2I4AA

Crystal structure of thioredoxin from the acidophile acetobacter aceti
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
107
structure length
107
Chain Sequence
SEHTLAVSDSSFDQDVLKASGLVLVDFWAEWCGPCKMIGPALGEIGKEFAGKVTVAKVNIDDNPETPNAYQVRSIPTLMLVRDGKVIDKKVGALPKSQLKAWVESAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords thioredoxin
publication title Atomic-resolution crystal structure of thioredoxin from the acidophilic bacterium Acetobacter aceti.
pubmed doi rcsb
source organism Acetobacter aceti
molecule tags Oxidoreductase
total genus 33
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2006-08-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2i4aA00
3DEXA 2REMA 2PBJA 3GIXA 3FZ9A 1TJDA 1XW9A 3IV4A 5EPFA 5ECPB 4TR4A 5G31A 2C1YA 2GTUA 4KUNA 1WMJA 1Z6MA 2VLVA 1K3LA 1EV9A 2H74A 1UVZA 5GSSA 1G6WA 1R4WA 5HFGA 1BQ7A 2XBQA 2H71A 3Q6OA 2EIQA 2GSSA 1URMA 2H8LA 2AAWA 4O7HA 4LMVA 1X5CA 1FAAA 2LSTA 2VL2C 4MF5A 2A4VA 4POBA 4XHMA 2AUVA 4DSRA 2WULA 4MH2A 3TOUA 5H5QA 1TTZA 2G2QA 3CTGA 2O87A 1GRXA 3KCMA 1NHYA 4X1UA 4ECBA 3GFKA 1FW1A 2YNXA 1ABAA 4L5LA 1JZDA 2J23A 3GL5A 2L4CA 4XS1A 4K6XA 4YQUA 4PNFA 13GSA 2YOIA 2H70A 3KZQA 3QAGA 3DD3A 2CAQA 5DCHA 3CXGA 2WZ9A 2IWTA 2YZHA 3GMFA 4WF4A 2IL3A 2XC2A 1X0RA 4I5QA 2GS3A 2YJHA 4XTSA 4HDEA 2NVLA 4OMVA 2B7JA 5H5SA 3PINA 1A8YA 1SJIA 4ZBDA 1X9SB 3F8UA 1TK8B 1GP1A 2B1KA 4OWYA 2JU5A 5DJMA 1R7HA 4EO3A 1OAZA 4OO5A 1IYHA 2Z9SA 5F05A 1PN9A 4GSTA 1XVWA 1G7EA 2FCHA 4Q5NA 3LWAA 3QDNA 4DSSA 2HYXA 3Q18A 4HJMA 3TCOA 3HCZA 3HJOA 3F3RA 5CRHA 3ZVJA 4MJBA 18GSA 2GQKA 2GSRA 2F9SA 1EOGA 3BBYA 3EU4A 6GSUA 1NM3A 3D5JA 4EKZA 4PURA 3DRNA 7GSSA 5GZZB 3F63A 1O7UA 2LQQA 1V2AA 4DSQA 3VI7A 5A4VA 5IPGA 3MWHA 2WDUA 4ZB8A 1RQMA 3ME7A 1XWGA 4RQXA 1W89A 2VAFA 2OACA 5ECSA 2LV3A 4ZXGA 5ID2B 4YAPA 2V2GA 3MDKA 3WD6A 2OBKA 2H6ZA 4ID0A 3LSZA 1PX6A 4N0VA 1JZOA 1JZWA 2VM1A 4HI7A 3QR6A 3VI5A 1Q4JA 3KTBA 4N11A 2RLIA 3FR3A 2E2GA 4ZL7A 3MAKA 1K0NA 3IAM2 3F0IA 1PL1A 2DC5A 2VM2A 4TVEA 4IN0A 3J7Yk 1O81A 4PX1A 3O6TA 3KJYA 3DVXA 4F9ZA 2RUFA 1ZL9A 3KGKA 2V6KA 3AY8A 2VL3A 1GL8A 1ERWA 2PVQA 3GX0A 2I1UA 5F06A 2FWHA 2WRTA 1YDKA 3TGZA 1FO5A 3UL3A 2IIYA 3TKRA 4I6XA 5GAPD 5DVBA 4LA1A 1OKTA 3A2VA 1RW1A 16GSA 5IOWA 4BVXA 4QL9A 2V6OA 3ZMKA 4Q5FA 1YF0A 1WP0A 1I9DA 2IFQB 4G10A 1T4YA 2MBTA 1WRYA 3TJJA 2DJ0A 5IMFA 4EC0A 5IMCA 2YWMA 3G7IA 2B5YA 5IO0A 3RAZA 1SU9A 3U6VA 4IQAA 1AXDA 4KGIA 4IGJA 4GCIA 4J57E 3KP9A 4TW5A 1BYEA 1K3YA 3GNJA 1XBSA 2CVBA 3D4TA 1JZRA 3RDWA 1XZOA 1XWAA 4KDUA 3DIEA 5JWOB 2P5RA 3IR4A 1Z9HA 4JR6A 1LBKA 1V57A 1SK0A 1CQHA 1ZYQB 1KBNA 1Y25A 1AAZA 3KXOA 5AN1A 4GQFA 1M7TA 4HZ2A 2DJ1A 5DAKA 3TB2A 1XFLA 4JR4A 1ACVA 2PVOC 2VO4A 4ULXA 1WOUA 2K8VA 4PUFC 5DCGA 2O85A 4N10A 5D73A 3NIVA 4GSNA 2FNOA 1ERTA 2BMXA 2HZEA 1PA3A 4HQZA 3O76A 2X99A 4BVYA 3VPTA 5C00A 2L5LA 5CAXA 3TJFA 5ELGA 2PMTA 4XS4A 2DLXA 1KTEA 5G5FA 2PERA 3KMOA 2CX3A 4IELA 3MNGA 1SKWB 1EEJA 3M0FA 2OA7A 1SYXA 3FRCA 1F37A 4POLA 1FOVA 1AQXA 5ECIB 3ZIVA 1ILOA 1TP9A 2JL4A 2F51A 3I43A 1OE7A 4XIHA 5DJLA 1W4VA 1EP7A 1AW9A 2YCDA 5CO3A 2OKAA 3H93A 5DQYA 2P31A 2LEGA 2V32A 1YKCA 2HFDA 4MCUA 2FHEA 1OYJA 4CDOA 1K0MA 4EL1A 4FYCA 1WWJA 3QPMA 4MP4A 1VF4A 4N0ZA 1XOAA 4NXIA 3W6GA 4WKWA 1J08A 1M99A 1XIYA 2YN1A 4ZBAA 4Q5RA 2TRXA 3E0UA 2O8VB 2H1DA 4V1Ap 3RHCA 1TK5B 2I3YA 1GULA 6GSWA 3QFAC 2ZCTA 1EZKA 3VURA 4TR1A 3NZNA 4RI6A 2LRNA 6GSTA 1MD4A 2VCZA 4K8MA 1FVJA 3CRUA 1GTIA 1Z5YE 3A3TA 2XPEA 5A4WA 1Q98A 2X8HA 3ZTLA 5FWGA 3I69A 3D22A 3RPNA 1PX7A 3F6DA 1YF1A 5DALB 3ME8A 1FB0A 5IMZA 3TDGA 4E8HA 4I2UA 2HZFA 3C8EA 1EOHA 5J3RA 2NTOA 3IC4A 1Y6EA 4OO4A 1B9YC 2H0HA 4HEA2 1XWCA 2ES7A 2VD1A 5EY6A 1M2AA 1VGLA 2YV7A 3VWXA 2XBIA 4IJIA 1UA5A 1PSQA 4L8EA 2M46A 3IA1A 2CQ9A 2A2RA 2FUG2 1AUCA 1JLVA 1PMTA 3DGQA 5J4UA 3G7JA 2JZSA 4ZL9A 3EINA 4WF5A 2B7KA 3FHKA 1TRWA 4F82A 2RIIA 5ECNB 3KIJA 3W8SA 2GZZA 1TKDB 4I8BA 4GF0A 5GSTA 3N9JA 3VWWA 3GRXA 4KX4A 1T8EB 1NHOA 1THOA 2FWGA 2FWFA 2O7KA 3HY2A 2FY6A 3KP8A 4K7OA 1X5DA 3LORA 4MF7A 1XXUA 1M2BA 3GTUB 2IPAA 3IK9A 5LNKe 1XOBA 2JZTA 2VCTA 3BJ5A 3PGTA 3WYWA 3LG6A 4CHSA 4ZBBA 3EC3A 4JE1A 4MMMA 2DSAA 3S9FA 3HXSA 1B8XA 2FA4A 4MJCA 1C72A 3TKSA 4J56E 3ZLPA 1FB6A 4FIWA 5HR3A 2E7PA 1Z7PA 4K0GA 1YY7A 4TXOB 2WFCA 12GSA 2KLXA 5KN3A 1HD2A 2MMAA 4KSMA 3QAVA 2DMMA 2I4AA 3ERWA 3EWLA 3DXBA 2ON5A 4NV2A 1XW6A 2LKUA 4NPBA 3RPPA 1GUKA 3IE3A 4L0WA 1QK8A 2F3MA 4KH7A 3ZYWA 4OCFA 1N8JA 3LQ7A 4BL7A 3C7MA 4HU9A 4F2IA 2ON7A 3IK7A 1A8LA 2F8AA 2AV4A 4KE3A 2X8GA 1B4PA 2OADA 5AISA 2H75A 3L9SA 4G2EA 3I6AA 4POKA 1BG5A 3M3MA 2GLRA 1YQ1A 4GRFA 2WJUA 2QC7A 4MH3A 2CV4A 3EU3A 1CQGA 1M9AA 1F2EA 2P0GA 5H5RA 1GSEA 3ERFA 4ISDA 1B9XC 3GKMA 5ID2A 2K18A 3FW2A 4GTUA 1G0TA 3LFLA 3D6IA 2YPMA 2GT5A 2YV9A 2X64A 1XW5A 1PKZA 2L59A 3GH6A 4BWQA 4ACSA 5KN1A 1ZCPA 2WGRA 3LEFA 1TU7A 2L4QA 4PXOA 4KSOA 2RM5A 1X5EA 1R5PA 1EP8A 4X0XA 3GUSA 4ZB6A 2K8SA 3H79A 4GWRA 1DUGA 2CT6A 4WEYA 1T7PB 2YJ7A 3CSIA 3EURA 3FZ4A 1ZYEA 4V2NA 3UAPA 1UC7A 3ISOA 1A2JA 3CYNA 3TRQA 5IO2A 4LL4B 3FEUA 2ALBA 2LQOA 3F3QA 3OR5A 4OFMA 3GURA 1VF1A 3N5OA 2EIOA 2IFQA 3DWVA 3FY7A 4O92A 3VFIA 2VLTA 3DKSA 1USBA 5F8BA 4GLTA 4KDXA 5G30A 5IM9A 2L6DA 3A5WA 3RHBA 1VF3A 10GSA 3GKKA 3VK9A 1T4ZA 4GQCA 4PUAA 2HI7A 5JWRB 1EV4A 1A23A 3GYKA 4ML1A 2YANA 3QFBC 3L0HA 5A4UA 4KA0A 2PU9C 2WS2A 2H01A 2K9FA 1GWCA 1XPVA 1V9WA 1SD9A 1Z7RA 1ML6A 1WE0A 5E59A 4TRXA 2FLSA 1GSSA 5IPHA 1PRXA 3ZZXA 4I2TA 3WGDA 1OKDA 2CAIA 1MTCA 1TW9A 3ZFBA 4NHZA 3IDVA 3O3TA 3MSZA 1GSDA 3JCML 5J9CA 1O85A 2H6XA 3GV1A 4WBJA 1SJ6A 2EIRA 5J5NA 3P2AA 1N2AA 1SENA 3H4KA 2YWNA 1K0OA 5KN2A 1Z6NA 3VWVA 4WR5A 4IS0A 2HLSA 2HT9A 2GQLA 2YWIA 3HZ8A 4MJEA 2NPBA 2YP6A 4DVCA 1SK2A 4G9HA 3UMAA 4EUYA 2HSHA 4FO5A 4KW6A 2RM6A 4D73B 3UVTA 4WBRD 1OC9B 3A2XA 4WXTA 1AQWA 3EMPA 4IP1A 4TKYA 3CSJA 5IMAA 3DMLA 1GUHA 4J2FA 4PGTA 4ZL8A 3FK8A 3Q74A 2LJRA 2AJQB 3PR8A 4N30A 1SKRB 5IIZA 3CSHA 5D9VA 2C3NA 4XRAA 4TXVA 1QGVA 2N5BA 1MD3A 1TDIA 3G9BA 1HNAA 2H6YA 2J9HA 3CMIA 4XCSA 6GSVA 4XS6A 3QAWA 3BD2A 2I9HA 3EMXA 1THXA 4MLYA 1OC3A 2CZ3A 2DJ3A 3F4RA 4QQ7A 3BCKA 2CVKA 3ZFLA 4FYBA 1GTAA 5ECKB 4X43A 5CRWA 1GSQA 1V58A 3TKSE 3C1SA 1HNCA 3SBCA 2C0EA 3M9JA 4NMUA 4NV5A 1SL2B 3LYPA 1JHBA 3CRTA 1K0AA 2KP2A 4PQHA 1T3BA 1GLPA 3KEBA 2C0GA 1TI3A 4RUVA 5CRGA 2VCQA 1OC8A 1J0FA 2VD0A 1K0DA 2GT6A 4JBBA 5JWQB 2E2MA 3GKNA 20GSA 1Z3EA 3RBTA 2CA8A 2GSTA 4K2DA 2L57A 4YH2A 5J9BA 2C0FA 2K6VA 3L4NA 1T00A 5DALA 4AGSA 4EDYA 3GSSA 5C04A 4HJ2A 3W8JA 1S3AA 2LNSA 4TOPA 5J41A 1QFNA 4IP6A 2C4JA 2PGTA 5IOXA 1A0FA 3HYPA 2XHFA 1F3AA 1V40A 4KNDA 2C0DA 3HJMA 3GSTA 4HU7A 3TKSC 4O32A 3C71A 1MDJA 3F9UA 1KNGA 4P3YB 5A5KA 1JLWA 4ZILA 5ECHB 1VF2A 1A2LA 3FR9A 4K9ZA 1QXHA 1XWBA 2JACA 1PD21 2V1MA 5ECLB 1U87A 4EXJA 4BWSA 2HNLA 6GSXA 1XVQA 1TXXA 4V1Ag 1DE2A 5IMVA 3APQA 2O89A 5KEJA 4IVFA 3CTFA 4GXZA 5IMDA 3FKFA 1R5AA 1U3AA 2IN3A 3BCIA 3EYTA 1GNEA 2H66A 6GSSA 2CZ2A 1TRUA 4F0BA 2H76A 2A2SA 2AHEA 5JCWA 2H0GA 3GTUA 2RUEA 2TIRA 5DBQA 2GDRA 4HZ4A 1K3OA 1YKAA 22GSA 2HSYA 5ELAA 1SD8A 4IHUA 4EVMA 1SYRA 2VL9A 1PL2A 2C8UA 4ECIA 2ZUPA 3CBUA 1PKWA 2JSZA 5B7CA 2HE3A 2L6CA 4K7IA 2VOCA 3ED3A 2PUKC 4HOJA 1BJXA 4TXOA 5F0GA 3IOSA 1FG4A 3M8NA 3UBKA 4JZQA 2ZNMA 5D93A 4MF6A 2JZRA 3LYKA 1O8WA 4V2MA 3NOFA 1NSWA 3F4SA 5B6MA 1H75A 2VCVA 2MZCA 1PGTA 4FH8A 5EL8A 5D9TA 4LMWA 4IQ1A 3KM6A 3P8WA 1GSUA 2XPDA 2DIZA 2OBIA 4AJ7A 4ZIJA 3C1RA 2DJ2A 2LRCA 4O5RA 2D2ZA 4ILFA 3ZRDA 2VIMA 1GTUA 1TI1A 1XCCA 3GX8A 3LXTA 4IW9A 5G5EA 4HUAA 3IBHA 2N5FA 1EWXA 2KUCA 3IPZA 4Q5QA 5IQYA 2VLUA 2MBSA 3EE2A 5HR2A 3L78A 1F6MC 4GSSA 2H72A 1TRVA 4MPGA 2MYGA 1SL1B 2VCXA 1H4OA 4TR3A 2OE0A 3K8NA 11GSA 3TJBA 1K0CA 4WR4A 1GH2A 2H1AA 1M0UA 3HVXA 3G7YA 5CREA 3FZAA 2DBCA 5B8BA 1LJRA 5LCZA 2I81A 3APOA 1YJ6A 5AGYA 1GNWA 1JFUA 4CW9A 5ENUA 1T1VA 4AJ8A 3VWUA 1HQOA 5ECMB 2GGTA 4TR0A 6GSYA 4E8EA 1E6BA 2AB6A 4HQSA 5LD0A 1OE8A 3HKRA 4K7NA 1WJKA 5ECRB 1RK4A 4BA7A 3FR6A 1TK0B 3TRXA 3FYGA 3GN3A 4RQRA 1QUWA 3I9V2 1F9MA 4MABA 5D9WA 4LLRA 4YQVA 1SK1A 1VRSD 2R2JA 4MPFA 3FZ5A 2DJJA 2QKEA 1AIUA 2H73A 4KDYA 2B6MA 5CRDA 4JEDA 3L9UA 2H1GA 4QL7A 2L5OA 2GSQA 4KAEA 4F03A 3TJGA 4H86A 1ZOFA 4MA9A 4BPYA 1UN2A 3US3A 4K0NA 5DDLA 5JCUA 3ERGA 2YWOA 2OE1A 5D9XA 4JRRA 1ON4A 3LGCA 5F07A 1B4QA 2GZYA 4Z7XA 2MMZA 4F0CA 1SL0B 3VPQA 1V98A 3DYRA 3GHAA 2CVDA 1TRSA 1ERUA 4MZCA 1DBYA 4OD7A 2H1BA 2R5GA 2LJAA 3Q19A 3P90A 2WCIA 3ZMLA 5D96A 1O8XA 3WGXA 1EEMA 1QQ2A 4ZB9A 1FHEA 1A24A 17GSA 2LJKA 4AF2A 1YZXA 2VL2A 3E9JB 2IMEA 1IYIA 1FVKA 1TOFA 4PQ1A 3PH9A 3DVWA 2KP1A 1BAYA 2B1LA 3QCPA 3WGEA 3KH9A 1S3DA 3UIWA 2M80A 3HA9A 4MJAA 3H1NA 4DSSB 5B8AA 3ZITA 2B5XA 1S3CA 1O6JA 2E0QA 5B6NA 1NW2A 5HFKA 4MK3A 2JADA 1EGOA 2F8FA 2N5AA 4D73A 1HYUA 3L9VA 1OC9A 4HS1A 3M9KA 4ML6A 5ECOB 2H19A 4ECJA 2R6KA 4XRDA 3J7Yb 2B5EA 2HXKA 5INYA 5KN0A 3IAS2 4IJ3A 1GUMA 8GSSA 3TOTA 1XWKA 2VUPA 4NWYA 3D21A 4G19A 2LNTA 3TKPA 2FWEA 1G6YA 1X9MB 3KH7A 2P5QA 4NHWA 2LS5A 2C80A 4PNGA 2X8CA 3IRAA 2VCWA 2BJXA 3KD0A 3HJPA 3UVHA 5L71A 3HVVA 1U88A 3TKQA 1DSBA 4EF0A 2C3TA 4WETA 2C3QA 1M2DA 1ST9A 1QMVA 3E3EA 1F3BA 5FT3A 5ECQB 2NBSA 3APSA 3ZVJD 1MDIA 2BTOT 5CNWA 4LL1B 1SKSB 4PQIA 1K0BA 1ERVA 1YEXA 1GTBA 1LU4A 2YZUA 1GSYA 2H30A 1J9BA 2MMNA 2KOKA 3LJRA 3TRPA 3V1WA 3HHVA 2GVPA 3HDCA 3QD9A 5EVOA 3WT1A 4I97A 4ECCA 3ZL5A 3F4TA 3IXRA 1WPIA 3ZIJA 1YEPA 2IMIA 2NDOA 2DJKA 4V2LA 4EDZA 1E2YA 2H0IA 5D8IA 2R3XA 2EC4A 3HD5A 2FD3A 5CP1A 2AYTA 3HZ4A 1BEDA 1B48A 1SJZA 2PN8A 1O73A 1ZGNA 1OVNA 3GL3A 2GQMA 4RI7A 5AIXA 1GLQA 4OFTA 4KCAA 3KTLA 4FYUA 2B3SA 4IBPA 3D4MA 5E4WA 3KMNA 3TJKA 3SWLA 2TRCP 1A2MA 5DAKB 5HQPA 3WT2A 4OCEA 5GAND 3GKXA 1ZMAA 2JSYA 5AIVA 4MZWA 1ZZYA 4TN8A 2HZEB 1M9BA 1HNBA 1EGRA 1R26A 5G1KA 5HR1A 2PPTA 4KCEA 2R37A 2LTKA 2DMLA 3UARA 5FHIA 2WB9A 4XS4B 2IMFA 5G2ZA 4IKHA 1U6TA 19GSA 1AQVA 4L0UA 4MZBA 3EVIA 5HFIA 2LRTA 1AC1A 1GSFA 3A2WA 3IHQA 4EE0A 3R2QA 2R4VA 3UJ1A 3M1GA 3HVSA 1A0RP 2CX4A 3GA4A 4L5OA 3U5RE 1MDKA 3ZREA 4JU5A 5CYYA 2IMKA 4YAVA 4NAXA 3UOMA 5COHA 3LXZA 1G7OA 2OJLA 5G1LA 1TU8A 3BOAA 1KEBA 1BX9A 3D0ZA 2IMDA 2V41A 2IJYA 4POMA 1MEKA 3C73A 1DE1A 2FA8A 2QGVA 3VLNA 14GSA 4MDCA 5HR0A 2OE3A 4KB3A 3GH9A 5DQSA 2G0FA 3TUEA 1U3IA 3F6FA 3UBLA 2KHPA 2DIYA 4OFNA 2LUSA 4YQMA 2M72A 2HRNA 3H8QA 4DEJA 1X9WB 9GSSA 2FGXA 4TR1B 5ABRA 2QSIA 1I5GA 3UEMA 3QMXA 2GZPA 1WIKA 1PQNA 3QOUA 5JCGA 2PWJA 3P7XA 4K1FA 2HRFA 2MMOA 4AJ6A
