEA 5AISA 2YNXA 5B6MA 1WE0A 3R2QA 5E59A 3KP8A 5A4UA 5CAXA 5HR2A 1XW9A 3KMOA 3UBKA 3EINA 2A4VA 4IW9A 5COHA 3LXTA 1V2AA 4FQUA 1YZXA 3ZZXA 1T3BA 2FWFA 4G19A 5FWGA 2OE3A 3GTUA 3G7YA 3IDVA 4BIKA 1AXDA 2YV9A 3IC4A 3UMAA 1C72A 3A2VA 3P90A 2YWNA 10GSA 3KXOA 5H5SA 1ML6A 2X8GA 3KD0A 3UL3A 1EOHA 1M2AA 3QFBC 1QMVA 1A2JA 4LMVA 4CW9A 4KCEA 2CVBA 4XS6A 1JZRA 4K2XA 4ZB6A 3DEXA 4NMUA 2PWJA 4F9ZA 3RHCA 4MDCA 4N0VA 2F8FA 3FW2A 1TDIA 2ALBA 1VF1A 1GNWA 4YAVA 4FO5A 4TKYA 1QGVA 1TJDA 2AYTA 4ULXA 1K0MA 1MD4A 2JADA 2FWEA 4Z2TA 2X99A 5HFGA 5DALA 1PL1A 2X49A 3IRAA 3EVIA 3FZ9A 5KOWA 4MH3A 3QPMA 3TRXA 4KDYA 5F06A 2HE3A 13GSA 2P0GA 1A2MA 1T4ZA 4YQVA 3DWVA 3E3EA 1OAZA 1MTCA 2YPMA 5EY6A 1GSSA 3HXSA 3US3A 7GSSA 2VL2A 1GTUA 5HR1A 3H8QA 2CAIA 3F3QA 1Q4JA 4Z2RA 2IFQA 3TGZA 1GL8A 4BL7B 2CVDA 4WF5A 5IMAA 4K8MA 1BAYA 4JU5A 4EXJA 3DVWA 5A4VA 2QA1A 4AGSA 1ZYNA 5CRDA 4X4JA 5CO3A 4I97A 1ZYQB 4EUYA 1PN9A 5CREA 1ZGNA 2AUVA 1XOBA 5IMCA 3TRQA 1W4VA 4MP4A 1J08A 3C1SA 3GL3A 2I9HA 3ERFA 1EGRA 5F8BA 4F2IA 4N10A 3DGQA 4K6XA 6GSXA 3CXGA 3KH7A 4YH2A 3CSHA 2GGTA 3GA4A 3TUEA 4HSCX 3UVTA 2G0FA 2VL2C 2FWGA 3DXBA 3HJPA 2HSHA 2VCVA 4NV2A 1GRXA 2AJQB 1YF1A 1HNAA 3UARA 3BD2A 2FHEA 4POBA 3TKSC 2ZNMA 3H4KA 1SL0B 3IR4A 3D22A 2GLRA 1NSWA 3N5OA 2IN3A 1F3AA 2V32A 2DJJA 3VWXA 4MZBA 4KH7A 1O8XA 1YEPA 1VF3A 2K18A 2VLVA 1XW5A 1ACVA 3FRCA 5D73A 2I3YA 1JZOA 3EU3A 1AQXA 3NOFA 4IP6A 3G7IA 8GSSA 2VCXA 1X5EA 1RQMA 1G7EA 4HEA2 1OC9A 5E4WA 3IK9A 1Z7RA 3VLNA 18GSA 2DJ1A 2TIRA 5AIXA 2B5EA 5DCHA 1YDKA 4X1UA 1XWGA 1XIYA 4ZILA 2V6OA 1XWAA 3QCPA 2DMMA 2FCHA 4DSSA 3ZL5A 4ICYA 2H6ZA 3CMIA 4HZ2A 3NIVA 4WBJA 5A4WA 3UJ1A 4OO4A 4MJCA 3M9KA 4KX4A 4L0WA 2H19A 1E6BA 1M9BA 1ON4A 2XHFA 4MLYA 2R2JA 3L9UA 1ZCPA 2H1AA 2LQOA 1A0FA 1FOHA 1WPIA 3GV1A 2H1GA 2K9FA 1USBA 2YP6A 1WMJA 4YKGA 3VWVA 2C1YA 2DSAA 3KZQA 3I6AA 1FO5A 4YAPA 4IVFA 3HZ4A 2C8UA 2QA2A 4GRFA 2PPTA 2PERA 3CQFA 2PU9C 4ML1A 5GSSA 3IBHA 3VWWA 4RQXA 1TXXA 5ECOB 4XS4B 5KN1A 1M0UA 2X64A 3TJJA 4E8HA 1NHOA 3GL5A 2RIIA 2YWMA 3F6FA 2O85A 3QD9A 5DAKA 3TJGA 1GSQA 4TN8A 2JZSA 2LRTA 3S9FA 5KN0A 3Q74A 4NWYA 2PVOC 5C04A 1HQOA 3TJFA 1T8EB 3WGDA 1A24A 3GFKA 4IGJA 1M3IA 4V1Ag 4YKFA 1YKCA 4Q5FA 1TOFA 1T1VA 3ME7A 1U88A 2MBSA 1SJZA 4JR6A 5ECIB 3KGKA 3LORA 3M1GA 4OWYA 1N2AA 2CA8A 3RHBA 2H1BA 3HYPA 3C7MA 4ZL8A 4IHUA 4MF7A 3IHGA 1XW6A 5HFKA 4BWQA 1PX6A 2AB6A 4PTSA 1EV9A 2CZ2A 3I9V2 3FK8A 5ELAA 1K0OA 5IMFA 1XPVA 1PRXA 2B7KA 6GSYA 2BTOT 1R4WA 4IBPA 3HVSA 3FZ5A 2H74A 3LJRA 2HXKA 1ZZYA 3CRTA 1TRUA 2AHEA 2RUFA 4Z2UA 4PNFA 2NBSA 4XRDA 4V2MA 3TOUA 2H76A 2GQKA 4LL4B 2KP2A 4K1FA 1Y6EA 3EMXA 3O76A 2V2GA 5G5FA 5FHIA 1AIUA 2VLTA 14GSA 4GTUA 1GWCA 1THOA 4XTSA 5ECRB 2GZPA 2VM1A 1YQ1A 3SWLA 2PN8A 2LQQA 2C0FA 2YV7A 2WB9A 4TXOB 2C0EA 1PA3A 2GZZA 2LNSA 1A8YA 3GYKA 2L6DA 2YOIA 4OD7A 3CTGA 1K3LA 4G0KA 5LCZA 2H66A 4TR1A 3Q6OA 4PQ1A 3QR6A 1GUHA 5IM9A 3WT1A 4EE0A 2LNTA 2QSIA 1DBYA 1PX7A 2XPDA 5DQYA 4WF4A 1LJRA 3TKQA 4XRAA 2JU5A 1JZDA 4PGTA 4HI7A 3RPNA 3EU4A 3FEUA 3LWAA 2OBKA 3DYRA 3WGXA 1DUGA 2GSRA 1A23A 1OYJA 4GWRA 9GSSA 3IAM2 4MJEA 4PUFC
chains in the Genus database with same CATH topology
2VCWA 3IC8A 3AY8A 2EIQA 2H70A 1K0CA 4E8EA 1UVZA 3ISOA 17GSA 2PVQA 4ZBBA 1M2DA 3KJYA 2GSSA 1O7UA 2I81A 3LXZA 2OE1A 4HU9A 5J9CA 1X9WB 2H1DA 1FB0A 2V41A 1TRVA 3QAGA 1J9BA 5EPFA 2NDOA 4HQSA 4F0CA 4L5OA 5AN1A 2VO4A 1VRSD 1PMTA 5IPHA 3F4RA 3HDCA 3ZLPA 3ZYWA 3UAPA 3LEFA 2L4CA 4TW5A 19GSA 1KEBA 2GTUA 1AW9A 1B8XA 2PGTA 5KN2A 1FAAA 4KDXA 5D8IA 3ERGA 1JLWA 5D9WA 4DVCA 4MH2A 3VK9A 3APQA 5GAPD 2M46A 1XBSA 4IQ1A 4P3YB 1XWCA 1TI1A 3K8NA 4BWSA 2N5FA 3LQ7A 3ME8A 3BOAA 3G7JA 3HCZA 1ABAA 4J56E 4F82A 4G10A 4IJIA 4JR4A 4QQ7A 1U3IA 4WETA 2B1KA 4WR4A 2YJ7A 1AAZA 4PQIA 5D9TA 4PQHA 1YEXA 3FY7A 3LW9A 2HNLA 4I2UA 4V1Ap 1M2BA 2ZCTA 2CQ9A 1X5DA 3A2WA 1O73A 4D73B 1A2LA 1DSBA 2L57A 2IPAA 4EIQA 1JLVA 3FMWA 2YWOA 3D6IA 2TRXA 4K7NA 2AV4A 2X4AA 2I4AA 2DMLA 1IYHA 2BMXA 4JZQA 3QFAC 4G0LA 5IMDA 12GSA 2X8CA 1V40A 4LLRA 2IMEA 3F8UA 4POKA 2MMOA 4NV5A 5CRWA 4WBRD 1Z9HA 4GQFA 3MYDA 2GT6A 3H93A 3I69A 4DSRA 2DJ0A 3ZRDA 5G2ZA 4MA9A 4MF6A 1OC8A 1FB6A 1MD3A 3J7Yb 4MF5A 1OC9B 2FGXA 5CNWA 1FVKA 2PUKC 2H8LA 4HJ2A 3VFIA 5H5QA 1SL1B 2DBCA 1SENA 1V9WA 2GSQA 1GTBA 3L9SA 2L5LA 1SU9A 4GSSA 4ZB8A 3L0HA 3CTFA 2VCQA 4DSSB 1OKTA 1YKAA 5IMZA 4MMMA 3TKSA 2JZRA 3KM6A 2FLSA 4K0NA 3HA9A 1F37A 2YN1A 2F3MA 4XIHA 4EO3A 2WULA 5ECKB 2K8VA 1VF4A 1GP1A 3ED3A 1ZMAA 1ILOA 5L71A 3M8NA 4ZIJA 1SD8A 5ID2B 2N5BA 5ECLB 2YANA 4MPGA 4YQUA 3ZVJD 2B5YA 2CAQA 4ECCA 4NHZA 2MBTA 2R0GA 2O8VB 2F51A 3KP9A 2HRAA 5IQYA 1PL2A 3EC3A 4V2LA 2H0HA 4K5RA 2A2RA 2LJRA 5H5RA 1XZOA 3D21A 2MMZA 4ISDA 1CQGA 1KNGA 3GNJA 2C3TA 3TJBA 1W89A 3DIEA 4JE1A 1S3AA 4K5SA 4FYUA 2C0GA 1BJXA 1A8LA 3APOA 1PGTA 2RM6A 1SKSB 1NHYA 3HKRA 2O89A 5LD0A 4HOJA 1CQHA 1O6JA 4WR5A 1UA5A 3PH9A 1THXA 3GKNA 5B8AA 1F6MC 2WFCA 5HR3A 5J3RA 2G2QA 1TK8B 3E9JB 2K6VA 4L0UA 1U87A 3L78A 1GSDA 2GSTA 1S3CA 1GLPA 3GURA 4BVYA 3R3EA 1OC3A 3UIWA 1GSEA 2LJAA 4RUVA 3IV4A 3CYNA 1GTAA 3O6TA 1GSYA 1DE2A 5INYA 3MIXA 2XBQA 1QK8A 4MZCA 1FG4A 1GSUA 2H0GA 4HDEA 1HNBA 2IMDA 2WCIA 1SD9A 4FYBA 1PQNA 5G31A 3F0IA 4PXOA 2LEGA 3KH9A 3IXRA 4BVXA 2DLXA 3I43A 2C4JA 1HD2A 3TKPA 1U6TA 4F03A 3IK7A 2J9HA 4Z7XA 4I5QA 4IELA 1XWKA 2M80A 4POLA 3L4NA 3ZTLA 1XVQA 4TR1B 1R7HA 4JBBA 3GMFA 2HLSA 5F05A 4KAEA 6GSTA 4GQCA 1NW2A 1Z6MA 3L9VA 1ERTA 4KB3A 2K8SA 1LU4A 5DVBA 5G1LA 2OADA 3Q18A 3FKFA 5IMVA 4ZBDA 2GVPA 3VI5A 4FIWA 2FD3A 1EZKA 4KCAA 3DD3A 4HS1A 1EEMA 1MDJA 2WRTA 2IMKA 1MDKA 3GH9A 6GSWA 16GSA 3JCML 3IHQA 2MMNA 1BX9A 2LUSA 1T4YA 2JZTA 1WJKA 4CDOA 1BEDA 2IWTA 1TTZA 1TP9A 4MZWA 2YJHA 3UEMA 5G30A 1FHEA 5LNKe 1WP0A 3CRUA 3U6VA 4EDYA 4EVMA 3DRNA 2VCZA 4OCFA 2QKEA 4KF9A 3O3TA 4IS0A 1K0BA 3RDWA 1RW1A 1XXUA 1H4OA 3H79A 4KW6A 1HYUA 4K0GA 1AQVA 22GSA 3V1WA 2DIZA 2YZHA 2WJUA 3P2AA 3HJMA 1EP8A 1FOVA 3GX8A 3WD6A 1V57A 1GLQA 2L4QA 4I8BA 1EWXA 2HZEB 1OE7A 5J41A 3C1RA 4K2DA 2F8AA 3GN3A 5CRHA 3TKSE 1SL2B 5KOXA 2IJYA 1SYRA 5G1KA 4EC0A 3A2XA 5ECSA 2C0DA 4MJBA 4KE3A 1WOUA 3ZFLA 3HVVA 1V98A 5B7CA 2L59A 2HT9A 2IIYA 3F6DA 4V2NA 4Q5QA 2FA8A 2NVLA 5ECNB 5B8BA 2HRNA 3GTUB 3GKMA 2UZ8A 4NPBA 1K0DA 2O87A 5D96A 4NHWA 1ZYEA 2EC4A 5KN3A 3P7XA 5HQPA 1I9DA 4MK3A 4OO5A 5GZZB 2R37A 3Q19A 4HQZA 4KGIA 3DVXA 3W6GA 1X9SB 4OFMA 5ECPB 4DSQA 2R0CA 4I6XA 5IIZA 1JFUA 2YCDA 4CHSA 3IOSA 3ZVJA 5DCGA 2HRFA 4N0ZA 1EGOA 3J7Yk 4ZB9A 3H1NA 4XS1A 5EL8A 4TOPA 5DQSA 2E0QA 4FH8A 2J23A 3F3RA 1NM3A 4DEJA 3GH6A 5DALB 4CY8A 4O7HA 1AQWA 2VAFA 2LS5A 2RLIA 2CZ3A 3C71A 3BCIA 3CSJA 4WKWA 2N5AA 2R5GA 3IA1A 2JSYA 1ZL9A 1VGLA 2X8HA 2H6XA 4IKHA 1SKWB 2B1LA 2B3SA 2C3QA 2H73A 3DMLA 3M3MA 4K9ZA 4X0XA 3QAVA 4EKZA 1ZOFA 3VPQA 1PN0A 5ECQB 1B48A 1O85A 1PKZA 3GX0A 4N30A 4BA7A 5BRTA 4AJ6A 3D4TA 4HUAA 2H71A 2R4VA 1URMA 2WS2A 1K3YA 1XCCA 5ENUA 2IFQB 4CY6A 1U3AA 4G9HA 4LL1B 3WT2A 3IPZA 4KA0A 1MEKA 1F3BA 2A2PA 1G0TA 3C8EA 4J2FA 3UOMA 3EWLA 3LSZA 3D0ZA 4TXOA 2ES7A 1M99A 3VI7A 2CX4A 3UBLA 2A4HA 2GT5A 4KSMA 2H01A 1TRWA 4TRXA 2KOKA 2FY6A 1B9XC 5IOWA 2GDRA 2HFDA 1HNCA 3TJKA 5J4UA 2B5XA 2P5RA 2H0IA 1PKWA 2HSMA 2LJKA 2LRNA 2MYGA 3HY2A 3TDGA 4TR3A 3LYKA 5DBQA 1T00A 1G7OA 2H72A 2P31A 4ACSA 1ZYPA 1B4PA 5AGYA 3TRPA 3GKKA 3QDNA 2Z9SA 2VCTA 2VOCA 2VLUA 