2DMMA

The solution structure of the second thioredoxin domain of human protein disulfide-isomerase a3
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
142
structure length
142
Chain Sequence
GSSGSSGFDGNLKRYLKSEPIPESNDGPVKVVVAENFDEIVNNENKDVLIEFYAPWCGHCKNLEPKYKELGEKLSKDPNIVIAKMDATANDVPSPYEVRGFPTIYFSPANKKLNPKKYEGGRELSDFISYLQREATSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Protein disulfide-isomerase A3
publication title The solution structure of the second thioredoxin domain of human Protein disulfide-isomerase A3
rcsb
source organism Homo sapiens
total genus 18
structure length 142
sequence length 142
ec nomenclature ec 5.3.4.1: Protein disulfide-isomerase.
pdb deposition date 2006-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2dmmA01
5HQPA 2LQOA 3V1WA 1BAYA 3SWLA 2B1KA 3I6AA 2MBSA 3U5RE 2B5YA 2GSTA 5H5QA 2V6OA 1VGLA 2V32A 3C71A 1SJIA 1XWKA 4XIHA 2F8AA 2RIIA 2CV4A 3HYPA 3UEMA 1GSDA 3UBKA 1PD21 1AUCA 1TI1A 2FHEA 3IBHA 5EPFA 2EIOA 2YOIA 2FCHA 2JZTA 2GSSA 3N9JA 1M9BA 3I43A 3DVXA 3M0FA 4H86A 2R2JA 2WZ9A 1M99A 1G6YA 4YQVA 2H72A 2A2SA 4K0GA 2KP2A 4GTUA 9GSSA 4F03A 2WS2A 6GSTA 4XS4A 3F3RA 5CP1A 2H74A 4LMVA 1Z3EA 2CAIA 3U6VA 1O73A 3IE3A 2H0GA 2DIYA 4POKA 1B4PA 2YNXA 1KTEA 4KSOA 3FZAA 2VM1A 3W8JA 1N2AA 2VCXA 1TI3A 3D22A 4ML1A 1K0BA 2I1UA 2ZCTA 1MDJA 3APQA 3KP9A 2H01A 3TDGA 4E8EA 2IN3A 4XCSA 3HHVA 2GQMA 2JL4A 2HT9A 3EINA 3G7IA 5AGYA 1K3YA 3GNJA 1JLVA 3TJJA 1MEKA 3TJKA 3GKMA 4HJMA 2CA8A 1ZL9A 3K8NA 1A0FA 2KHPA 4EL1A 5ECKB 3TRPA 4EF0A 18GSA 2LS5A 4ZBDA 3M9KA 2LV3A 1GNWA 4GF0A 5IO0A 3RHBA 11GSA 3L0HA 2KUCA 5H5RA 4K6XA 1X5DA 3HDCA 5D96A 2PGTA 3VLNA 1MD3A 4DVCA 2IWTA 4OCFA 6GSYA 1TK8B 4MF7A 5HR3A 1EV9A 2TRCP 2ALBA 4JR4A 3DWVA 2PBJA 4J56E 4FH8A 1FVJA 2R37A 4HQSA 1VF3A 2TIRA 1GTUA 4GQCA 4J57E 2DIZA 3CTGA 4WBJA 3WYWA 3LFLA 5GAND 2VD1A 3BCIA 1YDKA 6GSXA 1XOBA 2G2QA 1GNEA 4HJ2A 4E8HA 1T1VA 4FYCA 1EGRA 5IO2A 2VLVA 4HI7A 1K0DA 4MP4A 3F4RA 3F8UA 2CT6A 2L5LA 2V1MA 3C7MA 3QR6A 3IK9A 3C73A 1GLQA 1OC8A 1ON4A 1Z9HA 2HRNA 5D9XA 4YAPA 5DJLA 3NIVA 2PUKC 4TVEA 2FA4A 5G31A 3LXZA 2OBIA 5HFKA 4F0CA 2K8VA 5D9WA 1UA5A 1ZMAA 3KGKA 4NHZA 4F9ZA 3P7XA 2YPMA 4PURA 4DSSB 2AAWA 2ON7A 2RUFA 3GMFA 1J08A 4TXOA 4JE1A 2C80A 3KTBA 4V2NA 2I9HA 1JZWA 4TOPA 4OFNA 4FO5A 6GSSA 3EMPA 2IFQB 1YY7A 1GL8A 1O85A 3RPNA 3D21A 3AY8A 4N0ZA 2VCWA 3RPPA 2VLTA 5FWGA 2A4VA 1ERUA 2H66A 1JLWA 3RAZA 3IPZA 5DVBA 3FR9A 4ACSA 10GSA 1M9AA 2VL2A 3D5JA 2R3XA 2PN8A 1IYHA 5A4UA 3CRUA 1MTCA 1HNBA 1PKZA 1WOUA 2PU9C 1GH2A 1DBYA 6GSVA 5G5EA 2IIYA 1M2BA 4MJAA 3P2AA 4WR4A 1ERVA 1AXDA 2LKUA 1EEMA 3BJ5A 4JZQA 4OWYA 3BCKA 2B6MA 1F3AA 5AIVA 1W89A 3IK7A 2HSHA 4Q5FA 1U6TA 4I2UA 2I4AA 2B7JA 3UARA 1NSWA 1TU8A 2BTOT 4EDYA 1E2YA 2C0GA 1SKRB 4RI6A 2NTOA 1DE2A 3KTLA 3QDNA 3UIWA 1SKSB 2GSRA 2VL3A 4TN8A 3ZIVA 1YEPA 2H19A 2O8VB 1QUWA 5ABRA 2C0EA 2B7KA 2K6VA 2HSYA 2VD0A 2FNOA 2C3TA 5IMDA 1GSSA 1AW9A 1OAZA 1GLPA 3FHKA 5L71A 4PUAA 4BVYA 3H1NA 3F6DA 1O8XA 4GSTA 1ERWA 1G0TA 3F3QA 1IYIA 2YWOA 2H0IA 2F9SA 5DDLA 4HDEA 4IHUA 1PX7A 2BJXA 4MA9A 3WGDA 4K7NA 4ECCA 2GZPA 1QXHA 5DAKB 4K7IA 2WFCA 16GSA 3EC3A 5F07A 2LRNA 2JACA 1GTAA 5ECIB 4GRFA 1XVWA 5D8IA 4POLA 3KD0A 3CMIA 2HZEA 5CYYA 4BVXA 1XW9A 4K2DA 3FZ4A 5ENUA 3ZVJD 3IV4A 1SYRA 2OJLA 2X8GA 4RQRA 5CRWA 4WKWA 5ECOB 2I3YA 1GP1A 1U3IA 3VPTA 1W4VA 5EL8A 5D9TA 2HZFA 2LJAA 2R4VA 3VWVA 4NAXA 1Z6NA 3LSZA 3ZITA 1NM3A 1A23A 3GFKA 3MDKA 3HJMA 1R5AA 3H8QA 3P90A 4ZL8A 4ILFA 4YAVA 4ZILA 4N11A 2YV9A 1JZRA 4NHWA 3SBCA 2H6XA 1X9MB 1U3AA 2FD3A 1VF1A 3GV1A 3TKSC 5KEJA 1XW6A 4G19A 2LJRA 1YEXA 2C0FA 4F0BA 1KBNA 1GSFA 1XWCA 3UAPA 4KSMA 4TR1A 2N5FA 2CVBA 1XWAA 3LWAA 5HR2A 5C00A 2GQKA 4ISDA 1ZYQB 2F51A 4QQ7A 4WETA 4EXJA 4IP6A 5IOWA 2VCVA 4O7HA 4MCUA 1LU4A 4I8BA 2YWNA 5JCWA 2F3MA 3EURA 4JBBA 5FT3A 2EC4A 1TK0B 5COHA 4AJ6A 4OD7A 3FK8A 3GX0A 5G1LA 2QKEA 4DSRA 4ZB9A 4P3YB 3C1SA 4WF5A 3C1RA 2OACA 1CQHA 2GDRA 3GL5A 1ZZYA 2M72A 3MNGA 3UJ1A 4NMUA 2DJ2A 1K0OA 4KE3A 1C72A 3QCPA 1SYXA 3NZNA 4Z7XA 2YZHA 1Z7PA 4OMVA 3ZTLA 3UBLA 1AQWA 3O6TA 4RUVA 3VI5A 1PA3A 3N5OA 4PX1A 4MMMA 3G7YA 2IMKA 1YJ6A 2GSQA 3F63A 1X0RA 2GGTA 4N30A 4PNGA 2TRXA 3VWUA 1BG5A 3EE2A 3ZMKA 3HY2A 2LNSA 5CREA 4ML6A 4IS0A 4IJIA 5IMAA 1OC9A 4Q5QA 1SL2B 3KXOA 2N5BA 3QFBC 4MJEA 3VK9A 1PMTA 2QC7A 2DBCA 3D0ZA 3O76A 3KEBA 1T3BA 3ZZXA 2MYGA 3IXRA 4POBA 4OO4A 2OE3A 5IQYA 2YWIA 4O32A 1EGOA 3WGEA 4EKZA 4ECJA 2C4JA 1WP0A 3TKRA 2H76A 5DQSA 3DD3A 1YF0A 1H75A 3HA9A 2MBTA 20GSA 2MMNA 4Q5NA 1AQVA 3GH9A 3GL3A 1TOFA 3TCOA 2FUG2 1AIUA 4KDUA 4EDZA 3CYNA 3IHQA 3TKQA 1OE7A 2NBSA 2X64A 4V1Ap 1AAZA 4KDYA 5HR0A 4N0VA 2WRTA 4L5LA 2IMDA 6GSUA 1Q4JA 1XW5A 1QFNA 3GSSA 2L4QA 5IOXA 1PSQA 4GCIA 3M3MA 2YV7A 3ZFBA 1ZOFA 5G1KA 1V58A 2P5RA 1XIYA 4ZIJA 4OFMA 1A8LA 5HFIA 3Q19A 5IPGA 1X9SB 1GULA 3ZLPA 2QGVA 4G2EA 4X0XA 2B1LA 4MPGA 4BL7A 1J9BA 1CQGA 4DSQA 2CQ9A 2H75A 3KJYA 4MZBA 5ECNB 1TK5B 2OADA 3HJPA 2KOKA 3D4TA 1OC3A 3GX8A 3CSJA 3J7Yb 4ECIA 4L0WA 5CO3A 2L4CA 2IJYA 1B48A 4HZ2A 1FO5A 4MH2A 2OA7A 4D73A 3KM6A 1YF1A 3E3EA 3HZ4A 2XBIA 2OE1A 5DALA 5ID2B 2FGXA 2VOCA 4PGTA 1Y6EA 3GURA 4XHMA 1WWJA 5IPHA 4KA0A 1K3LA 2R6KA 2GTUA 4MPFA 4POMA 1NW2A 5KN2A 3S9FA 3LGCA 3VPQA 5J9CA 3TJFA 1ST9A 3ZMLA 2AJQB 1SK1A 1AQXA 1K0CA 3H4KA 2DLXA 3KMOA 2E7PA 3FZ5A 5AISA 2M80A 4ECBA 2ON5A 3IA1A 2H1AA 5GAPD 4K9ZA 1YQ1A 2EIRA 1UN2A 1GSYA 1EZKA 4PQ1A 2HE3A 3GKXA 1ML6A 4HZ4A 2FA8A 1EWXA 1LBKA 2GT5A 1THOA 2GVPA 1TRWA 2NVLA 1B4QA 3GKNA 5JWRB 2DJ1A 3UOMA 3APSA 5EVOA 2Z9SA 3L9UA 3D4MA 3FR3A 1SD9A 2YP6A 4IW9A 2VO4A 1TU7A 3CSIA 4YQMA 4KB3A 2MZCA 4JU5A 1XOAA 1MDKA 1T4ZA 5JWQB 2P5QA 3ME8A 1R7HA 5IMCA 5J5NA 3GA4A 2CX4A 1SL1B 1T8EB 4I6XA 4TXVA 1OE8A 3TUEA 5G30A 4ZL7A 1WIKA 5ECQB 3ME7A 4L5OA 2XPEA 4LA1A 5ECPB 2PMTA 1R5PA 2AB6A 1UC7A 4EC0A 2CZ3A 1QGVA 2WCIA 1GTIA 2GS3A 2VCQA 2H73A 4G10A 3I69A 2VL9A 1ERTA 1F3BA 2KLXA 3I9V2 4MH3A 1XPVA 3CSHA 1E6BA 3R2QA 3GHAA 4ZL9A 3Q74A 4NV5A 4IKHA 1XFLA 3TRQA 2DJ3A 3LG6A 4XS4B 5F06A 3H93A 1S3CA 1SL0B 1NHOA 2DJ0A 2LRCA 3DKSA 4IQ1A 4TR0A 1NHYA 1B9YC 1V2AA 1MDIA 2XHFA 1F2EA 3TB2A 4TRXA 3L78A 4TKYA 3TRXA 4LLRA 8GSSA 4IBPA 4XRDA 1O81A 5D9VA 1LJRA 3LXTA 5ELGA 2GT6A 2HYXA 2MMOA 3GTUB 3HJOA 1SJ6A 2GZZA 1BQ7A 2O89A 5EY6A 2VCTA 1FB0A 1B8XA 4ZB8A 1BJXA 4NPBA 4ZB6A 2FWGA 3DMLA 2FWEA 2H6ZA 4N10A 4OFTA 5CRGA 1SD8A 6GSWA 2K9FA 2GQLA 5C04A 5ECHB 2B3SA 4V1Ag 2L6DA 3KH9A 3IC4A 3LJRA 3TOTA 7GSSA 2FLSA 4ZBBA 2ES7A 5INYA 2HFDA 2GLRA 1G7OA 1S3DA 3QAWA 4IJ3A 4XRAA 1TP9A 3G7JA 4RQXA 5LCZA 1H4OA 4K1FA 1PRXA 2CVKA 5ECSA 2O87A 2L59A 2PWJA 3KIJA 3UVTA 2X8HA 1Q98A 5JWOB 1SJZA 3TGZA 1JZDA 1ILOA 3HCZA 2V2GA 4AJ8A 2NDOA 4KAEA 4XS1A 3NOFA 4MZWA 3MSZA 4KCAA 3UVHA 1X9WB 3KCMA 2DJJA 2WJUA 4QL7A 1Z7RA 2VAFA 2AHEA 5GZZB 2XBQA 4DSSA 5ECRB 4MK3A 1V57A 5KN3A 4EUYA 3GYKA 2YANA 2XPDA 3Q18A 2K8SA 3LQ7A 2IFQA 1X5EA 2LSTA 4LL4B 4WR5A 1F9MA 4X43A 4HS1A 2WDUA 5ELAA 5A4VA 3PINA 2IMEA 2JSZA 3KP8A 4L8EA 5LNKe 4GQFA 2DSAA 1G7EA 4NWYA 14GSA 4WF4A 2CAQA 3M9JA 2XC2A 3QAVA 1YKCA 3IOSA 2CZ2A 5IMZA 2LTKA 4TXOB 2AUVA 4EO3A 1EOHA 1TDIA 3BOAA 3LEFA 1WJKA 2HLSA 3HZ8A 4X1UA 5IM9A 2R5GA 4YH2A 1QQ2A 5DBQA 5F05A 2L57A 2JZSA 4OO5A 1ACVA 1OVNA 3G9BA 2REMA 3GKKA 4IQAA 1OYJA 3A2VA 2H30A 3HXSA 2LJKA 4JRRA 4IELA 3DYRA 1N8JA 2N5AA 4EE0A 1PGTA 2L6CA 1HD2A 3PR8A 3TKSA 1T00A 1FHEA 2CX3A 3A5WA 3ZL5A 1J0FA 4LMWA 4JEDA 2C8UA 4FYUA 2H1GA 4KGIA 4XS6A 2FY6A 2H6YA 3F4SA 3HKRA 1PQNA 3BBYA 2MMZA 1DE1A 5DJMA 3M8NA 5E4WA 2DC5A 3DXBA 3TKSE 1HYUA 5LD0A 4BPYA 4KH7A 1K3OA 1B9XC 5DAKA 1V9WA 1RW1A 5J41A 2VIMA 2H1DA 2YWMA 4AF2A 4I5QA 4WXTA 1QK8A 1EP8A 2DJKA 2H0HA 5KN0A 1RQMA 2J23A 3L4NA 3L9VA 2HXKA 2PVQA 3GTUA 5F0GA 2LNTA 1VRSD 3GN3A 4Q5RA 1ZCPA 3QFAC 4MJCA 1EP7A 3ZREA 1A2LA 5ECLB 4HQZA 4IP1A 2JU5A 3GUSA 4NV2A 1Y25A 3E9JB 3HD5A 4I97A 5DQYA 2I81A 13GSA 4MZCA 5GSTA 1T7PB 5A4WA 2F8FA 3GRXA 5E59A 1SK2A 5CNWA 1A8YA 3GIXA 4CDOA 2YJ7A 1FB6A 5J3RA 1BEDA 1SENA 1U87A 2H71A 1DUGA 2AV4A 2J9HA 4ZBAA 3VFIA 1FAAA 1R4WA 1BYEA 5DCHA 2DMLA 3IRAA 2YJHA 3DVWA 2YCDA 4KDXA 1GRXA 3F4TA 5JCGA 1TJDA 1F6MC 3CTFA 2VL2C 3KZQA 2AYTA 2HZEB 4IN0A 4MABA 3RBTA 2ZNMA 3QOUA 1PKWA 2JSYA 5GSSA 3LYPA 4IGJA 4NXIA 2MMAA 1K0MA 2LUSA 4OCEA 3ERFA 3IAM2 2RLIA 3M1GA 4BA7A 5IMFA 2C0DA 4V2LA 1A2MA 1GSQA 3VURA 2RM5A 4L0UA 4BWSA 1V40A 1A0RP 1M7TA 3US3A 4TR3A 3EU3A 2YZUA 3A2XA 1ZGNA 3ZFLA 1TXXA 4ID0A 4G9HA 1WPIA 4MDCA 4WEYA 1EV4A 3WGXA 3ZYWA 2IMIA 3CRTA 5JCUA 1M2AA 4HUAA 3ZRDA 1JZOA 1GUHA 2VM2A 1EOGA 3HVVA 4PUFC 3TOUA 2EIQA 2K18A 4TW5A 1U88A 2KP1A 1GUMA 3IR4A 4MF5A 1FOVA 2P0GA 1KNGA 2VUPA 1OKTA 3EWLA 2P31A 4KW6A 1WRYA 4PXOA 2B5EA 1X5CA 2LQQA 2RUEA 2H8LA 2V41A 3APOA 3UL3A 3KH7A 2A2RA 3FZ9A 2M46A 3ZIJA 1USBA 4TR1B 4CW9A 19GSA 1SK0A 2LEGA 4KNDA 1VF2A 1O7UA 3ERGA 1WE0A 2DMMA 1GWCA 1XCCA 1TRVA 3TJBA 3OR5A 3KMNA 2NPBA 4F2IA 2H70A 1QMVA 3MWHA 4GXZA 4KCEA 1Z5YE 5IIZA 3H79A 2OKAA 3O3TA 22GSA 1GTBA 3PH9A 1XBSA 5CRDA 2VLUA 1XWBA 3FKFA 5FHIA 4O5RA 1K0AA 2V6KA 3CXGA 4QL9A 2G0FA 1PL2A 3ISOA 2WULA 4HU7A 3BD2A 3PGTA 4J2FA 5B6NA 3HVSA 2IPAA 3C8EA 5B8BA 4GWRA 1M0UA 5D73A 3FR6A 1HQOA 3DRNA 2L5OA 1EEJA 1MD4A 2IMFA 3EVIA 2PPTA 3QAGA 1UVZA 3WT1A 4RI7A 1OKDA 1O8WA 2BMXA 1AC1A 1DSBA 5AN1A 1M2DA 3ED3A 5F8BA 3QMXA 3F0IA 2H1BA 1OC9B 4GLTA 3VWXA 3ZVJA 1PL1A 2C3QA 5G2ZA 3J7Yk 1S3AA 5IMVA 1SKWB 4ZXGA 5AIXA 4HOJA 3EMXA 3CBUA 3JCML 5B8AA 1BX9A 4HU9A 5J4UA 1FW1A 4F82A 1G6WA 3TJGA 5B7CA 3IAS2 1KEBA 3QPMA 2LRTA 1HNAA 1PX6A 2D2ZA 1F37A 1ABAA 4HEA2 2ZUPA 1A2JA 2OE0A 2X8CA 5HFGA 1XWGA 3W6GA 4MLYA 4K0NA 2VCZA 2C3NA 3L9SA 2C1YA 12GSA 2JADA 3FRCA 3GH6A 3P8WA 1ZYEA 2WGRA 5CRHA 3W8SA 3ERWA 3FYGA 5B6MA 1I9DA 2QSIA 5KN1A 1XZOA 3UMAA 1I5GA 3TKPA 4I2TA 3A2WA 1O6JA 2E0QA 2E2GA 3IDVA 3F6FA 2E2MA 3WT2A 5ID2A 4PQHA 1FG4A 1VF4A 1GSUA 3F9UA 3A3TA 2RM6A 1TKDB 1RK4A 4FYBA 2PVOC 5J9BA 1TTZA 1XXUA 2HNLA 5G5FA 2FWHA 4PNFA 2FWFA 3DEXA 3EU4A 2OBKA 2HI7A 3GSTA 2PERA 3RDWA 4GSNA 1GSEA 3VI7A 2WB9A 1V98A 1JFUA 3D6IA 1Z6MA 3FEUA 3LORA 5H5SA 4DEJA 3EYTA 1TRUA 2IL3A 3DGQA 3E0UA 5ECMB 4EVMA 5A5KA 1GUKA 2B5XA 4AJ7A 1THXA 2YN1A 2O7KA 4V2MA 4O92A 4D73B 17GSA 3HVXA 4PQIA 2CVDA 1TRSA 1TW9A 4LL1B 1URMA 4FIWA 3RHCA 5CAXA 2HRFA 1T4YA 4XTSA 3MAKA 4MF6A 3QD9A 5DALB 3WD6A 1PN9A 4CHSA 2O85A 1YZXA 4IVFA 5D93A 4ULXA 1K0NA 4GSSA 5HR1A 2X99A 3FY7A 3VWWA 1HNCA 1YKAA 4YQUA 1A24A 2GZYA 3LYKA 1SU9A 4TR4A 4KUNA 4MJBA 1R26A 3Q6OA 4WBRD 4K8MA 4BWQA 4K7OA 3FW2A 2JZRA 5DCGA 4KX4A 1FVKA 4AGSA 1WMJA 1JHBA 3DIEA 1XVQA 4JR6A
