3PINA

Crystal structure of mxr1 from saccharomyces cerevisiae in complex with trx2
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
104
structure length
104
Chain Sequence
MVTQLKSASEYDSALASGDKLVVVDFFATWCGPSKMIAPMIEKFAEQYSDAAFYKLDVDEVSDVAQKAEVSSMPTLIFYKGGKEVTRVVGANPAAIKQAIASNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport/oxidoreductase
molecule keywords Thioredoxin-2
publication title Structural plasticity of the thioredoxin recognition site of yeast methionine S-sulfoxide reductase Mxr1
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 33
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2010-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3pinA00
4MABA 2O89A 2MMNA 3UVHA 4MDCA 2VCTA 1KNGA 3ERGA 2IMDA 4NAXA 2B6MA 2ALBA 1E2YA 1VF1A 2YN1A 3BCKA 2F51A 1GSQA 1YEPA 1TDIA 1NHYA 3HJMA 1UA5A 2GSSA 2HFDA 4KCAA 3WT2A 3RHCA 4POLA 1XWAA 2I1UA 5IQYA 1ZYQB 2H19A 4IGJA 1R4WA 2I4AA 3TKQA 2E0QA 2VCVA 5E4WA 3WD6A 1HNBA 3LXZA 4KDYA 4JE1A 2DJJA 4TRXA 2RLIA 1VF4A 3H79A 5DBQA 3BCIA 5F05A 1YF0A 3GIXA 1PGTA 1GUKA 3UVTA 2G0FA 3L78A 2VUPA 2NTOA 5IPHA 1PSQA 3GH9A 3O6TA 2HRFA 5CNWA 3TJKA 5IMDA 1NW2A 1N8JA 4GF0A 2GQKA 1M2DA 1W4VA 3FYGA 4YQVA 5ECLB 1EGOA 4ML1A 1BAYA 1AW9A 1GP1A 1V58A 2K8SA 3LG6A 4ZL9A 2FA4A 4KX4A 1THOA 1J08A 1H4OA 3EWLA 1B9YC 1WE0A 2HZEA 4EL1A 3GUSA 2VO4A 3D6IA 5AIVA 5AIXA 4IHUA 1EWXA 2Z9SA 3TUEA 5C00A 2XC2A 3IV4A 1X0RA 2R2JA 3VWWA 1R5PA 1EP7A 1TRVA 4JR4A 2QKEA 3OR5A 2H8LA 1EP8A 4LLRA 4BVXA 1WIKA 2TIRA 1WP0A 3QPMA 4WR4A 2MYGA 2K6VA 3FK8A 1GSDA 4TN8A 4EC0A 4KUNA 3EURA 3ZLPA 2DIYA 1ZMAA 4F2IA 2C8UA 2KOKA 1YQ1A 1CQGA 1ERWA 4DSSA 5DALB 3M9KA 2PERA 4X1UA 6GSYA 3FRCA 4PQIA 3CYNA 2AUVA 1SD9A 4NV2A 4F0CA 4ACSA 2I9HA 1YKCA 6GSXA 2E2MA 3A2XA 1QUWA 2IN3A 2V32A 2REMA 1F37A 4PURA 3KD0A 17GSA 3M3MA 2QGVA 1M9AA 2VM1A 1Z7RA 2LRTA 3TOUA 2RM6A 4NV5A 3IAM2 4MJCA 4XRAA 2YANA 2NVLA 5G5EA 4ZB9A 3RPNA 1XXUA 13GSA 5B6NA 3SWLA 1YKAA 1SYXA 4V1Ag 3MDKA 3D21A 1MDKA 2FA8A 4L8EA 4PQ1A 2LJKA 2M46A 5F8BA 4IJ3A 4HU9A 4LMWA 1T1VA 5COHA 5AISA 2ZNMA 2E2GA 3G9BA 3KCMA 3PGTA 3M8NA 1XWGA 3VI5A 2FY6A 5ECSA 1T3BA 4GLTA 5JWOB 1B8XA 5KEJA 5ELGA 4EKZA 3KH9A 3EMPA 3ZITA 1WRYA 1U87A 1ZGNA 2H01A 3A3TA 3BOAA 3APQA 3ZZXA 3M9JA 3QDNA 2R4VA 3MNGA 5DJLA 3TJFA 2WULA 3FW2A 4TR4A 1FB6A 3ZVJD 3ZIVA 3PR8A 1K0NA 2WJUA 4HDEA 3M0FA 3FZ5A 2VL3A 1O8WA 1A0FA 4ZL7A 4HQSA 4IQAA 4XRDA 3GA4A 2CT6A 5FT3A 4XCSA 2DJ3A 4K1FA 2C0DA 1SK0A 4NMUA 3P90A 3ZFBA 3HJPA 3CRTA 1XVQA 3F3QA 1R26A 2JZSA 2PPTA 2YWMA 2DC5A 4I2TA 2CAIA 2LRNA 3HJOA 3D0ZA 1YF1A 1A2LA 2M80A 5DAKA 5KN3A 2OBIA 1GULA 1YJ6A 3HZ8A 1HNCA 3F6FA 2H70A 3APOA 1MD3A 3QAVA 1YZXA 1V40A 2I81A 4ZXGA 3MWHA 3FZ9A 2F8AA 2M72A 1B9XC 3DVXA 5EPFA 3TKSA 4IW9A 2H0HA 1M2AA 4G19A 4GSTA 1SENA 1NM3A 3ZMLA 3M1GA 5A4WA 2O8VB 3ZFLA 4HU7A 5CRDA 1WMJA 5G2ZA 5B7CA 2PUKC 2JU5A 5IOXA 2VCWA 1KEBA 4OD7A 4N10A 3CTGA 1M7TA 5IO0A 3BD2A 4ZBBA 2HZEB 9GSSA 4OCEA 2PBJA 3KMOA 3D22A 3GKKA 4RI7A 1K3LA 2JACA 4ZBAA 2WFCA 1FVJA 1IYHA 2DMMA 4KGIA 2WDUA 3EE2A 1GTIA 1E6BA 3L9SA 16GSA 4MP4A 1R5AA 1X9SB 1GL8A 5HFIA 4IELA 1F2EA 1X5EA 1FW1A 2CQ9A 5HFKA 2HZFA 3FHKA 4MJBA 1GTBA 3KP9A 4F0BA 4KAEA 5DQSA 2GLRA 1EEMA 2YOIA 4TVEA 3ERWA 