chains in the Genus database with same CATH superfamily
3DEXA 2REMA 2PBJA 3GIXA 3FZ9A 1TJDA 1XW9A 3IV4A 5EPFA 5ECPB 4TR4A 5G31A 2C1YA 2GTUA 4KUNA 1WMJA 1Z6MA 2VLVA 1K3LA 1EV9A 2H74A 1UVZA 5GSSA 1G6WA 1R4WA 5HFGA 1BQ7A 2XBQA 2H71A 3Q6OA 2EIQA 2GSSA 1URMA 2H8LA 2AAWA 4O7HA 4LMVA 1X5CA 1FAAA 2LSTA 2VL2C 4MF5A 2A4VA 4POBA 4XHMA 2AUVA 4DSRA 2WULA 4MH2A 3TOUA 5H5QA 1TTZA 2G2QA 1S3RA 3CTGA 2O87A 1GRXA 3KCMA 1NHYA 4X1UA 4ECBA 3GFKA 1FW1A 2YNXA 1ABAA 4L5LA 1JZDA 2J23A 3GL5A 2L4CA 4XS1A 4K6XA 4YQUA 4PNFA 3MIXA 13GSA 2YOIA 2H70A 3KZQA 3QAGA 3DD3A 2CAQA 5DCHA 3CXGA 2WZ9A 2IWTA 2YZHA 3GMFA 4WF4A 2IL3A 2XC2A 1X0RA 4I5QA 2GS3A 2YJHA 4XTSA 3CQFA 4HDEA 2NVLA 4OMVA 2B7JA 5H5SA 3PINA 1A8YA 1SJIA 4ZBDA 1X9SB 3F8UA 4MNNA 1TK8B 1GP1A 2B1KA 4OWYA 2JU5A 5DJMA 1R7HA 4EO3A 1OAZA 4OO5A 1IYHA 2Z9SA 5F05A 1PN9A 4GSTA 1XVWA 1G7EA 2FCHA 4Q5NA 3LWAA 3QDNA 4DSSA 2HYXA 3Q18A 4HJMA 3TCOA 3HCZA 3HJOA 3F3RA 5CRHA 3ZVJA 4MJBA 18GSA 2GQKA 2UZ8A 2GSRA 4BL7B 3IHGA 2F9SA 1EOGA 3BBYA 3EU4A 6GSUA 1NM3A 2R0GA 3D5JA 4EKZA 4PURA 3DRNA 7GSSA 5GZZB 3F63A 1O7UA 2LQQA 1V2AA 4DSQA 3VI7A 5A4VA 5IPGA 3MWHA 2WDUA 4ZB8A 1ZYNA 1RQMA 3ME7A 1XWGA 4RQXA 1W89A 2VAFA 2OACA 5ECSA 2LV3A 4ZXGA 2X4AA 5ID2B 4YAPA 1XG8A 2V2GA 3MDKA 3WD6A 4USSA 2OBKA 2H6ZA 4ID0A 3LSZA 1PX6A 4N0VA 1JZOA 1JZWA 2VM1A 4HI7A 5KOXA 3QR6A 3VI5A 1Q4JA 3KTBA 4N11A 2RLIA 3FR3A 2E2GA 4ZL7A 3MAKA 1K0NA 3IAM2 3F0IA 1PL1A 2DC5A 2VM2A 4TVEA 4IN0A 3J7Yk 1O81A 4PX1A 3O6TA 3KJYA 3DVXA 4F9ZA 4CY6A 2RUFA 1ZL9A 3KGKA 2V6KA 3AY8A 2VL3A 1GL8A 1ERWA 2PVQA 3GX0A 2I1UA 5F06A 2FWHA 2WRTA 1YDKA 3TGZA 1FO5A 3UL3A 2IIYA 3TKRA 4I6XA 5GAPD 5DVBA 4LA1A 1OKTA 3A2VA 1RW1A 4A5PA 16GSA 5IOWA 4BVXA 4QL9A 2V6OA 3ZMKA 4Q5FA 1YF0A 1WP0A 1I9DA 2IFQB 4FQUA 4G10A 1T4YA 2MBTA 1WRYA 3TJJA 2DJ0A 5IMFA 4EC0A 5IMCA 2YWMA 3G7IA 2B5YA 5IO0A 3RAZA 1SU9A 3U6VA 4IQAA 1AXDA 4KGIA 4IGJA 4GCIA 4J57E 3KP9A 4TW5A 1BYEA 1K3YA 3GNJA 1XBSA 2CVBA 3D4TA 1JZRA 3RDWA 5KOWA 1XZOA 1XWAA 4KDUA 3DIEA 5JWOB 2P5RA 3IR4A 1Z9HA 4JR6A 1M3JA 1LBKA 1V57A 1SK0A 1CQHA 1ZYQB 1KBNA 1Y25A 1AAZA 3KXOA 5AN1A 4GQFA 1M7TA 4HZ2A 2DJ1A 5DAKA 3TB2A 1XFLA 4JR4A 1ACVA 4EIPA 2PVOC 2VO4A 4ULXA 1WOUA 2K8VA 4PUFC 5DCGA 2O85A 4N10A 5D73A 3NIVA 4GSNA 2FNOA 1ERTA 2BMXA 2HZEA 1PA3A 4HQZA 3O76A 2X99A 4BVYA 3VPTA 5C00A 2L5LA 5CAXA 3TJFA 5ELGA 2PMTA 4XS4A 2DLXA 1KTEA 5G5FA 2PERA 3KMOA 2QA1A 2CX3A 4IELA 3MNGA 1SKWB 1EEJA 3M0FA 2OA7A 1SYXA 3FRCA 1F37A 2HSMA 4POLA 1FOVA 1AQXA 5ECIB 3ZIVA 1ILOA 1TP9A 2JL4A 2F51A 3I43A 1OE7A 4XIHA 5DJLA 1W4VA 1EP7A 1AW9A 2YCDA 5CO3A 2OKAA 3H93A 5DQYA 2P31A 2LEGA 3MYDA 2V32A 1YKCA 2HFDA 4MCUA 2FHEA 1OYJA 4CDOA 1K0MA 4EL1A 4FYCA 1WWJA 3QPMA 4MP4A 1VF4A 4N0ZA 1XOAA 4NXIA 3W6GA 4WKWA 4YKFA 1J08A 1M99A 1XIYA 2YN1A 4ZBAA 4Q5RA 2TRXA 3E0UA 2O8VB 2H1DA 2R0CA 4V1Ap 3RHCA 1TK5B 2I3YA 1GULA 6GSWA 3QFAC 2ZCTA 1EZKA 3VURA 4TR1A 3NZNA 4RI6A 2LRNA 6GSTA 1MD4A 2VCZA 4O5QA 4K8MA 1FVJA 4HSCX 3CRUA 2QA2A 1GTIA 1Z5YE 3A3TA 2XPEA 5A4WA 1Q98A 2X8HA 3ZTLA 5FWGA 3I69A 3D22A 1PN0A 3RPNA 1PX7A 3F6DA 1YF1A 5DALB 3ME8A 1FB0A 5IMZA 3TDGA 4E8HA 4I2UA 2HZFA 3C8EA 1EOHA 5J3RA 2NTOA 3IC4A 1Y6EA 4OO4A 1B9YC 2H0HA 4HEA2 1XWCA 2ES7A 2VD1A 5EY6A 1M2AA 1VGLA 2YV7A 3VWXA 2XBIA 4IJIA 1UA5A 1PSQA 4L8EA 2M46A 3IA1A 2CQ9A 2A2RA 2FUG2 1AUCA 1JLVA 1PMTA 3DGQA 5J4UA 3G7JA 2JZSA 4ZL9A 3EINA 4WF5A 2B7KA 3FHKA 1TRWA 4F82A 2RIIA 5ECNB 3KIJA 3W8SA 2GZZA 1TKDB 4I8BA 4GF0A 5GSTA 3N9JA 3VWWA 3GRXA 4KX4A 1T8EB 1NHOA 1THOA 2FWGA 2FWFA 2O7KA 3HY2A 2FY6A 3KP8A 4K7OA 1X5DA 3LORA 4MF7A 1XXUA 1M2BA 3GTUB 2IPAA 3IK9A 5LNKe 1XOBA 2JZTA 2VCTA 3BJ5A 3PGTA 3WYWA 3LG6A 4CHSA 4ZBBA 3EC3A 4JE1A 4MMMA 2DSAA 3S9FA 3HXSA 1B8XA 2FA4A 4MJCA 1C72A 3TKSA 4J56E 3ZLPA 1FB6A 4FIWA 5HR3A 2E7PA 1Z7PA 4K0GA 1YY7A 4TXOB 1PFOA 12GSA 2WFCA 2KLXA 5KN3A 1HD2A 2MMAA 4KSMA 3QAVA 2DMMA 2I4AA 3ERWA 3EWLA 3DXBA 2ON5A 5BMUA 4NV2A 1XW6A 2LKUA 4NPBA 3RPPA 1GUKA 3IE3A 4L0WA 1QK8A 2F3MA 4KH7A 3ZYWA 4OCFA 1N8JA 3LQ7A 4BL7A 3C7MA 4HU9A 4F2IA 2ON7A 3IK7A 1A8LA 2F8AA 2AV4A 4KE3A 2X8GA 1B4PA 2OADA 5AISA 2H75A 3L9SA 4G2EA 3I6AA 4POKA 1BG5A 3M3MA 2GLRA 1YQ1A 4GRFA 1ZYPA 2WJUA 2QC7A 4MH3A 2CV4A 3EU3A 4X4JA 1CQGA 1M9AA 1F2EA 2P0GA 5H5RA 1GSEA 3ERFA 4Z2UA 4ISDA 1B9XC 3GKMA 5ID2A 2K18A 3FW2A 4GTUA 1G0TA 3LFLA 3D6IA 2YPMA 2GT5A 2YV9A 2X64A 1XW5A 1PKZA 2L59A 3GH6A 4BWQA 4ACSA 5KN1A 1ZCPA 2WGRA 3LEFA 1TU7A 2L4QA 4PXOA 4KSOA 2RM5A 1X5EA 1R5PA 4YKGA 1EP8A 4X0XA 3GUSA 4ZB6A 2K8SA 3H79A 4GWRA 1DUGA 2CT6A 4WEYA 1T7PB 2YJ7A 3CSIA 3EURA 3FZ4A 1ZYEA 4V2NA 3UAPA 4CY8A 1UC7A 3ISOA 1A2JA 3CYNA 3TRQA 5IO2A 4LL4B 3FEUA 2ALBA 2LQOA 3F3QA 3OR5A 4OFMA 3GURA 1VF1A 3N5OA 2EIOA 2IFQA 3DWVA 3FY7A 4O92A 3VFIA 2VLTA 3DKSA 1USBA 5F8BA 4GLTA 4KDXA 5G30A 5IM9A 2L6DA 3A5WA 3RHBA 1VF3A 10GSA 4O5UA 3GKKA 3VK9A 1T4ZA 4GQCA 4PUAA 2HI7A 5JWRB 1EV4A 1A23A 3GYKA 4ML1A 2YANA 3QFBC 3L0HA 5A4UA 4KA0A 2PU9C 2WS2A 2H01A 2K9FA 1GWCA 1XPVA 1V9WA 1SD9A 1Z7RA 1ML6A 1WE0A 5E59A 4TRXA 2FLSA 1GSSA 5IPHA 1PRXA 3ZZXA 4I2TA 3WGDA 1OKDA 2CAIA 1MTCA 2HRAA 1TW9A 3ZFBA 4NHZA 3IDVA 3O3TA 1M3IA 3MSZA 1GSDA 3JCML 5J9CA 1O85A 2H6XA 3GV1A 4WBJA 1SJ6A 2EIRA 5J5NA 5BRTA 3P2AA 1N2AA 4G0IA 1SENA 3H4KA 2YWNA 1K0OA 5KN2A 1Z6NA 3VWVA 4WR5A 4IS0A 2HLSA 2HT9A 2GQLA 2YWIA 3HZ8A 4MJEA 4Z2TA 2R0PA 2NPBA 2YP6A 4DVCA 1SK2A 4G9HA 3UMAA 4EUYA 2HSHA 4FO5A 4KW6A 2RM6A 4D73B 3UVTA 3FMWA 4WBRD 1OC9B 3A2XA 4WXTA 1AQWA 3EMPA 4IP1A 4TKYA 3CSJA 5IMAA 3DMLA 1GUHA 4J2FA 4PGTA 4ZL8A 3FK8A 3Q74A 2LJRA 2AJQB 3PPUA 3PR8A 4N30A 1SKRB 5IIZA 3CSHA 5D9VA 2C3NA 4XRAA 4TXVA 1QGVA 2N5BA 1MD3A 1TDIA 3G9BA 1HNAA 2H6YA 2J9HA 3CMIA 4XCSA 6GSVA 4XS6A 3QAWA 3BD2A 2I9HA 3EMXA 1THXA 4MLYA 1OC3A 2CZ3A 2DJ3A 3F4RA 4QQ7A 3BCKA 2CVKA 3ZFLA 4FYBA 1GTAA 5ECKB 4X43A 5CRWA 1GSQA 1V58A 3TKSE 3C1SA 1HNCA 3SBCA 2C0EA 3M9JA 4NMUA 4NV5A 1SL2B 3LYPA 1JHBA 3CRTA 1K0AA 2KP2A 4PQHA 4K5RA 1T3BA 4KF9A 1GLPA 3KEBA 2C0GA 1TI3A 1FOHA 4RUVA 5CRGA 2VCQA 1OC8A 1J0FA 2VD0A 1K0DA 2GT6A 4JBBA 5JWQB 2E2MA 3GKNA 20GSA 1Z3EA 3RBTA 2CA8A 2GSTA 4K2DA 2L57A 4YH2A 5J9BA 2C0FA 2K6VA 3L4NA 1T00A 5DALA 4AGSA 4EDYA 3GSSA 5C04A 4HJ2A 3W8JA 1S3AA 2LNSA 4TOPA 5J41A 1QFNA 4IP6A 2C4JA 2PGTA 5IOXA 1A0FA 3HYPA 2XHFA 1F3AA 1V40A 4KNDA 3IC8A 2C0DA 3HJMA 3GSTA 4HU7A 3TKSC 4O32A 3C71A 1MDJA 3F9UA 1KNGA 4P3YB 5A5KA 1JLWA 4ZILA 5ECHB 1VF2A 1A2LA 3FR9A 4K9ZA 1QXHA 1XWBA 2JACA 1PD21 2V1MA 5ECLB 1U87A 4EXJA 4BWSA 2HNLA 6GSXA 1XVQA 1TXXA 4V1Ag 1DE2A 4K5SA 5IMVA 3APQA 2O89A 5KEJA 4IVFA 3CTFA 4GXZA 5IMDA 3FKFA 1R5AA 1U3AA 2IN3A 3BCIA 3EYTA 1GNEA 2DKIA 2H66A 3HVNA 6GSSA 2CZ2A 1TRUA 4F0BA 2H76A 2A2SA 2AHEA 5JCWA 2H0GA 3GTUA 2RUEA 2TIRA 5DBQA 2GDRA 4HZ4A 1K3OA 1YKAA 22GSA 2HSYA 5ELAA 1SD8A 4IHUA 4ICYA 4EVMA 1SYRA 2VL9A 1PL2A 2C8UA 4ECIA 2ZUPA 3CBUA 1PKWA 2JSZA 5B7CA 2HE3A 2L6CA 4K7IA 2VOCA 3ED3A 2PUKC 4HOJA 1BJXA 4TXOA 5F0GA 3IOSA 1FG4A 3M8NA 3UBKA 4JZQA 2ZNMA 5D93A 4MF6A 2JZRA 3LYKA 1O8WA 4V2MA 3NOFA 1NSWA 3F4SA 5B6MA 1H75A 2VCVA 2MZCA 1PGTA 4FH8A 5EL8A 5D9TA 4LMWA 4IQ1A 3KM6A 3P8WA 1GSUA 2XPDA 2DIZA 2OBIA 4AJ7A 4ZIJA 3C1RA 2DJ2A 2LRCA 4O5RA 2D2ZA 4ILFA 3ZRDA 2X49A 2VIMA 1GTUA 1TI1A 1XCCA 3GX8A 3LXTA 4IW9A 5G5EA 4HUAA 3IBHA 2N5FA 1EWXA 2KUCA 3IPZA 4Q5QA 5IQYA 2VLUA 2MBSA 3EE2A 5HR2A 3L78A 1F6MC 4GSSA 2H72A 1TRVA 4MPGA 2MYGA 1SL1B 2VCXA 1H4OA 4TR3A 2OE0A 3K8NA 11GSA 3TJBA 1K0CA 4WR4A 1GH2A 2H1AA 1M0UA 3HVXA 3G7YA 5CREA 3FZAA 2DBCA 5B8BA 1LJRA 5LCZA 2I81A 3APOA 1YJ6A 5AGYA 1GNWA 1JFUA 4CW9A 5ENUA 1T1VA 4AJ8A 3VWUA 1HQOA 5ECMB 2GGTA 4TR0A 6GSYA 2HRKA 4E8EA 1E6BA 2AB6A 3LW9A 4HQSA 5LD0A 1OE8A 3HKRA 4K7NA 1WJKA 5ECRB 1RK4A 4BA7A 3FR6A 1TK0B 3TRXA 3FYGA 3GN3A 4RQRA 1QUWA 3I9V2 1F9MA 4MABA 5D9WA 4LLRA 4YQVA 1SK1A 1VRSD 2R2JA 4MPFA 3FZ5A 2DJJA 2QKEA 1AIUA 2H73A 4KDYA 2B6MA 5CRDA 4JEDA 3L9UA 2H1GA 4QL7A 2L5OA 2GSQA 4KAEA 4F03A 3TJGA 4H86A 1ZOFA 4MA9A 4BPYA 1UN2A 3US3A 4K0NA 5DDLA 5JCUA 3ERGA 2YWOA 2OE1A 5D9XA 4JRRA 1ON4A 3LGCA 5F07A 1B4QA 2GZYA 4Z7XA 2MMZA 4F0CA 1SL0B 3EPTA 3VPQA 1V98A 3DYRA 3GHAA 2CVDA 1TRSA 1ERUA 4MZCA 1DBYA 4OD7A 2H1BA 2R5GA 2LJAA 3Q19A 3P90A 2WCIA 3ZMLA 5D96A 1O8XA 3WGXA 1EEMA 1QQ2A 4ZB9A 1FHEA 1A24A 17GSA 2LJKA 4AF2A 1YZXA 2VL2A 3E9JB 2IMEA 1IYIA 2A2PA 1FVKA 1TOFA 4PQ1A 3PH9A 3DVWA 2KP1A 1BAYA 2B1LA 3QCPA 3WGEA 3KH9A 1S3DA 3UIWA 2M80A 3HA9A 4MJAA 3H1NA 4DSSB 5B8AA 3ZITA 2B5XA 1S3CA 1O6JA 2E0QA 5B6NA 1NW2A 5HFKA 4MK3A 2JADA 1EGOA 2F8FA 2N5AA 4D73A 1HYUA 3L9VA 1OC9A 4HS1A 3M9KA 4ML6A 5ECOB 2H19A 4ECJA 4Z2RA 2R6KA 4XRDA 3J7Yb 2B5EA 2HXKA 