2FA4A 2DIYA 1EOGA 3KTBA 5C00A 2OJLA 2L5OA 3ZREA 3TCOA 4IQAA 1Z5YE 4J57E 2FWHA 1SKRB 1TKDB 1TK0B 2V6KA 2DJ2A 2OBIA 3F9UA 1G6WA 1AUCA 2CVKA 2YWIA 2HYXA 4EF0A 3FZ4A 4L8EA 2WZ9A 5JWRB 2HI7A 1YY7A 4POMA 4Q5NA 3LYPA 3PPUA 3FZAA 3G9BA 1N8JA 4X43A 2P5QA 1QQ2A 1SYXA 5KEJA 2E2GA 2WGRA 2FNOA 2VD0A 2B6MA 1Z6NA 1R5AA 2OACA 4KSOA 4OCEA 1ST9A 4BVYB 4IJ3A 3QOUA 1F9MA 2H30A 4O92A 4USSA 2D2ZA 1XFLA 3SBCA 2DJKA 2OKAA 2MMAA 2REMA 1X9MB 2KHPA 1R5PA 4GSNA 2LRCA 2V1MA 4TR0A 4O5QA 3FR6A 1TRSA 4OFTA 3PINA 4YQMA 3VWUA 1DE1A 5EVOA 1KTEA 2HZFA 2A2SA 2GS3A 4HZ4A 4BVXB 4GLTA 2JSZA 3ZITA 5IPGA 4ILFA 1FVJA 2IL3A 3F4SA 2E2MA 5FT3A 3ZMLA 5DAKB 5ELGA 1BYEA 3EURA 3RBTA 2ON7A 3D5JA 3FHKA 4K7OA 1XOAA 4ECJA 4XCSA 4F0BA 2VL9A 4D73A 1TI3A 3MAKA 4O5RA 3IE3A 2IMIA 1WWJA 3DKSA 2QC7A 4NAXA 2C80A 1T7PB 4PX1A 1GULA 2LKUA 3A5IA 3ERWA 1K0NA 3HJOA 5ECHB 3GHAA 1M9AA 5F0GA 5A5KA 3EPTA 2CV4A 2C3NA 4GXZA 3KMNA 1Y25A 3HVXA 2PMTA 1B4QA 1GUMA 5AIVA 3W8JA 3E0UA 4KUNA 4MNNA 4MCUA 4PNGA 3QAWA 4JEDA 3FYGA 4LA1A 4XHMA 1EEJA 2JL4A 3BBYA 4GF0A 2DKIA 1GSFA 4BL7A 2CX3A 2H6YA 3IAS2 4JRRA 4LMWA 1Q98A 2KP1A 5GAND 3GIXA 4QL7A 4ML6A 4RI7A 3CBUA 1UN2A 2ON5A 3W8SA 1BQ7A 2NPBA 4AF2A 3A5WA 2RUEA 5JCWA 4AJ8A 4TVEA 2VD1A 3FR9A 4EDZA 1AC1A 2HSYA 5ID2A 1G6YA 2PBJA 4BPYA 3HZ8A 4IN0A 4G0IA 2YZUA 4WEYA 1J0FA 1I5GA 4ID0A 4EL1A 5J9BA 4WXTA 2ZUPA 1ERWA 4ECIA 1K3OA 2GQMA 3F4TA 1GNEA 1WRYA 3MNGA 4OFNA 4A5PA 5DDLA 4KDUA 1EP7A 4I2TA 3KTLA 4G2EA 3TOTA 1Z3EA 5DJMA 5CP1A 4O32A 5JWOB 3C73A 1SK2A 2WDUA 3MSZA 2LTKA 5CYYA 1K0AA 2QGVA 3PR8A 3U5RE 2FUG2 1SJ6A 1ERVA 3WGEA 4QL9A 4GSTA 3WYWA 1WIKA 4RI6A 2BJXA 2LV3A 3CSIA 1A0RP 4N11A 20GSA 2XC2A 5G5EA 2VUPA 1LBKA 4O5UA 2XBIA 3VURA 2B7JA 1TW9A 2VM2A 5HFIA 3LGCA 3P8WA 1EV4A 2AAWA 4L5LA 1V58A 5JCUA 4MPFA 4ECBA 5CRGA 1RK4A 3FR3A 1TK5B 3LFLA 1IYIA 4ZXGA 3TKRA 4EIPA 1OVNA 4TXVA 1QUWA 1MDIA 3GSSA 4HU7A 2MZCA 1H75A 1SK0A 3APSA 2OE0A 4GCIA 4K7IA 4HJMA 2VIMA 1X0RA 3OR5A 2TRCP 1QFNA 1JHBA 3RPPA 3MWHA 1TU8A 1FW1A 1GH2A 2L6CA 5JCGA 1KBNA 6GSSA 2RM5A 3TB2A 1SJIA 4ZBAA 2H75A 3HHVA 4KNDA 1PSQA 6GSVA 3GRXA 3BJ5A 3A3TA 1XVWA 1GUKA 3EYTA 4PURA 4FYCA 2JACA 2IMFA 5ABRA 5DJLA 2DJ3A 1JZWA 1E2YA 4XS4A 4MJAA 2KUCA 5D93A 3ZMKA 3GUSA 2KLXA 3KIJA 1S3DA 2EIRA 3PGTA 2VL3A 1R26A 2R6KA 3RAZA 5IO2A 1X5CA 1F2EA 3F63A 1O81A 1TU7A 3LG6A 2M72A 11GSA 3MDKA 5D9VA 1YJ6A 1SK1A 2EIOA 2GQLA 3NZNA 3ZIVA 2I1UA 5IOXA 4NXIA 3HD5A 1OKDA 4AJ7A 4OMVA 1B9YC 3GSTA 3ZFBA 5HR0A 1ERUA 1VF2A 1OE8A 3VPTA 5ECMB 2E7PA 3KCMA 4ZL9A 1GTIA 2DC5A 4Q5RA 5D9XA 2R3XA 4ZL7A 1XWBA 2DKHA 2NTOA 2HRKA 2OA7A 3M0FA 3D4MA 5BMUA 1M7TA 3ZIJA 2LSTA 4PUAA 4RQRA 3M9JA 4TR4A 1PD21 2O7KA 2F9SA 3GKXA 2XPEA 1O8WA 1BG5A 2R0PA 3EMPA 5B6NA 4IP1A 1Z7PA 3BCKA 1QXHA 3KEBA 2CT6A 5J5NA 3N9JA 5JWQB 4H86A 1YF0A 3EE2A 1UC7A 4MABA 6GSUA 3UVHA 5GSTA 5IO0A 2GZYA 5F07A 3QMXA 5AISA 2HZEA 2YNXA 5B6MA 1WE0A 3R2QA 5E59A 3KP8A 5A4UA 5CAXA 5HR2A 1XW9A 3KMOA 3UBKA 3EINA 2A4VA 4IW9A 5COHA 3LXTA 1V2AA 4FQUA 1YZXA 3ZZXA 1T3BA 2FWFA 4G19A 5FWGA 2OE3A 3GTUA 3G7YA 3IDVA 1AXDA 2YV9A 3IC4A 3UMAA 1C72A 3A2VA 3P90A 2YWNA 10GSA 3KXOA 5H5SA 1ML6A 2X8GA 3KD0A 3UL3A 1EOHA 1M2AA 3QFBC 1QMVA 1A2JA 4LMVA 4CW9A 4KCEA 2CVBA 4XS6A 1JZRA 4K2XA 4ZB6A 3DEXA 4NMUA 2PWJA 4F9ZA 3RHCA 4MDCA 4N0VA 2F8FA 3FW2A 1TDIA 2ALBA 1VF1A 1GNWA 4YAVA 4FO5A 4TKYA 1QGVA 1TJDA 2AYTA 4ULXA 1K0MA 1MD4A 2JADA 2FWEA 4Z2TA 2X99A 5HFGA 5DALA 1PL1A 2X49A 3IRAA 3EVIA 3FZ9A 5KOWA 4MH3A 3QPMA 3TRXA 4KDYA 5F06A 2HE3A 13GSA 2P0GA 1A2MA 1T4ZA 4YQVA 3DWVA 3E3EA 1OAZA 1MTCA 2YPMA 5EY6A 1GSSA 3HXSA 3US3A 7GSSA 2VL2A 1GTUA 5HR1A 3H8QA 2CAIA 3F3QA 1Q4JA 4Z2RA 2IFQA 3TGZA 1GL8A 4BL7B 2CVDA 4WF5A 5IMAA 4K8MA 1BAYA 4JU5A 4EXJA 3DVWA 5A4VA 2QA1A 4AGSA 1ZYNA 5CRDA 4X4JA 5CO3A 4I97A 1ZYQB 4EUYA 1PN9A 5CREA 1ZGNA 2AUVA 1XOBA 5IMCA 3TRQA 1W4VA 4MP4A 1J08A 3C1SA 3GL3A 2I9HA 3ERFA 1EGRA 5F8BA 4F2IA 4N10A 3DGQA 4K6XA 6GSXA 3CXGA 3KH7A 4YH2A 3CSHA 2GGTA 3GA4A 3TUEA 3UVTA 2G0FA 2VL2C 2FWGA 3DXBA 3HJPA 2HSHA 2VCVA 4NV2A 1GRXA 2AJQB 1YF1A 1HNAA 3UARA 3BD2A 2FHEA 4POBA 3TKSC 2ZNMA 3H4KA 1SL0B 3IR4A 3D22A 2GLRA 1NSWA 3N5OA 2IN3A 1F3AA 2V32A 2DJJA 3VWXA 4MZBA 4KH7A 1O8XA 1YEPA 1VF3A 2K18A 2VLVA 1XW5A 1ACVA 3FRCA 5D73A 2I3YA 1JZOA 3EU3A 1AQXA 3NOFA 4IP6A 3G7IA 8GSSA 2VCXA 1X5EA 1RQMA 1G7EA 4HEA2 1OC9A 5E4WA 3IK9A 1Z7RA 3VLNA 18GSA 2DJ1A 2TIRA 5AIXA 2B5EA 5DCHA 1YDKA 4X1UA 1XWGA 1XIYA 4ZILA 2V6OA 1XWAA 3QCPA 2DMMA 2FCHA 4DSSA 3ZL5A 4ICYA 2H6ZA 3CMIA 4HZ2A 3NIVA 4WBJA 5A4WA 3UJ1A 4OO4A 4MJCA 3M9KA 4KX4A 4L0WA 2H19A 1E6BA 1M9BA 1ON4A 2XHFA 4MLYA 2R2JA 3L9UA 1ZCPA 2H1AA 2LQOA 1A0FA 1FOHA 1WPIA 3GV1A 2H1GA 2K9FA 1USBA 2YP6A 1WMJA 4YKGA 3VWVA 2C1YA 2DSAA 3KZQA 3I6AA 1FO5A 4YAPA 4IVFA 3HZ4A 2C8UA 2QA2A 4GRFA 2PPTA 2PERA 2PU9C 4ML1A 5GSSA 3IBHA 3VWWA 4RQXA 1TXXA 5ECOB 4XS4B 5KN1A 1M0UA 2X64A 3TJJA 4E8HA 1NHOA 3GL5A 2RIIA 2YWMA 3F6FA 2O85A 3QD9A 5DAKA 3TJGA 1GSQA 4TN8A 2JZSA 2LRTA 3S9FA 5KN0A 3Q74A 4NWYA 2PVOC 5C04A 1HQOA 3TJFA 1T8EB 3WGDA 1A24A 3GFKA 4IGJA 4V1Ag 4YKFA 1YKCA 4Q5FA 1TOFA 1T1VA 3ME7A 1U88A 2MBSA 1SJZA 4JR6A 5ECIB 3KGKA 3LORA 3M1GA 4OWYA 1N2AA 2CA8A 3RHBA 2H1BA 3HYPA 3C7MA 4ZL8A 4IHUA 4MF7A 3IHGA 1XW6A 5HFKA 4BWQA 1PX6A 2AB6A 4PTSA 1EV9A 2CZ2A 3I9V2 3FK8A 5ELAA 1K0OA 5IMFA 1XPVA 1PRXA 2B7KA 6GSYA 2BTOT 1R4WA 4IBPA 3HVSA 3FZ5A 2H74A 3LJRA 2HXKA 1ZZYA 3CRTA 1TRUA 2AHEA 2RUFA 4Z2UA 4PNFA 2NBSA 4XRDA 4V2MA 3TOUA 2H76A 2GQKA 4LL4B 2KP2A 4K1FA 1Y6EA 3EMXA 3O76A 2V2GA 5G5FA 5FHIA 1AIUA 2VLTA 14GSA 4GTUA 1GWCA 1THOA 4XTSA 5ECRB 2GZPA 2VM1A 1YQ1A 3SWLA 2PN8A 2LQQA 2C0FA 2YV7A 2WB9A 4TXOB 2C0EA 1PA3A 2GZZA 2LNSA 1A8YA 3GYKA 2L6DA 2YOIA 4OD7A 3CTGA 1K3LA 4G0KA 5LCZA 2H66A 4TR1A 3Q6OA 4PQ1A 3QR6A 1GUHA 5IM9A 3WT1A 4EE0A 2LNTA 2QSIA 1DBYA 1PX7A 2XPDA 5DQYA 4WF4A 1LJRA 3TKQA 4XRAA 2JU5A 1JZDA 4PGTA 4HI7A 3RPNA 3EU4A 3FEUA 3LWAA 2OBKA 3DYRA 3WGXA 1DUGA 2GSRA 1A23A 1OYJA 4GWRA 9GSSA 3IAM2 4MJEA 4PUFC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VCW A;  3AY8 A;  2EIQ A;  2H70 A;  1K0C A;  4E8E A;  1UVZ A;  3ISO A;  17GS A;  2PVQ A;  4ZBB A;  1M2D A;  3KJY A;  2GSS A;  1O7U A;  2I81 A;  3LXZ A;  2OE1 A;  4HU9 A;  5J9C A;  1X9W B;  2H1D A;  1FB0 A;  2V41 A;  1TRV A;  3QAG A;  1J9B A;  5EPF A;  2NDO A;  4HQS A;  4F0C A;  4L5O A;  5AN1 A;  2VO4 A;  1VRS D;  1PMT A;  5IPH A;  3F4R A;  3HDC A;  3ZLP A;  3ZYW A;  3UAP A;  3LEF A;  2L4C A;  4TW5 A;  19GS A;  1KEB A;  2GTU A;  1AW9 A;  1B8X A;  2PGT A;  5KN2 A;  1FAA A;  4KDX A;  5D8I A;  3ERG A;  1JLW A;  5D9W A;  4DVC A;  4MH2 A;  3VK9 A;  3APQ A;  5GAP D;  2M46 A;  1XBS A;  4IQ1 A;  4P3Y B;  1XWC A;  1TI1 A;  3K8N A;  4BWS A;  2N5F A;  3LQ7 A;  3ME8 A;  3BOA A;  3G7J A;  3HCZ A;  1ABA A;  4J56 E;  4F82 A;  4G10 A;  4IJI A;  4JR4 A;  4QQ7 A;  1U3I A;  4WET A;  2B1K A;  4WR4 A;  2YJ7 A;  1AAZ A;  4PQI A;  5D9T A;  4PQH A;  1YEX A;  3FY7 A;  2HNL A;  4I2U A;  4V1A p;  1M2B A;  2ZCT A;  2CQ9 A;  1X5D A;  3A2W A;  1O73 A;  4D73 B;  1A2L A;  1DSB A;  2L57 A;  2IPA A;  1JLV A;  2YWO A;  3D6I A;  2TRX A;  4K7N A;  2AV4 A;  2I4A A;  2DML A;  1IYH A;  2BMX A;  4JZQ A;  3QFA C;  5IMD A;  12GS A;  2X8C A;  1V40 A;  4LLR A;  2IME A;  3F8U A;  4POK A;  2MMO A;  4NV5 A;  5CRW A;  4WBR D;  