3HDCA

The crystal structure of thioredoxin protein from geobacter metallireducens
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
150
structure length
150
Chain Sequence
b'SLAPGKAESDAPLVRTGALAPNFKLPTLSGENKSLAQYRGKIVLVNFWASWCPYCRDEMPSMDRLVKSFPKGDLVVLAVNVEKRFPEKYRRAPVSFNFLSDATGQVQQRYGANRLPDTFIVDRKGIIRQRVTGGIEWDAPKVVSYLKSLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thioredoxin family protein
publication title The crystal structure of thioredoxin protein from Geobacter metallireducens
rcsb
source organism Geobacter metallireducens gs-15
molecule tags Oxidoreductase
total genus 38
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2009-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3hdcA01
3QPMA 2IMDA 1QFNA 5CRDA 4ISDA 3VK9A 3KZQA 1OC9A 4Q5RA 3GUSA 2VM2A 4YQUA 2XC2A 3ERWA 5ECOB 5IMDA 4ZL7A 1SL1B 1X5CA 4KGIA 3F9UA 4MK3A 4HQZA 3UJ1A 2P0GA 3EU3A 8GSSA 1GTUA 3M9JA 2GVPA 1XZOA 3O76A 1QGVA 3FR9A 2YZHA 4TN8A 3KH7A 4OO5A 1S3AA 5IO0A 5F8BA 1VF1A 5LNKe 3R2QA 4MF7A 4MF6A 4K1FA 1SK1A 1YY7A 3UVTA 3HCZA 3HY2A 5IMCA 2IN3A 4MJCA 1XW6A 2VLVA 2DJKA 2PMTA 2L5LA 1A2JA 2IIYA 1A2MA 4J57E 3C73A 1J9BA 1K0DA 2AUVA 2OE3A 1YF1A 1R5PA 1OKTA 2H71A 2H6XA 1MDKA 4MP4A 1YF0A 1Z7PA 3UL3A 1EZKA 4PQHA 1BX9A 2F8AA 4OO4A 4HJ2A 5CYYA 4WKWA 4TR0A 2KP2A 4FYUA 1GP1A 2A2RA 3KMOA 1GSUA 1SKWB 2HT9A 2H1BA 1J08A 1V58A 2P5QA 3LQ7A 16GSA 4FO5A 5G1LA 3GKXA 1JZDA 1SK2A 3A2VA 5IQYA 2JL4A 1HNAA 3APOA 3TGZA 3P2AA 1A0FA 3UARA 2GT5A 4KE3A 1THXA 3GV1A 2O8VB 3GX8A 4IP1A 4JZQA 4KA0A 1I9DA 3Q19A 2H1DA 2DIYA 4HU9A 4PQIA 3ZFLA 1BJXA 5HR0A 1GSSA 2GSQA 3F4RA 1RK4A 2C1YA 2GSRA 5L71A 3EINA 5DALB 3GYKA 2RLIA 4HS1A 2L5OA 3KTLA 4KUNA 4I2TA 5ENUA 2LRNA 1GSFA 5DVBA 2OE0A 4XRAA 3F3RA 3CTGA 3DVXA 4TR4A 4K0NA 1U3AA 7GSSA 3UIWA 3WGXA 4HU7A 4IN0A 1TTZA 2LJKA 3DGQA 1B4QA 4XCSA 5DAKA 2H6YA 1SD9A 3VI7A 3U5RE 1O85A 4NHZA 2YP6A 1T00A 2V6KA 4V2NA 2HXKA 1XW5A 2R6KA 2GLRA 2DJ2A 5KN3A 4KSMA 1PL1A 3Q18A 3KJYA 3EWLA 2GS3A 1EEJA 5ID2A 2PBJA 3M1GA 2CT6A 4MCUA 4GF0A 3MWHA 2DSAA 2ES7A 2JSYA 4JEDA 4Q5FA 4EF0A 1BAYA 2YNXA 1ML6A 2RUEA 4ZXGA 4WXTA 4K9ZA 2XPDA 3IBHA 1WRYA 3TUEA 3FZAA 4IVFA 2H0HA 3DWVA 4IKHA 2VCVA 1VF4A 1S3CA 4L5OA 3ZYWA 4OFTA 1Z6MA 1MDJA 3I43A 2V41A 2DMLA 5HFGA 4X1UA 2GGTA 1OC9B 4WR5A 1ACVA 3TCOA 4RI6A 4L0UA 2RM5A 2PWJA 2YWIA 2HNLA 4POLA 5ECSA 4EXJA 1T3BA 3L9VA 3FZ5A 4JRRA 4GTUA 1GSQA 4HEA2 3W8JA 4MDCA 2QC7A 1XWCA 1K3OA 5DCGA 2MYGA 3UEMA 2NVLA 3M8NA 4NV5A 1B9XC 2KP1A 3IOSA 3H8QA 3NIVA 1XVQA 3C1SA 1SJZA 1SYXA 3DMLA 4O5RA 4HOJA 4ECCA 4ECJA 1N8JA 4O92A 5JWOB 1FOVA 1EOGA 2YV7A 2DJ1A 3HD5A 5GSTA 4GQFA 2C8UA 3QFAC 2E0QA 1O81A 2B1KA 5GZZB 3G7JA 1V57A 5CRHA 4N11A 2GTUA 3GH6A 2IMEA 5DJMA 1CQHA 2B5XA 4NHWA 1SU9A 1AUCA 2FLSA 3LSZA 5ECMB 5D9VA 5D9WA 4ZB8A 1N2AA 2KUCA 3F6FA 1GULA 5KN1A 4MLYA 2TIRA 1QK8A 1B4PA 4MZCA 3KP9A 3TKSC 1K0BA 3VURA 3TKQA 1QXHA 4YQVA 4OFMA 4O7HA 3G7IA 3IRAA 5EPFA 5IPHA 3HZ4A 1C72A 3M0FA 5CNWA 3SBCA 1TRWA 4LLRA 4HI7A 4N30A 1X5DA 2H70A 4IJIA 1OE7A 4D73A 1OAZA 4XTSA 4KSOA 4F2IA 3RHBA 5D8IA 4OFNA 4K7OA 2QSIA 2LRTA 4QL9A 3ME8A 5ELAA 3CSIA 3GH9A 3UBLA 4H86A 4RQXA 1M99A 2L4QA 1K0OA 1XWKA 5DAKB 2BJXA 14GSA 2JACA 4BL7A 2B6MA 5JWRB 1EEMA 1AQWA 5IO2A 1M9BA 4XRDA 4ZB9A 1H4OA 2J23A 5IIZA 1BG5A 1G7EA 3GL3A 2ALBA 5IMZA 1FHEA 3EYTA 4GWRA 5AGYA 2MBTA 1TDIA 5G1KA 2WGRA 4XS4A 1TXXA 4RQRA 1G0TA 5DALA 5E59A 1SENA 3HJOA 1WWJA 5ECIB 1DSBA 4NMUA 2MMNA 3G9BA 1O73A 3NOFA 4QQ7A 4L0WA 4LMWA 5D93A 3FEUA 2FA4A 3CMIA 1V9WA 5B8AA 2PVQA 1AQVA 3VWXA 1X9SB 5B7CA 5J5NA 2V2GA 4KW6A 3U6VA 4AGSA 5IMAA 4DSRA 2H1AA 4CDOA 1HD2A 5EL8A 5CRGA 5IM9A 4J2FA 4I5QA 4ZL9A 3HXSA 3HA9A 3HDCA 2PVOC 3LJRA 2P5RA 1QUWA 1GRXA 2EIRA 3QFBC 4KCEA 1OVNA 3LEFA 6GSUA 1GWCA 2VLTA 2C0FA 2DLXA 4KCAA 3IDVA 5AIVA 3J7Yk 1H75A 5D73A 3DRNA 3ZIJA 2QKEA 1GTBA 1F37A 1OKDA 4HQSA 2VOCA 2OE1A 5AN1A 1ON4A 2HE3A 1TK5B 3HYPA 4G2EA 2C3QA 5G5FA 4IS0A 1PD21 3LFLA 5ECKB 2YWOA 5D9TA 4YQMA 3LGCA 3QAVA 4YH2A 1GSYA 2A2SA 1OC3A 2F8FA 2IFQA 3EMXA 1OYJA 2H66A 3M9KA 1GTIA 1MEKA 3DYRA 1TI3A 1S3DA 5LD0A 1SKRB 3TRPA 2VCZA 5D9XA 3GSTA 1ZYQB 3FZ4A 4TVEA 4KX4A 1PKZA 3CSHA 2ZUPA 3HJPA 3L78A 1EP8A 1O8WA 2VAFA 2JU5A 4WBRD 3GIXA 3Q6OA 1B8XA 3I9V2 2TRXA 4TXVA 3FRCA 4POBA 3TOUA 2H76A 3IK7A 4G9HA 1EGRA 1JHBA 4BVXA 1DE1A 3TKSA 5HFIA 3HVVA 2LQOA 3US3A 3ED3A 2R2JA 3D5JA 3GKNA 1K3LA 3H4KA 1ST9A 4ZILA 1K0CA 1XOAA 3QAGA 3IPZA 6GSVA 2R3XA 2VCQA 2XPEA 1YQ1A 2H74A 4D73B 2N5AA 4X0XA 4HJMA 4JR6A 2M80A 5A4VA 2RM6A 1DE2A 4IW9A 1F2EA 1M2BA 3QMXA 4IP6A 2VD0A 2X64A 4GSNA 5G2ZA 5FWGA 1Z7RA 4IELA 1PQNA 1ZGNA 2OACA 2IL3A 3ZFBA 5HFKA 1I5GA 3GKMA 3ZIVA 5F06A 2K8VA 4EDYA 4EKZA 2LUSA 4NPBA 1T1VA 2KLXA 2XBQA 1LBKA 1B48A 2LRCA 4FH8A 2L59A 1BYEA 3UAPA 4HZ4A 1URMA 2AV4A 1K0AA 4ML1A 4DSSB 1HNBA 22GSA 2EIOA 2NPBA 2C0DA 3UOMA 4K6XA 4CHSA 1PX6A 4FYBA 3VWWA 4AJ6A 1SJ6A 3LWAA 3LYPA 2RUFA 1AQXA 3N9JA 1PN9A 2L57A 6GSXA 4MF5A 2VL9A 4TW5A 4NWYA 2DJ3A 3FW2A 2X8HA 1GNEA 4XS4B 2H1GA 2AJQB 2H30A 5H5SA 1ERWA 2O87A 3TJGA 6GSSA 4EE0A 4I97A 3ZL5A 3PR8A 5IOWA 1Z3EA 2CX3A 3ERGA 3EMPA 3OR5A 1AXDA 4G19A 1G7OA 1T7PB 1PGTA 3FZ9A 2LTKA 5ECHB 2C0GA 2REMA 3LYKA 3RPPA 2H75A 5DCHA 2IJYA 2FWHA 3VFIA 2X99A 1JFUA 1NSWA 1XOBA 2YJHA 3IC4A 3ZTLA 2GQKA 5ECQB 3RBTA 2H0IA 5ELGA 1F6MC 4V2MA 4POKA 1NHOA 1FVKA 2K9FA 3D21A 3BD2A 3D22A 2WZ9A 1KTEA 3GURA 3ZVJD 2FNOA 4DVCA 1YZXA 4P3YB 1DUGA 1JLWA 5G31A 2DC5A 4MPFA 1B9YC 4IBPA 1WIKA 4HUAA 1MD3A 5H5RA 4MJAA 3F0IA 2VCWA 1TU7A 2LQQA 4V2LA 3IA1A 2IFQB 4EUYA 5ECLB 2YOIA 1G6YA 2JADA 2IPAA 1F3AA 1SYRA 3M3MA 3C8EA 3TKPA 3UVHA 5KEJA 1PX7A 5HR1A 4GXZA 1TRSA 3G7YA 3N5OA 1HQOA 1YKCA 3WGEA 2I3YA 5AISA 1SL0B 1PKWA 4TR1B 3F6DA 2B7JA 2H0GA 3ZRDA 4E8HA 4LL1B 3HVSA 4E8EA 4ECBA 10GSA 1JZRA 2VCTA 1FG4A 2I4AA 4ML6A 2V32A 1THOA 1UC7A 1Y25A 2X8GA 2VL2C 4L8EA 5J41A 2LSTA 3ME7A 3RAZA 2P31A 5B8BA 2MMOA 3VI5A 2AYTA 1RW1A 4K2DA 2B1LA 3KTBA 1GUKA 2PERA 4QL7A 4F0CA 2WDUA 1ZYEA 1Q4JA 2YJ7A 4F9ZA 1SK0A 3F4TA 9GSSA 3DD3A 3SWLA 2R5GA 4JE1A 4RI7A 3CRTA 4WEYA 4F82A 2FUG2 4G10A 5DQSA 2CAQA 4X43A 1VF2A 2E2MA 1NW2A 2K18A 2KOKA 2O89A 6GSWA 3VPTA 1OC8A 3D4MA 5KN0A 3H1NA 1WOUA 3TKSE 1A0RP 2PPTA 3WT2A 4K7IA 5IMFA 1V40A 4MH3A 4WF5A 3FHKA 2JSZA 3GNJA 2PN8A 1EWXA 1GLPA 3VLNA 2O7KA 2MMAA 4NXIA 4GRFA 17GSA 1E2YA 1XWGA 2C3TA 3CTFA 5A4WA 4L5LA 1R5AA 1YEPA 3P8WA 1YKAA 1AIUA 3A3TA 2M72A 4K8MA 2R4VA 1ZL9A 5C04A 3RHCA 2TRCP 2CA8A 1UN2A 4WF4A 3E0UA 2BMXA 1YEXA 3BCKA 3KH9A 1Z6NA 4AJ7A 1WPIA 4ZBBA 1M2DA 1TOFA 4ULXA 2CZ3A 3EE2A 4JR4A 2JZRA 4ILFA 4DSSA 2G2QA 3F8UA 3FYGA 4KAEA 3W6GA 2CV4A 2L6CA 4TOPA 1YDKA 1E6BA 3EC3A 4HZ2A 3PGTA 2CQ9A 4WBJA 1ABAA 1GUHA 5D96A 3FR3A 3RPNA 2DJ0A 2GZYA 5CP1A 4BWSA 1VF3A 4PX1A 1XWBA 2GSSA 3TJBA 2FA8A 3DVWA 2OADA 3DEXA 2N5FA 4TXOB 1IYHA 2MZCA 3F63A 2E7PA 5J9CA 3GSSA 1YJ6A 4DEJA 1QQ2A 4BA7A 3IHQA 3MSZA 3BBYA 2CX4A 1HNCA 2CVBA 3D4TA 3L9SA 4I6XA 1AW9A 1O8XA 1M2AA 1FVJA 2GZPA 3KMNA 3H93A 4N10A 5CO3A 1K0MA 2ZNMA 1AAZA 2VCXA 1KNGA 3ZITA 1V2AA 2BTOT 2HLSA 2OJLA 2PUKC 2V1MA 1W89A 3O6TA 1U87A 3TRQA 4MJEA 3QOUA 1M9AA 2H6ZA 1GH2A 1XCCA 4K0GA 2HSHA 3CRUA 1VGLA 2XHFA 3HJMA 2VL2A 2FY6A 2F3MA 4ECIA 3S9FA 1ERUA 3CBUA 4N0ZA 1U6TA 3GA4A 4BPYA 2WRTA 3GL5A 1HYUA 5HR3A 2I81A 2HYXA 2H73A 3ZLPA 4XS1A 1M0UA 3EVIA 5DDLA 4KB3A 1Y6EA 4NAXA 2GZZA 3QCPA 2GDRA 4XHMA 3HVXA 2AHEA 4OD7A 1GTAA 2DIZA 2YWNA 5LCZA 1R4WA 2WFCA 5J9BA 1PRXA 4TR1A 3JCML 3I6AA 1EV9A 2IMKA 2IWTA 3A2WA 5A4UA 2WULA 4LA1A 1O6JA 5KN2A 3QD9A 5ECPB 3PINA 4F03A 2XBIA 1XIYA 3LXZA 4KDUA 2B5EA 1TRUA 3LG6A 3ERFA 2K6VA 2LKUA 3IAM2 1NM3A 2VO4A 2LEGA 3QAWA 6GSYA 3C7MA 5IOXA 3ZMKA 2IMIA 3L9UA 2YPMA 3A5WA 3QR6A 2WS2A 1FAAA 3TJJA 5F07A 5F05A 3IR4A 1XFLA 3D0ZA 2K8SA 2G0FA 1TJDA 1PL2A 3QDNA 1GLQA 2HI7A 20GSA 3TOTA 3GRXA 4Z7XA 1ERVA 2H72A 1TU8A 4MABA 1W4VA 1JLVA 1SKSB 3ZREA 4KH7A 2A4VA 5J3RA 2HZEB 1BQ7A 5DQYA 2NTOA 2N5BA 2FWGA 1QMVA 4LMVA 1WMJA 5EVOA 1JZOA 3FKFA 4NV2A 1V98A 2I9HA 4F0BA 2WB9A 3KGKA 5JWQB 1GUMA 1XW9A 1KBNA 4JU5A 2GQLA 4EL1A 5C00A 2GQMA 3WD6A 2YCDA 2EIQA 2NDOA 1FW1A 1PMTA 2H19A 3KCMA 4YAPA 4XIHA 1X9WB 1A8YA 2FD3A 5A5KA 2B5YA 2LNSA 4OMVA 1R7HA 1TP9A 1GSDA 3IE3A 4V1Ag 4ZBDA 4I2UA 2F51A 1JZWA 3GTUB 2B3SA 3GN3A 2C80A 3KM6A 2LS5A 1SJIA 4PGTA 4IHUA 3F4SA 3CYNA 3C1RA 3FR6A 1MDIA 3EURA 1EV4A 2KHPA 4ID0A 2FCHA 5INYA 2CVDA 2YZUA 5B6NA 2WJUA 3GX0A 4TXOA 4CW9A 2LJRA 1VRSD 3WGDA 4MMMA 3VPQA 5JCUA 2OBIA 1U3IA 1A2LA 3HKRA 4OCEA 4GCIA 2B7KA 4K7NA 1PSQA 3TRXA 5H5QA 4HDEA 3I69A 1SL2B 5F0GA 4PNGA 2PU9C 4IJ3A 3IXRA 4OCFA 3WYWA 2R37A 3P90A 4TR3A 2ON5A 5CAXA 1OE8A 1ZCPA 3CSJA 1TK0B 2DMMA 4V1Ap 2F9SA 2C4JA 3IAS2 4N0VA 3Q74A 4GSSA 3ZVJA 1XVWA 1ZMAA 3GMFA 4PUAA 3IV4A 4Q5NA 1Z9HA 3C71A 5B6MA 3PH9A 2CAIA 4POMA 5GSSA 1IYIA 4OWYA 3GHAA 3D6IA 1Q98A 18GSA 2IMFA 4I8BA 5HQPA 2VIMA 4TKYA 5AIXA 5FT3A 2Z9SA 4RUVA 5GAND 4EVMA 2ZCTA 2MBSA 1EOHA 4EO3A 5JCGA 2HFDA 1TKDB 1MD4A 13GSA 1Z5YE 1ZZYA 3WT1A 4MH2A 4FIWA 3BOAA 1A23A 4XS6A 3W8SA 3TJFA 4KDXA 1NHYA 2VUPA 2VD1A 1XBSA 2VLUA 4MJBA 4EC0A 1O7UA 2JZTA 3HHVA 3EU4A 5CREA 3F3QA 6GSTA 1UA5A 1R26A 3UBKA 3L4NA 1X9MB 3CXGA 1FO5A 5IMVA 2C0EA 1LJRA 1ERTA 4BWQA 4WETA 1PA3A 3TB2A 5ABRA 1T8EB 1XPVA 1T4ZA 5ECNB 2JZSA 2QGVA 3HZ8A 4MZBA 1G6WA 2M46A 1T4YA 3GFKA 2CVKA 4AF2A 4MPGA 5G5EA 4MZWA 1X5EA 3TKRA 2YANA 1USBA 1AC1A 1XXUA 2LNTA 3APSA 3KXOA 2ON7A 4GLTA 1GL8A 4IQAA 5JCWA 1EGOA 4ZB6A 2J9HA 3E3EA 4ZL8A 3FK8A 2MMZA 1KEBA 4IQ1A 3MAKA 3UMAA 2L4CA 3J7Yb 4DSQA 3E9JB 1K3YA 1XWAA 2EC4A 1TW9A 4WR4A 1TI1A 4JBBA 3NZNA 4ZBAA 2VL3A 1F3BA 3O3TA 1X0RA 2DBCA 4AJ8A 5EY6A 2DJJA 4PQ1A 4PXOA 3DIEA 4EDZA 1GNWA 1TK8B 2FHEA 1SD8A 1WJKA 4GQCA 2CZ2A 1CQGA 1K0NA 3V1WA 3KP8A 2YN1A 3KEBA 2WCIA 2HZEA 3TJKA 4Q5QA 2FWEA 1UVZA 3VWUA 5DJLA 3RDWA 5ECRB 1ILOA 5COHA 1FB6A 3DKSA 3IK9A 2OA7A 4ZIJA 2GT6A 2E2GA 3ZZXA 4MA9A 4LL4B 1GSEA 2HRFA 3L0HA 1WP0A 1BEDA 5ID2B 1LU4A 2VM1A 5E4WA 4O32A 1TRVA 2FGXA 2I1UA 3FY7A 19GSA 4FYCA 1DBYA 1F9MA 3BCIA 1RQMA 2GSTA 2HRNA 2L6DA 2O85A 5J4UA 3GKKA 4BVYA 2HSYA 5DBQA 2AAWA 1A8LA 2HZFA 3GTUA 3ZMLA 1FB0A 3BJ5A 2OBKA 4PURA 2H01A 2H8LA 2X8CA 2V6OA 4GSTA 3DXBA 5HR2A 3MDKA 1WE0A 1U88A 3AY8A 3K8NA 3H79A 2RIIA 1A24A 2NBSA 3VWVA 3LORA 2FWFA 5G30A 1ZOFA 2LJAA 4KDYA 3LXTA 5FHIA 3P7XA 3TDGA 2OKAA 1MTCA 4J56E 12GSA 4IGJA 3APQA 3KD0A 4YAVA 1J0FA 2PGTA 4PNFA 5CRWA 4PUFC 1EP7A 2D2ZA 5GAPD 3MNGA 4KNDA 3ISOA 4TRXA 4ACSA 5IPGA 2YWMA 2YV9A 2C3NA 2LV3A 2AB6A 3KIJA 1M7TA 3A2XA 11GSA