chains in the Genus database with same CATH superfamily
5HQPA 2LQOA 4EIQA 3V1WA 1BAYA 3SWLA 2B1KA 3I6AA 2MBSA 3U5RE 2B5YA 2GSTA 5H5QA 2V6OA 1VGLA 2V32A 3C71A 1SJIA 1XWKA 4XIHA 2F8AA 2RIIA 2CV4A 3HYPA 3UEMA 1GSDA 3UBKA 1PD21 1AUCA 1TI1A 2FHEA 3IBHA 5EPFA 2EIOA 2YOIA 2FCHA 2JZTA 2GSSA 3N9JA 1M9BA 3I43A 3DVXA 3M0FA 4H86A 2R2JA 2WZ9A 4O5UA 1M99A 1G6YA 4CY6A 4YQVA 2H72A 2A2SA 4K0GA 2KP2A 4GTUA 1ZYNA 9GSSA 4F03A 2WS2A 6GSTA 4XS4A 3F3RA 5CP1A 2H74A 4LMVA 1Z3EA 2CAIA 3U6VA 1O73A 3IE3A 2H0GA 2DIYA 4POKA 1B4PA 2YNXA 1KTEA 4KSOA 3FZAA 2VM1A 3W8JA 1N2AA 2VCXA 1TI3A 3D22A 4ML1A 1K0BA 2I1UA 2ZCTA 1MDJA 3APQA 3KP9A 1FOHA 2H01A 3TDGA 4E8EA 2IN3A 4XCSA 3HHVA 2GQMA 2JL4A 2HT9A 3EINA 3G7IA 5AGYA 1K3YA 3GNJA 1JLVA 3TJJA 1MEKA 3TJKA 3GKMA 4HJMA 2CA8A 1ZL9A 3K8NA 1A0FA 2KHPA 4EL1A 5ECKB 3TRPA 4EF0A 18GSA 2A2PA 2LS5A 4ZBDA 3M9KA 2LV3A 1GNWA 4GF0A 5IO0A 3RHBA 11GSA 3L0HA 2KUCA 5H5RA 4K6XA 5BRTA 1X5DA 3HDCA 5D96A 2PGTA 3VLNA 1MD3A 4DVCA 2IWTA 4OCFA 6GSYA 1TK8B 4MF7A 5HR3A 1EV9A 2TRCP 2ALBA 4JR4A 3DWVA 2PBJA 4J56E 4K2XA 4FH8A 1FVJA 2R37A 4HQSA 1VF3A 2TIRA 4Z2TA 1GTUA 4GQCA 4J57E 2DIZA 3CTGA 4WBJA 3WYWA 3LFLA 5GAND 2VD1A 3BCIA 1YDKA 6GSXA 1XOBA 2G2QA 1GNEA 4HJ2A 4E8HA 1T1VA 4FYCA 1EGRA 5IO2A 2VLVA 4HI7A 1K0DA 4USSA 4MP4A 3F4RA 3F8UA 2CT6A 2L5LA 2V1MA 3C7MA 3QR6A 3IK9A 3C73A 1GLQA 1OC8A 1ON4A 1Z9HA 2HRNA 5D9XA 4YAPA 5DJLA 3NIVA 2PUKC 4TVEA 2FA4A 5G31A 3LXZA 2OBIA 5HFKA 4F0CA 2K8VA 5D9WA 1UA5A 1ZMAA 3KGKA 4NHZA 2DKIA 4F9ZA 3P7XA 4X4JA 2YPMA 4PURA 4DSSB 2AAWA 2ON7A 2RUFA 3GMFA 1J08A 4TXOA 4JE1A 2C80A 3KTBA 4V2NA 2I9HA 1JZWA 4TOPA 1M3JA 4OFNA 4FO5A 6GSSA 3EMPA 2IFQB 1YY7A 1GL8A 1O85A 3RPNA 3D21A 1PN0A 3AY8A 4N0ZA 2VCWA 3RPPA 2VLTA 5FWGA 2A4VA 1ERUA 2H66A 1JLWA 3RAZA 3IPZA 5DVBA 3FR9A 4ACSA 10GSA 1M9AA 2VL2A 3D5JA 2R3XA 2PN8A 1IYHA 5A4UA 3CRUA 1MTCA 1HNBA 1PKZA 1WOUA 2PU9C 1GH2A 1DBYA 6GSVA 5G5EA 2IIYA 1M2BA 4MJAA 3P2AA 4WR4A 1ERVA 1AXDA 2LKUA 1EEMA 3BJ5A 4JZQA 4OWYA 3BCKA 3IHGA 2B6MA 1F3AA 5AIVA 1W89A 3IK7A 1ZYPA 2HSHA 4Q5FA 1U6TA 4I2UA 2I4AA 2B7JA 3UARA 1NSWA 1TU8A 2BTOT 4EDYA 1E2YA 2X4AA 2C0GA 1SKRB 4RI6A 2NTOA 1DE2A 3KTLA 3QDNA 3UIWA 1SKSB 2GSRA 2VL3A 4TN8A 3ZIVA 1YEPA 2H19A 2O8VB 1QUWA 5ABRA 2C0EA 2B7KA 2K6VA 2HSYA 2VD0A 2FNOA 2C3TA 5IMDA 1GSSA 1AW9A 1OAZA 1GLPA 3FHKA 5L71A 4PUAA 4BVYA 3H1NA 3F6DA 1O8XA 4GSTA 1ERWA 1G0TA 3F3QA 1IYIA 2R0PA 3HVNA 2YWOA 2H0IA 2F9SA 5DDLA 4HDEA 4IHUA 4YKFA 2DKHA 1PX7A 2BJXA 4MA9A 3WGDA 4K7NA 4ECCA 2GZPA 1QXHA 5DAKB 4K7IA 2WFCA 16GSA 3EC3A 5F07A 2LRNA 1M3IA 2JACA 1GTAA 5ECIB 4GRFA 1XVWA 5D8IA 4POLA 3KD0A 3CMIA 2HZEA 5CYYA 4BVXA 1XW9A 4K2DA 3FZ4A 5ENUA 3ZVJD 3IV4A 1SYRA 2OJLA 2X8GA 4RQRA 5CRWA 4WKWA 5ECOB 2I3YA 1GP1A 1U3IA 3VPTA 1W4VA 5EL8A 5D9TA 2HZFA 2LJAA 2R4VA 3VWVA 4NAXA 1Z6NA 3LSZA 3ZITA 1NM3A 1A23A 4K5RA 3GFKA 3MDKA 3HJMA 1R5AA 3H8QA 3P90A 4ZL8A 4ILFA 4YAVA 4ZILA 4N11A 2YV9A 1JZRA 4NHWA 3SBCA 2H6XA 1X9MB 1U3AA 2FD3A 1VF1A 3GV1A 3TKSC 5KEJA 4FQUA 1XW6A 4G19A 2LJRA 1YEXA 2C0FA 4F0BA 1KBNA 1GSFA 1XWCA 3UAPA 4KSMA 3A5IA 2N5FA 4TR1A 2CVBA 1XWAA 3LWAA 5HR2A 4G0KA 5C00A 2GQKA 4ISDA 1ZYQB 2F51A 4QQ7A 4WETA 4EXJA 4IP6A 5IOWA 2VCVA 4O7HA 4MCUA 1LU4A 4I8BA 2YWNA 5JCWA 2F3MA 3EURA 4JBBA 5FT3A 4EIPA 2EC4A 1TK0B 5COHA 4AJ6A 4OD7A 3FK8A 3GX0A 5G1LA 2QKEA 4DSRA 4ZB9A 4P3YB 3C1SA 4WF5A 3C1RA 2OACA 1CQHA 2GDRA 3GL5A 1ZZYA 2M72A 3MNGA 3UJ1A 4NMUA 2DJ2A 1K0OA 4KE3A 1C72A 3QCPA 1SYXA 3NZNA 4Z7XA 2YZHA 1Z7PA 4OMVA 3ZTLA 3UBLA 1AQWA 3O6TA 4RUVA 3VI5A 1PA3A 3N5OA 2R0CA 4PX1A 5BMUA 4MMMA 3G7YA 2IMKA 1YJ6A 2GSQA 3F63A 1X0RA 2GGTA 4N30A 4PNGA 2TRXA 3VWUA 1BG5A 3EE2A 3ZMKA 3HY2A 2LNSA 5CREA 4ML6A 4IS0A 4IJIA 5IMAA 1OC9A 4Q5QA 1SL2B 3KXOA 2N5BA 3QFBC 4MJEA 3VK9A 1PMTA 2QC7A 4O5QA 2DBCA 3D0ZA 3O76A 3KEBA 1T3BA 3ZZXA 2MYGA 3IXRA 4POBA 4OO4A 4HSCX 2OE3A 5IQYA 2YWIA 4O32A 1EGOA 3WGEA 4EKZA 4ECJA 2C4JA 1WP0A 3TKRA 2H76A 5DQSA 3DD3A 1YF0A 1H75A 3HA9A 2MBTA 20GSA 2MMNA 4Q5NA 1AQVA 3GH9A 3GL3A 1TOFA 3TCOA 2FUG2 1AIUA 4KDUA 4EDZA 3CYNA 3IHQA 3TKQA 1OE7A 2NBSA 2X64A 4V1Ap 1AAZA 4KDYA 5HR0A 4N0VA 2WRTA 4L5LA 2IMDA 6GSUA 1Q4JA 1XW5A 1QFNA 3GSSA 2L4QA 5IOXA 1PSQA 4GCIA 3M3MA 2YV7A 3ZFBA 1ZOFA 5G1KA 1V58A 2P5RA 1XIYA 4ZIJA 4OFMA 3EPTA 1A8LA 5HFIA 3Q19A 5IPGA 3IC8A 1X9SB 1GULA 3ZLPA 2QGVA 4G2EA 4X0XA 2B1LA 4MPGA 4BL7A 1J9BA 1CQGA 4DSQA 2CQ9A 3MYDA 2H75A 3LW9A 4MZBA 3KJYA 5ECNB 1TK5B 2OADA 3HJPA 2KOKA 3D4TA 1OC3A 3GX8A 3CSJA 3J7Yb 4ECIA 4L0WA 5CO3A 2L4CA 2IJYA 1B48A 4HZ2A 1FO5A 4MH2A 2OA7A 4D73A 3KM6A 1YF1A 3E3EA 3HZ4A 2XBIA 2HRKA 2OE1A 5DALA 5ID2B 2FGXA 2VOCA 4PGTA 1Y6EA 3GURA 4XHMA 1WWJA 5IPHA 4KA0A 1K3LA 2R6KA 2GTUA 2R0GA 4MPFA 4POMA 1NW2A 5KN2A 3S9FA 3LGCA 3VPQA 5J9CA 3TJFA 1ST9A 3ZMLA 2AJQB 1SK1A 1AQXA 1K0CA 3H4KA 2DLXA 3KMOA 2E7PA 3FZ5A 3R3EA 5AISA 2M80A 4ECBA 2ON5A 3IA1A 2H1AA 5GAPD 4K9ZA 4CY8A 1YQ1A 2EIRA 1UN2A 1GSYA 1EZKA 4PQ1A 2HE3A 3GKXA 1ML6A 4HZ4A 2FA8A 2QA2A 1EWXA 1LBKA 2GT5A 1THOA 2GVPA 1TRWA 4Z2RA 2NVLA 1B4QA 3GKNA 5JWRB 2DJ1A 3UOMA 3APSA 5EVOA 2Z9SA 3L9UA 3D4MA 3FR3A 1SD9A 4Z2UA 4A5PA 2YP6A 4IW9A 2VO4A 1TU7A 3CSIA 4YQMA 4KB3A 2MZCA 4JU5A 1XOAA 1MDKA 1T4ZA 5JWQB 2P5QA 3ME8A 1R7HA 5IMCA 5J5NA 3GA4A 2CX4A 2HRAA 1SL1B 1T8EB 4I6XA 4TXVA 1OE8A 4G0IA 3TUEA 5G30A 4ZL7A 1WIKA 5ECQB 3ME7A 4L5OA 2XPEA 4LA1A 5ECPB 2PMTA 1R5PA 2AB6A 1UC7A 4EC0A 2CZ3A 1QGVA 3MIXA 1S3RA 2WCIA 1GTIA 2GS3A 2VCQA 2H73A 4G10A 3I69A 2VL9A 1ERTA 1F3BA 2KLXA 3I9V2 4MH3A 1XPVA 3CSHA 1E6BA 3R2QA 3GHAA 4ZL9A 3Q74A 4NV5A 4IKHA 1XFLA 3TRQA 2DJ3A 3LG6A 4XS4B 5F06A 3H93A 1S3CA 1SL0B 1NHOA 2DJ0A 2LRCA 3DKSA 4IQ1A 4PTSA 4TR0A 1NHYA 1B9YC 3FMWA 1V2AA 1MDIA 2XHFA 1F2EA 3TB2A 4TRXA 3L78A 4TKYA 3TRXA 4LLRA 8GSSA 4IBPA 4XRDA 1O81A 5D9VA 1LJRA 3LXTA 5ELGA 2GT6A 2HYXA 2MMOA 3GTUB 3HJOA 1SJ6A 2GZZA 1BQ7A 2O89A 5EY6A 2VCTA 1FB0A 1B8XA 4ZB8A 1BJXA 4NPBA 4ZB6A 2FWGA 3DMLA 2FWEA 2H6ZA 4N10A 4OFTA 5CRGA 1SD8A 6GSWA 2K9FA 2GQLA 5C04A 5ECHB 2B3SA 4V1Ag 2L6DA 3KH9A 3IC4A 3LJRA 3TOTA 7GSSA 2FLSA 4ZBBA 2ES7A 5INYA 2HFDA 2GLRA 1G7OA 1S3DA 3QAWA 4IJ3A 4XRAA 1TP9A 3G7JA 4RQXA 5LCZA 1H4OA 4K1FA 1PRXA 2CVKA 5ECSA 2O87A 2L59A 2PWJA 3KIJA 3UVTA 2X8HA 1Q98A 5JWOB 1SJZA 3TGZA 1JZDA 1ILOA 3HCZA 2V2GA 4AJ8A 2NDOA 4KAEA 4XS1A 3NOFA 4MZWA 3MSZA 4KCAA 3UVHA 1X9WB 3KCMA 2DJJA 2WJUA 4QL7A 1Z7RA 2VAFA 2AHEA 5GZZB 2XBQA 4DSSA 5ECRB 4MK3A 1V57A 5KN3A 4EUYA 3GYKA 2YANA 2XPDA 3Q18A 2K8SA 3LQ7A 2IFQA 1X5EA 2LSTA 4LL4B 4WR5A 1F9MA 4X43A 4HS1A 2WDUA 5ELAA 5A4VA 4MNNA 3PINA 2IMEA 2JSZA 3KP8A 4L8EA 5LNKe 4GQFA 2DSAA 1G7EA 4NWYA 14GSA 4WF4A 2CAQA 3M9JA 2XC2A 3QAVA 1YKCA 3IOSA 2A4HA 2CZ2A 5IMZA 2LTKA 4TXOB 2AUVA 4EO3A 1EOHA 1TDIA 3BOAA 3LEFA 1WJKA 2HLSA 3HZ8A 4X1UA 5IM9A 2R5GA 4YH2A 1QQ2A 5DBQA 5F05A 2L57A 2JZSA 4OO5A 1ACVA 1OVNA 3G9BA 2REMA 3GKKA 4IQAA 1OYJA 3A2VA 2H30A 3HXSA 2LJKA 4JRRA 4IELA 3DYRA 1N8JA 2N5AA 4EE0A 1PGTA 2L6CA 1HD2A 3PR8A 3TKSA 1T00A 1FHEA 2CX3A 3A5WA 3ZL5A 1J0FA 4LMWA 4JEDA 2C8UA 4FYUA 2H1GA 4KGIA 4XS6A 2FY6A 2H6YA 3F4SA 3HKRA 1PQNA 3BBYA 2MMZA 1DE1A 5DJMA 3M8NA 5E4WA 2DC5A 3DXBA 3TKSE 1HYUA 5LD0A 4BPYA 4KH7A 1K3OA 1B9XC 5DAKA 1V9WA 1RW1A 5J41A 2VIMA 2H1DA 2YWMA 4AF2A 4I5QA 4WXTA 1QK8A 1EP8A 2DJKA 2H0HA 5KN0A 1RQMA 2J23A 3L4NA 3L9VA 2HXKA 2PVQA 4BVYB 3GTUA 5F0GA 2UZ8A 2LNTA 1VRSD 3GN3A 4Q5RA 1ZCPA 3QFAC 4MJCA 1EP7A 3ZREA 1A2LA 5ECLB 4HQZA 4IP1A 2JU5A 3GUSA 4NV2A 1Y25A 3E9JB 3HD5A 4I97A 5DQYA 2I81A 13GSA 4MZCA 5GSTA 1T7PB 5A4WA 2F8FA 3GRXA 5E59A 1SK2A 5CNWA 1A8YA 3GIXA 4CDOA 2YJ7A 1FB6A 5J3RA 1BEDA 2HSMA 1SENA 1U87A 2H71A 1DUGA 2AV4A 2J9HA 4ZBAA 3VFIA 1FAAA 1R4WA 1BYEA 5DCHA 2DMLA 3IRAA 2YJHA 3DVWA 2YCDA 4KDXA 1GRXA 3F4TA 5JCGA 1TJDA 1F6MC 3CTFA 2VL2C 5KOWA 3KZQA 2AYTA 2HZEB 4IN0A 4MABA 3RBTA 2ZNMA 3QOUA 4BVXB 1PKWA 2JSYA 5GSSA 3LYPA 4IGJA 4NXIA 2MMAA 2QA1A 1K0MA 2LUSA 4OCEA 3ERFA 3IAM2 2RLIA 3M1GA 4BA7A 5IMFA 2C0DA 4V2LA 1A2MA 1GSQA 3VURA 2RM5A 4L0UA 4BWSA 1V40A 1A0RP 1M7TA 3US3A 4TR3A 3EU3A 2YZUA 3A2XA 1ZGNA 3ZFLA 1TXXA 4K5SA 4ID0A 4G9HA 1WPIA 4MDCA 4WEYA 1EV4A 3WGXA 3ZYWA 2IMIA 3CRTA 5JCUA 3CQFA 1M2AA 4HUAA 3ZRDA 1JZOA 1GUHA 2VM2A 1EOGA 3HVVA 4PUFC 3TOUA 2EIQA 2K18A 4TW5A 1U88A 2KP1A 1GUMA 3IR4A 4MF5A 1FOVA 2P0GA 1KNGA 2VUPA 1OKTA 3EWLA 2P31A 4KW6A 1WRYA 4PXOA 2B5EA 1X5CA 2LQQA 2RUEA 2H8LA 2V41A 3APOA 3UL3A 3KH7A 2A2RA 3FZ9A 2M46A 3ZIJA 1USBA 4TR1B 4CW9A 19GSA 1SK0A 2LEGA 4KNDA 1VF2A 1O7UA 3ERGA 1WE0A 2DMMA 1GWCA 1XCCA 1TRVA 3TJBA 3OR5A 3KMNA 2NPBA 4F2IA 