1Z9H A;  4GQF A;  2GT6 A;  3H93 A;  3I69 A;  4DSR A;  2DJ0 A;  3ZRD A;  5G2Z A;  4MA9 A;  4MF6 A;  1OC8 A;  1FB6 A;  1MD3 A;  3J7Y b;  4MF5 A;  1OC9 B;  2FGX A;  5CNW A;  1FVK A;  2PUK C;  2H8L A;  4HJ2 A;  3VFI A;  5H5Q A;  1SL1 B;  2DBC A;  1SEN A;  1V9W A;  2GSQ A;  1GTB A;  3L9S A;  2L5L A;  1SU9 A;  4GSS A;  4ZB8 A;  3L0H A;  3CTF A;  2VCQ A;  4DSS B;  1OKT A;  1YKA A;  5IMZ A;  4MMM A;  3TKS A;  2JZR A;  3KM6 A;  2FLS A;  4K0N A;  3HA9 A;  1F37 A;  2YN1 A;  2F3M A;  4XIH A;  4EO3 A;  2WUL A;  5ECK B;  2K8V A;  1VF4 A;  1GP1 A;  3ED3 A;  1ZMA A;  1ILO A;  5L71 A;  3M8N A;  4ZIJ A;  1SD8 A;  5ID2 B;  2N5B A;  5ECL B;  2YAN A;  4MPG A;  4YQU A;  3ZVJ D;  2B5Y A;  2CAQ A;  4ECC A;  4NHZ A;  2MBT A;  2O8V B;  2F51 A;  3KP9 A;  5IQY A;  1PL2 A;  3EC3 A;  4V2L A;  2H0H A;  2A2R A;  2LJR A;  5H5R A;  1XZO A;  3D21 A;  2MMZ A;  4ISD A;  1CQG A;  1KNG A;  3GNJ A;  2C3T A;  3TJB A;  1W89 A;  3DIE A;  4JE1 A;  1S3A A;  4FYU A;  2C0G A;  1BJX A;  1A8L A;  3APO A;  1PGT A;  2RM6 A;  1SKS B;  1NHY A;  3HKR A;  2O89 A;  5LD0 A;  4HOJ A;  1CQH A;  1O6J A;  4WR5 A;  1UA5 A;  3PH9 A;  1THX A;  3GKN A;  5B8A A;  1F6M C;  2WFC A;  5HR3 A;  5J3R A;  2G2Q A;  1TK8 B;  3E9J B;  2K6V A;  4L0U A;  1U87 A;  3L78 A;  1GSD A;  2GST A;  1S3C A;  1GLP A;  3GUR A;  4BVY A;  1OC3 A;  3UIW A;  1GSE A;  2LJA A;  4RUV A;  3IV4 A;  3CYN A;  1GTA A;  3O6T A;  1GSY A;  1DE2 A;  5INY A;  2XBQ A;  1QK8 A;  4MZC A;  1FG4 A;  1GSU A;  2H0G A;  4HDE A;  1HNB A;  2IMD A;  2WCI A;  1SD9 A;  4FYB A;  1PQN A;  5G31 A;  3F0I A;  4PXO A;  2LEG A;  3KH9 A;  3IXR A;  4BVX A;  2DLX A;  3I43 A;  2C4J A;  1HD2 A;  3TKP A;  1U6T A;  4F03 A;  3IK7 A;  2J9H A;  4Z7X A;  4I5Q A;  4IEL A;  1XWK A;  2M80 A;  4POL A;  3L4N A;  3ZTL A;  1XVQ A;  4TR1 B;  1R7H A;  4JBB A;  3GMF A;  2HLS A;  5F05 A;  4KAE A;  6GST A;  4GQC A;  1NW2 A;  1Z6M A;  3L9V A;  1ERT A;  4KB3 A;  2K8S A;  1LU4 A;  5DVB A;  5G1L A;  2OAD A;  3Q18 A;  3FKF A;  5IMV A;  4ZBD A;  2GVP A;  3VI5 A;  4FIW A;  2FD3 A;  1EZK A;  4KCA A;  3DD3 A;  4HS1 A;  1EEM A;  1MDJ A;  2WRT A;  2IMK A;  1MDK A;  3GH9 A;  6GSW A;  16GS A;  3JCM L;  3IHQ A;  2MMN A;  1BX9 A;  2LUS A;  1T4Y A;  2JZT A;  1WJK A;  4CDO A;  1BED A;  2IWT A;  1TTZ A;  1TP9 A;  4MZW A;  2YJH A;  3UEM A;  5G30 A;  1FHE A;  5LNK e;  1WP0 A;  3CRU A;  3U6V A;  4EDY A;  4EVM A;  3DRN A;  2VCZ A;  4OCF A;  2QKE A;  3O3T A;  4IS0 A;  1K0B A;  3RDW A;  1RW1 A;  1XXU A;  1H4O A;  3H79 A;  4KW6 A;  1HYU A;  4K0G A;  1AQV A;  22GS A;  3V1W A;  2DIZ A;  2YZH A;  2WJU A;  3P2A A;  3HJM A;  1EP8 A;  1FOV A;  3GX8 A;  3WD6 A;  1V57 A;  1GLQ A;  2L4Q A;  4I8B A;  1EWX A;  2HZE B;  1OE7 A;  5J41 A;  3C1R A;  4K2D A;  2F8A A;  3GN3 A;  5CRH A;  3TKS E;  1SL2 B;  2IJY A;  1SYR A;  5G1K A;  4EC0 A;  3A2X A;  5ECS A;  2C0D A;  4MJB A;  4KE3 A;  1WOU A;  3ZFL A;  3HVV A;  1V98 A;  5B7C A;  2L59 A;  2HT9 A;  2IIY A;  3F6D A;  4V2N A;  4Q5Q A;  2FA8 A;  2NVL A;  5ECN B;  5B8B A;  2HRN A;  3GTU B;  3GKM A;  4NPB A;  1K0D A;  2O87 A;  5D96 A;  4NHW A;  1ZYE A;  2EC4 A;  5KN3 A;  3P7X A;  5HQP A;  1I9D A;  4MK3 A;  4OO5 A;  5GZZ B;  2R37 A;  3Q19 A;  4HQZ A;  4KGI A;  3DVX A;  3W6G A;  1X9S B;  4OFM A;  5ECP B;  4DSQ A;  4I6X A;  5IIZ A;  1JFU A;  2YCD A;  4CHS A;  3IOS A;  3ZVJ A;  5DCG A;  2HRF A;  4N0Z A;  1EGO A;  3J7Y k;  4ZB9 A;  3H1N A;  4XS1 A;  5EL8 A;  4TOP A;  5DQS A;  2E0Q A;  4FH8 A;  2J23 A;  3F3R A;  1NM3 A;  4DEJ A;  3GH6 A;  5DAL B;  4O7H A;  1AQW A;  2VAF A;  2LS5 A;  2RLI A;  2CZ3 A;  3C71 A;  3BCI A;  3CSJ A;  4WKW A;  2N5A A;  2R5G A;  3IA1 A;  2JSY A;  1ZL9 A;  1VGL A;  2X8H A;  2H6X A;  4IKH A;  1SKW B;  2B1L A;  2B3S A;  2C3Q A;  2H73 A;  3DML A;  3M3M A;  4K9Z A;  4X0X A;  3QAV A;  4EKZ A;  1ZOF A;  3VPQ A;  5ECQ B;  1B48 A;  1O85 A;  1PKZ A;  3GX0 A;  4N30 A;  4BA7 A;  4AJ6 A;  3D4T A;  4HUA A;  2H71 A;  2R4V A;  1URM A;  2WS2 A;  1K3Y A;  1XCC A;  5ENU A;  2IFQ B;  1U3A A;  4G9H A;  4LL1 B;  3WT2 A;  3IPZ A;  4KA0 A;  1MEK A;  1F3B A;  1G0T A;  3C8E A;  4J2F A;  3UOM A;  3EWL A;  3LSZ A;  3D0Z A;  4TXO A;  2ES7 A;  1M99 A;  3VI7 A;  2CX4 A;  3UBL A;  2GT5 A;  4KSM A;  2H01 A;  1TRW A;  4TRX A;  2KOK A;  2FY6 A;  1B9X C;  5IOW A;  2GDR A;  2HFD A;  1HNC A;  3TJK A;  5J4U A;  2B5X A;  2P5R A;  2H0I A;  1PKW A;  2LJK A;  2LRN A;  2MYG A;  3HY2 A;  3TDG A;  4TR3 A;  3LYK A;  5DBQ A;  1T00 A;  1G7O A;  2H72 A;  2P31 A;  4ACS A;  1B4P A;  5AGY A;  3TRP A;  3GKK A;  3QDN A;  2Z9S A;  2VCT A;  2VOC A;  2VLU A;  2FA4 A;  2DIY A;  1EOG A;  3KTB A;  5C00 A;  2OJL A;  2L5O A;  3ZRE A;  3TCO A;  4IQA A;  1Z5Y E;  4J57 E;  2FWH A;  1SKR B;  1TKD B;  1TK0 B;  2V6K A;  2DJ2 A;  2OBI A;  3F9U A;  1G6W A;  1AUC A;  2CVK A;  2YWI A;  2HYX A;  4EF0 A;  3FZ4 A;  4L8E A;  2WZ9 A;  5JWR B;  2HI7 A;  1YY7 A;  4POM A;  4Q5N A;  3LYP A;  3FZA A;  3G9B A;  1N8J A;  4X43 A;  2P5Q A;  1QQ2 A;  1SYX A;  5KEJ A;  2E2G A;  2WGR A;  2FNO A;  2VD0 A;  2B6M A;  1Z6N A;  1R5A A;  2OAC A;  4KSO A;  4OCE A;  1ST9 A;  4IJ3 A;  3QOU A;  1F9M A;  2H30 A;  4O92 A;  2D2Z A;  1XFL A;  3SBC A;  2DJK A;  2OKA A;  2MMA A;  2REM A;  1X9M B;  2KHP A;  1R5P A;  4GSN A;  2LRC A;  2V1M A;  4TR0 A;  3FR6 A;  1TRS A;  4OFT A;  3PIN A;  4YQM A;  3VWU A;  1DE1 A;  5EVO A;  1KTE A;  2HZF A;  2A2S A;  2GS3 A;  4HZ4 A;  4GLT A;  2JSZ A;  3ZIT A;  5IPG A;  4ILF A;  1FVJ A;  2IL3 A;  3F4S A;  2E2M A;  5FT3 A;  3ZML A;  5DAK B;  5ELG A;  1BYE A;  3EUR A;  3RBT A;  2ON7 A;  3D5J A;  3FHK A;  4K7O A;  1XOA A;  4ECJ A;  4XCS A;  4F0B A;  2VL9 A;  4D73 A;  1TI3 A;  3MAK A;  4O5R A;  3IE3 A;  2IMI A;  1WWJ A;  3DKS A;  2QC7 A;  4NAX A;  2C80 A;  1T7P B;  4PX1 A;  1GUL A;  2LKU A;  3ERW A;  1K0N A;  3HJO A;  5ECH B;  3GHA A;  1M9A A;  5F0G A;  5A5K A;  2CV4 A;  2C3N A;  4GXZ A;  3KMN A;  1Y25 A;  3HVX A;  2PMT A;  1B4Q A;  1GUM A;  5AIV A;  3W8J A;  3E0U A;  4KUN A;  4MCU A;  4PNG A;  3QAW A;  4JED A;  3FYG A;  4LA1 A;  4XHM A;  1EEJ A;  2JL4 A;  3BBY A;  4GF0 A;  1GSF A;  4BL7 A;  2CX3 A;  2H6Y A;  3IAS 2;  4JRR A;  4LMW A;  1Q98 A;  2KP1 A;  5GAN D;  3GIX A;  4QL7 A;  4ML6 A;  4RI7 A;  3CBU A;  1UN2 A;  2ON5 A;  3W8S A;  1BQ7 A;  2NPB A;  4AF2 A;  3A5W A;  2RUE A;  5JCW A;  4AJ8 A;  4TVE A;  2VD1 A;  3FR9 A;  4EDZ A;  1AC1 A;  2HSY A;  5ID2 A;  1G6Y A;  2PBJ A;  4BPY A;  3HZ8 A;  4IN0 A;  2YZU A;  4WEY A;  1J0F A;  1I5G A;  4ID0 A;  4EL1 A;  5J9B A;  4WXT A;  2ZUP A;  1ERW A;  4ECI A;  1K3O A;  2GQM A;  3F4T A;  1GNE A;  1WRY A;  3MNG A;  4OFN A;  5DDL A;  4KDU A;  1EP7 A;  4I2T A;  3KTL A;  4G2E A;  3TOT A;  1Z3E A;  5DJM A;  5CP1 A;  4O32 A;  5JWO B;  3C73 A;  1SK2 A;  2WDU A;  3MSZ A;  2LTK A;  5CYY A;  1K0A A;  2QGV A;  3PR8 A;  3U5R E;  2FUG 2;  1SJ6 A;  1ERV A;  3WGE A;  4QL9 A;  4GST A;  3WYW A;  1WIK A;  4RI6 A;  2BJX A;  2LV3 A;  3CSI A;  1A0R P;  4N11 A;  20GS A;  2XC2 A;  5G5E A;  2VUP A;  1LBK A;  3VUR A;  2XBI A;  2B7J A;  1TW9 A;  2VM2 A;  5HFI A;  3LGC A;  3P8W A;  1EV4 A;  2AAW A;  4L5L A;  1V58 A;  5JCU A;  4MPF A;  4ECB A;  5CRG A;  1RK4 A;  3FR3 A;  1TK5 