4POMA 1SJZA 3LYPA 2BJXA 1XVWA 1SKSB 5H5SA 2GT6A 5JWQB 2XBQA 2A4VA 1THXA 1GTUA 2IIYA 2R5GA 4MPFA 4OCFA 5DQYA 2C0FA 2B5XA 3L4NA 3IC4A 1GSSA 5LCZA 1GTAA 3H4KA 2QSIA 5L71A 2OKAA 3KXOA 3F0IA 3GYKA 3GRXA 6GSTA 1B4QA 3LEFA 2K9FA 2X8CA 1PD21 4N0ZA 2FUG2 3QR6A 2CX3A 2V41A 3UBKA 1PKWA 1WOUA 5D73A 3EC3A 4WF5A 4QL9A 2H0IA 1K0BA 2MMZA 1K0MA 2LJRA 2IJYA 5AN1A 1Z5YE 2KP1A 3IHQA 4FYBA 3UAPA 4FYCA 2FWGA 2PMTA 1EEJA 1JLVA 3GTUB 5FHIA 4KE3A 5F06A 2CZ2A 4AJ7A 4TR3A 4V2MA 1SJ6A 2YJ7A 4GTUA 4MF7A 5GAPD 2CVKA 2IMIA 2FD3A 4ZB8A 1UN2A 1TK8B 1TK5B 4AGSA 3IBHA 4FIWA 1XPVA 3LXTA 1TW9A 1AIUA 4JU5A 4D73B 4ZIJA 1F9MA 3TDGA 3CRUA 5GAND 2X8HA 1FO5A 4N0VA 2DJ1A 4XHMA 4PX1A 4ID0A 4KB3A 2IMKA 1VF3A 5D9WA 1LBKA 2RUFA 3TJJA 5B6MA 3CBUA 2H75A 3APSA 3E9JB 3HVSA 1GNEA 2IWTA 1BJXA 4HEA2 2B1LA 2L6CA 5D96A 5JWRB 4RUVA 2YP6A 2LS5A 2EIOA 3VFIA 5A4VA 1TU8A 3U6VA 1A23A 1PX6A 1TXXA 3V1WA 4WF4A 2WGRA 3KM6A 2AV4A 4K2DA 1Q4JA 2G2QA 4XS4A 3UL3A 4OFMA 1S3CA 1A8YA 4YAPA 3QAWA 1PRXA 3TRXA 2OE3A 2V6OA 3LORA 3TRPA 3LFLA 5ECQB 2H6YA 2YWOA 2X8GA 3I6AA 5IM9A 1ILOA 2GT5A 2PWJA 1F6MC 4ILFA 3O3TA 2O7KA 2ON5A 5DAKB 2HT9A 2L57A 4JR6A 1C72A 1OKTA 1ERUA 4GRFA 1FG4A 5HFGA 4EUYA 4KA0A 3ZL5A 2E7PA 4P3YB 4O32A 4QQ7A 2LEGA 2C1YA 2TRXA 3UJ1A 2YPMA 1TI3A 5CREA 4Q5NA 1FOVA 2EIRA 3FR9A 1SKWB 2L4QA 2MMAA 3IAS2 4TXOA 3FEUA 2GS3A 1M9BA 1HNAA 2GDRA 3GFKA 4I2UA 4F03A 1T4YA 1AQWA 4TW5A 3PINA 2LRCA 3U5RE 3DRNA 3TB2A 4WBJA 3ME7A 2P31A 4HZ2A 4MF5A 1VRSD 3S9FA 1WJKA 19GSA 3VWXA 3IPZA 1Y6EA 5DJMA 4X43A 3GSTA 4WKWA 1ERVA 1EOGA 2EIQA 1I9DA 3WT1A 4BL7A 1CQHA 1T8EB 3CMIA 2R37A 5D93A 3WGEA 1URMA 4IP6A 4ECBA 4MLYA 3TRQA 4K8MA 1BYEA 2YCDA 2XPDA 3P7XA 5B8AA 3FR3A 1K0OA 3HCZA 1GUMA 1S3AA 2H66A 2VL2A 2C0EA 3ISOA 1NSWA 1B4PA 3UMAA 2VCQA 4GQFA 1GWCA 3QMXA 3RBTA 2MBSA 3EU3A 4LL1B 2FNOA 2CX4A 2FWHA 5LD0A 3ZVJA 3HKRA 2EC4A 3HY2A 3H1NA 1Z9HA 2GQLA 4K7NA 3QCPA 5DDLA 3TKPA 3TKSE 3KMNA 2A2SA 4LMVA 22GSA 4CHSA 3IDVA 4IBPA 2TRCP 2VLUA 1GLQA 2PVOC 4NHWA 3ZTLA 3QD9A 1EV9A 4WXTA 2P0GA 2P5RA 1ZYEA 3ZMKA 4YQMA 2VL9A 1V98A 3DGQA 4GCIA 3FY7A 2GSQA 3G7YA 5ID2A 1G0TA 1J9BA 1MD4A 2B3SA 1DSBA 1GSYA 3DYRA 1RK4A 2LNSA 4EF0A 5FWGA 5C04A 2FCHA 5ECHB 5LNKe 1QQ2A 4V1Ap 2H73A 3QAGA 5HR1A 14GSA 4DVCA 1SL1B 2AB6A 4TR1A 4WEYA 3UIWA 5A5KA 3DXBA 4K0NA 4EE0A 4CDOA 4HZ4A 2HSYA 4QL7A 3HHVA 2IMEA 4IN0A 1A0RP 2DIZA 3HDCA 2L4CA 2JSYA 4GWRA 3J7Yb 4RQRA 1ML6A 4BPYA 3GKNA 4Q5RA 3IA1A 3NZNA 4MA9A 1AUCA 2CVDA 5HR3A 1XBSA 4DEJA 1XIYA 3MSZA 4L5LA 1G6WA 2YV9A 2QC7A 2IFQA 4HI7A 1LJRA 4YAVA 4GSNA 2GVPA 2H71A 1XOBA 4HQZA 2B7JA 4NPBA 4RI6A 1XW5A 5HR2A 4L0WA 4E8EA 4BWQA 2B7KA 5J41A 2PU9C 1XWCA 3F8UA 5CRHA 5IMVA 1W89A 1ABAA 4WETA 3FR6A 2JZRA 2X99A 5EVOA 5G31A 5JCUA 1GSEA 1T00A 4MPGA 3W8SA 3P2AA 3LYKA 2C0GA 1T4ZA 2B1KA 5D9TA 3VURA 2OBKA 3H93A 4L5OA 3I9V2 4XS4B 1TTZA 5ECNB 3QFAC 2OJLA 1FHEA 3HD5A 1HQOA 3FZ4A 4TR0A 1KBNA 3LWAA 4ML6A 4PGTA 3VPQA 4OWYA 3ED3A 3C1RA 1ERTA 3KJYA 3LJRA 2CVBA 2LSTA 2BTOT 3TJGA 1TU7A 1OE7A 5CAXA 3CSHA 1O81A 4ECJA 4KSOA 2YWIA 2F8FA 2C3TA 3CSIA 5ENUA 4IKHA 1K3YA 4IQ1A 3UEMA 2HYXA 4YQUA 4BVYA 3HVXA 4K7IA 3E3EA 2AJQB 2L5OA 2KHPA 5HQPA 3EVIA 3H8QA 2OA7A 5H5QA 3F4TA 3WGDA 4Z7XA 1SK1A 3HYPA 3QOUA 1RW1A 4N30A 1V57A 4KDUA 