2H70A 1QMVA 3MWHA 4GXZA 4KCEA 1Z5YE 5IIZA 3H79A 2OKAA 3O3TA 22GSA 1GTBA 3PH9A 1XBSA 5CRDA 2VLUA 1XWBA 3FKFA 5FHIA 1PFOA 4O5RA 1K0AA 2V6KA 3CXGA 4QL9A 2G0FA 1PL2A 3ISOA 2WULA 4HU7A 3BD2A 3PGTA 4J2FA 5B6NA 3HVSA 2IPAA 3C8EA 5B8BA 4GWRA 1M0UA 5D73A 3FR6A 1HQOA 3DRNA 2L5OA 1EEJA 1MD4A 2IMFA 3EVIA 2PPTA 3QAGA 1UVZA 3WT1A 4RI7A 1OKDA 1O8WA 2BMXA 1AC1A 1DSBA 5AN1A 1M2DA 3ED3A 5F8BA 3QMXA 3F0IA 2H1BA 4BIKA 1OC9B 4GLTA 3VWXA 3ZVJA 1PL1A 2C3QA 5G2ZA 3J7Yk 1S3AA 2X49A 5IMVA 1SKWB 4ZXGA 5AIXA 4HOJA 3EMXA 3CBUA 3JCML 5B8AA 1BX9A 4HU9A 5J4UA 1FW1A 4F82A 1G6WA 3TJGA 5B7CA 3PPUA 3IAS2 1KEBA 3QPMA 2LRTA 1HNAA 1XG8A 1PX6A 2D2ZA 1F37A 1ABAA 4HEA2 2ZUPA 1A2JA 2OE0A 2X8CA 5HFGA 1XWGA 3W6GA 4YKGA 4MLYA 4K0NA 2VCZA 2C3NA 3L9SA 2C1YA 12GSA 2JADA 3FRCA 3GH6A 3P8WA 1ZYEA 2WGRA 5CRHA 3W8SA 3ERWA 3FYGA 5B6MA 1I9DA 2QSIA 5KN1A 1XZOA 3UMAA 4KF9A 1I5GA 3TKPA 4I2TA 3A2WA 1O6JA 2E0QA 2E2GA 3IDVA 3F6FA 2E2MA 3WT2A 5ID2A 4PQHA 1FG4A 1VF4A 1GSUA 3F9UA 3A3TA 2RM6A 1TKDB 1RK4A 4FYBA 2PVOC 5J9BA 1TTZA 1XXUA 2HNLA 5G5FA 2FWHA 4PNFA 2FWFA 3DEXA 3EU4A 2OBKA 2HI7A 3GSTA 2PERA 3RDWA 4GSNA 1GSEA 3VI7A 2WB9A 4BL7B 1V98A 1JFUA 3D6IA 4G0LA 1Z6MA 3FEUA 3LORA 5H5SA 4DEJA 3EYTA 5KOXA 1TRUA 2IL3A 3DGQA 3E0UA 5ECMB 4EVMA 5A5KA 1GUKA 2B5XA 4AJ7A 1THXA 2YN1A 2O7KA 4V2MA 4O92A 4D73B 17GSA 3HVXA 4PQIA 2CVDA 1TRSA 1TW9A 4LL1B 1URMA 4FIWA 3RHCA 5CAXA 2HRFA 1T4YA 4XTSA 3MAKA 4MF6A 3QD9A 5DALB 3WD6A 1PN9A 4ICYA 4CHSA 2O85A 1YZXA 4IVFA 5D93A 4ULXA 1K0NA 4GSSA 5HR1A 2X99A 3FY7A 3VWWA 1HNCA 1YKAA 4YQUA 1A24A 2GZYA 3LYKA 1SU9A 4TR4A 4KUNA 4MJBA 1R26A 3Q6OA 4WBRD 4K8MA 4BWQA 4K7OA 3FW2A 2JZRA 5DCGA 4KX4A 1FVKA 4AGSA 1WMJA 1JHBA 3DIEA 1XVQA 4JR6A
chains in the Genus database with same CATH topology
5HQPA 2LQOA 4EIQA 3V1WA 1BAYA 3SWLA 2B1KA 3I6AA 2MBSA 3U5RE 2B5YA 2GSTA 5H5QA 2V6OA 1VGLA 2V32A 3C71A 1SJIA 1XWKA 4XIHA 2F8AA 2RIIA 2CV4A 3HYPA 3UEMA 1GSDA 3UBKA 1PD21 1AUCA 1TI1A 2FHEA 3IBHA 5EPFA 2EIOA 2YOIA 2FCHA 2JZTA 2GSSA 3N9JA 1M9BA 3I43A 3DVXA 3M0FA 4H86A 2R2JA 2WZ9A 4O5UA 1M99A 1G6YA 4CY6A 4YQVA 2H72A 2A2SA 4K0GA 2KP2A 4GTUA 1ZYNA 9GSSA 4F03A 2WS2A 6GSTA 4XS4A 3F3RA 5CP1A 2H74A 4LMVA 1Z3EA 2CAIA 3U6VA 1O73A 3IE3A 2H0GA 2DIYA 4POKA 1B4PA 2YNXA 1KTEA 4KSOA 3FZAA 2VM1A 3W8JA 1N2AA 2VCXA 1TI3A 3D22A 4ML1A 1K0BA 2I1UA 2ZCTA 1MDJA 3APQA 3KP9A 1FOHA 2H01A 3TDGA 4E8EA 2IN3A 4XCSA 3HHVA 2GQMA 2JL4A 2HT9A 3EINA 3G7IA 5AGYA 1K3YA 3GNJA 1JLVA 3TJJA 1MEKA 3TJKA 3GKMA 4HJMA 2CA8A 1ZL9A 3K8NA 1A0FA 2KHPA 4EL1A 5ECKB 3TRPA 4EF0A 18GSA 2A2PA 2LS5A 4ZBDA 3M9KA 2LV3A 1GNWA 4GF0A 5IO0A 3RHBA 11GSA 3L0HA 2KUCA 5H5RA 4K6XA 5BRTA 1X5DA 3HDCA 5D96A 2PGTA 3VLNA 1MD3A 4DVCA 2IWTA 4OCFA 6GSYA 1TK8B 4MF7A 5HR3A 1EV9A 2TRCP 2ALBA 4JR4A 3DWVA 2PBJA 4J56E 4K2XA 4FH8A 1FVJA 2R37A 4HQSA 1VF3A 2TIRA 4Z2TA 1GTUA 4GQCA 4J57E 2DIZA 3CTGA 4WBJA 3WYWA 3LFLA 5GAND 2VD1A 3BCIA 1YDKA 6GSXA 1XOBA 2G2QA 1GNEA 4HJ2A 4E8HA 1T1VA 4FYCA 1EGRA 5IO2A 2VLVA 4HI7A 1K0DA 4USSA 4MP4A 3F4RA 3F8UA 2CT6A 2L5LA 2V1MA 3C7MA 3QR6A 3IK9A 3C73A 1GLQA 1OC8A 1ON4A 1Z9HA 2HRNA 5D9XA 4YAPA 5DJLA 3NIVA 2PUKC 4TVEA 2FA4A 5G31A 3LXZA 2OBIA 5HFKA 4F0CA 2K8VA 5D9WA 1UA5A 1ZMAA 3KGKA 4NHZA 2DKIA 4F9ZA 3P7XA 4X4JA 2YPMA 4PURA 4DSSB 2AAWA 2ON7A 2RUFA 3GMFA 1J08A 4TXOA 4JE1A 2C80A 3KTBA 4V2NA 2I9HA 1JZWA 4TOPA 4OFNA 4FO5A 6GSSA 3EMPA 2IFQB 1YY7A 1GL8A 1O85A 3RPNA 3D21A 1PN0A 3AY8A 4N0ZA 2VCWA 3RPPA 2VLTA 5FWGA 2A4VA 1ERUA 2H66A 1JLWA 3RAZA 3IPZA 5DVBA 3FR9A 4ACSA 10GSA 1M9AA 2VL2A 3D5JA 2R3XA 2PN8A 1IYHA 5A4UA 3CRUA 1MTCA 1HNBA 1PKZA 1WOUA 2PU9C 1GH2A 1DBYA 6GSVA 5G5EA 2IIYA 1M2BA 4MJAA 3P2AA 4WR4A 1ERVA 1AXDA 2LKUA 1EEMA 3BJ5A 4JZQA 4OWYA 3BCKA 3IHGA 2B6MA 1F3AA 5AIVA 1W89A 3IK7A 1ZYPA 2HSHA 4Q5FA 1U6TA 4I2UA 2I4AA 2B7JA 3UARA 1NSWA 1TU8A 2BTOT 4EDYA 1E2YA 2X4AA 2C0GA 1SKRB 4RI6A 2NTOA 1DE2A 3KTLA 3QDNA 3UIWA 1SKSB 2GSRA 2VL3A 4TN8A 3ZIVA 1YEPA 2H19A 2O8VB 1QUWA 5ABRA 2C0EA 2B7KA 2K6VA 2HSYA 2VD0A 2FNOA 2C3TA 5IMDA 1GSSA 1AW9A 1OAZA 1GLPA 3FHKA 5L71A 4PUAA 4BVYA 3H1NA 3F6DA 1O8XA 4GSTA 1ERWA 1G0TA 3F3QA 1IYIA 2R0PA 2YWOA 2H0IA 2F9SA 5DDLA 4HDEA 4IHUA 4YKFA 2DKHA 1PX7A 2BJXA 4MA9A 3WGDA 4K7NA 4ECCA 2GZPA 1QXHA 5DAKB 4K7IA 2WFCA 16GSA 3EC3A 5F07A 2LRNA 2JACA 1GTAA 5ECIB 4GRFA 1XVWA 5D8IA 4POLA 3KD0A 3CMIA 2HZEA 5CYYA 4BVXA 1XW9A 4K2DA 3FZ4A 5ENUA 3ZVJD 3IV4A 1SYRA 2OJLA 2X8GA 4RQRA 5CRWA 4WKWA 5ECOB 2I3YA 1GP1A 1U3IA 3VPTA 1W4VA 5EL8A 5D9TA 2HZFA 2LJAA 2R4VA 3VWVA 4NAXA 1Z6NA 3LSZA 3ZITA 1NM3A 1A23A 4K5RA 3GFKA 3MDKA 3HJMA 1R5AA 3H8QA 3P90A 4ZL8A 4ILFA 4YAVA 4ZILA 4N11A 2YV9A 1JZRA 4NHWA 3SBCA 2H6XA 1X9MB 1U3AA 2FD3A 1VF1A 3GV1A 3TKSC 5KEJA 4FQUA 1XW6A 4G19A 2LJRA 1YEXA 2C0FA 4F0BA 1KBNA 1GSFA 1XWCA 3UAPA 4KSMA 3A5IA 2N5FA 4TR1A 2CVBA 1XWAA 3LWAA 5HR2A 4G0KA 5C00A 2GQKA 4ISDA 1ZYQB 2F51A 4QQ7A 4WETA 4EXJA 4IP6A 5IOWA 2VCVA 4O7HA 4MCUA 1LU4A 4I8BA 2YWNA 5JCWA 2F3MA 3EURA 4JBBA 5FT3A 4EIPA 2EC4A 1TK0B 5COHA 4AJ6A 4OD7A 3FK8A 3GX0A 5G1LA 2QKEA 4DSRA 4ZB9A 4P3YB 3C1SA 4WF5A 3C1RA 2OACA 1CQHA 2GDRA 3GL5A 1ZZYA 2M72A 3MNGA 3UJ1A 4NMUA 2DJ2A 1K0OA 4KE3A 1C72A 3QCPA 1SYXA 3NZNA 4Z7XA 2YZHA 1Z7PA 4OMVA 3ZTLA 3UBLA 1AQWA 3O6TA 4RUVA 3VI5A 1PA3A 3N5OA 2R0CA 4PX1A 5BMUA 4MMMA 3G7YA 2IMKA 1YJ6A 2GSQA 3F63A 1X0RA 2GGTA 4N30A 4PNGA 2TRXA 3VWUA 1BG5A 3EE2A 3ZMKA 3HY2A 2LNSA 5CREA 4ML6A 4IS0A 4IJIA 5IMAA 1OC9A 4Q5QA 1SL2B 3KXOA 2N5BA 3QFBC 4MJEA 3VK9A 1PMTA 2QC7A 4O5QA 2DBCA 3D0ZA 3O76A 3KEBA 1T3BA 3ZZXA 2MYGA 3IXRA 4POBA 4OO4A 2OE3A 5IQYA 2YWIA 4O32A 1EGOA 3WGEA 4EKZA 4ECJA 2C4JA 1WP0A 3TKRA 2H76A 5DQSA 3DD3A 1YF0A 1H75A 3HA9A 2MBTA 20GSA 2MMNA 4Q5NA 1AQVA 3GH9A 3GL3A 1TOFA 3TCOA 2FUG2 1AIUA 4KDUA 4EDZA 3CYNA 3IHQA 3TKQA 1OE7A 2NBSA 2X64A 4V1Ap 1AAZA 4KDYA 5HR0A 4N0VA 2WRTA 4L5LA 2IMDA 6GSUA 1Q4JA 1XW5A 1QFNA 3GSSA 2L4QA 5IOXA 1PSQA 4GCIA 3M3MA 2YV7A 3ZFBA 1ZOFA 5G1KA 1V58A 2P5RA 1XIYA 4ZIJA 4OFMA 3EPTA 1A8LA 5HFIA 3Q19A 5IPGA 3IC8A 1X9SB 1GULA 3ZLPA 2QGVA 4G2EA 4X0XA 2B1LA 4MPGA 4BL7A 1J9BA 1CQGA 4DSQA 2CQ9A 3MYDA 2H75A 3LW9A 4MZBA 3KJYA 5ECNB 1TK5B 2OADA 3HJPA 2KOKA 3D4TA 1OC3A 3GX8A 3CSJA 3J7Yb 4ECIA 4L0WA 5CO3A 2L4CA 2IJYA 1B48A 4HZ2A 1FO5A 4MH2A 2OA7A 4D73A 3KM6A 1YF1A 3E3EA 3HZ4A 2XBIA 2HRKA 2OE1A 5DALA 5ID2B 2FGXA 2VOCA 4PGTA 1Y6EA 3GURA 4XHMA 1WWJA 5IPHA 4KA0A 1K3LA 2R6KA 2GTUA 2R0GA 4MPFA 4POMA 1NW2A 5KN2A 3S9FA 3LGCA 3VPQA 5J9CA 3TJFA 1ST9A 3ZMLA 2AJQB 1SK1A 1AQXA 1K0CA 3H4KA 2DLXA 3KMOA 2E7PA 3FZ5A 3R3EA 5AISA 2M80A 4ECBA 2ON5A 3IA1A 2H1AA 5GAPD 4K9ZA 4CY8A 1YQ1A 2EIRA 1UN2A 1GSYA 1EZKA 4PQ1A 2HE3A 3GKXA 1ML6A 4HZ4A 2FA8A 2QA2A 1EWXA 1LBKA 2GT5A 1THOA 2GVPA 1TRWA 4Z2RA 2NVLA 1B4QA 3GKNA 5JWRB 2DJ1A 3UOMA 3APSA 5EVOA 2Z9SA 3L9UA 3D4MA 3FR3A 1SD9A 4Z2UA 4A5PA 2YP6A 4IW9A 2VO4A 1TU7A 3CSIA 4YQMA 4KB3A 2MZCA 4JU5A 1XOAA 1MDKA 1T4ZA 5JWQB 2P5QA 3ME8A 1R7HA 5IMCA 5J5NA 3GA4A 2CX4A 2HRAA 1SL1B 1T8EB 4I6XA 4TXVA 1OE8A 4G0IA 3TUEA 5G30A 4ZL7A 1WIKA 5ECQB 3ME7A 4L5OA 2XPEA 4LA1A 5ECPB 2PMTA 1R5PA 2AB6A 1UC7A 4EC0A 2CZ3A 1QGVA 3MIXA 2WCIA 1GTIA 2GS3A 2VCQA 2H73A 4G10A 3I69A 2VL9A 1ERTA 1F3BA 2KLXA 3I9V2 4MH3A 1XPVA 3CSHA 1E6BA 3R2QA 3GHAA 4ZL9A 3Q74A 4NV5A 4IKHA 1XFLA 3TRQA 2DJ3A 3LG6A 4XS4B 5F06A 3H93A 1S3CA 1SL0B 1NHOA 2DJ0A 2LRCA 3DKSA 4IQ1A 4PTSA 4TR0A 1NHYA 1B9YC 3FMWA 1V2AA 1MDIA 2XHFA 1F2EA 3TB2A 4TRXA 3L78A 4TKYA 3TRXA 4LLRA 8GSSA 4IBPA 4XRDA 1O81A 5D9VA 1LJRA 3LXTA 5ELGA 2GT6A 2HYXA 2MMOA 3GTUB 3HJOA 1SJ6A 2GZZA 1BQ7A 2O89A 5EY6A 2VCTA 1FB0A 1B8XA 4ZB8A 1BJXA 4NPBA 4ZB6A 2FWGA 3DMLA 2FWEA 2H6ZA 4N10A 4OFTA 5CRGA 1SD8A 6GSWA 2K9FA 2GQLA 5C04A 5ECHB 2B3SA 4V1Ag 2L6DA 3KH9A 3IC4A 3LJRA 3TOTA 7GSSA 2FLSA 4ZBBA 2ES7A 5INYA 2HFDA 2GLRA 1G7OA 1S3DA 3QAWA 4IJ3A 4XRAA 1TP9A 3G7JA 4RQXA 5LCZA 1H4OA 4K1FA 1PRXA 2CVKA 5ECSA 2O87A 2L59A 2PWJA 3KIJA 3UVTA 2X8HA 1Q98A 5JWOB 1SJZA 3TGZA 1JZDA 1ILOA 3HCZA 2V2GA 4AJ8A 2NDOA 4KAEA 4XS1A 3NOFA 4MZWA 3MSZA 4KCAA 3UVHA 1X9WB 3KCMA 2DJJA 2WJUA 4QL7A 1Z7RA 2VAFA 2AHEA 5GZZB 2XBQA 4DSSA 5ECRB 4MK3A 1V57A 5KN3A 4EUYA 3GYKA 2YANA 2XPDA 3Q18A 2K8SA 3LQ7A 2IFQA 1X5EA 2LSTA 4LL4B 4WR5A 1F9MA 4X43A 4HS1A 2WDUA 5ELAA 5A4VA 4MNNA 3PINA 2IMEA 2JSZA 3KP8A 4L8EA 5LNKe 4GQFA 2DSAA 1G7EA 4NWYA 14GSA 4WF4A 2CAQA 3M9JA 2XC2A 3QAVA 1YKCA 3IOSA 2A4HA 2CZ2A 5IMZA 2LTKA 4TXOB 2AUVA 4EO3A 1EOHA 1TDIA 3BOAA 3LEFA 1WJKA 2HLSA 3HZ8A 4X1UA 5IM9A 2R5GA 4YH2A 1QQ2A 5DBQA 5F05A 2L57A 2JZSA 4OO5A 1ACVA 1OVNA 3G9BA 2REMA 3GKKA 4IQAA 1OYJA 3A2VA 2H30A 3HXSA 2LJKA 4JRRA 4IELA 3DYRA 1N8JA 2N5AA 4EE0A 1PGTA 2L6CA 1HD2A 3PR8A 3TKSA 1T00A 1FHEA 2CX3A 3A5WA 3ZL5A 1J0FA 4LMWA 4JEDA 2C8UA 4FYUA 2H1GA 4KGIA 4XS6A 2FY6A 2H6YA 3F4SA 3HKRA 1PQNA 3BBYA 2MMZA 1DE1A 5DJMA 3M8NA 5E4WA 2DC5A 3DXBA 3TKSE 1HYUA 5LD0A 4BPYA 4KH7A 1K3OA 1B9XC 5DAKA 1V9WA 1RW1A 5J41A 2VIMA 2H1DA 2YWMA 4AF2A 4I5QA 4WXTA 1QK8A 1EP8A 2DJKA 2H0HA 5KN0A 1RQMA 2J23A 3L4NA 3L9VA 2HXKA 2PVQA 4BVYB 3GTUA 5F0GA 2UZ8A 2LNTA 1VRSD 3GN3A 4Q5RA 1ZCPA 3QFAC 4MJCA 1EP7A 3ZREA 1A2LA 5ECLB 4HQZA 4IP1A 2JU5A 3GUSA 4NV2A 1Y25A 3E9JB 3HD5A 4I97A 5DQYA 2I81A 13GSA 4MZCA 5GSTA 1T7PB 5A4WA 2F8FA 3GRXA 5E59A 1SK2A 5CNWA 1A8YA 3GIXA 4CDOA 2YJ7A 1FB6A 5J3RA 1BEDA 2HSMA 1SENA 1U87A 2H71A 1DUGA 2AV4A 2J9HA 4ZBAA 3VFIA 1FAAA 1R4WA 1BYEA 5DCHA 2DMLA 3IRAA 2YJHA 3DVWA 2YCDA 4KDXA 1GRXA 3F4TA 5JCGA 1TJDA 1F6MC 3CTFA 2VL2C 5KOWA 3KZQA 2AYTA 2HZEB 4IN0A 4MABA 3RBTA 2ZNMA 3QOUA 4BVXB 1PKWA 2JSYA 5GSSA 3LYPA 4IGJA 