3HDCA

The crystal structure of thioredoxin protein from geobacter metallireducens
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
150
structure length
150
Chain Sequence
SLAPGKAESDAPLVRTGALAPNFKLPTLSGENKSLAQYRGKIVLVNFWASWCPYCRDEMPSMDRLVKSFPKGDLVVLAVNVEKRFPEKYRRAPVSFNFLSDATGQVQQRYGANRLPDTFIVDRKGIIRQRVTGGIEWDAPKVVSYLKSLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thioredoxin family protein
publication title The crystal structure of thioredoxin protein from Geobacter metallireducens
rcsb
source organism Geobacter metallireducens gs-15
molecule tags Oxidoreductase
total genus 38
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2009-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3hdcA01
3WGDA 3L78A 5DQYA 2XBQA 1Y25A 1TDIA 1QMVA 1QUWA 1S3AA 2F51A 2GSSA 3L4NA 2VCQA 4N11A 3RAZA 2K8VA 2HNLA 1X9MB 18GSA 3M9KA 3APSA 1GUHA 1OVNA 1A0FA 3D6IA 1QFNA 2DIYA 3ZL5A 4Q5NA 5ECSA 1U87A 4MABA 4TW5A 4EE0A 2LTKA 1THXA 8GSSA 1TP9A 2MBSA 5F07A 4TOPA 3F3RA 4KH7A 4K7IA 2H0IA 2HZEA 2PVQA 4K7OA 2P5RA 1OKDA 1J08A 4GCIA 1EEJA 2QC7A 3MNGA 1R4WA 4EC0A 2V2GA 2L5LA 2OACA 3WGXA 1Q98A 4AJ6A 3EMXA 1SKSB 2Z9SA 2VL2A 5D9WA 1V58A 1KNGA 2L6CA 1W4VA 1ZGNA 5CP1A 2LRNA 3IHQA 5F8BA 2QSIA 5INYA 3L9VA 3N9JA 3FYGA 2V32A 3UEMA 5DQSA 2RUFA 4POBA 17GSA 3I9V2 1F37A 3KD0A 4V2MA 5HFKA 5COHA 19GSA 1XW5A 3Q74A 1CQGA 2IN3A 1SKRB 1EEMA 4I5QA 3DEXA 5HFGA 3JCML 2GVPA 2RIIA 3KEBA 5AIVA 5A4VA 2ZUPA 4BL7A 3KJYA 4MPFA 4FYCA 5IMFA 3DIEA 2E7PA 4OO5A 3PH9A 5LNKe 5KN3A 3P90A 3GV1A 4PUFC 2EIRA 2YJHA 4IP6A 4N0ZA 4ZBAA 3TJKA 4PNFA 2O89A 1OKTA 4XS4B 5HR3A 3TKQA 1XW6A 2C3TA 4JBBA 1E6BA 4OFTA 3LSZA 3MWHA 1UN2A 3LGCA 1JFUA 4ECBA 5A5KA 3ZMLA 3F4TA 1T7PB 3TKSA 2KP2A 1KBNA 1XWBA 4GWRA 1YKCA 1K3YA 1TKDB 2B7KA 3QPMA 3M3MA 4KNDA 4HQSA 1R5AA 4OO4A 2HRFA 2X8CA 2LKUA 3BD2A 4TR1A 2HLSA 3HJOA 2RLIA 4TR4A 2B5XA 5IIZA 4GXZA 1TRVA 3QMXA 3F6FA 1FG4A 1N2AA 1A0RP 4X43A 2H71A 2L59A 3FZ9A 4KSMA 3NIVA 1OC3A 4K9ZA 3FK8A 2GT5A 3J7Yk 5J5NA 2K9FA 3HKRA 2FA4A 1FOVA 2JACA 2C4JA 1WOUA 1GSYA 1C72A 3WT1A 3W8JA 3SBCA 4WF4A 4ZL7A 3DVWA 2H76A 1AUCA 4FIWA 1R26A 4G9HA 2L6DA 1FW1A 5CYYA 2O87A 2EC4A 3HHVA 3IAS2 3GFKA 2PERA 1GSUA 2VIMA 4F2IA 2E2MA 4HU9A 4OFMA 2I9HA 3LWAA 5A4UA 2GZYA 4MZWA 2IMFA 4IN0A 1V57A 1N8JA 3AY8A 3GKMA 2HZEB 4IQAA 3VFIA 1MTCA 2VM2A 2H1AA 1YEXA 3IC4A 1K0OA 2MBTA 2FUG2 3FY7A 2BTOT 2GLRA 5D9XA 2N5FA 5HR2A 2C3NA 1WIKA 2FD3A 1VF4A 2CVBA 6GSXA 3GN3A 4EDZA 1RW1A 2WFCA 1B9YC 3IAM2 1TI3A 2B5YA 4WR4A 6GSTA 1SK1A 3ERWA 4OMVA 2AUVA 1SJIA 5CRDA 1EV4A 5HR1A 1VF2A 1Z7RA 3FRCA 3HXSA 1TK0B 3APOA 1BJXA 3IDVA 3TJFA 1AIUA 1GP1A 2YCDA 3LYPA 3FZ4A 2GGTA 1ZYEA 1A2MA 4CDOA 2C0DA 3RPNA 2YZUA 2P31A 4GSTA 3SWLA 1TRUA 3LXZA 2RM6A 3G9BA 3FZ5A 2DJJA 3M8NA 2C3QA 2VLUA 4ZBDA 4OCFA 1FVKA 1PGTA 3FHKA 3M0FA 2DIZA 1EP7A 4WEYA 2OE0A 6GSYA 3ZFLA 3F9UA 3TRPA 2DJ1A 3GKKA 5ECPB 3F0IA 3F63A 4OD7A 1K0CA 3D4TA 1XPVA 4G2EA 1XOBA 2WB9A 2L4CA 4EUYA 4G19A 4ACSA 2FWEA 1TK8B 4TR1B 3DKSA 4J56E 1M2DA 2KLXA 2XPDA 1F6MC 4O92A 2AB6A 2H72A 3KH7A 2X8HA 2GSTA 4ZB8A 2HFDA 1MD3A 4F82A 2EIOA 3TJGA 3DD3A 1JLWA 2AHEA 5CREA 1WE0A 4EXJA 4NAXA 6GSUA 2HI7A 2X8GA 3GTUA 6GSSA 3HZ8A 5FHIA 1BG5A 5IOXA 5AGYA 1PL1A 1EV9A 3ERGA 4GF0A 3W6GA 4XS1A 3A5WA 3DGQA 1PA3A 1SYXA 4WBRD 4PQHA 4IS0A 3CYNA 2OBIA 2VD0A 4QL7A 2QGVA 2PPTA 2J9HA 1GTAA 2F8FA 1EP8A 5CRWA 2V1MA 4NMUA 4MDCA 2H74A 5CO3A 1SYRA 3ZYWA 2QKEA 4GLTA 2CZ2A 14GSA 4ZL8A 4NV2A 2VLVA 2VCXA 2CAQA 2H19A 4XS4A 2P5QA 2JADA 3Q19A 1U3IA 5AIXA 3U6VA 4KX4A 5F06A 3GX0A 5E4WA 5EPFA 2CA8A 2H73A 2ON7A 3UL3A 3Q18A 4MZBA 5B8AA 4KAEA 3KMOA 3TDGA 2C0EA 2ALBA 2BMXA 5E59A 1VF1A 4F0BA 2J23A 1XWGA 3MSZA 4EF0A 2XPEA 1FVJA 1LU4A 3IV4A 3GL5A 4KB3A 2H0HA 4ECIA 4H86A 5D73A 5G5FA 1K0BA 1ON4A 3BBYA 4K2DA 2WGRA 3HDCA 2IL3A 1Z6NA 1ERTA 1Y6EA 2E2GA 2DJKA 3DXBA 6GSWA 1TW9A 4I2UA 5DBQA 5ECMB 1ERWA 3LQ7A 1G6YA 4BWSA 1U88A 5EVOA 1MD4A 3QAGA 1HNCA 4MJBA 5ELGA 3EINA 4YAVA 2JSYA 3KCMA 3ZRDA 3MAKA 3E0UA 2CX3A 4K8MA 3LYKA 2RM5A 3VI5A 3LORA 4HZ2A 3ZLPA 5KN0A 3UJ1A 5IMDA 3GHAA 3UBLA 2GQMA 3QD9A 1TI1A 3DWVA 4DVCA 2MMNA 2CAIA 2AYTA 3C71A 1B8XA 3E9JB 5DVBA 1JHBA 1BQ7A 4AF2A 1SJ6A 1O73A 4BA7A 1YF1A 4PUAA 2FCHA 2HXKA 3VWWA 1NW2A 3A2VA 3GUSA 1OE8A 4J2FA 4BVYA 5DJLA 4PX1A 2H0GA 2JL4A 5JCUA 1WWJA 1OE7A 3CXGA 2VUPA 4WF5A 5F05A 3L9SA 5ABRA 3EU3A 3GTUB 5DCGA 3QFBC 1B9XC 3UMAA 1URMA 1OAZA 1F3BA 4L0WA 1M7TA 2GDRA 3VWXA 4HI7A 4CHSA 2R37A 4MJEA 3D4MA 2H6YA 1IYHA 3VLNA 4QL9A 1DE2A 3DYRA 2D2ZA 1SK0A 4TVEA 3DMLA 4V2LA 5IOWA 5H5QA 3BCIA 4MP4A 2GQKA 3IK9A 5ELAA 2GSQA 2GSRA 3HVXA 2OE3A 1XOAA 1T3BA 3LXTA 2YV9A 1ML6A 1GLQA 3HD5A 4AJ8A 2XHFA 3HVSA 1PKZA 3TB2A 1QK8A 4TXOA 1B4PA 1QGVA 3GA4A 3A2XA 4I6XA 2LUSA 4MF6A 2JU5A 2DSAA 2I81A 3UAPA 3E3EA 5B8BA 3QFAC 4G10A 4GRFA 5ECKB 16GSA 3KMNA 2N5BA 3G7JA 4OFNA 2XC2A 4XCSA 3QCPA 3G7YA 2IFQA 2C0FA 3GL3A 2LQOA 3D21A 2HSHA 2DJ0A 1GTUA 4XS6A 2JZSA 2KP1A 4WETA 2P0GA 3KTBA 1IYIA 1ERVA 1GSQA 2H1BA 1GUMA 4BWQA 4YH2A 4IHUA 2HYXA 1MDIA 1ST9A 3APQA 2AV4A 4GQCA 1CQHA 4MCUA 1VF3A 4PQIA 4N0VA 3ZVJD 2YZHA 3F4SA 4F03A 4Q5RA 2OADA 3GH6A 2TRCP 4JE1A 1TRWA 1PSQA 5JCWA 2AJQB 1A24A 1EGRA 4ZB9A 2WS2A 4N10A 4K1FA 6GSVA 3TCOA 1X9SB 4ZB6A 5GSTA 3FEUA 2CQ9A 3ZFBA 4MPGA 4JR6A 1YDKA 2GZPA 5J41A 5B6MA 2R5GA 3D22A 5F0GA 1SL0B 1SD9A 1HNAA 4Z7XA 1M9BA 1GLPA 4DSQA 3KZQA 1Z3EA 1G6WA 1YZXA 1SJZA 3RDWA 1OC9A 2C0GA 13GSA 1SD8A 1HNBA 3FKFA 5G5EA 1USBA 4O5RA 3CSIA 2H1GA 4JRRA 1BAYA 1SENA 4X1UA 4NV5A 3L0HA 3LEFA 1V98A 1MDJA 3D0ZA 2A4VA 3UVHA 2R4VA 3GRXA 1NHOA 2PU9C 5H5RA 3WYWA 3F4RA 3WGEA 5ECLB 3C73A 3PGTA 5KEJA 4WR5A 2FGXA 3CTGA 3IR4A 1GTIA 3CSHA 5CAXA 4ILFA 3S9FA 3TRQA 4PQ1A 2YV7A 2OJLA 5HFIA 1DBYA 1DSBA 2VD1A 3TKSE 3RBTA 2DJ2A 2HE3A 4GQFA 3CMIA 3C1RA 1JLVA 3P7XA 1M99A 2VL3A 2MMOA 4ML6A 1SU9A 4GTUA 1VRSD 4WKWA 5IQYA 1BYEA 2YWOA 2ZNMA 1GUKA 5KN2A 5ECOB 1Z7PA 5GZZB 2LQQA 4TRXA 3F6DA 3PR8A 2CV4A 4WXTA 4IGJA 4POKA 1HD2A 5D96A 2H75A 1PKWA 1WPIA 4X0XA 4TXOB 4I97A 2HSYA 3UARA 1ZMAA 2H70A 2WCIA 2M80A 4IP1A 2PGTA 2WJUA 2JZRA 3VK9A 2O8VB 2OE1A 1AXDA 22GSA 1KTEA 3TKSC 1FAAA 3H93A 2IFQB 2I1UA 4FH8A 4XTSA 2AAWA 2V6KA 1ILOA 3KGKA 1T4ZA 2CX4A 2VCVA 3FR9A 1U3AA 2YJ7A 4HJMA 4HOJA 5G30A 1K0DA 1SL2B 3OR5A 3I69A 3GMFA 2NVLA 3PINA 5KN1A 1G7EA 1G0TA 1X0RA 3VWUA 2H30A 1FO5A 2FHEA 1SKWB 1GSFA 4KUNA 2V41A 3TJJA 1XWKA 5FT3A 1ERUA 5JCGA 2JZTA 3UVTA 2KUCA 4LMVA 1PX7A 4L0UA 5EL8A 3ZVJA 10GSA 4E8EA 3HA9A 1V9WA 3C7MA 2V6OA 4KW6A 3TUEA 2DLXA 2DMMA 3HVVA 4ZILA 5B6NA 1B48A 4F9ZA 3R2QA 4EO3A 4Q5QA 3O3TA 2K18A 1FB6A 3QOUA 5J3RA 4LL4B 3HY2A 1AQXA 3KP8A 2IJYA 1VGLA 1OC9B 1QQ2A 3CBUA 5CRGA 4P3YB 2LSTA 5C00A 2PBJA 1X5CA 3CSJA 4D73A 5IO2A 4HU7A 4ULXA 3WD6A 4KDUA 3P2AA 1YY7A 5ECQB 1GRXA 1H75A 2I4AA 3MDKA 3KTLA 2JSZA 4MF7A 3FR3A 5DALA 4OWYA 2LV3A 1PRXA 4K0NA 5D9TA 2PN8A 4HJ2A 4L5LA 3ZIVA 2XBIA 4WBJA 1J0FA 3GYKA 2C1YA 5J9CA 5DDLA 1FHEA 4TR3A 1XZOA 1B4QA 5IMAA 3N5OA 3ZIJA 1G7OA 2CT6A 3CRTA 4YQVA 4TN8A 3K8NA 1OYJA 2H1DA 2VM1A 3D5JA 1XW9A 1HYUA 5D9VA 1X5DA 4NXIA 5B7CA 1QXHA 3HZ4A 4HS1A 2LRTA 3V1WA 2LJAA 1PQNA 2L4QA 5ECRB 3C1SA 2VCZA 2HRNA 5H5SA 1ZCPA 3UIWA 4DSSA 2F8AA 1EGOA 2YP6A 1PD21 5IO0A 1YKAA 1TU7A 4O7HA 1F9MA 2NPBA 2B7JA 3Q6OA 5J4UA 2X64A 3KP9A 2CVDA 3QDNA 2YN1A 1TRSA 3IE3A 2LEGA 3EE2A 1T00A 3GURA 4XHMA 4V2NA 2KHPA 4KCAA 5G1LA 2HT9A 3HYPA 2IMDA 1O7UA 2VLTA 4EDYA 3L9UA 1Z9HA 3I43A 2VCTA 2NTOA 2GS3A 1TXXA 2H6ZA 2RUEA 4NWYA 3P8WA 4XIHA 1I5GA 3CTFA 2GZZA 3IPZA 3LG6A 5A4WA 4ZXGA 4YQUA 4ISDA 4K0GA 2B3SA 4ECJA 4O32A 2L5OA 2VOCA 4MJAA 5CNWA 1PL2A 1V2AA 2DJ3A 3EU4A 2R3XA 3IA1A 3RHBA 3EC3A 1SK2A 3H8QA 2PVOC 1YQ1A 1AQWA 4YQMA 1O8XA 5IPHA 2K6VA 5G31A 2VO4A 3TGZA 3DVXA 1XVWA 4MK3A 3I6AA 2ZCTA 4JEDA 1LBKA 5DAKA 3FW2A 1AQVA 2OBKA 3VURA 3G7IA 2H8LA 3U5RE 1OC8A 5AN1A 5L71A 3O6TA 1BEDA 5HQPA 4D73B 4E8HA 2C8UA 1ZYQB 4J57E 3F3QA 2YWIA 5HR0A 4Q5FA 2LNTA 1GNEA 2WDUA 4KSOA 4L8EA 3GNJA 2R2JA 4FYUA 2B6MA 4BVXA 3A3TA 4LMWA 1F3AA 1EOHA 2IMIA 5ECNB 4PNGA 2H01A 3HJPA 5DALB 2IWTA 3WT2A 4TR0A 3TOUA 4K7NA 3RHCA 1XFLA 3HCZA 1X5EA 1ACVA 2MYGA 5ENUA 2N5AA 3ME8A 2G0FA 5LD0A 1A2LA 5IPGA 1Z5YE 3IOSA 4F0CA 1A8LA 3H1NA 2FY6A 4IW9A 2A2SA 2FA8A 2NBSA 4AGSA 2YWMA 1EWXA 1YF0A 4MH3A 2L57A 1LJRA 1EOGA 4RQXA 4MH2A 2BJXA 3TJBA 3VPQA 3W8SA 3ZMKA 3GSSA 1WRYA 2MZCA 1GULA 2B5EA 2LNSA 2LS5A 3QAWA 4JR4A 2FWFA 1AW9A 2WRTA 5D8IA 3GSTA 4KCEA 1W89A 3BCKA 5G2ZA 4DEJA 4NHZA 2DBCA 3ZITA 3GX8A 4PURA 4DSSB 1JZRA 2ES7A 1K3LA 5GAND 1GSEA 1ZZYA 3GIXA 4RI6A 3NZNA 2CVKA 2FNOA 1KEBA 2GQLA 2WZ9A 4EKZA 1M2AA 2O85A 1ABAA 5GAPD 1PN9A 1YJ6A 3M1GA 1O85A 3ZTLA 1THOA 1H4OA 1Q4JA 2PMTA 1TK5B 3US3A 4XRAA 1JZWA 3NOFA 3F8UA 4ID0A 4HUAA 3TKPA 7GSSA 3A2WA 2A2RA 1TJDA 4I8BA 1WP0A 4KE3A 4I2TA 2VL9A 1K0NA 9GSSA 4KDXA 1A2JA 4PXOA 2TRXA 5ID2A 3IBHA 1UC7A 2I3YA 3H79A 4IBPA 1TTZA 4DSRA 2IMKA 1U6TA 1R7HA 2EIQA 5DJMA 4RQRA 5GSSA 2VL2C 4PGTA 3LFLA 4FYBA 1PX6A 2LJRA 2TIRA 1Z6MA 2IMEA 1JZDA 2DC5A 3EURA 4IJIA 4MJCA 4LA1A 5IMZA 2GT6A 1GTBA 4ECCA 4MLYA 1I9DA 2PUKC 1S3DA 3IRAA 3HJMA 2YPMA 4JZQA 4LL1B 2OKAA 1XWCA 2YANA 5DAKB 1E2YA 5LCZA 1RK4A 4IJ3A 4ZIJA 3KIJA 4QQ7A 2FWHA 4TXVA 4MZCA 2YOIA 1SL1B 4HQZA 1X9WB 2VCWA 2B1KA 2KOKA 1HQOA 1A23A 4HDEA 1TOFA 5ECIB 1XBSA 4KA0A 4N30A 1XXUA 1BX9A 12GSA 3EMPA 3IK7A 5D93A 2VAFA 1K3OA 3TRXA 2CZ3A 1O6JA 5JWQB 1YEPA 1A8YA 2LJKA 5FWGA 1WMJA 2G2QA 5JWRB 5JWOB 2X99A 1EZKA 3M9JA 1XVQA 3ME7A 3FZAA 1GH2A 1FB0A 4IELA 4JU5A 1O81A 2MMAA 4ZL9A 1T1VA 2M46A 3UOMA 4KGIA 5DCHA 1XIYA 4ZBBA 5IMVA 2F9SA 5G1KA 1XWAA 1GL8A 3ED3A 3J7Yb 3VI7A 2H6XA 2DMLA 1O8WA 1MEKA 1GSSA 4NHWA 4YAPA 5IMCA 1PMTA 5CRHA 4AJ7A 3ZREA 2C80A 2E0QA 2FLSA 2YWNA 3GKXA 4POLA 3EVIA 1NHYA 3VWVA 5AISA 3TOTA 2MMZA 4GSSA 3BJ5A 1ZL9A 3QAVA 3ISOA 2YNXA 4XRDA 4V1Ap 4BPYA 2K8SA 2HZFA 2PWJA 2ON5A 11GSA 4MMMA 2O7KA 1DE1A 20GSA 1ZOFA 2OA7A 2IIYA 2WULA 3O76A 3CRUA 1DUGA 1M2BA 1M9AA 2B1LA 3EYTA 1GNWA 1K0MA 4TKYA 1K0AA 3TKRA 4GSNA 4OCEA 4FO5A 5ECHB 3FR6A 5J9BA 4EL1A 2R6KA 2REMA 5ID2B 3KM6A 1XCCA 1GWCA 2H66A 1AC1A 3LJRA 2FWGA 2M72A 1RQMA 1TU8A 1J9BA 2IPAA 4RI7A 3H4KA 3GH9A 3EWLA 1NSWA 2NDOA 5IM9A 4MF5A 4V1Ag 1M0UA 3ERFA 3KH9A 4EVMA 1UVZA 1NM3A 1AAZA 3IXRA 3QR6A 3RPPA 4POMA 1WJKA 5EY6A 3C8EA 3UBKA 1JZOA 4HEA2 1F2EA 4RUVA 4L5OA 1V40A 4IQ1A 4KDYA 1UA5A 1MDKA 4MA9A 4CW9A 1S3CA 3ZZXA 3KXOA 4ML1A 3VPTA 1R5PA 3DRNA 4HZ4A 4IKHA 4IVFA 4NPBA 1T8EB 4K6XA 4LLRA 5C04A 3GKNA 2F3MA 2GTUA 1T4YA 1GSDA 3BOAA 2LRCA