5ECKB 4IJIA 3IXRA 3W6GA 5GSSA 3DMLA 2V1MA 5JCWA 3KP8A 3US3A 3GH6A 4AJ6A 1VGLA 1XWKA 1G6YA 1M0UA 4WR5A 4ZILA 5J9BA 2H1AA 4FYUA 3FZAA 3KTBA 1ZCPA 5EY6A 1IYIA 2CZ3A 3L9VA 5HR0A 4ZL8A 2PVQA 1OYJA 4DSSB 1PN9A 3TKSC 3ERFA 1JZWA 3W8JA 3VLNA 4XS1A 1Z6NA 1PX7A 2O87A 1Z3EA 3LQ7A 2HNLA 1JZRA 4F9ZA 2YZHA 3DWVA 1YDKA 4ZB6A 1OC9A 18GSA 1J0FA 4E8HA 2LKUA 1V2AA 3CTFA 1EGRA 1SU9A 1O6JA 2GZPA 4XS6A 4EXJA 1GNWA 4X0XA 4MZCA 5ABRA 1XFLA 1OAZA 3A5WA 5G1KA 1SL2B 1AQVA 4V2LA 3R2QA 4DSRA 6GSSA 2LNTA 2CA8A 2C80A 4NXIA 4PNFA 4Q5FA 2CV4A 5IPGA 4I97A 5ID2B 3I43A 3JCML 1U88A 1MEKA 3VK9A 4HUAA 2LV3A 5F0GA 2H0GA 4POKA 4KDXA 3D5JA 3L9UA 2FWEA 4H86A 3I69A 1O8XA 2L59A 2VLTA 4NWYA 5CP1A 2DLXA 1Z7PA 4XIHA 1ZOFA 3UOMA 1OVNA 2LTKA 1DE1A 2AHEA 2GSTA 1V9WA 1S3DA 1GLPA 1JZDA 1A8LA 2IFQB 2HSHA 3WGXA 4EVMA 2LUSA 8GSSA 4MH2A 3ZRDA 1MDJA 1PL2A 4RQXA 1ST9A 1K0DA 5F07A 1TRWA 3F63A 4HJMA 2DJ2A 4NHZA 4I8BA 4FH8A 1FB0A 4EO3A 1A2JA 4MZWA 3C1SA 5D9VA 5E59A 1R7HA 4O92A 1F3BA 5AGYA 4OFNA 2KUCA 3RDWA 1Z6MA 2DMLA 3A2VA 4KSMA 3BBYA 4BWSA 2MMOA 2RM5A 1O73A 2NDOA 3G7JA 3P8WA 5GZZB 3C8EA 3GKXA 3KTLA 1MDIA 2KLXA 3DEXA 1TJDA 4AJ8A 4EDYA 3LGCA 3QFBC 2VOCA 3MAKA 1QXHA 3VWUA 3UBLA 4F82A 2O85A 1VF2A 2IMFA 2C3NA 5IMZA 1U6TA 1XCCA 4IS0A 1TOFA 4G10A 2VD0A 2CAQA 4I6XA 4GQCA 1ZZYA 2DBCA 2C4JA 1OKDA 2GZYA 4MK3A 3A2WA 4OFTA 2IPAA 3GSSA 2GQMA 4YH2A 4PUFC 1ON4A 1SK2A 3LSZA 2JZTA 4ISDA 2VM2A 1XWBA 2OE0A 2I3YA 3GN3A 3N9JA 2B5YA 1TK0B 4TKYA 1YEXA 2YJHA 4HOJA 5G30A 1AAZA 3C73A 4CW9A 1QK8A 1BQ7A 2WZ9A 5CO3A 2H30A 1K0AA 5IMAA 1QFNA 4AF2A 2PGTA 2FHEA 5H5RA 3GL5A 3ZYWA 3EYTA 4O7HA 6GSUA 2HE3A 2A2RA 3G7IA 5A4UA 4K9ZA 2L5LA 4I5QA 4K6XA 4PQHA 3IE3A 1EZKA 5KN1A 3GX8A 7GSSA 1O85A 3GTUA 1OE8A 2AAWA 4K7OA 2GSRA 3RAZA 1LU4A 1OC9B 1GH2A 2R6KA 3KGKA 3EMXA 5B8BA 2NPBA 4PXOA 2C3QA 3F4SA 1T7PB 3HZ4A 1EOHA 3VI7A 2JSZA 3EU4A 2YZUA 4G9HA 3SBCA 4N11A 5CYYA 5CRWA 1I5GA 4JRRA 1WPIA 1B48A 1PQNA 1TI1A 4XTSA 4D73A 1SL0B 5ECPB 3GV1A 3NOFA 4GXZA 2XPEA 2OACA 4FO5A 4J57E 3GNJA 2P5QA 5J4UA 1XOAA 3Q19A 3Q74A 2RIIA 2XHFA 3GMFA 2AYTA 2MBTA 2VL2C 1X9WB 1H75A 1FVKA 2H1BA 2JADA 2FWFA 2GTUA 1G7OA 2ZCTA 2WS2A 1SJIA 3DKSA 4Q5QA 1XW9A 3GURA 3J7Yk 1DE2A 3TOTA 1JLWA 5DCGA 1SD8A 5KN0A 2HI7A 5IMCA 1AQXA 1UC7A 3C71A 3KEBA 1FAAA 1AC1A 4OMVA 4JZQA 4BA7A 3VPTA 5IIZA 5CRGA 1TRSA 1ZL9A 5D8IA 1PKZA 1XZOA 1U3IA 2BMXA 2H74A 2VAFA 2LQOA 5ECMB 2JL4A 3IK9A 1M2BA 1GUHA 2MZCA 1USBA 4ECIA 3N5OA 1Y25A 2FLSA 6GSVA 4J56E 20GSA 4HS1A 3WYWA 2YWNA 1JFUA 3BJ5A 2K18A 5GSTA 2VLVA 1RQMA 5DCHA 3K8NA 5INYA 4IVFA 3O76A 4TOPA 5D9XA 1TKDB 5G5FA 2ZUPA 5J5NA 4EDZA 3IR4A 3RHBA 1A24A 1NHOA 4PNGA 4KH7A 4POBA 3Q18A 1ACVA 1TP9A 2H72A 2KP2A 1BX9A 2N5FA 1UVZA 4TXVA 5DVBA 2PN8A 3RPPA 5ECRB 4J2FA 3KZQA 3Q6OA 4MJEA 1DBYA 1DUGA 4LA1A 3TKRA 1KTEA 11GSA 2YV7A 3TCOA 1GSUA 4ECCA 3F9UA 2GGTA 3HVVA 2N5AA 5EL8A 2L6DA 2WB9A 2GZZA 1PA3A 3KH7A 4TXOB 1JHBA 4ULXA 3D4MA 3F4RA 4HJ2A 3IRAA 1XW6A 3HXSA 4OO5A 2XBIA 4GSSA 3D4TA 2HLSA 2VIMA 2OADA 5J3RA 5ECOB 5DALA 2ES7A 4JBBA 2F3MA 2DSAA 3NIVA 3GHAA 2VD1A 2HRNA 2ON7A 1F3AA 3HA9A 1M99A 3TGZA 1PL1A 3ME8A 5IOWA 4V2NA 3AY8A 1GSFA 2LQQA 2J9HA 4MF6A 4IP1A 4KCEA 1K0CA 1TRUA 4K0GA 2B5EA 5KN2A 1YY7A 5JCGA 1OC3A 1X5CA 5ECIB 