4NXIA 2MMAA 2QA1A 1K0MA 2LUSA 4OCEA 3ERFA 3IAM2 2RLIA 3M1GA 4BA7A 5IMFA 2C0DA 4V2LA 1A2MA 1GSQA 3VURA 2RM5A 4L0UA 4BWSA 1V40A 1A0RP 1M7TA 3US3A 4TR3A 3EU3A 2YZUA 3A2XA 1ZGNA 3ZFLA 1TXXA 4K5SA 4ID0A 4G9HA 1WPIA 4MDCA 4WEYA 1EV4A 3WGXA 3ZYWA 2IMIA 3CRTA 5JCUA 1M2AA 4HUAA 3ZRDA 1JZOA 1GUHA 2VM2A 1EOGA 3HVVA 4PUFC 3TOUA 2EIQA 2K18A 4TW5A 1U88A 2KP1A 1GUMA 3IR4A 4MF5A 1FOVA 2P0GA 1KNGA 2VUPA 1OKTA 3EWLA 2P31A 4KW6A 1WRYA 4PXOA 2B5EA 1X5CA 2LQQA 2RUEA 2H8LA 2V41A 3APOA 3UL3A 3KH7A 2A2RA 3FZ9A 2M46A 3ZIJA 1USBA 4TR1B 4CW9A 19GSA 1SK0A 2LEGA 4KNDA 1VF2A 1O7UA 3ERGA 1WE0A 2DMMA 1GWCA 1XCCA 1TRVA 3TJBA 3OR5A 3KMNA 2NPBA 4F2IA 2H70A 1QMVA 3MWHA 4GXZA 4KCEA 1Z5YE 5IIZA 3H79A 2OKAA 3O3TA 22GSA 1GTBA 3PH9A 1XBSA 5CRDA 2VLUA 1XWBA 3FKFA 5FHIA 4O5RA 1K0AA 2V6KA 3CXGA 4QL9A 2G0FA 1PL2A 3ISOA 2WULA 4HU7A 3BD2A 3PGTA 4J2FA 5B6NA 3HVSA 2IPAA 3C8EA 5B8BA 4GWRA 1M0UA 5D73A 3FR6A 1HQOA 3DRNA 2L5OA 1EEJA 1MD4A 2IMFA 3EVIA 2PPTA 3QAGA 1UVZA 3WT1A 4RI7A 1OKDA 1O8WA 2BMXA 1AC1A 1DSBA 5AN1A 1M2DA 3ED3A 5F8BA 3QMXA 3F0IA 2H1BA 1OC9B 4GLTA 3VWXA 3ZVJA 1PL1A 2C3QA 5G2ZA 3J7Yk 1S3AA 2X49A 5IMVA 1SKWB 4ZXGA 5AIXA 4HOJA 3EMXA 3CBUA 3JCML 5B8AA 1BX9A 4HU9A 5J4UA 1FW1A 4F82A 1G6WA 3TJGA 5B7CA 3PPUA 3IAS2 1KEBA 3QPMA 2LRTA 1HNAA 1PX6A 2D2ZA 1F37A 1ABAA 4HEA2 2ZUPA 1A2JA 2OE0A 2X8CA 5HFGA 1XWGA 3W6GA 4YKGA 4MLYA 4K0NA 2VCZA 2C3NA 3L9SA 2C1YA 12GSA 2JADA 3FRCA 3GH6A 3P8WA 1ZYEA 2WGRA 5CRHA 3W8SA 3ERWA 3FYGA 5B6MA 1I9DA 2QSIA 5KN1A 1XZOA 3UMAA 4KF9A 1I5GA 3TKPA 4I2TA 3A2WA 1O6JA 2E0QA 2E2GA 3IDVA 3F6FA 2E2MA 3WT2A 5ID2A 4PQHA 1FG4A 1VF4A 1GSUA 3F9UA 3A3TA 2RM6A 1TKDB 1RK4A 4FYBA 2PVOC 5J9BA 1TTZA 1XXUA 2HNLA 5G5FA 2FWHA 4PNFA 2FWFA 3DEXA 3EU4A 2OBKA 2HI7A 3GSTA 2PERA 3RDWA 4GSNA 1GSEA 3VI7A 2WB9A 4BL7B 1V98A 1JFUA 3D6IA 4G0LA 1Z6MA 3FEUA 3LORA 5H5SA 4DEJA 3EYTA 5KOXA 1TRUA 2IL3A 3DGQA 3E0UA 5ECMB 4EVMA 5A5KA 1GUKA 2B5XA 4AJ7A 1THXA 2YN1A 2O7KA 4V2MA 4O92A 4D73B 17GSA 3HVXA 4PQIA 2CVDA 1TRSA 1TW9A 4LL1B 1URMA 4FIWA 3RHCA 5CAXA 2HRFA 1T4YA 4XTSA 3MAKA 4MF6A 3QD9A 5DALB 3WD6A 1PN9A 4ICYA 4CHSA 2O85A 1YZXA 4IVFA 5D93A 4ULXA 1K0NA 4GSSA 5HR1A 2X99A 3FY7A 3VWWA 1HNCA 1YKAA 4YQUA 1A24A 2GZYA 3LYKA 1SU9A 4TR4A 4KUNA 4MJBA 1R26A 3Q6OA 4WBRD 4K8MA 4BWQA 4K7OA 3FW2A 2JZRA 5DCGA 4KX4A 1FVKA 4AGSA 1WMJA 1JHBA 3DIEA 1XVQA 4JR6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HQP A;  2LQO A;  3V1W A;  1BAY A;  3SWL A;  2B1K A;  3I6A A;  2MBS A;  3U5R E;  2B5Y A;  2GST A;  5H5Q A;  2V6O A;  1VGL A;  2V32 A;  3C71 A;  1SJI A;  1XWK A;  4XIH A;  2F8A A;  2RII A;  2CV4 A;  3HYP A;  3UEM A;  1GSD A;  3UBK A;  1PD2 1;  1AUC A;  1TI1 A;  2FHE A;  3IBH A;  5EPF A;  2EIO A;  2YOI A;  2FCH A;  2JZT A;  2GSS A;  3N9J A;  1M9B A;  3I43 A;  3DVX A;  3M0F A;  4H86 A;  2R2J A;  2WZ9 A;  1M99 A;  1G6Y A;  4YQV A;  2H72 A;  2A2S A;  4K0G A;  2KP2 A;  4GTU A;  9GSS A;  4F03 A;  2WS2 A;  6GST A;  4XS4 A;  3F3R A;  5CP1 A;  2H74 A;  4LMV A;  1Z3E A;  2CAI A;  3U6V A;  1O73 A;  3IE3 A;  2H0G A;  2DIY A;  4POK A;  1B4P A;  2YNX A;  1KTE A;  4KSO A;  3FZA A;  2VM1 A;  3W8J A;  1N2A A;  2VCX A;  1TI3 A;  3D22 A;  4ML1 A;  1K0B A;  2I1U A;  2ZCT A;  1MDJ A;  3APQ A;  3KP9 A;  2H01 A;  3TDG A;  4E8E A;  2IN3 A;  4XCS A;  3HHV A;  2GQM A;  2JL4 A;  2HT9 A;  3EIN A;  3G7I A;  5AGY A;  1K3Y A;  3GNJ A;  1JLV A;  3TJJ A;  1MEK A;  3TJK A;  3GKM A;  4HJM A;  2CA8 A;  1ZL9 A;  3K8N A;  1A0F A;  2KHP A;  4EL1 A;  5ECK B;  3TRP A;  4EF0 A;  18GS A;  2LS5 A;  4ZBD A;  3M9K A;  2LV3 A;  1GNW A;  4GF0 A;  5IO0 A;  3RHB A;  11GS A;  3L0H A;  2KUC A;  5H5R A;  4K6X A;  1X5D A;  3HDC A;  5D96 A;  2PGT A;  3VLN A;  1MD3 A;  4DVC A;  2IWT A;  4OCF A;  6GSY A;  1TK8 B;  4MF7 A;  5HR3 A;  1EV9 A;  2TRC P;  2ALB A;  4JR4 A;  3DWV A;  2PBJ A;  4J56 E;  4FH8 A;  1FVJ A;  2R37 A;  4HQS A;  1VF3 A;  2TIR A;  1GTU A;  4GQC A;  4J57 E;  2DIZ A;  3CTG A;  4WBJ A;  3WYW A;  3LFL A;  5GAN D;  2VD1 A;  3BCI A;  1YDK A;  6GSX A;  1XOB A;  2G2Q A;  1GNE A;  4HJ2 A;  4E8H A;  1T1V A;  4FYC A;  1EGR A;  5IO2 A;  2VLV A;  4HI7 A;  1K0D A;  4MP4 A;  3F4R A;  3F8U A;  2CT6 A;  2L5L A;  2V1M A;  3C7M A;  3QR6 A;  3IK9 A;  3C73 A;  1GLQ A;  1OC8 A;  1ON4 A;  1Z9H A;  2HRN A;  5D9X A;  4YAP A;  5DJL A;  3NIV A;  2PUK C;  4TVE A;  2FA4 A;  5G31 A;  3LXZ A;  2OBI A;  5HFK A;  4F0C A;  2K8V A;  5D9W A;  1UA5 A;  1ZMA A;  3KGK A;  4NHZ A;  4F9Z A;  3P7X A;  2YPM A;  4PUR A;  4DSS B;  2AAW A;  2ON7 A;  2RUF A;  3GMF A;  1J08 A;  4TXO A;  4JE1 A;  2C80 A;  3KTB A;  4V2N A;  2I9H A;  1JZW A;  4TOP A;  4OFN A;  4FO5 A;  6GSS A;  3EMP A;  2IFQ B;  1YY7 A;  1GL8 A;  1O85 A;  3RPN A;  3D21 A;  3AY8 A;  4N0Z A;  2VCW A;  3RPP A;  2VLT A;  5FWG A;  2A4V A;  1ERU A;  2H66 A;  1JLW A;  3RAZ A;  3IPZ A;  5DVB A;  3FR9 A;  4ACS A;  10GS A;  1M9A A;  2VL2 A;  3D5J A;  2R3X A;  2PN8 A;  1IYH A;  5A4U A;  3CRU A;  1MTC A;  1HNB A;  1PKZ A;  1WOU A;  2PU9 C;  1GH2 A;  1DBY A;  6GSV A;  5G5E A;  2IIY A;  1M2B A;  4MJA A;  3P2A A;  4WR4 A;  1ERV A;  1AXD A;  2LKU A;  1EEM A;  3BJ5 A;  4JZQ A;  4OWY A;  3BCK A;  2B6M A;  1F3A A;  5AIV A;  1W89 A;  3IK7 A;  2HSH A;  4Q5F A;  1U6T A;  4I2U A;  2I4A A;  2B7J A;  3UAR A;  1NSW A;  1TU8 A;  2BTO T;  4EDY A;  1E2Y A;  2C0G A;  1SKR B;  4RI6 A;  2NTO A;  1DE2 A;  3KTL A;  3QDN A;  3UIW A;  1SKS B;  2GSR A;  2VL3 A;  4TN8 A;  3ZIV A;  1YEP A;  2H19 A;  2O8V B;  1QUW A;  5ABR A;  2C0E A;  2B7K A;  2K6V A;  2HSY A;  2VD0 A;  2FNO A;  2C3T A;  5IMD A;  1GSS A;  1AW9 A;  1OAZ A;  1GLP A;  3FHK A;  5L71 A;  4PUA A;  4BVY A;  3H1N A;  3F6D A;  1O8X A;  4GST A;  1ERW A;  1G0T A;  3F3Q A;  1IYI A;  2YWO A;  2H0I A;  2F9S A;  5DDL A;  4HDE A;  4IHU A;  1PX7 A;  2BJX A;  4MA9 A;  3WGD A;  4K7N A;  4ECC A;  2GZP A;  1QXH A;  5DAK B;  4K7I A;  2WFC A;  16GS A;  3EC3 A;  5F07 A;  2LRN A;  2JAC A;  1GTA A;  5ECI B;  4GRF A;  1XVW A;  5D8I A;  4POL A;  3KD0 A;  3CMI A;  2HZE A;  5CYY A;  4BVX A;  1XW9 A;  4K2D A;  3FZ4 A;  5ENU A;  3ZVJ D;  3IV4 A;  1SYR A;  2OJL A;  2X8G A;  4RQR A;  5CRW A;  4WKW A;  5ECO B;  2I3Y A;  1GP1 A;  1U3I A;  3VPT A;  1W4V A;  5EL8 A;  5D9T A;  2HZF A;  2LJA A;  2R4V A;  3VWV A;  4NAX A;  1Z6N A;  3LSZ A;  3ZIT A;  1NM3 A;  1A23 A;  3GFK A;  3MDK A;  3HJM A;  1R5A A;  3H8Q A;  3P90 A;  4ZL8 A;  4ILF A;  4YAV A;  4ZIL A;  4N11 A;  2YV9 A;  1JZR A;  4NHW A;  3SBC A;  2H6X A;  1X9M B;  1U3A A;  2FD3 A;  1VF1 A;  3GV1 A;  3TKS C;  5KEJ A;  1XW6 A;  4G19 A;  2LJR A;  1YEX A;  2C0F A;  4F0B A;  1KBN A;  1GSF A;  1XWC A;  3UAP A;  4KSM A;  4TR1 A;  2N5F A;  2CVB A;  1XWA A;  3LWA A;  5HR2 A;  5C00 A;  2GQK A;  4ISD A;  1ZYQ B;  2F51 A;  4QQ7 A;  4WET A;  4EXJ A;  4IP6 A;  5IOW A;  2VCV A;  4O7H A;  4MCU A;  1LU4 A;  4I8B A;  2YWN A;  5JCW A;  2F3M A;  3EUR A;  4JBB A;  5FT3 A;  2EC4 A;  1TK0 B;  5COH A;  4AJ6 A;  4OD7 A;  3FK8 A;  3GX0 A;  5G1L A;  2QKE A;  4DSR A;  4ZB9 A;  4P3Y B;  3C1S A;  4WF5 A;  3C1R A;  2OAC A;  1CQH A;  2GDR A;  3GL5 A;  1ZZY A;  2M72 A;  3MNG A;  3UJ1 A;  4NMU A;  2DJ2 A;  1K0O A;  4KE3 A;  1C72 A;  3QCP A;  1SYX A;  3NZN A;  4Z7X A;  2YZH A;  1Z7P A;  4OMV A;  3ZTL A;  3UBL A;  1AQW A;  3O6T A;  4RUV A;  3VI5 A;  1PA3 A;  3N5O A;  4PX1 A;  4MMM A;  3G7Y A;  2IMK A;  1YJ6 A;  2GSQ A;  3F63 A;  1X0R A;  2GGT A;  4N30 A;  4PNG A;  2TRX A;  3VWU A;  1BG5 A;  3EE2 A;  3ZMK A;  3HY2 A;  2LNS A;  5CRE A;  4ML6 A;  4IS0 A;  4IJI A;  5IMA A;  1OC9 A;  4Q5Q A;  1SL2 B;  3KXO A;  2N5B A;  3QFB C;  4MJE A;  3VK9 A;  1PMT A;  2QC7 A;  2DBC A;  3D0Z A;  3O76 A;  3KEB A;  1T3B A;  3ZZX A;  2MYG A;  3IXR A;  4POB A;  4OO4 A;  2OE3 A;  5IQY A;  2YWI A;  4O32 A;  1EGO A;  3WGE A;  4EKZ A;  4ECJ A;  2C4J A;  1WP0 A;  3TKR A;  2H76 A;  5DQS A;  3DD3 A;  1YF0 A;  1H75 A;  3HA9 A;  2MBT A;  20GS A;  2MMN A;  4Q5N A;  1AQV A;  3GH9 A;  3GL3 A;  1TOF A;  3TCO A;  2FUG 2;  1AIU A;  4KDU A;  4EDZ A;  3CYN A;  3IHQ A;  3TKQ A;  1OE7 A;  2NBS A;  2X64 A;  4V1A p;  1AAZ A;  4KDY A;  5HR0 A;  4N0V A;  2WRT A;  4L5L A;  2IMD A;  6GSU A;  1Q4J A;  1XW5 A;  1QFN A;  3GSS A;  2L4Q A;  5IOX A;  1PSQ A;  4GCI A;  3M3M A;  2YV7 A;  3ZFB A;  1ZOF A;  5G1K A;  1V58 A;  2P5R A;  1XIY A;  4ZIJ A;  4OFM A;  1A8L A;  5HFI A;  3Q19 A;  5IPG A;  1X9S B;  1GUL A;  3ZLP A;  2QGV A;  4G2E A;  4X0X A;  2B1L A;  4MPG A;  4BL7 A;  1J9B A;  1CQG A;  4DSQ A;  2CQ9 A;  2H75 A;  3KJY A;  4MZB A;  5ECN B;  1TK5 B;  2OAD A;  3HJP A;  2KOK A;  3D4T A;  1OC3 A;  3GX8 A;  3CSJ A;  3J7Y b;  4ECI A;  4L0W A;  5CO3 A;  2L4C A;  2IJY A;  1B48 A;  4HZ2 A;  1FO5 A;  4MH2 A;  2OA7 A;  4D73 A;  3KM6 A;  1YF1 A;  3E3E A;  3HZ4 A;  2XBI A;  2OE1 A;  5DAL A;  5ID2 B;  2FGX A;  2VOC A;  4PGT A;  1Y6E A;  3GUR A;  4XHM A;  1WWJ A;  5IPH A;  4KA0 A;  1K3L A;  2R6K A;  2GTU A;  4MPF A;  4POM A;  1NW2 A;  5KN2 A;  3S9F A;  3LGC A;  3VPQ A;  5J9C A;  3TJF A;  1ST9 A;  3ZML A;  2AJQ B;  1SK1 A;  1AQX A;  1K0C A;  3H4K A;  2DLX A;  3KMO A;  2E7P A;  3FZ5 A;  5AIS A;  2M80 A;  4ECB A;  2ON5 A;  3IA1 A;  2H1A A;  5GAP D;  4K9Z A;  1YQ1 A;  2EIR A;  1UN2 A;  1GSY A;  1EZK A;  4PQ1 A;  2HE3 A;  3GKX A;  1ML6 A;  4HZ4 A;  2FA8 A;  1EWX A;  1LBK A;  2GT5 A;  1THO A;  2GVP A;  1TRW A;  2NVL A;  1B4Q A;  3GKN A;  5JWR B;  2DJ1 A;  3UOM A;  3APS