chains in the Genus database with same CATH superfamily
3WGDA 3L78A 5DQYA 2XBQA 1Y25A 4USSA 1TDIA 1QMVA 1QUWA 1S3AA 2F51A 2GSSA 3L4NA 2VCQA 4N11A 3RAZA 2K8VA 2HNLA 1X9MB 18GSA 3M9KA 3APSA 4YKFA 1GUHA 1OVNA 4EIPA 1A0FA 3D6IA 1QFNA 2DIYA 3ZL5A 4Q5NA 5ECSA 1U87A 4MABA 4TW5A 4EE0A 2LTKA 1THXA 8GSSA 1TP9A 2MBSA 5F07A 4TOPA 3F3RA 4KH7A 4K7IA 2H0IA 2HZEA 2PVQA 3A5IA 4K7OA 2P5RA 1ZYNA 1OKDA 1J08A 4GCIA 1EEJA 2QC7A 3MNGA 1R4WA 4EC0A 2V2GA 2L5LA 2OACA 3WGXA 1Q98A 4AJ6A 3EMXA 1SKSB 2Z9SA 2VL2A 5D9WA 1V58A 1KNGA 2L6CA 1W4VA 1ZGNA 5CP1A 2LRNA 3IHQA 5F8BA 2QSIA 5INYA 3L9VA 3N9JA 3FYGA 2V32A 3UEMA 5DQSA 2RUFA 4POBA 17GSA 3I9V2 1F37A 3KD0A 4V2MA 5HFKA 5COHA 19GSA 1XW5A 3Q74A 1CQGA 2IN3A 1SKRB 1EEMA 4I5QA 3DEXA 5HFGA 3JCML 2GVPA 2RIIA 3KEBA 5AIVA 5A4VA 2ZUPA 4BL7A 3KJYA 4MPFA 4PTSA 4FYCA 5IMFA 3DIEA 2E7PA 4OO5A 3PH9A 5LNKe 5KN3A 3P90A 3GV1A 4PUFC 2EIRA 2YJHA 4IP6A 4N0ZA 4ZBAA 3TJKA 4PNFA 2O89A 1OKTA 4XS4B 5HR3A 2HRKA 3TKQA 1XW6A 2C3TA 4JBBA 1E6BA 4OFTA 3LSZA 3MWHA 1UN2A 3LGCA 1JFUA 4ECBA 5A5KA 3ZMLA 3F4TA 1T7PB 3TKSA 2KP2A 1KBNA 1XWBA 4GWRA 1YKCA 1K3YA 1TKDB 2B7KA 3QPMA 3M3MA 4KNDA 4HQSA 1R5AA 4OO4A 2HRFA 2X8CA 2LKUA 3BD2A 4TR1A 2HLSA 3HJOA 2RLIA 4TR4A 4K5RA 2B5XA 5IIZA 4GXZA 1TRVA 3R3EA 3QMXA 3F6FA 1FG4A 1N2AA 4EIQA 1A0RP 4X43A 2H71A 4FQUA 2L59A 3FZ9A 4KSMA 3NIVA 1OC3A 4K9ZA 3FK8A 2GT5A 3J7Yk 5J5NA 2K9FA 3HKRA 4HSCX 2FA4A 1FOVA 2JACA 2C4JA 1WOUA 1GSYA 1C72A 3WT1A 3W8JA 3SBCA 4WF4A 4ZL7A 3DVWA 2H76A 1AUCA 4FIWA 1R26A 4G9HA 2L6DA 1FW1A 5CYYA 2O87A 2EC4A 3HHVA 3IAS2 3GFKA 4O5UA 2PERA 1GSUA 2VIMA 4F2IA 2E2MA 2HRAA 4HU9A 4OFMA 2I9HA 3LWAA 5A4UA 2GZYA 4MZWA 2IMFA 4IN0A 1V57A 1N8JA 3AY8A 3GKMA 2HZEB 4IQAA 3VFIA 1MTCA 2VM2A 2H1AA 1YEXA 3IC4A 1K0OA 2MBTA 2FUG2 3FY7A 2BTOT 2GLRA 5D9XA 2N5FA 5HR2A 2C3NA 1WIKA 2FD3A 1VF4A 2CVBA 6GSXA 3GN3A 4EDZA 1RW1A 2WFCA 1B9YC 3IAM2 1TI3A 2B5YA 4WR4A 6GSTA 1SK1A 3ERWA 4OMVA 2AUVA 1SJIA 5CRDA 1EV4A 5HR1A 1VF2A 1Z7RA 3FRCA 3HXSA 1TK0B 3APOA 1BJXA 3IDVA 3TJFA 1AIUA 1GP1A 2YCDA 3LYPA 4ICYA 3FZ4A 2GGTA 1ZYEA 4BL7B 1A2MA 4CDOA 2C0DA 3RPNA 2YZUA 2P31A 4GSTA 3SWLA 1TRUA 3LXZA 2RM6A 3G9BA 3FZ5A 2DJJA 3M8NA 2C3QA 2VLUA 4ZBDA 4OCFA 1FVKA 1PGTA 3FHKA 3M0FA 2DIZA 1EP7A 4WEYA 2OE0A 6GSYA 4YKGA 3ZFLA 3F9UA 3TRPA 2DJ1A 3GKKA 5ECPB 3F0IA 3F63A 4OD7A 1K0CA 3D4TA 1XPVA 4G2EA 1XOBA 2WB9A 2L4CA 3LW9A 4EUYA 4G19A 4ACSA 5KOWA 2FWEA 1TK8B 4TR1B 3DKSA 4J56E 1M2DA 2KLXA 2XPDA 1F6MC 4O92A 2AB6A 2H72A 3KH7A 2X8HA 2GSTA 4ZB8A 2HFDA 1MD3A 4F82A 2EIOA 3TJGA 2A2PA 3DD3A 1JLWA 2AHEA 5CREA 1WE0A 4EXJA 4NAXA 4BIKA 6GSUA 2HI7A 2X8GA 4KF9A 3GTUA 6GSSA 3HZ8A 5FHIA 1BG5A 5IOXA 5AGYA 1PL1A 1EV9A 3ERGA 4GF0A 3W6GA 4XS1A 3A5WA 3DGQA 1PA3A 1SYXA 4WBRD 4PQHA 4IS0A 3CYNA 2OBIA 2VD0A 4QL7A 2QGVA 2PPTA 2J9HA 1GTAA 2F8FA 1EP8A 5CRWA 2V1MA 4NMUA 4MDCA 2H74A 5CO3A 1SYRA 3ZYWA 2QKEA 4G0LA 4GLTA 2CZ2A 14GSA 4ZL8A 4NV2A 2VLVA 2VCXA 2CAQA 2H19A 4XS4A 2P5QA 2JADA 3Q19A 1U3IA 5AIXA 3U6VA 4KX4A 5F06A 3GX0A 5E4WA 5KOXA 5EPFA 2CA8A 2H73A 2ON7A 3UL3A 3Q18A 4MZBA 5B8AA 4KAEA 3KMOA 3TDGA 2C0EA 2ALBA 2BMXA 2QA2A 5E59A 1VF1A 4F0BA 2J23A 2DKHA 1XWGA 3MSZA 4EF0A 2XPEA 1FVJA 1LU4A 3IV4A 3GL5A 4KB3A 2H0HA 4ECIA 4H86A 5D73A 5G5FA 1K0BA 1ON4A 3BBYA 4K2DA 2WGRA 3HDCA 2IL3A 1Z6NA 1ERTA 1Y6EA 2E2GA 2DJKA 3DXBA 6GSWA 1TW9A 4I2UA 5DBQA 5ECMB 1ERWA 3LQ7A 1G6YA 4BWSA 1U88A 5EVOA 1MD4A 3QAGA 1HNCA 4MJBA 5ELGA 3EINA 4YAVA 2JSYA 3KCMA 3ZRDA 3MAKA 3E0UA 2CX3A 2X49A 4K8MA 3LYKA 2RM5A 3VI5A 3LORA 4HZ2A 3ZLPA 5KN0A 3UJ1A 5IMDA 3GHAA 3UBLA 2GQMA 3QD9A 1TI1A 1M3IA 3DWVA 4DVCA 2MMNA 2CAIA 2AYTA 3C71A 1B8XA 3E9JB 5DVBA 1JHBA 1BQ7A 4AF2A 1SJ6A 1O73A 4BA7A 1YF1A 4PUAA 2FCHA 2HXKA 3VWWA 1NW2A 3A2VA 3GUSA 1OE8A 4J2FA 4BVYA 5DJLA 4PX1A 2H0GA 2R0GA 2JL4A 5JCUA 1WWJA 2HSMA 1OE7A 3CXGA 5BMUA 2VUPA 4WF5A 5F05A 3L9SA 5ABRA 3EU3A 3GTUB 5DCGA 3QFBC 1B9XC 2QA1A 3UMAA 4G0IA 1URMA 1OAZA 2UZ8A 1F3BA 4L0WA 1M7TA 2GDRA 3VWXA 4HI7A 4CHSA 2R37A 4MJEA 3D4MA 2H6YA 1IYHA 3VLNA 4QL9A 1DE2A 3DYRA 2D2ZA 1SK0A 4TVEA 3DMLA 4V2LA 5IOWA 5H5QA 3BCIA 4MP4A 2GQKA 3IK9A 4X4JA 5ELAA 2GSQA 2GSRA 3HVXA 2OE3A 1XOAA 1T3BA 3LXTA 2YV9A 1ML6A 1GLQA 3HD5A 3CQFA 4AJ8A 2XHFA 3HVSA 1PKZA 3TB2A 1QK8A 4TXOA 1B4PA 1QGVA 3GA4A 3A2XA 4I6XA 1XG8A 2LUSA 4MF6A 2JU5A 2DSAA 2I81A 3UAPA 3E3EA 5B8BA 3QFAC 4G10A 4GRFA 5ECKB 16GSA 3KMNA 2N5BA 3G7JA 4OFNA 2XC2A 4XCSA 3QCPA 3G7YA 2IFQA 2C0FA 3GL3A 2LQOA 3D21A 2HSHA 2DJ0A 1GTUA 4XS6A 2JZSA 2KP1A 4WETA 2P0GA 3KTBA 1IYIA 1ERVA 1GSQA 2H1BA 1GUMA 4BWQA 4YH2A 4IHUA 2HYXA 1MDIA 1ST9A 3APQA 2AV4A 4GQCA 1CQHA 4MCUA 1VF3A 4PQIA 4N0VA 3ZVJD 2YZHA 3F4SA 4F03A 4Q5RA 2OADA 3GH6A 2TRCP 4JE1A 1TRWA 1PSQA 5JCWA 2AJQB 1A24A 1EGRA 4ZB9A 2WS2A 4N10A 4K1FA 6GSVA 3TCOA 1X9SB 4ZB6A 5GSTA 3FEUA 2CQ9A 3ZFBA 4MPGA 4JR6A 1YDKA 2GZPA 5J41A 5B6MA 2R5GA 3D22A 5F0GA 1SL0B 1SD9A 1HNAA 4Z7XA 1M9BA 1GLPA 4DSQA 3KZQA 1Z3EA 1G6WA 1YZXA 1SJZA 3RDWA 1OC9A 2C0GA 13GSA 1SD8A 4CY6A 1HNBA 3FKFA 5G5EA 1USBA 4O5RA 4BVYB 3CSIA 2H1GA 4JRRA 1BAYA 1SENA 4X1UA 4NV5A 3L0HA 3LEFA 1V98A 1MDJA 3D0ZA 2A4VA 3UVHA 2R4VA 3GRXA 1NHOA 2PU9C 5H5RA 3WYWA 3F4RA 3WGEA 5ECLB 3C73A 3PGTA 5KEJA 4WR5A 2FGXA 3CTGA 2DKIA 1GTIA 3CSHA 3IR4A 5CAXA 4ILFA 3S9FA 3TRQA 4PQ1A 2YV7A 3MIXA 2OJLA 5HFIA 1DBYA 1DSBA 2VD1A 3TKSE 3RBTA 2DJ2A 2HE3A 5BRTA 4GQFA 3CMIA 3C1RA 1JLVA 3P7XA 1M99A 2VL3A 2MMOA 4ML6A 1SU9A 4GTUA 1VRSD 4WKWA 5IQYA 1BYEA 1S3RA 2YWOA 2ZNMA 1GUKA 5KN2A 5ECOB 1Z7PA 5GZZB 2LQQA 4TRXA 3F6DA 3PR8A 2CV4A 4WXTA 4IGJA 4POKA 1HD2A 5D96A 2H75A 1PKWA 1WPIA 4X0XA 4TXOB 4I97A 2HSYA 3UARA 1ZMAA 2H70A 2WCIA 2M80A 4IP1A 2PGTA 2WJUA 2JZRA 3VK9A 1ZYPA 2O8VB 2OE1A 1AXDA 22GSA 1KTEA 3TKSC 1FAAA 3H93A 2IFQB 2I1UA 4FH8A 4XTSA 2AAWA 2V6KA 1ILOA 3KGKA 1T4ZA 2CX4A 2VCVA 3FR9A 1U3AA 2YJ7A 4HJMA 4HOJA 5G30A 1K0DA 1SL2B 3OR5A 3I69A 3GMFA 2NVLA 3PINA 5KN1A 1G7EA 1G0TA 1X0RA 3VWUA 2H30A 1FO5A 2FHEA 1SKWB 1GSFA 4KUNA 2V41A 3MYDA 3TJJA 1XWKA 5FT3A 1ERUA 5JCGA 2JZTA 3UVTA 2KUCA 4LMVA 1PX7A 4L0UA 5EL8A 3ZVJA 10GSA 4E8EA 3HA9A 1V9WA 3C7MA 4Z2TA 2V6OA 4KW6A 3TUEA 2DLXA 3EPTA 2DMMA 3HVVA 4ZILA 5B6NA 1B48A 4F9ZA 3R2QA 4EO3A 4Q5QA 3O3TA 2K18A 1FB6A 3QOUA 5J3RA 4LL4B 3HY2A 1AQXA 3KP8A 2IJYA 1VGLA 1OC9B 1QQ2A 3CBUA 5CRGA 4P3YB 2LSTA 5C00A 2PBJA 1X5CA 3CSJA 4D73A 5IO2A 4HU7A 4ULXA 3WD6A 4KDUA 3P2AA 1YY7A 5ECQB 1GRXA 1H75A 2I4AA 3MDKA 3KTLA 2JSZA 4K5SA 4MF7A 3FR3A 5DALA 4OWYA 2LV3A 4K0NA 1PRXA 5D9TA 2PN8A 4HJ2A 4L5LA 3ZIVA 2XBIA 4WBJA 1J0FA 3GYKA 2C1YA 5J9CA 5DDLA 1FHEA 4TR3A 1XZOA 1B4QA 5IMAA 3N5OA 2R0CA 3ZIJA 1G7OA 2CT6A 3CRTA 4YQVA 4TN8A 3K8NA 1OYJA 2H1DA 2VM1A 3D5JA 1XW9A 4O5QA 1HYUA 5D9VA 1X5DA 4NXIA 5B7CA 1QXHA 3HZ4A 4HS1A 2LRTA 3V1WA 2LJAA 1PQNA 2L4QA 5ECRB 3C1SA 2VCZA 2HRNA 5H5SA 1ZCPA 3UIWA 4DSSA 2F8AA 1EGOA 2YP6A 1PD21 5IO0A 1YKAA 1TU7A 4O7HA 1F9MA 2NPBA 2B7JA 3Q6OA 5J4UA 2X64A 3KP9A 2CVDA 3QDNA 2YN1A 1TRSA 4K2XA 3IE3A 2LEGA 3EE2A 1T00A 3GURA 4XHMA 4Z2RA 4V2NA 2KHPA 4KCAA 5G1LA 2HT9A 3HYPA 2IMDA 1O7UA 2VLTA 4EDYA 1PFOA 3L9UA 1Z9HA 3I43A 2VCTA 2NTOA 3PPUA 2GS3A 1TXXA 2H6ZA 2RUEA 4NWYA 3P8WA 4XIHA 1I5GA 3CTFA 2GZZA 3IPZA 3LG6A 5A4WA 4ZXGA 4YQUA 4ISDA 4K0GA 2B3SA 4ECJA 4O32A 2L5OA 2VOCA 4MJAA 5CNWA 1PL2A 1V2AA 2DJ3A 3EU4A 2R3XA 3IA1A 3RHBA 3EC3A 1SK2A 3HVNA 3H8QA 2PVOC 1YQ1A 1AQWA 4YQMA 1O8XA 5IPHA 2K6VA 5G31A 2VO4A 3TGZA 3DVXA 1XVWA 4MK3A 3I6AA 2ZCTA 4JEDA 1LBKA 5DAKA 3FW2A 1AQVA 2OBKA 3VURA 3G7IA 2H8LA 3U5RE 1OC8A 5AN1A 5L71A 3O6TA 1BEDA 5HQPA 4D73B 4E8HA 2C8UA 1ZYQB 4J57E 3F3QA 2YWIA 5HR0A 4Q5FA 2LNTA 1GNEA 2WDUA 4KSOA 4L8EA 3GNJA 2R2JA 4FYUA 2B6MA 4BVXA 3A3TA 4LMWA 1F3AA 1EOHA 2IMIA 5ECNB 4PNGA 2H01A 3HJPA 5DALB 2IWTA 3WT2A 4TR0A 3TOUA 4K7NA 3RHCA 1XFLA 3HCZA 1X5EA 1ACVA 2MYGA 5ENUA 2N5AA 3ME8A 2G0FA 5LD0A 1A2LA 5IPGA 1Z5YE 3IOSA 4F0CA 1A8LA 3H1NA 2FY6A 4IW9A 2A2SA 2FA8A 2NBSA 4AGSA 2YWMA 1EWXA 1YF0A 4MH3A 2L57A 1LJRA 1EOGA 4RQXA 4MH2A 2BJXA 3TJBA 3VPQA 3W8SA 3ZMKA 3GSSA 1WRYA 2MZCA 1GULA 2B5EA 2LNSA 2LS5A 3QAWA 4JR4A 2FWFA 1AW9A 2WRTA 5D8IA 3GSTA 4KCEA 1W89A 3BCKA 5G2ZA 4DEJA 4NHZA 2DBCA 3ZITA 3GX8A 4PURA 4DSSB 1JZRA 2ES7A 1K3LA 5GAND 1GSEA 1ZZYA 3GIXA 4RI6A 3NZNA 2CVKA 2FNOA 1KEBA 2GQLA 2WZ9A 4EKZA 1M2AA 2O85A 1ABAA 5GAPD 1PN9A 1YJ6A 3M1GA 1O85A 3ZTLA 1PN0A 1THOA 1H4OA 1Q4JA 2PMTA 1TK5B 3US3A 2X4AA 4XRAA 1JZWA 3NOFA 3F8UA 4ID0A 4HUAA 3TKPA 7GSSA 3A2WA 2A2RA 1TJDA 4I8BA 1WP0A 4KE3A 4I2TA 2VL9A 1K0NA 9GSSA 4CY8A 4KDXA 1A2JA 4PXOA 2TRXA 5ID2A 3IBHA 1UC7A 2I3YA 3H79A 4IBPA 1TTZA 4DSRA 