B;  3LFL A;  1IYI A;  4ZXG A;  3TKR A;  1OVN A;  4TXV A;  1QUW A;  1MDI A;  3GSS A;  4HU7 A;  2MZC A;  1H75 A;  1SK0 A;  3APS A;  2OE0 A;  4GCI A;  4K7I A;  4HJM A;  2VIM A;  1X0R A;  3OR5 A;  2TRC P;  1QFN A;  1JHB A;  3RPP A;  3MWH A;  1TU8 A;  1FW1 A;  1GH2 A;  2L6C A;  5JCG A;  1KBN A;  6GSS A;  2RM5 A;  3TB2 A;  1SJI A;  4ZBA A;  2H75 A;  3HHV A;  4KND A;  1PSQ A;  6GSV A;  3GRX A;  3BJ5 A;  3A3T A;  1XVW A;  1GUK A;  3EYT A;  4PUR A;  4FYC A;  2JAC A;  2IMF A;  5ABR A;  5DJL A;  2DJ3 A;  1JZW A;  1E2Y A;  4XS4 A;  4MJA A;  2KUC A;  5D93 A;  3ZMK A;  3GUS A;  2KLX A;  3KIJ A;  1S3D A;  2EIR A;  3PGT A;  2VL3 A;  1R26 A;  2R6K A;  3RAZ A;  5IO2 A;  1X5C A;  1F2E A;  3F63 A;  1O81 A;  1TU7 A;  3LG6 A;  2M72 A;  11GS A;  3MDK A;  5D9V A;  1YJ6 A;  1SK1 A;  2EIO A;  2GQL A;  3NZN A;  3ZIV A;  2I1U A;  5IOX A;  4NXI A;  3HD5 A;  1OKD A;  4AJ7 A;  4OMV A;  1B9Y C;  3GST A;  3ZFB A;  5HR0 A;  1ERU A;  1VF2 A;  1OE8 A;  3VPT A;  5ECM B;  2E7P A;  3KCM A;  4ZL9 A;  1GTI A;  2DC5 A;  4Q5R A;  5D9X A;  2R3X A;  4ZL7 A;  1XWB A;  2NTO A;  2OA7 A;  3M0F A;  3D4M A;  1M7T A;  3ZIJ A;  2LST A;  4PUA A;  4RQR A;  3M9J A;  4TR4 A;  1PD2 1;  2O7K A;  2F9S A;  3GKX A;  2XPE A;  1O8W A;  1BG5 A;  3EMP A;  5B6N A;  4IP1 A;  1Z7P A;  3BCK A;  1QXH A;  3KEB A;  2CT6 A;  5J5N A;  3N9J A;  5JWQ B;  4H86 A;  1YF0 A;  3EE2 A;  1UC7 A;  4MAB A;  6GSU A;  3UVH A;  5GST A;  5IO0 A;  2GZY A;  5F07 A;  3QMX A;  5AIS A;  2HZE A;  2YNX A;  5B6M A;  1WE0 A;  3R2Q A;  5E59 A;  3KP8 A;  5A4U A;  5CAX A;  5HR2 A;  1XW9 A;  3KMO A;  3UBK A;  3EIN A;  2A4V A;  4IW9 A;  5COH A;  3LXT A;  1V2A A;  1YZX A;  3ZZX A;  1T3B A;  2FWF A;  4G19 A;  5FWG A;  2OE3 A;  3GTU A;  3G7Y A;  3IDV A;  1AXD A;  2YV9 A;  3IC4 A;  3UMA A;  1C72 A;  3A2V A;  3P90 A;  2YWN A;  10GS A;  3KXO A;  5H5S A;  1ML6 A;  2X8G A;  3KD0 A;  3UL3 A;  1EOH A;  1M2A A;  3QFB C;  1QMV A;  1A2J A;  4LMV A;  4CW9 A;  4KCE A;  2CVB A;  4XS6 A;  1JZR A;  4ZB6 A;  3DEX A;  4NMU A;  2PWJ A;  4F9Z A;  3RHC A;  4MDC A;  4N0V A;  2F8F A;  3FW2 A;  1TDI A;  2ALB A;  1VF1 A;  1GNW A;  4YAV A;  4FO5 A;  4TKY A;  1QGV A;  1TJD A;  2AYT A;  4ULX A;  1K0M A;  1MD4 A;  2JAD A;  2FWE A;  2X99 A;  5HFG A;  5DAL A;  1PL1 A;  3IRA A;  3EVI A;  3FZ9 A;  4MH3 A;  3QPM A;  3TRX A;  4KDY A;  5F06 A;  2HE3 A;  13GS A;  2P0G A;  1A2M A;  1T4Z A;  4YQV A;  3DWV A;  3E3E A;  1OAZ A;  1MTC A;  2YPM A;  5EY6 A;  1GSS A;  3HXS A;  3US3 A;  7GSS A;  2VL2 A;  1GTU A;  5HR1 A;  3H8Q A;  2CAI A;  3F3Q A;  1Q4J A;  2IFQ A;  3TGZ A;  1GL8 A;  2CVD A;  4WF5 A;  5IMA A;  4K8M A;  1BAY A;  4JU5 A;  4EXJ A;  3DVW A;  5A4V A;  4AGS A;  5CRD A;  5CO3 A;  4I97 A;  1ZYQ B;  4EUY A;  1PN9 A;  5CRE A;  1ZGN A;  2AUV A;  1XOB A;  5IMC A;  3TRQ A;  1W4V A;  4MP4 A;  1J08 A;  3C1S A;  3GL3 A;  2I9H A;  3ERF A;  1EGR A;  5F8B A;  4F2I A;  4N10 A;  3DGQ A;  4K6X A;  6GSX A;  3CXG A;  3KH7 A;  4YH2 A;  3CSH A;  2GGT A;  3GA4 A;  3TUE A;  3UVT A;  2G0F A;  2VL2 C;  2FWG A;  3DXB A;  3HJP A;  2HSH A;  2VCV A;  4NV2 A;  1GRX A;  2AJQ B;  1YF1 A;  1HNA A;  3UAR A;  3BD2 A;  2FHE A;  4POB A;  3TKS C;  2ZNM A;  3H4K A;  1SL0 B;  3IR4 A;  3D22 A;  2GLR A;  1NSW A;  3N5O A;  2IN3 A;  1F3A A;  2V32 A;  2DJJ A;  3VWX A;  4MZB A;  4KH7 A;  1O8X A;  1YEP A;  1VF3 A;  2K18 A;  2VLV A;  1XW5 A;  1ACV A;  3FRC A;  5D73 A;  2I3Y A;  1JZO A;  3EU3 A;  1AQX A;  3NOF A;  4IP6 A;  3G7I A;  8GSS A;  2VCX A;  1X5E A;  1RQM A;  1G7E A;  4HEA 2;  1OC9 A;  5E4W A;  3IK9 A;  1Z7R A;  3VLN A;  18GS A;  2DJ1 A;  2TIR A;  5AIX A;  2B5E A;  5DCH A;  1YDK A;  4X1U A;  1XWG A;  1XIY A;  4ZIL A;  2V6O A;  1XWA A;  3QCP A;  2DMM A;  2FCH A;  4DSS A;  3ZL5 A;  2H6Z A;  3CMI A;  4HZ2 A;  3NIV A;  4WBJ A;  5A4W A;  3UJ1 A;  4OO4 A;  4MJC A;  3M9K A;  4KX4 A;  4L0W A;  2H19 A;  1E6B A;  1M9B A;  1ON4 A;  2XHF A;  4MLY A;  2R2J A;  3L9U A;  1ZCP A;  2H1A A;  2LQO A;  1A0F A;  1WPI A;  3GV1 A;  2H1G A;  2K9F A;  1USB A;  2YP6 A;  1WMJ A;  3VWV A;  2C1Y A;  2DSA A;  3KZQ A;  3I6A A;  1FO5 A;  4YAP A;  4IVF A;  3HZ4 A;  2C8U A;  4GRF A;  2PPT A;  2PER A;  2PU9 C;  4ML1 A;  5GSS A;  3IBH A;  3VWW A;  4RQX A;  1TXX A;  5ECO B;  4XS4 B;  5KN1 A;  1M0U A;  2X64 A;  3TJJ A;  4E8H A;  1NHO A;  3GL5 A;  2RII A;  2YWM A;  3F6F A;  2O85 A;  3QD9 A;  5DAK A;  3TJG A;  1GSQ A;  4TN8 A;  2JZS A;  2LRT A;  3S9F A;  5KN0 A;  3Q74 A;  4NWY A;  2PVO C;  5C04 A;  1HQO A;  3TJF A;  1T8E B;  3WGD A;  1A24 A;  3GFK A;  4IGJ A;  4V1A g;  1YKC A;  4Q5F A;  1TOF A;  1T1V A;  3ME7 A;  1U88 A;  2MBS A;  1SJZ A;  4JR6 A;  5ECI B;  3KGK A;  3LOR A;  3M1G A;  4OWY A;  1N2A A;  2CA8 A;  3RHB A;  2H1B A;  3HYP A;  3C7M A;  4ZL8 A;  4IHU A;  4MF7 A;  1XW6 A;  5HFK A;  4BWQ A;  1PX6 A;  2AB6 A;  1EV9 A;  2CZ2 A;  3I9V 2;  3FK8 A;  5ELA A;  1K0O A;  5IMF A;  1XPV A;  1PRX A;  2B7K A;  6GSY A;  2BTO T;  1R4W A;  4IBP A;  3HVS A;  3FZ5 A;  2H74 A;  3LJR A;  2HXK A;  1ZZY A;  3CRT A;  1TRU A;  2AHE A;  2RUF A;  4PNF A;  2NBS A;  4XRD A;  4V2M A;  3TOU A;  2H76 A;  2GQK A;  4LL4 B;  2KP2 A;  4K1F A;  1Y6E A;  3EMX A;  3O76 A;  2V2G A;  5G5F A;  5FHI A;  1AIU A;  2VLT A;  14GS A;  4GTU A;  1GWC A;  1THO A;  4XTS A;  5ECR B;  2GZP A;  2VM1 A;  1YQ1 A;  3SWL A;  2PN8 A;  2LQQ A;  2C0F A;  2YV7 A;  2WB9 A;  4TXO B;  2C0E A;  1PA3 A;  2GZZ A;  2LNS A;  1A8Y A;  3GYK A;  2L6D A;  2YOI A;  4OD7 A;  3CTG A;  1K3L A;  5LCZ A;  2H66 A;  4TR1 A;  3Q6O A;  4PQ1 A;  3QR6 A;  1GUH A;  5IM9 A;  3WT1 A;  4EE0 A;  2LNT A;  2QSI A;  1DBY A;  1PX7 A;  2XPD A;  5DQY A;  4WF4 A;  1LJR A;  3TKQ A;  4XRA A;  2JU5 A;  1JZD A;  4PGT A;  4HI7 A;  3RPN A;  3EU4 A;  3FEU A;  3LWA A;  2OBK A;  3DYR A;  3WGX A;  1DUG A;  2GSR A;  1A23 A;  1OYJ A;  4GWR A;  9GSS A;  3IAM 2;  4MJE A;  4PUF C; 
#chains in the Genus database with same CATH topology
 2VCW A;  3IC8 A;  3AY8 A;  2EIQ A;  2H70 A;  1K0C A;  4E8E A;  1UVZ A;  3ISO A;  17GS A;  2PVQ A;  4ZBB A;  1M2D A;  3KJY A;  2GSS A;  1O7U A;  2I81 A;  3LXZ A;  2OE1 A;  4HU9 A;  5J9C A;  1X9W B;  2H1D A;  1FB0 A;  2V41 A;  1TRV A;  3QAG A;  1J9B A;  5EPF A;  2NDO A;  4HQS A;  4F0C A;  4L5O A;  5AN1 A;  2VO4 A;  1VRS D;  1PMT A;  5IPH A;  3F4R A;  3HDC A;  3ZLP A;  3ZYW A;  3UAP A;  3LEF A;  2L4C A;  4TW5 A;  19GS A;  1KEB A;  2GTU A;  1AW9 A;  1B8X A;  2PGT A;  5KN2 A;  1FAA A;  4KDX A;  5D8I A;  3ERG A;  1JLW A;  5D9W A;  4DVC A;  4MH2 A;  3VK9 A;  3APQ A;  5GAP D;  2M46 A;  1XBS A;  4IQ1 A;  4P3Y B;  1XWC A;  1TI1 A;  3K8N A;  4BWS A;  2N5F A;  3LQ7 A;  3ME8 A;  3BOA A;  3G7J A;  3HCZ A;  1ABA A;  4J56 E;  4F82 A;  4G10 A;  4IJI A;  4JR4 A;  4QQ7 A;  1U3I A;  4WET A;  2B1K A;  4WR4 A;  2YJ7 A;  1AAZ A;  4PQI A;  5D9T A;  4PQH A;  1YEX A;  3FY7 A;  3LW9 A;  2HNL A;  4I2U A;  4V1A p;  1M2B A;  2ZCT A;  2CQ9 A;  1X5D A;  3A2W A;  1O73 A;  4D73 B;  1A2L A;  1DSB A;  2L57 A;  2IPA A;  4EIQ A;  1JLV A;  3FMW A;  2YWO A;  3D6I A;  2TRX A;  4K7N A;  2AV4 A;  2X4A A;  2I4A A;  2DML A;  1IYH A;  2BMX A;  4JZQ A;  3QFA C;  4G0L A;  5IMD A;  12GS A;  2X8C A;  1V40 A;  4LLR A;  