5INYA 5KN0A 3IAS2 4IJ3A 1GUMA 8GSSA 3TOTA 3R3EA 1XWKA 2VUPA 4NWYA 3D21A 4G19A 2LNTA 3TKPA 2FWEA 1G6YA 1X9MB 3KH7A 2P5QA 4NHWA 2LS5A 2C80A 4PNGA 2X8CA 3IRAA 2VCWA 2BJXA 3KD0A 3HJPA 3UVHA 5L71A 3HVVA 1U88A 3TKQA 1DSBA 4EF0A 2C3TA 4WETA 2C3QA 1M2DA 1ST9A 1QMVA 3E3EA 1F3BA 5FT3A 5ECQB 2NBSA 3APSA 4PTSA 3ZVJD 1MDIA 2BTOT 5CNWA 4LL1B 1SKSB 4PQIA 1K0BA 1ERVA 1YEXA 1GTBA 1LU4A 2YZUA 1GSYA 2H30A 4BVXB 1J9BA 2MMNA 2KOKA 3LJRA 3TRPA 3V1WA 3HHVA 2GVPA 3HDCA 3QD9A 5EVOA 3WT1A 4I97A 4ECCA 3ZL5A 3F4TA 3IXRA 1WPIA 3ZIJA 1YEPA 2IMIA 2NDOA 2DJKA 4V2LA 4EDZA 1E2YA 2H0IA 5D8IA 2R3XA 2EC4A 3HD5A 2FD3A 5CP1A 2AYTA 3HZ4A 1BEDA 1B48A 1SJZA 2PN8A 4G0LA 1O73A 1ZGNA 1OVNA 3A5IA 3GL3A 2GQMA 4RI7A 5AIXA 1GLQA 4OFTA 4KCAA 3KTLA 4FYUA 2B3SA 4IBPA 3D4MA 5E4WA 3KMNA 3TJKA 3SWLA 2DKHA 2TRCP 1A2MA 5DAKB 5HQPA 3WT2A 4OCEA 4G0KA 5GAND 3GKXA 1ZMAA 2JSYA 5AIVA 4MZWA 1ZZYA 4TN8A 2HZEB 1M9BA 1HNBA 1EGRA 1R26A 5G1KA 4BVYB 5HR1A 2PPTA 4KCEA 2R37A 2LTKA 2DMLA 3UARA 5FHIA 2WB9A 4XS4B 2IMFA 5G2ZA 4IKHA 1U6TA 19GSA 1AQVA 4L0UA 2A4HA 4MZBA 3EVIA 5HFIA 2LRTA 1AC1A 1GSFA 3A2WA 3IHQA 4EE0A 3R2QA 2R4VA 3UJ1A 3M1GA 3HVSA 1A0RP 2CX4A 3GA4A 4L5OA 3U5RE 1MDKA 3ZREA 4JU5A 5CYYA 2IMKA 4YAVA 4NAXA 3UOMA 5COHA 3LXZA 1G7OA 2OJLA 5G1LA 1TU8A 3BOAA 1KEBA 1BX9A 3D0ZA 2IMDA 4EIQA 2V41A 2IJYA 4POMA 1MEKA 3C73A 1DE1A 2FA8A 2QGVA 3VLNA 14GSA 4MDCA 5HR0A 2OE3A 4KB3A 3GH9A 5DQSA 2G0FA 3TUEA 1U3IA 3F6FA 3UBLA 2KHPA 2DIYA 4K2XA 4OFNA 2LUSA 4YQMA 2M72A 2HRNA 3H8QA 4DEJA 1X9WB 9GSSA 2FGXA 4TR1B 4BIKA 5ABRA 2QSIA 1I5GA 3UEMA 3QMXA 2GZPA 1WIKA 1PQNA 3QOUA 5JCGA 2PWJA 3P7XA 4K1FA 2HRFA 2MMOA 4AJ6A
chains in the Genus database with same CATH topology
3DEXA 2REMA 2PBJA 3GIXA 3FZ9A 1TJDA 1XW9A 3IV4A 5EPFA 5ECPB 4TR4A 5G31A 2C1YA 2GTUA 4KUNA 1WMJA 1Z6MA 2VLVA 1K3LA 1EV9A 2H74A 1UVZA 5GSSA 1G6WA 1R4WA 5HFGA 1BQ7A 2XBQA 2H71A 3Q6OA 2EIQA 2GSSA 1URMA 2H8LA 2AAWA 4O7HA 4LMVA 1X5CA 1FAAA 2LSTA 2VL2C 4MF5A 2A4VA 4POBA 4XHMA 2AUVA 4DSRA 2WULA 4MH2A 3TOUA 5H5QA 1TTZA 2G2QA 3CTGA 2O87A 1GRXA 3KCMA 1NHYA 4X1UA 4ECBA 3GFKA 1FW1A 2YNXA 1ABAA 4L5LA 1JZDA 2J23A 3GL5A 2L4CA 4XS1A 4K6XA 4YQUA 4PNFA 3MIXA 13GSA 2YOIA 2H70A 3KZQA 3QAGA 3DD3A 2CAQA 5DCHA 3CXGA 2WZ9A 2IWTA 2YZHA 3GMFA 4WF4A 2IL3A 2XC2A 1X0RA 4I5QA 2GS3A 2YJHA 4XTSA 4HDEA 2NVLA 4OMVA 2B7JA 5H5SA 3PINA 1A8YA 1SJIA 4ZBDA 1X9SB 3F8UA 4MNNA 1TK8B 1GP1A 2B1KA 4OWYA 2JU5A 5DJMA 1R7HA 4EO3A 1OAZA 4OO5A 1IYHA 2Z9SA 5F05A 1PN9A 4GSTA 1XVWA 1G7EA 2FCHA 4Q5NA 3LWAA 3QDNA 4DSSA 2HYXA 3Q18A 4HJMA 3TCOA 3HCZA 3HJOA 3F3RA 5CRHA 3ZVJA 4MJBA 18GSA 2GQKA 2UZ8A 2GSRA 4BL7B 3IHGA 2F9SA 1EOGA 3BBYA 3EU4A 6GSUA 1NM3A 2R0GA 3D5JA 4EKZA 4PURA 3DRNA 7GSSA 5GZZB 3F63A 1O7UA 2LQQA 1V2AA 4DSQA 3VI7A 5A4VA 5IPGA 3MWHA 2WDUA 4ZB8A 1ZYNA 1RQMA 3ME7A 1XWGA 4RQXA 1W89A 2VAFA 2OACA 5ECSA 2LV3A 4ZXGA 2X4AA 5ID2B 4YAPA 2V2GA 3MDKA 3WD6A 4USSA 2OBKA 2H6ZA 4ID0A 3LSZA 1PX6A 4N0VA 1JZOA 1JZWA 2VM1A 4HI7A 5KOXA 3QR6A 3VI5A 1Q4JA 3KTBA 4N11A 2RLIA 3FR3A 2E2GA 4ZL7A 3MAKA 1K0NA 3IAM2 3F0IA 1PL1A 2DC5A 2VM2A 4TVEA 4IN0A 3J7Yk 1O81A 4PX1A 3O6TA 3KJYA 3DVXA 4F9ZA 4CY6A 2RUFA 1ZL9A 3KGKA 2V6KA 3AY8A 2VL3A 1GL8A 1ERWA 2PVQA 3GX0A 2I1UA 5F06A 2FWHA 2WRTA 1YDKA 3TGZA 1FO5A 3UL3A 2IIYA 3TKRA 4I6XA 5GAPD 5DVBA 4LA1A 1OKTA 3A2VA 1RW1A 4A5PA 16GSA 5IOWA 4BVXA 4QL9A 2V6OA 3ZMKA 4Q5FA 1YF0A 1WP0A 1I9DA 2IFQB 4FQUA 4G10A 1T4YA 2MBTA 1WRYA 3TJJA 2DJ0A 5IMFA 4EC0A 5IMCA 2YWMA 3G7IA 2B5YA 5IO0A 3RAZA 1SU9A 3U6VA 4IQAA 1AXDA 4KGIA 4IGJA 4GCIA 4J57E 3KP9A 4TW5A 1BYEA 1K3YA 3GNJA 1XBSA 2CVBA 3D4TA 1JZRA 3RDWA 5KOWA 1XZOA 1XWAA 4KDUA 3DIEA 5JWOB 2P5RA 3IR4A 1Z9HA 4JR6A 1LBKA 1V57A 1SK0A 1CQHA 1ZYQB 1KBNA 1Y25A 1AAZA 3KXOA 5AN1A 4GQFA 1M7TA 4HZ2A 2DJ1A 5DAKA 3TB2A 1XFLA 4JR4A 1ACVA 4EIPA 2PVOC 2VO4A 4ULXA 1WOUA 2K8VA 4PUFC 5DCGA 2O85A 4N10A 5D73A 3NIVA 4GSNA 2FNOA 1ERTA 2BMXA 2HZEA 1PA3A 4HQZA 3O76A 2X99A 4BVYA 3VPTA 5C00A 2L5LA 5CAXA 3TJFA 5ELGA 2PMTA 4XS4A 2DLXA 1KTEA 5G5FA 2PERA 3KMOA 2QA1A 2CX3A 4IELA 3MNGA 1SKWB 1EEJA 3M0FA 2OA7A 1SYXA 3FRCA 1F37A 2HSMA 4POLA 1FOVA 1AQXA 5ECIB 3ZIVA 1ILOA 1TP9A 2JL4A 2F51A 3I43A 1OE7A 4XIHA 5DJLA 1W4VA 1EP7A 1AW9A 2YCDA 5CO3A 2OKAA 3H93A 5DQYA 2P31A 2LEGA 3MYDA 2V32A 1YKCA 2HFDA 4MCUA 2FHEA 1OYJA 4CDOA 1K0MA 4EL1A 4FYCA 1WWJA 3QPMA 4MP4A 1VF4A 4N0ZA 1XOAA 4NXIA 3W6GA 4WKWA 4YKFA 1J08A 1M99A 1XIYA 2YN1A 4ZBAA 4Q5RA 2TRXA 3E0UA 2O8VB 2H1DA 2R0CA 4V1Ap 3RHCA 1TK5B 2I3YA 1GULA 6GSWA 3QFAC 2ZCTA 1EZKA 3VURA 4TR1A 3NZNA 4RI6A 2LRNA 6GSTA 1MD4A 2VCZA 4O5QA 4K8MA 1FVJA 3CRUA 2QA2A 1GTIA 1Z5YE 3A3TA 2XPEA 5A4WA 1Q98A 2X8HA 3ZTLA 5FWGA 3I69A 3D22A 1PN0A 3RPNA 1PX7A 3F6DA 1YF1A 5DALB 3ME8A 1FB0A 5IMZA 3TDGA 4E8HA 4I2UA 2HZFA 3C8EA 1EOHA 5J3RA 2NTOA 3IC4A 1Y6EA 4OO4A 1B9YC 2H0HA 4HEA2 1XWCA 2ES7A 2VD1A 5EY6A 1M2AA 1VGLA 2YV7A 3VWXA 2XBIA 4IJIA 1UA5A 1PSQA 4L8EA 2M46A 3IA1A 2CQ9A 2A2RA 2FUG2 1AUCA 1JLVA 1PMTA 3DGQA 5J4UA 3G7JA 2JZSA 4ZL9A 3EINA 4WF5A 2B7KA 3FHKA 1TRWA 4F82A 2RIIA 5ECNB 3KIJA 3W8SA 2GZZA 1TKDB 4I8BA 4GF0A 5GSTA 3N9JA 3VWWA 3GRXA 4KX4A 1T8EB 1NHOA 1THOA 2FWGA 2FWFA 2O7KA 3HY2A 2FY6A 3KP8A 4K7OA 1X5DA 3LORA 4MF7A 1XXUA 1M2BA 3GTUB 2IPAA 3IK9A 5LNKe 1XOBA 2JZTA 2VCTA 3BJ5A 3PGTA 3WYWA 3LG6A 4CHSA 4ZBBA 3EC3A 4JE1A 4MMMA 2DSAA 3S9FA 3HXSA 1B8XA 2FA4A 4MJCA 1C72A 3TKSA 4J56E 3ZLPA 1FB6A 4FIWA 5HR3A 2E7PA 1Z7PA 4K0GA 1YY7A 4TXOB 2WFCA 12GSA 2KLXA 5KN3A 1HD2A 2MMAA 4KSMA 3QAVA 2DMMA 2I4AA 3ERWA 3EWLA 3DXBA 2ON5A 5BMUA 4NV2A 1XW6A 2LKUA 4NPBA 3RPPA 1GUKA 3IE3A 4L0WA 1QK8A 2F3MA 4KH7A 3ZYWA 4OCFA 1N8JA 3LQ7A 4BL7A 3C7MA 4HU9A 4F2IA 2ON7A 3IK7A 1A8LA 2F8AA 2AV4A 4KE3A 2X8GA 1B4PA 2OADA 5AISA 2H75A 3L9SA 4G2EA 3I6AA 4POKA 1BG5A 3M3MA 2GLRA 1YQ1A 4GRFA 1ZYPA 2WJUA 2QC7A 4MH3A 2CV4A 3EU3A 4X4JA 1CQGA 1M9AA 1F2EA 2P0GA 5H5RA 1GSEA 3ERFA 4Z2UA 4ISDA 1B9XC 3GKMA 5ID2A 2K18A 3FW2A 4GTUA 1G0TA 3LFLA 3D6IA 2YPMA 2GT5A 2YV9A 2X64A 1XW5A 1PKZA 2L59A 3GH6A 4BWQA 4ACSA 5KN1A 1ZCPA 2WGRA 3LEFA 1TU7A 2L4QA 4PXOA 4KSOA 2RM5A 1X5EA 1R5PA 4YKGA 1EP8A 4X0XA 3GUSA 4ZB6A 2K8SA 3H79A 4GWRA 1DUGA 2CT6A 4WEYA 1T7PB 2YJ7A 3CSIA 3EURA 3FZ4A 1ZYEA 4V2NA 3UAPA 4CY8A 1UC7A 3ISOA 1A2JA 3CYNA 3TRQA 5IO2A 4LL4B 3FEUA 2ALBA 2LQOA 3F3QA 3OR5A 4OFMA 3GURA 1VF1A 3N5OA 2EIOA 2IFQA 3DWVA 3FY7A 4O92A 3VFIA 2VLTA 3DKSA 1USBA 5F8BA 4GLTA 4KDXA 5G30A 5IM9A 2L6DA 3A5WA 3RHBA 1VF3A 10GSA 4O5UA 3GKKA 3VK9A 1T4ZA 4GQCA 4PUAA 2HI7A 5JWRB 1EV4A 1A23A 3GYKA 4ML1A 2YANA 3QFBC 3L0HA 5A4UA 4KA0A 2PU9C 2WS2A 2H01A 2K9FA 1GWCA 1XPVA 1V9WA 1SD9A 1Z7RA 1ML6A 1WE0A 5E59A 4TRXA 2FLSA 1GSSA 5IPHA 1PRXA 3ZZXA 4I2TA 3WGDA 1OKDA 2CAIA 1MTCA 2HRAA 1TW9A 3ZFBA 4NHZA 3IDVA 3O3TA 3MSZA 1GSDA 3JCML 5J9CA 1O85A 2H6XA 3GV1A 4WBJA 1SJ6A 2EIRA 5J5NA 5BRTA 3P2AA 1N2AA 4G0IA 1SENA 3H4KA 2YWNA 1K0OA 5KN2A 1Z6NA 3VWVA 4WR5A 4IS0A 2HLSA 2HT9A 2GQLA 2YWIA 3HZ8A 4MJEA 4Z2TA 2R0PA 2NPBA 2YP6A 4DVCA 1SK2A 4G9HA 3UMAA 4EUYA 2HSHA 4FO5A 4KW6A 2RM6A 4D73B 3UVTA 3FMWA 4WBRD 1OC9B 3A2XA 4WXTA 1AQWA 3EMPA 4IP1A 4TKYA 3CSJA 5IMAA 3DMLA 1GUHA 4J2FA 4PGTA 4ZL8A 3FK8A 3Q74A 2LJRA 2AJQB 3PPUA 3PR8A 4N30A 1SKRB 5IIZA 3CSHA 5D9VA 2C3NA 4XRAA 4TXVA 1QGVA 2N5BA 1MD3A 1TDIA 3G9BA 1HNAA 2H6YA 2J9HA 3CMIA 4XCSA 6GSVA 4XS6A 3QAWA 3BD2A 2I9HA 3EMXA 1THXA 4MLYA 1OC3A 2CZ3A 2DJ3A 3F4RA 4QQ7A 3BCKA 2CVKA 3ZFLA 4FYBA 1GTAA 5ECKB 4X43A 5CRWA 1GSQA 1V58A 3TKSE 3C1SA 1HNCA 3SBCA 2C0EA 3M9JA 4NMUA 4NV5A 1SL2B 3LYPA 1JHBA 3CRTA 1K0AA 2KP2A 4PQHA 4K5RA 1T3BA 4KF9A 1GLPA 3KEBA 2C0GA 1TI3A 1FOHA 4RUVA 5CRGA 2VCQA 1OC8A 1J0FA 2VD0A 1K0DA 2GT6A 4JBBA 5JWQB 2E2MA 3GKNA 20GSA 1Z3EA 3RBTA 2CA8A 2GSTA 4K2DA 2L57A 4YH2A 5J9BA 2C0FA 2K6VA 3L4NA 1T00A 5DALA 4AGSA 4EDYA 3GSSA 5C04A 4HJ2A 3W8JA 1S3AA 2LNSA 4TOPA 5J41A 1QFNA 4IP6A 2C4JA 2PGTA 5IOXA 1A0FA 3HYPA 2XHFA 1F3AA 1V40A 4KNDA 3IC8A 2C0DA 3HJMA 3GSTA 4HU7A 3TKSC 4O32A 3C71A 1MDJA 3F9UA 1KNGA 4P3YB 5A5KA 1JLWA 4ZILA 5ECHB 1VF2A 1A2LA 3FR9A 4K9ZA 1QXHA 1XWBA 2JACA 1PD21 2V1MA 5ECLB 1U87A 4EXJA 4BWSA 2HNLA 6GSXA 1XVQA 1TXXA 4V1Ag 1DE2A 4K5SA 5IMVA 3APQA 2O89A 5KEJA 4IVFA 3CTFA 4GXZA 5IMDA 3FKFA 1R5AA 1U3AA 2IN3A 3BCIA 3EYTA 1GNEA 2DKIA 2H66A 6GSSA 2CZ2A 1TRUA 4F0BA 2H76A 2A2SA 2AHEA 5JCWA 2H0GA 3GTUA 2RUEA 2TIRA 5DBQA 2GDRA 4HZ4A 1K3OA 1YKAA 22GSA 2HSYA 5ELAA 1SD8A 4IHUA 4ICYA 4EVMA 1SYRA 2VL9A 1PL2A 2C8UA 4ECIA 2ZUPA 3CBUA 1PKWA 2JSZA 5B7CA 2HE3A 2L6CA 4K7IA 2VOCA 3ED3A 2PUKC 4HOJA 1BJXA 4TXOA 5F0GA 3IOSA 1FG4A 3M8NA 3UBKA 4JZQA 2ZNMA 5D93A 4MF6A 2JZRA 3LYKA 1O8WA 4V2MA 3NOFA 1NSWA 3F4SA 5B6MA 1H75A 2VCVA 2MZCA 1PGTA 4FH8A 5EL8A 5D9TA 4LMWA 4IQ1A 3KM6A 3P8WA 1GSUA 2XPDA 2DIZA 2OBIA 4AJ7A 4ZIJA 3C1RA 2DJ2A 2LRCA 4O5RA 2D2ZA 4ILFA 3ZRDA 2X49A 2VIMA 1GTUA 1TI1A 1XCCA 3GX8A 3LXTA 4IW9A 5G5EA 4HUAA 3IBHA 2N5FA 1EWXA 2KUCA 3IPZA 4Q5QA 5IQYA 2VLUA 2MBSA 3EE2A 5HR2A 3L78A 1F6MC 4GSSA 2H72A 1TRVA 4MPGA 2MYGA 1SL1B 2VCXA 1H4OA 4TR3A 2OE0A 3K8NA 11GSA 3TJBA 1K0CA 4WR4A 1GH2A 2H1AA 1M0UA 3HVXA 3G7YA 5CREA 3FZAA 2DBCA 5B8BA 1LJRA 5LCZA 2I81A 3APOA 1YJ6A 5AGYA 1GNWA 1JFUA 4CW9A 5ENUA 1T1VA 4AJ8A 3VWUA 1HQOA 5ECMB 2GGTA 4TR0A 6GSYA 2HRKA 4E8EA 1E6BA 2AB6A 3LW9A 4HQSA 5LD0A 1OE8A 3HKRA 4K7NA 1WJKA 5ECRB 1RK4A 4BA7A 3FR6A 1TK0B 3TRXA 3FYGA 3GN3A 4RQRA 1QUWA 3I9V2 1F9MA 4MABA 5D9WA 4LLRA 4YQVA 1SK1A 1VRSD 2R2JA 4MPFA 3FZ5A 2DJJA 2QKEA 1AIUA 2H73A 4KDYA 2B6MA 5CRDA 4JEDA 3L9UA 2H1GA 4QL7A 2L5OA 2GSQA 4KAEA 4F03A 3TJGA 4H86A 1ZOFA 4MA9A 