1BG5A 2LJAA 2WRTA 2H6XA 1QMVA 1Q98A 1G7EA 1OC8A 1A2MA 1EV4A 1MTCA 2FGXA 2H1DA 4KNDA 2IL3A 1HD2A 4LL4B 4ZBDA 1BEDA 1K3OA 4G2EA 2YNXA 3F3RA 4JEDA 1O7UA 1WWJA 3EINA 2J23A 1SYRA 2V6KA 2F9SA 3GX0A 1QGVA 3UARA 3GKMA 2X64A 3IK7A 6GSWA 2HXKA 4PUAA 12GSA 4MZBA 4DSQA 1JZOA 4L0UA 4MJAA 4MCUA 1U3AA 1SKRB 3IOSA 2H6ZA 4WBRD 3FKFA 5ELAA 2H1GA 4MH3A 2N5BA 1HYUA 3GL3A 2D2ZA 3C7MA 1X9MB 4KW6A 3TJBA 3E0UA 3DIEA 3VWVA 1X5DA 3ZIJA 3DD3A 2VCXA 1AXDA 1N2AA 1PMTA 2H76A 2NBSA 1GRXA 5J9CA 3KIJA 2WCIA 2OE1A 3L0HA 4OO4A 2VCZA 3DVWA 4MMMA 3CSJA 2DJKA 5G1LA 3F6DA 3CXGA 4TR1B 5IO2A 2DJ0A 2R3XA 2K8VA 2V2GA 3PH9A 10GSA 2RUEA 3ZREA 4O5RA 5IMFA
chains in the Genus database with same CATH superfamily
4MABA 2O89A 2MMNA 3UVHA 4MDCA 2VCTA 4CY6A 1KNGA 3ERGA 2IMDA 4O5QA 4NAXA 2B6MA 2ALBA 1E2YA 1VF1A 2YN1A 3BCKA 2F51A 1GSQA 1YEPA 1TDIA 1NHYA 3HJMA 1UA5A 2GSSA 2HFDA 4KCAA 3WT2A 3RHCA 4POLA 1XWAA 2I1UA 5IQYA 1ZYQB 2H19A 4IGJA 1R4WA 2I4AA 3TKQA 2E0QA 2VCVA 3IC8A 5E4WA 3WD6A 1HNBA 3LXZA 4KDYA 4JE1A 2DJJA 4TRXA 2RLIA 1VF4A 3H79A 5DBQA 3BCIA 5F05A 1YF0A 3GIXA 1PGTA 1GUKA 3UVTA 2G0FA 3L78A 1PFOA 2VUPA 3HVNA 2NTOA 5IPHA 1PSQA 3GH9A 3O6TA 2HRFA 5CNWA 3TJKA 5IMDA 1NW2A 1N8JA 4GF0A 2GQKA 1M2DA 1W4VA 3FYGA 4CY8A 4YQVA 5ECLB 1EGOA 4ML1A 1BAYA 1AW9A 1GP1A 1V58A 2K8SA 3LG6A 4ZL9A 2FA4A 4KX4A 1THOA 1J08A 1H4OA 3EWLA 1B9YC 1WE0A 2HZEA 4EL1A 3GUSA 2VO4A 3D6IA 5AIVA 5AIXA 4IHUA 1EWXA 2Z9SA 3TUEA 5C00A 2XC2A 3IV4A 1X0RA 2R2JA 3VWWA 1R5PA 1EP7A 1TRVA 3PPUA 4JR4A 2QKEA 2QA1A 3OR5A 2H8LA 1EP8A 4LLRA 4BVXA 1WIKA 2TIRA 1WP0A 3QPMA 2R0CA 4BVYB 4WR4A 2MYGA 2K6VA 4G0IA 3FK8A 1GSDA 4TN8A 4EC0A 4KUNA 3EURA 3ZLPA 2DIYA 1ZMAA 4F2IA 2C8UA 2KOKA 1YQ1A 1CQGA 1ERWA 4DSSA 5DALB 3M9KA 2PERA 4X1UA 6GSYA 3FRCA 4PQIA 3CYNA 2AUVA 1SD9A 4NV2A 4F0CA 4ACSA 2I9HA 1YKCA 6GSXA 2E2MA 3A2XA 1QUWA 2IN3A 2V32A 2REMA 1F37A 4PURA 3KD0A 17GSA 3M3MA 2QGVA 1M9AA 2VM1A 1Z7RA 2LRTA 3TOUA 2RM6A 1FOHA 4NV5A 3IAM2 4MJCA 4XRAA 2YANA 2NVLA 5G5EA 4ZB9A 3RPNA 1XXUA 13GSA 5B6NA 3SWLA 1YKAA 1SYXA 4V1Ag 3MDKA 3D21A 1MDKA 1ZYNA 2FA8A 4L8EA 4PQ1A 2LJKA 2M46A 5F8BA 4IJ3A 4HU9A 4LMWA 1T1VA 5COHA 5AISA 2ZNMA 2E2GA 3G9BA 3KCMA 3PGTA 3M8NA 1XWGA 3VI5A 2FY6A 5ECSA 1T3BA 4GLTA 5JWOB 1B8XA 5KEJA 5ELGA 4EKZA 3KH9A 3EMPA 3ZITA 2DKHA 1WRYA 1U87A 1ZGNA 2H01A 3A3TA 3BOAA 3APQA 3ZZXA 3M9JA 3QDNA 2R4VA 3MNGA 5DJLA 3TJFA 2WULA 3FW2A 4TR4A 1FB6A 3ZVJD 3ZIVA 3PR8A 1K0NA 2WJUA 4HDEA 3M0FA 3FZ5A 2VL3A 1O8WA 1A0FA 4ZL7A 4HQSA 4IQAA 4XRDA 3GA4A 2CT6A 5FT3A 4A5PA 4XCSA 2DJ3A 4G0KA 4K1FA 2C0DA 1SK0A 4NMUA 4MNNA 3P90A 3ZFBA 3HJPA 3CRTA 1XVQA 3F3QA 1R26A 2JZSA 2PPTA 2YWMA 2DC5A 4I2TA 2CAIA 2LRNA 3HJOA 3D0ZA 1YF1A 4HSCX 1A2LA 2M80A 5DAKA 5KN3A 2OBIA 1GULA 1YJ6A 3HZ8A 1HNCA 4YKFA 3F6FA 2H70A 3APOA 1MD3A 3QAVA 1YZXA 1V40A 2I81A 4ZXGA 3MWHA 3FZ9A 2F8AA 2M72A 1B9XC 3DVXA 5EPFA 3TKSA 4IW9A 2H0HA 1M2AA 4G19A 3FMWA 4GSTA 1SENA 1NM3A 3ZMLA 3M1GA 5A4WA 2O8VB 3ZFLA 4HU7A 5CRDA 1WMJA 5G2ZA 2HSMA 5B7CA 2PUKC 2JU5A 5IOXA 2VCWA 1KEBA 4OD7A 4N10A 3CTGA 1M7TA 5IO0A 3BD2A 4ZBBA 2HZEB 9GSSA 4OCEA 2PBJA 3KMOA 3D22A 3GKKA 4RI7A 1K3LA 2JACA 4ZBAA 2WFCA 1FVJA 1IYHA 2DMMA 4KGIA 2WDUA 3EE2A 1GTIA 1E6BA 3L9SA 16GSA 4MP4A 4BVXB 1R5AA 1X9SB 1GL8A 