chains in the Genus database with same CATH superfamily
3QPMA 2IMDA 1QFNA 5CRDA 4ISDA 3VK9A 3KZQA 1OC9A 4Q5RA 3GUSA 2VM2A 4YQUA 2XC2A 3ERWA 5ECOB 5IMDA 4ZL7A 1SL1B 1X5CA 4KGIA 3F9UA 4MK3A 4HQZA 3UJ1A 2P0GA 3EU3A 8GSSA 1GTUA 3M9JA 2GVPA 1XZOA 3O76A 1QGVA 3FR9A 2YZHA 5BMUA 4TN8A 3KH7A 4OO5A 1S3AA 5IO0A 5F8BA 1VF1A 5LNKe 3R2QA 4MF7A 4MF6A 4K1FA 1SK1A 1YY7A 3UVTA 3HCZA 3HY2A 5IMCA 2IN3A 4MJCA 1XW6A 2VLVA 2DJKA 2PMTA 2L5LA 1A2JA 2IIYA 1A2MA 4J57E 3A5IA 3C73A 1J9BA 1K0DA 2AUVA 2OE3A 1YF1A 1R5PA 1OKTA 1M3IA 2H71A 2H6XA 1MDKA 4MP4A 1YF0A 1Z7PA 3UL3A 1EZKA 4PQHA 1BX9A 2F8AA 4OO4A 4HJ2A 5CYYA 4WKWA 4TR0A 2KP2A 4FYUA 1GP1A 1PN0A 5BRTA 2A2RA 3KMOA 1GSUA 1SKWB 2HT9A 2H1BA 1J08A 1V58A 4Z2TA 2P5QA 3LQ7A 4HSCX 16GSA 4FO5A 5G1LA 3GKXA 1JZDA 1SK2A 3A2VA 5IQYA 2JL4A 1HNAA 4BL7B 3APOA 3TGZA 3P2AA 1A0FA 3IC8A 3UARA 2GT5A 4KE3A 1THXA 3GV1A 4Z2UA 2O8VB 3GX8A 4IP1A 4JZQA 4KA0A 1I9DA 3Q19A 2H1DA 2DIYA 4HU9A 4PQIA 3ZFLA 1BJXA 5HR0A 1GSSA 2GSQA 3F4RA 1RK4A 2C1YA 2GSRA 5L71A 3EINA 5DALB 3GYKA 4BVYB 2RLIA 4HS1A 2L5OA 3KTLA 4KUNA 4I2TA 5ENUA 2LRNA 1GSFA 5DVBA 2OE0A 4XRAA 3F3RA 3CTGA 3DVXA 4TR4A 4K0NA 1U3AA 7GSSA 3UIWA 3WGXA 4HU7A 4IN0A 1TTZA 2HRAA 2LJKA 3DGQA 1PFOA 1B4QA 4XCSA 5DAKA 2H6YA 1SD9A 3VI7A 3U5RE 1O85A 4NHZA 2YP6A 1T00A 2V6KA 4V2NA 2HXKA 1XW5A 2R6KA 2GLRA 2DJ2A 5KN3A 4KSMA 1PL1A 3Q18A 4G0IA 3KJYA 3EWLA 2GS3A 1EEJA 5ID2A 2PBJA 3M1GA 2CT6A 4MCUA 4GF0A 3MWHA 2DSAA 2ES7A 2JSYA 4JEDA 4Q5FA 4EF0A 1BAYA 2YNXA 1ML6A 2RUEA 4ZXGA 3CQFA 4WXTA 4K9ZA 2XPDA 3IBHA 1WRYA 3TUEA 3FZAA 4IVFA 2H0HA 3DWVA 4IKHA 2VCVA 1VF4A 1S3CA 4L5OA 3ZYWA 4OFTA 1Z6MA 3IHGA 1MDJA 3I43A 2V41A 2DMLA 5HFGA 4X1UA 2GGTA 1OC9B 4WR5A 1ACVA 4K2XA 3TCOA 4RI6A 4L0UA 2RM5A 2PWJA 2YWIA 2HNLA 4POLA 5ECSA 4EXJA 1T3BA 3L9VA 3FZ5A 4Z2RA 4JRRA 4GTUA 1GSQA 4HEA2 3W8JA 4MDCA 2QC7A 1XWCA 1K3OA 5DCGA 2MYGA 3UEMA 2NVLA 3M8NA 4NV5A 1B9XC 2KP1A 4YKGA 1M3JA 3IOSA 3H8QA 3NIVA 1XVQA 2HSMA 3C1SA 1SJZA 1SYXA 3DMLA 4O5RA 4HOJA 4ECCA 4ECJA 1N8JA 4O92A 5JWOB 1FOVA 1EOGA 2YV7A 2DJ1A 3HD5A 5GSTA 4GQFA 2C8UA 3QFAC 2E0QA 1O81A 2B1KA 5GZZB 3G7JA 1V57A 5CRHA 4N11A 2GTUA 3GH6A 2IMEA 5DJMA 1CQHA 2B5XA 4NHWA 1SU9A 1AUCA 2FLSA 2DKHA 3LSZA 5ECMB 5D9VA 5D9WA 4ZB8A 1N2AA 2KUCA 3F6FA 1GULA 5KN1A 4MLYA 2TIRA 1QK8A 1B4PA 4MZCA 3KP9A 4K5RA 3TKSC 1K0BA 3VURA 3TKQA 1QXHA 4YQVA 4OFMA 4O7HA 4BIKA 3G7IA 3IRAA 5EPFA 5IPHA 3HZ4A 1C72A 3M0FA 5CNWA 3SBCA 1TRWA 4LLRA 4HI7A 4N30A 1X5DA 2H70A 4IJIA 1OE7A 4D73A 1OAZA 4XTSA 4KSOA 4F2IA 3RHBA 5D8IA 4OFNA 4K7OA 2QSIA 2LRTA 4QL9A 1ZYNA 3ME8A 5ELAA 3CSIA 3GH9A 3UBLA 4H86A 4RQXA 1M99A 2L4QA 1K0OA 1XWKA 5DAKB 2X4AA 2BJXA 14GSA 2JACA 4BL7A 2B6MA 5JWRB 1EEMA 1AQWA 5IO2A 1M9BA 4XRDA 4ZB9A 1H4OA 2J23A 5IIZA 1BG5A 1G7EA 3GL3A 2ALBA 5IMZA 1FHEA 3EYTA 4GWRA 5AGYA 2MBTA 4CY6A 1TDIA 5G1KA 2WGRA 4XS4A 1TXXA 4RQRA 1G0TA 5DALA 5E59A 1SENA 3HJOA 1WWJA 5ECIB 1DSBA 4NMUA 2MMNA 3G9BA 1O73A 3NOFA 4QQ7A 4L0WA 4LMWA 5D93A 3FEUA 2FA4A 3CMIA 1V9WA 5B8AA 2PVQA 1AQVA 3VWXA 1X9SB 5B7CA 5J5NA 2V2GA 4KW6A 3U6VA 4AGSA 5IMAA 4DSRA 2H1AA 4CDOA 1HD2A 5EL8A 5CRGA 5IM9A 4J2FA 4I5QA 4ZL9A 3HXSA 3HA9A 3HDCA 2PVOC 3LJRA 2P5RA 2R0GA 1QUWA 3LW9A 1GRXA 2EIRA 3QFBC 4KCEA 1OVNA 3LEFA 6GSUA 1GWCA 2VLTA 2C0FA 2DLXA 4KCAA 3IDVA 5AIVA 3J7Yk 1H75A 5D73A 3DRNA 3ZIJA 2QKEA 1GTBA 1F37A 1OKDA 4HQSA 2VOCA 2OE1A 5AN1A 1ON4A 2HE3A 1TK5B 3HYPA 4G2EA 2C3QA 5G5FA 4IS0A 1PD21 3LFLA 5ECKB 2YWOA 5D9TA 4YQMA 3LGCA 3QAVA 4YH2A 1GSYA 2A2SA 1OC3A 2F8FA 2IFQA 3EMXA 1OYJA 2H66A 3M9KA 1GTIA 1MEKA 3DYRA 1TI3A 1S3DA 5LD0A 1SKRB 3TRPA 2VCZA 5D9XA 3GSTA 1ZYQB 3FZ4A 4TVEA 4KX4A 1PKZA 3CSHA 2ZUPA 3HJPA 3L78A 1EP8A 1O8WA 2VAFA 2JU5A 4WBRD 3GIXA 3Q6OA 1B8XA 3I9V2 2TRXA 4TXVA 3FRCA 4POBA 3TOUA 2H76A 3IK7A 4G9HA 1EGRA 1JHBA 4BVXA 1DE1A 3TKSA 5HFIA 3HVVA 2LQOA 3US3A 3ED3A 2R2JA 3D5JA 3GKNA 1K3LA 3H4KA 1ST9A 3EPTA 4ZILA 1K0CA 1XOAA 3QAGA 3IPZA 6GSVA 2R3XA 2VCQA 2XPEA 1YQ1A 2H74A 4D73B 2N5AA 4X0XA 4HJMA 4JR6A 2M80A 5A4VA 2RM6A 1DE2A 4IW9A 1F2EA 1M2BA 3QMXA 4IP6A 2VD0A 2X64A 4GSNA 5G2ZA 5FWGA 1Z7RA 4IELA 1PQNA 1ZGNA 2OACA 2IL3A 3ZFBA 5HFKA 1I5GA 3GKMA 3ZIVA 5F06A 2K8VA 4EDYA 4EKZA 2LUSA 4NPBA 1T1VA 2KLXA 2XBQA 1LBKA 1B48A 2LRCA 4FH8A 2L59A 1BYEA 3UAPA 4HZ4A 1URMA 2AV4A 1K0AA 4ML1A 4DSSB 1HNBA 22GSA 2EIOA 2NPBA 2C0DA 3UOMA 4K6XA 4CHSA 1PX6A 4FYBA 3VWWA 4AJ6A 1SJ6A 3LWAA 3LYPA 2RUFA 1FOHA 1AQXA 3N9JA 1PN9A 2L57A 6GSXA 1XG8A 4MF5A 2VL9A 4TW5A 4NWYA 2DJ3A 3FW2A 2X8HA 1GNEA 4XS4B 2H1GA 2AJQB 2H30A 5H5SA 1ERWA 2O87A 3TJGA 6GSSA 4EE0A 4I97A 3ZL5A 3PR8A 5IOWA 1Z3EA 2CX3A 3ERGA 3EMPA 3OR5A 1AXDA 4G19A 1G7OA 1T7PB 1PGTA 3FZ9A 2LTKA 5ECHB 2C0GA 2REMA 3LYKA 3RPPA 2H75A 5DCHA 2IJYA 2FWHA 3VFIA 2X99A 1JFUA 1NSWA 1XOBA 2YJHA 3IC4A 3ZTLA 2GQKA 5ECQB 3RBTA 2H0IA 5ELGA 1F6MC 4V2MA 4POKA 1NHOA 1FVKA 3MIXA 2K9FA 3D21A 3BD2A 3D22A 2WZ9A 1KTEA 3GURA 4G0LA 3ZVJD 2FNOA 4DVCA 1YZXA 4P3YB 1DUGA 1JLWA 5G31A 2DC5A 4MPFA 1B9YC 4IBPA 1WIKA 4HUAA 1MD3A 5H5RA 4MJAA 3F0IA 2VCWA 1TU7A 2LQQA 4V2LA 3IA1A 2IFQB 4EUYA 5ECLB 2YOIA 1G6YA 2JADA 2IPAA 1F3AA 4CY8A 1SYRA 3M3MA 3C8EA 3TKPA 3UVHA 5KEJA 1PX7A 5HR1A 4GXZA 1TRSA 3G7YA 3N5OA 1HQOA 1YKCA 3WGEA 2I3YA 5AISA 1SL0B 1PKWA 4TR1B 4O5UA 3F6DA 2B7JA 2H0GA 3ZRDA 4E8HA 4LL1B 3HVSA 4E8EA 4ECBA 10GSA 1JZRA 2VCTA 4BVXB 1FG4A 2I4AA 4ML6A 2V32A 5KOXA 1THOA 1UC7A 1Y25A 2X8GA 2VL2C 4L8EA 5J41A 2LSTA 3ME7A 3RAZA 2P31A 5B8BA 2MMOA 3VI5A 2AYTA 1RW1A 4KF9A 2QA1A 4K2DA 2B1LA 3KTBA 1GUKA 2PERA 4QL7A 4F0CA 2WDUA 1ZYEA 1Q4JA 2YJ7A 4FQUA 4F9ZA 1SK0A 3F4TA 9GSSA 3DD3A 3SWLA 2R5GA 4JE1A 4RI7A 3CRTA 4WEYA 4F82A 2FUG2 4G10A 5DQSA 2CAQA 4X43A 1VF2A 2E2MA 1NW2A 2K18A 2KOKA 2O89A 6GSWA 3VPTA 1OC8A 3D4MA 5KN0A 3H1NA 1WOUA 3TKSE 1A0RP 2PPTA 3WT2A 4K7IA 5IMFA 1V40A 4MH3A 4WF5A 3FHKA 2JSZA 3GNJA 2PN8A 1EWXA 1GLPA 4O5QA 3VLNA 2O7KA 2MMAA 4NXIA 4GRFA 17GSA 1E2YA 1XWGA 2C3TA 3CTFA 5A4WA 4L5LA 1R5AA 1YEPA 3P8WA 1YKAA 1AIUA 3A3TA 2M72A 4K8MA 2R4VA 1ZL9A 5C04A 3RHCA 2TRCP 2CA8A 1UN2A 4WF4A 3E0UA 2BMXA 1YEXA 4EIQA 3BCKA 3KH9A 1Z6NA 4YKFA 1WPIA 4ZBBA 4AJ7A 1M2DA 1TOFA 4ULXA 2CZ3A 3EE2A 4JR4A 2JZRA 4ILFA 2HRKA 4DSSA 2G2QA 3F8UA 3FYGA 4KAEA 3W6GA 2CV4A 2L6CA 4TOPA 1YDKA 1E6BA 3EC3A 4HZ2A 3PGTA 2CQ9A 4WBJA 1ABAA 1GUHA 3MYDA 5D96A 3FR3A 3RPNA 2DJ0A 2GZYA 5CP1A 4BWSA 1VF3A 4PX1A 1XWBA 2GSSA 3TJBA 2UZ8A 2FA8A 3DVWA 2OADA 3DEXA 2N5FA 4TXOB 1IYHA 2MZCA 3F63A 2E7PA 5J9CA 3GSSA 1YJ6A 4DEJA 1QQ2A 3HVNA 4BA7A 3IHQA 3MSZA 3BBYA 2CX4A 1HNCA 2CVBA 3D4TA 3L9SA 4I6XA 1AW9A 1O8XA 1M2AA 1FVJA 2GZPA 3KMNA 3H93A 4N10A 5CO3A 1K0MA 2ZNMA 1AAZA 2VCXA 2DKIA 1KNGA 3ZITA 1V2AA 2BTOT 2HLSA 2OJLA 2PUKC 2V1MA 1W89A 3O6TA 1U87A 3TRQA 4MJEA 3QOUA 1M9AA 2H6ZA 1GH2A 1XCCA 4K0GA 2HSHA 3CRUA 1VGLA 2XHFA 4MNNA 3HJMA 2VL2A 2FY6A 2F3MA 4ECIA 3S9FA 1ERUA 3CBUA 4N0ZA 1U6TA 3GA4A 4BPYA 2WRTA 3GL5A 1HYUA 5HR3A 2I81A 2HYXA 2H73A 3ZLPA 4XS1A 1M0UA 3EVIA 5DDLA 4KB3A 1Y6EA 4NAXA 2GZZA 3QCPA 2GDRA 4XHMA 3HVXA 2AHEA 4OD7A 1GTAA 2DIZA 2YWNA 5LCZA 1R4WA 2WFCA 5J9BA 1PRXA 4TR1A 3JCML 3I6AA 1EV9A 2IMKA 2IWTA 3A2WA 5A4UA 2WULA 4LA1A 1O6JA 5KN2A 3QD9A 5ECPB 3PINA 4USSA 4F03A 2XBIA 1XIYA 3LXZA 4KDUA 2B5EA 1TRUA 3LG6A 3ERFA 2K6VA 4G0KA 2LKUA 3IAM2 1NM3A 2VO4A 2LEGA 3QAWA 6GSYA 3C7MA 1S3RA 5IOXA 3ZMKA 2IMIA 3L9UA 2YPMA 3A5WA 3QR6A 2WS2A 1FAAA 3TJJA 5F07A 5F05A 3IR4A 1XFLA 3D0ZA 2K8SA 2G0FA 1TJDA 1PL2A 3QDNA 1GLQA 2HI7A 20GSA 3TOTA 3GRXA 4Z7XA 1ERVA 2H72A 1TU8A 4MABA 1W4VA 1JLVA 1SKSB 3ZREA 4KH7A 2A4VA 5J3RA 2HZEB 1BQ7A 5DQYA 2NTOA 2N5BA 2FWGA 1QMVA 4LMVA 1WMJA 5EVOA 1JZOA 3FKFA 4NV2A 5KOWA 1V98A 2I9HA 4F0BA 2WB9A 3KGKA 5JWQB 1GUMA 1XW9A 1KBNA 4JU5A 2GQLA 4EL1A 5C00A 2GQMA 3FMWA 3WD6A 2YCDA 2EIQA 2NDOA 1FW1A 1PMTA 2H19A 3KCMA 4YAPA 4XIHA 1X9WB 1A8YA 4ICYA 2FD3A 5A5KA 2B5YA 2LNSA 4OMVA 1R7HA 1TP9A 1GSDA 3IE3A 4V1Ag 4ZBDA 4I2UA 2F51A 1JZWA 3GTUB 2B3SA 3GN3A 2C80A 3KM6A 2LS5A 1SJIA 4PGTA 4IHUA 3F4SA 3CYNA 3C1RA 3FR6A 1MDIA 3EURA 1EV4A 2KHPA 4ID0A 2FCHA 5INYA 2CVDA 2YZUA 5B6NA 2WJUA 3GX0A 4TXOA 4CW9A 2A4HA 2LJRA 1VRSD 3WGDA 4MMMA 3VPQA 5JCUA 2OBIA 1U3IA 1A2LA 3HKRA 4OCEA 4GCIA 2B7KA 4K7NA 1PSQA 3TRXA 5H5QA 4HDEA 3I69A 1SL2B 5F0GA 4PNGA 2PU9C 4IJ3A 3IXRA 4OCFA 3WYWA 2R37A 3P90A 4TR3A 2ON5A 5CAXA 1OE8A 1ZCPA 3CSJA 1TK0B 2DMMA 4V1Ap 2F9SA 2C4JA 3IAS2 2R0CA 4N0VA 3Q74A 4GSSA 3ZVJA 1XVWA 1ZMAA 3GMFA 4PUAA 3IV4A 4Q5NA 1Z9HA 3C71A 5B6MA 3PH9A 2CAIA 4POMA 5GSSA 1IYIA 4OWYA 3GHAA 3D6IA 1Q98A 18GSA 2IMFA 4I8BA 5HQPA 3R3EA 2VIMA 4TKYA 5AIXA 5FT3A 2Z9SA 