2IMKA 1U6TA 1R7HA 2EIQA 5DJMA 4RQRA 5GSSA 2VL2C 4PGTA 3LFLA 4FYBA 1PX6A 2LJRA 2TIRA 1Z6MA 2IMEA 1JZDA 2DC5A 3EURA 4IJIA 4MJCA 4LA1A 5IMZA 2GT6A 1GTBA 4ECCA 4MLYA 1I9DA 2PUKC 1S3DA 3IRAA 3HJMA 2YPMA 4JZQA 4LL1B 2OKAA 1XWCA 2YANA 5DAKB 1E2YA 5LCZA 1RK4A 4IJ3A 4ZIJA 3KIJA 4QQ7A 2FWHA 4TXVA 4MZCA 2YOIA 1SL1B 4HQZA 1X9WB 2VCWA 2B1KA 2KOKA 1HQOA 1A23A 4HDEA 1TOFA 5ECIB 1XBSA 4BVXB 4KA0A 4N30A 1XXUA 1BX9A 12GSA 3EMPA 3IK7A 5D93A 2VAFA 3IHGA 1K3OA 3TRXA 2CZ3A 1O6JA 5JWQB 1YEPA 4MNNA 1A8YA 2LJKA 5FWGA 1WMJA 2G2QA 5JWRB 5JWOB 2X99A 1EZKA 3M9JA 1XVQA 3ME7A 2A4HA 3FZAA 1GH2A 1FB0A 4IELA 4JU5A 1O81A 2MMAA 4ZL9A 1T1VA 2M46A 3FMWA 3UOMA 4KGIA 5DCHA 1XIYA 4ZBBA 5IMVA 2F9SA 5G1KA 1XWAA 1GL8A 3ED3A 3J7Yb 3VI7A 2H6XA 2DMLA 1O8WA 1MEKA 1GSSA 4NHWA 4YAPA 5IMCA 1PMTA 5CRHA 4AJ7A 3ZREA 2C80A 2E0QA 2FLSA 2YWNA 3GKXA 4POLA 3EVIA 1NHYA 3VWVA 5AISA 3TOTA 4A5PA 2MMZA 4GSSA 3BJ5A 1ZL9A 3QAVA 3ISOA 2YNXA 4XRDA 4V1Ap 4BPYA 2K8SA 3IC8A 2HZFA 2PWJA 2ON5A 11GSA 4MMMA 2O7KA 1DE1A 4Z2UA 20GSA 1ZOFA 2OA7A 2IIYA 2WULA 3O76A 3CRUA 1DUGA 1M2BA 1M9AA 2B1LA 1M3JA 3EYTA 1GNWA 1K0MA 4TKYA 1K0AA 3TKRA 4GSNA 4OCEA 4FO5A 5ECHB 3FR6A 5J9BA 4EL1A 2R6KA 2REMA 5ID2B 3KM6A 1XCCA 1GWCA 2H66A 1AC1A 3LJRA 2FWGA 2M72A 1RQMA 1TU8A 1J9BA 2IPAA 4RI7A 3H4KA 3GH9A 3EWLA 1NSWA 2NDOA 5IM9A 4MF5A 4V1Ag 1M0UA 3ERFA 3KH9A 4EVMA 1UVZA 1NM3A 1AAZA 2R0PA 3IXRA 3QR6A 3RPPA 4POMA 1FOHA 1WJKA 5EY6A 3C8EA 3UBKA 1JZOA 4HEA2 1F2EA 4RUVA 4L5OA 1V40A 4IQ1A 4KDYA 1UA5A 1MDKA 4MA9A 4CW9A 1S3CA 3ZZXA 3KXOA 4ML1A 3VPTA 1R5PA 3DRNA 4HZ4A 4IKHA 4IVFA 4NPBA 1T8EB 4K6XA 4LLRA 5C04A 4G0KA 3GKNA 2F3MA 2GTUA 1T4YA 1GSDA 3BOAA 2LRCA
chains in the Genus database with same CATH topology
3WGDA 3L78A 5DQYA 2XBQA 1Y25A 4USSA 1TDIA 1QMVA 1QUWA 1S3AA 2F51A 2GSSA 3L4NA 2VCQA 4N11A 3RAZA 2K8VA 2HNLA 1X9MB 18GSA 3M9KA 3APSA 4YKFA 1GUHA 1OVNA 4EIPA 1A0FA 3D6IA 1QFNA 2DIYA 3ZL5A 4Q5NA 5ECSA 1U87A 4MABA 4TW5A 4EE0A 2LTKA 1THXA 8GSSA 1TP9A 2MBSA 5F07A 4TOPA 3F3RA 4KH7A 4K7IA 2H0IA 2HZEA 2PVQA 3A5IA 4K7OA 2P5RA 1ZYNA 1OKDA 1J08A 4GCIA 1EEJA 2QC7A 3MNGA 1R4WA 4EC0A 2V2GA 2L5LA 2OACA 3WGXA 1Q98A 4AJ6A 3EMXA 1SKSB 2Z9SA 2VL2A 5D9WA 1V58A 1KNGA 2L6CA 1W4VA 1ZGNA 5CP1A 2LRNA 3IHQA 5F8BA 2QSIA 5INYA 3L9VA 3N9JA 3FYGA 2V32A 3UEMA 5DQSA 2RUFA 4POBA 17GSA 3I9V2 1F37A 3KD0A 4V2MA 5HFKA 5COHA 19GSA 1XW5A 3Q74A 1CQGA 2IN3A 1SKRB 1EEMA 4I5QA 3DEXA 5HFGA 3JCML 2GVPA 2RIIA 3KEBA 5AIVA 5A4VA 2ZUPA 4BL7A 3KJYA 4MPFA 4PTSA 4FYCA 5IMFA 3DIEA 2E7PA 4OO5A 3PH9A 5LNKe 5KN3A 3P90A 3GV1A 4PUFC 2EIRA 2YJHA 4IP6A 4N0ZA 4ZBAA 3TJKA 4PNFA 2O89A 1OKTA 4XS4B 5HR3A 2HRKA 3TKQA 1XW6A 2C3TA 4JBBA 1E6BA 4OFTA 3LSZA 3MWHA 1UN2A 3LGCA 1JFUA 4ECBA 5A5KA 3ZMLA 3F4TA 1T7PB 3TKSA 2KP2A 1KBNA 1XWBA 4GWRA 1YKCA 1K3YA 1TKDB 2B7KA 3QPMA 3M3MA 4KNDA 4HQSA 1R5AA 4OO4A 2HRFA 2X8CA 2LKUA 3BD2A 4TR1A 2HLSA 3HJOA 2RLIA 4TR4A 4K5RA 2B5XA 5IIZA 4GXZA 1TRVA 3R3EA 3QMXA 3F6FA 1FG4A 1N2AA 4EIQA 1A0RP 4X43A 2H71A 4FQUA 2L59A 3FZ9A 4KSMA 3NIVA 1OC3A 4K9ZA 3FK8A 2GT5A 3J7Yk 5J5NA 2K9FA 3HKRA 2FA4A 1FOVA 2JACA 2C4JA 1WOUA 1GSYA 1C72A 3WT1A 3W8JA 3SBCA 4WF4A 4ZL7A 3DVWA 2H76A 1AUCA 4FIWA 1R26A 4G9HA 2L6DA 1FW1A 5CYYA 2O87A 2EC4A 3HHVA 3IAS2 3GFKA 4O5UA 2PERA 1GSUA 2VIMA 4F2IA 2E2MA 2HRAA 4HU9A 4OFMA 2I9HA 3LWAA 5A4UA 2GZYA 4MZWA 2IMFA 4IN0A 1V57A 1N8JA 3AY8A 3GKMA 2HZEB 4IQAA 3VFIA 1MTCA 2VM2A 2H1AA 1YEXA 3IC4A 1K0OA 2MBTA 2FUG2 3FY7A 2BTOT 2GLRA 5D9XA 2N5FA 5HR2A 2C3NA 1WIKA 2FD3A 1VF4A 2CVBA 6GSXA 3GN3A 4EDZA 1RW1A 2WFCA 1B9YC 3IAM2 1TI3A 2B5YA 4WR4A 6GSTA 1SK1A 3ERWA 4OMVA 2AUVA 1SJIA 5CRDA 1EV4A 5HR1A 1VF2A 1Z7RA 3FRCA 3HXSA 1TK0B 3APOA 1BJXA 3IDVA 3TJFA 1AIUA 1GP1A 2YCDA 3LYPA 4ICYA 3FZ4A 2GGTA 1ZYEA 4BL7B 1A2MA 4CDOA 2C0DA 3RPNA 2YZUA 2P31A 4GSTA 3SWLA 1TRUA 3LXZA 2RM6A 3G9BA 3FZ5A 2DJJA 3M8NA 2C3QA 2VLUA 4ZBDA 4OCFA 1FVKA 1PGTA 3FHKA 3M0FA 2DIZA 1EP7A 4WEYA 2OE0A 6GSYA 4YKGA 3ZFLA 3F9UA 3TRPA 2DJ1A 3GKKA 5ECPB 3F0IA 3F63A 4OD7A 1K0CA 3D4TA 1XPVA 4G2EA 1XOBA 2WB9A 2L4CA 3LW9A 4EUYA 4G19A 4ACSA 5KOWA 2FWEA 1TK8B 4TR1B 3DKSA 4J56E 1M2DA 2KLXA 2XPDA 1F6MC 4O92A 2AB6A 2H72A 3KH7A 2X8HA 2GSTA 4ZB8A 2HFDA 1MD3A 4F82A 2EIOA 3TJGA 2A2PA 3DD3A 1JLWA 2AHEA 5CREA 1WE0A 4EXJA 4NAXA 6GSUA 2HI7A 2X8GA 4KF9A 3GTUA 6GSSA 3HZ8A 5FHIA 1BG5A 5IOXA 5AGYA 1PL1A 1EV9A 3ERGA 4GF0A 3W6GA 4XS1A 3A5WA 3DGQA 1PA3A 1SYXA 4WBRD 4PQHA 4IS0A 3CYNA 2OBIA 2VD0A 4QL7A 2QGVA 2PPTA 2J9HA 1GTAA 2F8FA 1EP8A 5CRWA 2V1MA 4NMUA 4MDCA 2H74A 5CO3A 1SYRA 3ZYWA 2QKEA 4G0LA 4GLTA 2CZ2A 14GSA 4ZL8A 4NV2A 2VLVA 2VCXA 2CAQA 2H19A 4XS4A 2P5QA 2JADA 3Q19A 1U3IA 5AIXA 3U6VA 4KX4A 5F06A 3GX0A 5E4WA 5KOXA 5EPFA 2CA8A 2H73A 2ON7A 3UL3A 3Q18A 4MZBA 5B8AA 4KAEA 3KMOA 3TDGA 2C0EA 2ALBA 2BMXA 2QA2A 5E59A 1VF1A 4F0BA 2J23A 2DKHA 1XWGA 3MSZA 4EF0A 2XPEA 1FVJA 1LU4A 3IV4A 3GL5A 4KB3A 2H0HA 4ECIA 4H86A 5D73A 5G5FA 1K0BA 1ON4A 3BBYA 4K2DA 2WGRA 3HDCA 2IL3A 1Z6NA 1ERTA 1Y6EA 2E2GA 2DJKA 3DXBA 6GSWA 1TW9A 4I2UA 5DBQA 5ECMB 1ERWA 3LQ7A 1G6YA 4BWSA 1U88A 5EVOA 1MD4A 3QAGA 1HNCA 4MJBA 5ELGA 3EINA 4YAVA 2JSYA 3KCMA 3ZRDA 3MAKA 3E0UA 2CX3A 2X49A 4K8MA 3LYKA 2RM5A 3VI5A 3LORA 4HZ2A 3ZLPA 5KN0A 3UJ1A 5IMDA 3GHAA 3UBLA 2GQMA 3QD9A 1TI1A 3DWVA 4DVCA 2MMNA 2CAIA 2AYTA 3C71A 1B8XA 3E9JB 5DVBA 1JHBA 1BQ7A 4AF2A 1SJ6A 1O73A 4BA7A 1YF1A 4PUAA 2FCHA 2HXKA 3VWWA 1NW2A 3A2VA 3GUSA 1OE8A 4J2FA 4BVYA 5DJLA 4PX1A 2H0GA 2R0GA 2JL4A 5JCUA 1WWJA 2HSMA 1OE7A 3CXGA 5BMUA 2VUPA 4WF5A 5F05A 3L9SA 5ABRA 3EU3A 3GTUB 5DCGA 3QFBC 1B9XC 2QA1A 3UMAA 4G0IA 1URMA 1OAZA 2UZ8A 1F3BA 4L0WA 1M7TA 2GDRA 3VWXA 4HI7A 4CHSA 2R37A 4MJEA 3D4MA 2H6YA 1IYHA 3VLNA 4QL9A 1DE2A 3DYRA 2D2ZA 1SK0A 4TVEA 3DMLA 4V2LA 5IOWA 5H5QA 3BCIA 4MP4A 2GQKA 3IK9A 4X4JA 5ELAA 2GSQA 2GSRA 3HVXA 2OE3A 1XOAA 1T3BA 3LXTA 2YV9A 1ML6A 1GLQA 3HD5A 4AJ8A 2XHFA 3HVSA 1PKZA 3TB2A 1QK8A 4TXOA 1B4PA 1QGVA 3GA4A 3A2XA 4I6XA 2LUSA 4MF6A 2JU5A 2DSAA 2I81A 3UAPA 3E3EA 5B8BA 3QFAC 4G10A 4GRFA 5ECKB 16GSA 3KMNA 2N5BA 3G7JA 4OFNA 2XC2A 4XCSA 3QCPA 3G7YA 2IFQA 2C0FA 3GL3A 2LQOA 3D21A 2HSHA 2DJ0A 1GTUA 4XS6A 2JZSA 2KP1A 4WETA 2P0GA 3KTBA 1IYIA 1ERVA 1GSQA 2H1BA 1GUMA 4BWQA 4YH2A 4IHUA 2HYXA 1MDIA 1ST9A 3APQA 2AV4A 4GQCA 1CQHA 4MCUA 1VF3A 4PQIA 4N0VA 3ZVJD 2YZHA 3F4SA 4F03A 4Q5RA 2OADA 3GH6A 2TRCP 4JE1A 1TRWA 1PSQA 5JCWA 2AJQB 1A24A 1EGRA 4ZB9A 2WS2A 4N10A 4K1FA 6GSVA 3TCOA 1X9SB 4ZB6A 5GSTA 3FEUA 2CQ9A 3ZFBA 4MPGA 4JR6A 1YDKA 2GZPA 5J41A 5B6MA 2R5GA 3D22A 5F0GA 1SL0B 1SD9A 1HNAA 4Z7XA 1M9BA 1GLPA 4DSQA 3KZQA 1Z3EA 1G6WA 1YZXA 1SJZA 3RDWA 1OC9A 2C0GA 13GSA 1SD8A 4CY6A 1HNBA 3FKFA 5G5EA 1USBA 4O5RA 4BVYB 3CSIA 2H1GA 4JRRA 1BAYA 1SENA 4X1UA 4NV5A 3L0HA 3LEFA 1V98A 1MDJA 3D0ZA 2A4VA 3UVHA 2R4VA 3GRXA 1NHOA 2PU9C 5H5RA 3WYWA 3F4RA 3WGEA 5ECLB 3C73A 3PGTA 5KEJA 4WR5A 2FGXA 3CTGA 2DKIA 1GTIA 3CSHA 3IR4A 5CAXA 4ILFA 3S9FA 3TRQA 4PQ1A 2YV7A 3MIXA 2OJLA 5HFIA 1DBYA 1DSBA 2VD1A 3TKSE 3RBTA 2DJ2A 2HE3A 5BRTA 4GQFA 3CMIA 3C1RA 1JLVA 3P7XA 1M99A 2VL3A 2MMOA 4ML6A 1SU9A 4GTUA 1VRSD 4WKWA 5IQYA 1BYEA 2YWOA 2ZNMA 1GUKA 5KN2A 5ECOB 1Z7PA 5GZZB 2LQQA 4TRXA 3F6DA 3PR8A 2CV4A 4WXTA 4IGJA 4POKA 1HD2A 5D96A 2H75A 1PKWA 1WPIA 4X0XA 4TXOB 4I97A 2HSYA 3UARA 1ZMAA 2H70A 2WCIA 2M80A 4IP1A 2PGTA 2WJUA 2JZRA 3VK9A 1ZYPA 2O8VB 2OE1A 1AXDA 22GSA 1KTEA 3TKSC 1FAAA 3H93A 2IFQB 2I1UA 4FH8A 4XTSA 2AAWA 2V6KA 1ILOA 3KGKA 1T4ZA 2CX4A 2VCVA 3FR9A 1U3AA 2YJ7A 4HJMA 4HOJA 5G30A 1K0DA 1SL2B 3OR5A 3I69A 3GMFA 2NVLA 3PINA 5KN1A 1G7EA 1G0TA 1X0RA 3VWUA 2H30A 1FO5A 2FHEA 1SKWB 1GSFA 4KUNA 2V41A 3MYDA 3TJJA 1XWKA 5FT3A 1ERUA 5JCGA 2JZTA 3UVTA 2KUCA 4LMVA 1PX7A 4L0UA 5EL8A 3ZVJA 10GSA 4E8EA 3HA9A 1V9WA 3C7MA 4Z2TA 2V6OA 4KW6A 3TUEA 2DLXA 3EPTA 2DMMA 3HVVA 4ZILA 5B6NA 1B48A 4F9ZA 3R2QA 4EO3A 4Q5QA 3O3TA 2K18A 1FB6A 3QOUA 5J3RA 4LL4B 3HY2A 1AQXA 3KP8A 2IJYA 1VGLA 1OC9B 1QQ2A 3CBUA 5CRGA 4P3YB 2LSTA 5C00A 2PBJA 1X5CA 3CSJA 4D73A 5IO2A 4HU7A 4ULXA 3WD6A 4KDUA 3P2AA 1YY7A 5ECQB 1GRXA 1H75A 2I4AA 3MDKA 3KTLA 2JSZA 4K5SA 4MF7A 3FR3A 5DALA 4OWYA 2LV3A 4K0NA 1PRXA 5D9TA 2PN8A 4HJ2A 4L5LA 3ZIVA 2XBIA 4WBJA 1J0FA 3GYKA 2C1YA 5J9CA 5DDLA 1FHEA 4TR3A 1XZOA 1B4QA 5IMAA 3N5OA 2R0CA 3ZIJA 1G7OA 2CT6A 3CRTA 4YQVA 4TN8A 3K8NA 1OYJA 2H1DA 2VM1A 3D5JA 1XW9A 4O5QA 1HYUA 5D9VA 1X5DA 4NXIA 5B7CA 1QXHA 3HZ4A 4HS1A 2LRTA 3V1WA 2LJAA 1PQNA 2L4QA 5ECRB 3C1SA 2VCZA 2HRNA 5H5SA 1ZCPA 3UIWA 4DSSA 2F8AA 1EGOA 2YP6A 1PD21 5IO0A 1YKAA 1TU7A 4O7HA 1F9MA 2NPBA 2B7JA 3Q6OA 5J4UA 2X64A 3KP9A 2CVDA 3QDNA 2YN1A 1TRSA 4K2XA 3IE3A 2LEGA 3EE2A 1T00A 3GURA 4XHMA 4Z2RA 4V2NA 2KHPA 4KCAA 5G1LA 2HT9A 3HYPA 2IMDA 1O7UA 2VLTA 4EDYA 3L9UA 1Z9HA 3I43A 2VCTA 2NTOA 3PPUA 2GS3A 1TXXA 2H6ZA 2RUEA 4NWYA 3P8WA 4XIHA 1I5GA 3CTFA 2GZZA 3IPZA 3LG6A 5A4WA 4ZXGA 4YQUA 4ISDA 4K0GA 2B3SA 4ECJA 4O32A 2L5OA 2VOCA 4MJAA 5CNWA 1PL2A 1V2AA 2DJ3A 3EU4A 2R3XA 3IA1A 3RHBA 3EC3A 1SK2A 3H8QA 2PVOC 1YQ1A 1AQWA 4YQMA 1O8XA 5IPHA 2K6VA 5G31A 2VO4A 3TGZA 3DVXA 1XVWA 4MK3A 3I6AA 2ZCTA 4JEDA 1LBKA 5DAKA 3FW2A 1AQVA 2OBKA 3VURA 3G7IA 2H8LA 3U5RE 1OC8A 5AN1A 5L71A 3O6TA 1BEDA 5HQPA 4D73B 4E8HA 2C8UA 1ZYQB 4J57E 3F3QA 2YWIA 5HR0A 4Q5FA 2LNTA 1GNEA 2WDUA 4KSOA 4L8EA 3GNJA 2R2JA 4FYUA 2B6MA 4BVXA 3A3TA 4LMWA 1F3AA 1EOHA 2IMIA 5ECNB 4PNGA 2H01A 3HJPA 5DALB 2IWTA 3WT2A 4TR0A 3TOUA 4K7NA 3RHCA 1XFLA 3HCZA 1X5EA 1ACVA 2MYGA 5ENUA 2N5AA 3ME8A 2G0FA 5LD0A 1A2LA 5IPGA 1Z5YE 3IOSA 4F0CA 1A8LA 3H1NA 2FY6A 4IW9A 2A2SA 2FA8A 2NBSA 