5HFIA 4IELA 1F2EA 1X5EA 5KOWA 1FW1A 2CQ9A 5HFKA 4FQUA 2HZFA 3FHKA 4MJBA 1GTBA 3KP9A 2R0PA 4F0BA 4KAEA 5DQSA 2GLRA 1EEMA 2YOIA 4TVEA 3ERWA 4POMA 1SJZA 3LYPA 2BJXA 1XVWA 1SKSB 5H5SA 2GT6A 5JWQB 1M3JA 2XBQA 2A4VA 1THXA 2HRKA 1GTUA 2IIYA 2R5GA 4MPFA 4OCFA 5DQYA 2C0FA 2B5XA 3L4NA 3IC4A 1GSSA 5LCZA 1GTAA 3H4KA 2QSIA 5L71A 2OKAA 3KXOA 3F0IA 3GYKA 3GRXA 6GSTA 1B4QA 3LEFA 2A4HA 2K9FA 2X8CA 1PD21 4N0ZA 2FUG2 3QR6A 2CX3A 2V41A 4K2XA 3UBKA 1PKWA 1WOUA 5D73A 3EC3A 4WF5A 4QL9A 2H0IA 1K0BA 2MMZA 1K0MA 2LJRA 2IJYA 5AN1A 1Z5YE 2KP1A 3IHQA 4FYBA 3UAPA 4FYCA 2FWGA 2PMTA 1EEJA 1JLVA 3GTUB 5FHIA 4KE3A 5F06A 2CZ2A 4AJ7A 4TR3A 4V2MA 1SJ6A 2YJ7A 4GTUA 4MF7A 5GAPD 2CVKA 2IMIA 2FD3A 4ZB8A 1UN2A 1TK8B 1TK5B 4AGSA 3IBHA 4FIWA 1XPVA 3LXTA 1TW9A 1AIUA 4Z2UA 4JU5A 4D73B 4ZIJA 1F9MA 3TDGA 3CRUA 5GAND 2X8HA 1FO5A 4N0VA 2DJ1A 4XHMA 4PX1A 4ID0A 4KB3A 2IMKA 1VF3A 5D9WA 1LBKA 2RUFA 3TJJA 5B6MA 3CBUA 2H75A 3APSA 3E9JB 3HVSA 1GNEA 2IWTA 1BJXA 4HEA2 2B1LA 2L6CA 5D96A 5JWRB 4RUVA 2YP6A 2LS5A 2EIOA 3VFIA 4YKGA 5A4VA 1TU8A 3U6VA 1A23A 1PX6A 1TXXA 3V1WA 4WF4A 2WGRA 3KM6A 2AV4A 4K2DA 1Q4JA 2G2QA 4XS4A 3UL3A 4OFMA 1S3CA 1A8YA 4YAPA 1M3IA 3QAWA 1PRXA 3TRXA 2OE3A 2V6OA 3LORA 3TRPA 3LFLA 5ECQB 2H6YA 2YWOA 2X8GA 3I6AA 5IM9A 1ILOA 2GT5A 2PWJA 1F6MC 4ILFA 3O3TA 2O7KA 2ON5A 5DAKB 2HT9A 2L57A 4JR6A 1C72A 1OKTA 1ERUA 4GRFA 1FG4A 5HFGA 4EUYA 4KA0A 3ZL5A 2E7PA 4P3YB 4O32A 4QQ7A 2LEGA 2C1YA 2TRXA 3UJ1A 2YPMA 1TI3A 5CREA 4Q5NA 1FOVA 2EIRA 3FR9A 1SKWB 2L4QA 2MMAA 3IAS2 4TXOA 3FEUA 2GS3A 1M9BA 1HNAA 2GDRA 3GFKA 4I2UA 4F03A 1T4YA 1AQWA 4TW5A 3PINA 1PN0A 2LRCA 3U5RE 3DRNA 3TB2A 4WBJA 3ME7A 2P31A 4HZ2A 4MF5A 1VRSD 3S9FA 1WJKA 1S3RA 19GSA 3VWXA 3IPZA 1Y6EA 5DJMA 4X43A 3GSTA 4WKWA 3CQFA 4G0LA 1ERVA 1EOGA 2EIQA 1I9DA 3WT1A 4BL7A 1CQHA 1T8EB 3CMIA 2R37A 5D93A 3WGEA 1URMA 4IP6A 4ECBA 4MLYA 3TRQA 4K8MA 1BYEA 2YCDA 2XPDA 3P7XA 5B8AA 1ZYPA 3FR3A 1K0OA 3HCZA 1GUMA 1S3AA 2H66A 2VL2A 2C0EA 3ISOA 1NSWA 1B4PA 3UMAA 2VCQA 4GQFA 1GWCA 3QMXA 3RBTA 2MBSA 3EU3A 4LL1B 2FNOA 2CX4A 2FWHA 5LD0A 3ZVJA 3HKRA 2EC4A 3HY2A 3H1NA 1Z9HA 2GQLA 4K7NA 3QCPA 5DDLA 3TKPA 3TKSE 3KMNA 2A2SA 4LMVA 22GSA 4CHSA 3IDVA 4IBPA 2TRCP 2VLUA 1GLQA 2PVOC 4NHWA 3ZTLA 3QD9A 1EV9A 4WXTA 2P0GA 2P5RA 4X4JA 1ZYEA 3ZMKA 4YQMA 2DKIA 2VL9A 1V98A 3DGQA 4GCIA 3FY7A 2GSQA 3G7YA 5ID2A 1G0TA 1J9BA 1MD4A 2B3SA 1DSBA 1GSYA 3DYRA 1RK4A 2LNSA 4EF0A 5FWGA 5C04A 2FCHA 5ECHB 5LNKe 1QQ2A 4V1Ap 2H73A 3QAGA 5HR1A 14GSA 4DVCA 1SL1B 2AB6A 4TR1A 4WEYA 3UIWA 4EIQA 5A5KA 3DXBA 4K0NA 4EE0A 4CDOA 4HZ4A 2QA2A 2HSYA 4QL7A 3HHVA 2IMEA 4IN0A 1A0RP 2DIZA 3HDCA 2L4CA 2JSYA 4GWRA 3J7Yb 4RQRA 1ML6A 4BPYA 3GKNA 4Q5RA 3IA1A 3NZNA 4MA9A 1AUCA 2CVDA 5HR3A 1XBSA 4DEJA 1XIYA 3MSZA 4L5LA 1G6WA 2YV9A 2QC7A 2IFQA 4HI7A 1LJRA 4YAVA 2X49A 4GSNA 2GVPA 2H71A 1XOBA 4HQZA 2B7JA 4NPBA 4RI6A 1XW5A 5HR2A 4L0WA 4E8EA 4BWQA 2B7KA 5J41A 2PU9C 1XWCA 3F8UA 5CRHA 5IMVA 1W89A 1ABAA 4WETA 3FR6A 2JZRA 2X99A 5EVOA 5G31A 4EIPA 5JCUA 1GSEA 1T00A 4MPGA 3W8SA 3P2AA 3LYKA 2C0GA 1T4ZA 2B1KA 5D9TA 3VURA 2OBKA 3H93A 4L5OA 3I9V2 4XS4B 1TTZA 4K5RA 5ECNB 3QFAC 2OJLA 1FHEA 3HD5A 1HQOA 3FZ4A 4TR0A 1KBNA 3LWAA 4ML6A 4PGTA 3VPQA 4OWYA 3ED3A 3C1RA 5BRTA 1ERTA 3KJYA 3LJRA 