4BPYA 1UN2A 3US3A 4K0NA 5DDLA 5JCUA 3ERGA 2YWOA 2OE1A 5D9XA 4JRRA 1ON4A 3LGCA 5F07A 1B4QA 2GZYA 4Z7XA 2MMZA 4F0CA 1SL0B 3EPTA 3VPQA 1V98A 3DYRA 3GHAA 2CVDA 1TRSA 1ERUA 4MZCA 1DBYA 4OD7A 2H1BA 2R5GA 2LJAA 3Q19A 3P90A 2WCIA 3ZMLA 5D96A 1O8XA 3WGXA 1EEMA 1QQ2A 4ZB9A 1FHEA 1A24A 17GSA 2LJKA 4AF2A 1YZXA 2VL2A 3E9JB 2IMEA 1IYIA 2A2PA 1FVKA 1TOFA 4PQ1A 3PH9A 3DVWA 2KP1A 1BAYA 2B1LA 3QCPA 3WGEA 3KH9A 1S3DA 3UIWA 2M80A 3HA9A 4MJAA 3H1NA 4DSSB 5B8AA 3ZITA 2B5XA 1S3CA 1O6JA 2E0QA 5B6NA 1NW2A 5HFKA 4MK3A 2JADA 1EGOA 2F8FA 2N5AA 4D73A 1HYUA 3L9VA 1OC9A 4HS1A 3M9KA 4ML6A 5ECOB 2H19A 4ECJA 4Z2RA 2R6KA 4XRDA 3J7Yb 2B5EA 2HXKA 5INYA 5KN0A 3IAS2 4IJ3A 1GUMA 8GSSA 3TOTA 3R3EA 1XWKA 2VUPA 4NWYA 3D21A 4G19A 2LNTA 3TKPA 2FWEA 1G6YA 1X9MB 3KH7A 2P5QA 4NHWA 2LS5A 2C80A 4PNGA 2X8CA 3IRAA 2VCWA 2BJXA 3KD0A 3HJPA 3UVHA 5L71A 3HVVA 1U88A 3TKQA 1DSBA 4EF0A 2C3TA 4WETA 2C3QA 1M2DA 1ST9A 1QMVA 3E3EA 1F3BA 5FT3A 5ECQB 2NBSA 3APSA 4PTSA 3ZVJD 1MDIA 2BTOT 5CNWA 4LL1B 1SKSB 4PQIA 1K0BA 1ERVA 1YEXA 1GTBA 1LU4A 2YZUA 1GSYA 2H30A 4BVXB 1J9BA 2MMNA 2KOKA 3LJRA 3TRPA 3V1WA 3HHVA 2GVPA 3HDCA 3QD9A 5EVOA 3WT1A 4I97A 4ECCA 3ZL5A 3F4TA 3IXRA 1WPIA 3ZIJA 1YEPA 2IMIA 2NDOA 2DJKA 4V2LA 4EDZA 1E2YA 2H0IA 5D8IA 2R3XA 2EC4A 3HD5A 2FD3A 5CP1A 2AYTA 3HZ4A 1BEDA 1B48A 1SJZA 2PN8A 4G0LA 1O73A 1ZGNA 1OVNA 3A5IA 3GL3A 2GQMA 4RI7A 5AIXA 1GLQA 4OFTA 4KCAA 3KTLA 4FYUA 2B3SA 4IBPA 3D4MA 5E4WA 3KMNA 3TJKA 3SWLA 2DKHA 2TRCP 1A2MA 5DAKB 5HQPA 3WT2A 4OCEA 4G0KA 5GAND 3GKXA 1ZMAA 2JSYA 5AIVA 4MZWA 1ZZYA 4TN8A 2HZEB 1M9BA 1HNBA 1EGRA 1R26A 5G1KA 4BVYB 5HR1A 2PPTA 4KCEA 2R37A 2LTKA 2DMLA 3UARA 5FHIA 2WB9A 4XS4B 2IMFA 5G2ZA 4IKHA 1U6TA 19GSA 1AQVA 4L0UA 2A4HA 4MZBA 3EVIA 5HFIA 2LRTA 1AC1A 1GSFA 3A2WA 3IHQA 4EE0A 3R2QA 2R4VA 3UJ1A 3M1GA 3HVSA 1A0RP 2CX4A 3GA4A 4L5OA 3U5RE 1MDKA 3ZREA 4JU5A 5CYYA 2IMKA 4YAVA 4NAXA 3UOMA 5COHA 3LXZA 1G7OA 2OJLA 5G1LA 1TU8A 3BOAA 1KEBA 1BX9A 3D0ZA 2IMDA 4EIQA 2V41A 2IJYA 4POMA 1MEKA 3C73A 1DE1A 2FA8A 2QGVA 3VLNA 14GSA 4MDCA 5HR0A 2OE3A 4KB3A 3GH9A 5DQSA 2G0FA 3TUEA 1U3IA 3F6FA 3UBLA 2KHPA 2DIYA 4K2XA 4OFNA 2LUSA 4YQMA 2M72A 2HRNA 3H8QA 4DEJA 1X9WB 9GSSA 2FGXA 4TR1B 5ABRA 2QSIA 1I5GA 3UEMA 3QMXA 2GZPA 1WIKA 1PQNA 3QOUA 5JCGA 2PWJA 3P7XA 4K1FA 2HRFA 2MMOA 4AJ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DEX A;  2REM A;  2PBJ A;  3GIX A;  3FZ9 A;  1TJD A;  1XW9 A;  3IV4 A;  5EPF A;  5ECP B;  4TR4 A;  5G31 A;  2C1Y A;  2GTU A;  4KUN A;  1WMJ A;  1Z6M A;  2VLV A;  1K3L A;  1EV9 A;  2H74 A;  1UVZ A;  5GSS A;  1G6W A;  1R4W A;  5HFG A;  1BQ7 A;  2XBQ A;  2H71 A;  3Q6O A;  2EIQ A;  2GSS A;  1URM A;  2H8L A;  2AAW A;  4O7H A;  4LMV A;  1X5C A;  1FAA A;  2LST A;  2VL2 C;  4MF5 A;  2A4V A;  4POB A;  4XHM A;  2AUV A;  4DSR A;  2WUL A;  4MH2 A;  3TOU A;  5H5Q A;  1TTZ A;  2G2Q A;  3CTG A;  2O87 A;  1GRX A;  3KCM A;  1NHY A;  4X1U A;  4ECB A;  3GFK A;  1FW1 A;  2YNX A;  1ABA A;  4L5L A;  1JZD A;  2J23 A;  3GL5 A;  2L4C A;  4XS1 A;  4K6X A;  4YQU A;  4PNF A;  13GS A;  2YOI A;  2H70 A;  3KZQ A;  3QAG A;  3DD3 A;  2CAQ A;  5DCH A;  3CXG A;  2WZ9 A;  2IWT A;  2YZH A;  3GMF A;  4WF4 A;  2IL3 A;  2XC2 A;  1X0R A;  4I5Q A;  2GS3 A;  2YJH A;  4XTS A;  4HDE A;  2NVL A;  4OMV A;  2B7J A;  5H5S A;  3PIN A;  1A8Y A;  1SJI A;  4ZBD A;  1X9S B;  3F8U A;  1TK8 B;  1GP1 A;  2B1K A;  4OWY A;  2JU5 A;  5DJM A;  1R7H A;  4EO3 A;  1OAZ A;  4OO5 A;  1IYH A;  2Z9S A;  5F05 A;  1PN9 A;  4GST A;  1XVW A;  1G7E A;  2FCH A;  4Q5N A;  3LWA A;  3QDN A;  4DSS A;  2HYX A;  3Q18 A;  4HJM A;  3TCO A;  3HCZ A;  3HJO A;  3F3R A;  5CRH A;  3ZVJ A;  4MJB A;  18GS A;  2GQK A;  2GSR A;  2F9S A;  1EOG A;  3BBY A;  3EU4 A;  6GSU A;  1NM3 A;  3D5J A;  4EKZ A;  4PUR A;  3DRN A;  7GSS A;  5GZZ B;  3F63 A;  1O7U A;  2LQQ A;  1V2A A;  4DSQ A;  3VI7 A;  5A4V A;  5IPG A;  3MWH A;  2WDU A;  4ZB8 A;  1RQM A;  3ME7 A;  1XWG A;  4RQX A;  1W89 A;  2VAF A;  2OAC A;  5ECS A;  2LV3 A;  4ZXG A;  5ID2 B;  4YAP A;  2V2G A;  3MDK A;  3WD6 A;  2OBK A;  2H6Z A;  4ID0 A;  3LSZ A;  1PX6 A;  4N0V A;  1JZO A;  1JZW A;  2VM1 A;  4HI7 A;  3QR6 A;  3VI5 A;  1Q4J A;  3KTB A;  4N11 A;  2RLI A;  3FR3 A;  2E2G A;  4ZL7 A;  3MAK A;  1K0N A;  3IAM 2;  3F0I A;  1PL1 A;  2DC5 A;  2VM2 A;  4TVE A;  4IN0 A;  3J7Y k;  1O81 A;  4PX1 A;  3O6T A;  3KJY A;  3DVX A;  4F9Z A;  2RUF A;  1ZL9 A;  3KGK A;  2V6K A;  3AY8 A;  2VL3 A;  1GL8 A;  1ERW A;  2PVQ A;  3GX0 A;  2I1U A;  5F06 A;  2FWH A;  2WRT A;  1YDK A;  3TGZ A;  1FO5 A;  3UL3 A;  2IIY A;  3TKR A;  4I6X A;  5GAP D;  5DVB A;  4LA1 A;  1OKT A;  3A2V A;  1RW1 A;  16GS A;  5IOW A;  4BVX A;  4QL9 A;  2V6O A;  3ZMK A;  4Q5F A;  1YF0 A;  1WP0 A;  1I9D A;  2IFQ B;  4G10 A;  1T4Y A;  2MBT A;  1WRY A;  3TJJ A;  2DJ0 A;  5IMF A;  4EC0 A;  5IMC A;  2YWM A;  3G7I A;  2B5Y A;  5IO0 A;  3RAZ A;  1SU9 A;  3U6V A;  4IQA A;  1AXD A;  4KGI A;  4IGJ A;  4GCI A;  4J57 E;  3KP9 A;  4TW5 A;  1BYE A;  1K3Y A;  3GNJ A;  1XBS A;  2CVB A;  3D4T A;  1JZR A;  3RDW A;  1XZO A;  1XWA A;  4KDU A;  3DIE A;  5JWO B;  2P5R A;  3IR4 A;  1Z9H A;  4JR6 A;  1LBK A;  1V57 A;  1SK0 A;  1CQH A;  1ZYQ B;  1KBN A;  1Y25 A;  1AAZ A;  3KXO A;  5AN1 A;  4GQF A;  1M7T A;  4HZ2 A;  2DJ1 A;  5DAK A;  3TB2 A;  1XFL A;  4JR4 A;  1ACV A;  2PVO C;  2VO4 A;  4ULX A;  1WOU A;  2K8V A;  4PUF C;  5DCG A;  2O85 A;  4N10 A;  5D73 A;  3NIV A;  4GSN A;  2FNO A;  1ERT A;  2BMX A;  2HZE A;  1PA3 A;  4HQZ A;  3O76 A;  2X99 A;  4BVY A;  3VPT A;  5C00 A;  2L5L A;  5CAX A;  3TJF A;  5ELG A;  2PMT A;  4XS4 A;  2DLX A;  1KTE A;  5G5F A;  2PER A;  3KMO A;  2CX3 A;  4IEL A;  3MNG A;  1SKW B;  1EEJ A;  3M0F A;  2OA7 A;  1SYX A;  3FRC A;  1F37 A;  4POL A;  1FOV A;  1AQX A;  5ECI B;  3ZIV A;  1ILO A;  1TP9 A;  2JL4 A;  2F51 A;  3I43 A;  1OE7 A;  4XIH A;  5DJL A;  1W4V A;  1EP7 A;  1AW9 A;  2YCD A;  5CO3 A;  2OKA A;  3H93 A;  5DQY A;  2P31 A;  2LEG A;  2V32 A;  1YKC A;  2HFD A;  4MCU A;  2FHE A;  1OYJ A;  4CDO A;  1K0M A;  4EL1 A;  4FYC A;  1WWJ A;  3QPM A;  4MP4 A;  1VF4 A;  4N0Z A;  1XOA A;  4NXI A;  3W6G A;  4WKW A;  1J08 A;  1M99 A;  1XIY A;  2YN1 A;  4ZBA A;  4Q5R A;  2TRX A;  3E0U A;  2O8V B;  2H1D A;  4V1A p;  3RHC A;  1TK5 B;  2I3Y A;  1GUL A;  6GSW A;  3QFA C;  2ZCT A;  1EZK A;  3VUR A;  4TR1 A;  3NZN A;  4RI6 A;  2LRN A;  6GST A;  1MD4 A;  2VCZ A;  4K8M A;  1FVJ A;  3CRU A;  1GTI A;  1Z5Y E;  3A3T A;  2XPE A;  5A4W A;  1Q98 A;  2X8H A;  3ZTL A;  5FWG A;  3I69 A;  3D22 A;  3RPN A;  1PX7 A;  3F6D A;  1YF1 A;  5DAL B;  3ME8 A;  1FB0 A;  5IMZ A;  3TDG A;  4E8H A;  4I2U A;  2HZF A;  3C8E A;  1EOH A;  5J3R A;  2NTO A;  3IC4 A;  1Y6E A;  4OO4 A;  1B9Y C;  2H0H A;  4HEA 2;  1XWC A;  2ES7 A;  2VD1 A;  5EY6 A;  1M2A A;  1VGL A;  2YV7 A;  3VWX A;  2XBI A;  4IJI A;  1UA5 A;  1PSQ A;  4L8E A;  2M46 A;  3IA1 A;  2CQ9 A;  2A2R A;  2FUG 2;  1AUC A;  1JLV A;  1PMT A;  3DGQ A;  5J4U A;  3G7J A;  2JZS A;  4ZL9 A;  3EIN A;  4WF5 A;  2B7K A;  3FHK A;  1TRW A;  4F82 A;  2RII A;  5ECN B;  3KIJ A;  3W8S A;  2GZZ A;  1TKD B;  4I8B A;  4GF0 A;  5GST A;  3N9J A;  3VWW A;  3GRX A;  4KX4 A;  1T8E B;  1NHO A;  1THO A;  2FWG A;  2FWF A;  2O7K A;  3HY2 A;  2FY6 A;  3KP8 A;  4K7O A;  1X5D A;  3LOR A;  4MF7 A;  1XXU A;  1M2B A;  3GTU B;  2IPA A;  3IK9 A;  5LNK e;  1XOB A;  2JZT A;  2VCT A;  3BJ5 A;  3PGT A;  3WYW A;  3LG6 A;  4CHS A;  4ZBB A;  3EC3 A;  4JE1 A;  4MMM A;  2DSA A;  3S9F A;  3HXS A;  1B8X A;  2FA4 A;  4MJC A;  1C72 A;  3TKS A;  4J56 E;  3ZLP A;  1FB6 A;  4FIW A;  5HR3 A;  2E7P A;  1Z7P A;  4K0G A;  1YY7 A;  4TXO B;  2WFC A;  12GS A;  2KLX A;  5KN3 A;  1HD2 A;  2MMA A;  4KSM A;  3QAV A;  2DMM A;  2I4A A;  3ERW A;  3EWL A;  3DXB A;  2ON5 A;  4NV2 A;  1XW6 A;  2LKU A;  4NPB A;  3RPP A;  1GUK A;  3IE3 A;  4L0W A;  1QK8 A;  2F3M A;  4KH7 A;  3ZYW A;  4OCF A;  1N8J A;  3LQ7 A;  4BL7 A;  3C7M A;  4HU9 A;  4F2I A;  2ON7 A;  3IK7 A;  1A8L A;  2F8A A;  2AV4 A;  4KE3 A;  2X8G A;  1B4P A;  2OAD A;  5AIS A;  2H75 A;  3L9S A;  4G2E A;  3I6A A;  4POK A;  1BG5 A;  3M3M A;  2GLR A;  1YQ1 A;  4GRF A;  2WJU A;  2QC7 A;  4MH3 A;  2CV4 A;  3EU3 A;  1CQG A;  1M9A A;  1F2E A;  2P0G A;  5H5R A;  1GSE A;  3ERF A;  4ISD A;  1B9X C;  3GKM A;  5ID2 A;  2K18 A;  3FW2 A;  4GTU A;  1G0T A;  3LFL A;  3D6I A;  2YPM A;  2GT5 A;  2YV9 A;  2X64 A;  1XW5 A;  1PKZ A;  2L59 A;  3GH6 A;  4BWQ A;  4ACS A;  5KN1 A;  1ZCP A;  2WGR A;  3LEF A;  1TU7 A;  2L4Q A;  4PXO A;  4KSO A;  2RM5 A;  1X5E A;  1R5P A;  1EP8 A;  4X0X A;  3GUS A;  4ZB6 A;  2K8S A;  3H79 A;  4GWR A;  1DUG A;  2CT6 A;  4WEY A;  1T7P B;  2YJ7 A;  3CSI A;  3EUR A;  3FZ4 A;  1ZYE A;  4V2N A;  3UAP A;  1UC7 A;  3ISO A;  1A2J A;  3CYN A;  3TRQ A;  5IO2 A;  4LL4 B;  3FEU A;  2ALB A;  2LQO A;  3F3Q A;  3OR5 A;  4OFM A;  3GUR A;  1VF1 A;  3N5O A;  2EIO A;  2IFQ A;  3DWV A;  3FY7 A;  4O92 A;  3VFI A;  2VLT A;  3DKS A;  1USB A;  5F8B A;  4GLT A;  4KDX A;  5G30 A;  5IM9 A;  2L6D A;  3A5W A;  3RHB A;  1VF3 A;  10GS A;  3GKK A;  3VK9 A;  1T4Z A;  4GQC A;  4PUA A;  2HI7 A;  5JWR B;  1EV4 A;  1A23 A;  3GYK A;  4ML1 A;  2YAN A;  3QFB C;  3L0H A;  5A4U A;  4KA0 A;  2PU9 C;  2WS2 A;  2H01 A;  2K9F A;  1GWC A;  1XPV A;  1V9W A;  1SD9 A;  1Z7R A;  1ML6 A;  1WE0 A;  5E59 A;  4TRX A;  2FLS A;  1GSS A;  5IPH A;  1PRX A;  3ZZX A;  4I2T A;  