4AGSA 2YWMA 1EWXA 1YF0A 4MH3A 2L57A 1LJRA 1EOGA 4RQXA 4MH2A 2BJXA 3TJBA 3VPQA 3W8SA 3ZMKA 3GSSA 1WRYA 2MZCA 1GULA 2B5EA 2LNSA 2LS5A 3QAWA 4JR4A 2FWFA 1AW9A 2WRTA 5D8IA 3GSTA 4KCEA 1W89A 3BCKA 5G2ZA 4DEJA 4NHZA 2DBCA 3ZITA 3GX8A 4PURA 4DSSB 1JZRA 2ES7A 1K3LA 5GAND 1GSEA 1ZZYA 3GIXA 4RI6A 3NZNA 2CVKA 2FNOA 1KEBA 2GQLA 2WZ9A 4EKZA 1M2AA 2O85A 1ABAA 5GAPD 1PN9A 1YJ6A 3M1GA 1O85A 3ZTLA 1PN0A 1THOA 1H4OA 1Q4JA 2PMTA 1TK5B 3US3A 2X4AA 4XRAA 1JZWA 3NOFA 3F8UA 4ID0A 4HUAA 3TKPA 7GSSA 3A2WA 2A2RA 1TJDA 4I8BA 1WP0A 4KE3A 4I2TA 2VL9A 1K0NA 9GSSA 4CY8A 4KDXA 1A2JA 4PXOA 2TRXA 5ID2A 3IBHA 1UC7A 2I3YA 3H79A 4IBPA 1TTZA 4DSRA 2IMKA 1U6TA 1R7HA 2EIQA 5DJMA 4RQRA 5GSSA 2VL2C 4PGTA 3LFLA 4FYBA 1PX6A 2LJRA 2TIRA 1Z6MA 2IMEA 1JZDA 2DC5A 3EURA 4IJIA 4MJCA 4LA1A 5IMZA 2GT6A 1GTBA 4ECCA 4MLYA 1I9DA 2PUKC 1S3DA 3IRAA 3HJMA 2YPMA 4JZQA 4LL1B 2OKAA 1XWCA 2YANA 5DAKB 1E2YA 5LCZA 1RK4A 4IJ3A 4ZIJA 3KIJA 4QQ7A 2FWHA 4TXVA 4MZCA 2YOIA 1SL1B 4HQZA 1X9WB 2VCWA 2B1KA 2KOKA 1HQOA 1A23A 4HDEA 1TOFA 5ECIB 1XBSA 4BVXB 4KA0A 4N30A 1XXUA 1BX9A 12GSA 3EMPA 3IK7A 5D93A 2VAFA 3IHGA 1K3OA 3TRXA 2CZ3A 1O6JA 5JWQB 1YEPA 4MNNA 1A8YA 2LJKA 5FWGA 1WMJA 2G2QA 5JWRB 5JWOB 2X99A 1EZKA 3M9JA 1XVQA 3ME7A 2A4HA 3FZAA 1GH2A 1FB0A 4IELA 4JU5A 1O81A 2MMAA 4ZL9A 1T1VA 2M46A 3FMWA 3UOMA 4KGIA 5DCHA 1XIYA 4ZBBA 5IMVA 2F9SA 5G1KA 1XWAA 1GL8A 3ED3A 3J7Yb 3VI7A 2H6XA 2DMLA 1O8WA 1MEKA 1GSSA 4NHWA 4YAPA 5IMCA 1PMTA 5CRHA 4AJ7A 3ZREA 2C80A 2E0QA 2FLSA 2YWNA 3GKXA 4POLA 3EVIA 1NHYA 3VWVA 5AISA 3TOTA 4A5PA 2MMZA 4GSSA 3BJ5A 1ZL9A 3QAVA 3ISOA 2YNXA 4XRDA 4V1Ap 4BPYA 2K8SA 3IC8A 2HZFA 2PWJA 2ON5A 11GSA 4MMMA 2O7KA 1DE1A 4Z2UA 20GSA 1ZOFA 2OA7A 2IIYA 2WULA 3O76A 3CRUA 1DUGA 1M2BA 1M9AA 2B1LA 3EYTA 1GNWA 1K0MA 4TKYA 1K0AA 3TKRA 4GSNA 4OCEA 4FO5A 5ECHB 3FR6A 5J9BA 4EL1A 2R6KA 2REMA 5ID2B 3KM6A 1XCCA 1GWCA 2H66A 1AC1A 3LJRA 2FWGA 2M72A 1RQMA 1TU8A 1J9BA 2IPAA 4RI7A 3H4KA 3GH9A 3EWLA 1NSWA 2NDOA 5IM9A 4MF5A 4V1Ag 1M0UA 3ERFA 3KH9A 4EVMA 1UVZA 1NM3A 1AAZA 2R0PA 3IXRA 3QR6A 3RPPA 4POMA 1FOHA 1WJKA 5EY6A 3C8EA 3UBKA 1JZOA 4HEA2 1F2EA 4RUVA 4L5OA 1V40A 4IQ1A 4KDYA 1UA5A 1MDKA 4MA9A 4CW9A 1S3CA 3ZZXA 3KXOA 4ML1A 3VPTA 1R5PA 3DRNA 4HZ4A 4IKHA 4IVFA 4NPBA 1T8EB 4K6XA 4LLRA 5C04A 4G0KA 3GKNA 2F3MA 2GTUA 1T4YA 1GSDA 3BOAA 2LRCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WGD A;  3L78 A;  5DQY A;  2XBQ A;  1Y25 A;  1TDI A;  1QMV A;  1QUW A;  1S3A A;  2F51 A;  2GSS A;  3L4N A;  2VCQ A;  4N11 A;  3RAZ A;  2K8V A;  2HNL A;  1X9M B;  18GS A;  3M9K A;  3APS A;  1GUH A;  1OVN A;  1A0F A;  3D6I A;  1QFN A;  2DIY A;  3ZL5 A;  4Q5N A;  5ECS A;  1U87 A;  4MAB A;  4TW5 A;  4EE0 A;  2LTK A;  1THX A;  8GSS A;  1TP9 A;  2MBS A;  5F07 A;  4TOP A;  3F3R A;  4KH7 A;  4K7I A;  2H0I A;  2HZE A;  2PVQ A;  4K7O A;  2P5R A;  1OKD A;  1J08 A;  4GCI A;  1EEJ A;  2QC7 A;  3MNG A;  1R4W A;  4EC0 A;  2V2G A;  2L5L A;  2OAC A;  3WGX A;  1Q98 A;  4AJ6 A;  3EMX A;  1SKS B;  2Z9S A;  2VL2 A;  5D9W A;  1V58 A;  1KNG A;  2L6C A;  1W4V A;  1ZGN A;  5CP1 A;  2LRN A;  3IHQ A;  5F8B A;  2QSI A;  5INY A;  3L9V A;  3N9J A;  3FYG A;  2V32 A;  3UEM A;  5DQS A;  2RUF A;  4POB A;  17GS A;  3I9V 2;  1F37 A;  3KD0 A;  4V2M A;  5HFK A;  5COH A;  19GS A;  1XW5 A;  3Q74 A;  1CQG A;  2IN3 A;  1SKR B;  1EEM A;  4I5Q A;  3DEX A;  5HFG A;  3JCM L;  2GVP A;  2RII A;  3KEB A;  5AIV A;  5A4V A;  2ZUP A;  4BL7 A;  3KJY A;  4MPF A;  4FYC A;  5IMF A;  3DIE A;  2E7P A;  4OO5 A;  3PH9 A;  5LNK e;  5KN3 A;  3P90 A;  3GV1 A;  4PUF C;  2EIR A;  2YJH A;  4IP6 A;  4N0Z A;  4ZBA A;  3TJK A;  4PNF A;  2O89 A;  1OKT A;  4XS4 B;  5HR3 A;  3TKQ A;  1XW6 A;  2C3T A;  4JBB A;  1E6B A;  4OFT A;  3LSZ A;  3MWH A;  1UN2 A;  3LGC A;  1JFU A;  4ECB A;  5A5K A;  3ZML A;  3F4T A;  1T7P B;  3TKS A;  2KP2 A;  1KBN A;  1XWB A;  4GWR A;  1YKC A;  1K3Y A;  1TKD B;  2B7K A;  3QPM A;  3M3M A;  4KND A;  4HQS A;  1R5A A;  4OO4 A;  2HRF A;  2X8C A;  2LKU A;  3BD2 A;  4TR1 A;  2HLS A;  3HJO A;  2RLI A;  4TR4 A;  2B5X A;  5IIZ A;  4GXZ A;  1TRV A;  3QMX A;  3F6F A;  1FG4 A;  1N2A A;  1A0R P;  4X43 A;  2H71 A;  2L59 A;  3FZ9 A;  4KSM A;  3NIV A;  1OC3 A;  4K9Z A;  3FK8 A;  2GT5 A;  3J7Y k;  5J5N A;  2K9F A;  3HKR A;  2FA4 A;  1FOV A;  2JAC A;  2C4J A;  1WOU A;  1GSY A;  1C72 A;  3WT1 A;  3W8J A;  3SBC A;  4WF4 A;  4ZL7 A;  3DVW A;  2H76 A;  1AUC A;  4FIW A;  1R26 A;  4G9H A;  2L6D A;  1FW1 A;  5CYY A;  2O87 A;  2EC4 A;  3HHV A;  3IAS 2;  3GFK A;  2PER A;  1GSU A;  2VIM A;  4F2I A;  2E2M A;  4HU9 A;  4OFM A;  2I9H A;  3LWA A;  5A4U A;  2GZY A;  4MZW A;  2IMF A;  4IN0 A;  1V57 A;  1N8J A;  3AY8 A;  3GKM A;  2HZE B;  4IQA A;  3VFI A;  1MTC A;  2VM2 A;  2H1A A;  1YEX A;  3IC4 A;  1K0O A;  2MBT A;  2FUG 2;  3FY7 A;  2BTO T;  2GLR A;  5D9X A;  2N5F A;  5HR2 A;  2C3N A;  1WIK A;  2FD3 A;  1VF4 A;  2CVB A;  6GSX A;  3GN3 A;  4EDZ A;  1RW1 A;  2WFC A;  1B9Y C;  3IAM 2;  1TI3 A;  2B5Y A;  4WR4 A;  6GST A;  1SK1 A;  3ERW A;  4OMV A;  2AUV A;  1SJI A;  5CRD A;  1EV4 A;  5HR1 A;  1VF2 A;  1Z7R A;  3FRC A;  3HXS A;  1TK0 B;  3APO A;  1BJX A;  3IDV A;  3TJF A;  1AIU A;  1GP1 A;  2YCD A;  3LYP A;  3FZ4 A;  2GGT A;  1ZYE A;  1A2M A;  4CDO A;  2C0D A;  3RPN A;  2YZU A;  2P31 A;  4GST A;  3SWL A;  1TRU A;  3LXZ A;  2RM6 A;  3G9B A;  3FZ5 A;  2DJJ A;  3M8N A;  2C3Q A;  2VLU A;  4ZBD A;  4OCF A;  1FVK A;  1PGT A;  3FHK A;  3M0F A;  2DIZ A;  1EP7 A;  4WEY A;  2OE0 A;  6GSY A;  3ZFL A;  3F9U A;  3TRP A;  2DJ1 A;  3GKK A;  5ECP B;  3F0I A;  3F63 A;  4OD7 A;  1K0C A;  3D4T A;  1XPV A;  4G2E A;  1XOB A;  2WB9 A;  2L4C A;  4EUY A;  4G19 A;  4ACS A;  2FWE A;  1TK8 B;  4TR1 B;  3DKS A;  4J56 E;  1M2D A;  2KLX A;  2XPD A;  1F6M C;  4O92 A;  2AB6 A;  2H72 A;  3KH7 A;  2X8H A;  2GST A;  4ZB8 A;  2HFD A;  1MD3 A;  4F82 A;  2EIO A;  3TJG A;  3DD3 A;  1JLW A;  2AHE A;  5CRE A;  1WE0 A;  4EXJ A;  4NAX A;  6GSU A;  2HI7 A;  2X8G A;  3GTU A;  6GSS A;  3HZ8 A;  5FHI A;  1BG5 A;  5IOX A;  5AGY A;  1PL1 A;  1EV9 A;  3ERG A;  4GF0 A;  3W6G A;  4XS1 A;  3A5W A;  3DGQ A;  1PA3 A;  1SYX A;  4WBR D;  4PQH A;  4IS0 A;  3CYN A;  2OBI A;  2VD0 A;  4QL7 A;  2QGV A;  2PPT A;  2J9H A;  1GTA A;  2F8F A;  1EP8 A;  5CRW A;  2V1M A;  4NMU A;  4MDC A;  2H74 A;  5CO3 A;  1SYR A;  3ZYW A;  2QKE A;  4GLT A;  2CZ2 A;  14GS A;  4ZL8 A;  4NV2 A;  2VLV A;  2VCX A;  2CAQ A;  2H19 A;  4XS4 A;  2P5Q A;  2JAD A;  3Q19 A;  1U3I A;  5AIX A;  3U6V A;  4KX4 A;  5F06 A;  3GX0 A;  5E4W A;  5EPF A;  2CA8 A;  2H73 A;  2ON7 A;  3UL3 A;  3Q18 A;  4MZB A;  5B8A A;  4KAE A;  3KMO A;  3TDG A;  2C0E A;  2ALB A;  2BMX A;  5E59 A;  1VF1 A;  4F0B A;  2J23 A;  1XWG A;  3MSZ A;  4EF0 A;  2XPE A;  1FVJ A;  1LU4 A;  3IV4 A;  3GL5 A;  4KB3 A;  2H0H A;  4ECI A;  4H86 A;  5D73 A;  5G5F A;  1K0B A;  1ON4 A;  3BBY A;  4K2D A;  2WGR A;  3HDC A;  2IL3 A;  1Z6N A;  1ERT A;  1Y6E A;  2E2G A;  2DJK A;  3DXB A;  6GSW A;  1TW9 A;  4I2U A;  5DBQ A;  5ECM B;  1ERW A;  3LQ7 A;  1G6Y A;  4BWS A;  1U88 A;  5EVO A;  1MD4 A;  3QAG A;  1HNC A;  4MJB A;  5ELG A;  3EIN A;  4YAV A;  2JSY A;  3KCM A;  3ZRD A;  3MAK A;  3E0U A;  2CX3 A;  4K8M A;  3LYK A;  2RM5 A;  3VI5 A;  3LOR A;  4HZ2 A;  3ZLP A;  5KN0 A;  3UJ1 A;  5IMD A;  3GHA A;  3UBL A;  2GQM A;  3QD9 A;  1TI1 A;  3DWV A;  4DVC A;  2MMN A;  2CAI A;  2AYT A;  3C71 A;  1B8X A;  3E9J B;  5DVB A;  1JHB A;  1BQ7 A;  4AF2 A;  1SJ6 A;  1O73 A;  4BA7 A;  1YF1 A;  4PUA A;  2FCH A;  2HXK A;  3VWW A;  1NW2 A;  3A2V A;  3GUS A;  1OE8 A;  4J2F A;  4BVY A;  5DJL A;  4PX1 A;  2H0G A;  2JL4 A;  5JCU A;  1WWJ A;  1OE7 A;  3CXG A;  2VUP A;  4WF5 A;  5F05 A;  3L9S A;  5ABR A;  3EU3 A;  3GTU B;  5DCG A;  3QFB C;  1B9X C;  3UMA A;  1URM A;  1OAZ A;  1F3B A;  4L0W A;  1M7T A;  2GDR A;  3VWX A;  4HI7 A;  4CHS A;  2R37 A;  4MJE A;  3D4M A;  2H6Y A;  1IYH A;  3VLN A;  4QL9 A;  1DE2 A;  3DYR A;  2D2Z A;  1SK0 A;  4TVE A;  3DML A;  4V2L A;  5IOW A;  5H5Q A;  3BCI A;  4MP4 A;  2GQK A;  3IK9 A;  5ELA A;  2GSQ A;  2GSR A;  3HVX A;  2OE3 A;  1XOA A;  1T3B A;  3LXT A;  2YV9 A;  1ML6 A;  1GLQ A;  3HD5 A;  4AJ8 A;  2XHF A;  3HVS A;  1PKZ A;  3TB2 A;  1QK8 A;  4TXO A;  1B4P A;  1QGV A;  3GA4 A;  3A2X A;  4I6X A;  2LUS A;  4MF6 A;  2JU5 A;  2DSA A;  2I81 A;  3UAP A;  3E3E A;  5B8B A;  3QFA C;  4G10 A;  4GRF A;  5ECK B;  16GS A;  3KMN A;  2N5B A;  3G7J A;  4OFN A;  2XC2 A;  4XCS A;  3QCP A;  3G7Y A;  2IFQ A;  2C0F A;  3GL3 A;  2LQO A;  3D21 A;  2HSH A;  2DJ0 A;  1GTU A;  4XS6 A;  2JZS A;  2KP1 A;  4WET A;  2P0G A;  3KTB A;  1IYI A;  1ERV A;  1GSQ A;  2H1B A;  1GUM A;  4BWQ A;  4YH2 A;  4IHU A;  2HYX A;  1MDI A;  1ST9 A;  3APQ A;  2AV4 A;  4GQC A;  1CQH A;  4MCU A;  1VF3 A;  4PQI A;  4N0V A;  3ZVJ D;  2YZH A;  3F4S A;  4F03 A;  4Q5R A;  2OAD A;  3GH6 A;  2TRC P;  4JE1 A;  1TRW A;  1PSQ A;  5JCW A;  2AJQ B;  1A24 A;  1EGR A;  4ZB9 A;  2WS2 A;  4N10 A;  4K1F A;  6GSV A;  3TCO A;  1X9S B;  4ZB6 A;  5GST A;  3FEU A;  2CQ9 A;  3ZFB A;  4MPG A;  4JR6 A;  1YDK A;  2GZP A;  5J41 A;  5B6M A;  2R5G A;  3D22 A;  5F0G A;  1SL0 B;  1SD9 A;  1HNA A;  4Z7X A;  1M9B A;  1GLP A;  4DSQ A;  3KZQ A;  1Z3E A;  1G6W A;  1YZX A;  1SJZ A;  3RDW A;  1OC9 A;  2C0G A;  13GS A;  1SD8 A;  1HNB A;  3FKF A;  5G5E A;  1USB A;  4O5R A;  3CSI A;  2H1G A;  4JRR A;  1BAY A;  1SEN A;  