A;  5EVO A;  2Z9S A;  3L9U A;  3D4M A;  3FR3 A;  1SD9 A;  2YP6 A;  4IW9 A;  2VO4 A;  1TU7 A;  3CSI A;  4YQM A;  4KB3 A;  2MZC A;  4JU5 A;  1XOA A;  1MDK A;  1T4Z A;  5JWQ B;  2P5Q A;  3ME8 A;  1R7H A;  5IMC A;  5J5N A;  3GA4 A;  2CX4 A;  1SL1 B;  1T8E B;  4I6X A;  4TXV A;  1OE8 A;  3TUE A;  5G30 A;  4ZL7 A;  1WIK A;  5ECQ B;  3ME7 A;  4L5O A;  2XPE A;  4LA1 A;  5ECP B;  2PMT A;  1R5P A;  2AB6 A;  1UC7 A;  4EC0 A;  2CZ3 A;  1QGV A;  2WCI A;  1GTI A;  2GS3 A;  2VCQ A;  2H73 A;  4G10 A;  3I69 A;  2VL9 A;  1ERT A;  1F3B A;  2KLX A;  3I9V 2;  4MH3 A;  1XPV A;  3CSH A;  1E6B A;  3R2Q A;  3GHA A;  4ZL9 A;  3Q74 A;  4NV5 A;  4IKH A;  1XFL A;  3TRQ A;  2DJ3 A;  3LG6 A;  4XS4 B;  5F06 A;  3H93 A;  1S3C A;  1SL0 B;  1NHO A;  2DJ0 A;  2LRC A;  3DKS A;  4IQ1 A;  4TR0 A;  1NHY A;  1B9Y C;  1V2A A;  1MDI A;  2XHF A;  1F2E A;  3TB2 A;  4TRX A;  3L78 A;  4TKY A;  3TRX A;  4LLR A;  8GSS A;  4IBP A;  4XRD A;  1O81 A;  5D9V A;  1LJR A;  3LXT A;  5ELG A;  2GT6 A;  2HYX A;  2MMO A;  3GTU B;  3HJO A;  1SJ6 A;  2GZZ A;  1BQ7 A;  2O89 A;  5EY6 A;  2VCT A;  1FB0 A;  1B8X A;  4ZB8 A;  1BJX A;  4NPB A;  4ZB6 A;  2FWG A;  3DML A;  2FWE A;  2H6Z A;  4N10 A;  4OFT A;  5CRG A;  1SD8 A;  6GSW A;  2K9F A;  2GQL A;  5C04 A;  5ECH B;  2B3S A;  4V1A g;  2L6D A;  3KH9 A;  3IC4 A;  3LJR A;  3TOT A;  7GSS A;  2FLS A;  4ZBB A;  2ES7 A;  5INY A;  2HFD A;  2GLR A;  1G7O A;  1S3D A;  3QAW A;  4IJ3 A;  4XRA A;  1TP9 A;  3G7J A;  4RQX A;  5LCZ A;  1H4O A;  4K1F A;  1PRX A;  2CVK A;  5ECS A;  2O87 A;  2L59 A;  2PWJ A;  3KIJ A;  3UVT A;  2X8H A;  1Q98 A;  5JWO B;  1SJZ A;  3TGZ A;  1JZD A;  1ILO A;  3HCZ A;  2V2G A;  4AJ8 A;  2NDO A;  4KAE A;  4XS1 A;  3NOF A;  4MZW A;  3MSZ A;  4KCA A;  3UVH A;  1X9W B;  3KCM A;  2DJJ A;  2WJU A;  4QL7 A;  1Z7R A;  2VAF A;  2AHE A;  5GZZ B;  2XBQ A;  4DSS A;  5ECR B;  4MK3 A;  1V57 A;  5KN3 A;  4EUY A;  3GYK A;  2YAN A;  2XPD A;  3Q18 A;  2K8S A;  3LQ7 A;  2IFQ A;  1X5E A;  2LST A;  4LL4 B;  4WR5 A;  1F9M A;  4X43 A;  4HS1 A;  2WDU A;  5ELA A;  5A4V A;  3PIN A;  2IME A;  2JSZ A;  3KP8 A;  4L8E A;  5LNK e;  4GQF A;  2DSA A;  1G7E A;  4NWY A;  14GS A;  4WF4 A;  2CAQ A;  3M9J A;  2XC2 A;  3QAV A;  1YKC A;  3IOS A;  2CZ2 A;  5IMZ A;  2LTK A;  4TXO B;  2AUV A;  4EO3 A;  1EOH A;  1TDI A;  3BOA A;  3LEF A;  1WJK A;  2HLS A;  3HZ8 A;  4X1U A;  5IM9 A;  2R5G A;  4YH2 A;  1QQ2 A;  5DBQ A;  5F05 A;  2L57 A;  2JZS A;  4OO5 A;  1ACV A;  1OVN A;  3G9B A;  2REM A;  3GKK A;  4IQA A;  1OYJ A;  3A2V A;  2H30 A;  3HXS A;  2LJK A;  4JRR A;  4IEL A;  3DYR A;  1N8J A;  2N5A A;  4EE0 A;  1PGT A;  2L6C A;  1HD2 A;  3PR8 A;  3TKS A;  1T00 A;  1FHE A;  2CX3 A;  3A5W A;  3ZL5 A;  1J0F A;  4LMW A;  4JED A;  2C8U A;  4FYU A;  2H1G A;  4KGI A;  4XS6 A;  2FY6 A;  2H6Y A;  3F4S A;  3HKR A;  1PQN A;  3BBY A;  2MMZ A;  1DE1 A;  5DJM A;  3M8N A;  5E4W A;  2DC5 A;  3DXB A;  3TKS E;  1HYU A;  5LD0 A;  4BPY A;  4KH7 A;  1K3O A;  1B9X C;  5DAK A;  1V9W A;  1RW1 A;  5J41 A;  2VIM A;  2H1D A;  2YWM A;  4AF2 A;  4I5Q A;  4WXT A;  1QK8 A;  1EP8 A;  2DJK A;  2H0H A;  5KN0 A;  1RQM A;  2J23 A;  3L4N A;  3L9V A;  2HXK A;  2PVQ A;  3GTU A;  5F0G A;  2LNT A;  1VRS D;  3GN3 A;  4Q5R A;  1ZCP A;  3QFA C;  4MJC A;  1EP7 A;  3ZRE A;  1A2L A;  5ECL B;  4HQZ A;  4IP1 A;  2JU5 A;  3GUS A;  4NV2 A;  1Y25 A;  3E9J B;  3HD5 A;  4I97 A;  5DQY A;  2I81 A;  13GS A;  4MZC A;  5GST A;  1T7P B;  5A4W A;  2F8F A;  3GRX A;  5E59 A;  1SK2 A;  5CNW A;  1A8Y A;  3GIX A;  4CDO A;  2YJ7 A;  1FB6 A;  5J3R A;  1BED A;  1SEN A;  1U87 A;  2H71 A;  1DUG A;  2AV4 A;  2J9H A;  4ZBA A;  3VFI A;  1FAA A;  1R4W A;  1BYE A;  5DCH A;  2DML A;  3IRA A;  2YJH A;  3DVW A;  2YCD A;  4KDX A;  1GRX A;  3F4T A;  5JCG A;  1TJD A;  1F6M C;  3CTF A;  2VL2 C;  3KZQ A;  2AYT A;  2HZE B;  4IN0 A;  4MAB A;  3RBT A;  2ZNM A;  3QOU A;  1PKW A;  2JSY A;  5GSS A;  3LYP A;  4IGJ A;  4NXI A;  2MMA A;  1K0M A;  2LUS A;  4OCE A;  3ERF A;  3IAM 2;  2RLI A;  3M1G A;  4BA7 A;  5IMF A;  2C0D A;  4V2L A;  1A2M A;  1GSQ A;  3VUR A;  2RM5 A;  4L0U A;  4BWS A;  1V40 A;  1A0R P;  1M7T A;  3US3 A;  4TR3 A;  3EU3 A;  2YZU A;  3A2X A;  1ZGN A;  3ZFL A;  1TXX A;  4ID0 A;  4G9H A;  1WPI A;  4MDC A;  4WEY A;  1EV4 A;  3WGX A;  3ZYW A;  2IMI A;  3CRT A;  5JCU A;  1M2A A;  4HUA A;  3ZRD A;  1JZO A;  1GUH A;  2VM2 A;  1EOG A;  3HVV A;  4PUF C;  3TOU A;  2EIQ A;  2K18 A;  4TW5 A;  1U88 A;  2KP1 A;  1GUM A;  3IR4 A;  4MF5 A;  1FOV A;  2P0G A;  1KNG A;  2VUP A;  1OKT A;  3EWL A;  2P31 A;  4KW6 A;  1WRY A;  4PXO A;  2B5E A;  1X5C A;  2LQQ A;  2RUE A;  2H8L A;  2V41 A;  3APO A;  3UL3 A;  3KH7 A;  2A2R A;  3FZ9 A;  2M46 A;  3ZIJ A;  1USB A;  4TR1 B;  4CW9 A;  19GS A;  1SK0 A;  2LEG A;  4KND A;  1VF2 A;  1O7U A;  3ERG A;  1WE0 A;  2DMM A;  1GWC A;  1XCC A;  1TRV A;  3TJB A;  3OR5 A;  3KMN A;  2NPB A;  4F2I A;  2H70 A;  1QMV A;  3MWH A;  4GXZ A;  4KCE A;  1Z5Y E;  5IIZ A;  3H79 A;  2OKA A;  3O3T A;  22GS A;  1GTB A;  3PH9 A;  1XBS A;  5CRD A;  2VLU A;  1XWB A;  3FKF A;  5FHI A;  4O5R A;  1K0A A;  2V6K A;  3CXG A;  4QL9 A;  2G0F A;  1PL2 A;  3ISO A;  2WUL A;  4HU7 A;  3BD2 A;  3PGT A;  4J2F A;  5B6N A;  3HVS A;  2IPA A;  3C8E A;  5B8B A;  4GWR A;  1M0U A;  5D73 A;  3FR6 A;  1HQO A;  3DRN A;  2L5O A;  1EEJ A;  1MD4 A;  2IMF A;  3EVI A;  2PPT A;  3QAG A;  1UVZ A;  3WT1 A;  4RI7 A;  1OKD A;  1O8W A;  2BMX A;  1AC1 A;  1DSB A;  5AN1 A;  1M2D A;  3ED3 A;  5F8B A;  3QMX A;  3F0I A;  2H1B A;  1OC9 B;  4GLT A;  3VWX A;  3ZVJ A;  1PL1 A;  2C3Q A;  5G2Z A;  3J7Y k;  1S3A A;  5IMV A;  1SKW B;  4ZXG A;  5AIX A;  4HOJ A;  3EMX A;  3CBU A;  3JCM L;  5B8A A;  1BX9 A;  4HU9 A;  5J4U A;  1FW1 A;  4F82 A;  1G6W A;  3TJG A;  5B7C A;  3IAS 2;  1KEB A;  3QPM A;  2LRT A;  1HNA A;  1PX6 A;  2D2Z A;  1F37 A;  1ABA A;  4HEA 2;  2ZUP A;  1A2J A;  2OE0 A;  2X8C A;  5HFG A;  1XWG A;  3W6G A;  4MLY A;  4K0N A;  2VCZ A;  2C3N A;  3L9S A;  2C1Y A;  12GS A;  2JAD A;  3FRC A;  3GH6 A;  3P8W A;  1ZYE A;  2WGR A;  5CRH A;  3W8S A;  3ERW A;  3FYG A;  5B6M A;  1I9D A;  2QSI A;  5KN1 A;  1XZO A;  3UMA A;  1I5G A;  3TKP A;  4I2T A;  3A2W A;  1O6J A;  2E0Q A;  2E2G A;  3IDV A;  3F6F A;  2E2M A;  3WT2 A;  5ID2 A;  4PQH A;  1FG4 A;  1VF4 A;  1GSU A;  3F9U A;  3A3T A;  2RM6 A;  1TKD B;  1RK4 A;  4FYB A;  2PVO C;  5J9B A;  1TTZ A;  1XXU A;  2HNL A;  5G5F A;  2FWH A;  4PNF A;  2FWF A;  3DEX A;  3EU4 A;  2OBK A;  2HI7 A;  3GST A;  2PER A;  3RDW A;  4GSN A;  1GSE A;  3VI7 A;  2WB9 A;  1V98 A;  1JFU A;  3D6I A;  1Z6M A;  3FEU A;  3LOR A;  5H5S A;  4DEJ A;  3EYT A;  1TRU A;  2IL3 A;  3DGQ A;  3E0U A;  5ECM B;  4EVM A;  5A5K A;  1GUK A;  2B5X A;  4AJ7 A;  1THX A;  2YN1 A;  2O7K A;  4V2M A;  4O92 A;  4D73 B;  17GS A;  3HVX A;  4PQI A;  2CVD A;  1TRS A;  1TW9 A;  4LL1 B;  1URM A;  4FIW A;  3RHC A;  5CAX A;  2HRF A;  1T4Y A;  4XTS A;  3MAK A;  4MF6 A;  3QD9 A;  5DAL B;  3WD6 A;  1PN9 A;  4CHS A;  2O85 A;  1YZX A;  4IVF A;  5D93 A;  4ULX A;  1K0N A;  4GSS A;  5HR1 A;  2X99 A;  3FY7 A;  3VWW A;  1HNC A;  1YKA A;  4YQU A;  1A24 A;  2GZY A;  3LYK A;  1SU9 A;  4TR4 A;  4KUN A;  4MJB A;  1R26 A;  3Q6O A;  4WBR D;  4K8M A;  4BWQ A;  4K7O A;  3FW2 A;  2JZR A;  5DCG A;  4KX4 A;  1FVK A;  4AGS A;  1WMJ A;  1JHB A;  3DIE A;  1XVQ A;  4JR6 A; 
#chains in the Genus database with same CATH topology
 5HQP A;  2LQO A;  4EIQ A;  3V1W A;  1BAY A;  3SWL A;  2B1K A;  3I6A A;  2MBS A;  3U5R E;  2B5Y A;  2GST A;  5H5Q A;  2V6O A;  1VGL A;  2V32 A;  3C71 A;  1SJI A;  1XWK A;  4XIH A;  2F8A A;  2RII A;  2CV4 A;  3HYP A;  3UEM A;  1GSD A;  3UBK A;  1PD2 1;  1AUC A;  1TI1 A;  2FHE A;  3IBH A;  5EPF A;  2EIO A;  2YOI A;  2FCH A;  2JZT A;  2GSS A;  3N9J A;  1M9B A;  3I43 A;  3DVX A;  3M0F A;  4H86 A;  2R2J A;  2WZ9 A;  4O5U A;  1M99 A;  1G6Y A;  4CY6 A;  4YQV A;  2H72 A;  2A2S A;  4K0G A;  2KP2 A;  4GTU A;  1ZYN A;  9GSS A;  4F03 A;  2WS2 A;  6GST A;  4XS4 A;  3F3R A;  5CP1 A;  2H74 A;  4LMV A;  1Z3E A;  2CAI A;  3U6V A;  1O73 A;  3IE3 A;  2H0G A;  2DIY A;  4POK A;  1B4P A;  2YNX A;  1KTE A;  4KSO A;  3FZA A;  2VM1 A;  3W8J A;  1N2A A;  2VCX A;  1TI3 A;  3D22 A;  4ML1 A;  1K0B A;  2I1U A;  2ZCT A;  1MDJ A;  3APQ A;  3KP9 A;  1FOH A;  2H01 A;  3TDG A;  4E8E A;  2IN3 A;  4XCS A;  3HHV A;  2GQM A;  2JL4 A;  2HT9 A;  3EIN A;  3G7I A;  5AGY A;  1K3Y A;  3GNJ A;  1JLV A;  3TJJ A;  1MEK A;  3TJK A;  3GKM A;  4HJM A;  2CA8 A;  1ZL9 A;  3K8N A;  1A0F A;  2KHP A;  4EL1 A;  5ECK B;  3TRP A;  4EF0 A;  18GS A;  2A2P A;  2LS5 A;  4ZBD A;  3M9K A;  2LV3 A;  1GNW A;  4GF0 A;  5IO0 A;  3RHB A;  11GS A;  3L0H A;  2KUC A;  5H5R A;  4K6X A;  5BRT A;  1X5D A;  3HDC A;  5D96 A;  2PGT A;  3VLN A;  1MD3 A;  4DVC A;  2IWT A;  4OCF A;  6GSY A;  1TK8 B;  4MF7 A;  5HR3 A;  1EV9 A;  2TRC P;  2ALB A;  4JR4 A;  3DWV A;  2PBJ A;  4J56 E;  4K2X A;  4FH8 A;  1FVJ A;  2R37 A;  4HQS A;  1VF3 A;  2TIR A;  4Z2T A;  1GTU A;  4GQC A;  4J57 E;  2DIZ A;  3CTG A;  4WBJ A;  3WYW A;  3LFL A;  5GAN D;  2VD1 A;  3BCI A;  1YDK A;  6GSX A;  1XOB A;  2G2Q A;  1GNE A;  4HJ2 A;  4E8H A;  1T1V A;  4FYC A;  1EGR A;  5IO2 A;  2VLV A;  4HI7 A;  1K0D A;  4USS A;  4MP4 A;  3F4R A;  3F8U A;  2CT6 A;  2L5L A;  2V1M A;  3C7M A;  3QR6 A;  3IK9 A;  3C73 A;  1GLQ A;  1OC8 A;  