2CVBA 2LSTA 2BTOT 3TJGA 1TU7A 1OE7A 5CAXA 3CSHA 1O81A 4ECJA 4KSOA 2YWIA 3MIXA 2F8FA 2C3TA 3CSIA 5ENUA 3A5IA 4IKHA 3R3EA 1K3YA 4IQ1A 3MYDA 3UEMA 2HYXA 4YQUA 4BVYA 3HVXA 4K7IA 3E3EA 2AJQB 2L5OA 2KHPA 5HQPA 3EVIA 3H8QA 2OA7A 5H5QA 3F4TA 3WGDA 4Z7XA 1SK1A 3HYPA 3QOUA 1RW1A 4N30A 1V57A 4KDUA 5ECKB 4IJIA 3IXRA 3W6GA 5GSSA 3DMLA 2V1MA 5JCWA 3KP8A 3US3A 3GH6A 4AJ6A 1VGLA 1XWKA 1G6YA 1M0UA 4WR5A 4ZILA 5J9BA 2H1AA 4FYUA 3FZAA 3KTBA 1ZCPA 5EY6A 4BL7B 1IYIA 2CZ3A 3L9VA 5HR0A 4ZL8A 2PVQA 1OYJA 4DSSB 1PN9A 3TKSC 3ERFA 1JZWA 3W8JA 3VLNA 4XS1A 1Z6NA 1PX7A 2O87A 1Z3EA 3LQ7A 2HNLA 1JZRA 4F9ZA 2YZHA 3DWVA 1YDKA 4ZB6A 1OC9A 18GSA 1J0FA 4E8HA 2LKUA 1V2AA 3CTFA 1EGRA 1SU9A 1O6JA 2GZPA 4XS6A 4EXJA 1GNWA 4X0XA 4MZCA 5ABRA 1XFLA 1OAZA 3A5WA 5G1KA 1SL2B 1AQVA 4V2LA 3R2QA 4DSRA 6GSSA 2LNTA 2CA8A 2C80A 2HRAA 4NXIA 4PNFA 4Z2RA 4Q5FA 2CV4A 5IPGA 4I97A 5ID2B 3I43A 3JCML 1U88A 1MEKA 3VK9A 4HUAA 2LV3A 5F0GA 2H0GA 4POKA 4KDXA 3D5JA 3L9UA 2FWEA 4H86A 3I69A 1O8XA 2L59A 2VLTA 4NWYA 5CP1A 4KF9A 4USSA 2DLXA 1Z7PA 4XIHA 1ZOFA 3UOMA 1OVNA 2LTKA 1DE1A 2AHEA 2GSTA 1V9WA 1S3DA 1GLPA 1JZDA 4PTSA 1A8LA 2IFQB 2HSHA 3WGXA 4EVMA 2LUSA 8GSSA 4MH2A 3ZRDA 1MDJA 1PL2A 4RQXA 1ST9A 1K0DA 5F07A 1TRWA 3F63A 4HJMA 2DJ2A 4NHZA 4I8BA 4FH8A 1FB0A 4EO3A 1A2JA 4MZWA 3C1SA 5D9VA 5E59A 1R7HA 4O92A 1F3BA 5AGYA 4OFNA 2KUCA 3RDWA 1Z6MA 2DMLA 3A2VA 4KSMA 3BBYA 4BWSA 2MMOA 2RM5A 1O73A 2NDOA 3G7JA 3P8WA 5GZZB 3C8EA 3GKXA 3KTLA 1MDIA 2KLXA 3DEXA 1TJDA 4AJ8A 2X4AA 4EDYA 3LGCA 3LW9A 3QFBC 2VOCA 3MAKA 1QXHA 3VWUA 3UBLA 4F82A 2O85A 1VF2A 2IMFA 2C3NA 5IMZA 1U6TA 1XCCA 4IS0A 1TOFA 4G10A 2VD0A 2CAQA 4I6XA 4GQCA 1ZZYA 2DBCA 2C4JA 1OKDA 2GZYA 4MK3A 3A2WA 4OFTA 2IPAA 3GSSA 2GQMA 4YH2A 4PUFC 1ON4A 1SK2A 3LSZA 2JZTA 4ISDA 2VM2A 1XWBA 2OE0A 2I3YA 3GN3A 3N9JA 2B5YA 1TK0B 4TKYA 1YEXA 2YJHA 4HOJA 5G30A 1AAZA 3C73A 4CW9A 1QK8A 1BQ7A 2WZ9A 5CO3A 1XG8A 2H30A 1K0AA 5IMAA 5BMUA 1QFNA 4AF2A 2PGTA 2FHEA 5H5RA 3GL5A 3ZYWA 3EYTA 4O7HA 6GSUA 2HE3A 2A2RA 3G7IA 5A4UA 4K9ZA 2L5LA 4I5QA 4K6XA 4PQHA 3IE3A 1EZKA 4Z2TA 5KN1A 3GX8A 7GSSA 1O85A 3GTUA 1OE8A 2AAWA 4K7OA 2GSRA 3RAZA 1LU4A 1OC9B 1GH2A 2R6KA 3KGKA 3EMXA 5B8BA 2NPBA 4PXOA 2C3QA 3F4SA 1T7PB 3HZ4A 1EOHA 3VI7A 2JSZA 3EU4A 2YZUA 4G9HA 3SBCA 4N11A 5CYYA 5CRWA 1I5GA 4JRRA 1WPIA 1B48A 1PQNA 1TI1A 3EPTA 4XTSA 4D73A 1SL0B 5ECPB 3GV1A 3NOFA 4GXZA 2XPEA 2OACA 4FO5A 4J57E 3GNJA 2P5QA 5J4UA 1XOAA 3Q19A 3Q74A 2RIIA 2XHFA 3GMFA 2AYTA 2MBTA 2VL2C 1X9WB 1H75A 1FVKA 2H1BA 2JADA 2FWFA 2GTUA 1G7OA 2ZCTA 2WS2A 1SJIA 3DKSA 4Q5QA 1XW9A 3GURA 3J7Yk 1DE2A 3TOTA 1JLWA 5DCGA 1SD8A 5KN0A 5KOXA 2HI7A 5IMCA 1AQXA 1UC7A 3C71A 3KEBA 1FAAA 1AC1A 4OMVA 4JZQA 4BA7A 3VPTA 5IIZA 5CRGA 1TRSA 1ZL9A 5D8IA 1PKZA 1XZOA 1U3IA 2BMXA 2H74A 2VAFA 2LQOA 5ECMB 2JL4A 3IK9A 1M2BA 1GUHA 2MZCA 1USBA 4ECIA 3N5OA 1Y25A 2FLSA 6GSVA 4J56E 20GSA 4HS1A 3WYWA 2YWNA 1JFUA 3BJ5A 2K18A 5GSTA 2VLVA 2R0GA 1RQMA 5DCHA 3K8NA 5INYA 4IVFA 3O76A 4TOPA 5D9XA 1TKDB 5G5FA 2ZUPA 5J5NA 4EDZA 3IR4A 3RHBA 1A24A 1NHOA 4PNGA 4KH7A 4POBA 3Q18A 1ACVA 1TP9A 2H72A 2KP2A 1BX9A 2N5FA 1UVZA 4TXVA 2UZ8A 5DVBA 2PN8A 3RPPA 5ECRB 4J2FA 3KZQA 3Q6OA 4MJEA 1DBYA 1DUGA 4LA1A 3TKRA 1KTEA 11GSA 2YV7A 3TCOA 1GSUA 4ECCA 3F9UA 