4X1U A;  4NV5 A;  3L0H A;  3LEF A;  1V98 A;  1MDJ A;  3D0Z A;  2A4V A;  3UVH A;  2R4V A;  3GRX A;  1NHO A;  2PU9 C;  5H5R A;  3WYW A;  3F4R A;  3WGE A;  5ECL B;  3C73 A;  3PGT A;  5KEJ A;  4WR5 A;  2FGX A;  3CTG A;  3IR4 A;  1GTI A;  3CSH A;  5CAX A;  4ILF A;  3S9F A;  3TRQ A;  4PQ1 A;  2YV7 A;  2OJL A;  5HFI A;  1DBY A;  1DSB A;  2VD1 A;  3TKS E;  3RBT A;  2DJ2 A;  2HE3 A;  4GQF A;  3CMI A;  3C1R A;  1JLV A;  3P7X A;  1M99 A;  2VL3 A;  2MMO A;  4ML6 A;  1SU9 A;  4GTU A;  1VRS D;  4WKW A;  5IQY A;  1BYE A;  2YWO A;  2ZNM A;  1GUK A;  5KN2 A;  5ECO B;  1Z7P A;  5GZZ B;  2LQQ A;  4TRX A;  3F6D A;  3PR8 A;  2CV4 A;  4WXT A;  4IGJ A;  4POK A;  1HD2 A;  5D96 A;  2H75 A;  1PKW A;  1WPI A;  4X0X A;  4TXO B;  4I97 A;  2HSY A;  3UAR A;  1ZMA A;  2H70 A;  2WCI A;  2M80 A;  4IP1 A;  2PGT A;  2WJU A;  2JZR A;  3VK9 A;  2O8V B;  2OE1 A;  1AXD A;  22GS A;  1KTE A;  3TKS C;  1FAA A;  3H93 A;  2IFQ B;  2I1U A;  4FH8 A;  4XTS A;  2AAW A;  2V6K A;  1ILO A;  3KGK A;  1T4Z A;  2CX4 A;  2VCV A;  3FR9 A;  1U3A A;  2YJ7 A;  4HJM A;  4HOJ A;  5G30 A;  1K0D A;  1SL2 B;  3OR5 A;  3I69 A;  3GMF A;  2NVL A;  3PIN A;  5KN1 A;  1G7E A;  1G0T A;  1X0R A;  3VWU A;  2H30 A;  1FO5 A;  2FHE A;  1SKW B;  1GSF A;  4KUN A;  2V41 A;  3TJJ A;  1XWK A;  5FT3 A;  1ERU A;  5JCG A;  2JZT A;  3UVT A;  2KUC A;  4LMV A;  1PX7 A;  4L0U A;  5EL8 A;  3ZVJ A;  10GS A;  4E8E A;  3HA9 A;  1V9W A;  3C7M A;  2V6O A;  4KW6 A;  3TUE A;  2DLX A;  2DMM A;  3HVV A;  4ZIL A;  5B6N A;  1B48 A;  4F9Z A;  3R2Q A;  4EO3 A;  4Q5Q A;  3O3T A;  2K18 A;  1FB6 A;  3QOU A;  5J3R A;  4LL4 B;  3HY2 A;  1AQX A;  3KP8 A;  2IJY A;  1VGL A;  1OC9 B;  1QQ2 A;  3CBU A;  5CRG A;  4P3Y B;  2LST A;  5C00 A;  2PBJ A;  1X5C A;  3CSJ A;  4D73 A;  5IO2 A;  4HU7 A;  4ULX A;  3WD6 A;  4KDU A;  3P2A A;  1YY7 A;  5ECQ B;  1GRX A;  1H75 A;  2I4A A;  3MDK A;  3KTL A;  2JSZ A;  4MF7 A;  3FR3 A;  5DAL A;  4OWY A;  2LV3 A;  1PRX A;  4K0N A;  5D9T A;  2PN8 A;  4HJ2 A;  4L5L A;  3ZIV A;  2XBI A;  4WBJ A;  1J0F A;  3GYK A;  2C1Y A;  5J9C A;  5DDL A;  1FHE A;  4TR3 A;  1XZO A;  1B4Q A;  5IMA A;  3N5O A;  3ZIJ A;  1G7O A;  2CT6 A;  3CRT A;  4YQV A;  4TN8 A;  3K8N A;  1OYJ A;  2H1D A;  2VM1 A;  3D5J A;  1XW9 A;  1HYU A;  5D9V A;  1X5D A;  4NXI A;  5B7C A;  1QXH A;  3HZ4 A;  4HS1 A;  2LRT A;  3V1W A;  2LJA A;  1PQN A;  2L4Q A;  5ECR B;  3C1S A;  2VCZ A;  2HRN A;  5H5S A;  1ZCP A;  3UIW A;  4DSS A;  2F8A A;  1EGO A;  2YP6 A;  1PD2 1;  5IO0 A;  1YKA A;  1TU7 A;  4O7H A;  1F9M A;  2NPB A;  2B7J A;  3Q6O A;  5J4U A;  2X64 A;  3KP9 A;  2CVD A;  3QDN A;  2YN1 A;  1TRS A;  3IE3 A;  2LEG A;  3EE2 A;  1T00 A;  3GUR A;  4XHM A;  4V2N A;  2KHP A;  4KCA A;  5G1L A;  2HT9 A;  3HYP A;  2IMD A;  1O7U A;  2VLT A;  4EDY A;  3L9U A;  1Z9H A;  3I43 A;  2VCT A;  2NTO A;  2GS3 A;  1TXX A;  2H6Z A;  2RUE A;  4NWY A;  3P8W A;  4XIH A;  1I5G A;  3CTF A;  2GZZ A;  3IPZ A;  3LG6 A;  5A4W A;  4ZXG A;  4YQU A;  4ISD A;  4K0G A;  2B3S A;  4ECJ A;  4O32 A;  2L5O A;  2VOC A;  4MJA A;  5CNW A;  1PL2 A;  1V2A A;  2DJ3 A;  3EU4 A;  2R3X A;  3IA1 A;  3RHB A;  3EC3 A;  1SK2 A;  3H8Q A;  2PVO C;  1YQ1 A;  1AQW A;  4YQM A;  1O8X A;  5IPH A;  2K6V A;  5G31 A;  2VO4 A;  3TGZ A;  3DVX A;  1XVW A;  4MK3 A;  3I6A A;  2ZCT A;  4JED A;  1LBK A;  5DAK A;  3FW2 A;  1AQV A;  2OBK A;  3VUR A;  3G7I A;  2H8L A;  3U5R E;  1OC8 A;  5AN1 A;  5L71 A;  3O6T A;  1BED A;  5HQP A;  4D73 B;  4E8H A;  2C8U A;  1ZYQ B;  4J57 E;  3F3Q A;  2YWI A;  5HR0 A;  4Q5F A;  2LNT A;  1GNE A;  2WDU A;  4KSO A;  4L8E A;  3GNJ A;  2R2J A;  4FYU A;  2B6M A;  4BVX A;  3A3T A;  4LMW A;  1F3A A;  1EOH A;  2IMI A;  5ECN B;  4PNG A;  2H01 A;  3HJP A;  5DAL B;  2IWT A;  3WT2 A;  4TR0 A;  3TOU A;  4K7N A;  3RHC A;  1XFL A;  3HCZ A;  1X5E A;  1ACV A;  2MYG A;  5ENU A;  2N5A A;  3ME8 A;  2G0F A;  5LD0 A;  1A2L A;  5IPG A;  1Z5Y E;  3IOS A;  4F0C A;  1A8L A;  3H1N A;  2FY6 A;  4IW9 A;  2A2S A;  2FA8 A;  2NBS A;  4AGS A;  2YWM A;  1EWX A;  1YF0 A;  4MH3 A;  2L57 A;  1LJR A;  1EOG A;  4RQX A;  4MH2 A;  2BJX A;  3TJB A;  3VPQ A;  3W8S A;  3ZMK A;  3GSS A;  1WRY A;  2MZC A;  1GUL A;  2B5E A;  2LNS A;  2LS5 A;  3QAW A;  4JR4 A;  2FWF A;  1AW9 A;  2WRT A;  5D8I A;  3GST A;  4KCE A;  1W89 A;  3BCK A;  5G2Z A;  4DEJ A;  4NHZ A;  2DBC A;  3ZIT A;  3GX8 A;  4PUR A;  4DSS B;  1JZR A;  2ES7 A;  1K3L A;  5GAN D;  1GSE A;  1ZZY A;  3GIX A;  4RI6 A;  3NZN A;  2CVK A;  2FNO A;  1KEB A;  2GQL A;  2WZ9 A;  4EKZ A;  1M2A A;  2O85 A;  1ABA A;  5GAP D;  1PN9 A;  1YJ6 A;  3M1G A;  1O85 A;  3ZTL A;  1THO A;  1H4O A;  1Q4J A;  2PMT A;  1TK5 B;  3US3 A;  4XRA A;  1JZW A;  3NOF A;  3F8U A;  4ID0 A;  4HUA A;  3TKP A;  7GSS A;  3A2W A;  2A2R A;  1TJD A;  4I8B A;  1WP0 A;  4KE3 A;  4I2T A;  2VL9 A;  1K0N A;  9GSS A;  4KDX A;  1A2J A;  4PXO A;  2TRX A;  5ID2 A;  3IBH A;  1UC7 A;  2I3Y A;  3H79 A;  4IBP A;  1TTZ A;  4DSR A;  2IMK A;  1U6T A;  1R7H A;  2EIQ A;  5DJM A;  4RQR A;  5GSS A;  2VL2 C;  4PGT A;  3LFL A;  4FYB A;  1PX6 A;  2LJR A;  2TIR A;  1Z6M A;  2IME A;  1JZD A;  2DC5 A;  3EUR A;  4IJI A;  4MJC A;  4LA1 A;  5IMZ A;  2GT6 A;  1GTB A;  4ECC A;  4MLY A;  1I9D A;  2PUK C;  1S3D A;  3IRA A;  3HJM A;  2YPM A;  4JZQ A;  4LL1 B;  2OKA A;  1XWC A;  2YAN A;  5DAK B;  1E2Y A;  5LCZ A;  1RK4 A;  4IJ3 A;  4ZIJ A;  3KIJ A;  4QQ7 A;  2FWH A;  4TXV A;  4MZC A;  2YOI A;  1SL1 B;  4HQZ A;  1X9W B;  2VCW A;  2B1K A;  2KOK A;  1HQO A;  1A23 A;  4HDE A;  1TOF A;  5ECI B;  1XBS A;  4KA0 A;  4N30 A;  1XXU A;  1BX9 A;  12GS A;  3EMP A;  3IK7 A;  5D93 A;  2VAF A;  1K3O A;  3TRX A;  2CZ3 A;  1O6J A;  5JWQ B;  1YEP A;  1A8Y A;  2LJK A;  5FWG A;  1WMJ A;  2G2Q A;  5JWR B;  5JWO B;  2X99 A;  1EZK A;  3M9J A;  1XVQ A;  3ME7 A;  3FZA A;  1GH2 A;  1FB0 A;  4IEL A;  4JU5 A;  1O81 A;  2MMA A;  4ZL9 A;  1T1V A;  2M46 A;  3UOM A;  4KGI A;  5DCH A;  1XIY A;  4ZBB A;  5IMV A;  2F9S A;  5G1K A;  1XWA A;  1GL8 A;  3ED3 A;  3J7Y b;  3VI7 A;  2H6X A;  2DML A;  1O8W A;  1MEK A;  1GSS A;  4NHW A;  4YAP A;  5IMC A;  1PMT A;  5CRH A;  4AJ7 A;  3ZRE A;  2C80 A;  2E0Q A;  2FLS A;  2YWN A;  3GKX A;  4POL A;  3EVI A;  1NHY A;  3VWV A;  5AIS A;  3TOT A;  2MMZ A;  4GSS A;  3BJ5 A;  1ZL9 A;  3QAV A;  3ISO A;  2YNX A;  4XRD A;  4V1A p;  4BPY A;  2K8S A;  2HZF A;  2PWJ A;  2ON5 A;  11GS A;  4MMM A;  2O7K A;  1DE1 A;  20GS A;  1ZOF A;  2OA7 A;  2IIY A;  2WUL A;  3O76 A;  3CRU A;  1DUG A;  1M2B A;  1M9A A;  2B1L A;  3EYT A;  1GNW A;  1K0M A;  4TKY A;  1K0A A;  3TKR A;  4GSN A;  4OCE A;  4FO5 A;  5ECH B;  3FR6 A;  5J9B A;  4EL1 A;  2R6K A;  2REM A;  5ID2 B;  3KM6 A;  1XCC A;  1GWC A;  2H66 A;  1AC1 A;  3LJR A;  2FWG A;  2M72 A;  1RQM A;  1TU8 A;  1J9B A;  2IPA A;  4RI7 A;  3H4K A;  3GH9 A;  3EWL A;  1NSW A;  2NDO A;  5IM9 A;  4MF5 A;  4V1A g;  1M0U A;  3ERF A;  3KH9 A;  4EVM A;  1UVZ A;  1NM3 A;  1AAZ A;  3IXR A;  3QR6 A;  3RPP A;  4POM A;  1WJK A;  5EY6 A;  3C8E A;  3UBK A;  1JZO A;  4HEA 2;  1F2E A;  4RUV A;  4L5O A;  1V40 A;  4IQ1 A;  4KDY A;  1UA5 A;  1MDK A;  4MA9 A;  4CW9 A;  1S3C A;  3ZZX A;  3KXO A;  4ML1 A;  3VPT A;  1R5P A;  3DRN A;  4HZ4 A;  4IKH A;  4IVF A;  4NPB A;  1T8E B;  4K6X A;  4LLR A;  5C04 A;  3GKN A;  2F3M A;  2GTU A;  1T4Y A;  1GSD A;  3BOA A;  2LRC A; 
#chains in the Genus database with same CATH topology
 3WGD A;  3L78 A;  5DQY A;  2XBQ A;  1Y25 A;  4USS A;  1TDI A;  1QMV A;  1QUW A;  1S3A A;  2F51 A;  2GSS A;  3L4N A;  2VCQ A;  4N11 A;  3RAZ A;  2K8V A;  2HNL A;  1X9M B;  18GS A;  3M9K A;  3APS A;  4YKF A;  1GUH A;  1OVN A;  4EIP A;  1A0F A;  3D6I A;  1QFN A;  2DIY A;  3ZL5 A;  4Q5N A;  5ECS A;  1U87 A;  4MAB A;  4TW5 A;  4EE0 A;  2LTK A;  1THX A;  8GSS A;  1TP9 A;  2MBS A;  5F07 A;  4TOP A;  3F3R A;  4KH7 A;  4K7I A;  2H0I A;  2HZE A;  2PVQ A;  3A5I A;  4K7O A;  2P5R A;  1ZYN A;  1OKD A;  1J08 A;  4GCI A;  1EEJ A;  2QC7 A;  3MNG A;  1R4W A;  4EC0 A;  2V2G A;  2L5L A;  2OAC A;  3WGX A;  1Q98 A;  4AJ6 A;  3EMX A;  1SKS B;  2Z9S A;  2VL2 A;  5D9W A;  1V58 A;  1KNG A;  2L6C A;  1W4V A;  1ZGN A;  5CP1 A;  2LRN A;  3IHQ A;  5F8B A;  2QSI A;  5INY A;  3L9V A;  3N9J A;  3FYG A;  2V32 A;  3UEM A;  5DQS A;  2RUF A;  4POB A;  17GS A;  3I9V 2;  1F37 A;  3KD0 A;  4V2M A;  5HFK A;  5COH A;  19GS A;  1XW5 A;  3Q74 A;  1CQG A;  2IN3 A;  1SKR B;  1EEM A;  4I5Q A;  3DEX A;  5HFG A;  3JCM L;  2GVP A;  2RII A;  3KEB A;  5AIV A;  5A4V A;  2ZUP A;  4BL7 A;  3KJY A;  4MPF A;  4PTS A;  4FYC A;  5IMF A;  3DIE A;  2E7P A;  4OO5 A;  3PH9 A;  5LNK e;  5KN3 A;  3P90 A;  3GV1 A;  4PUF C;  2EIR A;  2YJH A;  4IP6 A;  4N0Z A;  4ZBA A;  3TJK A;  4PNF A;  2O89 A;  1OKT A;  4XS4 B;  5HR3 A;  2HRK A;  3TKQ A;  1XW6 A;  2C3T A;  4JBB A;  1E6B A;  4OFT A;  3LSZ A;  3MWH A;  1UN2 A;  3LGC A;  1JFU A;  4ECB A;  5A5K A;  3ZML A;  3F4T A;  1T7P B;  3TKS A;  2KP2 A;  1KBN A;  1XWB A;  4GWR A;  1YKC A;  1K3Y A;  1TKD B;  2B7K A;  3QPM A;  3M3M A;  4KND A;  4HQS A;  1R5A A;  4OO4 A;  2HRF A;  2X8C A;  2LKU A;  3BD2 A;  4TR1 A;  2HLS A;  3HJO A;  2RLI A;  4TR4 A;  4K5R A;  2B5X A;  5IIZ A;  4GXZ A;  1TRV A;  3R3E A;  3QMX A;  3F6F A;  1FG4 A;  1N2A A;  4EIQ A;  1A0R P;  4X43 A;  2H71 A;  4FQU A;  2L59 A;  3FZ9 A;  4KSM A;  3NIV A;  1OC3 A;  4K9Z A;  3FK8 A;  2GT5 A;  