1ON4 A;  1Z9H A;  2HRN A;  5D9X A;  4YAP A;  5DJL A;  3NIV A;  2PUK C;  4TVE A;  2FA4 A;  5G31 A;  3LXZ A;  2OBI A;  5HFK A;  4F0C A;  2K8V A;  5D9W A;  1UA5 A;  1ZMA A;  3KGK A;  4NHZ A;  2DKI A;  4F9Z A;  3P7X A;  4X4J A;  2YPM A;  4PUR A;  4DSS B;  2AAW A;  2ON7 A;  2RUF A;  3GMF A;  1J08 A;  4TXO A;  4JE1 A;  2C80 A;  3KTB A;  4V2N A;  2I9H A;  1JZW A;  4TOP A;  1M3J A;  4OFN A;  4FO5 A;  6GSS A;  3EMP A;  2IFQ B;  1YY7 A;  1GL8 A;  1O85 A;  3RPN A;  3D21 A;  1PN0 A;  3AY8 A;  4N0Z A;  2VCW A;  3RPP A;  2VLT A;  5FWG A;  2A4V A;  1ERU A;  2H66 A;  1JLW A;  3RAZ A;  3IPZ A;  5DVB A;  3FR9 A;  4ACS A;  10GS A;  1M9A A;  2VL2 A;  3D5J A;  2R3X A;  2PN8 A;  1IYH A;  5A4U A;  3CRU A;  1MTC A;  1HNB A;  1PKZ A;  1WOU A;  2PU9 C;  1GH2 A;  1DBY A;  6GSV A;  5G5E A;  2IIY A;  1M2B A;  4MJA A;  3P2A A;  4WR4 A;  1ERV A;  1AXD A;  2LKU A;  1EEM A;  3BJ5 A;  4JZQ A;  4OWY A;  3BCK A;  3IHG A;  2B6M A;  1F3A A;  5AIV A;  1W89 A;  3IK7 A;  1ZYP A;  2HSH A;  4Q5F A;  1U6T A;  4I2U A;  2I4A A;  2B7J A;  3UAR A;  1NSW A;  1TU8 A;  2BTO T;  4EDY A;  1E2Y A;  2X4A A;  2C0G A;  1SKR B;  4RI6 A;  2NTO A;  1DE2 A;  3KTL A;  3QDN A;  3UIW A;  1SKS B;  2GSR A;  2VL3 A;  4TN8 A;  3ZIV A;  1YEP A;  2H19 A;  2O8V B;  1QUW A;  5ABR A;  2C0E A;  2B7K A;  2K6V A;  2HSY A;  2VD0 A;  2FNO A;  2C3T A;  5IMD A;  1GSS A;  1AW9 A;  1OAZ A;  1GLP A;  3FHK A;  5L71 A;  4PUA A;  4BVY A;  3H1N A;  3F6D A;  1O8X A;  4GST A;  1ERW A;  1G0T A;  3F3Q A;  1IYI A;  2R0P A;  3HVN A;  2YWO A;  2H0I A;  2F9S A;  5DDL A;  4HDE A;  4IHU A;  4YKF A;  2DKH A;  1PX7 A;  2BJX A;  4MA9 A;  3WGD A;  4K7N A;  4ECC A;  2GZP A;  1QXH A;  5DAK B;  4K7I A;  2WFC A;  16GS A;  3EC3 A;  5F07 A;  2LRN A;  1M3I A;  2JAC A;  1GTA A;  5ECI B;  4GRF A;  1XVW A;  5D8I A;  4POL A;  3KD0 A;  3CMI A;  2HZE A;  5CYY A;  4BVX A;  1XW9 A;  4K2D A;  3FZ4 A;  5ENU A;  3ZVJ D;  3IV4 A;  1SYR A;  2OJL A;  2X8G A;  4RQR A;  5CRW A;  4WKW A;  5ECO B;  2I3Y A;  1GP1 A;  1U3I A;  3VPT A;  1W4V A;  5EL8 A;  5D9T A;  2HZF A;  2LJA A;  2R4V A;  3VWV A;  4NAX A;  1Z6N A;  3LSZ A;  3ZIT A;  1NM3 A;  1A23 A;  4K5R A;  3GFK A;  3MDK A;  3HJM A;  1R5A A;  3H8Q A;  3P90 A;  4ZL8 A;  4ILF A;  4YAV A;  4ZIL A;  4N11 A;  2YV9 A;  1JZR A;  4NHW A;  3SBC A;  2H6X A;  1X9M B;  1U3A A;  2FD3 A;  1VF1 A;  3GV1 A;  3TKS C;  5KEJ A;  4FQU A;  1XW6 A;  4G19 A;  2LJR A;  1YEX A;  2C0F A;  4F0B A;  1KBN A;  1GSF A;  1XWC A;  3UAP A;  4KSM A;  3A5I A;  2N5F A;  4TR1 A;  2CVB A;  1XWA A;  3LWA A;  5HR2 A;  4G0K A;  5C00 A;  2GQK A;  4ISD A;  1ZYQ B;  2F51 A;  4QQ7 A;  4WET A;  4EXJ A;  4IP6 A;  5IOW A;  2VCV A;  4O7H A;  4MCU A;  1LU4 A;  4I8B A;  2YWN A;  5JCW A;  2F3M A;  3EUR A;  4JBB A;  5FT3 A;  4EIP A;  2EC4 A;  1TK0 B;  5COH A;  4AJ6 A;  4OD7 A;  3FK8 A;  3GX0 A;  5G1L A;  2QKE A;  4DSR A;  4ZB9 A;  4P3Y B;  3C1S A;  4WF5 A;  3C1R A;  2OAC A;  1CQH A;  2GDR A;  3GL5 A;  1ZZY A;  2M72 A;  3MNG A;  3UJ1 A;  4NMU A;  2DJ2 A;  1K0O A;  4KE3 A;  1C72 A;  3QCP A;  1SYX A;  3NZN A;  4Z7X A;  2YZH A;  1Z7P A;  4OMV A;  3ZTL A;  3UBL A;  1AQW A;  3O6T A;  4RUV A;  3VI5 A;  1PA3 A;  3N5O A;  2R0C A;  4PX1 A;  5BMU A;  4MMM A;  3G7Y A;  2IMK A;  1YJ6 A;  2GSQ A;  3F63 A;  1X0R A;  2GGT A;  4N30 A;  4PNG A;  2TRX A;  3VWU A;  1BG5 A;  3EE2 A;  3ZMK A;  3HY2 A;  2LNS A;  5CRE A;  4ML6 A;  4IS0 A;  4IJI A;  5IMA A;  1OC9 A;  4Q5Q A;  1SL2 B;  3KXO A;  2N5B A;  3QFB C;  4MJE A;  3VK9 A;  1PMT A;  2QC7 A;  4O5Q A;  2DBC A;  3D0Z A;  3O76 A;  3KEB A;  1T3B A;  3ZZX A;  2MYG A;  3IXR A;  4POB A;  4OO4 A;  4HSC X;  2OE3 A;  5IQY A;  2YWI A;  4O32 A;  1EGO A;  3WGE A;  4EKZ A;  4ECJ A;  2C4J A;  1WP0 A;  3TKR A;  2H76 A;  5DQS A;  3DD3 A;  1YF0 A;  1H75 A;  3HA9 A;  2MBT A;  20GS A;  2MMN A;  4Q5N A;  1AQV A;  3GH9 A;  3GL3 A;  1TOF A;  3TCO A;  2FUG 2;  1AIU A;  4KDU A;  4EDZ A;  3CYN A;  3IHQ A;  3TKQ A;  1OE7 A;  2NBS A;  2X64 A;  4V1A p;  1AAZ A;  4KDY A;  5HR0 A;  4N0V A;  2WRT A;  4L5L A;  2IMD A;  6GSU A;  1Q4J A;  1XW5 A;  1QFN A;  3GSS A;  2L4Q A;  5IOX A;  1PSQ A;  4GCI A;  3M3M A;  2YV7 A;  3ZFB A;  1ZOF A;  5G1K A;  1V58 A;  2P5R A;  1XIY A;  4ZIJ A;  4OFM A;  3EPT A;  1A8L A;  5HFI A;  3Q19 A;  5IPG A;  3IC8 A;  1X9S B;  1GUL A;  3ZLP A;  2QGV A;  4G2E A;  4X0X A;  2B1L A;  4MPG A;  4BL7 A;  1J9B A;  1CQG A;  4DSQ A;  2CQ9 A;  3MYD A;  2H75 A;  3LW9 A;  4MZB A;  3KJY A;  5ECN B;  1TK5 B;  2OAD A;  3HJP A;  2KOK A;  3D4T A;  1OC3 A;  3GX8 A;  3CSJ A;  3J7Y b;  4ECI A;  4L0W A;  5CO3 A;  2L4C A;  2IJY A;  1B48 A;  4HZ2 A;  1FO5 A;  4MH2 A;  2OA7 A;  4D73 A;  3KM6 A;  1YF1 A;  3E3E A;  3HZ4 A;  2XBI A;  2HRK A;  2OE1 A;  5DAL A;  5ID2 B;  2FGX A;  2VOC A;  4PGT A;  1Y6E A;  3GUR A;  4XHM A;  1WWJ A;  5IPH A;  4KA0 A;  1K3L A;  2R6K A;  2GTU A;  2R0G A;  4MPF A;  4POM A;  1NW2 A;  5KN2 A;  3S9F A;  3LGC A;  3VPQ A;  5J9C A;  3TJF A;  1ST9 A;  3ZML A;  2AJQ B;  1SK1 A;  1AQX A;  1K0C A;  3H4K A;  2DLX A;  3KMO A;  2E7P A;  3FZ5 A;  3R3E A;  5AIS A;  2M80 A;  4ECB A;  2ON5 A;  3IA1 A;  2H1A A;  5GAP D;  4K9Z A;  4CY8 A;  1YQ1 A;  2EIR A;  1UN2 A;  1GSY A;  1EZK A;  4PQ1 A;  2HE3 A;  3GKX A;  1ML6 A;  4HZ4 A;  2FA8 A;  2QA2 A;  1EWX A;  1LBK A;  2GT5 A;  1THO A;  2GVP A;  1TRW A;  4Z2R A;  2NVL A;  1B4Q A;  3GKN A;  5JWR B;  2DJ1 A;  3UOM A;  3APS A;  5EVO A;  2Z9S A;  3L9U A;  3D4M A;  3FR3 A;  1SD9 A;  4Z2U A;  4A5P A;  2YP6 A;  4IW9 A;  2VO4 A;  1TU7 A;  3CSI A;  4YQM A;  4KB3 A;  2MZC A;  4JU5 A;  1XOA A;  1MDK A;  1T4Z A;  5JWQ B;  2P5Q A;  3ME8 A;  1R7H A;  5IMC A;  5J5N A;  3GA4 A;  2CX4 A;  2HRA A;  1SL1 B;  1T8E B;  4I6X A;  4TXV A;  1OE8 A;  4G0I A;  3TUE A;  5G30 A;  4ZL7 A;  1WIK A;  5ECQ B;  3ME7 A;  4L5O A;  2XPE A;  4LA1 A;  5ECP B;  2PMT A;  1R5P A;  2AB6 A;  1UC7 A;  4EC0 A;  2CZ3 A;  1QGV A;  3MIX A;  1S3R A;  2WCI A;  1GTI A;  2GS3 A;  2VCQ A;  2H73 A;  4G10 A;  3I69 A;  2VL9 A;  1ERT A;  1F3B A;  2KLX A;  3I9V 2;  4MH3 A;  1XPV A;  3CSH A;  1E6B A;  3R2Q A;  3GHA A;  4ZL9 A;  3Q74 A;  4NV5 A;  4IKH A;  1XFL A;  3TRQ A;  2DJ3 A;  3LG6 A;  4XS4 B;  5F06 A;  3H93 A;  1S3C A;  1SL0 B;  1NHO A;  2DJ0 A;  2LRC A;  3DKS A;  4IQ1 A;  4PTS A;  4TR0 A;  1NHY A;  1B9Y C;  3FMW A;  1V2A A;  1MDI A;  2XHF A;  1F2E A;  3TB2 A;  4TRX A;  3L78 A;  4TKY A;  3TRX A;  4LLR A;  8GSS A;  4IBP A;  4XRD A;  1O81 A;  5D9V A;  1LJR A;  3LXT A;  5ELG A;  2GT6 A;  2HYX A;  2MMO A;  3GTU B;  3HJO A;  1SJ6 A;  2GZZ A;  1BQ7 A;  2O89 A;  5EY6 A;  2VCT A;  1FB0 A;  1B8X A;  4ZB8 A;  1BJX A;  4NPB A;  4ZB6 A;  2FWG A;  3DML A;  2FWE A;  2H6Z A;  4N10 A;  4OFT A;  5CRG A;  1SD8 A;  6GSW A;  2K9F A;  2GQL A;  5C04 A;  5ECH B;  2B3S A;  4V1A g;  2L6D A;  3KH9 A;  3IC4 A;  3LJR A;  3TOT A;  7GSS A;  2FLS A;  4ZBB A;  2ES7 A;  5INY A;  2HFD A;  2GLR A;  1G7O A;  1S3D A;  3QAW A;  4IJ3 A;  4XRA A;  1TP9 A;  3G7J A;  4RQX A;  5LCZ A;  1H4O A;  4K1F A;  1PRX A;  2CVK A;  5ECS A;  2O87 A;  2L59 A;  2PWJ A;  3KIJ A;  3UVT A;  2X8H A;  1Q98 A;  5JWO B;  1SJZ A;  3TGZ A;  1JZD A;  1ILO A;  3HCZ A;  2V2G A;  4AJ8 A;  2NDO A;  4KAE A;  4XS1 A;  3NOF A;  4MZW A;  3MSZ A;  4KCA A;  3UVH A;  1X9W B;  3KCM A;  2DJJ A;  2WJU A;  4QL7 A;  1Z7R A;  2VAF A;  2AHE A;  5GZZ B;  2XBQ A;  4DSS A;  5ECR B;  4MK3 A;  1V57 A;  5KN3 A;  4EUY A;  3GYK A;  2YAN A;  2XPD A;  3Q18 A;  2K8S A;  3LQ7 A;  2IFQ A;  1X5E A;  2LST A;  4LL4 B;  4WR5 A;  1F9M A;  4X43 A;  4HS1 A;  2WDU A;  5ELA A;  5A4V A;  4MNN A;  3PIN A;  2IME A;  2JSZ A;  3KP8 A;  4L8E A;  5LNK e;  4GQF A;  2DSA A;  1G7E A;  4NWY A;  14GS A;  4WF4 A;  2CAQ A;  3M9J A;  2XC2 A;  3QAV A;  1YKC A;  3IOS A;  2A4H A;  2CZ2 A;  5IMZ A;  2LTK A;  4TXO B;  2AUV A;  4EO3 A;  1EOH A;  1TDI A;  3BOA A;  3LEF A;  1WJK A;  2HLS A;  3HZ8 A;  4X1U A;  5IM9 A;  2R5G A;  4YH2 A;  1QQ2 A;  5DBQ A;  5F05 A;  2L57 A;  2JZS A;  4OO5 A;  1ACV A;  1OVN A;  3G9B A;  2REM A;  3GKK A;  4IQA A;  1OYJ A;  3A2V A;  2H30 A;  3HXS A;  2LJK A;  4JRR A;  4IEL A;  3DYR A;  1N8J A;  2N5A A;  4EE0 A;  1PGT A;  2L6C A;  1HD2 A;  3PR8 A;  3TKS A;  1T00 A;  1FHE A;  2CX3 A;  3A5W A;  3ZL5 A;  1J0F A;  4LMW A;  4JED A;  2C8U A;  4FYU A;  2H1G A;  4KGI A;  4XS6 A;  2FY6 A;  2H6Y A;  3F4S A;  3HKR A;  1PQN A;  3BBY A;  2MMZ A;  1DE1 A;  5DJM A;  3M8N A;  5E4W A;  2DC5 A;  3DXB A;  3TKS E;  1HYU A;  5LD0 A;  4BPY A;  4KH7 A;  1K3O A;  1B9X C;  5DAK A;  1V9W A;  1RW1 A;  5J41 A;  2VIM A;  2H1D A;  2YWM A;  4AF2 A;  4I5Q A;  4WXT A;  1QK8 A;  1EP8 A;  2DJK A;  2H0H A;  5KN0 A;  1RQM A;  2J23 A;  3L4N A;  3L9V A;  2HXK A;  2PVQ A;  4BVY B;  3GTU A;  5F0G A;  2UZ8 A;  2LNT A;  1VRS D;  3GN3 A;  4Q5R A;  1ZCP A;  3QFA C;  4MJC A;  1EP7 A;  3ZRE A;  1A2L A;  5ECL B;  4HQZ A;  4IP1 A;  2JU5 A;  3GUS A;  4NV2 A;  1Y25 A;  3E9J B;  3HD5 A;  4I97 A;  5DQY A;  2I81 A;  13GS A;  4MZC A;  5GST A;  1T7P B;  5A4W A;  2F8F A;  3GRX A;  5E59 A;  1SK2 A;  5CNW A;  1A8Y A;  3GIX A;  4CDO A;  2YJ7 A;  1FB6 A;  5J3R A;  1BED A;  2HSM A;  1SEN A;  1U87 A;  2H71 A;  1DUG A;  2AV4 A;  2J9H A;  4ZBA A;  3VFI A;  1FAA A;  1R4W A;  1BYE A;  5DCH A;  2DML A;  3IRA A;  2YJH A;  3DVW A;  2YCD A;  4KDX A;  1GRX A;  3F4T A;  5JCG A;  1TJD A;  1F6M C;  3CTF A;  