4RUVA 5GAND 4EVMA 2ZCTA 2MBSA 1EOHA 4EO3A 5JCGA 2HFDA 1TKDB 1MD4A 13GSA 1Z5YE 1ZZYA 3WT1A 4MH2A 4FIWA 3BOAA 1A23A 4XS6A 3W8SA 3TJFA 4KDXA 1NHYA 2VUPA 2QA2A 2VD1A 1XBSA 2VLUA 4MJBA 4EC0A 1O7UA 2JZTA 3HHVA 3EU4A 5CREA 3F3QA 6GSTA 1UA5A 1R26A 3UBKA 3L4NA 1X9MB 3CXGA 3PPUA 1FO5A 5IMVA 2C0EA 1LJRA 1ERTA 4BWQA 4WETA 1PA3A 3TB2A 5ABRA 1T8EB 1XPVA 1T4ZA 5ECNB 2JZSA 2QGVA 3HZ8A 4MZBA 1G6WA 4X4JA 2M46A 1T4YA 3GFKA 2CVKA 4AF2A 4MPGA 5G5EA 4MZWA 1X5EA 3TKRA 2YANA 1USBA 1AC1A 1XXUA 2LNTA 3APSA 3KXOA 4A5PA 2ON7A 4GLTA 1GL8A 4IQAA 5JCWA 1EGOA 4ZB6A 2J9HA 3E3EA 4ZL8A 3FK8A 2MMZA 1KEBA 4IQ1A 3MAKA 3UMAA 2L4CA 3J7Yb 4DSQA 3E9JB 2X49A 1K3YA 1ZYPA 1XWAA 2EC4A 1TW9A 4WR4A 1TI1A 4JBBA 3NZNA 4ZBAA 2VL3A 1F3BA 3O3TA 1X0RA 2DBCA 4AJ8A 5EY6A 2DJJA 4PQ1A 4PXOA 3DIEA 4EDZA 1GNWA 1TK8B 2FHEA 1SD8A 1WJKA 4GQCA 2CZ2A 1CQGA 1K0NA 3V1WA 3KP8A 2YN1A 3KEBA 2WCIA 2HZEA 3TJKA 4Q5QA 2FWEA 1UVZA 3VWUA 5DJLA 3RDWA 5ECRB 1ILOA 5COHA 1FB6A 3DKSA 3IK9A 2OA7A 4ZIJA 2GT6A 2E2GA 3ZZXA 4MA9A 4LL4B 1GSEA 2HRFA 3L0HA 1WP0A 1BEDA 5ID2B 1LU4A 2VM1A 5E4WA 4O32A 1TRVA 2FGXA 2I1UA 3FY7A 19GSA 4FYCA 1DBYA 1F9MA 3BCIA 1RQMA 2GSTA 2HRNA 2L6DA 4K5SA 2O85A 4EIPA 5J4UA 3GKKA 4BVYA 2HSYA 5DBQA 2AAWA 1A8LA 2HZFA 3GTUA 3ZMLA 1FB0A 3BJ5A 2OBKA 4PURA 2H01A 2H8LA 2X8CA 2V6OA 4GSTA 3DXBA 5HR2A 3MDKA 1WE0A 1U88A 3AY8A 3K8NA 3H79A 2RIIA 1A24A 2NBSA 3VWVA 2A2PA 3LORA 2FWFA 5G30A 1ZOFA 2LJAA 4KDYA 3LXTA 5FHIA 3P7XA 3TDGA 2OKAA 1MTCA 4J56E 12GSA 4IGJA 3APQA 3KD0A 4YAVA 1J0FA 2PGTA 4PNFA 5CRWA 4PUFC 1EP7A 2D2ZA 5GAPD 3MNGA 4KNDA 3ISOA 4TRXA 4ACSA 2R0PA 5IPGA 2YWMA 2YV9A 2C3NA 2LV3A 2AB6A 3KIJA 1M7TA 4PTSA 3A2XA 11GSA
chains in the Genus database with same CATH topology
3QPMA 2IMDA 1QFNA 5CRDA 4ISDA 3VK9A 3KZQA 1OC9A 4Q5RA 3GUSA 2VM2A 4YQUA 2XC2A 3ERWA 5ECOB 5IMDA 4ZL7A 1SL1B 1X5CA 4KGIA 3F9UA 4MK3A 4HQZA 3UJ1A 2P0GA 3EU3A 8GSSA 1GTUA 3M9JA 2GVPA 1XZOA 3O76A 1QGVA 3FR9A 2YZHA 5BMUA 4TN8A 3KH7A 4OO5A 1S3AA 5IO0A 5F8BA 1VF1A 5LNKe 3R2QA 4MF7A 4MF6A 4K1FA 1SK1A 1YY7A 3UVTA 3HCZA 3HY2A 5IMCA 2IN3A 4MJCA 1XW6A 2VLVA 2DJKA 2PMTA 2L5LA 1A2JA 2IIYA 1A2MA 4J57E 3A5IA 3C73A 1J9BA 1K0DA 2AUVA 2OE3A 1YF1A 1R5PA 1OKTA 2H71A 2H6XA 1MDKA 4MP4A 1YF0A 1Z7PA 3UL3A 1EZKA 4PQHA 1BX9A 2F8AA 4OO4A 4HJ2A 5CYYA 4WKWA 4TR0A 2KP2A 4FYUA 1GP1A 1PN0A 5BRTA 2A2RA 3KMOA 1GSUA 1SKWB 2HT9A 2H1BA 1J08A 1V58A 4Z2TA 2P5QA 3LQ7A 16GSA 4FO5A 5G1LA 3GKXA 1JZDA 1SK2A 3A2VA 5IQYA 2JL4A 1HNAA 4BL7B 3APOA 3TGZA 3P2AA 1A0FA 3IC8A 3UARA 2GT5A 4KE3A 1THXA 3GV1A 4Z2UA 2O8VB 3GX8A 4IP1A 4JZQA 4KA0A 1I9DA 3Q19A 2H1DA 2DIYA 4HU9A 4PQIA 3ZFLA 1BJXA 5HR0A 1GSSA 2GSQA 3F4RA 1RK4A 2C1YA 2GSRA 5L71A 3EINA 5DALB 3GYKA 4BVYB 2RLIA 4HS1A 2L5OA 3KTLA 4KUNA 4I2TA 5ENUA 2LRNA 1GSFA 5DVBA 2OE0A 4XRAA 3F3RA 3CTGA 3DVXA 4TR4A 4K0NA 1U3AA 7GSSA 3UIWA 3WGXA 4HU7A 4IN0A 1TTZA 2HRAA 2LJKA 3DGQA 1B4QA 4XCSA 5DAKA 2H6YA 1SD9A 3VI7A 3U5RE 1O85A 4NHZA 2YP6A 1T00A 2V6KA 4V2NA 2HXKA 1XW5A 2R6KA 2GLRA 2DJ2A 5KN3A 4KSMA 1PL1A 3Q18A 4G0IA 3KJYA 3EWLA 2GS3A 1EEJA 5ID2A 2PBJA 3M1GA 2CT6A 4MCUA 4GF0A 3MWHA 2DSAA 2ES7A 2JSYA 4JEDA 4Q5FA 4EF0A 1BAYA 2YNXA 1ML6A 2RUEA 4ZXGA 4WXTA 4K9ZA 2XPDA 3IBHA 1WRYA 3TUEA 3FZAA 4IVFA 2H0HA 3DWVA 4IKHA 2VCVA 1VF4A 1S3CA 4L5OA 3ZYWA 4OFTA 1Z6MA 3IHGA 1MDJA 3I43A 2V41A 2DMLA 5HFGA 4X1UA 2GGTA 1OC9B 4WR5A 1ACVA 4K2XA 3TCOA 4RI6A 4L0UA 2RM5A 2PWJA 2YWIA 2HNLA 4POLA 5ECSA 4EXJA 1T3BA 3L9VA 3FZ5A 4Z2RA 4JRRA 4GTUA 1GSQA 4HEA2 3W8JA 4MDCA 2QC7A 1XWCA 1K3OA 5DCGA 2MYGA 3UEMA 2NVLA 3M8NA 4NV5A 1B9XC 2KP1A 4YKGA 3IOSA 3H8QA 3NIVA 1XVQA 2HSMA 3C1SA 1SJZA 1SYXA 3DMLA 4O5RA 4HOJA 4ECCA 4ECJA 1N8JA 4O92A 5JWOB 1FOVA 1EOGA 2YV7A 2DJ1A 3HD5A 5GSTA 4GQFA 2C8UA 3QFAC 2E0QA 1O81A 2B1KA 5GZZB 3G7JA 1V57A 5CRHA 4N11A 2GTUA 3GH6A 2IMEA 5DJMA 1CQHA 2B5XA 4NHWA 1SU9A 1AUCA 2FLSA 2DKHA 3LSZA 5ECMB 5D9VA 5D9WA 4ZB8A 1N2AA 2KUCA 3F6FA 1GULA 5KN1A 4MLYA 2TIRA 1QK8A 1B4PA 4MZCA 3KP9A 4K5RA 3TKSC 1K0BA 3VURA 3TKQA 1QXHA 4YQVA 4OFMA 4O7HA 3G7IA 3IRAA 5EPFA 5IPHA 3HZ4A 1C72A 3M0FA 5CNWA 3SBCA 1TRWA 4LLRA 4HI7A 4N30A 1X5DA 2H70A 4IJIA 1OE7A 4D73A 1OAZA 4XTSA 4KSOA 4F2IA 3RHBA 5D8IA 4OFNA 4K7OA 2QSIA 2LRTA 4QL9A 1ZYNA 3ME8A 5ELAA 3CSIA 3GH9A 3UBLA 4H86A 4RQXA 1M99A 2L4QA 1K0OA 1XWKA 5DAKB 2X4AA 2BJXA 14GSA 2JACA 4BL7A 2B6MA 5JWRB 1EEMA 1AQWA 5IO2A 1M9BA 4XRDA 4ZB9A 1H4OA 2J23A 5IIZA 1BG5A 1G7EA 3GL3A 2ALBA 5IMZA 1FHEA 3EYTA 4GWRA 5AGYA 2MBTA 4CY6A 1TDIA 5G1KA 2WGRA 4XS4A 1TXXA 4RQRA 1G0TA 5DALA 5E59A 1SENA 3HJOA 1WWJA 5ECIB 1DSBA 4NMUA 2MMNA 3G9BA 1O73A 3NOFA 4QQ7A 4L0WA 4LMWA 5D93A 3FEUA 2FA4A 3CMIA 1V9WA 5B8AA 2PVQA 1AQVA 3VWXA 1X9SB 5B7CA 5J5NA 2V2GA 4KW6A 3U6VA 4AGSA 5IMAA 4DSRA 2H1AA 4CDOA 1HD2A 5EL8A 5CRGA 5IM9A 4J2FA 4I5QA 4ZL9A 3HXSA 3HA9A 3HDCA 2PVOC 3LJRA 2P5RA 2R0GA 1QUWA 3LW9A 1GRXA 2EIRA 3QFBC 4KCEA 1OVNA 3LEFA 6GSUA 1GWCA 2VLTA 2C0FA 2DLXA 4KCAA 3IDVA 5AIVA 3J7Yk 1H75A 5D73A 3DRNA 3ZIJA 2QKEA 1GTBA 1F37A 1OKDA 4HQSA 2VOCA 2OE1A 5AN1A 1ON4A 2HE3A 1TK5B 3HYPA 4G2EA 2C3QA 5G5FA 4IS0A 1PD21 3LFLA 5ECKB 2YWOA 5D9TA 4YQMA 3LGCA 3QAVA 4YH2A 1GSYA 2A2SA 1OC3A 2F8FA 2IFQA 3EMXA 1OYJA 2H66A 3M9KA 1GTIA 1MEKA 3DYRA 1TI3A 1S3DA 5LD0A 1SKRB 3TRPA 2VCZA 5D9XA 3GSTA 1ZYQB 3FZ4A 4TVEA 4KX4A 1PKZA 3CSHA 2ZUPA 3HJPA 3L78A 1EP8A 1O8WA 2VAFA 2JU5A 4WBRD 3GIXA 3Q6OA 1B8XA 3I9V2 2TRXA 4TXVA 3FRCA 4POBA 3TOUA 2H76A 3IK7A 4G9HA 1EGRA 1JHBA 4BVXA 1DE1A 3TKSA 5HFIA 3HVVA 2LQOA 3US3A 3ED3A 2R2JA 3D5JA 3GKNA 1K3LA 3H4KA 1ST9A 3EPTA 4ZILA 1K0CA 1XOAA 3QAGA 3IPZA 6GSVA 2R3XA 2VCQA 2XPEA 1YQ1A 2H74A 4D73B 2N5AA 4X0XA 4HJMA 4JR6A 2M80A 5A4VA 2RM6A 1DE2A 4IW9A 1F2EA 1M2BA 3QMXA 4IP6A 2VD0A 2X64A 4GSNA 5G2ZA 5FWGA 1Z7RA 4IELA 1PQNA 1ZGNA 2OACA 2IL3A 3ZFBA 5HFKA 1I5GA 3GKMA 3ZIVA 5F06A 2K8VA 4EDYA 4EKZA 2LUSA 4NPBA 1T1VA 2KLXA 2XBQA 1LBKA 1B48A 2LRCA 4FH8A 2L59A 1BYEA 3UAPA 4HZ4A 1URMA 2AV4A 1K0AA 4ML1A 4DSSB 1HNBA 22GSA 2EIOA 2NPBA 2C0DA 3UOMA 4K6XA 4CHSA 1PX6A 4FYBA 3VWWA 4AJ6A 1SJ6A 3LWAA 3LYPA 2RUFA 1FOHA 1AQXA 3N9JA 1PN9A 2L57A 6GSXA 4MF5A 2VL9A 4TW5A 4NWYA 2DJ3A 3FW2A 2X8HA 1GNEA 4XS4B 2H1GA 2AJQB 2H30A 5H5SA 1ERWA 2O87A 3TJGA 6GSSA 4EE0A 4I97A 3ZL5A 3PR8A 5IOWA 1Z3EA 2CX3A 3ERGA 3EMPA 3OR5A 1AXDA 4G19A 1G7OA 1T7PB 1PGTA 3FZ9A 2LTKA 5ECHB 2C0GA 2REMA 3LYKA 3RPPA 2H75A 5DCHA 2IJYA 2FWHA 3VFIA 2X99A 1JFUA 1NSWA 1XOBA 2YJHA 3IC4A 3ZTLA 2GQKA 5ECQB 3RBTA 2H0IA 5ELGA 1F6MC 4V2MA 4POKA 1NHOA 1FVKA 3MIXA 2K9FA 3D21A 3BD2A 3D22A 2WZ9A 1KTEA 3GURA 4G0LA 3ZVJD 2FNOA 4DVCA 1YZXA 4P3YB 1DUGA 1JLWA 5G31A 2DC5A 4MPFA 1B9YC 4IBPA 1WIKA 4HUAA 1MD3A 5H5RA 4MJAA 3F0IA 2VCWA 1TU7A 2LQQA 4V2LA 3IA1A 2IFQB 4EUYA 5ECLB 2YOIA 1G6YA 2JADA 2IPAA 1F3AA 4CY8A 1SYRA 3M3MA 3C8EA 3TKPA 3UVHA 5KEJA 1PX7A 5HR1A 4GXZA 1TRSA 3G7YA 3N5OA 1HQOA 1YKCA 3WGEA 2I3YA 5AISA 1SL0B 1PKWA 4TR1B 4O5UA 3F6DA 2B7JA 2H0GA 3ZRDA 4E8HA 4LL1B 3HVSA 4E8EA 4ECBA 10GSA 1JZRA 2VCTA 4BVXB 1FG4A 2I4AA 4ML6A 2V32A 5KOXA 1THOA 1UC7A 1Y25A 2X8GA 2VL2C 4L8EA 5J41A 2LSTA 3ME7A 3RAZA 2P31A 5B8BA 2MMOA 3VI5A 2AYTA 1RW1A 4KF9A 2QA1A 4K2DA 2B1LA 3KTBA 1GUKA 2PERA 4QL7A 4F0CA 2WDUA 1ZYEA 1Q4JA 2YJ7A 4FQUA 4F9ZA 1SK0A 3F4TA 9GSSA 3DD3A 3SWLA 2R5GA 4JE1A 4RI7A 3CRTA 4WEYA 4F82A 2FUG2 4G10A 5DQSA 2CAQA 4X43A 1VF2A 2E2MA 1NW2A 2K18A 2KOKA 2O89A 6GSWA 3VPTA 1OC8A 3D4MA 5KN0A 3H1NA 1WOUA 3TKSE 1A0RP 2PPTA 3WT2A 4K7IA 5IMFA 1V40A 4MH3A 4WF5A 3FHKA 2JSZA 3GNJA 2PN8A 1EWXA 1GLPA 4O5QA 3VLNA 2O7KA 2MMAA 4NXIA 4GRFA 17GSA 1E2YA 1XWGA 2C3TA 3CTFA 5A4WA 4L5LA 1R5AA 1YEPA 3P8WA 1YKAA 1AIUA 3A3TA 2M72A 4K8MA 2R4VA 1ZL9A 5C04A 3RHCA 2TRCP 2CA8A 1UN2A 4WF4A 3E0UA 2BMXA 1YEXA 4EIQA 3BCKA 3KH9A 1Z6NA 4YKFA 1WPIA 4ZBBA 4AJ7A 1M2DA 1TOFA 4ULXA 2CZ3A 3EE2A 4JR4A 2JZRA 4ILFA 2HRKA 4DSSA 2G2QA 3F8UA 3FYGA 4KAEA 3W6GA 2CV4A 2L6CA 4TOPA 1YDKA 1E6BA 3EC3A 4HZ2A 3PGTA 2CQ9A 4WBJA 1ABAA 1GUHA 3MYDA 5D96A 3FR3A 3RPNA 2DJ0A 2GZYA 5CP1A 4BWSA 1VF3A 4PX1A 1XWBA 2GSSA 3TJBA 2UZ8A 2FA8A 3DVWA 2OADA 3DEXA 2N5FA 4TXOB 1IYHA 2MZCA 3F63A 2E7PA 5J9CA 3GSSA 1YJ6A 4DEJA 1QQ2A 4BA7A 3IHQA 3MSZA 3BBYA 2CX4A 1HNCA 2CVBA 3D4TA 3L9SA 4I6XA 1AW9A 1O8XA 1M2AA 1FVJA 2GZPA 3KMNA 3H93A 4N10A 5CO3A 1K0MA 2ZNMA 1AAZA 2VCXA 2DKIA 1KNGA 3ZITA 1V2AA 2BTOT 2HLSA 2OJLA 2PUKC 2V1MA 1W89A 3O6TA 1U87A 3TRQA 4MJEA 3QOUA 1M9AA 2H6ZA 1GH2A 1XCCA 4K0GA 2HSHA 3CRUA 1VGLA 2XHFA 4MNNA 3HJMA 2VL2A 2FY6A 2F3MA 4ECIA 3S9FA 1ERUA 3CBUA 4N0ZA 1U6TA 3GA4A 4BPYA 2WRTA 3GL5A 1HYUA 5HR3A 2I81A 2HYXA 2H73A 3ZLPA 4XS1A 1M0UA 3EVIA 5DDLA 4KB3A 1Y6EA 4NAXA 2GZZA 3QCPA 2GDRA 4XHMA 3HVXA 2AHEA 4OD7A 1GTAA 2DIZA 2YWNA 5LCZA 1R4WA 2WFCA 5J9BA 1PRXA 4TR1A 3JCML 3I6AA 1EV9A 2IMKA 2IWTA 3A2WA 5A4UA 2WULA 4LA1A 1O6JA 5KN2A 3QD9A 5ECPB 3PINA 4USSA 4F03A 2XBIA 1XIYA 3LXZA 4KDUA 2B5EA 1TRUA 3LG6A 3ERFA 2K6VA 4G0KA 2LKUA 3IAM2 1NM3A 2VO4A 2LEGA 3QAWA 6GSYA 3C7MA 5IOXA 3ZMKA 2IMIA 3L9UA 2YPMA 3A5WA 3QR6A 2WS2A 1FAAA 3TJJA 5F07A 5F05A 3IR4A 1XFLA 3D0ZA 2K8SA 2G0FA 1TJDA 1PL2A 3QDNA 1GLQA 2HI7A 20GSA 3TOTA 3GRXA 4Z7XA 1ERVA 2H72A 1TU8A 4MABA 1W4VA 1JLVA 1SKSB 3ZREA 4KH7A 2A4VA 5J3RA 2HZEB 1BQ7A 5DQYA 2NTOA 2N5BA 2FWGA 1QMVA 4LMVA 1WMJA 5EVOA 1JZOA 3FKFA 4NV2A 5KOWA 1V98A 2I9HA 4F0BA 2WB9A 3KGKA 5JWQB 1GUMA 1XW9A 1KBNA 4JU5A 2GQLA 4EL1A 5C00A 2GQMA 3FMWA 3WD6A 2YCDA 2EIQA 2NDOA 1FW1A 1PMTA 2H19A 3KCMA 4YAPA 4XIHA 1X9WB 1A8YA 4ICYA 2FD3A 5A5KA 2B5YA 2LNSA 4OMVA 1R7HA 1TP9A 1GSDA 3IE3A 4V1Ag 4ZBDA 4I2UA 2F51A 1JZWA 