2IME A;  3F8U A;  4POK A;  2MMO A;  4NV5 A;  5CRW A;  4WBR D;  1Z9H A;  4GQF A;  3MYD A;  2GT6 A;  3H93 A;  3I69 A;  4DSR A;  2DJ0 A;  3ZRD A;  5G2Z A;  4MA9 A;  4MF6 A;  1OC8 A;  1FB6 A;  1MD3 A;  3J7Y b;  4MF5 A;  1OC9 B;  2FGX A;  5CNW A;  1FVK A;  2PUK C;  2H8L A;  4HJ2 A;  3VFI A;  5H5Q A;  1SL1 B;  2DBC A;  1SEN A;  1V9W A;  2GSQ A;  1GTB A;  3L9S A;  2L5L A;  1SU9 A;  4GSS A;  4ZB8 A;  3L0H A;  3CTF A;  2VCQ A;  4DSS B;  1OKT A;  1YKA A;  5IMZ A;  4MMM A;  3TKS A;  2JZR A;  3KM6 A;  2FLS A;  4K0N A;  3HA9 A;  1F37 A;  2YN1 A;  2F3M A;  4XIH A;  4EO3 A;  2WUL A;  5ECK B;  2K8V A;  1VF4 A;  1GP1 A;  3ED3 A;  1ZMA A;  1ILO A;  5L71 A;  1S3R A;  3M8N A;  4ZIJ A;  1SD8 A;  5ID2 B;  2N5B A;  5ECL B;  2YAN A;  4MPG A;  4YQU A;  3ZVJ D;  1PFO A;  2B5Y A;  2CAQ A;  3HVN A;  4ECC A;  4NHZ A;  2MBT A;  2R0G A;  2O8V B;  2F51 A;  3KP9 A;  2HRA A;  5IQY A;  1PL2 A;  3EC3 A;  4V2L A;  2H0H A;  4K5R A;  2A2R A;  2LJR A;  5H5R A;  1XZO A;  3D21 A;  2MMZ A;  4ISD A;  1CQG A;  1KNG A;  3GNJ A;  2C3T A;  3TJB A;  1W89 A;  1M3J A;  3DIE A;  4JE1 A;  1S3A A;  4K5S A;  4FYU A;  2C0G A;  1BJX A;  1A8L A;  3APO A;  1PGT A;  2RM6 A;  1SKS B;  1NHY A;  3HKR A;  2O89 A;  5LD0 A;  4HOJ A;  1CQH A;  1O6J A;  4WR5 A;  1UA5 A;  3PH9 A;  1THX A;  3GKN A;  5B8A A;  1F6M C;  2WFC A;  5HR3 A;  5J3R A;  2G2Q A;  1TK8 B;  3E9J B;  2K6V A;  4L0U A;  1U87 A;  3L78 A;  1GSD A;  2GST A;  1S3C A;  1GLP A;  3GUR A;  4BVY A;  3R3E A;  1OC3 A;  3UIW A;  1GSE A;  2LJA A;  4RUV A;  3IV4 A;  3CYN A;  1GTA A;  3O6T A;  1GSY A;  1DE2 A;  5INY A;  3MIX A;  2XBQ A;  1QK8 A;  4MZC A;  1FG4 A;  1GSU A;  2H0G A;  4HDE A;  1HNB A;  2IMD A;  2WCI A;  1SD9 A;  4FYB A;  1PQN A;  5G31 A;  3F0I A;  4PXO A;  2LEG A;  3KH9 A;  3IXR A;  4BVX A;  2DLX A;  3I43 A;  2C4J A;  1HD2 A;  3TKP A;  1U6T A;  4F03 A;  3IK7 A;  2J9H A;  4Z7X A;  4I5Q A;  4IEL A;  1XWK A;  2M80 A;  4POL A;  3L4N A;  3ZTL A;  1XVQ A;  4TR1 B;  1R7H A;  4JBB A;  3GMF A;  2HLS A;  5F05 A;  4KAE A;  6GST A;  4GQC A;  1NW2 A;  1Z6M A;  3L9V A;  1ERT A;  4KB3 A;  2K8S A;  1LU4 A;  5DVB A;  5G1L A;  2OAD A;  3Q18 A;  3FKF A;  5IMV A;  4ZBD A;  2GVP A;  3VI5 A;  4FIW A;  2FD3 A;  1EZK A;  4KCA A;  3DD3 A;  4HS1 A;  1EEM A;  1MDJ A;  2WRT A;  2IMK A;  1MDK A;  3GH9 A;  6GSW A;  16GS A;  3JCM L;  3IHQ A;  2MMN A;  1BX9 A;  2LUS A;  1T4Y A;  2JZT A;  1WJK A;  4CDO A;  1BED A;  2IWT A;  1TTZ A;  1TP9 A;  4MZW A;  2YJH A;  3UEM A;  5G30 A;  1FHE A;  5LNK e;  1WP0 A;  3CRU A;  3U6V A;  4EDY A;  4EVM A;  3DRN A;  2VCZ A;  4OCF A;  2QKE A;  4KF9 A;  3O3T A;  4IS0 A;  1K0B A;  3RDW A;  1RW1 A;  1XXU A;  1H4O A;  3H79 A;  4KW6 A;  1HYU A;  4K0G A;  1AQV A;  22GS A;  3V1W A;  2DIZ A;  2YZH A;  2WJU A;  3P2A A;  3HJM A;  1EP8 A;  1FOV A;  3GX8 A;  3WD6 A;  1V57 A;  1GLQ A;  2L4Q A;  4I8B A;  1EWX A;  2HZE B;  1OE7 A;  5J41 A;  3C1R A;  4K2D A;  2F8A A;  3GN3 A;  5CRH A;  3TKS E;  1SL2 B;  5KOX A;  2IJY A;  1SYR A;  5G1K A;  4EC0 A;  3A2X A;  5ECS A;  2C0D A;  4MJB A;  4KE3 A;  1WOU A;  3ZFL A;  3HVV A;  1V98 A;  5B7C A;  2L59 A;  2HT9 A;  2IIY A;  3F6D A;  4V2N A;  4Q5Q A;  2FA8 A;  2NVL A;  5ECN B;  5B8B A;  2HRN A;  3GTU B;  3GKM A;  2UZ8 A;  4NPB A;  1K0D A;  2O87 A;  5D96 A;  4NHW A;  1ZYE A;  2EC4 A;  5KN3 A;  3P7X A;  5HQP A;  1I9D A;  4MK3 A;  4OO5 A;  5GZZ B;  2R37 A;  3Q19 A;  4HQZ A;  4KGI A;  3DVX A;  3W6G A;  1X9S B;  4OFM A;  5ECP B;  4DSQ A;  2R0C A;  4I6X A;  5IIZ A;  1JFU A;  2YCD A;  4CHS A;  3IOS A;  3ZVJ A;  5DCG A;  2HRF A;  4N0Z A;  1EGO A;  3J7Y k;  4ZB9 A;  3H1N A;  4XS1 A;  5EL8 A;  4TOP A;  1XG8 A;  5DQS A;  2E0Q A;  4FH8 A;  2J23 A;  3F3R A;  1NM3 A;  4DEJ A;  3GH6 A;  5DAL B;  4CY8 A;  4O7H A;  1AQW A;  2VAF A;  2LS5 A;  2RLI A;  2CZ3 A;  3C71 A;  3BCI A;  3CSJ A;  4WKW A;  2N5A A;  2R5G A;  3IA1 A;  2JSY A;  1ZL9 A;  1VGL A;  2X8H A;  2H6X A;  4IKH A;  1SKW B;  2B1L A;  2B3S A;  2C3Q A;  2H73 A;  3DML A;  3M3M A;  4K9Z A;  4X0X A;  3QAV A;  4EKZ A;  1ZOF A;  3VPQ A;  1PN0 A;  5ECQ B;  1B48 A;  1O85 A;  1PKZ A;  3GX0 A;  4N30 A;  4BA7 A;  5BRT A;  4AJ6 A;  3D4T A;  4HUA A;  2H71 A;  2R4V A;  1URM A;  2WS2 A;  1K3Y A;  1XCC A;  5ENU A;  2IFQ B;  4CY6 A;  1U3A A;  4G9H A;  4LL1 B;  3WT2 A;  3IPZ A;  4KA0 A;  1MEK A;  1F3B A;  2A2P A;  1G0T A;  3C8E A;  4J2F A;  3UOM A;  3EWL A;  3LSZ A;  3D0Z A;  4TXO A;  2ES7 A;  1M99 A;  3VI7 A;  2CX4 A;  3UBL A;  2A4H A;  2GT5 A;  4KSM A;  2H01 A;  1TRW A;  4TRX A;  2KOK A;  2FY6 A;  1B9X C;  5IOW A;  2GDR A;  2HFD A;  1HNC A;  3TJK A;  5J4U A;  2B5X A;  2P5R A;  2H0I A;  1PKW A;  2HSM A;  2LJK A;  2LRN A;  2MYG A;  3HY2 A;  3TDG A;  4TR3 A;  3LYK A;  5DBQ A;  1T00 A;  1G7O A;  2H72 A;  2P31 A;  4ACS A;  1ZYP A;  1B4P A;  5AGY A;  3TRP A;  3GKK A;  3QDN A;  2Z9S A;  2VCT A;  2VOC A;  2VLU A;  2FA4 A;  2DIY A;  1EOG A;  3KTB A;  5C00 A;  2OJL A;  2L5O A;  3ZRE A;  3TCO A;  4IQA A;  1Z5Y E;  4J57 E;  2FWH A;  1SKR B;  1TKD B;  1TK0 B;  2V6K A;  2DJ2 A;  2OBI A;  3F9U A;  1G6W A;  1AUC A;  2CVK A;  2YWI A;  2HYX A;  4EF0 A;  3FZ4 A;  4L8E A;  2WZ9 A;  5JWR B;  2HI7 A;  1YY7 A;  4POM A;  4Q5N A;  3LYP A;  3PPU A;  3FZA A;  3G9B A;  1N8J A;  4X43 A;  2P5Q A;  1QQ2 A;  1SYX A;  5KEJ A;  2E2G A;  2WGR A;  2FNO A;  2VD0 A;  2B6M A;  1Z6N A;  1R5A A;  2OAC A;  4KSO A;  4OCE A;  1ST9 A;  4BVY B;  4IJ3 A;  3QOU A;  1F9M A;  2H30 A;  4O92 A;  4USS A;  2D2Z A;  1XFL A;  3SBC A;  2DJK A;  2OKA A;  2MMA A;  2REM A;  1X9M B;  2KHP A;  1R5P A;  4GSN A;  2LRC A;  2V1M A;  4TR0 A;  4O5Q A;  3FR6 A;  1TRS A;  4OFT A;  3PIN A;  4YQM A;  3VWU A;  1DE1 A;  5EVO A;  1KTE A;  2HZF A;  2A2S A;  2GS3 A;  4HZ4 A;  4BVX B;  4GLT A;  2JSZ A;  3ZIT A;  5IPG A;  4ILF A;  1FVJ A;  2IL3 A;  3F4S A;  2E2M A;  5FT3 A;  3ZML A;  5DAK B;  5ELG A;  1BYE A;  3EUR A;  3RBT A;  2ON7 A;  3D5J A;  3FHK A;  4K7O A;  1XOA A;  4ECJ A;  4XCS A;  4F0B A;  2VL9 A;  4D73 A;  1TI3 A;  3MAK A;  4O5R A;  3IE3 A;  2IMI A;  1WWJ A;  3DKS A;  2QC7 A;  4NAX A;  2C80 A;  1T7P B;  4PX1 A;  1GUL A;  2LKU A;  3A5I A;  3ERW A;  1K0N A;  3HJO A;  5ECH B;  3GHA A;  1M9A A;  5F0G A;  5A5K A;  3EPT A;  2CV4 A;  2C3N A;  4GXZ A;  3KMN A;  1Y25 A;  3HVX A;  2PMT A;  1B4Q A;  1GUM A;  5AIV A;  3W8J A;  3E0U A;  4KUN A;  4MNN A;  4MCU A;  4PNG A;  3QAW A;  4JED A;  3FYG A;  4LA1 A;  4XHM A;  1EEJ A;  2JL4 A;  3BBY A;  4GF0 A;  2DKI A;  1GSF A;  4BL7 A;  2CX3 A;  2H6Y A;  3IAS 2;  4JRR A;  4LMW A;  1Q98 A;  2KP1 A;  5GAN D;  3GIX A;  4QL7 A;  4ML6 A;  4RI7 A;  3CBU A;  1UN2 A;  2ON5 A;  3W8S A;  1BQ7 A;  2NPB A;  4AF2 A;  3A5W A;  2RUE A;  5JCW A;  4AJ8 A;  4TVE A;  2VD1 A;  3FR9 A;  4EDZ A;  1AC1 A;  2HSY A;  5ID2 A;  1G6Y A;  2PBJ A;  4BPY A;  3HZ8 A;  4IN0 A;  4G0I A;  2YZU A;  4WEY A;  1J0F A;  1I5G A;  4ID0 A;  4EL1 A;  5J9B A;  4WXT A;  2ZUP A;  1ERW A;  4ECI A;  1K3O A;  2GQM A;  3F4T A;  1GNE A;  1WRY A;  3MNG A;  4OFN A;  4A5P A;  5DDL A;  4KDU A;  1EP7 A;  4I2T A;  3KTL A;  4G2E A;  3TOT A;  1Z3E A;  5DJM A;  5CP1 A;  4O32 A;  5JWO B;  3C73 A;  1SK2 A;  2WDU A;  3MSZ A;  2LTK A;  5CYY A;  