3WGD A;  1OKD A;  2CAI A;  1MTC A;  1TW9 A;  3ZFB A;  4NHZ A;  3IDV A;  3O3T A;  3MSZ A;  1GSD A;  3JCM L;  5J9C A;  1O85 A;  2H6X A;  3GV1 A;  4WBJ A;  1SJ6 A;  2EIR A;  5J5N A;  3P2A A;  1N2A A;  1SEN A;  3H4K A;  2YWN A;  1K0O A;  5KN2 A;  1Z6N A;  3VWV A;  4WR5 A;  4IS0 A;  2HLS A;  2HT9 A;  2GQL A;  2YWI A;  3HZ8 A;  4MJE A;  2NPB A;  2YP6 A;  4DVC A;  1SK2 A;  4G9H A;  3UMA A;  4EUY A;  2HSH A;  4FO5 A;  4KW6 A;  2RM6 A;  4D73 B;  3UVT A;  4WBR D;  1OC9 B;  3A2X A;  4WXT A;  1AQW A;  3EMP A;  4IP1 A;  4TKY A;  3CSJ A;  5IMA A;  3DML A;  1GUH A;  4J2F A;  4PGT A;  4ZL8 A;  3FK8 A;  3Q74 A;  2LJR A;  2AJQ B;  3PR8 A;  4N30 A;  1SKR B;  5IIZ A;  3CSH A;  5D9V A;  2C3N A;  4XRA A;  4TXV A;  1QGV A;  2N5B A;  1MD3 A;  1TDI A;  3G9B A;  1HNA A;  2H6Y A;  2J9H A;  3CMI A;  4XCS A;  6GSV A;  4XS6 A;  3QAW A;  3BD2 A;  2I9H A;  3EMX A;  1THX A;  4MLY A;  1OC3 A;  2CZ3 A;  2DJ3 A;  3F4R A;  4QQ7 A;  3BCK A;  2CVK A;  3ZFL A;  4FYB A;  1GTA A;  5ECK B;  4X43 A;  5CRW A;  1GSQ A;  1V58 A;  3TKS E;  3C1S A;  1HNC A;  3SBC A;  2C0E A;  3M9J A;  4NMU A;  4NV5 A;  1SL2 B;  3LYP A;  1JHB A;  3CRT A;  1K0A A;  2KP2 A;  4PQH A;  1T3B A;  1GLP A;  3KEB A;  2C0G A;  1TI3 A;  4RUV A;  5CRG A;  2VCQ A;  1OC8 A;  1J0F A;  2VD0 A;  1K0D A;  2GT6 A;  4JBB A;  5JWQ B;  2E2M A;  3GKN A;  20GS A;  1Z3E A;  3RBT A;  2CA8 A;  2GST A;  4K2D A;  2L57 A;  4YH2 A;  5J9B A;  2C0F A;  2K6V A;  3L4N A;  1T00 A;  5DAL A;  4AGS A;  4EDY A;  3GSS A;  5C04 A;  4HJ2 A;  3W8J A;  1S3A A;  2LNS A;  4TOP A;  5J41 A;  1QFN A;  4IP6 A;  2C4J A;  2PGT A;  5IOX A;  1A0F A;  3HYP A;  2XHF A;  1F3A A;  1V40 A;  4KND A;  2C0D A;  3HJM A;  3GST A;  4HU7 A;  3TKS C;  4O32 A;  3C71 A;  1MDJ A;  3F9U A;  1KNG A;  4P3Y B;  5A5K A;  1JLW A;  4ZIL A;  5ECH B;  1VF2 A;  1A2L A;  3FR9 A;  4K9Z A;  1QXH A;  1XWB A;  2JAC A;  1PD2 1;  2V1M A;  5ECL B;  1U87 A;  4EXJ A;  4BWS A;  2HNL A;  6GSX A;  1XVQ A;  1TXX A;  4V1A g;  1DE2 A;  5IMV A;  3APQ A;  2O89 A;  5KEJ A;  4IVF A;  3CTF A;  4GXZ A;  5IMD A;  3FKF A;  1R5A A;  1U3A A;  2IN3 A;  3BCI A;  3EYT A;  1GNE A;  2H66 A;  6GSS A;  2CZ2 A;  1TRU A;  4F0B A;  2H76 A;  2A2S A;  2AHE A;  5JCW A;  2H0G A;  3GTU A;  2RUE A;  2TIR A;  5DBQ A;  2GDR A;  4HZ4 A;  1K3O A;  1YKA A;  22GS A;  2HSY A;  5ELA A;  1SD8 A;  4IHU A;  4EVM A;  1SYR A;  2VL9 A;  1PL2 A;  2C8U A;  4ECI A;  2ZUP A;  3CBU A;  1PKW A;  2JSZ A;  5B7C A;  2HE3 A;  2L6C A;  4K7I A;  2VOC A;  3ED3 A;  2PUK C;  4HOJ A;  1BJX A;  4TXO A;  5F0G A;  3IOS A;  1FG4 A;  3M8N A;  3UBK A;  4JZQ A;  2ZNM A;  5D93 A;  4MF6 A;  2JZR A;  3LYK A;  1O8W A;  4V2M A;  3NOF A;  1NSW A;  3F4S A;  5B6M A;  1H75 A;  2VCV A;  2MZC A;  1PGT A;  4FH8 A;  5EL8 A;  5D9T A;  4LMW A;  4IQ1 A;  3KM6 A;  3P8W A;  1GSU A;  2XPD A;  2DIZ A;  2OBI A;  4AJ7 A;  4ZIJ A;  3C1R A;  2DJ2 A;  2LRC A;  4O5R A;  2D2Z A;  4ILF A;  3ZRD A;  2VIM A;  1GTU A;  1TI1 A;  1XCC A;  3GX8 A;  3LXT A;  4IW9 A;  5G5E A;  4HUA A;  3IBH A;  2N5F A;  1EWX A;  2KUC A;  3IPZ A;  4Q5Q A;  5IQY A;  2VLU A;  2MBS A;  3EE2 A;  5HR2 A;  3L78 A;  1F6M C;  4GSS A;  2H72 A;  1TRV A;  4MPG A;  2MYG A;  1SL1 B;  2VCX A;  1H4O A;  4TR3 A;  2OE0 A;  3K8N A;  11GS A;  3TJB A;  1K0C A;  4WR4 A;  1GH2 A;  2H1A A;  1M0U A;  3HVX A;  3G7Y A;  5CRE A;  3FZA A;  2DBC A;  5B8B A;  1LJR A;  5LCZ A;  2I81 A;  3APO A;  1YJ6 A;  5AGY A;  1GNW A;  1JFU A;  4CW9 A;  5ENU A;  1T1V A;  4AJ8 A;  3VWU A;  1HQO A;  5ECM B;  2GGT A;  4TR0 A;  6GSY A;  4E8E A;  1E6B A;  2AB6 A;  4HQS A;  5LD0 A;  1OE8 A;  3HKR A;  4K7N A;  1WJK A;  5ECR B;  1RK4 A;  4BA7 A;  3FR6 A;  1TK0 B;  3TRX A;  3FYG A;  3GN3 A;  4RQR A;  1QUW A;  3I9V 2;  1F9M A;  4MAB A;  5D9W A;  4LLR A;  4YQV A;  1SK1 A;  1VRS D;  2R2J A;  4MPF A;  3FZ5 A;  2DJJ A;  2QKE A;  1AIU A;  2H73 A;  4KDY A;  2B6M A;  5CRD A;  4JED A;  3L9U A;  2H1G A;  4QL7 A;  2L5O A;  2GSQ A;  4KAE A;  4F03 A;  3TJG A;  4H86 A;  1ZOF A;  4MA9 A;  4BPY A;  1UN2 A;  3US3 A;  4K0N A;  5DDL A;  5JCU A;  3ERG A;  2YWO A;  2OE1 A;  5D9X A;  4JRR A;  1ON4 A;  3LGC A;  5F07 A;  1B4Q A;  2GZY A;  4Z7X A;  2MMZ A;  4F0C A;  1SL0 B;  3VPQ A;  1V98 A;  3DYR A;  3GHA A;  2CVD A;  1TRS A;  1ERU A;  4MZC A;  1DBY A;  4OD7 A;  2H1B A;  2R5G A;  2LJA A;  3Q19 A;  3P90 A;  2WCI A;  3ZML A;  5D96 A;  1O8X A;  3WGX A;  1EEM A;  1QQ2 A;  4ZB9 A;  1FHE A;  1A24 A;  17GS A;  2LJK A;  4AF2 A;  1YZX A;  2VL2 A;  3E9J B;  2IME A;  1IYI A;  1FVK A;  1TOF A;  4PQ1 A;  3PH9 A;  3DVW A;  2KP1 A;  1BAY A;  2B1L A;  3QCP A;  3WGE A;  3KH9 A;  1S3D A;  3UIW A;  2M80 A;  3HA9 A;  4MJA A;  3H1N A;  4DSS B;  5B8A A;  3ZIT A;  2B5X A;  1S3C A;  1O6J A;  2E0Q A;  5B6N A;  1NW2 A;  5HFK A;  4MK3 A;  2JAD A;  1EGO A;  2F8F A;  2N5A A;  4D73 A;  1HYU A;  3L9V A;  1OC9 A;  4HS1 A;  3M9K A;  4ML6 A;  5ECO B;  2H19 A;  4ECJ A;  2R6K A;  4XRD A;  3J7Y b;  2B5E A;  2HXK A;  5INY A;  5KN0 A;  3IAS 2;  4IJ3 A;  1GUM A;  8GSS A;  3TOT A;  1XWK A;  2VUP A;  4NWY A;  3D21 A;  4G19 A;  2LNT A;  3TKP A;  2FWE A;  1G6Y A;  1X9M B;  3KH7 A;  2P5Q A;  4NHW A;  2LS5 A;  2C80 A;  4PNG A;  2X8C A;  3IRA A;  2VCW A;  2BJX A;  3KD0 A;  3HJP A;  3UVH A;  5L71 A;  3HVV A;  1U88 A;  3TKQ A;  1DSB A;  4EF0 A;  2C3T A;  4WET A;  2C3Q A;  1M2D A;  1ST9 A;  1QMV A;  3E3E A;  1F3B A;  5FT3 A;  5ECQ B;  2NBS A;  3APS A;  3ZVJ D;  1MDI A;  2BTO T;  5CNW A;  4LL1 B;  1SKS B;  4PQI A;  1K0B A;  1ERV A;  1YEX A;  1GTB A;  1LU4 A;  2YZU A;  1GSY A;  2H30 A;  1J9B A;  2MMN A;  2KOK A;  3LJR A;  3TRP A;  3V1W A;  3HHV A;  2GVP A;  3HDC A;  3QD9 A;  5EVO A;  3WT1 A;  4I97 A;  4ECC A;  3ZL5 A;  3F4T A;  3IXR A;  1WPI A;  3ZIJ A;  1YEP A;  2IMI A;  2NDO A;  2DJK A;  4V2L A;  4EDZ A;  1E2Y A;  2H0I A;  5D8I A;  2R3X A;  2EC4 A;  3HD5 A;  2FD3 A;  5CP1 A;  2AYT A;  3HZ4 A;  1BED A;  1B48 A;  1SJZ A;  2PN8 A;  1O73 A;  1ZGN A;  1OVN A;  3GL3 A;  2GQM A;  4RI7 A;  5AIX A;  1GLQ A;  4OFT A;  4KCA A;  3KTL A;  4FYU A;  2B3S A;  4IBP A;  3D4M A;  5E4W A;  3KMN A;  3TJK A;  3SWL A;  2TRC P;  1A2M A;  5DAK B;  5HQP A;  3WT2 A;  4OCE A;  5GAN D;  3GKX A;  1ZMA A;  2JSY A;  5AIV A;  4MZW A;  1ZZY A;  4TN8 A;  2HZE B;  1M9B A;  1HNB A;  1EGR A;  1R26 A;  5G1K A;  5HR1 A;  2PPT A;  4KCE A;  2R37 A;  2LTK A;  2DML A;  3UAR A;  5FHI A;  2WB9 A;  4XS4 B;  2IMF A;  5G2Z A;  4IKH A;  1U6T A;  19GS A;  1AQV A;  4L0U A;  4MZB A;  3EVI A;  5HFI A;  2LRT A;  1AC1 A;  1GSF A;  3A2W A;  3IHQ A;  4EE0 A;  3R2Q A;  2R4V A;  3UJ1 A;  3M1G A;  3HVS A;  1A0R P;  2CX4 A;  3GA4 A;  4L5O A;  3U5R E;  1MDK A;  3ZRE A;  4JU5 A;  5CYY A;  2IMK A;  4YAV A;  4NAX A;  3UOM A;  5COH A;  3LXZ A;  1G7O A;  2OJL A;  5G1L A;  1TU8 A;  3BOA A;  1KEB A;  1BX9 A;  3D0Z A;  2IMD A;  2V41 A;  2IJY A;  4POM A;  1MEK A;  3C73 A;  1DE1 A;  2FA8 A;  2QGV A;  3VLN A;  14GS A;  4MDC A;  5HR0 A;  2OE3 A;  4KB3 A;  3GH9 A;  5DQS A;  2G0F A;  3TUE A;  1U3I A;  3F6F A;  3UBL A;  2KHP A;  2DIY A;  4OFN A;  2LUS A;  4YQM A;  2M72 A;  2HRN A;  3H8Q A;  4DEJ A;  1X9W B;  9GSS A;  2FGX A;  4TR1 B;  5ABR A;  2QSI A;  1I5G A;  3UEM A;  3QMX A;  2GZP A;  1WIK A;  1PQN A;  3QOU A;  5JCG A;  2PWJ A;  3P7X A;  4K1F A;  2HRF A;  2MMO A;  4AJ6 A; 
#chains in the Genus database with same CATH topology
 3DEX A;  2REM A;  2PBJ A;  3GIX A;  3FZ9 A;  1TJD A;  1XW9 A;  3IV4 A;  5EPF A;  5ECP B;  4TR4 A;  5G31 A;  2C1Y A;  2GTU A;  4KUN A;  1WMJ A;  1Z6M A;  2VLV A;  1K3L A;  1EV9 A;  2H74 A;  1UVZ A;  5GSS A;  1G6W A;  1R4W A;  5HFG A;  1BQ7 A;  2XBQ A;  2H71 A;  3Q6O A;  2EIQ A;  2GSS A;  1URM A;  2H8L A;  2AAW A;  4O7H A;  4LMV A;  1X5C A;  1FAA A;  2LST A;  2VL2 C;  4MF5 A;  2A4V A;  4POB A;  4XHM A;  2AUV A;  4DSR A;  2WUL A;  4MH2 A;  3TOU A;  5H5Q A;  1TTZ A;  2G2Q A;  1S3R A;  3CTG A;  2O87 A;  1GRX A;  3KCM A;  1NHY A;  4X1U A;  4ECB A;  3GFK A;  1FW1 A;  2YNX A;  1ABA A;  4L5L A;  1JZD A;  2J23 A;  3GL5 A;  2L4C A;  4XS1 A;  4K6X A;  4YQU A;  4PNF A;  3MIX A;  13GS A;  2YOI A;  2H70 A;  3KZQ A;  3QAG A;  3DD3 A;  2CAQ A;  5DCH A;  3CXG A;  2WZ9 A;  2IWT A;  2YZH A;  3GMF A;  4WF4 A;  2IL3 A;  2XC2 A;  1X0R A;  4I5Q A;  2GS3 A;  2YJH A;  4XTS A;  3CQF A;  4HDE A;  2NVL A;  4OMV A;  2B7J A;  5H5S A;  3PIN A;  1A8Y A;  1SJI A;  4ZBD A;  1X9S B;  3F8U A;  4MNN A;  1TK8 B;  1GP1 A;  2B1K A;  4OWY A;  2JU5 A;  5DJM A;  1R7H A;  4EO3 A;  1OAZ A;  4OO5 A;  1IYH A;  2Z9S A;  5F05 A;  1PN9 A;  4GST A;  1XVW A;  1G7E A;  2FCH A;  4Q5N A;  3LWA A;  3QDN A;  4DSS A;  2HYX A;  3Q18 A;  4HJM A;  3TCO A;  3HCZ A;  3HJO A;  3F3R A;  5CRH A;  3ZVJ A;  4MJB A;  18GS A;  2GQK A;  2UZ8 A;  2GSR A;  4BL7 B;  3IHG A;  2F9S A;  1EOG A;  3BBY A;  3EU4 A;  6GSU A;  1NM3 A;  2R0G A;  3D5J A;  4EKZ A;  4PUR A;  3DRN A;  7GSS A;  5GZZ B;  3F63 A;  1O7U A;  2LQQ A;  1V2A A;  4DSQ A;  3VI7 A;  5A4V A;  5IPG A;  3MWH A;  2WDU A;  4ZB8 A;  1ZYN A;  1RQM A;  3ME7 A;  1XWG A;  4RQX A;  1W89 A;  2VAF A;  2OAC A;  5ECS A;  2LV3 A;  4ZXG A;  2X4A A;  5ID2 B;  4YAP A;  1XG8 A;  2V2G A;  3MDK A;  3WD6 A;  4USS A;  2OBK A;  2H6Z A;  4ID0 A;  3LSZ A;  1PX6 A;  4N0V A;  1JZO A;  1JZW A;  2VM1 A;  4HI7 A;  5KOX A;  3QR6 A;  3VI5 A;  1Q4J A;  3KTB A;  4N11 A;  2RLI A;  3FR3 