2VL2 C;  5KOW A;  3KZQ A;  2AYT A;  2HZE B;  4IN0 A;  4MAB A;  3RBT A;  2ZNM A;  3QOU A;  4BVX B;  1PKW A;  2JSY A;  5GSS A;  3LYP A;  4IGJ A;  4NXI A;  2MMA A;  2QA1 A;  1K0M A;  2LUS A;  4OCE A;  3ERF A;  3IAM 2;  2RLI A;  3M1G A;  4BA7 A;  5IMF A;  2C0D A;  4V2L A;  1A2M A;  1GSQ A;  3VUR A;  2RM5 A;  4L0U A;  4BWS A;  1V40 A;  1A0R P;  1M7T A;  3US3 A;  4TR3 A;  3EU3 A;  2YZU A;  3A2X A;  1ZGN A;  3ZFL A;  1TXX A;  4K5S A;  4ID0 A;  4G9H A;  1WPI A;  4MDC A;  4WEY A;  1EV4 A;  3WGX A;  3ZYW A;  2IMI A;  3CRT A;  5JCU A;  3CQF A;  1M2A A;  4HUA A;  3ZRD A;  1JZO A;  1GUH A;  2VM2 A;  1EOG A;  3HVV A;  4PUF C;  3TOU A;  2EIQ A;  2K18 A;  4TW5 A;  1U88 A;  2KP1 A;  1GUM A;  3IR4 A;  4MF5 A;  1FOV A;  2P0G A;  1KNG A;  2VUP A;  1OKT A;  3EWL A;  2P31 A;  4KW6 A;  1WRY A;  4PXO A;  2B5E A;  1X5C A;  2LQQ A;  2RUE A;  2H8L A;  2V41 A;  3APO A;  3UL3 A;  3KH7 A;  2A2R A;  3FZ9 A;  2M46 A;  3ZIJ A;  1USB A;  4TR1 B;  4CW9 A;  19GS A;  1SK0 A;  2LEG A;  4KND A;  1VF2 A;  1O7U A;  3ERG A;  1WE0 A;  2DMM A;  1GWC A;  1XCC A;  1TRV A;  3TJB A;  3OR5 A;  3KMN A;  2NPB A;  4F2I A;  2H70 A;  1QMV A;  3MWH A;  4GXZ A;  4KCE A;  1Z5Y E;  5IIZ A;  3H79 A;  2OKA A;  3O3T A;  22GS A;  1GTB A;  3PH9 A;  1XBS A;  5CRD A;  2VLU A;  1XWB A;  3FKF A;  5FHI A;  1PFO A;  4O5R A;  1K0A A;  2V6K A;  3CXG A;  4QL9 A;  2G0F A;  1PL2 A;  3ISO A;  2WUL A;  4HU7 A;  3BD2 A;  3PGT A;  4J2F A;  5B6N A;  3HVS A;  2IPA A;  3C8E A;  5B8B A;  4GWR A;  1M0U A;  5D73 A;  3FR6 A;  1HQO A;  3DRN A;  2L5O A;  1EEJ A;  1MD4 A;  2IMF A;  3EVI A;  2PPT A;  3QAG A;  1UVZ A;  3WT1 A;  4RI7 A;  1OKD A;  1O8W A;  2BMX A;  1AC1 A;  1DSB A;  5AN1 A;  1M2D A;  3ED3 A;  5F8B A;  3QMX A;  3F0I A;  2H1B A;  4BIK A;  1OC9 B;  4GLT A;  3VWX A;  3ZVJ A;  1PL1 A;  2C3Q A;  5G2Z A;  3J7Y k;  1S3A A;  2X49 A;  5IMV A;  1SKW B;  4ZXG A;  5AIX A;  4HOJ A;  3EMX A;  3CBU A;  3JCM L;  5B8A A;  1BX9 A;  4HU9 A;  5J4U A;  1FW1 A;  4F82 A;  1G6W A;  3TJG A;  5B7C A;  3PPU A;  3IAS 2;  1KEB A;  3QPM A;  2LRT A;  1HNA A;  1XG8 A;  1PX6 A;  2D2Z A;  1F37 A;  1ABA A;  4HEA 2;  2ZUP A;  1A2J A;  2OE0 A;  2X8C A;  5HFG A;  1XWG A;  3W6G A;  4YKG A;  4MLY A;  4K0N A;  2VCZ A;  2C3N A;  3L9S A;  2C1Y A;  12GS A;  2JAD A;  3FRC A;  3GH6 A;  3P8W A;  1ZYE A;  2WGR A;  5CRH A;  3W8S A;  3ERW A;  3FYG A;  5B6M A;  1I9D A;  2QSI A;  5KN1 A;  1XZO A;  3UMA A;  4KF9 A;  1I5G A;  3TKP A;  4I2T A;  3A2W A;  1O6J A;  2E0Q A;  2E2G A;  3IDV A;  3F6F A;  2E2M A;  3WT2 A;  5ID2 A;  4PQH A;  1FG4 A;  1VF4 A;  1GSU A;  3F9U A;  3A3T A;  2RM6 A;  1TKD B;  1RK4 A;  4FYB A;  2PVO C;  5J9B A;  1TTZ A;  1XXU A;  2HNL A;  5G5F A;  2FWH A;  4PNF A;  2FWF A;  3DEX A;  3EU4 A;  2OBK A;  2HI7 A;  3GST A;  2PER A;  3RDW A;  4GSN A;  1GSE A;  3VI7 A;  2WB9 A;  4BL7 B;  1V98 A;  1JFU A;  3D6I A;  4G0L A;  1Z6M A;  3FEU A;  3LOR A;  5H5S A;  4DEJ A;  3EYT A;  5KOX A;  1TRU A;  2IL3 A;  3DGQ A;  3E0U A;  5ECM B;  4EVM A;  5A5K A;  1GUK A;  2B5X A;  4AJ7 A;  1THX A;  2YN1 A;  2O7K A;  4V2M A;  4O92 A;  4D73 B;  17GS A;  3HVX A;  4PQI A;  2CVD A;  1TRS A;  1TW9 A;  4LL1 B;  1URM A;  4FIW A;  3RHC A;  5CAX A;  2HRF A;  1T4Y A;  4XTS A;  3MAK A;  4MF6 A;  3QD9 A;  5DAL B;  3WD6 A;  1PN9 A;  4ICY A;  4CHS A;  2O85 A;  1YZX A;  4IVF A;  5D93 A;  4ULX A;  1K0N A;  4GSS A;  5HR1 A;  2X99 A;  3FY7 A;  3VWW A;  1HNC A;  1YKA A;  4YQU A;  1A24 A;  2GZY A;  3LYK A;  1SU9 A;  4TR4 A;  4KUN A;  4MJB A;  1R26 A;  3Q6O A;  4WBR D;  4K8M A;  4BWQ A;  4K7O A;  3FW2 A;  2JZR A;  5DCG A;  4KX4 A;  1FVK A;  4AGS A;  1WMJ A;  1JHB A;  3DIE A;  1XVQ A;  4JR6 A; 
#chains in the Genus database with same CATH homology
 5HQP A;  2LQO A;  4EIQ A;  3V1W A;  1BAY A;  3SWL A;  2B1K A;  3I6A A;  2MBS A;  3U5R E;  2B5Y A;  2GST A;  5H5Q A;  2V6O A;  1VGL A;  2V32 A;  3C71 A;  1SJI A;  1XWK A;  4XIH A;  2F8A A;  2RII A;  2CV4 A;  3HYP A;  3UEM A;  1GSD A;  3UBK A;  1PD2 1;  1AUC A;  1TI1 A;  2FHE A;  3IBH A;  5EPF A;  2EIO A;  2YOI A;  2FCH A;  2JZT A;  2GSS A;  3N9J A;  1M9B A;  3I43 A;  3DVX A;  3M0F A;  4H86 A;  2R2J A;  2WZ9 A;  4O5U A;  1M99 A;  1G6Y A;  4CY6 A;  4YQV A;  2H72 A;  2A2S A;  4K0G A;  2KP2 A;  4GTU A;  1ZYN A;  9GSS A;  4F03 A;  2WS2 A;  6GST A;  4XS4 A;  3F3R A;  5CP1 A;  2H74 A;  4LMV A;  1Z3E A;  2CAI A;  3U6V A;  1O73 A;  3IE3 A;  2H0G A;  2DIY A;  4POK A;  1B4P A;  2YNX A;  1KTE A;  4KSO A;  3FZA A;  2VM1 A;  3W8J A;  1N2A A;  2VCX A;  1TI3 A;  3D22 A;  4ML1 A;  1K0B A;  2I1U A;  2ZCT A;  1MDJ A;  3APQ A;  3KP9 A;  1FOH A;  2H01 A;  3TDG A;  4E8E A;  2IN3 A;  4XCS A;  3HHV A;  2GQM A;  2JL4 A;  2HT9 A;  3EIN A;  3G7I A;  5AGY A;  1K3Y A;  3GNJ A;  1JLV A;  3TJJ A;  1MEK A;  3TJK A;  3GKM A;  4HJM A;  2CA8 A;  1ZL9 A;  3K8N A;  1A0F A;  2KHP A;  4EL1 A;  5ECK B;  3TRP A;  4EF0 A;  18GS A;  2A2P A;  2LS5 A;  4ZBD A;  3M9K A;  2LV3 A;  1GNW A;  4GF0 A;  5IO0 A;  3RHB A;  11GS A;  3L0H A;  2KUC A;  5H5R A;  4K6X A;  5BRT A;  1X5D A;  3HDC A;  5D96 A;  2PGT A;  3VLN A;  1MD3 A;  4DVC A;  2IWT A;  4OCF A;  6GSY A;  1TK8 B;  4MF7 A;  5HR3 A;  1EV9 A;  2TRC P;  2ALB A;  4JR4 A;  3DWV A;  2PBJ A;  4J56 E;  4K2X A;  4FH8 A;  1FVJ A;  2R37 A;  4HQS A;  1VF3 A;  2TIR A;  4Z2T A;  1GTU A;  4GQC A;  4J57 E;  2DIZ A;  3CTG A;  4WBJ A;  3WYW A;  3LFL A;  5GAN D;  2VD1 A;  3BCI A;  1YDK A;  6GSX A;  1XOB A;  2G2Q A;  1GNE A;  4HJ2 A;  4E8H A;  1T1V A;  4FYC A;  1EGR A;  5IO2 A;  2VLV A;  4HI7 A;  1K0D A;  4USS A;  4MP4 A;  3F4R A;  3F8U A;  2CT6 A;  2L5L A;  2V1M A;  3C7M A;  3QR6 A;  3IK9 A;  3C73 A;  1GLQ A;  1OC8 A;  1ON4 A;  1Z9H A;  2HRN A;  5D9X A;  4YAP A;  5DJL A;  3NIV A;  2PUK C;  4TVE A;  2FA4 A;  5G31 A;  3LXZ A;  2OBI A;  5HFK A;  4F0C A;  2K8V A;  5D9W A;  1UA5 A;  1ZMA A;  3KGK A;  4NHZ A;  2DKI A;  4F9Z A;  3P7X A;  4X4J A;  2YPM A;  4PUR A;  4DSS B;  2AAW A;  2ON7 A;  2RUF A;  3GMF A;  1J08 A;  4TXO A;  4JE1 A;  2C80 A;  3KTB A;  4V2N A;  2I9H A;  1JZW A;  4TOP A;  4OFN A;  4FO5 A;  6GSS A;  3EMP A;  2IFQ B;  1YY7 A;  1GL8 A;  1O85 A;  3RPN A;  3D21 A;  1PN0 A;  3AY8 A;  4N0Z A;  2VCW A;  3RPP A;  2VLT A;  5FWG A;  2A4V A;  1ERU A;  2H66 A;  1JLW A;  3RAZ A;  3IPZ A;  5DVB A;  3FR9 A;  4ACS A;  10GS A;  1M9A A;  2VL2 A;  3D5J A;  2R3X A;  2PN8 A;  1IYH A;  5A4U A;  3CRU A;  1MTC A;  1HNB A;  1PKZ A;  1WOU A;  2PU9 C;  1GH2 A;  1DBY A;  6GSV A;  5G5E A;  2IIY A;  1M2B A;  4MJA A;  3P2A A;  4WR4 A;  1ERV A;  1AXD A;  2LKU A;  1EEM A;  3BJ5 A;  4JZQ A;  4OWY A;  3BCK A;  3IHG A;  2B6M A;  1F3A A;  5AIV A;  1W89 A;  3IK7 A;  1ZYP A;  2HSH A;  4Q5F A;  1U6T A;  4I2U A;  2I4A A;  2B7J A;  3UAR A;  1NSW A;  1TU8 A;  2BTO T;  4EDY A;  1E2Y A;  2X4A A;  2C0G A;  1SKR B;  4RI6 A;  2NTO A;  1DE2 A;  3KTL A;  3QDN A;  3UIW A;  1SKS B;  2GSR A;  2VL3 A;  4TN8 A;  3ZIV A;  1YEP A;  2H19 A;  2O8V B;  1QUW A;  5ABR A;  2C0E A;  2B7K A;  2K6V A;  2HSY A;  2VD0 A;  2FNO A;  2C3T A;  5IMD A;  1GSS A;  1AW9 A;  1OAZ A;  1GLP A;  3FHK A;  5L71 A;  4PUA A;  4BVY A;  3H1N A;  3F6D A;  1O8X A;  4GST A;  1ERW A;  1G0T A;  3F3Q A;  1IYI A;  2R0P A;  2YWO A;  2H0I A;  2F9S A;  5DDL A;  4HDE A;  4IHU A;  4YKF A;  2DKH A;  1PX7 A;  2BJX A;  4MA9 A;  3WGD A;  4K7N A;  4ECC A;  2GZP A;  1QXH A;  5DAK B;  4K7I A;  2WFC A;  16GS A;  3EC3 A;  5F07 A;  2LRN A;  2JAC A;  1GTA A;  5ECI B;  4GRF A;  1XVW A;  5D8I A;  4POL A;  3KD0 A;  3CMI A;  2HZE A;  5CYY A;  4BVX A;  1XW9 A;  4K2D A;  3FZ4 A;  5ENU A;  3ZVJ D;  3IV4 A;  1SYR A;  2OJL A;  2X8G A;  4RQR A;  5CRW A;  4WKW A;  5ECO B;  2I3Y A;  1GP1 A;  1U3I A;  3VPT A;  1W4V A;  5EL8 A;  5D9T A;  2HZF A;  2LJA A;  2R4V A;  3VWV A;  4NAX A;  1Z6N A;  3LSZ A;  3ZIT A;  1NM3 A;  1A23 A;  4K5R A;  3GFK A;  3MDK A;  3HJM A;  1R5A A;  3H8Q A;  3P90 A;  4ZL8 A;  4ILF A;  4YAV A;  4ZIL A;  4N11 A;  2YV9 A;  1JZR A;  4NHW A;  3SBC A;  2H6X A;  1X9M B;  1U3A A;  2FD3 A;  1VF1 A;  3GV1 A;  3TKS C;  5KEJ A;  4FQU A;  1XW6 A;  4G19 A;  2LJR A;  1YEX A;  2C0F A;  4F0B A;  1KBN A;  1GSF A;  1XWC A;  3UAP A;  4KSM A;  3A5I A;  2N5F A;  4TR1 A;  2CVB A;  1XWA A;  3LWA A;  5HR2 A;  4G0K A;  5C00 A;  2GQK A;  4ISD A;  1ZYQ B;  2F51 A;  4QQ7 A;  4WET A;  4EXJ A;  4IP6 A;  5IOW A;  2VCV A;  4O7H A;  4MCU A;  1LU4 A;  4I8B A;  2YWN A;  5JCW A;  2F3M A;  3EUR A;  4JBB A;  5FT3 A;  4EIP A;  2EC4 A;  1TK0 B;  5COH A;  4AJ6 A;  4OD7 A;  3FK8 A;  3GX0 A;  5G1L A;  2QKE A;  4DSR A;  4ZB9 A;  4P3Y B;  3C1S A;  4WF5 A;  3C1R A;  2OAC A;  1CQH A;  2GDR A;  3GL5 A;  1ZZY A;  2M72 A;  3MNG A;  3UJ1 A;  4NMU A;  2DJ2 A;  1K0O A;  4KE3 A;  1C72 A;  3QCP A;  1SYX A;  3NZN A;  4Z7X A;  2YZH A;  1Z7P A;  4OMV A;  3ZTL A;  3UBL A;  1AQW A;  3O6T A;  4RUV A;  3VI5 A;  1PA3 A;  3N5O A;  2R0C A;  4PX1 A;  5BMU A;  4MMM A;  3G7Y A;  2IMK A;  1YJ6 A;  2GSQ A;  3F63 A;  1X0R A;  2GGT A;  4N30 A;  4PNG A;  2TRX A;  3VWU A;  1BG5 A;  3EE2 A;  3ZMK A;  3HY2 A;  2LNS A;  5CRE A;  4ML6 A;  4IS0 A;  4IJI A;  5IMA A;  1OC9 A;  4Q5Q A;  1SL2 B;  3KXO A;  2N5B A;  3QFB C;  4MJE A;  3VK9 A;  1PMT A;  2QC7 A;  4O5Q A;  2DBC A;  3D0Z A;  3O76 A;  3KEB A;  1T3B A;  3ZZX A;  2MYG A;  3IXR A;  4POB A;  4OO4 A;  2OE3 A;  5IQY A;  2YWI A;  4O32 A;  1EGO A;  