1K0A A;  2QGV A;  3PR8 A;  3U5R E;  2FUG 2;  1SJ6 A;  1ERV A;  3WGE A;  4QL9 A;  4GST A;  3WYW A;  1WIK A;  4RI6 A;  2BJX A;  2LV3 A;  3CSI A;  1A0R P;  4N11 A;  20GS A;  2XC2 A;  5G5E A;  2VUP A;  1LBK A;  4O5U A;  2XBI A;  3VUR A;  2B7J A;  1TW9 A;  2VM2 A;  5HFI A;  3LGC A;  3P8W A;  1EV4 A;  2AAW A;  4L5L A;  1V58 A;  5JCU A;  4MPF A;  4ECB A;  5CRG A;  1RK4 A;  3FR3 A;  1TK5 B;  3LFL A;  1IYI A;  4ZXG A;  3TKR A;  4EIP A;  1OVN A;  4TXV A;  1QUW A;  1MDI A;  3GSS A;  4HU7 A;  2MZC A;  1H75 A;  1SK0 A;  3APS A;  2OE0 A;  4GCI A;  4K7I A;  4HJM A;  2VIM A;  1X0R A;  3OR5 A;  2TRC P;  1QFN A;  1JHB A;  3RPP A;  3MWH A;  1TU8 A;  1FW1 A;  1GH2 A;  2L6C A;  5JCG A;  1KBN A;  6GSS A;  2RM5 A;  3TB2 A;  1SJI A;  4ZBA A;  2H75 A;  3HHV A;  4KND A;  1PSQ A;  6GSV A;  3GRX A;  3BJ5 A;  3A3T A;  1XVW A;  1GUK A;  3EYT A;  4PUR A;  4FYC A;  2JAC A;  2IMF A;  5ABR A;  5DJL A;  2DJ3 A;  1JZW A;  1E2Y A;  4XS4 A;  4MJA A;  2KUC A;  5D93 A;  3ZMK A;  3GUS A;  2KLX A;  3KIJ A;  1S3D A;  2EIR A;  3PGT A;  2VL3 A;  1R26 A;  2R6K A;  3RAZ A;  5IO2 A;  1X5C A;  1F2E A;  3F63 A;  1O81 A;  1TU7 A;  3LG6 A;  2M72 A;  11GS A;  3MDK A;  5D9V A;  1YJ6 A;  1SK1 A;  2EIO A;  2GQL A;  3NZN A;  3ZIV A;  2I1U A;  5IOX A;  4NXI A;  3HD5 A;  1OKD A;  4AJ7 A;  4OMV A;  1B9Y C;  3GST A;  3ZFB A;  5HR0 A;  1ERU A;  1VF2 A;  1OE8 A;  3VPT A;  5ECM B;  2E7P A;  3KCM A;  4ZL9 A;  1GTI A;  2DC5 A;  4Q5R A;  5D9X A;  2R3X A;  4ZL7 A;  1XWB A;  2DKH A;  2NTO A;  2HRK A;  2OA7 A;  3M0F A;  3D4M A;  5BMU A;  1M7T A;  3ZIJ A;  2LST A;  4PUA A;  4RQR A;  3M9J A;  4TR4 A;  1PD2 1;  2O7K A;  2F9S A;  3GKX A;  2XPE A;  1O8W A;  1BG5 A;  2R0P A;  3EMP A;  5B6N A;  4IP1 A;  1Z7P A;  3BCK A;  1QXH A;  3KEB A;  2CT6 A;  5J5N A;  3N9J A;  5JWQ B;  4H86 A;  1YF0 A;  3EE2 A;  1UC7 A;  4MAB A;  6GSU A;  3UVH A;  5GST A;  5IO0 A;  2GZY A;  5F07 A;  3QMX A;  2HZE A;  5AIS A;  2YNX A;  5B6M A;  1WE0 A;  3R2Q A;  5E59 A;  3KP8 A;  5A4U A;  5CAX A;  5HR2 A;  1XW9 A;  3KMO A;  3UBK A;  3EIN A;  2A4V A;  4IW9 A;  5COH A;  3LXT A;  1V2A A;  4FQU A;  1YZX A;  3ZZX A;  1T3B A;  2FWF A;  4G19 A;  5FWG A;  2OE3 A;  3GTU A;  3G7Y A;  3IDV A;  4BIK A;  1AXD A;  2YV9 A;  3IC4 A;  3UMA A;  1C72 A;  3A2V A;  3P90 A;  2YWN A;  10GS A;  3KXO A;  5H5S A;  1ML6 A;  2X8G A;  3KD0 A;  3UL3 A;  1EOH A;  1M2A A;  3QFB C;  1QMV A;  1A2J A;  4LMV A;  4CW9 A;  4KCE A;  2CVB A;  4XS6 A;  1JZR A;  4K2X A;  4ZB6 A;  3DEX A;  4NMU A;  2PWJ A;  4F9Z A;  3RHC A;  4MDC A;  4N0V A;  2F8F A;  3FW2 A;  1TDI A;  2ALB A;  1VF1 A;  1GNW A;  4YAV A;  4FO5 A;  4TKY A;  1QGV A;  1TJD A;  2AYT A;  4ULX A;  1K0M A;  1MD4 A;  2JAD A;  2FWE A;  4Z2T A;  2X99 A;  5HFG A;  5DAL A;  1PL1 A;  2X49 A;  3IRA A;  3EVI A;  3FZ9 A;  5KOW A;  4MH3 A;  3QPM A;  3TRX A;  4KDY A;  5F06 A;  2HE3 A;  13GS A;  2P0G A;  1A2M A;  1T4Z A;  4YQV A;  3DWV A;  3E3E A;  1OAZ A;  1MTC A;  2YPM A;  5EY6 A;  1GSS A;  3HXS A;  3US3 A;  7GSS A;  2VL2 A;  1GTU A;  5HR1 A;  3H8Q A;  2CAI A;  3F3Q A;  1Q4J A;  4Z2R A;  2IFQ A;  3TGZ A;  1GL8 A;  4BL7 B;  2CVD A;  4WF5 A;  5IMA A;  4K8M A;  1BAY A;  4JU5 A;  4EXJ A;  3DVW A;  5A4V A;  2QA1 A;  4AGS A;  1ZYN A;  5CRD A;  4X4J A;  5CO3 A;  4I97 A;  1ZYQ B;  4EUY A;  1PN9 A;  5CRE A;  1ZGN A;  2AUV A;  1XOB A;  5IMC A;  3TRQ A;  1W4V A;  4MP4 A;  1J08 A;  3C1S A;  3GL3 A;  2I9H A;  3ERF A;  1EGR A;  5F8B A;  4F2I A;  4N10 A;  3DGQ A;  4K6X A;  6GSX A;  3CXG A;  3KH7 A;  4YH2 A;  3CSH A;  2GGT A;  3GA4 A;  3TUE A;  4HSC X;  3UVT A;  2G0F A;  2VL2 C;  2FWG A;  3DXB A;  3HJP A;  2HSH A;  2VCV A;  4NV2 A;  1GRX A;  2AJQ B;  1YF1 A;  1HNA A;  3UAR A;  3BD2 A;  2FHE A;  4POB A;  3TKS C;  2ZNM A;  3H4K A;  1SL0 B;  3IR4 A;  3D22 A;  2GLR A;  1NSW A;  3N5O A;  2IN3 A;  1F3A A;  2V32 A;  2DJJ A;  3VWX A;  4MZB A;  4KH7 A;  1O8X A;  1YEP A;  1VF3 A;  2K18 A;  2VLV A;  1XW5 A;  1ACV A;  3FRC A;  5D73 A;  2I3Y A;  1JZO A;  3EU3 A;  1AQX A;  3NOF A;  4IP6 A;  3G7I A;  8GSS A;  2VCX A;  1X5E A;  1RQM A;  1G7E A;  4HEA 2;  1OC9 A;  5E4W A;  3IK9 A;  1Z7R A;  3VLN A;  18GS A;  2DJ1 A;  2TIR A;  5AIX A;  2B5E A;  5DCH A;  1YDK A;  4X1U A;  1XWG A;  1XIY A;  4ZIL A;  2V6O A;  1XWA A;  3QCP A;  2DMM A;  2FCH A;  4DSS A;  3ZL5 A;  4ICY A;  2H6Z A;  3CMI A;  4HZ2 A;  3NIV A;  4WBJ A;  5A4W A;  3UJ1 A;  4OO4 A;  4MJC A;  3M9K A;  4KX4 A;  4L0W A;  2H19 A;  1E6B A;  1M9B A;  1ON4 A;  2XHF A;  4MLY A;  2R2J A;  3L9U A;  1ZCP A;  2H1A A;  2LQO A;  1A0F A;  1FOH A;  1WPI A;  3GV1 A;  2H1G A;  2K9F A;  1USB A;  2YP6 A;  1WMJ A;  4YKG A;  3VWV A;  2C1Y A;  2DSA A;  3KZQ A;  3I6A A;  1FO5 A;  4YAP A;  4IVF A;  3HZ4 A;  2C8U A;  2QA2 A;  4GRF A;  2PPT A;  2PER A;  3CQF A;  2PU9 C;  4ML1 A;  5GSS A;  3IBH A;  3VWW A;  4RQX A;  1TXX A;  5ECO B;  4XS4 B;  5KN1 A;  1M0U A;  2X64 A;  3TJJ A;  4E8H A;  1NHO A;  3GL5 A;  2RII A;  2YWM A;  3F6F A;  2O85 A;  3QD9 A;  5DAK A;  3TJG A;  1GSQ A;  4TN8 A;  2JZS A;  2LRT A;  3S9F A;  5KN0 A;  3Q74 A;  4NWY A;  2PVO C;  5C04 A;  1HQO A;  3TJF A;  1T8E B;  3WGD A;  1A24 A;  3GFK A;  4IGJ A;  1M3I A;  4V1A g;  4YKF A;  1YKC A;  4Q5F A;  1TOF A;  1T1V A;  3ME7 A;  1U88 A;  2MBS A;  1SJZ A;  4JR6 A;  5ECI B;  3KGK A;  3LOR A;  3M1G A;  4OWY A;  1N2A A;  2CA8 A;  3RHB A;  2H1B A;  3HYP A;  3C7M A;  4ZL8 A;  4IHU A;  4MF7 A;  3IHG A;  1XW6 A;  5HFK A;  4BWQ A;  1PX6 A;  2AB6 A;  4PTS A;  1EV9 A;  2CZ2 A;  3I9V 2;  3FK8 A;  5ELA A;  1K0O A;  5IMF A;  1XPV A;  1PRX A;  2B7K A;  6GSY A;  2BTO T;  1R4W A;  4IBP A;  3HVS A;  3FZ5 A;  2H74 A;  3LJR A;  2HXK A;  1ZZY A;  3CRT A;  1TRU A;  2AHE A;  2RUF A;  4Z2U A;  4PNF A;  2NBS A;  4XRD A;  4V2M A;  3TOU A;  2H76 A;  2GQK A;  4LL4 B;  2KP2 A;  4K1F A;  1Y6E A;  3EMX A;  3O76 A;  2V2G A;  5G5F A;  5FHI A;  1AIU A;  2VLT A;  14GS A;  4GTU A;  1GWC A;  1THO A;  4XTS A;  5ECR B;  2GZP A;  2VM1 A;  1YQ1 A;  3SWL A;  2PN8 A;  2LQQ A;  2C0F A;  2YV7 A;  2WB9 A;  4TXO B;  2C0E A;  1PA3 A;  2GZZ A;  2LNS A;  1A8Y A;  3GYK A;  2L6D A;  2YOI A;  4OD7 A;  3CTG A;  1K3L A;  4G0K A;  5LCZ A;  2H66 A;  4TR1 A;  3Q6O A;  4PQ1 A;  3QR6 A;  1GUH A;  5IM9 A;  3WT1 A;  4EE0 A;  2LNT A;  2QSI A;  1DBY A;  1PX7 A;  2XPD A;  5DQY A;  4WF4 A;  1LJR A;  3TKQ A;  4XRA A;  2JU5 A;  1JZD A;  4PGT A;  4HI7 A;  3RPN A;  3EU4 A;  3FEU A;  3LWA A;  2OBK A;  3DYR A;  3WGX A;  1DUG A;  2GSR A;  1A23 A;  1OYJ A;  4GWR A;  9GSS A;  3IAM 2;  4MJE A;  4PUF C; 
#chains in the Genus database with same CATH homology