2GGTA 3HVVA 2N5AA 5EL8A 2L6DA 2WB9A 2GZZA 1PA3A 3KH7A 4TXOB 1JHBA 4O5UA 4ULXA 3D4MA 3F4RA 4HJ2A 3IRAA 1XW6A 3HXSA 4OO5A 2XBIA 4GSSA 3D4TA 2HLSA 4ICYA 2VIMA 2OADA 5J3RA 5ECOB 5DALA 2ES7A 4JBBA 2F3MA 2DSAA 3NIVA 3GHAA 2VD1A 2HRNA 2ON7A 1F3AA 3HA9A 1M99A 3TGZA 1PL1A 3ME8A 5IOWA 4V2NA 3AY8A 1GSFA 2LQQA 2J9HA 4MF6A 4IP1A 4KCEA 1K0CA 1TRUA 4K0GA 2B5EA 5KN2A 1YY7A 5JCGA 1OC3A 1X5CA 5ECIB 1BG5A 2LJAA 3IHGA 2WRTA 2H6XA 1QMVA 1Q98A 1G7EA 1OC8A 1A2MA 1EV4A 1MTCA 2FGXA 2H1DA 4KNDA 2IL3A 4K5SA 1HD2A 4LL4B 4ZBDA 1BEDA 1K3OA 4G2EA 2YNXA 3F3RA 4JEDA 1O7UA 1WWJA 3EINA 2J23A 1SYRA 2V6KA 2F9SA 3GX0A 1QGVA 3UARA 3GKMA 2X64A 3IK7A 6GSWA 2HXKA 4PUAA 12GSA 4MZBA 4DSQA 1JZOA 4BIKA 4L0UA 4MJAA 4MCUA 1U3AA 1SKRB 3IOSA 2H6ZA 4WBRD 3FKFA 5ELAA 2H1GA 4MH3A 2N5BA 1HYUA 3GL3A 2D2ZA 3C7MA 1X9MB 4KW6A 3TJBA 3E0UA 3DIEA 3VWVA 1X5DA 3ZIJA 3DD3A 2A2PA 2VCXA 1AXDA 1N2AA 1PMTA 2H76A 2NBSA 1GRXA 5J9CA 3KIJA 2WCIA 2OE1A 3L0HA 4OO4A 2VCZA 3DVWA 4MMMA 3CSJA 2DJKA 5G1LA 3F6DA 3CXGA 4TR1B 5IO2A 2DJ0A 2R3XA 2K8VA 2V2GA 3PH9A 10GSA 2RUEA 3ZREA 4O5RA 5IMFA
chains in the Genus database with same CATH topology
4MABA 2O89A 2MMNA 3UVHA 4MDCA 2VCTA 4CY6A 1KNGA 3ERGA 2IMDA 4O5QA 4NAXA 2B6MA 2ALBA 1E2YA 1VF1A 2YN1A 3BCKA 2F51A 1GSQA 1YEPA 1TDIA 1NHYA 3HJMA 1UA5A 2GSSA 2HFDA 4KCAA 3WT2A 3RHCA 4POLA 1XWAA 2I1UA 5IQYA 1ZYQB 2H19A 4IGJA 1R4WA 2I4AA 3TKQA 2E0QA 2VCVA 3IC8A 5E4WA 3WD6A 1HNBA 3LXZA 4KDYA 4JE1A 2DJJA 4TRXA 2RLIA 1VF4A 3H79A 5DBQA 3BCIA 5F05A 1YF0A 3GIXA 1PGTA 1GUKA 3UVTA 2G0FA 3L78A 2VUPA 2NTOA 5IPHA 1PSQA 3GH9A 3O6TA 2HRFA 5CNWA 3TJKA 5IMDA 1NW2A 1N8JA 4GF0A 2GQKA 1M2DA 1W4VA 3FYGA 4CY8A 4YQVA 5ECLB 1EGOA 4ML1A 1BAYA 1AW9A 1GP1A 1V58A 2K8SA 3LG6A 4ZL9A 2FA4A 4KX4A 1THOA 1J08A 1H4OA 3EWLA 1B9YC 1WE0A 2HZEA 4EL1A 3GUSA 2VO4A 3D6IA 5AIVA 5AIXA 4IHUA 1EWXA 2Z9SA 3TUEA 5C00A 2XC2A 3IV4A 1X0RA 2R2JA 3VWWA 1R5PA 1EP7A 1TRVA 3PPUA 4JR4A 2QKEA 2QA1A 3OR5A 2H8LA 1EP8A 4LLRA 4BVXA 1WIKA 2TIRA 1WP0A 3QPMA 2R0CA 4BVYB 4WR4A 2MYGA 2K6VA 4G0IA 3FK8A 1GSDA 4TN8A 4EC0A 4KUNA 3EURA 3ZLPA 2DIYA 1ZMAA 4F2IA 2C8UA 2KOKA 1YQ1A 1CQGA 1ERWA 4DSSA 5DALB 3M9KA 2PERA 4X1UA 6GSYA 3FRCA 4PQIA 3CYNA 2AUVA 1SD9A 4NV2A 4F0CA 4ACSA 2I9HA 1YKCA 6GSXA 2E2MA 3A2XA 1QUWA 2IN3A 2V32A 2REMA 1F37A 4PURA 3KD0A 17GSA 3M3MA 2QGVA 1M9AA 2VM1A 1Z7RA 2LRTA 3TOUA 2RM6A 1FOHA 4NV5A 3IAM2 4MJCA 4XRAA 2YANA 2NVLA 5G5EA 4ZB9A 3RPNA 1XXUA 13GSA 5B6NA 3SWLA 1YKAA 1SYXA 4V1Ag 3MDKA 3D21A 1MDKA 1ZYNA 2FA8A 4L8EA 4PQ1A 2LJKA 2M46A 5F8BA 4IJ3A 4HU9A 4LMWA 1T1VA 5COHA 5AISA 2ZNMA 2E2GA 3G9BA 3KCMA 3PGTA 3M8NA 1XWGA 3VI5A 2FY6A 5ECSA 1T3BA 4GLTA 5JWOB 1B8XA 5KEJA 5ELGA 4EKZA 3KH9A 3EMPA 3ZITA 2DKHA 1WRYA 1U87A 1ZGNA 2H01A 3A3TA 3BOAA 3APQA 3ZZXA 3M9JA 3QDNA 2R4VA 3MNGA 5DJLA 3TJFA 2WULA 3FW2A 4TR4A 1FB6A 3ZVJD 3ZIVA 3PR8A 1K0NA 2WJUA 4HDEA 3M0FA 3FZ5A 2VL3A 1O8WA 1A0FA 4ZL7A 4HQSA 4IQAA 4XRDA 3GA4A 2CT6A 5FT3A 4A5PA 4XCSA 2DJ3A 4G0KA 4K1FA 2C0DA 1SK0A 4NMUA 4MNNA 3P90A 3ZFBA 3HJPA 3CRTA 1XVQA 3F3QA 1R26A 2JZSA 2PPTA 2YWMA 2DC5A 4I2TA 2CAIA 2LRNA 3HJOA 3D0ZA 1YF1A 1A2LA 2M80A 5DAKA 5KN3A 2OBIA 1GULA 1YJ6A 3HZ8A 1HNCA 4YKFA 3F6FA 2H70A 3APOA 1MD3A 3QAVA 1YZXA 1V40A 2I81A 4ZXGA 3MWHA 