A;  2E2G A;  4ZL7 A;  3MAK A;  1K0N A;  3IAM 2;  3F0I A;  1PL1 A;  2DC5 A;  2VM2 A;  4TVE A;  4IN0 A;  3J7Y k;  1O81 A;  4PX1 A;  3O6T A;  3KJY A;  3DVX A;  4F9Z A;  4CY6 A;  2RUF A;  1ZL9 A;  3KGK A;  2V6K A;  3AY8 A;  2VL3 A;  1GL8 A;  1ERW A;  2PVQ A;  3GX0 A;  2I1U A;  5F06 A;  2FWH A;  2WRT A;  1YDK A;  3TGZ A;  1FO5 A;  3UL3 A;  2IIY A;  3TKR A;  4I6X A;  5GAP D;  5DVB A;  4LA1 A;  1OKT A;  3A2V A;  1RW1 A;  4A5P A;  16GS A;  5IOW A;  4BVX A;  4QL9 A;  2V6O A;  3ZMK A;  4Q5F A;  1YF0 A;  1WP0 A;  1I9D A;  2IFQ B;  4FQU A;  4G10 A;  1T4Y A;  2MBT A;  1WRY A;  3TJJ A;  2DJ0 A;  5IMF A;  4EC0 A;  5IMC A;  2YWM A;  3G7I A;  2B5Y A;  5IO0 A;  3RAZ A;  1SU9 A;  3U6V A;  4IQA A;  1AXD A;  4KGI A;  4IGJ A;  4GCI A;  4J57 E;  3KP9 A;  4TW5 A;  1BYE A;  1K3Y A;  3GNJ A;  1XBS A;  2CVB A;  3D4T A;  1JZR A;  3RDW A;  5KOW A;  1XZO A;  1XWA A;  4KDU A;  3DIE A;  5JWO B;  2P5R A;  3IR4 A;  1Z9H A;  4JR6 A;  1M3J A;  1LBK A;  1V57 A;  1SK0 A;  1CQH A;  1ZYQ B;  1KBN A;  1Y25 A;  1AAZ A;  3KXO A;  5AN1 A;  4GQF A;  1M7T A;  4HZ2 A;  2DJ1 A;  5DAK A;  3TB2 A;  1XFL A;  4JR4 A;  1ACV A;  4EIP A;  2PVO C;  2VO4 A;  4ULX A;  1WOU A;  2K8V A;  4PUF C;  5DCG A;  2O85 A;  4N10 A;  5D73 A;  3NIV A;  4GSN A;  2FNO A;  1ERT A;  2BMX A;  2HZE A;  1PA3 A;  4HQZ A;  3O76 A;  2X99 A;  4BVY A;  3VPT A;  5C00 A;  2L5L A;  5CAX A;  3TJF A;  5ELG A;  2PMT A;  4XS4 A;  2DLX A;  1KTE A;  5G5F A;  2PER A;  3KMO A;  2QA1 A;  2CX3 A;  4IEL A;  3MNG A;  1SKW B;  1EEJ A;  3M0F A;  2OA7 A;  1SYX A;  3FRC A;  1F37 A;  2HSM A;  4POL A;  1FOV A;  1AQX A;  5ECI B;  3ZIV A;  1ILO A;  1TP9 A;  2JL4 A;  2F51 A;  3I43 A;  1OE7 A;  4XIH A;  5DJL A;  1W4V A;  1EP7 A;  1AW9 A;  2YCD A;  5CO3 A;  2OKA A;  3H93 A;  5DQY A;  2P31 A;  2LEG A;  3MYD A;  2V32 A;  1YKC A;  2HFD A;  4MCU A;  2FHE A;  1OYJ A;  4CDO A;  1K0M A;  4EL1 A;  4FYC A;  1WWJ A;  3QPM A;  4MP4 A;  1VF4 A;  4N0Z A;  1XOA A;  4NXI A;  3W6G A;  4WKW A;  4YKF A;  1J08 A;  1M99 A;  1XIY A;  2YN1 A;  4ZBA A;  4Q5R A;  2TRX A;  3E0U A;  2O8V B;  2H1D A;  2R0C A;  4V1A p;  3RHC A;  1TK5 B;  2I3Y A;  1GUL A;  6GSW A;  3QFA C;  2ZCT A;  1EZK A;  3VUR A;  4TR1 A;  3NZN A;  4RI6 A;  2LRN A;  6GST A;  1MD4 A;  2VCZ A;  4O5Q A;  4K8M A;  1FVJ A;  4HSC X;  3CRU A;  2QA2 A;  1GTI A;  1Z5Y E;  3A3T A;  2XPE A;  5A4W A;  1Q98 A;  2X8H A;  3ZTL A;  5FWG A;  3I69 A;  3D22 A;  1PN0 A;  3RPN A;  1PX7 A;  3F6D A;  1YF1 A;  5DAL B;  3ME8 A;  1FB0 A;  5IMZ A;  3TDG A;  4E8H A;  4I2U A;  2HZF A;  3C8E A;  1EOH A;  5J3R A;  2NTO A;  3IC4 A;  1Y6E A;  4OO4 A;  1B9Y C;  2H0H A;  4HEA 2;  1XWC A;  2ES7 A;  2VD1 A;  5EY6 A;  1M2A A;  1VGL A;  2YV7 A;  3VWX A;  2XBI A;  4IJI A;  1UA5 A;  1PSQ A;  4L8E A;  2M46 A;  3IA1 A;  2CQ9 A;  2A2R A;  2FUG 2;  1AUC A;  1JLV A;  1PMT A;  3DGQ A;  5J4U A;  3G7J A;  2JZS A;  4ZL9 A;  3EIN A;  4WF5 A;  2B7K A;  3FHK A;  1TRW A;  4F82 A;  2RII A;  5ECN B;  3KIJ A;  3W8S A;  2GZZ A;  1TKD B;  4I8B A;  4GF0 A;  5GST A;  3N9J A;  3VWW A;  3GRX A;  4KX4 A;  1T8E B;  1NHO A;  1THO A;  2FWG A;  2FWF A;  2O7K A;  3HY2 A;  2FY6 A;  3KP8 A;  4K7O A;  1X5D A;  3LOR A;  4MF7 A;  1XXU A;  1M2B A;  3GTU B;  2IPA A;  3IK9 A;  5LNK e;  1XOB A;  2JZT A;  2VCT A;  3BJ5 A;  3PGT A;  3WYW A;  3LG6 A;  4CHS A;  4ZBB A;  3EC3 A;  4JE1 A;  4MMM A;  2DSA A;  3S9F A;  3HXS A;  1B8X A;  2FA4 A;  4MJC A;  1C72 A;  3TKS A;  4J56 E;  3ZLP A;  1FB6 A;  4FIW A;  5HR3 A;  2E7P A;  1Z7P A;  4K0G A;  1YY7 A;  4TXO B;  1PFO A;  12GS A;  2WFC A;  2KLX A;  5KN3 A;  1HD2 A;  2MMA A;  4KSM A;  3QAV A;  2DMM A;  2I4A A;  3ERW A;  3EWL A;  3DXB A;  2ON5 A;  5BMU A;  4NV2 A;  1XW6 A;  2LKU A;  4NPB A;  3RPP A;  1GUK A;  3IE3 A;  4L0W A;  1QK8 A;  2F3M A;  4KH7 A;  3ZYW A;  4OCF A;  1N8J A;  3LQ7 A;  4BL7 A;  3C7M A;  4HU9 A;  4F2I A;  2ON7 A;  3IK7 A;  1A8L A;  2F8A A;  2AV4 A;  4KE3 A;  2X8G A;  1B4P A;  2OAD A;  5AIS A;  2H75 A;  3L9S A;  4G2E A;  3I6A A;  4POK A;  1BG5 A;  3M3M A;  2GLR A;  1YQ1 A;  4GRF A;  1ZYP A;  2WJU A;  2QC7 A;  4MH3 A;  2CV4 A;  3EU3 A;  4X4J A;  1CQG A;  1M9A A;  1F2E A;  2P0G A;  5H5R A;  1GSE A;  3ERF A;  4Z2U A;  4ISD A;  1B9X C;  3GKM A;  5ID2 A;  2K18 A;  3FW2 A;  4GTU A;  1G0T A;  3LFL A;  3D6I A;  2YPM A;  2GT5 A;  2YV9 A;  2X64 A;  1XW5 A;  1PKZ A;  2L59 A;  3GH6 A;  4BWQ A;  4ACS A;  5KN1 A;  1ZCP A;  2WGR A;  3LEF A;  1TU7 A;  2L4Q A;  4PXO A;  4KSO A;  2RM5 A;  1X5E A;  1R5P A;  4YKG A;  1EP8 A;  4X0X A;  3GUS A;  4ZB6 A;  2K8S A;  3H79 A;  4GWR A;  1DUG A;  2CT6 A;  4WEY A;  1T7P B;  2YJ7 A;  3CSI A;  3EUR A;  3FZ4 A;  1ZYE A;  4V2N A;  3UAP A;  4CY8 A;  1UC7 A;  3ISO A;  1A2J A;  3CYN A;  3TRQ A;  5IO2 A;  4LL4 B;  3FEU A;  2ALB A;  2LQO A;  3F3Q A;  3OR5 A;  4OFM A;  3GUR A;  1VF1 A;  3N5O A;  2EIO A;  2IFQ A;  3DWV A;  3FY7 A;  4O92 A;  3VFI A;  2VLT A;  3DKS A;  1USB A;  5F8B A;  4GLT A;  4KDX A;  5G30 A;  5IM9 A;  2L6D A;  3A5W A;  3RHB A;  1VF3 A;  10GS A;  4O5U A;  3GKK A;  3VK9 A;  1T4Z A;  4GQC A;  4PUA A;  2HI7 A;  5JWR B;  1EV4 A;  1A23 A;  3GYK A;  4ML1 A;  2YAN A;  3QFB C;  3L0H A;  5A4U A;  4KA0 A;  2PU9 C;  2WS2 A;  2H01 A;  2K9F A;  1GWC A;  1XPV A;  1V9W A;  1SD9 A;  1Z7R A;  1ML6 A;  1WE0 A;  5E59 A;  4TRX A;  2FLS A;  1GSS A;  5IPH A;  1PRX A;  3ZZX A;  4I2T A;  3WGD A;  1OKD A;  2CAI A;  1MTC A;  2HRA A;  1TW9 A;  3ZFB A;  4NHZ A;  3IDV A;  3O3T A;  1M3I A;  3MSZ A;  1GSD A;  3JCM L;  5J9C A;  1O85 A;  2H6X A;  3GV1 A;  4WBJ A;  1SJ6 A;  2EIR A;  5J5N A;  5BRT A;  3P2A A;  1N2A A;  4G0I A;  1SEN A;  3H4K A;  2YWN A;  1K0O A;  5KN2 A;  1Z6N A;  3VWV A;  4WR5 A;  4IS0 A;  2HLS A;  2HT9 A;  2GQL A;  2YWI A;  3HZ8 A;  4MJE A;  4Z2T A;  2R0P A;  2NPB A;  2YP6 A;  4DVC A;  1SK2 A;  4G9H A;  3UMA A;  4EUY A;  2HSH A;  4FO5 A;  4KW6 A;  2RM6 A;  4D73 B;  3UVT A;  3FMW A;  4WBR D;  1OC9 B;  3A2X A;  4WXT A;  1AQW A;  3EMP A;  4IP1 A;  4TKY A;  3CSJ A;  5IMA A;  3DML A;  1GUH A;  4J2F A;  4PGT A;  4ZL8 A;  3FK8 A;  3Q74 A;  2LJR A;  2AJQ B;  3PPU A;  3PR8 A;  4N30 A;  1SKR B;  5IIZ A;  3CSH A;  5D9V A;  2C3N A;  4XRA A;  4TXV A;  1QGV A;  2N5B A;  1MD3 A;  1TDI A;  3G9B A;  1HNA A;  2H6Y A;  2J9H A;  3CMI A;  4XCS A;  6GSV A;  4XS6 A;  3QAW A;  3BD2 A;  2I9H A;  3EMX A;  1THX A;  4MLY A;  1OC3 A;  2CZ3 A;  2DJ3 A;  3F4R A;  4QQ7 A;  3BCK A;  2CVK A;  3ZFL A;  4FYB A;  1GTA A;  5ECK B;  4X43 A;  5CRW A;  1GSQ A;  1V58 A;  3TKS E;  3C1S A;  1HNC A;  3SBC A;  2C0E A;  3M9J A;  4NMU A;  4NV5 A;  1SL2 B;  3LYP A;  1JHB A;  3CRT A;  1K0A A;  2KP2 A;  4PQH A;  4K5R A;  1T3B A;  4KF9 A;  1GLP A;  3KEB A;  2C0G A;  1TI3 A;  1FOH A;  4RUV A;  5CRG A;  2VCQ A;  1OC8 A;  1J0F A;  2VD0 A;  1K0D A;  2GT6 A;  4JBB A;  5JWQ B;  2E2M A;  3GKN A;  20GS A;  1Z3E A;  3RBT A;  2CA8 A;  2GST A;  4K2D A;  2L57 A;  4YH2 A;  5J9B A;  2C0F A;  2K6V A;  3L4N A;  1T00 A;  5DAL A;  4AGS A;  4EDY A;  3GSS A;  5C04 A;  4HJ2 A;  3W8J A;  1S3A A;  2LNS A;  4TOP A;  5J41 A;  1QFN A;  4IP6 A;  2C4J A;  2PGT A;  5IOX A;  1A0F A;  3HYP A;  2XHF A;  1F3A A;  1V40 A;  4KND A;  3IC8 A;  2C0D A;  3HJM A;  3GST A;  4HU7 A;  3TKS C;  4O32 A;  3C71 A;  1MDJ A;  3F9U A;  1KNG A;  4P3Y B;  5A5K A;  1JLW A;  4ZIL A;  5ECH B;  1VF2 A;  1A2L A;  3FR9 A;  4K9Z A;  1QXH A;  1XWB A;  2JAC A;  1PD2 1;  2V1M A;  5ECL B;  1U87 A;  4EXJ A;  4BWS A;  2HNL A;  6GSX A;  1XVQ A;  1TXX A;  4V1A g;  1DE2 A;  4K5S A;  5IMV A;  3APQ A;  2O89 A;  5KEJ A;  4IVF A;  3CTF A;  4GXZ A;  5IMD A;  3FKF A;  1R5A A;  1U3A A;  2IN3 A;  3BCI A;  3EYT A;  1GNE A;  2DKI A;  2H66 A;  3HVN A;  6GSS A;  2CZ2 A;  1TRU A;  4F0B A;  2H76 A;  2A2S A;  2AHE A;  5JCW A;  2H0G A;  3GTU A;  2RUE A;  2TIR A;  5DBQ A;  2GDR A;  4HZ4 A;  1K3O A;  1YKA A;  22GS A;  2HSY A;  5ELA A;  1SD8 A;  4IHU A;  4ICY A;  4EVM A;  1SYR A;  2VL9 A;  1PL2 A;  2C8U A;  4ECI A;  2ZUP A;  3CBU A;  1PKW A;  2JSZ A;  5B7C A;  2HE3 A;  2L6C A;  4K7I A;  2VOC A;  3ED3 A;  2PUK C;  4HOJ A;  1BJX A;  4TXO A;  5F0G A;  3IOS A;  1FG4 A;  3M8N A;  3UBK A;  4JZQ A;  2ZNM A;  5D93 A;  4MF6 A;  2JZR A;  3LYK A;  1O8W A;  4V2M A;  3NOF A;  1NSW A;  3F4S A;  5B6M A;  1H75 A;  2VCV A;  2MZC A;  1PGT A;  4FH8 A;  5EL8 A;  5D9T A;  4LMW A;  4IQ1 A;  3KM6 A;  3P8W A;  1GSU A;  2XPD A;  2DIZ A;  2OBI A;  4AJ7 A;  4ZIJ A;  3C1R A;  2DJ2 A;  2LRC A;  4O5R A;  2D2Z A;  4ILF A;  3ZRD A;  2X49 A;  2VIM A;  1GTU A;  1TI1 A;  1XCC A;  3GX8 A;  3LXT A;  4IW9 A;  5G5E A;  4HUA A;  3IBH A;  2N5F A;  1EWX A;  2KUC A;  3IPZ A;  4Q5Q A;  5IQY A;  2VLU A;  2MBS A;  3EE2 A;  5HR2 A;  3L78 A;  1F6M C;  4GSS A;  2H72 A;  1TRV A;  4MPG A;  2MYG A;  1SL1 B;  2VCX A;  1H4O A;  4TR3 A;  2OE0 A;  3K8N A;  11GS A;  3TJB A;  1K0C A;  4WR4 A;  1GH2 A;  2H1A A;  1M0U A;  3HVX A;  3G7Y A;  5CRE A;  3FZA A;  2DBC A;  5B8B A;  1LJR A;  5LCZ A;  2I81 A;  3APO A;  1YJ6 A;  5AGY A;  1GNW A;  1JFU A;  4CW9 A;  5ENU A;  1T1V A;  4AJ8 A;  3VWU A;  1HQO A;  5ECM B;  2GGT A;  4TR0 A;  6GSY A;  2HRK A;  4E8E A;  1E6B A;  2AB6 A;  3LW9 A;  4HQS A;  5LD0 A;  1OE8 A;  3HKR A;  4K7N A;  1WJK A;  5ECR B;  1RK4 A;  4BA7 A;  3FR6 A;  1TK0 B;  3TRX A;  3FYG A;  3GN3 A;  4RQR A;  1QUW A;  3I9V 2;  1F9M A;  4MAB A;  5D9W A;  