3GTUB 2B3SA 3GN3A 2C80A 3KM6A 2LS5A 1SJIA 4PGTA 4IHUA 3F4SA 3CYNA 3C1RA 3FR6A 1MDIA 3EURA 1EV4A 2KHPA 4ID0A 2FCHA 5INYA 2CVDA 2YZUA 5B6NA 2WJUA 3GX0A 4TXOA 4CW9A 2A4HA 2LJRA 1VRSD 3WGDA 4MMMA 3VPQA 5JCUA 2OBIA 1U3IA 1A2LA 3HKRA 4OCEA 4GCIA 2B7KA 4K7NA 1PSQA 3TRXA 5H5QA 4HDEA 3I69A 1SL2B 5F0GA 4PNGA 2PU9C 4IJ3A 3IXRA 4OCFA 3WYWA 2R37A 3P90A 4TR3A 2ON5A 5CAXA 1OE8A 1ZCPA 3CSJA 1TK0B 2DMMA 4V1Ap 2F9SA 2C4JA 3IAS2 2R0CA 4N0VA 3Q74A 4GSSA 3ZVJA 1XVWA 1ZMAA 3GMFA 4PUAA 3IV4A 4Q5NA 1Z9HA 3C71A 5B6MA 3PH9A 2CAIA 4POMA 5GSSA 1IYIA 4OWYA 3GHAA 3D6IA 1Q98A 18GSA 2IMFA 4I8BA 5HQPA 3R3EA 2VIMA 4TKYA 5AIXA 5FT3A 2Z9SA 4RUVA 5GAND 4EVMA 2ZCTA 2MBSA 1EOHA 4EO3A 5JCGA 2HFDA 1TKDB 1MD4A 13GSA 1Z5YE 1ZZYA 3WT1A 4MH2A 4FIWA 3BOAA 1A23A 4XS6A 3W8SA 3TJFA 4KDXA 1NHYA 2VUPA 2QA2A 2VD1A 1XBSA 2VLUA 4MJBA 4EC0A 1O7UA 2JZTA 3HHVA 3EU4A 5CREA 3F3QA 6GSTA 1UA5A 1R26A 3UBKA 3L4NA 1X9MB 3CXGA 3PPUA 1FO5A 5IMVA 2C0EA 1LJRA 1ERTA 4BWQA 4WETA 1PA3A 3TB2A 5ABRA 1T8EB 1XPVA 1T4ZA 5ECNB 2JZSA 2QGVA 3HZ8A 4MZBA 1G6WA 4X4JA 2M46A 1T4YA 3GFKA 2CVKA 4AF2A 4MPGA 5G5EA 4MZWA 1X5EA 3TKRA 2YANA 1USBA 1AC1A 1XXUA 2LNTA 3APSA 3KXOA 4A5PA 2ON7A 4GLTA 1GL8A 4IQAA 5JCWA 1EGOA 4ZB6A 2J9HA 3E3EA 4ZL8A 3FK8A 2MMZA 1KEBA 4IQ1A 3MAKA 3UMAA 2L4CA 3J7Yb 4DSQA 3E9JB 2X49A 1K3YA 1ZYPA 1XWAA 2EC4A 1TW9A 4WR4A 1TI1A 4JBBA 3NZNA 4ZBAA 2VL3A 1F3BA 3O3TA 1X0RA 2DBCA 4AJ8A 5EY6A 2DJJA 4PQ1A 4PXOA 3DIEA 4EDZA 1GNWA 1TK8B 2FHEA 1SD8A 1WJKA 4GQCA 2CZ2A 1CQGA 1K0NA 3V1WA 3KP8A 2YN1A 3KEBA 2WCIA 2HZEA 3TJKA 4Q5QA 2FWEA 1UVZA 3VWUA 5DJLA 3RDWA 5ECRB 1ILOA 5COHA 1FB6A 3DKSA 3IK9A 2OA7A 4ZIJA 2GT6A 2E2GA 3ZZXA 4MA9A 4LL4B 1GSEA 2HRFA 3L0HA 1WP0A 1BEDA 5ID2B 1LU4A 2VM1A 5E4WA 4O32A 1TRVA 2FGXA 2I1UA 3FY7A 19GSA 4FYCA 1DBYA 1F9MA 3BCIA 1RQMA 2GSTA 2HRNA 2L6DA 4K5SA 2O85A 4EIPA 5J4UA 3GKKA 4BVYA 2HSYA 5DBQA 2AAWA 1A8LA 2HZFA 3GTUA 3ZMLA 1FB0A 3BJ5A 2OBKA 4PURA 2H01A 2H8LA 2X8CA 2V6OA 4GSTA 3DXBA 5HR2A 3MDKA 1WE0A 1U88A 3AY8A 3K8NA 3H79A 2RIIA 1A24A 2NBSA 3VWVA 2A2PA 3LORA 2FWFA 5G30A 1ZOFA 2LJAA 4KDYA 3LXTA 5FHIA 3P7XA 3TDGA 2OKAA 1MTCA 4J56E 12GSA 4IGJA 3APQA 3KD0A 4YAVA 1J0FA 2PGTA 4PNFA 5CRWA 4PUFC 1EP7A 2D2ZA 5GAPD 3MNGA 4KNDA 3ISOA 4TRXA 4ACSA 2R0PA 5IPGA 2YWMA 2YV9A 2C3NA 2LV3A 2AB6A 3KIJA 1M7TA 4PTSA 3A2XA 11GSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QPM A;  2IMD A;  1QFN A;  5CRD A;  4ISD A;  3VK9 A;  3KZQ A;  1OC9 A;  4Q5R A;  3GUS A;  2VM2 A;  4YQU A;  2XC2 A;  3ERW A;  5ECO B;  5IMD A;  4ZL7 A;  1SL1 B;  1X5C A;  4KGI A;  3F9U A;  4MK3 A;  4HQZ A;  3UJ1 A;  2P0G A;  3EU3 A;  8GSS A;  1GTU A;  3M9J A;  2GVP A;  1XZO A;  3O76 A;  1QGV A;  3FR9 A;  2YZH A;  4TN8 A;  3KH7 A;  4OO5 A;  1S3A A;  5IO0 A;  5F8B A;  1VF1 A;  5LNK e;  3R2Q A;  4MF7 A;  4MF6 A;  4K1F A;  1SK1 A;  1YY7 A;  3UVT A;  3HCZ A;  3HY2 A;  5IMC A;  2IN3 A;  4MJC A;  1XW6 A;  2VLV A;  2DJK A;  2PMT A;  2L5L A;  1A2J A;  2IIY A;  1A2M A;  4J57 E;  3C73 A;  1J9B A;  1K0D A;  2AUV A;  2OE3 A;  1YF1 A;  1R5P A;  1OKT A;  2H71 A;  2H6X A;  1MDK A;  4MP4 A;  1YF0 A;  1Z7P A;  3UL3 A;  1EZK A;  4PQH A;  1BX9 A;  2F8A A;  4OO4 A;  4HJ2 A;  5CYY A;  4WKW A;  4TR0 A;  2KP2 A;  4FYU A;  1GP1 A;  2A2R A;  3KMO A;  1GSU A;  1SKW B;  2HT9 A;  2H1B A;  1J08 A;  1V58 A;  2P5Q A;  3LQ7 A;  16GS A;  4FO5 A;  5G1L A;  3GKX A;  1JZD A;  1SK2 A;  3A2V A;  5IQY A;  2JL4 A;  1HNA A;  3APO A;  3TGZ A;  3P2A A;  1A0F A;  3UAR A;  2GT5 A;  4KE3 A;  1THX A;  3GV1 A;  2O8V B;  3GX8 A;  4IP1 A;  4JZQ A;  4KA0 A;  1I9D A;  3Q19 A;  2H1D A;  2DIY A;  4HU9 A;  4PQI A;  3ZFL A;  1BJX A;  5HR0 A;  1GSS A;  2GSQ A;  3F4R A;  1RK4 A;  2C1Y A;  2GSR A;  5L71 A;  3EIN A;  5DAL B;  3GYK A;  2RLI A;  4HS1 A;  2L5O A;  3KTL A;  4KUN A;  4I2T A;  5ENU A;  2LRN A;  1GSF A;  5DVB A;  2OE0 A;  4XRA A;  3F3R A;  3CTG A;  3DVX A;  4TR4 A;  4K0N A;  1U3A A;  7GSS A;  3UIW A;  3WGX A;  4HU7 A;  4IN0 A;  1TTZ A;  2LJK A;  3DGQ A;  1B4Q A;  4XCS A;  5DAK A;  2H6Y A;  1SD9 A;  3VI7 A;  3U5R E;  1O85 A;  4NHZ A;  2YP6 A;  1T00 A;  2V6K A;  4V2N A;  2HXK A;  1XW5 A;  2R6K A;  2GLR A;  2DJ2 A;  5KN3 A;  4KSM A;  1PL1 A;  3Q18 A;  3KJY A;  3EWL A;  2GS3 A;  1EEJ A;  5ID2 A;  2PBJ A;  3M1G A;  2CT6 A;  4MCU A;  4GF0 A;  3MWH A;  2DSA A;  2ES7 A;  2JSY A;  4JED A;  4Q5F A;  4EF0 A;  1BAY A;  2YNX A;  1ML6 A;  2RUE A;  4ZXG A;  4WXT A;  4K9Z A;  2XPD A;  3IBH A;  1WRY A;  3TUE A;  3FZA A;  4IVF A;  2H0H A;  3DWV A;  4IKH A;  2VCV A;  1VF4 A;  1S3C A;  4L5O A;  3ZYW A;  4OFT A;  1Z6M A;  1MDJ A;  3I43 A;  2V41 A;  2DML A;  5HFG A;  4X1U A;  2GGT A;  1OC9 B;  4WR5 A;  1ACV A;  3TCO A;  4RI6 A;  4L0U A;  2RM5 A;  2PWJ A;  2YWI A;  2HNL A;  4POL A;  5ECS A;  4EXJ A;  1T3B A;  3L9V A;  3FZ5 A;  4JRR A;  4GTU A;  1GSQ A;  4HEA 2;  3W8J A;  4MDC A;  2QC7 A;  1XWC A;  1K3O A;  5DCG A;  2MYG A;  3UEM A;  2NVL A;  3M8N A;  4NV5 A;  1B9X C;  2KP1 A;  3IOS A;  3H8Q A;  3NIV A;  1XVQ A;  3C1S A;  1SJZ A;  1SYX A;  3DML A;  4O5R A;  4HOJ A;  4ECC A;  4ECJ A;  1N8J A;  4O92 A;  5JWO B;  1FOV A;  1EOG A;  2YV7 A;  2DJ1 A;  3HD5 A;  5GST A;  4GQF A;  2C8U A;  3QFA C;  2E0Q A;  1O81 A;  2B1K A;  5GZZ B;  3G7J A;  1V57 A;  5CRH A;  4N11 A;  2GTU A;  3GH6 A;  2IME A;  5DJM A;  1CQH A;  2B5X A;  4NHW A;  1SU9 A;  1AUC A;  2FLS A;  3LSZ A;  5ECM B;  5D9V A;  5D9W A;  4ZB8 A;  1N2A A;  2KUC A;  3F6F A;  1GUL A;  5KN1 A;  4MLY A;  2TIR A;  1QK8 A;  1B4P A;  4MZC A;  3KP9 A;  3TKS C;  1K0B A;  3VUR A;  3TKQ A;  1QXH A;  4YQV A;  4OFM A;  4O7H A;  3G7I A;  3IRA A;  5EPF A;  5IPH A;  3HZ4 A;  1C72 A;  3M0F A;  5CNW A;  3SBC A;  1TRW A;  4LLR A;  4HI7 A;  4N30 A;  1X5D A;  2H70 A;  4IJI A;  1OE7 A;  4D73 A;  1OAZ A;  4XTS A;  4KSO A;  4F2I A;  3RHB A;  5D8I A;  4OFN A;  4K7O A;  2QSI A;  2LRT A;  4QL9 A;  3ME8 A;  5ELA A;  3CSI A;  3GH9 A;  3UBL A;  4H86 A;  4RQX A;  1M99 A;  2L4Q A;  1K0O A;  1XWK A;  5DAK B;  2BJX A;  14GS A;  2JAC A;  4BL7 A;  2B6M A;  5JWR B;  1EEM A;  1AQW A;  5IO2 A;  1M9B A;  4XRD A;  4ZB9 A;  1H4O A;  2J23 A;  5IIZ A;  1BG5 A;  1G7E A;  3GL3 A;  2ALB A;  5IMZ A;  1FHE A;  3EYT A;  4GWR A;  5AGY A;  2MBT A;  1TDI A;  5G1K A;  2WGR A;  4XS4 A;  1TXX A;  4RQR A;  1G0T A;  5DAL A;  5E59 A;  1SEN A;  3HJO A;  1WWJ A;  5ECI B;  1DSB A;  4NMU A;  2MMN A;  3G9B A;  1O73 A;  3NOF A;  4QQ7 A;  4L0W A;  4LMW A;  5D93 A;  3FEU A;  2FA4 A;  3CMI A;  1V9W A;  5B8A A;  2PVQ A;  1AQV A;  3VWX A;  1X9S B;  5B7C A;  5J5N A;  2V2G A;  4KW6 A;  3U6V A;  4AGS A;  5IMA A;  4DSR A;  2H1A A;  4CDO A;  1HD2 A;  5EL8 A;  5CRG A;  5IM9 A;  4J2F A;  4I5Q A;  4ZL9 A;  3HXS A;  3HA9 A;  3HDC A;  2PVO C;  3LJR A;  2P5R A;  1QUW A;  1GRX A;  2EIR A;  3QFB C;  4KCE A;  1OVN A;  3LEF A;  6GSU A;  1GWC A;  2VLT A;  2C0F A;  2DLX A;  4KCA A;  3IDV A;  5AIV A;  3J7Y k;  1H75 A;  5D73 A;  3DRN A;  3ZIJ A;  2QKE A;  1GTB A;  1F37 A;  1OKD A;  4HQS A;  2VOC A;  2OE1 A;  5AN1 A;  1ON4 A;  2HE3 A;  1TK5 B;  3HYP A;  4G2E A;  2C3Q A;  5G5F A;  4IS0 A;  1PD2 1;  3LFL A;  5ECK B;  2YWO A;  5D9T A;  4YQM A;  3LGC A;  3QAV A;  4YH2 A;  1GSY A;  2A2S A;  1OC3 A;  2F8F A;  2IFQ A;  3EMX A;  1OYJ A;  2H66 A;  3M9K A;  1GTI A;  1MEK A;  3DYR A;  1TI3 A;  1S3D A;  5LD0 A;  1SKR B;  3TRP A;  2VCZ A;  5D9X A;  3GST A;  1ZYQ B;  3FZ4 A;  4TVE A;  4KX4 A;  1PKZ A;  3CSH A;  2ZUP A;  3HJP A;  3L78 A;  1EP8 A;  1O8W A;  2VAF A;  2JU5 A;  4WBR D;  3GIX A;  3Q6O A;  1B8X A;  3I9V 2;  2TRX A;  4TXV A;  3FRC A;  4POB A;  3TOU A;  2H76 A;  3IK7 A;  4G9H A;  1EGR A;  1JHB A;  4BVX A;  1DE1 A;  3TKS A;  5HFI A;  3HVV A;  2LQO A;  3US3 A;  3ED3 A;  2R2J A;  3D5J A;  3GKN A;  1K3L A;  3H4K A;  1ST9 A;  4ZIL A;  1K0C A;  1XOA A;  3QAG A;  3IPZ A;  6GSV A;  2R3X A;  2VCQ A;  2XPE A;  1YQ1 A;  2H74 A;  4D73 B;  2N5A A;  4X0X A;  4HJM A;  4JR6 A;  2M80 A;  5A4V A;  2RM6 A;  1DE2 A;  4IW9 A;  1F2E A;  1M2B A;  3QMX A;  4IP6 A;  2VD0 A;  2X64 A;  4GSN A;  5G2Z A;  5FWG A;  1Z7R A;  4IEL A;  1PQN A;  1ZGN A;  2OAC A;  2IL3 A;  3ZFB A;  5HFK A;  1I5G A;  3GKM A;  3ZIV A;  5F06 A;  2K8V A;  4EDY A;  4EKZ A;  2LUS A;  4NPB A;  1T1V A;  2KLX A;  2XBQ A;  1LBK A;  1B48 A;  2LRC A;  4FH8 A;  2L59 A;  1BYE A;  3UAP A;  4HZ4 A;  1URM A;  2AV4 A;  1K0A A;  4ML1 A;  4DSS B;  1HNB A;  22GS A;  2EIO A;  2NPB A;  2C0D A;  3UOM A;  4K6X A;  4CHS A;  1PX6 A;  4FYB A;  3VWW A;  4AJ6 A;  1SJ6 A;  3LWA A;  3LYP A;  2RUF A;  1AQX A;  3N9J A;  1PN9 A;  2L57 A;  6GSX A;  4MF5 A;  2VL9 A;  4TW5 A;  4NWY A;  2DJ3 A;  3FW2 A;  2X8H A;  1GNE A;  4XS4 B;  2H1G A;  2AJQ B;  2H30 A;  5H5S A;  1ERW A;  2O87 A;  3TJG A;  6GSS A;  4EE0 A;  4I97 A;  3ZL5 A;  3PR8 A;  5IOW A;  1Z3E A;  2CX3 A;  3ERG A;  3EMP A;  3OR5 A;  1AXD A;  4G19 A;  1G7O A;  1T7P B;  1PGT A;  3FZ9 A;  2LTK A;  5ECH B;  2C0G A;  2REM A;  3LYK A;  3RPP A;  2H75 A;  5DCH A;  2IJY A;  2FWH A;  3VFI A;  2X99 A;  1JFU A;  1NSW A;  1XOB A;  2YJH A;  3IC4 A;  3ZTL A;  2GQK A;  5ECQ B;  3RBT A;  2H0I A;  5ELG A;  1F6M C;  4V2M A;  4POK A;  1NHO A;  1FVK A;  2K9F A;  3D21 A;  3BD2 A;  3D22 A;  2WZ9 A;  1KTE A;  3GUR A;  3ZVJ D;  2FNO A;  4DVC A;  1YZX A;  4P3Y B;  1DUG A;  1JLW A;  5G31 A;  2DC5 A;  4MPF A;  1B9Y C;  4IBP A;  1WIK A;  4HUA A;  1MD3 A;  5H5R A;  4MJA A;  3F0I A;  