3WGE A;  4EKZ A;  4ECJ A;  2C4J A;  1WP0 A;  3TKR A;  2H76 A;  5DQS A;  3DD3 A;  1YF0 A;  1H75 A;  3HA9 A;  2MBT A;  20GS A;  2MMN A;  4Q5N A;  1AQV A;  3GH9 A;  3GL3 A;  1TOF A;  3TCO A;  2FUG 2;  1AIU A;  4KDU A;  4EDZ A;  3CYN A;  3IHQ A;  3TKQ A;  1OE7 A;  2NBS A;  2X64 A;  4V1A p;  1AAZ A;  4KDY A;  5HR0 A;  4N0V A;  2WRT A;  4L5L A;  2IMD A;  6GSU A;  1Q4J A;  1XW5 A;  1QFN A;  3GSS A;  2L4Q A;  5IOX A;  1PSQ A;  4GCI A;  3M3M A;  2YV7 A;  3ZFB A;  1ZOF A;  5G1K A;  1V58 A;  2P5R A;  1XIY A;  4ZIJ A;  4OFM A;  3EPT A;  1A8L A;  5HFI A;  3Q19 A;  5IPG A;  3IC8 A;  1X9S B;  1GUL A;  3ZLP A;  2QGV A;  4G2E A;  4X0X A;  2B1L A;  4MPG A;  4BL7 A;  1J9B A;  1CQG A;  4DSQ A;  2CQ9 A;  3MYD A;  2H75 A;  3LW9 A;  4MZB A;  3KJY A;  5ECN B;  1TK5 B;  2OAD A;  3HJP A;  2KOK A;  3D4T A;  1OC3 A;  3GX8 A;  3CSJ A;  3J7Y b;  4ECI A;  4L0W A;  5CO3 A;  2L4C A;  2IJY A;  1B48 A;  4HZ2 A;  1FO5 A;  4MH2 A;  2OA7 A;  4D73 A;  3KM6 A;  1YF1 A;  3E3E A;  3HZ4 A;  2XBI A;  2HRK A;  2OE1 A;  5DAL A;  5ID2 B;  2FGX A;  2VOC A;  4PGT A;  1Y6E A;  3GUR A;  4XHM A;  1WWJ A;  5IPH A;  4KA0 A;  1K3L A;  2R6K A;  2GTU A;  2R0G A;  4MPF A;  4POM A;  1NW2 A;  5KN2 A;  3S9F A;  3LGC A;  3VPQ A;  5J9C A;  3TJF A;  1ST9 A;  3ZML A;  2AJQ B;  1SK1 A;  1AQX A;  1K0C A;  3H4K A;  2DLX A;  3KMO A;  2E7P A;  3FZ5 A;  3R3E A;  5AIS A;  2M80 A;  4ECB A;  2ON5 A;  3IA1 A;  2H1A A;  5GAP D;  4K9Z A;  4CY8 A;  1YQ1 A;  2EIR A;  1UN2 A;  1GSY A;  1EZK A;  4PQ1 A;  2HE3 A;  3GKX A;  1ML6 A;  4HZ4 A;  2FA8 A;  2QA2 A;  1EWX A;  1LBK A;  2GT5 A;  1THO A;  2GVP A;  1TRW A;  4Z2R A;  2NVL A;  1B4Q A;  3GKN A;  5JWR B;  2DJ1 A;  3UOM A;  3APS A;  5EVO A;  2Z9S A;  3L9U A;  3D4M A;  3FR3 A;  1SD9 A;  4Z2U A;  4A5P A;  2YP6 A;  4IW9 A;  2VO4 A;  1TU7 A;  3CSI A;  4YQM A;  4KB3 A;  2MZC A;  4JU5 A;  1XOA A;  1MDK A;  1T4Z A;  5JWQ B;  2P5Q A;  3ME8 A;  1R7H A;  5IMC A;  5J5N A;  3GA4 A;  2CX4 A;  2HRA A;  1SL1 B;  1T8E B;  4I6X A;  4TXV A;  1OE8 A;  4G0I A;  3TUE A;  5G30 A;  4ZL7 A;  1WIK A;  5ECQ B;  3ME7 A;  4L5O A;  2XPE A;  4LA1 A;  5ECP B;  2PMT A;  1R5P A;  2AB6 A;  1UC7 A;  4EC0 A;  2CZ3 A;  1QGV A;  3MIX A;  2WCI A;  1GTI A;  2GS3 A;  2VCQ A;  2H73 A;  4G10 A;  3I69 A;  2VL9 A;  1ERT A;  1F3B A;  2KLX A;  3I9V 2;  4MH3 A;  1XPV A;  3CSH A;  1E6B A;  3R2Q A;  3GHA A;  4ZL9 A;  3Q74 A;  4NV5 A;  4IKH A;  1XFL A;  3TRQ A;  2DJ3 A;  3LG6 A;  4XS4 B;  5F06 A;  3H93 A;  1S3C A;  1SL0 B;  1NHO A;  2DJ0 A;  2LRC A;  3DKS A;  4IQ1 A;  4PTS A;  4TR0 A;  1NHY A;  1B9Y C;  3FMW A;  1V2A A;  1MDI A;  2XHF A;  1F2E A;  3TB2 A;  4TRX A;  3L78 A;  4TKY A;  3TRX A;  4LLR A;  8GSS A;  4IBP A;  4XRD A;  1O81 A;  5D9V A;  1LJR A;  3LXT A;  5ELG A;  2GT6 A;  2HYX A;  2MMO A;  3GTU B;  3HJO A;  1SJ6 A;  2GZZ A;  1BQ7 A;  2O89 A;  5EY6 A;  2VCT A;  1FB0 A;  1B8X A;  4ZB8 A;  1BJX A;  4NPB A;  4ZB6 A;  2FWG A;  3DML A;  2FWE A;  2H6Z A;  4N10 A;  4OFT A;  5CRG A;  1SD8 A;  6GSW A;  2K9F A;  2GQL A;  5C04 A;  5ECH B;  2B3S A;  4V1A g;  2L6D A;  3KH9 A;  3IC4 A;  3LJR A;  3TOT A;  7GSS A;  2FLS A;  4ZBB A;  2ES7 A;  5INY A;  2HFD A;  2GLR A;  1G7O A;  1S3D A;  3QAW A;  4IJ3 A;  4XRA A;  1TP9 A;  3G7J A;  4RQX A;  5LCZ A;  1H4O A;  4K1F A;  1PRX A;  2CVK A;  5ECS A;  2O87 A;  2L59 A;  2PWJ A;  3KIJ A;  3UVT A;  2X8H A;  1Q98 A;  5JWO B;  1SJZ A;  3TGZ A;  1JZD A;  1ILO A;  3HCZ A;  2V2G A;  4AJ8 A;  2NDO A;  4KAE A;  4XS1 A;  3NOF A;  4MZW A;  3MSZ A;  4KCA A;  3UVH A;  1X9W B;  3KCM A;  2DJJ A;  2WJU A;  4QL7 A;  1Z7R A;  2VAF A;  2AHE A;  5GZZ B;  2XBQ A;  4DSS A;  5ECR B;  4MK3 A;  1V57 A;  5KN3 A;  4EUY A;  3GYK A;  2YAN A;  2XPD A;  3Q18 A;  2K8S A;  3LQ7 A;  2IFQ A;  1X5E A;  2LST A;  4LL4 B;  4WR5 A;  1F9M A;  4X43 A;  4HS1 A;  2WDU A;  5ELA A;  5A4V A;  4MNN A;  3PIN A;  2IME A;  2JSZ A;  3KP8 A;  4L8E A;  5LNK e;  4GQF A;  2DSA A;  1G7E A;  4NWY A;  14GS A;  4WF4 A;  2CAQ A;  3M9J A;  2XC2 A;  3QAV A;  1YKC A;  3IOS A;  2A4H A;  2CZ2 A;  5IMZ A;  2LTK A;  4TXO B;  2AUV A;  4EO3 A;  1EOH A;  1TDI A;  3BOA A;  3LEF A;  1WJK A;  2HLS A;  3HZ8 A;  4X1U A;  5IM9 A;  2R5G A;  4YH2 A;  1QQ2 A;  5DBQ A;  5F05 A;  2L57 A;  2JZS A;  4OO5 A;  1ACV A;  1OVN A;  3G9B A;  2REM A;  3GKK A;  4IQA A;  1OYJ A;  3A2V A;  2H30 A;  3HXS A;  2LJK A;  4JRR A;  4IEL A;  3DYR A;  1N8J A;  2N5A A;  4EE0 A;  1PGT A;  2L6C A;  1HD2 A;  3PR8 A;  3TKS A;  1T00 A;  1FHE A;  2CX3 A;  3A5W A;  3ZL5 A;  1J0F A;  4LMW A;  4JED A;  2C8U A;  4FYU A;  2H1G A;  4KGI A;  4XS6 A;  2FY6 A;  2H6Y A;  3F4S A;  3HKR A;  1PQN A;  3BBY A;  2MMZ A;  1DE1 A;  5DJM A;  3M8N A;  5E4W A;  2DC5 A;  3DXB A;  3TKS E;  1HYU A;  5LD0 A;  4BPY A;  4KH7 A;  1K3O A;  1B9X C;  5DAK A;  1V9W A;  1RW1 A;  5J41 A;  2VIM A;  2H1D A;  2YWM A;  4AF2 A;  4I5Q A;  4WXT A;  1QK8 A;  1EP8 A;  2DJK A;  2H0H A;  5KN0 A;  1RQM A;  2J23 A;  3L4N A;  3L9V A;  2HXK A;  2PVQ A;  4BVY B;  3GTU A;  5F0G A;  2UZ8 A;  2LNT A;  1VRS D;  3GN3 A;  4Q5R A;  1ZCP A;  3QFA C;  4MJC A;  1EP7 A;  3ZRE A;  1A2L A;  5ECL B;  4HQZ A;  4IP1 A;  2JU5 A;  3GUS A;  4NV2 A;  1Y25 A;  3E9J B;  3HD5 A;  4I97 A;  5DQY A;  2I81 A;  13GS A;  4MZC A;  5GST A;  1T7P B;  5A4W A;  2F8F A;  3GRX A;  5E59 A;  1SK2 A;  5CNW A;  1A8Y A;  3GIX A;  4CDO A;  2YJ7 A;  1FB6 A;  5J3R A;  1BED A;  2HSM A;  1SEN A;  1U87 A;  2H71 A;  1DUG A;  2AV4 A;  2J9H A;  4ZBA A;  3VFI A;  1FAA A;  1R4W A;  1BYE A;  5DCH A;  2DML A;  3IRA A;  2YJH A;  3DVW A;  2YCD A;  4KDX A;  1GRX A;  3F4T A;  5JCG A;  1TJD A;  1F6M C;  3CTF A;  2VL2 C;  5KOW A;  3KZQ A;  2AYT A;  2HZE B;  4IN0 A;  4MAB A;  3RBT A;  2ZNM A;  3QOU A;  4BVX B;  1PKW A;  2JSY A;  5GSS A;  3LYP A;  4IGJ A;  4NXI A;  2MMA A;  2QA1 A;  1K0M A;  2LUS A;  4OCE A;  3ERF A;  3IAM 2;  2RLI A;  3M1G A;  4BA7 A;  5IMF A;  2C0D A;  4V2L A;  1A2M A;  1GSQ A;  3VUR A;  2RM5 A;  4L0U A;  4BWS A;  1V40 A;  1A0R P;  1M7T A;  3US3 A;  4TR3 A;  3EU3 A;  2YZU A;  3A2X A;  1ZGN A;  3ZFL A;  1TXX A;  4K5S A;  4ID0 A;  4G9H A;  1WPI A;  4MDC A;  4WEY A;  1EV4 A;  3WGX A;  3ZYW A;  2IMI A;  3CRT A;  5JCU A;  1M2A A;  4HUA A;  3ZRD A;  1JZO A;  1GUH A;  2VM2 A;  1EOG A;  3HVV A;  4PUF C;  3TOU A;  2EIQ A;  2K18 A;  4TW5 A;  1U88 A;  2KP1 A;  1GUM A;  3IR4 A;  4MF5 A;  1FOV A;  2P0G A;  1KNG A;  2VUP A;  1OKT A;  3EWL A;  2P31 A;  4KW6 A;  1WRY A;  4PXO A;  2B5E A;  1X5C A;  2LQQ A;  2RUE A;  2H8L A;  2V41 A;  3APO A;  3UL3 A;  3KH7 A;  2A2R A;  3FZ9 A;  2M46 A;  3ZIJ A;  1USB A;  4TR1 B;  4CW9 A;  19GS A;  1SK0 A;  2LEG A;  4KND A;  1VF2 A;  1O7U A;  3ERG A;  1WE0 A;  2DMM A;  1GWC A;  1XCC A;  1TRV A;  3TJB A;  3OR5 A;  3KMN A;  2NPB A;  4F2I A;  2H70 A;  1QMV A;  3MWH A;  4GXZ A;  4KCE A;  1Z5Y E;  5IIZ A;  3H79 A;  2OKA A;  3O3T A;  22GS A;  1GTB A;  3PH9 A;  1XBS A;  5CRD A;  2VLU A;  1XWB A;  3FKF A;  5FHI A;  4O5R A;  1K0A A;  2V6K A;  3CXG A;  4QL9 A;  2G0F A;  1PL2 A;  3ISO A;  2WUL A;  4HU7 A;  3BD2 A;  3PGT A;  4J2F A;  5B6N A;  3HVS A;  2IPA A;  3C8E A;  5B8B A;  4GWR A;  1M0U A;  5D73 A;  3FR6 A;  1HQO A;  3DRN A;  2L5O A;  1EEJ A;  1MD4 A;  2IMF A;  3EVI A;  2PPT A;  3QAG A;  1UVZ A;  3WT1 A;  4RI7 A;  1OKD A;  1O8W A;  2BMX A;  1AC1 A;  1DSB A;  5AN1 A;  1M2D A;  3ED3 A;  5F8B A;  3QMX A;  3F0I A;  2H1B A;  1OC9 B;  4GLT A;  3VWX A;  3ZVJ A;  1PL1 A;  2C3Q A;  5G2Z A;  3J7Y k;  1S3A A;  2X49 A;  5IMV A;  1SKW B;  4ZXG A;  5AIX A;  4HOJ A;  3EMX A;  3CBU A;  3JCM L;  5B8A A;  1BX9 A;  4HU9 A;  5J4U A;  1FW1 A;  4F82 A;  1G6W A;  3TJG A;  5B7C A;  3PPU A;  3IAS 2;  1KEB A;  3QPM A;  2LRT A;  1HNA A;  1PX6 A;  2D2Z A;  1F37 A;  1ABA A;  4HEA 2;  2ZUP A;  1A2J A;  2OE0 A;  2X8C A;  5HFG A;  1XWG A;  3W6G A;  4YKG A;  4MLY A;  4K0N A;  2VCZ A;  2C3N A;  3L9S A;  2C1Y A;  12GS A;  2JAD A;  3FRC A;  3GH6 A;  3P8W A;  1ZYE A;  2WGR A;  5CRH A;  3W8S A;  3ERW A;  3FYG A;  5B6M A;  1I9D A;  2QSI A;  5KN1 A;  1XZO A;  3UMA A;  4KF9 A;  1I5G A;  3TKP A;  4I2T A;  3A2W A;  1O6J A;  2E0Q A;  2E2G A;  3IDV A;  3F6F A;  2E2M A;  3WT2 A;  5ID2 A;  4PQH A;  1FG4 A;  1VF4 A;  1GSU A;  3F9U A;  3A3T A;  2RM6 A;  1TKD B;  1RK4 A;  4FYB A;  2PVO C;  5J9B A;  1TTZ A;  1XXU A;  2HNL A;  5G5F A;  2FWH A;  4PNF A;  2FWF A;  3DEX A;  3EU4 A;  2OBK A;  2HI7 A;  3GST A;  2PER A;  3RDW A;  4GSN A;  1GSE A;  3VI7 A;  2WB9 A;  4BL7 B;  1V98 A;  1JFU A;  3D6I A;  4G0L A;  1Z6M A;  3FEU A;  3LOR A;  5H5S A;  4DEJ A;  3EYT A;  5KOX A;  1TRU A;  2IL3 A;  3DGQ A;  3E0U A;  5ECM B;  4EVM A;  5A5K A;  1GUK A;  2B5X A;  4AJ7 A;  1THX A;  2YN1 A;  2O7K A;  4V2M A;  4O92 A;  4D73 B;  17GS A;  3HVX A;  4PQI A;  2CVD A;  1TRS A;  1TW9 A;  4LL1 B;  1URM A;  4FIW A;  3RHC A;  5CAX A;  2HRF A;  1T4Y A;  4XTS A;  3MAK A;  4MF6 A;  3QD9 A;  5DAL B;  3WD6 A;  1PN9 A;  4ICY A;  4CHS A;  2O85 A;  1YZX A;  4IVF A;  5D93 A;  4ULX A;  1K0N A;  4GSS A;  5HR1 A;  2X99 A;  3FY7 A;  3VWW A;  1HNC A;  1YKA A;  4YQU A;  1A24 A;  2GZY A;  3LYK A;  1SU9 A;  4TR4 A;  4KUN A;  4MJB A;  1R26 A;  3Q6O A;  4WBR D;  4K8M A;  4BWQ A;  4K7O A;  3FW2 A;  2JZR A;  5DCG A;  4KX4 A;  1FVK A;  4AGS A;  1WMJ A;  1JHB A;  3DIE A;  1XVQ A;  4JR6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...