3J7Y k;  5J5N A;  2K9F A;  3HKR A;  4HSC X;  2FA4 A;  1FOV A;  2JAC A;  2C4J A;  1WOU A;  1GSY A;  1C72 A;  3WT1 A;  3W8J A;  3SBC A;  4WF4 A;  4ZL7 A;  3DVW A;  2H76 A;  1AUC A;  4FIW A;  1R26 A;  4G9H A;  2L6D A;  1FW1 A;  5CYY A;  2O87 A;  2EC4 A;  3HHV A;  3IAS 2;  3GFK A;  4O5U A;  2PER A;  1GSU A;  2VIM A;  4F2I A;  2E2M A;  2HRA A;  4HU9 A;  4OFM A;  2I9H A;  3LWA A;  5A4U A;  2GZY A;  4MZW A;  2IMF A;  4IN0 A;  1V57 A;  1N8J A;  3AY8 A;  3GKM A;  2HZE B;  4IQA A;  3VFI A;  1MTC A;  2VM2 A;  2H1A A;  1YEX A;  3IC4 A;  1K0O A;  2MBT A;  2FUG 2;  3FY7 A;  2BTO T;  2GLR A;  5D9X A;  2N5F A;  5HR2 A;  2C3N A;  1WIK A;  2FD3 A;  1VF4 A;  2CVB A;  6GSX A;  3GN3 A;  4EDZ A;  1RW1 A;  2WFC A;  1B9Y C;  3IAM 2;  1TI3 A;  2B5Y A;  4WR4 A;  6GST A;  1SK1 A;  3ERW A;  4OMV A;  2AUV A;  1SJI A;  5CRD A;  1EV4 A;  5HR1 A;  1VF2 A;  1Z7R A;  3FRC A;  3HXS A;  1TK0 B;  3APO A;  1BJX A;  3IDV A;  3TJF A;  1AIU A;  1GP1 A;  2YCD A;  3LYP A;  4ICY A;  3FZ4 A;  2GGT A;  1ZYE A;  4BL7 B;  1A2M A;  4CDO A;  2C0D A;  3RPN A;  2YZU A;  2P31 A;  4GST A;  3SWL A;  1TRU A;  3LXZ A;  2RM6 A;  3G9B A;  3FZ5 A;  2DJJ A;  3M8N A;  2C3Q A;  2VLU A;  4ZBD A;  4OCF A;  1FVK A;  1PGT A;  3FHK A;  3M0F A;  2DIZ A;  1EP7 A;  4WEY A;  2OE0 A;  6GSY A;  4YKG A;  3ZFL A;  3F9U A;  3TRP A;  2DJ1 A;  3GKK A;  5ECP B;  3F0I A;  3F63 A;  4OD7 A;  1K0C A;  3D4T A;  1XPV A;  4G2E A;  1XOB A;  2WB9 A;  2L4C A;  3LW9 A;  4EUY A;  4G19 A;  4ACS A;  5KOW A;  2FWE A;  1TK8 B;  4TR1 B;  3DKS A;  4J56 E;  1M2D A;  2KLX A;  2XPD A;  1F6M C;  4O92 A;  2AB6 A;  2H72 A;  3KH7 A;  2X8H A;  2GST A;  4ZB8 A;  2HFD A;  1MD3 A;  4F82 A;  2EIO A;  3TJG A;  2A2P A;  3DD3 A;  1JLW A;  2AHE A;  5CRE A;  1WE0 A;  4EXJ A;  4NAX A;  4BIK A;  6GSU A;  2HI7 A;  2X8G A;  4KF9 A;  3GTU A;  6GSS A;  3HZ8 A;  5FHI A;  1BG5 A;  5IOX A;  5AGY A;  1PL1 A;  1EV9 A;  3ERG A;  4GF0 A;  3W6G A;  4XS1 A;  3A5W A;  3DGQ A;  1PA3 A;  1SYX A;  4WBR D;  4PQH A;  4IS0 A;  3CYN A;  2OBI A;  2VD0 A;  4QL7 A;  2QGV A;  2PPT A;  2J9H A;  1GTA A;  2F8F A;  1EP8 A;  5CRW A;  2V1M A;  4NMU A;  4MDC A;  2H74 A;  5CO3 A;  1SYR A;  3ZYW A;  2QKE A;  4G0L A;  4GLT A;  2CZ2 A;  14GS A;  4ZL8 A;  4NV2 A;  2VLV A;  2VCX A;  2CAQ A;  2H19 A;  4XS4 A;  2P5Q A;  2JAD A;  3Q19 A;  1U3I A;  5AIX A;  3U6V A;  4KX4 A;  5F06 A;  3GX0 A;  5E4W A;  5KOX A;  5EPF A;  2CA8 A;  2H73 A;  2ON7 A;  3UL3 A;  3Q18 A;  4MZB A;  5B8A A;  4KAE A;  3KMO A;  3TDG A;  2C0E A;  2ALB A;  2BMX A;  2QA2 A;  5E59 A;  1VF1 A;  4F0B A;  2J23 A;  2DKH A;  1XWG A;  3MSZ A;  4EF0 A;  2XPE A;  1FVJ A;  1LU4 A;  3IV4 A;  3GL5 A;  4KB3 A;  2H0H A;  4ECI A;  4H86 A;  5D73 A;  5G5F A;  1K0B A;  1ON4 A;  3BBY A;  4K2D A;  2WGR A;  3HDC A;  2IL3 A;  1Z6N A;  1ERT A;  1Y6E A;  2E2G A;  2DJK A;  3DXB A;  6GSW A;  1TW9 A;  4I2U A;  5DBQ A;  5ECM B;  1ERW A;  3LQ7 A;  1G6Y A;  4BWS A;  1U88 A;  5EVO A;  1MD4 A;  3QAG A;  1HNC A;  4MJB A;  5ELG A;  3EIN A;  4YAV A;  2JSY A;  3KCM A;  3ZRD A;  3MAK A;  3E0U A;  2CX3 A;  2X49 A;  4K8M A;  3LYK A;  2RM5 A;  3VI5 A;  3LOR A;  4HZ2 A;  3ZLP A;  5KN0 A;  3UJ1 A;  5IMD A;  3GHA A;  3UBL A;  2GQM A;  3QD9 A;  1TI1 A;  1M3I A;  3DWV A;  4DVC A;  2MMN A;  2CAI A;  2AYT A;  3C71 A;  1B8X A;  3E9J B;  5DVB A;  1JHB A;  1BQ7 A;  4AF2 A;  1SJ6 A;  1O73 A;  4BA7 A;  1YF1 A;  4PUA A;  2FCH A;  2HXK A;  3VWW A;  1NW2 A;  3A2V A;  3GUS A;  1OE8 A;  4J2F A;  4BVY A;  5DJL A;  4PX1 A;  2H0G A;  2R0G A;  2JL4 A;  5JCU A;  1WWJ A;  2HSM A;  1OE7 A;  3CXG A;  5BMU A;  2VUP A;  4WF5 A;  5F05 A;  3L9S A;  5ABR A;  3EU3 A;  3GTU B;  5DCG A;  3QFB C;  1B9X C;  2QA1 A;  3UMA A;  4G0I A;  1URM A;  1OAZ A;  2UZ8 A;  1F3B A;  4L0W A;  1M7T A;  2GDR A;  3VWX A;  4HI7 A;  4CHS A;  2R37 A;  4MJE A;  3D4M A;  2H6Y A;  1IYH A;  3VLN A;  4QL9 A;  1DE2 A;  3DYR A;  2D2Z A;  1SK0 A;  4TVE A;  3DML A;  4V2L A;  5IOW A;  5H5Q A;  3BCI A;  4MP4 A;  2GQK A;  3IK9 A;  4X4J A;  5ELA A;  2GSQ A;  2GSR A;  3HVX A;  2OE3 A;  1XOA A;  1T3B A;  3LXT A;  2YV9 A;  1ML6 A;  1GLQ A;  3HD5 A;  3CQF A;  4AJ8 A;  2XHF A;  3HVS A;  1PKZ A;  3TB2 A;  1QK8 A;  4TXO A;  1B4P A;  1QGV A;  3GA4 A;  3A2X A;  4I6X A;  1XG8 A;  2LUS A;  4MF6 A;  2JU5 A;  2DSA A;  2I81 A;  3UAP A;  3E3E A;  5B8B A;  3QFA C;  4G10 A;  4GRF A;  5ECK B;  16GS A;  3KMN A;  2N5B A;  3G7J A;  4OFN A;  2XC2 A;  4XCS A;  3QCP A;  3G7Y A;  2IFQ A;  2C0F A;  3GL3 A;  2LQO A;  3D21 A;  2HSH A;  2DJ0 A;  1GTU A;  4XS6 A;  2JZS A;  2KP1 A;  4WET A;  2P0G A;  3KTB A;  1IYI A;  1ERV A;  1GSQ A;  2H1B A;  1GUM A;  4BWQ A;  4YH2 A;  4IHU A;  2HYX A;  1MDI A;  1ST9 A;  3APQ A;  2AV4 A;  4GQC A;  1CQH A;  4MCU A;  1VF3 A;  4PQI A;  4N0V A;  3ZVJ D;  2YZH A;  3F4S A;  4F03 A;  4Q5R A;  2OAD A;  3GH6 A;  2TRC P;  4JE1 A;  1TRW A;  1PSQ A;  5JCW A;  2AJQ B;  1A24 A;  1EGR A;  4ZB9 A;  2WS2 A;  4N10 A;  4K1F A;  6GSV A;  3TCO A;  1X9S B;  4ZB6 A;  5GST A;  3FEU A;  2CQ9 A;  3ZFB A;  4MPG A;  4JR6 A;  1YDK A;  2GZP A;  5J41 A;  5B6M A;  2R5G A;  3D22 A;  5F0G A;  1SL0 B;  1SD9 A;  1HNA A;  4Z7X A;  1M9B A;  1GLP A;  4DSQ A;  3KZQ A;  1Z3E A;  1G6W A;  1YZX A;  1SJZ A;  3RDW A;  1OC9 A;  2C0G A;  13GS A;  1SD8 A;  4CY6 A;  1HNB A;  3FKF A;  5G5E A;  1USB A;  4O5R A;  4BVY B;  3CSI A;  2H1G A;  4JRR A;  1BAY A;  1SEN A;  4X1U A;  4NV5 A;  3L0H A;  3LEF A;  1V98 A;  1MDJ A;  3D0Z A;  2A4V A;  3UVH A;  2R4V A;  3GRX A;  1NHO A;  2PU9 C;  5H5R A;  3WYW A;  3F4R A;  3WGE A;  5ECL B;  3C73 A;  3PGT A;  5KEJ A;  4WR5 A;  2FGX A;  3CTG A;  2DKI A;  1GTI A;  3CSH A;  3IR4 A;  5CAX A;  4ILF A;  3S9F A;  3TRQ A;  4PQ1 A;  2YV7 A;  3MIX A;  2OJL A;  5HFI A;  1DBY A;  1DSB A;  2VD1 A;  3TKS E;  3RBT A;  2DJ2 A;  2HE3 A;  5BRT A;  4GQF A;  3CMI A;  3C1R A;  1JLV A;  3P7X A;  1M99 A;  2VL3 A;  2MMO A;  4ML6 A;  1SU9 A;  4GTU A;  1VRS D;  4WKW A;  5IQY A;  1BYE A;  1S3R A;  2YWO A;  2ZNM A;  1GUK A;  5KN2 A;  5ECO B;  1Z7P A;  5GZZ B;  2LQQ A;  4TRX A;  3F6D A;  3PR8 A;  2CV4 A;  4WXT A;  4IGJ A;  4POK A;  1HD2 A;  5D96 A;  2H75 A;  1PKW A;  1WPI A;  4X0X A;  4TXO B;  4I97 A;  2HSY A;  3UAR A;  1ZMA A;  2H70 A;  2WCI A;  2M80 A;  4IP1 A;  2PGT A;  2WJU A;  2JZR A;  3VK9 A;  1ZYP A;  2O8V B;  2OE1 A;  1AXD A;  22GS A;  1KTE A;  3TKS C;  1FAA A;  3H93 A;  2IFQ B;  2I1U A;  4FH8 A;  4XTS A;  2AAW A;  2V6K A;  1ILO A;  3KGK A;  1T4Z A;  2CX4 A;  2VCV A;  3FR9 A;  1U3A A;  2YJ7 A;  4HJM A;  4HOJ A;  5G30 A;  1K0D A;  1SL2 B;  3OR5 A;  3I69 A;  3GMF A;  2NVL A;  3PIN A;  5KN1 A;  1G7E A;  1G0T A;  1X0R A;  3VWU A;  2H30 A;  1FO5 A;  2FHE A;  1SKW B;  1GSF A;  4KUN A;  2V41 A;  3MYD A;  3TJJ A;  1XWK A;  5FT3 A;  1ERU A;  5JCG A;  2JZT A;  3UVT A;  2KUC A;  4LMV A;  1PX7 A;  4L0U A;  5EL8 A;  3ZVJ A;  10GS A;  4E8E A;  3HA9 A;  1V9W A;  3C7M A;  4Z2T A;  2V6O A;  4KW6 A;  3TUE A;  2DLX A;  3EPT A;  2DMM A;  3HVV A;  4ZIL A;  5B6N A;  1B48 A;  4F9Z A;  3R2Q A;  4EO3 A;  4Q5Q A;  3O3T A;  2K18 A;  1FB6 A;  3QOU A;  5J3R A;  4LL4 B;  3HY2 A;  1AQX A;  3KP8 A;  2IJY A;  1VGL A;  1OC9 B;  1QQ2 A;  3CBU A;  5CRG A;  4P3Y B;  2LST A;  5C00 A;  2PBJ A;  1X5C A;  3CSJ A;  4D73 A;  5IO2 A;  4HU7 A;  4ULX A;  3WD6 A;  4KDU A;  3P2A A;  1YY7 A;  5ECQ B;  1GRX A;  1H75 A;  2I4A A;  3MDK A;  3KTL A;  2JSZ A;  4K5S A;  4MF7 A;  3FR3 A;  5DAL A;  4OWY A;  2LV3 A;  4K0N A;  1PRX A;  5D9T A;  2PN8 A;  4HJ2 A;  4L5L A;  3ZIV A;  2XBI A;  4WBJ A;  1J0F A;  3GYK A;  2C1Y A;  5J9C A;  5DDL A;  1FHE A;  4TR3 A;  1XZO A;  1B4Q A;  5IMA A;  3N5O A;  2R0C A;  3ZIJ A;  1G7O A;  2CT6 A;  3CRT A;  4YQV A;  4TN8 A;  3K8N A;  1OYJ A;  2H1D A;  2VM1 A;  3D5J A;  1XW9 A;  4O5Q A;  1HYU A;  5D9V A;  1X5D A;  4NXI A;  5B7C A;  1QXH A;  3HZ4 A;  4HS1 A;  2LRT A;  3V1W A;  2LJA A;  1PQN A;  2L4Q A;  5ECR B;  3C1S A;  2VCZ A;  2HRN A;  5H5S A;  1ZCP A;  3UIW A;  4DSS A;  2F8A A;  1EGO A;  2YP6 A;  1PD2 1;  5IO0 A;  1YKA A;  1TU7 A;  4O7H A;  1F9M A;  2NPB A;  2B7J A;  3Q6O A;  5J4U A;  2X64 A;  3KP9 A;  2CVD A;  3QDN A;  2YN1 A;  1TRS A;  4K2X A;  3IE3 A;  2LEG A;  3EE2 A;  1T00 A;  3GUR A;  4XHM A;  4Z2R A;  4V2N A;  2KHP A;  4KCA A;  5G1L A;  2HT9 A;  3HYP A;  2IMD A;  1O7U A;  2VLT A;  4EDY A;  1PFO A;  3L9U A;  1Z9H A;  3I43 A;  2VCT A;  2NTO A;  3PPU A;  2GS3 A;  1TXX A;  2H6Z A;  2RUE A;  4NWY A;  3P8W A;  4XIH A;  1I5G A;  3CTF A;  2GZZ A;  3IPZ A;  3LG6 A;  5A4W A;  4ZXG A;  4YQU A;  4ISD A;  4K0G A;  2B3S A;  4ECJ A;  4O32 A;  2L5O A;  2VOC A;  4MJA A;  5CNW A;  1PL2 A;  1V2A A;  2DJ3 A;  3EU4 A;  2R3X A;  3IA1 A;  3RHB A;  3EC3 A;  1SK2 A;  3HVN A;  3H8Q A;  2PVO C;  1YQ1 A;  1AQW A;  4YQM A;  1O8X A;  5IPH A;  2K6V A;  5G31 A;  2VO4 A;  3TGZ A;  3DVX A;  1XVW A;  4MK3 A;  3I6A A;  2ZCT A;  4JED A;  1LBK A;  5DAK A;  3FW2 A;  1AQV A;  2OBK A;  3VUR A;  3G7I A;  2H8L A;  3U5R E;  1OC8 A;  5AN1 A;  5L71 A;  3O6T A;  1BED A;  5HQP A;  4D73 B;  4E8H A;  2C8U A;  1ZYQ B;  4J57 E;  3F3Q A;  2YWI A;  5HR0 A;  4Q5F A;  2LNT A;  1GNE A;  2WDU A;  4KSO A;  4L8E A;  3GNJ A;  2R2J A;  4FYU A;  2B6M A;  4BVX A;  3A3T A;  4LMW A;  1F3A A;  1EOH A;  2IMI A;  5ECN B;  4PNG A;  2H01 A;  3HJP A;  5DAL B;  2IWT A;  3WT2 A;  4TR0 A;  3TOU A;  4K7N A;  3RHC