2VCW A;  1TU7 A;  2LQQ A;  4V2L A;  3IA1 A;  2IFQ B;  4EUY A;  5ECL B;  2YOI A;  1G6Y A;  2JAD A;  2IPA A;  1F3A A;  1SYR A;  3M3M A;  3C8E A;  3TKP A;  3UVH A;  5KEJ A;  1PX7 A;  5HR1 A;  4GXZ A;  1TRS A;  3G7Y A;  3N5O A;  1HQO A;  1YKC A;  3WGE A;  2I3Y A;  5AIS A;  1SL0 B;  1PKW A;  4TR1 B;  3F6D A;  2B7J A;  2H0G A;  3ZRD A;  4E8H A;  4LL1 B;  3HVS A;  4E8E A;  4ECB A;  10GS A;  1JZR A;  2VCT A;  1FG4 A;  2I4A A;  4ML6 A;  2V32 A;  1THO A;  1UC7 A;  1Y25 A;  2X8G A;  2VL2 C;  4L8E A;  5J41 A;  2LST A;  3ME7 A;  3RAZ A;  2P31 A;  5B8B A;  2MMO A;  3VI5 A;  2AYT A;  1RW1 A;  4K2D A;  2B1L A;  3KTB A;  1GUK A;  2PER A;  4QL7 A;  4F0C A;  2WDU A;  1ZYE A;  1Q4J A;  2YJ7 A;  4F9Z A;  1SK0 A;  3F4T A;  9GSS A;  3DD3 A;  3SWL A;  2R5G A;  4JE1 A;  4RI7 A;  3CRT A;  4WEY A;  4F82 A;  2FUG 2;  4G10 A;  5DQS A;  2CAQ A;  4X43 A;  1VF2 A;  2E2M A;  1NW2 A;  2K18 A;  2KOK A;  2O89 A;  6GSW A;  3VPT A;  1OC8 A;  3D4M A;  5KN0 A;  3H1N A;  1WOU A;  3TKS E;  1A0R P;  2PPT A;  3WT2 A;  4K7I A;  5IMF A;  1V40 A;  4MH3 A;  4WF5 A;  3FHK A;  2JSZ A;  3GNJ A;  2PN8 A;  1EWX A;  1GLP A;  3VLN A;  2O7K A;  2MMA A;  4NXI A;  4GRF A;  17GS A;  1E2Y A;  1XWG A;  2C3T A;  3CTF A;  5A4W A;  4L5L A;  1R5A A;  1YEP A;  3P8W A;  1YKA A;  1AIU A;  3A3T A;  2M72 A;  4K8M A;  2R4V A;  1ZL9 A;  5C04 A;  3RHC A;  2TRC P;  2CA8 A;  1UN2 A;  4WF4 A;  3E0U A;  2BMX A;  1YEX A;  3BCK A;  3KH9 A;  1Z6N A;  4AJ7 A;  1WPI A;  4ZBB A;  1M2D A;  1TOF A;  4ULX A;  2CZ3 A;  3EE2 A;  4JR4 A;  2JZR A;  4ILF A;  4DSS A;  2G2Q A;  3F8U A;  3FYG A;  4KAE A;  3W6G A;  2CV4 A;  2L6C A;  4TOP A;  1YDK A;  1E6B A;  3EC3 A;  4HZ2 A;  3PGT A;  2CQ9 A;  4WBJ A;  1ABA A;  1GUH A;  5D96 A;  3FR3 A;  3RPN A;  2DJ0 A;  2GZY A;  5CP1 A;  4BWS A;  1VF3 A;  4PX1 A;  1XWB A;  2GSS A;  3TJB A;  2FA8 A;  3DVW A;  2OAD A;  3DEX A;  2N5F A;  4TXO B;  1IYH A;  2MZC A;  3F63 A;  2E7P A;  5J9C A;  3GSS A;  1YJ6 A;  4DEJ A;  1QQ2 A;  4BA7 A;  3IHQ A;  3MSZ A;  3BBY A;  2CX4 A;  1HNC A;  2CVB A;  3D4T A;  3L9S A;  4I6X A;  1AW9 A;  1O8X A;  1M2A A;  1FVJ A;  2GZP A;  3KMN A;  3H93 A;  4N10 A;  5CO3 A;  1K0M A;  2ZNM A;  1AAZ A;  2VCX A;  1KNG A;  3ZIT A;  1V2A A;  2BTO T;  2HLS A;  2OJL A;  2PUK C;  2V1M A;  1W89 A;  3O6T A;  1U87 A;  3TRQ A;  4MJE A;  3QOU A;  1M9A A;  2H6Z A;  1GH2 A;  1XCC A;  4K0G A;  2HSH A;  3CRU A;  1VGL A;  2XHF A;  3HJM A;  2VL2 A;  2FY6 A;  2F3M A;  4ECI A;  3S9F A;  1ERU A;  3CBU A;  4N0Z A;  1U6T A;  3GA4 A;  4BPY A;  2WRT A;  3GL5 A;  1HYU A;  5HR3 A;  2I81 A;  2HYX A;  2H73 A;  3ZLP A;  4XS1 A;  1M0U A;  3EVI A;  5DDL A;  4KB3 A;  1Y6E A;  4NAX A;  2GZZ A;  3QCP A;  2GDR A;  4XHM A;  3HVX A;  2AHE A;  4OD7 A;  1GTA A;  2DIZ A;  2YWN A;  5LCZ A;  1R4W A;  2WFC A;  5J9B A;  1PRX A;  4TR1 A;  3JCM L;  3I6A A;  1EV9 A;  2IMK A;  2IWT A;  3A2W A;  5A4U A;  2WUL A;  4LA1 A;  1O6J A;  5KN2 A;  3QD9 A;  5ECP B;  3PIN A;  4F03 A;  2XBI A;  1XIY A;  3LXZ A;  4KDU A;  2B5E A;  1TRU A;  3LG6 A;  3ERF A;  2K6V A;  2LKU A;  3IAM 2;  1NM3 A;  2VO4 A;  2LEG A;  3QAW A;  6GSY A;  3C7M A;  5IOX A;  3ZMK A;  2IMI A;  3L9U A;  2YPM A;  3A5W A;  3QR6 A;  2WS2 A;  1FAA A;  3TJJ A;  5F07 A;  5F05 A;  3IR4 A;  1XFL A;  3D0Z A;  2K8S A;  2G0F A;  1TJD A;  1PL2 A;  3QDN A;  1GLQ A;  2HI7 A;  20GS A;  3TOT A;  3GRX A;  4Z7X A;  1ERV A;  2H72 A;  1TU8 A;  4MAB A;  1W4V A;  1JLV A;  1SKS B;  3ZRE A;  4KH7 A;  2A4V A;  5J3R A;  2HZE B;  1BQ7 A;  5DQY A;  2NTO A;  2N5B A;  2FWG A;  1QMV A;  4LMV A;  1WMJ A;  5EVO A;  1JZO A;  3FKF A;  4NV2 A;  1V98 A;  2I9H A;  4F0B A;  2WB9 A;  3KGK A;  5JWQ B;  1GUM A;  1XW9 A;  1KBN A;  4JU5 A;  2GQL A;  4EL1 A;  5C00 A;  2GQM A;  3WD6 A;  2YCD A;  2EIQ A;  2NDO A;  1FW1 A;  1PMT A;  2H19 A;  3KCM A;  4YAP A;  4XIH A;  1X9W B;  1A8Y A;  2FD3 A;  5A5K A;  2B5Y A;  2LNS A;  4OMV A;  1R7H A;  1TP9 A;  1GSD A;  3IE3 A;  4V1A g;  4ZBD A;  4I2U A;  2F51 A;  1JZW A;  3GTU B;  2B3S A;  3GN3 A;  2C80 A;  3KM6 A;  2LS5 A;  1SJI A;  4PGT A;  4IHU A;  3F4S A;  3CYN A;  3C1R A;  3FR6 A;  1MDI A;  3EUR A;  1EV4 A;  2KHP A;  4ID0 A;  2FCH A;  5INY A;  2CVD A;  2YZU A;  5B6N A;  2WJU A;  3GX0 A;  4TXO A;  4CW9 A;  2LJR A;  1VRS D;  3WGD A;  4MMM A;  3VPQ A;  5JCU A;  2OBI A;  1U3I A;  1A2L A;  3HKR A;  4OCE A;  4GCI A;  2B7K A;  4K7N A;  1PSQ A;  3TRX A;  5H5Q A;  4HDE A;  3I69 A;  1SL2 B;  5F0G A;  4PNG A;  2PU9 C;  4IJ3 A;  3IXR A;  4OCF A;  3WYW A;  2R37 A;  3P90 A;  4TR3 A;  2ON5 A;  5CAX A;  1OE8 A;  1ZCP A;  3CSJ A;  1TK0 B;  2DMM A;  4V1A p;  2F9S A;  2C4J A;  3IAS 2;  4N0V A;  3Q74 A;  4GSS A;  3ZVJ A;  1XVW A;  1ZMA A;  3GMF A;  4PUA A;  3IV4 A;  4Q5N A;  1Z9H A;  3C71 A;  5B6M A;  3PH9 A;  2CAI A;  4POM A;  5GSS A;  1IYI A;  4OWY A;  3GHA A;  3D6I A;  1Q98 A;  18GS A;  2IMF A;  4I8B A;  5HQP A;  2VIM A;  4TKY A;  5AIX A;  5FT3 A;  2Z9S A;  4RUV A;  5GAN D;  4EVM A;  2ZCT A;  2MBS A;  1EOH A;  4EO3 A;  5JCG A;  2HFD A;  1TKD B;  1MD4 A;  13GS A;  1Z5Y E;  1ZZY A;  3WT1 A;  4MH2 A;  4FIW A;  3BOA A;  1A23 A;  4XS6 A;  3W8S A;  3TJF A;  4KDX A;  1NHY A;  2VUP A;  2VD1 A;  1XBS A;  2VLU A;  4MJB A;  4EC0 A;  1O7U A;  2JZT A;  3HHV A;  3EU4 A;  5CRE A;  3F3Q A;  6GST A;  1UA5 A;  1R26 A;  3UBK A;  3L4N A;  1X9M B;  3CXG A;  1FO5 A;  5IMV A;  2C0E A;  1LJR A;  1ERT A;  4BWQ A;  4WET A;  1PA3 A;  3TB2 A;  5ABR A;  1T8E B;  1XPV A;  1T4Z A;  5ECN B;  2JZS A;  2QGV A;  3HZ8 A;  4MZB A;  1G6W A;  2M46 A;  1T4Y A;  3GFK A;  2CVK A;  4AF2 A;  4MPG A;  5G5E A;  4MZW A;  1X5E A;  3TKR A;  2YAN A;  1USB A;  1AC1 A;  1XXU A;  2LNT A;  3APS A;  3KXO A;  2ON7 A;  4GLT A;  1GL8 A;  4IQA A;  5JCW A;  1EGO A;  4ZB6 A;  2J9H A;  3E3E A;  4ZL8 A;  3FK8 A;  2MMZ A;  1KEB A;  4IQ1 A;  3MAK A;  3UMA A;  2L4C A;  3J7Y b;  4DSQ A;  3E9J B;  1K3Y A;  1XWA A;  2EC4 A;  1TW9 A;  4WR4 A;  1TI1 A;  4JBB A;  3NZN A;  4ZBA A;  2VL3 A;  1F3B A;  3O3T A;  1X0R A;  2DBC A;  4AJ8 A;  5EY6 A;  2DJJ A;  4PQ1 A;  4PXO A;  3DIE A;  4EDZ A;  1GNW A;  1TK8 B;  2FHE A;  1SD8 A;  1WJK A;  4GQC A;  2CZ2 A;  1CQG A;  1K0N A;  3V1W A;  3KP8 A;  2YN1 A;  3KEB A;  2WCI A;  2HZE A;  3TJK A;  4Q5Q A;  2FWE A;  1UVZ A;  3VWU A;  5DJL A;  3RDW A;  5ECR B;  1ILO A;  5COH A;  1FB6 A;  3DKS A;  3IK9 A;  2OA7 A;  4ZIJ A;  2GT6 A;  2E2G A;  3ZZX A;  4MA9 A;  4LL4 B;  1GSE A;  2HRF A;  3L0H A;  1WP0 A;  1BED A;  5ID2 B;  1LU4 A;  2VM1 A;  5E4W A;  4O32 A;  1TRV A;  2FGX A;  2I1U A;  3FY7 A;  19GS A;  4FYC A;  1DBY A;  1F9M A;  3BCI A;  1RQM A;  2GST A;  2HRN A;  2L6D A;  2O85 A;  5J4U A;  3GKK A;  4BVY A;  2HSY A;  5DBQ A;  2AAW A;  1A8L A;  2HZF A;  3GTU A;  3ZML A;  1FB0 A;  3BJ5 A;  2OBK A;  4PUR A;  2H01 A;  2H8L A;  2X8C A;  2V6O A;  4GST A;  3DXB A;  5HR2 A;  3MDK A;  1WE0 A;  1U88 A;  3AY8 A;  3K8N A;  3H79 A;  2RII A;  1A24 A;  2NBS A;  3VWV A;  3LOR A;  2FWF A;  5G30 A;  1ZOF A;  2LJA A;  4KDY A;  3LXT A;  5FHI A;  3P7X A;  3TDG A;  2OKA A;  1MTC A;  4J56 E;  12GS A;  4IGJ A;  3APQ A;  3KD0 A;  4YAV A;  1J0F A;  2PGT A;  4PNF A;  5CRW A;  4PUF C;  1EP7 A;  2D2Z A;  5GAP D;  3MNG A;  4KND A;  3ISO A;  4TRX A;  4ACS A;  5IPG A;  2YWM A;  2YV9 A;  2C3N A;  2LV3 A;  2AB6 A;  3KIJ A;  1M7T A;  3A2X A;  11GS A; 
#chains in the Genus database with same CATH topology
 3QPM A;  2IMD A;  1QFN A;  5CRD A;  4ISD A;  3VK9 A;  3KZQ A;  1OC9 A;  4Q5R A;  3GUS A;  2VM2 A;  4YQU A;  2XC2 A;  3ERW A;  5ECO B;  5IMD A;  4ZL7 A;  1SL1 B;  1X5C A;  4KGI A;  3F9U A;  4MK3 A;  4HQZ A;  3UJ1 A;  2P0G A;  3EU3 A;  8GSS A;  1GTU A;  3M9J A;  2GVP A;  1XZO A;  3O76 A;  1QGV A;  3FR9 A;  2YZH A;  5BMU A;  4TN8 A;  3KH7 A;  4OO5 A;  1S3A A;  5IO0 A;  5F8B A;  1VF1 A;  5LNK e;  3R2Q A;  4MF7 A;  4MF6 A;  4K1F A;  1SK1 A;  1YY7 A;  3UVT A;  3HCZ A;  3HY2 A;  5IMC A;  2IN3 A;  4MJC A;  1XW6 A;  2VLV A;  2DJK A;  2PMT A;  2L5L A;  1A2J A;  2IIY A;  1A2M A;  4J57 E;  3A5I A;  3C73 A;  1J9B A;  1K0D A;  2AUV A;  2OE3 A;  1YF1 A;  1R5P A;  1OKT A;  1M3I A;  2H71 A;  2H6X A;  1MDK A;  4MP4 A;  1YF0 A;  1Z7P A;  3UL3 A;  1EZK A;  4PQH A;  1BX9 A;  2F8A A;  4OO4 A;  4HJ2 A;  5CYY A;  4WKW A;  4TR0 A;  2KP2 A;  4FYU A;  1GP1 A;  1PN0 A;  5BRT A;  2A2R A;  3KMO A;  1GSU A;  1SKW B;  2HT9 A;  2H1B A;  1J08 A;  1V58 A;  4Z2T A;  2P5Q A;  3LQ7 A;  4HSC X;  16GS A;  4FO5 A;  5G1L A;  3GKX A;  1JZD A;  1SK2 A;  3A2V A;  5IQY A;  2JL4 A;  1HNA A;  4BL7 B;  3APO A;  3TGZ A;  3P2A A;  1A0F A;  3IC8 A;  3UAR A;  2GT5 A;  4KE3 A;  1THX A;  3GV1 A;  4Z2U A;  2O8V B;  3GX8 A;  4IP1 A;  4JZQ A;  4KA0 A;  1I9D A;  3Q19 A;  2H1D A;  2DIY A;  4HU9 A;  4PQI A;  3ZFL A;  1BJX A;  5HR0 A;  1GSS A;  2GSQ A;  3F4R A;  1RK4 A;  2C1Y A;  2GSR A;  5L71 A;  3EIN A;  5DAL B;  3GYK A;  4BVY B;  2RLI A;  4HS1 A;  2L5O A;  3KTL A;  4KUN A;  4I2T A;  5ENU A;  2LRN A;  1GSF A;  5DVB A;  2OE0 A;  4XRA A;  3F3R A;  3CTG A;  3DVX A;  4TR4 A;  4K0N A;  1U3A A;  7GSS A;  3UIW A;  3WGX A;  4HU7 A;  4IN0 A;  1TTZ A;  2HRA A;  2LJK A;  3DGQ A;  1PFO A;  1B4Q A;  4XCS A;  5DAK A;  2H6Y A;  1SD9 A;  3VI7 A;  3U5R E;  1O85 A;  4NHZ A;  2YP6 A;  1T00 A;  2V6K A;  4V2N A;  2HXK A;  1XW5 A;  2R6K A;  2GLR A;  2DJ2 A;  5KN3 A;  4KSM A;  1PL1 A;  3Q18 A;  4G0I A;  