 2VCW A;  3IC8 A;  3AY8 A;  2EIQ A;  2H70 A;  1K0C A;  4E8E A;  1UVZ A;  3ISO A;  17GS A;  2PVQ A;  4ZBB A;  1M2D A;  3KJY A;  2GSS A;  1O7U A;  2I81 A;  3LXZ A;  2OE1 A;  4HU9 A;  5J9C A;  1X9W B;  2H1D A;  1FB0 A;  2V41 A;  1TRV A;  3QAG A;  1J9B A;  5EPF A;  2NDO A;  4HQS A;  4F0C A;  4L5O A;  5AN1 A;  2VO4 A;  1VRS D;  1PMT A;  5IPH A;  3F4R A;  3HDC A;  3ZLP A;  3ZYW A;  3UAP A;  3LEF A;  2L4C A;  4TW5 A;  19GS A;  1KEB A;  2GTU A;  1AW9 A;  1B8X A;  2PGT A;  5KN2 A;  1FAA A;  4KDX A;  5D8I A;  3ERG A;  1JLW A;  5D9W A;  4DVC A;  4MH2 A;  3VK9 A;  3APQ A;  5GAP D;  2M46 A;  1XBS A;  4IQ1 A;  4P3Y B;  1XWC A;  1TI1 A;  3K8N A;  4BWS A;  2N5F A;  3LQ7 A;  3ME8 A;  3BOA A;  3G7J A;  3HCZ A;  1ABA A;  4J56 E;  4F82 A;  4G10 A;  4IJI A;  4JR4 A;  4QQ7 A;  1U3I A;  4WET A;  2B1K A;  4WR4 A;  2YJ7 A;  1AAZ A;  4PQI A;  5D9T A;  4PQH A;  1YEX A;  3FY7 A;  3LW9 A;  2HNL A;  4I2U A;  4V1A p;  1M2B A;  2ZCT A;  2CQ9 A;  1X5D A;  3A2W A;  1O73 A;  4D73 B;  1A2L A;  1DSB A;  2L57 A;  2IPA A;  4EIQ A;  1JLV A;  3FMW A;  2YWO A;  3D6I A;  2TRX A;  4K7N A;  2AV4 A;  2X4A A;  2I4A A;  2DML A;  1IYH A;  2BMX A;  4JZQ A;  3QFA C;  4G0L A;  5IMD A;  12GS A;  2X8C A;  1V40 A;  4LLR A;  2IME A;  3F8U A;  4POK A;  2MMO A;  4NV5 A;  5CRW A;  4WBR D;  1Z9H A;  4GQF A;  3MYD A;  2GT6 A;  3H93 A;  3I69 A;  4DSR A;  2DJ0 A;  3ZRD A;  5G2Z A;  4MA9 A;  4MF6 A;  1OC8 A;  1FB6 A;  1MD3 A;  3J7Y b;  4MF5 A;  1OC9 B;  2FGX A;  5CNW A;  1FVK A;  2PUK C;  2H8L A;  4HJ2 A;  3VFI A;  5H5Q A;  1SL1 B;  2DBC A;  1SEN A;  1V9W A;  2GSQ A;  1GTB A;  3L9S A;  2L5L A;  1SU9 A;  4GSS A;  4ZB8 A;  3L0H A;  3CTF A;  2VCQ A;  4DSS B;  1OKT A;  1YKA A;  5IMZ A;  4MMM A;  3TKS A;  2JZR A;  3KM6 A;  2FLS A;  4K0N A;  3HA9 A;  1F37 A;  2YN1 A;  2F3M A;  4XIH A;  4EO3 A;  2WUL A;  5ECK B;  2K8V A;  1VF4 A;  1GP1 A;  3ED3 A;  1ZMA A;  1ILO A;  5L71 A;  3M8N A;  4ZIJ A;  1SD8 A;  5ID2 B;  2N5B A;  5ECL B;  2YAN A;  4MPG A;  4YQU A;  3ZVJ D;  2B5Y A;  2CAQ A;  4ECC A;  4NHZ A;  2MBT A;  2R0G A;  2O8V B;  2F51 A;  3KP9 A;  2HRA A;  5IQY A;  1PL2 A;  3EC3 A;  4V2L A;  2H0H A;  4K5R A;  2A2R A;  2LJR A;  5H5R A;  1XZO A;  3D21 A;  2MMZ A;  4ISD A;  1CQG A;  1KNG A;  3GNJ A;  2C3T A;  3TJB A;  1W89 A;  3DIE A;  4JE1 A;  1S3A A;  4K5S A;  4FYU A;  2C0G A;  1BJX A;  1A8L A;  3APO A;  1PGT A;  2RM6 A;  1SKS B;  1NHY A;  3HKR A;  2O89 A;  5LD0 A;  4HOJ A;  1CQH A;  1O6J A;  4WR5 A;  1UA5 A;  3PH9 A;  1THX A;  3GKN A;  5B8A A;  1F6M C;  2WFC A;  5HR3 A;  5J3R A;  2G2Q A;  1TK8 B;  3E9J B;  2K6V A;  4L0U A;  1U87 A;  3L78 A;  1GSD A;  2GST A;  1S3C A;  1GLP A;  3GUR A;  4BVY A;  3R3E A;  1OC3 A;  3UIW A;  1GSE A;  2LJA A;  4RUV A;  3IV4 A;  3CYN A;  1GTA A;  3O6T A;  1GSY A;  1DE2 A;  5INY A;  3MIX A;  2XBQ A;  1QK8 A;  4MZC A;  1FG4 A;  1GSU A;  2H0G A;  4HDE A;  1HNB A;  2IMD A;  2WCI A;  1SD9 A;  4FYB A;  1PQN A;  5G31 A;  3F0I A;  4PXO A;  2LEG A;  3KH9 A;  3IXR A;  4BVX A;  2DLX A;  3I43 A;  2C4J A;  1HD2 A;  3TKP A;  1U6T A;  4F03 A;  3IK7 A;  2J9H A;  4Z7X A;  4I5Q A;  4IEL A;  1XWK A;  2M80 A;  4POL A;  3L4N A;  3ZTL A;  1XVQ A;  4TR1 B;  1R7H A;  4JBB A;  3GMF A;  2HLS A;  5F05 A;  4KAE A;  6GST A;  4GQC A;  1NW2 A;  1Z6M A;  3L9V A;  1ERT A;  4KB3 A;  2K8S A;  1LU4 A;  5DVB A;  5G1L A;  2OAD A;  3Q18 A;  3FKF A;  5IMV A;  4ZBD A;  2GVP A;  3VI5 A;  4FIW A;  2FD3 A;  1EZK A;  4KCA A;  3DD3 A;  4HS1 A;  1EEM A;  1MDJ A;  2WRT A;  2IMK A;  1MDK A;  3GH9 A;  6GSW A;  16GS A;  3JCM L;  3IHQ A;  2MMN A;  1BX9 A;  2LUS A;  1T4Y A;  2JZT A;  1WJK A;  4CDO A;  1BED A;  2IWT A;  1TTZ A;  1TP9 A;  4MZW A;  2YJH A;  3UEM A;  5G30 A;  1FHE A;  5LNK e;  1WP0 A;  3CRU A;  3U6V A;  4EDY A;  4EVM A;  3DRN A;  2VCZ A;  4OCF A;  2QKE A;  4KF9 A;  3O3T A;  4IS0 A;  1K0B A;  3RDW A;  1RW1 A;  1XXU A;  1H4O A;  3H79 A;  4KW6 A;  1HYU A;  4K0G A;  1AQV A;  22GS A;  3V1W A;  2DIZ A;  2YZH A;  2WJU A;  3P2A A;  3HJM A;  1EP8 A;  1FOV A;  3GX8 A;  3WD6 A;  1V57 A;  1GLQ A;  2L4Q A;  4I8B A;  1EWX A;  2HZE B;  1OE7 A;  5J41 A;  3C1R A;  4K2D A;  2F8A A;  3GN3 A;  5CRH A;  3TKS E;  1SL2 B;  5KOX A;  2IJY A;  1SYR A;  5G1K A;  4EC0 A;  3A2X A;  5ECS A;  2C0D A;  4MJB A;  4KE3 A;  1WOU A;  3ZFL A;  3HVV A;  1V98 A;  5B7C A;  2L59 A;  2HT9 A;  2IIY A;  3F6D A;  4V2N A;  4Q5Q A;  2FA8 A;  2NVL A;  5ECN B;  5B8B A;  2HRN A;  3GTU B;  3GKM A;  2UZ8 A;  4NPB A;  1K0D A;  2O87 A;  5D96 A;  4NHW A;  1ZYE A;  2EC4 A;  5KN3 A;  3P7X A;  5HQP A;  1I9D A;  4MK3 A;  4OO5 A;  5GZZ B;  2R37 A;  3Q19 A;  4HQZ A;  4KGI A;  3DVX A;  3W6G A;  1X9S B;  4OFM A;  5ECP B;  4DSQ A;  2R0C A;  4I6X A;  5IIZ A;  1JFU A;  2YCD A;  4CHS A;  3IOS A;  3ZVJ A;  5DCG A;  2HRF A;  4N0Z A;  1EGO A;  3J7Y k;  4ZB9 A;  3H1N A;  4XS1 A;  5EL8 A;  4TOP A;  5DQS A;  2E0Q A;  4FH8 A;  2J23 A;  3F3R A;  1NM3 A;  4DEJ A;  3GH6 A;  5DAL B;  4CY8 A;  4O7H A;  1AQW A;  2VAF A;  2LS5 A;  2RLI A;  2CZ3 A;  3C71 A;  3BCI A;  3CSJ A;  4WKW A;  2N5A A;  2R5G A;  3IA1 A;  2JSY A;  1ZL9 A;  1VGL A;  2X8H A;  2H6X A;  4IKH A;  1SKW B;  2B1L A;  2B3S A;  2C3Q A;  2H73 A;  3DML A;  3M3M A;  4K9Z A;  4X0X A;  3QAV A;  4EKZ A;  1ZOF A;  3VPQ A;  1PN0 A;  5ECQ B;  1B48 A;  1O85 A;  1PKZ A;  3GX0 A;  4N30 A;  4BA7 A;  5BRT A;  4AJ6 A;  3D4T A;  4HUA A;  2H71 A;  2R4V A;  1URM A;  2WS2 A;  1K3Y A;  1XCC A;  5ENU A;  2IFQ B;  4CY6 A;  1U3A A;  4G9H A;  4LL1 B;  3WT2 A;  3IPZ A;  4KA0 A;  1MEK A;  1F3B A;  2A2P A;  1G0T A;  3C8E A;  4J2F A;  3UOM A;  3EWL A;  3LSZ A;  3D0Z A;  4TXO A;  2ES7 A;  1M99 A;  3VI7 A;  2CX4 A;  3UBL A;  2A4H A;  2GT5 A;  4KSM A;  2H01 A;  1TRW A;  4TRX A;  2KOK A;  2FY6 A;  1B9X C;  5IOW A;  2GDR A;  2HFD A;  1HNC A;  3TJK A;  5J4U A;  2B5X A;  2P5R A;  2H0I A;  1PKW A;  2HSM A;  2LJK A;  2LRN A;  2MYG A;  3HY2 A;  3TDG A;  4TR3 A;  3LYK A;  5DBQ A;  1T00 A;  1G7O A;  2H72 A;  2P31 A;  4ACS A;  1ZYP A;  1B4P A;  5AGY A;  3TRP A;  3GKK A;  3QDN A;  2Z9S A;  2VCT A;  2VOC A;  2VLU A;  2FA4 A;  2DIY A;  1EOG A;  3KTB A;  5C00 A;  2OJL A;  2L5O A;  3ZRE A;  3TCO A;  4IQA A;  1Z5Y E;  4J57 E;  2FWH A;  1SKR B;  1TKD B;  1TK0 B;  2V6K A;  2DJ2 A;  2OBI A;  3F9U A;  1G6W A;  1AUC A;  2CVK A;  2YWI A;  2HYX A;  4EF0 A;  3FZ4 A;  4L8E A;  2WZ9 A;  5JWR B;  2HI7 A;  1YY7 A;  4POM A;  4Q5N A;  3LYP A;  3PPU A;  3FZA A;  3G9B A;  1N8J A;  4X43 A;  2P5Q A;  1QQ2 A;  1SYX A;  5KEJ A;  2E2G A;  2WGR A;  2FNO A;  2VD0 A;  2B6M A;  1Z6N A;  1R5A A;  2OAC A;  4KSO A;  4OCE A;  1ST9 A;  4BVY B;  4IJ3 A;  3QOU A;  1F9M A;  2H30 A;  4O92 A;  4USS A;  2D2Z A;  1XFL A;  3SBC A;  2DJK A;  2OKA A;  2MMA A;  2REM A;  1X9M B;  2KHP A;  1R5P A;  4GSN A;  2LRC A;  2V1M A;  4TR0 A;  4O5Q A;  3FR6 A;  1TRS A;  4OFT A;  3PIN A;  4YQM A;  3VWU A;  1DE1 A;  5EVO A;  1KTE A;  2HZF A;  2A2S A;  2GS3 A;  4HZ4 A;  4BVX B;  4GLT A;  2JSZ A;  3ZIT A;  5IPG A;  4ILF A;  1FVJ A;  2IL3 A;  3F4S A;  2E2M A;  5FT3 A;  3ZML A;  5DAK B;  5ELG A;  1BYE A;  3EUR A;  3RBT A;  2ON7 A;  3D5J A;  3FHK A;  4K7O A;  1XOA A;  4ECJ A;  4XCS A;  4F0B A;  2VL9 A;  4D73 A;  1TI3 A;  3MAK A;  4O5R A;  3IE3 A;  2IMI A;  1WWJ A;  3DKS A;  2QC7 A;  4NAX A;  2C80 A;  1T7P B;  4PX1 A;  1GUL A;  2LKU A;  3A5I A;  3ERW A;  1K0N A;  3HJO A;  5ECH B;  3GHA A;  1M9A A;  5F0G A;  5A5K A;  3EPT A;  2CV4 A;  2C3N A;  4GXZ A;  3KMN A;  1Y25 A;  3HVX A;  2PMT A;  1B4Q A;  1GUM A;  5AIV A;  3W8J A;  3E0U A;  4KUN A;  4MNN A;  4MCU A;  4PNG A;  3QAW A;  4JED A;  3FYG A;  4LA1 A;  4XHM A;  1EEJ A;  2JL4 A;  3BBY A;  4GF0 A;  2DKI A;  1GSF A;  4BL7 A;  2CX3 A;  2H6Y A;  3IAS 2;  4JRR A;  4LMW A;  1Q98 A;  2KP1 A;  