A;  1XFL A;  3HCZ A;  1X5E A;  1ACV A;  2MYG A;  5ENU A;  2N5A A;  3ME8 A;  2G0F A;  5LD0 A;  1A2L A;  5IPG A;  1Z5Y E;  3IOS A;  4F0C A;  1A8L A;  3H1N A;  2FY6 A;  4IW9 A;  2A2S A;  2FA8 A;  2NBS A;  4AGS A;  2YWM A;  1EWX A;  1YF0 A;  4MH3 A;  2L57 A;  1LJR A;  1EOG A;  4RQX A;  4MH2 A;  2BJX A;  3TJB A;  3VPQ A;  3W8S A;  3ZMK A;  3GSS A;  1WRY A;  2MZC A;  1GUL A;  2B5E A;  2LNS A;  2LS5 A;  3QAW A;  4JR4 A;  2FWF A;  1AW9 A;  2WRT A;  5D8I A;  3GST A;  4KCE A;  1W89 A;  3BCK A;  5G2Z A;  4DEJ A;  4NHZ A;  2DBC A;  3ZIT A;  3GX8 A;  4PUR A;  4DSS B;  1JZR A;  2ES7 A;  1K3L A;  5GAN D;  1GSE A;  1ZZY A;  3GIX A;  4RI6 A;  3NZN A;  2CVK A;  2FNO A;  1KEB A;  2GQL A;  2WZ9 A;  4EKZ A;  1M2A A;  2O85 A;  1ABA A;  5GAP D;  1PN9 A;  1YJ6 A;  3M1G A;  1O85 A;  3ZTL A;  1PN0 A;  1THO A;  1H4O A;  1Q4J A;  2PMT A;  1TK5 B;  3US3 A;  2X4A A;  4XRA A;  1JZW A;  3NOF A;  3F8U A;  4ID0 A;  4HUA A;  3TKP A;  7GSS A;  3A2W A;  2A2R A;  1TJD A;  4I8B A;  1WP0 A;  4KE3 A;  4I2T A;  2VL9 A;  1K0N A;  9GSS A;  4CY8 A;  4KDX A;  1A2J A;  4PXO A;  2TRX A;  5ID2 A;  3IBH A;  1UC7 A;  2I3Y A;  3H79 A;  4IBP A;  1TTZ A;  4DSR A;  2IMK A;  1U6T A;  1R7H A;  2EIQ A;  5DJM A;  4RQR A;  5GSS A;  2VL2 C;  4PGT A;  3LFL A;  4FYB A;  1PX6 A;  2LJR A;  2TIR A;  1Z6M A;  2IME A;  1JZD A;  2DC5 A;  3EUR A;  4IJI A;  4MJC A;  4LA1 A;  5IMZ A;  2GT6 A;  1GTB A;  4ECC A;  4MLY A;  1I9D A;  2PUK C;  1S3D A;  3IRA A;  3HJM A;  2YPM A;  4JZQ A;  4LL1 B;  2OKA A;  1XWC A;  2YAN A;  5DAK B;  1E2Y A;  5LCZ A;  1RK4 A;  4IJ3 A;  4ZIJ A;  3KIJ A;  4QQ7 A;  2FWH A;  4TXV A;  4MZC A;  2YOI A;  1SL1 B;  4HQZ A;  1X9W B;  2VCW A;  2B1K A;  2KOK A;  1HQO A;  1A23 A;  4HDE A;  1TOF A;  5ECI B;  1XBS A;  4BVX B;  4KA0 A;  4N30 A;  1XXU A;  1BX9 A;  12GS A;  3EMP A;  3IK7 A;  5D93 A;  2VAF A;  3IHG A;  1K3O A;  3TRX A;  2CZ3 A;  1O6J A;  5JWQ B;  1YEP A;  4MNN A;  1A8Y A;  2LJK A;  5FWG A;  1WMJ A;  2G2Q A;  5JWR B;  5JWO B;  2X99 A;  1EZK A;  3M9J A;  1XVQ A;  3ME7 A;  2A4H A;  3FZA A;  1GH2 A;  1FB0 A;  4IEL A;  4JU5 A;  1O81 A;  2MMA A;  4ZL9 A;  1T1V A;  2M46 A;  3FMW A;  3UOM A;  4KGI A;  5DCH A;  1XIY A;  4ZBB A;  5IMV A;  2F9S A;  5G1K A;  1XWA A;  1GL8 A;  3ED3 A;  3J7Y b;  3VI7 A;  2H6X A;  2DML A;  1O8W A;  1MEK A;  1GSS A;  4NHW A;  4YAP A;  5IMC A;  1PMT A;  5CRH A;  4AJ7 A;  3ZRE A;  2C80 A;  2E0Q A;  2FLS A;  2YWN A;  3GKX A;  4POL A;  3EVI A;  1NHY A;  3VWV A;  5AIS A;  3TOT A;  4A5P A;  2MMZ A;  4GSS A;  3BJ5 A;  1ZL9 A;  3QAV A;  3ISO A;  2YNX A;  4XRD A;  4V1A p;  4BPY A;  2K8S A;  3IC8 A;  2HZF A;  2PWJ A;  2ON5 A;  11GS A;  4MMM A;  2O7K A;  1DE1 A;  4Z2U A;  20GS A;  1ZOF A;  2OA7 A;  2IIY A;  2WUL A;  3O76 A;  3CRU A;  1DUG A;  1M2B A;  1M9A A;  2B1L A;  1M3J A;  3EYT A;  1GNW A;  1K0M A;  4TKY A;  1K0A A;  3TKR A;  4GSN A;  4OCE A;  4FO5 A;  5ECH B;  3FR6 A;  5J9B A;  4EL1 A;  2R6K A;  2REM A;  5ID2 B;  3KM6 A;  1XCC A;  1GWC A;  2H66 A;  1AC1 A;  3LJR A;  2FWG A;  2M72 A;  1RQM A;  1TU8 A;  1J9B A;  2IPA A;  4RI7 A;  3H4K A;  3GH9 A;  3EWL A;  1NSW A;  2NDO A;  5IM9 A;  4MF5 A;  4V1A g;  1M0U A;  3ERF A;  3KH9 A;  4EVM A;  1UVZ A;  1NM3 A;  1AAZ A;  2R0P A;  3IXR A;  3QR6 A;  3RPP A;  4POM A;  1FOH A;  1WJK A;  5EY6 A;  3C8E A;  3UBK A;  1JZO A;  4HEA 2;  1F2E A;  4RUV A;  4L5O A;  1V40 A;  4IQ1 A;  4KDY A;  1UA5 A;  1MDK A;  4MA9 A;  4CW9 A;  1S3C A;  3ZZX A;  3KXO A;  4ML1 A;  3VPT A;  1R5P A;  3DRN A;  4HZ4 A;  4IKH A;  4IVF A;  4NPB A;  1T8E B;  4K6X A;  4LLR A;  5C04 A;  4G0K A;  3GKN A;  2F3M A;  2GTU A;  1T4Y A;  1GSD A;  3BOA A;  2LRC A; 
#chains in the Genus database with same CATH homology
 3WGD A;  3L78 A;  5DQY A;  2XBQ A;  1Y25 A;  4USS A;  1TDI A;  1QMV A;  1QUW A;  1S3A A;  2F51 A;  2GSS A;  3L4N A;  2VCQ A;  4N11 A;  3RAZ A;  2K8V A;  2HNL A;  1X9M B;  18GS A;  3M9K A;  3APS A;  4YKF A;  1GUH A;  1OVN A;  4EIP A;  1A0F A;  3D6I A;  1QFN A;  2DIY A;  3ZL5 A;  4Q5N A;  5ECS A;  1U87 A;  4MAB A;  4TW5 A;  4EE0 A;  2LTK A;  1THX A;  8GSS A;  1TP9 A;  2MBS A;  5F07 A;  4TOP A;  3F3R A;  4KH7 A;  4K7I A;  2H0I A;  2HZE A;  2PVQ A;  3A5I A;  4K7O A;  2P5R A;  1ZYN A;  1OKD A;  1J08 A;  4GCI A;  1EEJ A;  2QC7 A;  3MNG A;  1R4W A;  4EC0 A;  2V2G A;  2L5L A;  2OAC A;  3WGX A;  1Q98 A;  4AJ6 A;  3EMX A;  1SKS B;  2Z9S A;  2VL2 A;  5D9W A;  1V58 A;  1KNG A;  2L6C A;  1W4V A;  1ZGN A;  5CP1 A;  2LRN A;  3IHQ A;  5F8B A;  2QSI A;  5INY A;  3L9V A;  3N9J A;  3FYG A;  2V32 A;  3UEM A;  5DQS A;  2RUF A;  4POB A;  17GS A;  3I9V 2;  1F37 A;  3KD0 A;  4V2M A;  5HFK A;  5COH A;  19GS A;  1XW5 A;  3Q74 A;  1CQG A;  2IN3 A;  1SKR B;  1EEM A;  4I5Q A;  3DEX A;  5HFG A;  3JCM L;  2GVP A;  2RII A;  3KEB A;  5AIV A;  5A4V A;  2ZUP A;  4BL7 A;  3KJY A;  4MPF A;  4PTS A;  4FYC A;  5IMF A;  3DIE A;  2E7P A;  4OO5 A;  3PH9 A;  5LNK e;  5KN3 A;  3P90 A;  3GV1 A;  4PUF C;  2EIR A;  2YJH A;  4IP6 A;  4N0Z A;  4ZBA A;  3TJK A;  4PNF A;  2O89 A;  1OKT A;  4XS4 B;  5HR3 A;  2HRK A;  3TKQ A;  1XW6 A;  2C3T A;  4JBB A;  1E6B A;  4OFT A;  3LSZ A;  3MWH A;  1UN2 A;  3LGC A;  1JFU A;  4ECB A;  5A5K A;  3ZML A;  3F4T A;  1T7P B;  3TKS A;  2KP2 A;  1KBN A;  1XWB A;  4GWR A;  1YKC A;  1K3Y A;  1TKD B;  2B7K A;  3QPM A;  3M3M A;  4KND A;  4HQS A;  1R5A A;  4OO4 A;  2HRF A;  2X8C A;  2LKU A;  3BD2 A;  4TR1 A;  2HLS A;  3HJO A;  2RLI A;  4TR4 A;  4K5R A;  2B5X A;  5IIZ A;  4GXZ A;  1TRV A;  3R3E A;  3QMX A;  3F6F A;  1FG4 A;  1N2A A;  4EIQ A;  1A0R P;  4X43 A;  2H71 A;  4FQU A;  2L59 A;  3FZ9 A;  4KSM A;  3NIV A;  1OC3 A;  4K9Z A;  3FK8 A;  2GT5 A;  3J7Y k;  5J5N A;  2K9F A;  3HKR A;  2FA4 A;  1FOV A;  2JAC A;  2C4J A;  1WOU A;  1GSY A;  1C72 A;  3WT1 A;  3W8J A;  3SBC A;  4WF4 A;  4ZL7 A;  3DVW A;  2H76 A;  1AUC A;  4FIW A;  1R26 A;  4G9H A;  2L6D A;  1FW1 A;  5CYY A;  2O87 A;  2EC4 A;  3HHV A;  3IAS 2;  3GFK A;  4O5U A;  2PER A;  1GSU A;  2VIM A;  4F2I A;  2E2M A;  2HRA A;  4HU9 A;  4OFM A;  2I9H A;  3LWA A;  5A4U A;  2GZY A;  4MZW A;  2IMF A;  4IN0 A;  1V57 A;  1N8J A;  3AY8 A;  3GKM A;  2HZE B;  4IQA A;  3VFI A;  1MTC A;  2VM2 A;  2H1A A;  1YEX A;  3IC4 A;  1K0O A;  2MBT A;  2FUG 2;  3FY7 A;  2BTO T;  2GLR A;  5D9X A;  2N5F A;  5HR2 A;  2C3N A;  1WIK A;  2FD3 A;  1VF4 A;  2CVB A;  6GSX A;  3GN3 A;  4EDZ A;  1RW1 A;  2WFC A;  1B9Y C;  3IAM 2;  1TI3 A;  2B5Y A;  4WR4 A;  6GST A;  1SK1 A;  3ERW A;  4OMV A;  2AUV A;  1SJI A;  5CRD A;  1EV4 A;  5HR1 A;  1VF2 A;  1Z7R A;  3FRC A;  3HXS A;  1TK0 B;  3APO A;  1BJX A;  3IDV A;  3TJF A;  1AIU A;  1GP1 A;  2YCD A;  3LYP A;  4ICY A;  3FZ4 A;  2GGT A;  1ZYE A;  4BL7 B;  1A2M A;  4CDO A;  2C0D A;  3RPN A;  2YZU A;  2P31 A;  4GST A;  3SWL A;  1TRU A;  3LXZ A;  2RM6 A;  3G9B A;  3FZ5 A;  2DJJ A;  3M8N A;  2C3Q A;  2VLU A;  4ZBD A;  4OCF A;  1FVK A;  1PGT A;  3FHK A;  3M0F A;  2DIZ A;  1EP7 A;  4WEY A;  2OE0 A;  6GSY A;  4YKG A;  3ZFL A;  3F9U A;  3TRP A;  2DJ1 A;  3GKK A;  5ECP B;  3F0I A;  3F63 A;  4OD7 A;  1K0C A;  3D4T A;  1XPV A;  4G2E A;  1XOB A;  2WB9 A;  2L4C A;  3LW9 A;  4EUY A;  4G19 A;  4ACS A;  5KOW A;  2FWE A;  1TK8 B;  4TR1 B;  3DKS A;  4J56 E;  1M2D A;  2KLX A;  2XPD A;  1F6M C;  4O92 A;  2AB6 A;  2H72 A;  3KH7 A;  2X8H A;  2GST A;  4ZB8 A;  2HFD A;  1MD3 A;  4F82 A;  2EIO A;  3TJG A;  2A2P A;  3DD3 A;  1JLW A;  2AHE A;  5CRE A;  1WE0 A;  4EXJ A;  4NAX A;  6GSU A;  2HI7 A;  2X8G A;  4KF9 A;  3GTU A;  6GSS A;  3HZ8 A;  5FHI A;  1BG5 A;  5IOX A;  5AGY A;  1PL1 A;  1EV9 A;  3ERG A;  4GF0 A;  3W6G A;  4XS1 A;  3A5W A;  3DGQ A;  1PA3 A;  1SYX A;  4WBR D;  4PQH A;  4IS0 A;  3CYN A;  2OBI A;  2VD0 A;  4QL7 A;  2QGV A;  2PPT A;  2J9H A;  1GTA A;  2F8F A;  1EP8 A;  5CRW A;  2V1M A;  4NMU A;  4MDC A;  2H74 A;  5CO3 A;  1SYR A;  3ZYW A;  2QKE A;  4G0L A;  4GLT A;  2CZ2 A;  14GS A;  4ZL8 A;  4NV2 A;  2VLV A;  2VCX A;  2CAQ A;  2H19 A;  4XS4 A;  2P5Q A;  2JAD A;  3Q19 A;  1U3I A;  5AIX A;  3U6V A;  4KX4 A;  5F06 A;  3GX0 A;  5E4W A;  5KOX A;  5EPF A;  2CA8 A;  2H73 A;  2ON7 A;  3UL3 A;  3Q18 A;  4MZB A;  5B8A A;  4KAE A;  3KMO A;  3TDG A;  2C0E A;  2ALB A;  2BMX A;  2QA2 A;  5E59 A;  1VF1 A;  4F0B A;  2J23 A;  2DKH A;  1XWG A;  3MSZ A;  4EF0 A;  2XPE A;  1FVJ A;  1LU4 A;  3IV4 A;  3GL5 A;  4KB3 A;  2H0H A;  4ECI A;  4H86 A;  5D73 A;  5G5F A;  1K0B A;  1ON4 A;  3BBY A;  4K2D A;  2WGR A;  3HDC A;  2IL3 A;  1Z6N A;  1ERT A;  1Y6E A;  2E2G A;  2DJK A;  3DXB A;  6GSW A;  1TW9 A;  4I2U A;  5DBQ A;  5ECM B;  1ERW A;  3LQ7 A;  1G6Y A;  4BWS A;  1U88 A;  5EVO A;  1MD4 A;  3QAG A;  1HNC A;  4MJB A;  5ELG A;  3EIN A;  4YAV A;  2JSY A;  3KCM A;  3ZRD A;  3MAK A;  3E0U A;  2CX3 A;  2X49 A;  4K8M A;  3LYK A;  2RM5 A;  3VI5 A;  3LOR A;  4HZ2 A;  3ZLP A;  5KN0 A;  3UJ1 A;  5IMD A;  3GHA A;  3UBL A;  2GQM A;  3QD9 A;  1TI1 A;  3DWV A;  4DVC A;  2MMN A;  2CAI A;  2AYT A;  3C71 A;  1B8X A;  3E9J B;  5DVB A;  1JHB A;  1BQ7 A;  4AF2 A;  1SJ6 A;  1O73 A;  4BA7 A;  1YF1 A;  4PUA A;  2FCH A;  2HXK A;  3VWW A;  1NW2 A;  3A2V A;  3GUS A;  1OE8 A;  4J2F A;  4BVY A;  5DJL A;  4PX1 A;  2H0G A;  2R0G A;  2JL4 A;  5JCU A;  1WWJ A;  2HSM A;  1OE7 A;  3CXG A;  5BMU A;  2VUP A;  4WF5 A;  5F05 A;  3L9S A;  5ABR A;  3EU3 A;  3GTU B;  5DCG