3KJY A;  3EWL A;  2GS3 A;  1EEJ A;  5ID2 A;  2PBJ A;  3M1G A;  2CT6 A;  4MCU A;  4GF0 A;  3MWH A;  2DSA A;  2ES7 A;  2JSY A;  4JED A;  4Q5F A;  4EF0 A;  1BAY A;  2YNX A;  1ML6 A;  2RUE A;  4ZXG A;  3CQF A;  4WXT A;  4K9Z A;  2XPD A;  3IBH A;  1WRY A;  3TUE A;  3FZA A;  4IVF A;  2H0H A;  3DWV A;  4IKH A;  2VCV A;  1VF4 A;  1S3C A;  4L5O A;  3ZYW A;  4OFT A;  1Z6M A;  3IHG A;  1MDJ A;  3I43 A;  2V41 A;  2DML A;  5HFG A;  4X1U A;  2GGT A;  1OC9 B;  4WR5 A;  1ACV A;  4K2X A;  3TCO A;  4RI6 A;  4L0U A;  2RM5 A;  2PWJ A;  2YWI A;  2HNL A;  4POL A;  5ECS A;  4EXJ A;  1T3B A;  3L9V A;  3FZ5 A;  4Z2R A;  4JRR A;  4GTU A;  1GSQ A;  4HEA 2;  3W8J A;  4MDC A;  2QC7 A;  1XWC A;  1K3O A;  5DCG A;  2MYG A;  3UEM A;  2NVL A;  3M8N A;  4NV5 A;  1B9X C;  2KP1 A;  4YKG A;  1M3J A;  3IOS A;  3H8Q A;  3NIV A;  1XVQ A;  2HSM A;  3C1S A;  1SJZ A;  1SYX A;  3DML A;  4O5R A;  4HOJ A;  4ECC A;  4ECJ A;  1N8J A;  4O92 A;  5JWO B;  1FOV A;  1EOG A;  2YV7 A;  2DJ1 A;  3HD5 A;  5GST A;  4GQF A;  2C8U A;  3QFA C;  2E0Q A;  1O81 A;  2B1K A;  5GZZ B;  3G7J A;  1V57 A;  5CRH A;  4N11 A;  2GTU A;  3GH6 A;  2IME A;  5DJM A;  1CQH A;  2B5X A;  4NHW A;  1SU9 A;  1AUC A;  2FLS A;  2DKH A;  3LSZ A;  5ECM B;  5D9V A;  5D9W A;  4ZB8 A;  1N2A A;  2KUC A;  3F6F A;  1GUL A;  5KN1 A;  4MLY A;  2TIR A;  1QK8 A;  1B4P A;  4MZC A;  3KP9 A;  4K5R A;  3TKS C;  1K0B A;  3VUR A;  3TKQ A;  1QXH A;  4YQV A;  4OFM A;  4O7H A;  4BIK A;  3G7I A;  3IRA A;  5EPF A;  5IPH A;  3HZ4 A;  1C72 A;  3M0F A;  5CNW A;  3SBC A;  1TRW A;  4LLR A;  4HI7 A;  4N30 A;  1X5D A;  2H70 A;  4IJI A;  1OE7 A;  4D73 A;  1OAZ A;  4XTS A;  4KSO A;  4F2I A;  3RHB A;  5D8I A;  4OFN A;  4K7O A;  2QSI A;  2LRT A;  4QL9 A;  1ZYN A;  3ME8 A;  5ELA A;  3CSI A;  3GH9 A;  3UBL A;  4H86 A;  4RQX A;  1M99 A;  2L4Q A;  1K0O A;  1XWK A;  5DAK B;  2X4A A;  2BJX A;  14GS A;  2JAC A;  4BL7 A;  2B6M A;  5JWR B;  1EEM A;  1AQW A;  5IO2 A;  1M9B A;  4XRD A;  4ZB9 A;  1H4O A;  2J23 A;  5IIZ A;  1BG5 A;  1G7E A;  3GL3 A;  2ALB A;  5IMZ A;  1FHE A;  3EYT A;  4GWR A;  5AGY A;  2MBT A;  4CY6 A;  1TDI A;  5G1K A;  2WGR A;  4XS4 A;  1TXX A;  4RQR A;  1G0T A;  5DAL A;  5E59 A;  1SEN A;  3HJO A;  1WWJ A;  5ECI B;  1DSB A;  4NMU A;  2MMN A;  3G9B A;  1O73 A;  3NOF A;  4QQ7 A;  4L0W A;  4LMW A;  5D93 A;  3FEU A;  2FA4 A;  3CMI A;  1V9W A;  5B8A A;  2PVQ A;  1AQV A;  3VWX A;  1X9S B;  5B7C A;  5J5N A;  2V2G A;  4KW6 A;  3U6V A;  4AGS A;  5IMA A;  4DSR A;  2H1A A;  4CDO A;  1HD2 A;  5EL8 A;  5CRG A;  5IM9 A;  4J2F A;  4I5Q A;  4ZL9 A;  3HXS A;  3HA9 A;  3HDC A;  2PVO C;  3LJR A;  2P5R A;  2R0G A;  1QUW A;  3LW9 A;  1GRX A;  2EIR A;  3QFB C;  4KCE A;  1OVN A;  3LEF A;  6GSU A;  1GWC A;  2VLT A;  2C0F A;  2DLX A;  4KCA A;  3IDV A;  5AIV A;  3J7Y k;  1H75 A;  5D73 A;  3DRN A;  3ZIJ A;  2QKE A;  1GTB A;  1F37 A;  1OKD A;  4HQS A;  2VOC A;  2OE1 A;  5AN1 A;  1ON4 A;  2HE3 A;  1TK5 B;  3HYP A;  4G2E A;  2C3Q A;  5G5F A;  4IS0 A;  1PD2 1;  3LFL A;  5ECK B;  2YWO A;  5D9T A;  4YQM A;  3LGC A;  3QAV A;  4YH2 A;  1GSY A;  2A2S A;  1OC3 A;  2F8F A;  2IFQ A;  3EMX A;  1OYJ A;  2H66 A;  3M9K A;  1GTI A;  1MEK A;  3DYR A;  1TI3 A;  1S3D A;  5LD0 A;  1SKR B;  3TRP A;  2VCZ A;  5D9X A;  3GST A;  1ZYQ B;  3FZ4 A;  4TVE A;  4KX4 A;  1PKZ A;  3CSH A;  2ZUP A;  3HJP A;  3L78 A;  1EP8 A;  1O8W A;  2VAF A;  2JU5 A;  4WBR D;  3GIX A;  3Q6O A;  1B8X A;  3I9V 2;  2TRX A;  4TXV A;  3FRC A;  4POB A;  3TOU A;  2H76 A;  3IK7 A;  4G9H A;  1EGR A;  1JHB A;  4BVX A;  1DE1 A;  3TKS A;  5HFI A;  3HVV A;  2LQO A;  3US3 A;  3ED3 A;  2R2J A;  3D5J A;  3GKN A;  1K3L A;  3H4K A;  1ST9 A;  3EPT A;  4ZIL A;  1K0C A;  1XOA A;  3QAG A;  3IPZ A;  6GSV A;  2R3X A;  2VCQ A;  2XPE A;  1YQ1 A;  2H74 A;  4D73 B;  2N5A A;  4X0X A;  4HJM A;  4JR6 A;  2M80 A;  5A4V A;  2RM6 A;  1DE2 A;  4IW9 A;  1F2E A;  1M2B A;  3QMX A;  4IP6 A;  2VD0 A;  2X64 A;  4GSN A;  5G2Z A;  5FWG A;  1Z7R A;  4IEL A;  1PQN A;  1ZGN A;  2OAC A;  2IL3 A;  3ZFB A;  5HFK A;  1I5G A;  3GKM A;  3ZIV A;  5F06 A;  2K8V A;  4EDY A;  4EKZ A;  2LUS A;  4NPB A;  1T1V A;  2KLX A;  2XBQ A;  1LBK A;  1B48 A;  2LRC A;  4FH8 A;  2L59 A;  1BYE A;  3UAP A;  4HZ4 A;  1URM A;  2AV4 A;  1K0A A;  4ML1 A;  4DSS B;  1HNB A;  22GS A;  2EIO A;  2NPB A;  2C0D A;  3UOM A;  4K6X A;  4CHS A;  1PX6 A;  4FYB A;  3VWW A;  4AJ6 A;  1SJ6 A;  3LWA A;  3LYP A;  2RUF A;  1FOH A;  1AQX A;  3N9J A;  1PN9 A;  2L57 A;  6GSX A;  1XG8 A;  4MF5 A;  2VL9 A;  4TW5 A;  4NWY A;  2DJ3 A;  3FW2 A;  2X8H A;  1GNE A;  4XS4 B;  2H1G A;  2AJQ B;  2H30 A;  5H5S A;  1ERW A;  2O87 A;  3TJG A;  6GSS A;  4EE0 A;  4I97 A;  3ZL5 A;  3PR8 A;  5IOW A;  1Z3E A;  2CX3 A;  3ERG A;  3EMP A;  3OR5 A;  1AXD A;  4G19 A;  1G7O A;  1T7P B;  1PGT A;  3FZ9 A;  2LTK A;  5ECH B;  2C0G A;  2REM A;  3LYK A;  3RPP A;  2H75 A;  5DCH A;  2IJY A;  2FWH A;  3VFI A;  2X99 A;  1JFU A;  1NSW A;  1XOB A;  2YJH A;  3IC4 A;  3ZTL A;  2GQK A;  5ECQ B;  3RBT A;  2H0I A;  5ELG A;  1F6M C;  4V2M A;  4POK A;  1NHO A;  1FVK A;  3MIX A;  2K9F A;  3D21 A;  3BD2 A;  3D22 A;  2WZ9 A;  1KTE A;  3GUR A;  4G0L A;  3ZVJ D;  2FNO A;  4DVC A;  1YZX A;  4P3Y B;  1DUG A;  1JLW A;  5G31 A;  2DC5 A;  4MPF A;  1B9Y C;  4IBP A;  1WIK A;  4HUA A;  1MD3 A;  5H5R A;  4MJA A;  3F0I A;  2VCW A;  1TU7 A;  2LQQ A;  4V2L A;  3IA1 A;  2IFQ B;  4EUY A;  5ECL B;  2YOI A;  1G6Y A;  2JAD A;  2IPA A;  1F3A A;  4CY8 A;  1SYR A;  3M3M A;  3C8E A;  3TKP A;  3UVH A;  5KEJ A;  1PX7 A;  5HR1 A;  4GXZ A;  1TRS A;  3G7Y A;  3N5O A;  1HQO A;  1YKC A;  3WGE A;  2I3Y A;  5AIS A;  1SL0 B;  1PKW A;  4TR1 B;  4O5U A;  3F6D A;  2B7J A;  2H0G A;  3ZRD A;  4E8H A;  4LL1 B;  3HVS A;  4E8E A;  4ECB A;  10GS A;  1JZR A;  2VCT A;  4BVX B;  1FG4 A;  2I4A A;  4ML6 A;  2V32 A;  5KOX A;  1THO A;  1UC7 A;  1Y25 A;  2X8G A;  2VL2 C;  4L8E A;  5J41 A;  2LST A;  3ME7 A;  3RAZ A;  2P31 A;  5B8B A;  2MMO A;  3VI5 A;  2AYT A;  1RW1 A;  4KF9 A;  2QA1 A;  4K2D A;  2B1L A;  3KTB A;  1GUK A;  2PER A;  4QL7 A;  4F0C A;  2WDU A;  1ZYE A;  1Q4J A;  2YJ7 A;  4FQU A;  4F9Z A;  1SK0 A;  3F4T A;  9GSS A;  3DD3 A;  3SWL A;  2R5G A;  4JE1 A;  4RI7 A;  3CRT A;  4WEY A;  4F82 A;  2FUG 2;  4G10 A;  5DQS A;  2CAQ A;  4X43 A;  1VF2 A;  2E2M A;  1NW2 A;  2K18 A;  2KOK A;  2O89 A;  6GSW A;  3VPT A;  1OC8 A;  3D4M A;  5KN0 A;  3H1N A;  1WOU A;  3TKS E;  1A0R P;  2PPT A;  3WT2 A;  4K7I A;  5IMF A;  1V40 A;  4MH3 A;  4WF5 A;  3FHK A;  2JSZ A;  3GNJ A;  2PN8 A;  1EWX A;  1GLP A;  4O5Q A;  3VLN A;  2O7K A;  2MMA A;  4NXI A;  4GRF A;  17GS A;  1E2Y A;  1XWG A;  2C3T A;  3CTF A;  5A4W A;  4L5L A;  1R5A A;  1YEP A;  3P8W A;  1YKA A;  1AIU A;  3A3T A;  2M72 A;  4K8M A;  2R4V A;  1ZL9 A;  5C04 A;  3RHC A;  2TRC P;  2CA8 A;  1UN2 A;  4WF4 A;  3E0U A;  2BMX A;  1YEX A;  4EIQ A;  3BCK A;  3KH9 A;  1Z6N A;  4YKF A;  1WPI A;  4ZBB A;  4AJ7 A;  1M2D A;  1TOF A;  4ULX A;  2CZ3 A;  3EE2 A;  4JR4 A;  2JZR A;  4ILF A;  2HRK A;  4DSS A;  2G2Q A;  3F8U A;  3FYG A;  4KAE A;  3W6G A;  2CV4 A;  2L6C A;  4TOP A;  1YDK A;  1E6B A;  3EC3 A;  4HZ2 A;  3PGT A;  2CQ9 A;  4WBJ A;  1ABA A;  1GUH A;  3MYD A;  5D96 A;  3FR3 A;  3RPN A;  2DJ0 A;  2GZY A;  5CP1 A;  4BWS A;  1VF3 A;  4PX1 A;  1XWB A;  2GSS A;  3TJB A;  2UZ8 A;  2FA8 A;  3DVW A;  2OAD A;  3DEX A;  2N5F A;  4TXO B;  1IYH A;  2MZC A;  3F63 A;  2E7P A;  5J9C A;  3GSS A;  1YJ6 A;  4DEJ A;  1QQ2 A;  3HVN A;  4BA7 A;  3IHQ A;  3MSZ A;  3BBY A;  2CX4 A;  1HNC A;  2CVB A;  3D4T A;  3L9S A;  4I6X A;  1AW9 A;  1O8X A;  1M2A A;  1FVJ A;  2GZP A;  3KMN A;  3H93 A;  4N10 A;  5CO3 A;  1K0M A;  2ZNM A;  1AAZ A;  2VCX A;  2DKI A;  1KNG A;  3ZIT A;  1V2A A;  2BTO T;  2HLS A;  2OJL A;  2PUK C;  2V1M A;  1W89 A;  3O6T A;  1U87 A;  3TRQ A;  4MJE A;  3QOU A;  1M9A A;  2H6Z A;  1GH2 A;  1XCC A;  4K0G A;  2HSH A;  3CRU A;  1VGL A;  2XHF A;  4MNN A;  3HJM A;  2VL2 A;  2FY6 A;  2F3M A;  4ECI A;  3S9F A;  1ERU A;  3CBU A;  4N0Z A;  1U6T A;  3GA4 A;  4BPY A;  2WRT A;  3GL5 A;  1HYU A;  5HR3 A;  2I81 A;  2HYX A;  2H73 A;  3ZLP A;  4XS1 A;  1M0U A;  3EVI A;  5DDL A;  4KB3 A;  1Y6E A;  4NAX A;  2GZZ A;  3QCP A;  2GDR A;  4XHM A;  3HVX A;  2AHE A;  4OD7 A;  1GTA A;  2DIZ A;  2YWN A;  5LCZ A;  1R4W A;  2WFC A;  5J9B A;  1PRX A;  4TR1 A;  3JCM L;  3I6A A;  1EV9 A;  2IMK A;  2IWT A;  3A2W A;  5A4U A;  2WUL A;  4LA1 A;  1O6J A;  5KN2 A;  3QD9 A;  5ECP B;  3PIN A;  4USS A;  4F03 A;  2XBI A;  1XIY A;  3LXZ A;  4KDU A;  2B5E A;  1TRU A;  3LG6 A;  3ERF A;  2K6V A;  4G0K A;  2LKU A;  3IAM 2;  1NM3 A;  2VO4 A;  2LEG A;  3QAW A;  6GSY A;  3C7M A;  1S3R A;  5IOX A;  3ZMK A;  2IMI A;  3L9U A;  2YPM A;  3A5W A;  3QR6 A;  2WS2 A;  1FAA A;  3TJJ A;  5F07 A;  5F05 A;  3IR4 A;  1XFL A;  3D0Z A;  2K8S A;  2G0F A;  1TJD A;  1PL2 A;  3QDN A;  1GLQ A;  2HI7 A;  20GS A;  3TOT A;  3GRX A;  4Z7X A;  1ERV A;  2H72 A;  1TU8 A;  4MAB A;  1W4V A;  1JLV A;  1SKS B;  3ZRE A;  4KH7 A;  2A4V A;  5J3R A;  2HZE B;  1BQ7 A;  5DQY A;  2NTO A;  2N5B A;  2FWG A;  1QMV A;  4LMV A;  1WMJ A;  5EVO A;  1JZO A;  3FKF A;  4NV2 A;  5KOW A;  1V98 A;  2I9H A;  4F0B A;  2WB9 A;  3KGK A;  5JWQ B;  1GUM A;  1XW9 A;  1KBN A;  4JU5 A;  2GQL A;  4EL1 A;  5C00 A;  2GQM A;  3FMW A;  3WD6 A;  2YCD A;  2EIQ A;  2NDO