4LLR A;  4YQV A;  1SK1 A;  1VRS D;  2R2J A;  4MPF A;  3FZ5 A;  2DJJ A;  2QKE A;  1AIU A;  2H73 A;  4KDY A;  2B6M A;  5CRD A;  4JED A;  3L9U A;  2H1G A;  4QL7 A;  2L5O A;  2GSQ A;  4KAE A;  4F03 A;  3TJG A;  4H86 A;  1ZOF A;  4MA9 A;  4BPY A;  1UN2 A;  3US3 A;  4K0N A;  5DDL A;  5JCU A;  3ERG A;  2YWO A;  2OE1 A;  5D9X A;  4JRR A;  1ON4 A;  3LGC A;  5F07 A;  1B4Q A;  2GZY A;  4Z7X A;  2MMZ A;  4F0C A;  1SL0 B;  3EPT A;  3VPQ A;  1V98 A;  3DYR A;  3GHA A;  2CVD A;  1TRS A;  1ERU A;  4MZC A;  1DBY A;  4OD7 A;  2H1B A;  2R5G A;  2LJA A;  3Q19 A;  3P90 A;  2WCI A;  3ZML A;  5D96 A;  1O8X A;  3WGX A;  1EEM A;  1QQ2 A;  4ZB9 A;  1FHE A;  1A24 A;  17GS A;  2LJK A;  4AF2 A;  1YZX A;  2VL2 A;  3E9J B;  2IME A;  1IYI A;  2A2P A;  1FVK A;  1TOF A;  4PQ1 A;  3PH9 A;  3DVW A;  2KP1 A;  1BAY A;  2B1L A;  3QCP A;  3WGE A;  3KH9 A;  1S3D A;  3UIW A;  2M80 A;  3HA9 A;  4MJA A;  3H1N A;  4DSS B;  5B8A A;  3ZIT A;  2B5X A;  1S3C A;  1O6J A;  2E0Q A;  5B6N A;  1NW2 A;  5HFK A;  4MK3 A;  2JAD A;  1EGO A;  2F8F A;  2N5A A;  4D73 A;  1HYU A;  3L9V A;  1OC9 A;  4HS1 A;  3M9K A;  4ML6 A;  5ECO B;  2H19 A;  4ECJ A;  4Z2R A;  2R6K A;  4XRD A;  3J7Y b;  2B5E A;  2HXK A;  5INY A;  5KN0 A;  3IAS 2;  4IJ3 A;  1GUM A;  8GSS A;  3TOT A;  3R3E A;  1XWK A;  2VUP A;  4NWY A;  3D21 A;  4G19 A;  2LNT A;  3TKP A;  2FWE A;  1G6Y A;  1X9M B;  3KH7 A;  2P5Q A;  4NHW A;  2LS5 A;  2C80 A;  4PNG A;  2X8C A;  3IRA A;  2VCW A;  2BJX A;  3KD0 A;  3HJP A;  3UVH A;  5L71 A;  3HVV A;  1U88 A;  3TKQ A;  1DSB A;  4EF0 A;  2C3T A;  4WET A;  2C3Q A;  1M2D A;  1ST9 A;  1QMV A;  3E3E A;  1F3B A;  5FT3 A;  5ECQ B;  2NBS A;  3APS A;  4PTS A;  3ZVJ D;  1MDI A;  2BTO T;  5CNW A;  4LL1 B;  1SKS B;  4PQI A;  1K0B A;  1ERV A;  1YEX A;  1GTB A;  1LU4 A;  2YZU A;  1GSY A;  2H30 A;  4BVX B;  1J9B A;  2MMN A;  2KOK A;  3LJR A;  3TRP A;  3V1W A;  3HHV A;  2GVP A;  3HDC A;  3QD9 A;  5EVO A;  3WT1 A;  4I97 A;  4ECC A;  3ZL5 A;  3F4T A;  3IXR A;  1WPI A;  3ZIJ A;  1YEP A;  2IMI A;  2NDO A;  2DJK A;  4V2L A;  4EDZ A;  1E2Y A;  2H0I A;  5D8I A;  2R3X A;  2EC4 A;  3HD5 A;  2FD3 A;  5CP1 A;  2AYT A;  3HZ4 A;  1BED A;  1B48 A;  1SJZ A;  2PN8 A;  4G0L A;  1O73 A;  1ZGN A;  1OVN A;  3A5I A;  3GL3 A;  2GQM A;  4RI7 A;  5AIX A;  1GLQ A;  4OFT A;  4KCA A;  3KTL A;  4FYU A;  2B3S A;  4IBP A;  3D4M A;  5E4W A;  3KMN A;  3TJK A;  3SWL A;  2DKH A;  2TRC P;  1A2M A;  5DAK B;  5HQP A;  3WT2 A;  4OCE A;  4G0K A;  5GAN D;  3GKX A;  1ZMA A;  2JSY A;  5AIV A;  4MZW A;  1ZZY A;  4TN8 A;  2HZE B;  1M9B A;  1HNB A;  1EGR A;  1R26 A;  5G1K A;  4BVY B;  5HR1 A;  2PPT A;  4KCE A;  2R37 A;  2LTK A;  2DML A;  3UAR A;  5FHI A;  2WB9 A;  4XS4 B;  2IMF A;  5G2Z A;  4IKH A;  1U6T A;  19GS A;  1AQV A;  4L0U A;  2A4H A;  4MZB A;  3EVI A;  5HFI A;  2LRT A;  1AC1 A;  1GSF A;  3A2W A;  3IHQ A;  4EE0 A;  3R2Q A;  2R4V A;  3UJ1 A;  3M1G A;  3HVS A;  1A0R P;  2CX4 A;  3GA4 A;  4L5O A;  3U5R E;  1MDK A;  3ZRE A;  4JU5 A;  5CYY A;  2IMK A;  4YAV A;  4NAX A;  3UOM A;  5COH A;  3LXZ A;  1G7O A;  2OJL A;  5G1L A;  1TU8 A;  3BOA A;  1KEB A;  1BX9 A;  3D0Z A;  2IMD A;  4EIQ A;  2V41 A;  2IJY A;  4POM A;  1MEK A;  3C73 A;  1DE1 A;  2FA8 A;  2QGV A;  3VLN A;  14GS A;  4MDC A;  5HR0 A;  2OE3 A;  4KB3 A;  3GH9 A;  5DQS A;  2G0F A;  3TUE A;  1U3I A;  3F6F A;  3UBL A;  2KHP A;  2DIY A;  4K2X A;  4OFN A;  2LUS A;  4YQM A;  2M72 A;  2HRN A;  3H8Q A;  4DEJ A;  1X9W B;  9GSS A;  2FGX A;  4TR1 B;  4BIK A;  5ABR A;  2QSI A;  1I5G A;  3UEM A;  3QMX A;  2GZP A;  1WIK A;  1PQN A;  3QOU A;  5JCG A;  2PWJ A;  3P7X A;  4K1F A;  2HRF A;  2MMO A;  4AJ6 A; 
#chains in the Genus database with same CATH homology
 3DEX A;  2REM A;  2PBJ A;  3GIX A;  3FZ9 A;  1TJD A;  1XW9 A;  3IV4 A;  5EPF A;  5ECP B;  4TR4 A;  5G31 A;  2C1Y A;  2GTU A;  4KUN A;  1WMJ A;  1Z6M A;  2VLV A;  1K3L A;  1EV9 A;  2H74 A;  1UVZ A;  5GSS A;  1G6W A;  1R4W A;  5HFG A;  1BQ7 A;  2XBQ A;  2H71 A;  3Q6O A;  2EIQ A;  2GSS A;  1URM A;  2H8L A;  2AAW A;  4O7H A;  4LMV A;  1X5C A;  1FAA A;  2LST A;  2VL2 C;  4MF5 A;  2A4V A;  4POB A;  4XHM A;  2AUV A;  4DSR A;  2WUL A;  4MH2 A;  3TOU A;  5H5Q A;  1TTZ A;  2G2Q A;  3CTG A;  2O87 A;  1GRX A;  3KCM A;  1NHY A;  4X1U A;  4ECB A;  3GFK A;  1FW1 A;  2YNX A;  1ABA A;  4L5L A;  1JZD A;  2J23 A;  3GL5 A;  2L4C A;  4XS1 A;  4K6X A;  4YQU A;  4PNF A;  3MIX A;  13GS A;  2YOI A;  2H70 A;  3KZQ A;  3QAG A;  3DD3 A;  2CAQ A;  5DCH A;  3CXG A;  2WZ9 A;  2IWT A;  2YZH A;  3GMF A;  4WF4 A;  2IL3 A;  2XC2 A;  1X0R A;  4I5Q A;  2GS3 A;  2YJH A;  4XTS A;  4HDE A;  2NVL A;  4OMV A;  2B7J A;  5H5S A;  3PIN A;  1A8Y A;  1SJI A;  4ZBD A;  1X9S B;  3F8U A;  4MNN A;  1TK8 B;  1GP1 A;  2B1K A;  4OWY A;  2JU5 A;  5DJM A;  1R7H A;  4EO3 A;  1OAZ A;  4OO5 A;  1IYH A;  2Z9S A;  5F05 A;  1PN9 A;  4GST A;  1XVW A;  1G7E A;  2FCH A;  4Q5N A;  3LWA A;  3QDN A;  4DSS A;  2HYX A;  3Q18 A;  4HJM A;  3TCO A;  3HCZ A;  3HJO A;  3F3R A;  5CRH A;  3ZVJ A;  4MJB A;  18GS A;  2GQK A;  2UZ8 A;  2GSR A;  4BL7 B;  3IHG A;  2F9S A;  1EOG A;  3BBY A;  3EU4 A;  6GSU A;  1NM3 A;  2R0G A;  3D5J A;  4EKZ A;  4PUR A;  3DRN A;  7GSS A;  5GZZ B;  3F63 A;  1O7U A;  2LQQ A;  1V2A A;  4DSQ A;  3VI7 A;  5A4V A;  5IPG A;  3MWH A;  2WDU A;  4ZB8 A;  1ZYN A;  1RQM A;  3ME7 A;  1XWG A;  4RQX A;  1W89 A;  2VAF A;  2OAC A;  5ECS A;  2LV3 A;  4ZXG A;  2X4A A;  5ID2 B;  4YAP A;  2V2G A;  3MDK A;  3WD6 A;  4USS A;  2OBK A;  2H6Z A;  4ID0 A;  3LSZ A;  1PX6 A;  4N0V A;  1JZO A;  1JZW A;  2VM1 A;  4HI7 A;  5KOX A;  3QR6 A;  3VI5 A;  1Q4J A;  3KTB A;  4N11 A;  2RLI A;  3FR3 A;  2E2G A;  4ZL7 A;  3MAK A;  1K0N A;  3IAM 2;  3F0I A;  1PL1 A;  2DC5 A;  2VM2 A;  4TVE A;  4IN0 A;  3J7Y k;  1O81 A;  4PX1 A;  3O6T A;  3KJY A;  3DVX A;  4F9Z A;  4CY6 A;  2RUF A;  1ZL9 A;  3KGK A;  2V6K A;  3AY8 A;  2VL3 A;  1GL8 A;  1ERW A;  2PVQ A;  3GX0 A;  2I1U A;  5F06 A;  2FWH A;  2WRT A;  1YDK A;  3TGZ A;  1FO5 A;  3UL3 A;  2IIY A;  3TKR A;  4I6X A;  5GAP D;  5DVB A;  4LA1 A;  1OKT A;  3A2V A;  1RW1 A;  4A5P A;  16GS A;  5IOW A;  4BVX A;  4QL9 A;  2V6O A;  3ZMK A;  4Q5F A;  1YF0 A;  1WP0 A;  1I9D A;  2IFQ B;  4FQU A;  4G10 A;  1T4Y A;  2MBT A;  1WRY A;  3TJJ A;  2DJ0 A;  5IMF A;  4EC0 A;  5IMC A;  2YWM A;  3G7I A;  2B5Y A;  5IO0 A;  3RAZ A;  1SU9 A;  3U6V A;  4IQA A;  1AXD A;  4KGI A;  4IGJ A;  4GCI A;  4J57 E;  3KP9 A;  4TW5 A;  1BYE A;  1K3Y A;  3GNJ A;  1XBS A;  2CVB A;  3D4T A;  1JZR A;  3RDW A;  5KOW A;  1XZO A;  1XWA A;  4KDU A;  3DIE A;  5JWO B;  2P5R A;  3IR4 A;  1Z9H A;  4JR6 A;  1LBK A;  1V57 A;  1SK0 A;  1CQH A;  1ZYQ B;  1KBN A;  1Y25 A;  1AAZ A;  3KXO A;  5AN1 A;  4GQF A;  1M7T A;  4HZ2 A;  2DJ1 A;  5DAK A;  3TB2 A;  1XFL A;  4JR4 A;  1ACV A;  4EIP A;  2PVO C;  2VO4 A;  4ULX A;  1WOU A;  2K8V A;  4PUF C;  5DCG A;  2O85 A;  4N10 A;  5D73 A;  3NIV A;  4GSN A;  2FNO A;  1ERT A;  2BMX A;  2HZE A;  1PA3 A;  4HQZ A;  3O76 A;  2X99 A;  4BVY A;  3VPT A;  5C00 A;  2L5L A;  5CAX A;  3TJF A;  5ELG A;  2PMT A;  4XS4 A;  2DLX A;  1KTE A;  5G5F A;  2PER A;  3KMO A;  2QA1 A;  2CX3 A;  4IEL A;  3MNG A;  1SKW B;  1EEJ A;  3M0F A;  2OA7 A;  1SYX A;  3FRC A;  1F37 A;  2HSM A;  4POL A;  1FOV A;  1AQX A;  5ECI B;  3ZIV A;  1ILO A;  1TP9 A;  2JL4 A;  2F51 A;  3I43 A;  1OE7 A;  4XIH A;  5DJL A;  1W4V A;  1EP7 A;  1AW9 A;  2YCD A;  5CO3 A;  2OKA A;  3H93 A;  5DQY A;  2P31 A;  2LEG A;  3MYD A;  2V32 A;  1YKC A;  2HFD A;  4MCU A;  2FHE A;  1OYJ A;  4CDO A;  1K0M A;  4EL1 A;  4FYC A;  1WWJ A;  3QPM A;  4MP4 A;  1VF4 A;  4N0Z A;  1XOA A;  4NXI A;  3W6G A;  4WKW A;  4YKF A;  1J08 A;  1M99 A;  1XIY A;  2YN1 A;  4ZBA A;  4Q5R A;  2TRX A;  3E0U A;  2O8V B;  2H1D A;  2R0C A;  4V1A p;  3RHC A;  1TK5 B;  2I3Y A;  1GUL A;  6GSW A;  3QFA C;  2ZCT A;  1EZK A;  3VUR A;  4TR1 A;  3NZN A;  4RI6 A;  2LRN A;  6GST A;  1MD4 A;  2VCZ A;  4O5Q A;  4K8M A;  1FVJ A;  3CRU A;  2QA2 A;  1GTI A;  1Z5Y E;  3A3T A;  2XPE A;  5A4W A;  1Q98 A;  2X8H A;  3ZTL A;  5FWG A;  3I69 A;  3D22 A;  1PN0 A;  3RPN A;  1PX7 A;  3F6D A;  1YF1 A;  5DAL B;  3ME8 A;  1FB0 A;  5IMZ A;  3TDG A;  4E8H A;  4I2U A;  2HZF A;  3C8E A;  1EOH A;  5J3R A;  2NTO A;  3IC4 A;  1Y6E A;  4OO4 A;  1B9Y C;  2H0H A;  4HEA 2;  1XWC A;  2ES7 A;  2VD1 A;  5EY6 A;  1M2A A;  1VGL A;  2YV7 A;  3VWX A;  2XBI A;  4IJI A;  1UA5 A;  1PSQ A;  4L8E A;  2M46 A;  3IA1 A;  2CQ9 A;  2A2R A;  2FUG 2;  1AUC A;  1JLV A;  1PMT A;  3DGQ A;  5J4U A;  3G7J A;  2JZS A;  4ZL9 A;  3EIN A;  4WF5 A;  2B7K A;  3FHK A;  1TRW A;  4F82 A;  2RII A;  5ECN B;  3KIJ A;  3W8S A;  2GZZ A;  1TKD B;  4I8B A;  4GF0 A;  5GST A;  3N9J A;  3VWW A;  3GRX A;  4KX4 A;  1T8E B;  1NHO A;  1THO A;  2FWG A;  2FWF A;  2O7K A;  3HY2 A;  2FY6 A;  3KP8 A;  4K7O A;  1X5D A;  3LOR A;  4MF7 A;  1XXU A;  1M2B A;  3GTU B;  2IPA A;  3IK9 A;  5LNK e;  1XOB A;  2JZT A;  2VCT A;  3BJ5 A;  3PGT A;  3WYW A;  3LG6 A;  4CHS A;  4ZBB A;  3EC3 A;  4JE1 A;  4MMM A;  2DSA A;  3S9F A;  3HXS A;  1B8X A;  2FA4 A;  4MJC A;  1C72 A;  3TKS A;  4J56 E;  3ZLP A;  1FB6 A;  4FIW A;  5HR3 A;  2E7P A;  1Z7P A;  4K0G A;  1YY7 A;  4TXO B;  2WFC A;  12GS A;  2KLX A;  5KN3 A;  1HD2 A;  2MMA A;  4KSM A;  3QAV A;  2DMM A;  2I4A A;  3ERW A;  3EWL A;  3DXB A;  2ON5 A;  