A;  3QFB C;  1B9X C;  2QA1 A;  3UMA A;  4G0I A;  1URM A;  1OAZ A;  2UZ8 A;  1F3B A;  4L0W A;  1M7T A;  2GDR A;  3VWX A;  4HI7 A;  4CHS A;  2R37 A;  4MJE A;  3D4M A;  2H6Y A;  1IYH A;  3VLN A;  4QL9 A;  1DE2 A;  3DYR A;  2D2Z A;  1SK0 A;  4TVE A;  3DML A;  4V2L A;  5IOW A;  5H5Q A;  3BCI A;  4MP4 A;  2GQK A;  3IK9 A;  4X4J A;  5ELA A;  2GSQ A;  2GSR A;  3HVX A;  2OE3 A;  1XOA A;  1T3B A;  3LXT A;  2YV9 A;  1ML6 A;  1GLQ A;  3HD5 A;  4AJ8 A;  2XHF A;  3HVS A;  1PKZ A;  3TB2 A;  1QK8 A;  4TXO A;  1B4P A;  1QGV A;  3GA4 A;  3A2X A;  4I6X A;  2LUS A;  4MF6 A;  2JU5 A;  2DSA A;  2I81 A;  3UAP A;  3E3E A;  5B8B A;  3QFA C;  4G10 A;  4GRF A;  5ECK B;  16GS A;  3KMN A;  2N5B A;  3G7J A;  4OFN A;  2XC2 A;  4XCS A;  3QCP A;  3G7Y A;  2IFQ A;  2C0F A;  3GL3 A;  2LQO A;  3D21 A;  2HSH A;  2DJ0 A;  1GTU A;  4XS6 A;  2JZS A;  2KP1 A;  4WET A;  2P0G A;  3KTB A;  1IYI A;  1ERV A;  1GSQ A;  2H1B A;  1GUM A;  4BWQ A;  4YH2 A;  4IHU A;  2HYX A;  1MDI A;  1ST9 A;  3APQ A;  2AV4 A;  4GQC A;  1CQH A;  4MCU A;  1VF3 A;  4PQI A;  4N0V A;  3ZVJ D;  2YZH A;  3F4S A;  4F03 A;  4Q5R A;  2OAD A;  3GH6 A;  2TRC P;  4JE1 A;  1TRW A;  1PSQ A;  5JCW A;  2AJQ B;  1A24 A;  1EGR A;  4ZB9 A;  2WS2 A;  4N10 A;  4K1F A;  6GSV A;  3TCO A;  1X9S B;  4ZB6 A;  5GST A;  3FEU A;  2CQ9 A;  3ZFB A;  4MPG A;  4JR6 A;  1YDK A;  2GZP A;  5J41 A;  5B6M A;  2R5G A;  3D22 A;  5F0G A;  1SL0 B;  1SD9 A;  1HNA A;  4Z7X A;  1M9B A;  1GLP A;  4DSQ A;  3KZQ A;  1Z3E A;  1G6W A;  1YZX A;  1SJZ A;  3RDW A;  1OC9 A;  2C0G A;  13GS A;  1SD8 A;  4CY6 A;  1HNB A;  3FKF A;  5G5E A;  1USB A;  4O5R A;  4BVY B;  3CSI A;  2H1G A;  4JRR A;  1BAY A;  1SEN A;  4X1U A;  4NV5 A;  3L0H A;  3LEF A;  1V98 A;  1MDJ A;  3D0Z A;  2A4V A;  3UVH A;  2R4V A;  3GRX A;  1NHO A;  2PU9 C;  5H5R A;  3WYW A;  3F4R A;  3WGE A;  5ECL B;  3C73 A;  3PGT A;  5KEJ A;  4WR5 A;  2FGX A;  3CTG A;  2DKI A;  1GTI A;  3CSH A;  3IR4 A;  5CAX A;  4ILF A;  3S9F A;  3TRQ A;  4PQ1 A;  2YV7 A;  3MIX A;  2OJL A;  5HFI A;  1DBY A;  1DSB A;  2VD1 A;  3TKS E;  3RBT A;  2DJ2 A;  2HE3 A;  5BRT A;  4GQF A;  3CMI A;  3C1R A;  1JLV A;  3P7X A;  1M99 A;  2VL3 A;  2MMO A;  4ML6 A;  1SU9 A;  4GTU A;  1VRS D;  4WKW A;  5IQY A;  1BYE A;  2YWO A;  2ZNM A;  1GUK A;  5KN2 A;  5ECO B;  1Z7P A;  5GZZ B;  2LQQ A;  4TRX A;  3F6D A;  3PR8 A;  2CV4 A;  4WXT A;  4IGJ A;  4POK A;  1HD2 A;  5D96 A;  2H75 A;  1PKW A;  1WPI A;  4X0X A;  4TXO B;  4I97 A;  2HSY A;  3UAR A;  1ZMA A;  2H70 A;  2WCI A;  2M80 A;  4IP1 A;  2PGT A;  2WJU A;  2JZR A;  3VK9 A;  1ZYP A;  2O8V B;  2OE1 A;  1AXD A;  22GS A;  1KTE A;  3TKS C;  1FAA A;  3H93 A;  2IFQ B;  2I1U A;  4FH8 A;  4XTS A;  2AAW A;  2V6K A;  1ILO A;  3KGK A;  1T4Z A;  2CX4 A;  2VCV A;  3FR9 A;  1U3A A;  2YJ7 A;  4HJM A;  4HOJ A;  5G30 A;  1K0D A;  1SL2 B;  3OR5 A;  3I69 A;  3GMF A;  2NVL A;  3PIN A;  5KN1 A;  1G7E A;  1G0T A;  1X0R A;  3VWU A;  2H30 A;  1FO5 A;  2FHE A;  1SKW B;  1GSF A;  4KUN A;  2V41 A;  3MYD A;  3TJJ A;  1XWK A;  5FT3 A;  1ERU A;  5JCG A;  2JZT A;  3UVT A;  2KUC A;  4LMV A;  1PX7 A;  4L0U A;  5EL8 A;  3ZVJ A;  10GS A;  4E8E A;  3HA9 A;  1V9W A;  3C7M A;  4Z2T A;  2V6O A;  4KW6 A;  3TUE A;  2DLX A;  3EPT A;  2DMM A;  3HVV A;  4ZIL A;  5B6N A;  1B48 A;  4F9Z A;  3R2Q A;  4EO3 A;  4Q5Q A;  3O3T A;  2K18 A;  1FB6 A;  3QOU A;  5J3R A;  4LL4 B;  3HY2 A;  1AQX A;  3KP8 A;  2IJY A;  1VGL A;  1OC9 B;  1QQ2 A;  3CBU A;  5CRG A;  4P3Y B;  2LST A;  5C00 A;  2PBJ A;  1X5C A;  3CSJ A;  4D73 A;  5IO2 A;  4HU7 A;  4ULX A;  3WD6 A;  4KDU A;  3P2A A;  1YY7 A;  5ECQ B;  1GRX A;  1H75 A;  2I4A A;  3MDK A;  3KTL A;  2JSZ A;  4K5S A;  4MF7 A;  3FR3 A;  5DAL A;  4OWY A;  2LV3 A;  4K0N A;  1PRX A;  5D9T A;  2PN8 A;  4HJ2 A;  4L5L A;  3ZIV A;  2XBI A;  4WBJ A;  1J0F A;  3GYK A;  2C1Y A;  5J9C A;  5DDL A;  1FHE A;  4TR3 A;  1XZO A;  1B4Q A;  5IMA A;  3N5O A;  2R0C A;  3ZIJ A;  1G7O A;  2CT6 A;  3CRT A;  4YQV A;  4TN8 A;  3K8N A;  1OYJ A;  2H1D A;  2VM1 A;  3D5J A;  1XW9 A;  4O5Q A;  1HYU A;  5D9V A;  1X5D A;  4NXI A;  5B7C A;  1QXH A;  3HZ4 A;  4HS1 A;  2LRT A;  3V1W A;  2LJA A;  1PQN A;  2L4Q A;  5ECR B;  3C1S A;  2VCZ A;  2HRN A;  5H5S A;  1ZCP A;  3UIW A;  4DSS A;  2F8A A;  1EGO A;  2YP6 A;  1PD2 1;  5IO0 A;  1YKA A;  1TU7 A;  4O7H A;  1F9M A;  2NPB A;  2B7J A;  3Q6O A;  5J4U A;  2X64 A;  3KP9 A;  2CVD A;  3QDN A;  2YN1 A;  1TRS A;  4K2X A;  3IE3 A;  2LEG A;  3EE2 A;  1T00 A;  3GUR A;  4XHM A;  4Z2R A;  4V2N A;  2KHP A;  4KCA A;  5G1L A;  2HT9 A;  3HYP A;  2IMD A;  1O7U A;  2VLT A;  4EDY A;  3L9U A;  1Z9H A;  3I43 A;  2VCT A;  2NTO A;  3PPU A;  2GS3 A;  1TXX A;  2H6Z A;  2RUE A;  4NWY A;  3P8W A;  4XIH A;  1I5G A;  3CTF A;  2GZZ A;  3IPZ A;  3LG6 A;  5A4W A;  4ZXG A;  4YQU A;  4ISD A;  4K0G A;  2B3S A;  4ECJ A;  4O32 A;  2L5O A;  2VOC A;  4MJA A;  5CNW A;  1PL2 A;  1V2A A;  2DJ3 A;  3EU4 A;  2R3X A;  3IA1 A;  3RHB A;  3EC3 A;  1SK2 A;  3H8Q A;  2PVO C;  1YQ1 A;  1AQW A;  4YQM A;  1O8X A;  5IPH A;  2K6V A;  5G31 A;  2VO4 A;  3TGZ A;  3DVX A;  1XVW A;  4MK3 A;  3I6A A;  2ZCT A;  4JED A;  1LBK A;  5DAK A;  3FW2 A;  1AQV A;  2OBK A;  3VUR A;  3G7I A;  2H8L A;  3U5R E;  1OC8 A;  5AN1 A;  5L71 A;  3O6T A;  1BED A;  5HQP A;  4D73 B;  4E8H A;  2C8U A;  1ZYQ B;  4J57 E;  3F3Q A;  2YWI A;  5HR0 A;  4Q5F A;  2LNT A;  1GNE A;  2WDU A;  4KSO A;  4L8E A;  3GNJ A;  2R2J A;  4FYU A;  2B6M A;  4BVX A;  3A3T A;  4LMW A;  1F3A A;  1EOH A;  2IMI A;  5ECN B;  4PNG A;  2H01 A;  3HJP A;  5DAL B;  2IWT A;  3WT2 A;  4TR0 A;  3TOU A;  4K7N A;  3RHC A;  1XFL A;  3HCZ A;  1X5E A;  1ACV A;  2MYG A;  5ENU A;  2N5A A;  3ME8 A;  2G0F A;  5LD0 A;  1A2L A;  5IPG A;  1Z5Y E;  3IOS A;  4F0C A;  1A8L A;  3H1N A;  2FY6 A;  4IW9 A;  2A2S A;  2FA8 A;  2NBS A;  4AGS A;  2YWM A;  1EWX A;  1YF0 A;  4MH3 A;  2L57 A;  1LJR A;  1EOG A;  4RQX A;  4MH2 A;  2BJX A;  3TJB A;  3VPQ A;  3W8S A;  3ZMK A;  3GSS A;  1WRY A;  2MZC A;  1GUL A;  2B5E A;  2LNS A;  2LS5 A;  3QAW A;  4JR4 A;  2FWF A;  1AW9 A;  2WRT A;  5D8I A;  3GST A;  4KCE A;  1W89 A;  3BCK A;  5G2Z A;  4DEJ A;  4NHZ A;  2DBC A;  3ZIT A;  3GX8 A;  4PUR A;  4DSS B;  1JZR A;  2ES7 A;  1K3L A;  5GAN D;  1GSE A;  1ZZY A;  3GIX A;  4RI6 A;  3NZN A;  2CVK A;  2FNO A;  1KEB A;  2GQL A;  2WZ9 A;  4EKZ A;  1M2A A;  2O85 A;  1ABA A;  5GAP D;  1PN9 A;  1YJ6 A;  3M1G A;  1O85 A;  3ZTL A;  1PN0 A;  1THO A;  1H4O A;  1Q4J A;  2PMT A;  1TK5 B;  3US3 A;  2X4A A;  4XRA A;  1JZW A;  3NOF A;  3F8U A;  4ID0 A;  4HUA A;  3TKP A;  7GSS A;  3A2W A;  2A2R A;  1TJD A;  4I8B A;  1WP0 A;  4KE3 A;  4I2T A;  2VL9 A;  1K0N A;  9GSS A;  4CY8 A;  4KDX A;  1A2J A;  4PXO A;  2TRX A;  5ID2 A;  3IBH A;  1UC7 A;  2I3Y A;  3H79 A;  4IBP A;  1TTZ A;  4DSR A;  2IMK A;  1U6T A;  1R7H A;  2EIQ A;  5DJM A;  4RQR A;  5GSS A;  2VL2 C;  4PGT A;  3LFL A;  4FYB A;  1PX6 A;  2LJR A;  2TIR A;  1Z6M A;  2IME A;  1JZD A;  2DC5 A;  3EUR A;  4IJI A;  4MJC A;  4LA1 A;  5IMZ A;  2GT6 A;  1GTB A;  4ECC A;  4MLY A;  1I9D A;  2PUK C;  1S3D A;  3IRA A;  3HJM A;  2YPM A;  4JZQ A;  4LL1 B;  2OKA A;  1XWC A;  2YAN A;  5DAK B;  1E2Y A;  5LCZ A;  1RK4 A;  4IJ3 A;  4ZIJ A;  3KIJ A;  4QQ7 A;  2FWH A;  4TXV A;  4MZC A;  2YOI A;  1SL1 B;  4HQZ A;  1X9W B;  2VCW A;  2B1K A;  2KOK A;  1HQO A;  1A23 A;  4HDE A;  1TOF A;  5ECI B;  1XBS A;  4BVX B;  4KA0 A;  4N30 A;  1XXU A;  1BX9 A;  12GS A;  3EMP A;  3IK7 A;  5D93 A;  2VAF A;  3IHG A;  1K3O A;  3TRX A;  2CZ3 A;  1O6J A;  5JWQ B;  1YEP A;  4MNN A;  1A8Y A;  2LJK A;  5FWG A;  1WMJ A;  2G2Q A;  5JWR B;  5JWO B;  2X99 A;  1EZK A;  3M9J A;  1XVQ A;  3ME7 A;  2A4H A;  3FZA A;  1GH2 A;  1FB0 A;  4IEL A;  4JU5 A;  1O81 A;  2MMA A;  4ZL9 A;  1T1V A;  2M46 A;  3FMW A;  3UOM A;  4KGI A;  5DCH A;  1XIY A;  4ZBB A;  5IMV A;  2F9S A;  5G1K A;  1XWA A;  1GL8 A;  3ED3 A;  3J7Y b;  3VI7 A;  2H6X A;  2DML A;  1O8W A;  1MEK A;  1GSS A;  4NHW A;  4YAP A;  5IMC A;  1PMT A;  5CRH A;  4AJ7 A;  3ZRE A;  2C80 A;  2E0Q A;  2FLS A;  2YWN A;  3GKX A;  4POL A;  3EVI A;  1NHY A;  3VWV A;  5AIS A;  3TOT A;  4A5P A;  2MMZ A;  4GSS A;  3BJ5 A;  1ZL9 A;  3QAV A;  3ISO A;  2YNX A;  4XRD A;  4V1A p;  4BPY A;  2K8S A;  3IC8 A;  2HZF A;  2PWJ A;  2ON5 A;  11GS A;  4MMM A;  2O7K A;  1DE1 A;  4Z2U A;  20GS A;  1ZOF A;  2OA7 A;  2IIY A;  2WUL A;  3O76 A;  3CRU A;  1DUG A;  1M2B A;  1M9A A;  2B1L A;  3EYT A;  1GNW A;  1K0M A;  4TKY A;  1K0A A;  3TKR A;  4GSN A;  4OCE A;  4FO5 A;  5ECH B;  3FR6 A;  5J9B A;  4EL1 A;  2R6K A;  2REM A;  5ID2 B;  3KM6 A;  1XCC A;  1GWC A;  2H66 A;  1AC1 A;  3LJR A;  2FWG A;  2M72 A;  1RQM A;  1TU8 A;  1J9B A;  2IPA A;  4RI7 A;  3H4K A;  3GH9 A;  3EWL A;  1NSW A;  2NDO A;  5IM9 A;  4MF5 A;  4V1A g;  1M0U A;  3ERF A;  3KH9 A;  4EVM A;  1UVZ A;  1NM3 A;  1AAZ A;  2R0P A;  3IXR A;  3QR6 A;  3RPP A;  4POM A;  1FOH A;  1WJK A;  5EY6 A;  3C8E A;  3UBK A;  1JZO A;  4HEA 2;  1F2E A;  4RUV A;  4L5O A;  1V40 A;  4IQ1 A;  4KDY A;  1UA5 A;  1MDK A;  4MA9 A;  4CW9 A;  1S3C A;  3ZZX A;  3KXO A;  4ML1 A;  3VPT A;  1R5P A;  3DRN A;  4HZ4 A;  4IKH A;  4IVF A;  4NPB A;  1T8E B;  4K6X A;  4LLR A;  5C04 A;  4G0K A;  3GKN A;  2F3M A;  2GTU A;  1T4Y A;  1GSD A;  3BOA A;  2LRC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...