A;  1FW1 A;  1PMT A;  2H19 A;  3KCM A;  4YAP A;  4XIH A;  1X9W B;  1A8Y A;  4ICY A;  2FD3 A;  5A5K A;  2B5Y A;  2LNS A;  4OMV A;  1R7H A;  1TP9 A;  1GSD A;  3IE3 A;  4V1A g;  4ZBD A;  4I2U A;  2F51 A;  1JZW A;  3GTU B;  2B3S A;  3GN3 A;  2C80 A;  3KM6 A;  2LS5 A;  1SJI A;  4PGT A;  4IHU A;  3F4S A;  3CYN A;  3C1R A;  3FR6 A;  1MDI A;  3EUR A;  1EV4 A;  2KHP A;  4ID0 A;  2FCH A;  5INY A;  2CVD A;  2YZU A;  5B6N A;  2WJU A;  3GX0 A;  4TXO A;  4CW9 A;  2A4H A;  2LJR A;  1VRS D;  3WGD A;  4MMM A;  3VPQ A;  5JCU A;  2OBI A;  1U3I A;  1A2L A;  3HKR A;  4OCE A;  4GCI A;  2B7K A;  4K7N A;  1PSQ A;  3TRX A;  5H5Q A;  4HDE A;  3I69 A;  1SL2 B;  5F0G A;  4PNG A;  2PU9 C;  4IJ3 A;  3IXR A;  4OCF A;  3WYW A;  2R37 A;  3P90 A;  4TR3 A;  2ON5 A;  5CAX A;  1OE8 A;  1ZCP A;  3CSJ A;  1TK0 B;  2DMM A;  4V1A p;  2F9S A;  2C4J A;  3IAS 2;  2R0C A;  4N0V A;  3Q74 A;  4GSS A;  3ZVJ A;  1XVW A;  1ZMA A;  3GMF A;  4PUA A;  3IV4 A;  4Q5N A;  1Z9H A;  3C71 A;  5B6M A;  3PH9 A;  2CAI A;  4POM A;  5GSS A;  1IYI A;  4OWY A;  3GHA A;  3D6I A;  1Q98 A;  18GS A;  2IMF A;  4I8B A;  5HQP A;  3R3E A;  2VIM A;  4TKY A;  5AIX A;  5FT3 A;  2Z9S A;  4RUV A;  5GAN D;  4EVM A;  2ZCT A;  2MBS A;  1EOH A;  4EO3 A;  5JCG A;  2HFD A;  1TKD B;  1MD4 A;  13GS A;  1Z5Y E;  1ZZY A;  3WT1 A;  4MH2 A;  4FIW A;  3BOA A;  1A23 A;  4XS6 A;  3W8S A;  3TJF A;  4KDX A;  1NHY A;  2VUP A;  2QA2 A;  2VD1 A;  1XBS A;  2VLU A;  4MJB A;  4EC0 A;  1O7U A;  2JZT A;  3HHV A;  3EU4 A;  5CRE A;  3F3Q A;  6GST A;  1UA5 A;  1R26 A;  3UBK A;  3L4N A;  1X9M B;  3CXG A;  3PPU A;  1FO5 A;  5IMV A;  2C0E A;  1LJR A;  1ERT A;  4BWQ A;  4WET A;  1PA3 A;  3TB2 A;  5ABR A;  1T8E B;  1XPV A;  1T4Z A;  5ECN B;  2JZS A;  2QGV A;  3HZ8 A;  4MZB A;  1G6W A;  4X4J A;  2M46 A;  1T4Y A;  3GFK A;  2CVK A;  4AF2 A;  4MPG A;  5G5E A;  4MZW A;  1X5E A;  3TKR A;  2YAN A;  1USB A;  1AC1 A;  1XXU A;  2LNT A;  3APS A;  3KXO A;  4A5P A;  2ON7 A;  4GLT A;  1GL8 A;  4IQA A;  5JCW A;  1EGO A;  4ZB6 A;  2J9H A;  3E3E A;  4ZL8 A;  3FK8 A;  2MMZ A;  1KEB A;  4IQ1 A;  3MAK A;  3UMA A;  2L4C A;  3J7Y b;  4DSQ A;  3E9J B;  2X49 A;  1K3Y A;  1ZYP A;  1XWA A;  2EC4 A;  1TW9 A;  4WR4 A;  1TI1 A;  4JBB A;  3NZN A;  4ZBA A;  2VL3 A;  1F3B A;  3O3T A;  1X0R A;  2DBC A;  4AJ8 A;  5EY6 A;  2DJJ A;  4PQ1 A;  4PXO A;  3DIE A;  4EDZ A;  1GNW A;  1TK8 B;  2FHE A;  1SD8 A;  1WJK A;  4GQC A;  2CZ2 A;  1CQG A;  1K0N A;  3V1W A;  3KP8 A;  2YN1 A;  3KEB A;  2WCI A;  2HZE A;  3TJK A;  4Q5Q A;  2FWE A;  1UVZ A;  3VWU A;  5DJL A;  3RDW A;  5ECR B;  1ILO A;  5COH A;  1FB6 A;  3DKS A;  3IK9 A;  2OA7 A;  4ZIJ A;  2GT6 A;  2E2G A;  3ZZX A;  4MA9 A;  4LL4 B;  1GSE A;  2HRF A;  3L0H A;  1WP0 A;  1BED A;  5ID2 B;  1LU4 A;  2VM1 A;  5E4W A;  4O32 A;  1TRV A;  2FGX A;  2I1U A;  3FY7 A;  19GS A;  4FYC A;  1DBY A;  1F9M A;  3BCI A;  1RQM A;  2GST A;  2HRN A;  2L6D A;  4K5S A;  2O85 A;  4EIP A;  5J4U A;  3GKK A;  4BVY A;  2HSY A;  5DBQ A;  2AAW A;  1A8L A;  2HZF A;  3GTU A;  3ZML A;  1FB0 A;  3BJ5 A;  2OBK A;  4PUR A;  2H01 A;  2H8L A;  2X8C A;  2V6O A;  4GST A;  3DXB A;  5HR2 A;  3MDK A;  1WE0 A;  1U88 A;  3AY8 A;  3K8N A;  3H79 A;  2RII A;  1A24 A;  2NBS A;  3VWV A;  2A2P A;  3LOR A;  2FWF A;  5G30 A;  1ZOF A;  2LJA A;  4KDY A;  3LXT A;  5FHI A;  3P7X A;  3TDG A;  2OKA A;  1MTC A;  4J56 E;  12GS A;  4IGJ A;  3APQ A;  3KD0 A;  4YAV A;  1J0F A;  2PGT A;  4PNF A;  5CRW A;  4PUF C;  1EP7 A;  2D2Z A;  5GAP D;  3MNG A;  4KND A;  3ISO A;  4TRX A;  4ACS A;  2R0P A;  5IPG A;  2YWM A;  2YV9 A;  2C3N A;  2LV3 A;  2AB6 A;  3KIJ A;  1M7T A;  4PTS A;  3A2X A;  11GS A; 
#chains in the Genus database with same CATH homology
 3QPM A;  2IMD A;  1QFN A;  5CRD A;  4ISD A;  3VK9 A;  3KZQ A;  1OC9 A;  4Q5R A;  3GUS A;  2VM2 A;  4YQU A;  2XC2 A;  3ERW A;  5ECO B;  5IMD A;  4ZL7 A;  1SL1 B;  1X5C A;  4KGI A;  3F9U A;  4MK3 A;  4HQZ A;  3UJ1 A;  2P0G A;  3EU3 A;  8GSS A;  1GTU A;  3M9J A;  2GVP A;  1XZO A;  3O76 A;  1QGV A;  3FR9 A;  2YZH A;  5BMU A;  4TN8 A;  3KH7 A;  4OO5 A;  1S3A A;  5IO0 A;  5F8B A;  1VF1 A;  5LNK e;  3R2Q A;  4MF7 A;  4MF6 A;  4K1F A;  1SK1 A;  1YY7 A;  3UVT A;  3HCZ A;  3HY2 A;  5IMC A;  2IN3 A;  4MJC A;  1XW6 A;  2VLV A;  2DJK A;  2PMT A;  2L5L A;  1A2J A;  2IIY A;  1A2M A;  4J57 E;  3A5I A;  3C73 A;  1J9B A;  1K0D A;  2AUV A;  2OE3 A;  1YF1 A;  1R5P A;  1OKT A;  2H71 A;  2H6X A;  1MDK A;  4MP4 A;  1YF0 A;  1Z7P A;  3UL3 A;  1EZK A;  4PQH A;  1BX9 A;  2F8A A;  4OO4 A;  4HJ2 A;  5CYY A;  4WKW A;  4TR0 A;  2KP2 A;  4FYU A;  1GP1 A;  1PN0 A;  5BRT A;  2A2R A;  3KMO A;  1GSU A;  1SKW B;  2HT9 A;  2H1B A;  1J08 A;  1V58 A;  4Z2T A;  2P5Q A;  3LQ7 A;  16GS A;  4FO5 A;  5G1L A;  3GKX A;  1JZD A;  1SK2 A;  3A2V A;  5IQY A;  2JL4 A;  1HNA A;  4BL7 B;  3APO A;  3TGZ A;  3P2A A;  1A0F A;  3IC8 A;  3UAR A;  2GT5 A;  4KE3 A;  1THX A;  3GV1 A;  4Z2U A;  2O8V B;  3GX8 A;  4IP1 A;  4JZQ A;  4KA0 A;  1I9D A;  3Q19 A;  2H1D A;  2DIY A;  4HU9 A;  4PQI A;  3ZFL A;  1BJX A;  5HR0 A;  1GSS A;  2GSQ A;  3F4R A;  1RK4 A;  2C1Y A;  2GSR A;  5L71 A;  3EIN A;  5DAL B;  3GYK A;  4BVY B;  2RLI A;  4HS1 A;  2L5O A;  3KTL A;  4KUN A;  4I2T A;  5ENU A;  2LRN A;  1GSF A;  5DVB A;  2OE0 A;  4XRA A;  3F3R A;  3CTG A;  3DVX A;  4TR4 A;  4K0N A;  1U3A A;  7GSS A;  3UIW A;  3WGX A;  4HU7 A;  4IN0 A;  1TTZ A;  2HRA A;  2LJK A;  3DGQ A;  1B4Q A;  4XCS A;  5DAK A;  2H6Y A;  1SD9 A;  3VI7 A;  3U5R E;  1O85 A;  4NHZ A;  2YP6 A;  1T00 A;  2V6K A;  4V2N A;  2HXK A;  1XW5 A;  2R6K A;  2GLR A;  2DJ2 A;  5KN3 A;  4KSM A;  1PL1 A;  3Q18 A;  4G0I A;  3KJY A;  3EWL A;  2GS3 A;  1EEJ A;  5ID2 A;  2PBJ A;  3M1G A;  2CT6 A;  4MCU A;  4GF0 A;  3MWH A;  2DSA A;  2ES7 A;  2JSY A;  4JED A;  4Q5F A;  4EF0 A;  1BAY A;  2YNX A;  1ML6 A;  2RUE A;  4ZXG A;  4WXT A;  4K9Z A;  2XPD A;  3IBH A;  1WRY A;  3TUE A;  3FZA A;  4IVF A;  2H0H A;  3DWV A;  4IKH A;  2VCV A;  1VF4 A;  1S3C A;  4L5O A;  3ZYW A;  4OFT A;  1Z6M A;  3IHG A;  1MDJ A;  3I43 A;  2V41 A;  2DML A;  5HFG A;  4X1U A;  2GGT A;  1OC9 B;  4WR5 A;  1ACV A;  4K2X A;  3TCO A;  4RI6 A;  4L0U A;  2RM5 A;  2PWJ A;  2YWI A;  2HNL A;  4POL A;  5ECS A;  4EXJ A;  1T3B A;  3L9V A;  3FZ5 A;  4Z2R A;  4JRR A;  4GTU A;  1GSQ A;  4HEA 2;  3W8J A;  4MDC A;  2QC7 A;  1XWC A;  1K3O A;  5DCG A;  2MYG A;  3UEM A;  2NVL A;  3M8N A;  4NV5 A;  1B9X C;  2KP1 A;  4YKG A;  3IOS A;  3H8Q A;  3NIV A;  1XVQ A;  2HSM A;  3C1S A;  1SJZ A;  1SYX A;  3DML A;  4O5R A;  4HOJ A;  4ECC A;  4ECJ A;  1N8J A;  4O92 A;  5JWO B;  1FOV A;  1EOG A;  2YV7 A;  2DJ1 A;  3HD5 A;  5GST A;  4GQF A;  2C8U A;  3QFA C;  2E0Q A;  1O81 A;  2B1K A;  5GZZ B;  3G7J A;  1V57 A;  5CRH A;  4N11 A;  2GTU A;  3GH6 A;  2IME A;  5DJM A;  1CQH A;  2B5X A;  4NHW A;  1SU9 A;  1AUC A;  2FLS A;  2DKH A;  3LSZ A;  5ECM B;  5D9V A;  5D9W A;  4ZB8 A;  1N2A A;  2KUC A;  3F6F A;  1GUL A;  5KN1 A;  4MLY A;  2TIR A;  1QK8 A;  1B4P A;  4MZC A;  3KP9 A;  4K5R A;  3TKS C;  1K0B A;  3VUR A;  3TKQ A;  1QXH A;  4YQV A;  4OFM A;  4O7H A;  3G7I A;  3IRA A;  5EPF A;  5IPH A;  3HZ4 A;  1C72 A;  3M0F A;  5CNW A;  3SBC A;  1TRW A;  4LLR A;  4HI7 A;  4N30 A;  1X5D A;  2H70 A;  4IJI A;  1OE7 A;  4D73 A;  1OAZ A;  4XTS A;  4KSO A;  4F2I A;  3RHB A;  5D8I A;  4OFN A;  4K7O A;  2QSI A;  2LRT A;  4QL9 A;  1ZYN A;  3ME8 A;  5ELA A;  3CSI A;  3GH9 A;  3UBL A;  4H86 A;  4RQX A;  1M99 A;  2L4Q A;  1K0O A;  1XWK A;  5DAK B;  2X4A A;  2BJX A;  14GS A;  2JAC A;  4BL7 A;  2B6M A;  5JWR B;  1EEM A;  1AQW A;  5IO2 A;  1M9B A;  4XRD A;  4ZB9 A;  1H4O A;  2J23 A;  5IIZ A;  1BG5 A;  1G7E A;  3GL3 A;  2ALB A;  5IMZ A;  1FHE A;  3EYT A;  4GWR A;  5AGY A;  2MBT A;  4CY6 A;  1TDI A;  5G1K A;  2WGR A;  4XS4 A;  1TXX A;  4RQR A;  1G0T A;  5DAL A;  5E59 A;  1SEN A;  3HJO A;  1WWJ A;  5ECI B;  1DSB A;  4NMU A;  2MMN A;  3G9B A;  1O73 A;  3NOF A;  4QQ7 A;  4L0W A;  4LMW A;  5D93 A;  3FEU A;  2FA4 A;  3CMI A;  1V9W A;  5B8A A;  2PVQ A;  1AQV A;  3VWX A;  1X9S B;  5B7C A;  5J5N A;  2V2G A;  4KW6 A;  3U6V A;  4AGS A;  5IMA A;  4DSR A;  2H1A A;  4CDO A;  1HD2 A;  5EL8 A;  5CRG A;  5IM9 A;  4J2F A;  4I5Q A;  4ZL9 A;  3HXS A;  3HA9 A;  3HDC A;  2PVO C;  3LJR A;  2P5R A;  2R0G A;  1QUW A;  3LW9 A;  1GRX A;  2EIR A;  3QFB C;  4KCE A;  1OVN A;  3LEF A;  6GSU A;  1GWC A;  2VLT A;  2C0F A;  2DLX A;  4KCA A;  3IDV A;  5AIV A;  3J7Y k;  1H75 A;  5D73 A;  3DRN A;  3ZIJ A;  2QKE A;  1GTB A;  1F37 A;  1OKD A;  4HQS A;  2VOC A;  2OE1 A;  5AN1 A;  1ON4 A;  2HE3 A;  1TK5 B;  3HYP A;  4G2E A;  2C3Q A;  5G5F A;  4IS0 A;  1PD2 1;  3LFL A;  5ECK B;  2YWO A;  5D9T A;  4YQM A;  3LGC A;  3QAV A;  4YH2 A;  1GSY A;  2A2S A;  1OC3 A;  2F8F A;  2IFQ A;  3EMX A;  1OYJ A;  2H66 A;  3M9K A;  1GTI A;  1MEK A;  3DYR A;  1TI3 A;  1S3D A;  5LD0 A;  1SKR B;  3TRP A;  2VCZ A;  5D9X A;  3GST A;  1ZYQ B;  3FZ4 A;  4TVE A;  4KX4 A;  1PKZ A;  3CSH A;  2ZUP A;  3HJP A;  3L78 A;  1EP8 A;  1O8W A;  2VAF A;  2JU5 A;  4WBR D;  3GIX A;  3Q6O A;  1B8X A;  3I9V 2;  2TRX A;  4TXV A;  3FRC A;  4POB A;  3TOU A;  2H76 A;  3IK7 A;  4G9H A;  1EGR A;  1JHB A;  4BVX A;  1DE1 A;  3TKS A;  5HFI A;  3HVV A;  2LQO A;  3US3 A;  3ED3 A;  2R2J A;  3D5J A;  3GKN A;  1K3L A;  3H4K A;  1ST9 A;  3EPT A;  4ZIL