5BMU A;  4NV2 A;  1XW6 A;  2LKU A;  4NPB A;  3RPP A;  1GUK A;  3IE3 A;  4L0W A;  1QK8 A;  2F3M A;  4KH7 A;  3ZYW A;  4OCF A;  1N8J A;  3LQ7 A;  4BL7 A;  3C7M A;  4HU9 A;  4F2I A;  2ON7 A;  3IK7 A;  1A8L A;  2F8A A;  2AV4 A;  4KE3 A;  2X8G A;  1B4P A;  2OAD A;  5AIS A;  2H75 A;  3L9S A;  4G2E A;  3I6A A;  4POK A;  1BG5 A;  3M3M A;  2GLR A;  1YQ1 A;  4GRF A;  1ZYP A;  2WJU A;  2QC7 A;  4MH3 A;  2CV4 A;  3EU3 A;  4X4J A;  1CQG A;  1M9A A;  1F2E A;  2P0G A;  5H5R A;  1GSE A;  3ERF A;  4Z2U A;  4ISD A;  1B9X C;  3GKM A;  5ID2 A;  2K18 A;  3FW2 A;  4GTU A;  1G0T A;  3LFL A;  3D6I A;  2YPM A;  2GT5 A;  2YV9 A;  2X64 A;  1XW5 A;  1PKZ A;  2L59 A;  3GH6 A;  4BWQ A;  4ACS A;  5KN1 A;  1ZCP A;  2WGR A;  3LEF A;  1TU7 A;  2L4Q A;  4PXO A;  4KSO A;  2RM5 A;  1X5E A;  1R5P A;  4YKG A;  1EP8 A;  4X0X A;  3GUS A;  4ZB6 A;  2K8S A;  3H79 A;  4GWR A;  1DUG A;  2CT6 A;  4WEY A;  1T7P B;  2YJ7 A;  3CSI A;  3EUR A;  3FZ4 A;  1ZYE A;  4V2N A;  3UAP A;  4CY8 A;  1UC7 A;  3ISO A;  1A2J A;  3CYN A;  3TRQ A;  5IO2 A;  4LL4 B;  3FEU A;  2ALB A;  2LQO A;  3F3Q A;  3OR5 A;  4OFM A;  3GUR A;  1VF1 A;  3N5O A;  2EIO A;  2IFQ A;  3DWV A;  3FY7 A;  4O92 A;  3VFI A;  2VLT A;  3DKS A;  1USB A;  5F8B A;  4GLT A;  4KDX A;  5G30 A;  5IM9 A;  2L6D A;  3A5W A;  3RHB A;  1VF3 A;  10GS A;  4O5U A;  3GKK A;  3VK9 A;  1T4Z A;  4GQC A;  4PUA A;  2HI7 A;  5JWR B;  1EV4 A;  1A23 A;  3GYK A;  4ML1 A;  2YAN A;  3QFB C;  3L0H A;  5A4U A;  4KA0 A;  2PU9 C;  2WS2 A;  2H01 A;  2K9F A;  1GWC A;  1XPV A;  1V9W A;  1SD9 A;  1Z7R A;  1ML6 A;  1WE0 A;  5E59 A;  4TRX A;  2FLS A;  1GSS A;  5IPH A;  1PRX A;  3ZZX A;  4I2T A;  3WGD A;  1OKD A;  2CAI A;  1MTC A;  2HRA A;  1TW9 A;  3ZFB A;  4NHZ A;  3IDV A;  3O3T A;  3MSZ A;  1GSD A;  3JCM L;  5J9C A;  1O85 A;  2H6X A;  3GV1 A;  4WBJ A;  1SJ6 A;  2EIR A;  5J5N A;  5BRT A;  3P2A A;  1N2A A;  4G0I A;  1SEN A;  3H4K A;  2YWN A;  1K0O A;  5KN2 A;  1Z6N A;  3VWV A;  4WR5 A;  4IS0 A;  2HLS A;  2HT9 A;  2GQL A;  2YWI A;  3HZ8 A;  4MJE A;  4Z2T A;  2R0P A;  2NPB A;  2YP6 A;  4DVC A;  1SK2 A;  4G9H A;  3UMA A;  4EUY A;  2HSH A;  4FO5 A;  4KW6 A;  2RM6 A;  4D73 B;  3UVT A;  3FMW A;  4WBR D;  1OC9 B;  3A2X A;  4WXT A;  1AQW A;  3EMP A;  4IP1 A;  4TKY A;  3CSJ A;  5IMA A;  3DML A;  1GUH A;  4J2F A;  4PGT A;  4ZL8 A;  3FK8 A;  3Q74 A;  2LJR A;  2AJQ B;  3PPU A;  3PR8 A;  4N30 A;  1SKR B;  5IIZ A;  3CSH A;  5D9V A;  2C3N A;  4XRA A;  4TXV A;  1QGV A;  2N5B A;  1MD3 A;  1TDI A;  3G9B A;  1HNA A;  2H6Y A;  2J9H A;  3CMI A;  4XCS A;  6GSV A;  4XS6 A;  3QAW A;  3BD2 A;  2I9H A;  3EMX A;  1THX A;  4MLY A;  1OC3 A;  2CZ3 A;  2DJ3 A;  3F4R A;  4QQ7 A;  3BCK A;  2CVK A;  3ZFL A;  4FYB A;  1GTA A;  5ECK B;  4X43 A;  5CRW A;  1GSQ A;  1V58 A;  3TKS E;  3C1S A;  1HNC A;  3SBC A;  2C0E A;  3M9J A;  4NMU A;  4NV5 A;  1SL2 B;  3LYP A;  1JHB A;  3CRT A;  1K0A A;  2KP2 A;  4PQH A;  4K5R A;  1T3B A;  4KF9 A;  1GLP A;  3KEB A;  2C0G A;  1TI3 A;  1FOH A;  4RUV A;  5CRG A;  2VCQ A;  1OC8 A;  1J0F A;  2VD0 A;  1K0D A;  2GT6 A;  4JBB A;  5JWQ B;  2E2M A;  3GKN A;  20GS A;  1Z3E A;  3RBT A;  2CA8 A;  2GST A;  4K2D A;  2L57 A;  4YH2 A;  5J9B A;  2C0F A;  2K6V A;  3L4N A;  1T00 A;  5DAL A;  4AGS A;  4EDY A;  3GSS A;  5C04 A;  4HJ2 A;  3W8J A;  1S3A A;  2LNS A;  4TOP A;  5J41 A;  1QFN A;  4IP6 A;  2C4J A;  2PGT A;  5IOX A;  1A0F A;  3HYP A;  2XHF A;  1F3A A;  1V40 A;  4KND A;  3IC8 A;  2C0D A;  3HJM A;  3GST A;  4HU7 A;  3TKS C;  4O32 A;  3C71 A;  1MDJ A;  3F9U A;  1KNG A;  4P3Y B;  5A5K A;  1JLW A;  4ZIL A;  5ECH B;  1VF2 A;  1A2L A;  3FR9 A;  4K9Z A;  1QXH A;  1XWB A;  2JAC A;  1PD2 1;  2V1M A;  5ECL B;  1U87 A;  4EXJ A;  4BWS A;  2HNL A;  6GSX A;  1XVQ A;  1TXX A;  4V1A g;  1DE2 A;  4K5S A;  5IMV A;  3APQ A;  2O89 A;  5KEJ A;  4IVF A;  3CTF A;  4GXZ A;  5IMD A;  3FKF A;  1R5A A;  1U3A A;  2IN3 A;  3BCI A;  3EYT A;  1GNE A;  2DKI A;  2H66 A;  6GSS A;  2CZ2 A;  1TRU A;  4F0B A;  2H76 A;  2A2S A;  2AHE A;  5JCW A;  2H0G A;  3GTU A;  2RUE A;  2TIR A;  5DBQ A;  2GDR A;  4HZ4 A;  1K3O A;  1YKA A;  22GS A;  2HSY A;  5ELA A;  1SD8 A;  4IHU A;  4ICY A;  4EVM A;  1SYR A;  2VL9 A;  1PL2 A;  2C8U A;  4ECI A;  2ZUP A;  3CBU A;  1PKW A;  2JSZ A;  5B7C A;  2HE3 A;  2L6C A;  4K7I A;  2VOC A;  3ED3 A;  2PUK C;  4HOJ A;  1BJX A;  4TXO A;  5F0G A;  3IOS A;  1FG4 A;  3M8N A;  3UBK A;  4JZQ A;  2ZNM A;  5D93 A;  4MF6 A;  2JZR A;  3LYK A;  1O8W A;  4V2M A;  3NOF A;  1NSW A;  3F4S A;  5B6M A;  1H75 A;  2VCV A;  2MZC A;  1PGT A;  4FH8 A;  5EL8 A;  5D9T A;  4LMW A;  4IQ1 A;  3KM6 A;  3P8W A;  1GSU A;  2XPD A;  2DIZ A;  2OBI A;  4AJ7 A;  4ZIJ A;  3C1R A;  2DJ2 A;  2LRC A;  4O5R A;  2D2Z A;  4ILF A;  3ZRD A;  2X49 A;  2VIM A;  1GTU A;  1TI1 A;  1XCC A;  3GX8 A;  3LXT A;  4IW9 A;  5G5E A;  4HUA A;  3IBH A;  2N5F A;  1EWX A;  2KUC A;  3IPZ A;  4Q5Q A;  5IQY A;  2VLU A;  2MBS A;  3EE2 A;  5HR2 A;  3L78 A;  1F6M C;  4GSS A;  2H72 A;  1TRV A;  4MPG A;  2MYG A;  1SL1 B;  2VCX A;  1H4O A;  4TR3 A;  2OE0 A;  3K8N A;  11GS A;  3TJB A;  1K0C A;  4WR4 A;  1GH2 A;  2H1A A;  1M0U A;  3HVX A;  3G7Y A;  5CRE A;  3FZA A;  2DBC A;  5B8B A;  1LJR A;  5LCZ A;  2I81 A;  3APO A;  1YJ6 A;  5AGY A;  1GNW A;  1JFU A;  4CW9 A;  5ENU A;  1T1V A;  4AJ8 A;  3VWU A;  1HQO A;  5ECM B;  2GGT A;  4TR0 A;  6GSY A;  2HRK A;  4E8E A;  1E6B A;  2AB6 A;  3LW9 A;  4HQS A;  5LD0 A;  1OE8 A;  3HKR A;  4K7N A;  1WJK A;  5ECR B;  1RK4 A;  4BA7 A;  3FR6 A;  1TK0 B;  3TRX A;  3FYG A;  3GN3 A;  4RQR A;  1QUW A;  3I9V 2;  1F9M A;  4MAB A;  5D9W A;  4LLR A;  4YQV A;  1SK1 A;  1VRS D;  2R2J A;  4MPF A;  3FZ5 A;  2DJJ A;  2QKE A;  1AIU A;  2H73 A;  4KDY A;  2B6M A;  5CRD A;  4JED A;  3L9U A;  2H1G A;  4QL7 A;  2L5O A;  2GSQ A;  4KAE A;  4F03 A;  3TJG A;  4H86 A;  1ZOF A;  4MA9 A;  4BPY A;  1UN2 A;  3US3 A;  4K0N A;  5DDL A;  5JCU A;  3ERG A;  2YWO A;  2OE1 A;  5D9X A;  4JRR A;  1ON4 A;  3LGC A;  5F07 A;  1B4Q A;  2GZY A;  4Z7X A;  2MMZ A;  4F0C A;  1SL0 B;  3EPT A;  3VPQ A;  1V98 A;  3DYR A;  3GHA A;  2CVD A;  1TRS A;  1ERU A;  4MZC A;  1DBY A;  4OD7 A;  2H1B A;  2R5G A;  2LJA A;  3Q19 A;  3P90 A;  2WCI A;  3ZML A;  5D96 A;  1O8X A;  3WGX A;  1EEM A;  1QQ2 A;  4ZB9 A;  1FHE A;  1A24 A;  17GS A;  2LJK A;  4AF2 A;  1YZX A;  2VL2 A;  3E9J B;  2IME A;  1IYI A;  2A2P A;  1FVK A;  1TOF A;  4PQ1 A;  3PH9 A;  3DVW A;  2KP1 A;  1BAY A;  2B1L A;  3QCP A;  3WGE A;  3KH9 A;  1S3D A;  3UIW A;  2M80 A;  3HA9 A;  4MJA A;  3H1N A;  4DSS B;  5B8A A;  3ZIT A;  2B5X A;  1S3C A;  1O6J A;  2E0Q A;  5B6N A;  1NW2 A;  5HFK A;  4MK3 A;  2JAD A;  1EGO A;  2F8F A;  2N5A A;  4D73 A;  1HYU A;  3L9V A;  1OC9 A;  4HS1 A;  3M9K A;  4ML6 A;  5ECO B;  2H19 A;  4ECJ A;  4Z2R A;  2R6K A;  4XRD A;  3J7Y b;  2B5E A;  2HXK A;  5INY A;  5KN0 A;  3IAS 2;  4IJ3 A;  1GUM A;  8GSS A;  3TOT A;  3R3E A;  1XWK A;  2VUP A;  4NWY A;  3D21 A;  4G19 A;  2LNT A;  3TKP A;  2FWE A;  1G6Y A;  1X9M B;  3KH7 A;  2P5Q A;  4NHW A;  2LS5 A;  2C80 A;  4PNG A;  2X8C A;  3IRA A;  2VCW A;  2BJX A;  3KD0 A;  3HJP A;  3UVH A;  5L71 A;  3HVV A;  1U88 A;  3TKQ A;  1DSB A;  4EF0 A;  2C3T A;  4WET A;  2C3Q A;  1M2D A;  1ST9 A;  1QMV A;  3E3E A;  1F3B A;  5FT3 A;  5ECQ B;  2NBS A;  3APS A;  4PTS A;  3ZVJ D;  1MDI A;  2BTO T;  5CNW A;  4LL1 B;  1SKS B;  4PQI A;  1K0B A;  1ERV A;  1YEX A;  1GTB A;  1LU4 A;  2YZU A;  1GSY A;  2H30 A;  4BVX B;  1J9B A;  2MMN A;  2KOK A;  3LJR A;  3TRP A;  3V1W A;  3HHV A;  2GVP A;  3HDC A;  3QD9 A;  5EVO A;  3WT1 A;  4I97 A;  4ECC A;  3ZL5 A;  3F4T A;  3IXR A;  1WPI A;  3ZIJ A;  1YEP A;  2IMI A;  2NDO A;  2DJK A;  4V2L A;  4EDZ A;  1E2Y A;  2H0I A;  5D8I A;  2R3X A;  2EC4 A;  3HD5 A;  2FD3 A;  5CP1 A;  2AYT A;  3HZ4 A;  1BED A;  1B48 A;  1SJZ A;  2PN8 A;  4G0L A;  1O73 A;  1ZGN A;  1OVN A;  3A5I A;  3GL3 A;  2GQM A;  4RI7 A;  5AIX A;  1GLQ A;  4OFT A;  4KCA A;  3KTL A;  4FYU A;  2B3S A;  4IBP A;  3D4M A;  5E4W A;  3KMN A;  3TJK A;  3SWL A;  2DKH A;  2TRC P;  1A2M A;  5DAK B;  5HQP A;  3WT2 A;  4OCE A;  4G0K A;  5GAN D;  3GKX A;  1ZMA A;  2JSY A;  5AIV A;  4MZW A;  1ZZY A;  4TN8 A;  2HZE B;  1M9B A;  1HNB A;  1EGR A;  1R26 A;  5G1K A;  4BVY B;  5HR1 A;  2PPT A;  4KCE A;  2R37 A;  2LTK A;  2DML A;  3UAR A;  5FHI A;  2WB9 A;  4XS4 B;  2IMF A;  5G2Z A;  4IKH A;  1U6T A;  19GS A;  1AQV A;  4L0U A;  2A4H A;  4MZB A;  3EVI A;  5HFI A;  2LRT A;  1AC1 A;  1GSF A;  3A2W A;  3IHQ A;  4EE0 A;  3R2Q A;  2R4V A;  3UJ1 A;  3M1G A;  3HVS A;  1A0R P;  2CX4 A;  3GA4 A;  4L5O A;  3U5R E;  1MDK A;  3ZRE A;  4JU5 A;  5CYY A;  2IMK A;  4YAV A;  4NAX A;  3UOM A;  5COH A;  3LXZ A;  1G7O A;  2OJL A;  5G1L A;  1TU8 A;  3BOA A;  1KEB A;  1BX9 A;  3D0Z A;  2IMD A;  4EIQ A;  2V41 A;  2IJY A;  4POM A;  1MEK A;  3C73 A;  1DE1 A;  2FA8 A;  2QGV A;  3VLN A;  14GS A;  4MDC A;  5HR0 A;  2OE3 A;  4KB3 A;  3GH9 A;  5DQS A;  2G0F A;  3TUE A;  1U3I A;  3F6F A;  3UBL A;  2KHP A;  2DIY A;  4K2X A;  4OFN A;  2LUS A;  4YQM A;  2M72 A;  2HRN A;  3H8Q A;  4DEJ A;  1X9W B;  9GSS A;  2FGX A;  4TR1 B;  5ABR A;  2QSI A;  1I5G A;  3UEM A;  3QMX A;  2GZP A;  1WIK A;  1PQN A;  3QOU A;  5JCG A;  2PWJ A;  3P7X A;  4K1F A;  2HRF A;  2MMO A;  4AJ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...