5GAN D;  3GIX A;  4QL7 A;  4ML6 A;  4RI7 A;  3CBU A;  1UN2 A;  2ON5 A;  3W8S A;  1BQ7 A;  2NPB A;  4AF2 A;  3A5W A;  2RUE A;  5JCW A;  4AJ8 A;  4TVE A;  2VD1 A;  3FR9 A;  4EDZ A;  1AC1 A;  2HSY A;  5ID2 A;  1G6Y A;  2PBJ A;  4BPY A;  3HZ8 A;  4IN0 A;  4G0I A;  2YZU A;  4WEY A;  1J0F A;  1I5G A;  4ID0 A;  4EL1 A;  5J9B A;  4WXT A;  2ZUP A;  1ERW A;  4ECI A;  1K3O A;  2GQM A;  3F4T A;  1GNE A;  1WRY A;  3MNG A;  4OFN A;  4A5P A;  5DDL A;  4KDU A;  1EP7 A;  4I2T A;  3KTL A;  4G2E A;  3TOT A;  1Z3E A;  5DJM A;  5CP1 A;  4O32 A;  5JWO B;  3C73 A;  1SK2 A;  2WDU A;  3MSZ A;  2LTK A;  5CYY A;  1K0A A;  2QGV A;  3PR8 A;  3U5R E;  2FUG 2;  1SJ6 A;  1ERV A;  3WGE A;  4QL9 A;  4GST A;  3WYW A;  1WIK A;  4RI6 A;  2BJX A;  2LV3 A;  3CSI A;  1A0R P;  4N11 A;  20GS A;  2XC2 A;  5G5E A;  2VUP A;  1LBK A;  4O5U A;  2XBI A;  3VUR A;  2B7J A;  1TW9 A;  2VM2 A;  5HFI A;  3LGC A;  3P8W A;  1EV4 A;  2AAW A;  4L5L A;  1V58 A;  5JCU A;  4MPF A;  4ECB A;  5CRG A;  1RK4 A;  3FR3 A;  1TK5 B;  3LFL A;  1IYI A;  4ZXG A;  3TKR A;  4EIP A;  1OVN A;  4TXV A;  1QUW A;  1MDI A;  3GSS A;  4HU7 A;  2MZC A;  1H75 A;  1SK0 A;  3APS A;  2OE0 A;  4GCI A;  4K7I A;  4HJM A;  2VIM A;  1X0R A;  3OR5 A;  2TRC P;  1QFN A;  1JHB A;  3RPP A;  3MWH A;  1TU8 A;  1FW1 A;  1GH2 A;  2L6C A;  5JCG A;  1KBN A;  6GSS A;  2RM5 A;  3TB2 A;  1SJI A;  4ZBA A;  2H75 A;  3HHV A;  4KND A;  1PSQ A;  6GSV A;  3GRX A;  3BJ5 A;  3A3T A;  1XVW A;  1GUK A;  3EYT A;  4PUR A;  4FYC A;  2JAC A;  2IMF A;  5ABR A;  5DJL A;  2DJ3 A;  1JZW A;  1E2Y A;  4XS4 A;  4MJA A;  2KUC A;  5D93 A;  3ZMK A;  3GUS A;  2KLX A;  3KIJ A;  1S3D A;  2EIR A;  3PGT A;  2VL3 A;  1R26 A;  2R6K A;  3RAZ A;  5IO2 A;  1X5C A;  1F2E A;  3F63 A;  1O81 A;  1TU7 A;  3LG6 A;  2M72 A;  11GS A;  3MDK A;  5D9V A;  1YJ6 A;  1SK1 A;  2EIO A;  2GQL A;  3NZN A;  3ZIV A;  2I1U A;  5IOX A;  4NXI A;  3HD5 A;  1OKD A;  4AJ7 A;  4OMV A;  1B9Y C;  3GST A;  3ZFB A;  5HR0 A;  1ERU A;  1VF2 A;  1OE8 A;  3VPT A;  5ECM B;  2E7P A;  3KCM A;  4ZL9 A;  1GTI A;  2DC5 A;  4Q5R A;  5D9X A;  2R3X A;  4ZL7 A;  1XWB A;  2DKH A;  2NTO A;  2HRK A;  2OA7 A;  3M0F A;  3D4M A;  5BMU A;  1M7T A;  3ZIJ A;  2LST A;  4PUA A;  4RQR A;  3M9J A;  4TR4 A;  1PD2 1;  2O7K A;  2F9S A;  3GKX A;  2XPE A;  1O8W A;  1BG5 A;  2R0P A;  3EMP A;  5B6N A;  4IP1 A;  1Z7P A;  3BCK A;  1QXH A;  3KEB A;  2CT6 A;  5J5N A;  3N9J A;  5JWQ B;  4H86 A;  1YF0 A;  3EE2 A;  1UC7 A;  4MAB A;  6GSU A;  3UVH A;  5GST A;  5IO0 A;  2GZY A;  5F07 A;  3QMX A;  5AIS A;  2HZE A;  2YNX A;  5B6M A;  1WE0 A;  3R2Q A;  5E59 A;  3KP8 A;  5A4U A;  5CAX A;  5HR2 A;  1XW9 A;  3KMO A;  3UBK A;  3EIN A;  2A4V A;  4IW9 A;  5COH A;  3LXT A;  1V2A A;  4FQU A;  1YZX A;  3ZZX A;  1T3B A;  2FWF A;  4G19 A;  5FWG A;  2OE3 A;  3GTU A;  3G7Y A;  3IDV A;  1AXD A;  2YV9 A;  3IC4 A;  3UMA A;  1C72 A;  3A2V A;  3P90 A;  2YWN A;  10GS A;  3KXO A;  5H5S A;  1ML6 A;  2X8G A;  3KD0 A;  3UL3 A;  1EOH A;  1M2A A;  3QFB C;  1QMV A;  1A2J A;  4LMV A;  4CW9 A;  4KCE A;  2CVB A;  4XS6 A;  1JZR A;  4K2X A;  4ZB6 A;  3DEX A;  4NMU A;  2PWJ A;  4F9Z A;  3RHC A;  4MDC A;  4N0V A;  2F8F A;  3FW2 A;  1TDI A;  2ALB A;  1VF1 A;  1GNW A;  4YAV A;  4FO5 A;  4TKY A;  1QGV A;  1TJD A;  2AYT A;  4ULX A;  1K0M A;  1MD4 A;  2JAD A;  2FWE A;  4Z2T A;  2X99 A;  5HFG A;  5DAL A;  1PL1 A;  2X49 A;  3IRA A;  3EVI A;  3FZ9 A;  5KOW A;  4MH3 A;  3QPM A;  3TRX A;  4KDY A;  5F06 A;  2HE3 A;  13GS A;  2P0G A;  1A2M A;  1T4Z A;  4YQV A;  3DWV A;  3E3E A;  1OAZ A;  1MTC A;  2YPM A;  5EY6 A;  1GSS A;  3HXS A;  3US3 A;  7GSS A;  2VL2 A;  1GTU A;  5HR1 A;  3H8Q A;  2CAI A;  3F3Q A;  1Q4J A;  4Z2R A;  2IFQ A;  3TGZ A;  1GL8 A;  4BL7 B;  2CVD A;  4WF5 A;  5IMA A;  4K8M A;  1BAY A;  4JU5 A;  4EXJ A;  3DVW A;  5A4V A;  2QA1 A;  4AGS A;  1ZYN A;  5CRD A;  4X4J A;  5CO3 A;  4I97 A;  1ZYQ B;  4EUY A;  1PN9 A;  5CRE A;  1ZGN A;  2AUV A;  1XOB A;  5IMC A;  3TRQ A;  1W4V A;  4MP4 A;  1J08 A;  3C1S A;  3GL3 A;  2I9H A;  3ERF A;  1EGR A;  5F8B A;  4F2I A;  4N10 A;  3DGQ A;  4K6X A;  6GSX A;  3CXG A;  3KH7 A;  4YH2 A;  3CSH A;  2GGT A;  3GA4 A;  3TUE A;  3UVT A;  2G0F A;  2VL2 C;  2FWG A;  3DXB A;  3HJP A;  2HSH A;  2VCV A;  4NV2 A;  1GRX A;  2AJQ B;  1YF1 A;  1HNA A;  3UAR A;  3BD2 A;  2FHE A;  4POB A;  3TKS C;  2ZNM A;  3H4K A;  1SL0 B;  3IR4 A;  3D22 A;  2GLR A;  1NSW A;  3N5O A;  2IN3 A;  1F3A A;  2V32 A;  2DJJ A;  3VWX A;  4MZB A;  4KH7 A;  1O8X A;  1YEP A;  1VF3 A;  2K18 A;  2VLV A;  1XW5 A;  1ACV A;  3FRC A;  5D73 A;  2I3Y A;  1JZO A;  3EU3 A;  1AQX A;  3NOF A;  4IP6 A;  3G7I A;  8GSS A;  2VCX A;  1X5E A;  1RQM A;  1G7E A;  4HEA 2;  1OC9 A;  5E4W A;  3IK9 A;  1Z7R A;  3VLN A;  18GS A;  2DJ1 A;  2TIR A;  5AIX A;  2B5E A;  5DCH A;  1YDK A;  4X1U A;  1XWG A;  1XIY A;  4ZIL A;  2V6O A;  1XWA A;  3QCP A;  2DMM A;  2FCH A;  4DSS A;  3ZL5 A;  4ICY A;  2H6Z A;  3CMI A;  4HZ2 A;  3NIV A;  4WBJ A;  5A4W A;  3UJ1 A;  4OO4 A;  4MJC A;  3M9K A;  4KX4 A;  4L0W A;  2H19 A;  1E6B A;  1M9B A;  1ON4 A;  2XHF A;  4MLY A;  2R2J A;  3L9U A;  1ZCP A;  2H1A A;  2LQO A;  1A0F A;  1FOH A;  1WPI A;  3GV1 A;  2H1G A;  2K9F A;  1USB A;  2YP6 A;  1WMJ A;  4YKG A;  3VWV A;  2C1Y A;  2DSA A;  3KZQ A;  3I6A A;  1FO5 A;  4YAP A;  4IVF A;  3HZ4 A;  2C8U A;  2QA2 A;  4GRF A;  2PPT A;  2PER A;  2PU9 C;  4ML1 A;  5GSS A;  3IBH A;  3VWW A;  4RQX A;  1TXX A;  5ECO B;  4XS4 B;  5KN1 A;  1M0U A;  2X64 A;  3TJJ A;  4E8H A;  1NHO A;  3GL5 A;  2RII A;  2YWM A;  3F6F A;  2O85 A;  3QD9 A;  5DAK A;  3TJG A;  1GSQ A;  4TN8 A;  2JZS A;  2LRT A;  3S9F A;  5KN0 A;  3Q74 A;  4NWY A;  2PVO C;  5C04 A;  1HQO A;  3TJF A;  1T8E B;  3WGD A;  1A24 A;  3GFK A;  4IGJ A;  4V1A g;  4YKF A;  1YKC A;  4Q5F A;  1TOF A;  1T1V A;  3ME7 A;  1U88 A;  2MBS A;  1SJZ A;  4JR6 A;  5ECI B;  3KGK A;  3LOR A;  3M1G A;  4OWY A;  1N2A A;  2CA8 A;  3RHB A;  2H1B A;  3HYP A;  3C7M A;  4ZL8 A;  4IHU A;  4MF7 A;  3IHG A;  1XW6 A;  5HFK A;  4BWQ A;  1PX6 A;  2AB6 A;  4PTS A;  1EV9 A;  2CZ2 A;  3I9V 2;  3FK8 A;  5ELA A;  1K0O A;  5IMF A;  1XPV A;  1PRX A;  2B7K A;  6GSY A;  2BTO T;  1R4W A;  4IBP A;  3HVS A;  3FZ5 A;  2H74 A;  3LJR A;  2HXK A;  1ZZY A;  3CRT A;  1TRU A;  2AHE A;  2RUF A;  4Z2U A;  4PNF A;  2NBS A;  4XRD A;  4V2M A;  3TOU A;  2H76 A;  2GQK A;  4LL4 B;  2KP2 A;  4K1F A;  1Y6E A;  3EMX A;  3O76 A;  2V2G A;  5G5F A;  5FHI A;  1AIU A;  2VLT A;  14GS A;  4GTU A;  1GWC A;  1THO A;  4XTS A;  5ECR B;  2GZP A;  2VM1 A;  1YQ1 A;  3SWL A;  2PN8 A;  2LQQ A;  2C0F A;  2YV7 A;  2WB9 A;  4TXO B;  2C0E A;  1PA3 A;  2GZZ A;  2LNS A;  1A8Y A;  3GYK A;  2L6D A;  2YOI A;  4OD7 A;  3CTG A;  1K3L A;  4G0K A;  5LCZ A;  2H66 A;  4TR1 A;  3Q6O A;  4PQ1 A;  3QR6 A;  1GUH A;  5IM9 A;  3WT1 A;  4EE0 A;  2LNT A;  2QSI A;  1DBY A;  1PX7 A;  2XPD A;  5DQY A;  4WF4 A;  1LJR A;  3TKQ A;  4XRA A;  2JU5 A;  1JZD A;  4PGT A;  4HI7 A;  3RPN A;  3EU4 A;  3FEU A;  3LWA A;  2OBK A;  3DYR A;  3WGX A;  1DUG A;  2GSR A;  1A23 A;  1OYJ A;  4GWR A;  9GSS A;  3IAM 2;  4MJE A;  4PUF C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...