A;  1K0C A;  1XOA A;  3QAG A;  3IPZ A;  6GSV A;  2R3X A;  2VCQ A;  2XPE A;  1YQ1 A;  2H74 A;  4D73 B;  2N5A A;  4X0X A;  4HJM A;  4JR6 A;  2M80 A;  5A4V A;  2RM6 A;  1DE2 A;  4IW9 A;  1F2E A;  1M2B A;  3QMX A;  4IP6 A;  2VD0 A;  2X64 A;  4GSN A;  5G2Z A;  5FWG A;  1Z7R A;  4IEL A;  1PQN A;  1ZGN A;  2OAC A;  2IL3 A;  3ZFB A;  5HFK A;  1I5G A;  3GKM A;  3ZIV A;  5F06 A;  2K8V A;  4EDY A;  4EKZ A;  2LUS A;  4NPB A;  1T1V A;  2KLX A;  2XBQ A;  1LBK A;  1B48 A;  2LRC A;  4FH8 A;  2L59 A;  1BYE A;  3UAP A;  4HZ4 A;  1URM A;  2AV4 A;  1K0A A;  4ML1 A;  4DSS B;  1HNB A;  22GS A;  2EIO A;  2NPB A;  2C0D A;  3UOM A;  4K6X A;  4CHS A;  1PX6 A;  4FYB A;  3VWW A;  4AJ6 A;  1SJ6 A;  3LWA A;  3LYP A;  2RUF A;  1FOH A;  1AQX A;  3N9J A;  1PN9 A;  2L57 A;  6GSX A;  4MF5 A;  2VL9 A;  4TW5 A;  4NWY A;  2DJ3 A;  3FW2 A;  2X8H A;  1GNE A;  4XS4 B;  2H1G A;  2AJQ B;  2H30 A;  5H5S A;  1ERW A;  2O87 A;  3TJG A;  6GSS A;  4EE0 A;  4I97 A;  3ZL5 A;  3PR8 A;  5IOW A;  1Z3E A;  2CX3 A;  3ERG A;  3EMP A;  3OR5 A;  1AXD A;  4G19 A;  1G7O A;  1T7P B;  1PGT A;  3FZ9 A;  2LTK A;  5ECH B;  2C0G A;  2REM A;  3LYK A;  3RPP A;  2H75 A;  5DCH A;  2IJY A;  2FWH A;  3VFI A;  2X99 A;  1JFU A;  1NSW A;  1XOB A;  2YJH A;  3IC4 A;  3ZTL A;  2GQK A;  5ECQ B;  3RBT A;  2H0I A;  5ELG A;  1F6M C;  4V2M A;  4POK A;  1NHO A;  1FVK A;  3MIX A;  2K9F A;  3D21 A;  3BD2 A;  3D22 A;  2WZ9 A;  1KTE A;  3GUR A;  4G0L A;  3ZVJ D;  2FNO A;  4DVC A;  1YZX A;  4P3Y B;  1DUG A;  1JLW A;  5G31 A;  2DC5 A;  4MPF A;  1B9Y C;  4IBP A;  1WIK A;  4HUA A;  1MD3 A;  5H5R A;  4MJA A;  3F0I A;  2VCW A;  1TU7 A;  2LQQ A;  4V2L A;  3IA1 A;  2IFQ B;  4EUY A;  5ECL B;  2YOI A;  1G6Y A;  2JAD A;  2IPA A;  1F3A A;  4CY8 A;  1SYR A;  3M3M A;  3C8E A;  3TKP A;  3UVH A;  5KEJ A;  1PX7 A;  5HR1 A;  4GXZ A;  1TRS A;  3G7Y A;  3N5O A;  1HQO A;  1YKC A;  3WGE A;  2I3Y A;  5AIS A;  1SL0 B;  1PKW A;  4TR1 B;  4O5U A;  3F6D A;  2B7J A;  2H0G A;  3ZRD A;  4E8H A;  4LL1 B;  3HVS A;  4E8E A;  4ECB A;  10GS A;  1JZR A;  2VCT A;  4BVX B;  1FG4 A;  2I4A A;  4ML6 A;  2V32 A;  5KOX A;  1THO A;  1UC7 A;  1Y25 A;  2X8G A;  2VL2 C;  4L8E A;  5J41 A;  2LST A;  3ME7 A;  3RAZ A;  2P31 A;  5B8B A;  2MMO A;  3VI5 A;  2AYT A;  1RW1 A;  4KF9 A;  2QA1 A;  4K2D A;  2B1L A;  3KTB A;  1GUK A;  2PER A;  4QL7 A;  4F0C A;  2WDU A;  1ZYE A;  1Q4J A;  2YJ7 A;  4FQU A;  4F9Z A;  1SK0 A;  3F4T A;  9GSS A;  3DD3 A;  3SWL A;  2R5G A;  4JE1 A;  4RI7 A;  3CRT A;  4WEY A;  4F82 A;  2FUG 2;  4G10 A;  5DQS A;  2CAQ A;  4X43 A;  1VF2 A;  2E2M A;  1NW2 A;  2K18 A;  2KOK A;  2O89 A;  6GSW A;  3VPT A;  1OC8 A;  3D4M A;  5KN0 A;  3H1N A;  1WOU A;  3TKS E;  1A0R P;  2PPT A;  3WT2 A;  4K7I A;  5IMF A;  1V40 A;  4MH3 A;  4WF5 A;  3FHK A;  2JSZ A;  3GNJ A;  2PN8 A;  1EWX A;  1GLP A;  4O5Q A;  3VLN A;  2O7K A;  2MMA A;  4NXI A;  4GRF A;  17GS A;  1E2Y A;  1XWG A;  2C3T A;  3CTF A;  5A4W A;  4L5L A;  1R5A A;  1YEP A;  3P8W A;  1YKA A;  1AIU A;  3A3T A;  2M72 A;  4K8M A;  2R4V A;  1ZL9 A;  5C04 A;  3RHC A;  2TRC P;  2CA8 A;  1UN2 A;  4WF4 A;  3E0U A;  2BMX A;  1YEX A;  4EIQ A;  3BCK A;  3KH9 A;  1Z6N A;  4YKF A;  1WPI A;  4ZBB A;  4AJ7 A;  1M2D A;  1TOF A;  4ULX A;  2CZ3 A;  3EE2 A;  4JR4 A;  2JZR A;  4ILF A;  2HRK A;  4DSS A;  2G2Q A;  3F8U A;  3FYG A;  4KAE A;  3W6G A;  2CV4 A;  2L6C A;  4TOP A;  1YDK A;  1E6B A;  3EC3 A;  4HZ2 A;  3PGT A;  2CQ9 A;  4WBJ A;  1ABA A;  1GUH A;  3MYD A;  5D96 A;  3FR3 A;  3RPN A;  2DJ0 A;  2GZY A;  5CP1 A;  4BWS A;  1VF3 A;  4PX1 A;  1XWB A;  2GSS A;  3TJB A;  2UZ8 A;  2FA8 A;  3DVW A;  2OAD A;  3DEX A;  2N5F A;  4TXO B;  1IYH A;  2MZC A;  3F63 A;  2E7P A;  5J9C A;  3GSS A;  1YJ6 A;  4DEJ A;  1QQ2 A;  4BA7 A;  3IHQ A;  3MSZ A;  3BBY A;  2CX4 A;  1HNC A;  2CVB A;  3D4T A;  3L9S A;  4I6X A;  1AW9 A;  1O8X A;  1M2A A;  1FVJ A;  2GZP A;  3KMN A;  3H93 A;  4N10 A;  5CO3 A;  1K0M A;  2ZNM A;  1AAZ A;  2VCX A;  2DKI A;  1KNG A;  3ZIT A;  1V2A A;  2BTO T;  2HLS A;  2OJL A;  2PUK C;  2V1M A;  1W89 A;  3O6T A;  1U87 A;  3TRQ A;  4MJE A;  3QOU A;  1M9A A;  2H6Z A;  1GH2 A;  1XCC A;  4K0G A;  2HSH A;  3CRU A;  1VGL A;  2XHF A;  4MNN A;  3HJM A;  2VL2 A;  2FY6 A;  2F3M A;  4ECI A;  3S9F A;  1ERU A;  3CBU A;  4N0Z A;  1U6T A;  3GA4 A;  4BPY A;  2WRT A;  3GL5 A;  1HYU A;  5HR3 A;  2I81 A;  2HYX A;  2H73 A;  3ZLP A;  4XS1 A;  1M0U A;  3EVI A;  5DDL A;  4KB3 A;  1Y6E A;  4NAX A;  2GZZ A;  3QCP A;  2GDR A;  4XHM A;  3HVX A;  2AHE A;  4OD7 A;  1GTA A;  2DIZ A;  2YWN A;  5LCZ A;  1R4W A;  2WFC A;  5J9B A;  1PRX A;  4TR1 A;  3JCM L;  3I6A A;  1EV9 A;  2IMK A;  2IWT A;  3A2W A;  5A4U A;  2WUL A;  4LA1 A;  1O6J A;  5KN2 A;  3QD9 A;  5ECP B;  3PIN A;  4USS A;  4F03 A;  2XBI A;  1XIY A;  3LXZ A;  4KDU A;  2B5E A;  1TRU A;  3LG6 A;  3ERF A;  2K6V A;  4G0K A;  2LKU A;  3IAM 2;  1NM3 A;  2VO4 A;  2LEG A;  3QAW A;  6GSY A;  3C7M A;  5IOX A;  3ZMK A;  2IMI A;  3L9U A;  2YPM A;  3A5W A;  3QR6 A;  2WS2 A;  1FAA A;  3TJJ A;  5F07 A;  5F05 A;  3IR4 A;  1XFL A;  3D0Z A;  2K8S A;  2G0F A;  1TJD A;  1PL2 A;  3QDN A;  1GLQ A;  2HI7 A;  20GS A;  3TOT A;  3GRX A;  4Z7X A;  1ERV A;  2H72 A;  1TU8 A;  4MAB A;  1W4V A;  1JLV A;  1SKS B;  3ZRE A;  4KH7 A;  2A4V A;  5J3R A;  2HZE B;  1BQ7 A;  5DQY A;  2NTO A;  2N5B A;  2FWG A;  1QMV A;  4LMV A;  1WMJ A;  5EVO A;  1JZO A;  3FKF A;  4NV2 A;  5KOW A;  1V98 A;  2I9H A;  4F0B A;  2WB9 A;  3KGK A;  5JWQ B;  1GUM A;  1XW9 A;  1KBN A;  4JU5 A;  2GQL A;  4EL1 A;  5C00 A;  2GQM A;  3FMW A;  3WD6 A;  2YCD A;  2EIQ A;  2NDO A;  1FW1 A;  1PMT A;  2H19 A;  3KCM A;  4YAP A;  4XIH A;  1X9W B;  1A8Y A;  4ICY A;  2FD3 A;  5A5K A;  2B5Y A;  2LNS A;  4OMV A;  1R7H A;  1TP9 A;  1GSD A;  3IE3 A;  4V1A g;  4ZBD A;  4I2U A;  2F51 A;  1JZW A;  3GTU B;  2B3S A;  3GN3 A;  2C80 A;  3KM6 A;  2LS5 A;  1SJI A;  4PGT A;  4IHU A;  3F4S A;  3CYN A;  3C1R A;  3FR6 A;  1MDI A;  3EUR A;  1EV4 A;  2KHP A;  4ID0 A;  2FCH A;  5INY A;  2CVD A;  2YZU A;  5B6N A;  2WJU A;  3GX0 A;  4TXO A;  4CW9 A;  2A4H A;  2LJR A;  1VRS D;  3WGD A;  4MMM A;  3VPQ A;  5JCU A;  2OBI A;  1U3I A;  1A2L A;  3HKR A;  4OCE A;  4GCI A;  2B7K A;  4K7N A;  1PSQ A;  3TRX A;  5H5Q A;  4HDE A;  3I69 A;  1SL2 B;  5F0G A;  4PNG A;  2PU9 C;  4IJ3 A;  3IXR A;  4OCF A;  3WYW A;  2R37 A;  3P90 A;  4TR3 A;  2ON5 A;  5CAX A;  1OE8 A;  1ZCP A;  3CSJ A;  1TK0 B;  2DMM A;  4V1A p;  2F9S A;  2C4J A;  3IAS 2;  2R0C A;  4N0V A;  3Q74 A;  4GSS A;  3ZVJ A;  1XVW A;  1ZMA A;  3GMF A;  4PUA A;  3IV4 A;  4Q5N A;  1Z9H A;  3C71 A;  5B6M A;  3PH9 A;  2CAI A;  4POM A;  5GSS A;  1IYI A;  4OWY A;  3GHA A;  3D6I A;  1Q98 A;  18GS A;  2IMF A;  4I8B A;  5HQP A;  3R3E A;  2VIM A;  4TKY A;  5AIX A;  5FT3 A;  2Z9S A;  4RUV A;  5GAN D;  4EVM A;  2ZCT A;  2MBS A;  1EOH A;  4EO3 A;  5JCG A;  2HFD A;  1TKD B;  1MD4 A;  13GS A;  1Z5Y E;  1ZZY A;  3WT1 A;  4MH2 A;  4FIW A;  3BOA A;  1A23 A;  4XS6 A;  3W8S A;  3TJF A;  4KDX A;  1NHY A;  2VUP A;  2QA2 A;  2VD1 A;  1XBS A;  2VLU A;  4MJB A;  4EC0 A;  1O7U A;  2JZT A;  3HHV A;  3EU4 A;  5CRE A;  3F3Q A;  6GST A;  1UA5 A;  1R26 A;  3UBK A;  3L4N A;  1X9M B;  3CXG A;  3PPU A;  1FO5 A;  5IMV A;  2C0E A;  1LJR A;  1ERT A;  4BWQ A;  4WET A;  1PA3 A;  3TB2 A;  5ABR A;  1T8E B;  1XPV A;  1T4Z A;  5ECN B;  2JZS A;  2QGV A;  3HZ8 A;  4MZB A;  1G6W A;  4X4J A;  2M46 A;  1T4Y A;  3GFK A;  2CVK A;  4AF2 A;  4MPG A;  5G5E A;  4MZW A;  1X5E A;  3TKR A;  2YAN A;  1USB A;  1AC1 A;  1XXU A;  2LNT A;  3APS A;  3KXO A;  4A5P A;  2ON7 A;  4GLT A;  1GL8 A;  4IQA A;  5JCW A;  1EGO A;  4ZB6 A;  2J9H A;  3E3E A;  4ZL8 A;  3FK8 A;  2MMZ A;  1KEB A;  4IQ1 A;  3MAK A;  3UMA A;  2L4C A;  3J7Y b;  4DSQ A;  3E9J B;  2X49 A;  1K3Y A;  1ZYP A;  1XWA A;  2EC4 A;  1TW9 A;  4WR4 A;  1TI1 A;  4JBB A;  3NZN A;  4ZBA A;  2VL3 A;  1F3B A;  3O3T A;  1X0R A;  2DBC A;  4AJ8 A;  5EY6 A;  2DJJ A;  4PQ1 A;  4PXO A;  3DIE A;  4EDZ A;  1GNW A;  1TK8 B;  2FHE A;  1SD8 A;  1WJK A;  4GQC A;  2CZ2 A;  1CQG A;  1K0N A;  3V1W A;  3KP8 A;  2YN1 A;  3KEB A;  2WCI A;  2HZE A;  3TJK A;  4Q5Q A;  2FWE A;  1UVZ A;  3VWU A;  5DJL A;  3RDW A;  5ECR B;  1ILO A;  5COH A;  1FB6 A;  3DKS A;  3IK9 A;  2OA7 A;  4ZIJ A;  2GT6 A;  2E2G A;  3ZZX A;  4MA9 A;  4LL4 B;  1GSE A;  2HRF A;  3L0H A;  1WP0 A;  1BED A;  5ID2 B;  1LU4 A;  2VM1 A;  5E4W A;  4O32 A;  1TRV A;  2FGX A;  2I1U A;  3FY7 A;  19GS A;  4FYC A;  1DBY A;  1F9M A;  3BCI A;  1RQM A;  2GST A;  2HRN A;  2L6D A;  4K5S A;  2O85 A;  4EIP A;  5J4U A;  3GKK A;  4BVY A;  2HSY A;  5DBQ A;  2AAW A;  1A8L A;  2HZF A;  3GTU A;  3ZML A;  1FB0 A;  3BJ5 A;  2OBK A;  4PUR A;  2H01 A;  2H8L A;  2X8C A;  2V6O A;  4GST A;  3DXB A;  5HR2 A;  3MDK A;  1WE0 A;  1U88 A;  3AY8 A;  3K8N A;  3H79 A;  2RII A;  1A24 A;  2NBS A;  3VWV A;  2A2P A;  3LOR A;  2FWF A;  5G30 A;  1ZOF A;  2LJA A;  4KDY A;  3LXT A;  5FHI A;  3P7X A;  3TDG A;  2OKA A;  1MTC A;  4J56 E;  12GS A;  4IGJ A;  3APQ A;  3KD0 A;  4YAV A;  1J0F A;  2PGT A;  4PNF A;  5CRW A;  4PUF C;  1EP7 A;  2D2Z A;  5GAP D;  3MNG A;  4KND A;  3ISO A;  4TRX A;  4ACS A;  2R0P A;  5IPG A;  2YWM A;  2YV9 A;  2C3N A;  2LV3 A;  2AB6 A;  3KIJ A;  1M7T A;  4PTS A;  3A2X A;  11GS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...