3FZ9A 2F8AA 2M72A 1B9XC 3DVXA 5EPFA 3TKSA 4IW9A 2H0HA 1M2AA 4G19A 3FMWA 4GSTA 1SENA 1NM3A 3ZMLA 3M1GA 5A4WA 2O8VB 3ZFLA 4HU7A 5CRDA 1WMJA 5G2ZA 2HSMA 5B7CA 2PUKC 2JU5A 5IOXA 2VCWA 1KEBA 4OD7A 4N10A 3CTGA 1M7TA 5IO0A 3BD2A 4ZBBA 2HZEB 9GSSA 4OCEA 2PBJA 3KMOA 3D22A 3GKKA 4RI7A 1K3LA 2JACA 4ZBAA 2WFCA 1FVJA 1IYHA 2DMMA 4KGIA 2WDUA 3EE2A 1GTIA 1E6BA 3L9SA 16GSA 4MP4A 4BVXB 1R5AA 1X9SB 1GL8A 5HFIA 4IELA 1F2EA 1X5EA 5KOWA 1FW1A 2CQ9A 5HFKA 4FQUA 2HZFA 3FHKA 4MJBA 1GTBA 3KP9A 2R0PA 4F0BA 4KAEA 5DQSA 2GLRA 1EEMA 2YOIA 4TVEA 3ERWA 4POMA 1SJZA 3LYPA 2BJXA 1XVWA 1SKSB 5H5SA 2GT6A 5JWQB 2XBQA 2A4VA 1THXA 2HRKA 1GTUA 2IIYA 2R5GA 4MPFA 4OCFA 5DQYA 2C0FA 2B5XA 3L4NA 3IC4A 1GSSA 5LCZA 1GTAA 3H4KA 2QSIA 5L71A 2OKAA 3KXOA 3F0IA 3GYKA 3GRXA 6GSTA 1B4QA 3LEFA 2A4HA 2K9FA 2X8CA 1PD21 4N0ZA 2FUG2 3QR6A 2CX3A 2V41A 4K2XA 3UBKA 1PKWA 1WOUA 5D73A 3EC3A 4WF5A 4QL9A 2H0IA 1K0BA 2MMZA 1K0MA 2LJRA 2IJYA 5AN1A 1Z5YE 2KP1A 3IHQA 4FYBA 3UAPA 4FYCA 2FWGA 2PMTA 1EEJA 1JLVA 3GTUB 5FHIA 4KE3A 5F06A 2CZ2A 4AJ7A 4TR3A 4V2MA 1SJ6A 2YJ7A 4GTUA 4MF7A 5GAPD 2CVKA 2IMIA 2FD3A 4ZB8A 1UN2A 1TK8B 1TK5B 4AGSA 3IBHA 4FIWA 1XPVA 3LXTA 1TW9A 1AIUA 4Z2UA 4JU5A 4D73B 4ZIJA 1F9MA 3TDGA 3CRUA 5GAND 2X8HA 1FO5A 4N0VA 2DJ1A 4XHMA 4PX1A 4ID0A 4KB3A 2IMKA 1VF3A 5D9WA 1LBKA 2RUFA 3TJJA 5B6MA 3CBUA 2H75A 3APSA 3E9JB 3HVSA 1GNEA 2IWTA 1BJXA 4HEA2 2B1LA 2L6CA 5D96A 5JWRB 4RUVA 2YP6A 2LS5A 2EIOA 3VFIA 4YKGA 5A4VA 1TU8A 3U6VA 1A23A 1PX6A 1TXXA 3V1WA 4WF4A 2WGRA 3KM6A 2AV4A 4K2DA 1Q4JA 2G2QA 4XS4A 3UL3A 4OFMA 1S3CA 1A8YA 4YAPA 3QAWA 1PRXA 3TRXA 2OE3A 2V6OA 3LORA 3TRPA 3LFLA 5ECQB 2H6YA 2YWOA 2X8GA 3I6AA 5IM9A 1ILOA 2GT5A 2PWJA 1F6MC 4ILFA 3O3TA 2O7KA 2ON5A 5DAKB 2HT9A 2L57A 4JR6A 1C72A 1OKTA 1ERUA 4GRFA 1FG4A 5HFGA 4EUYA 4KA0A 3ZL5A 2E7PA 4P3YB 4O32A 4QQ7A 2LEGA 2C1YA 2TRXA 3UJ1A 2YPMA 1TI3A 5CREA 4Q5NA 1FOVA 2EIRA 3FR9A 1SKWB 2L4QA 2MMAA 3IAS2 4TXOA 3FEUA 2GS3A 1M9BA 1HNAA 2GDRA 3GFKA 4I2UA 4F03A 1T4YA 1AQWA 4TW5A 3PINA 1PN0A 2LRCA 3U5RE 3DRNA 3TB2A 4WBJA 3ME7A 2P31A 4HZ2A 4MF5A 1VRSD 3S9FA 1WJKA 19GSA 3VWXA 3IPZA 1Y6EA 5DJMA 4X43A 3GSTA 4WKWA 4G0LA 1ERVA 1EOGA 2EIQA 1I9DA 3WT1A 4BL7A 1CQHA 1T8EB 3CMIA 2R37A 5D93A 3WGEA 1URMA 4IP6A 4ECBA 4MLYA 3TRQA 4K8MA 1BYEA 2YCDA 2XPDA 3P7XA 5B8AA 1ZYPA 3FR3A 1K0OA 3HCZA 1GUMA 1S3AA 2H66A 2VL2A 2C0EA 3ISOA 1NSWA 1B4PA 3UMAA 2VCQA 4GQFA 1GWCA 3QMXA 3RBTA 2MBSA 3EU3A 4LL1B 2FNOA 2CX4A 2FWHA 5LD0A 3ZVJA 3HKRA 2EC4A 3HY2A 3H1NA 1Z9HA 2GQLA 4K7NA 3QCPA 5DDLA 3TKPA 3TKSE 3KMNA 2A2SA 4LMVA 22GSA 4CHSA 3IDVA 4IBPA 2TRCP 2VLUA 1GLQA 2PVOC 4NHWA 3ZTLA 3QD9A 1EV9A 4WXTA 2P0GA 2P5RA 4X4JA 1ZYEA 3ZMKA 4YQMA 2DKIA 2VL9A 1V98A 3DGQA 4GCIA 3FY7A 2GSQA 3G7YA 5ID2A 1G0TA 1J9BA 1MD4A 2B3SA 1DSBA 1GSYA 3DYRA 1RK4A 2LNSA 4EF0A 5FWGA 5C04A 2FCHA 5ECHB 5LNKe 1QQ2A 4V1Ap 2H73A 3QAGA 5HR1A 14GSA 4DVCA 1SL1B 2AB6A 4TR1A 4WEYA 3UIWA 4EIQA 5A5KA 3DXBA 4K0NA 4EE0A 4CDOA 4HZ4A 2QA2A 2HSYA 4QL7A 3HHVA 2IMEA 4IN0A 1A0RP 2DIZA 3HDCA 2L4CA 2JSYA 4GWRA 3J7Yb 4RQRA 1ML6A 4BPYA 3GKNA 4Q5RA 3IA1A 3NZNA 4MA9A 1AUCA 2CVDA 5HR3A 1XBSA 4DEJA 1XIYA 3MSZA 4L5LA 1G6WA 2YV9A 2QC7A 2IFQA 4HI7A 1LJRA 4YAVA 2X49A 4GSNA 2GVPA 2H71A 1XOBA 4HQZA 2B7JA 4NPBA 4RI6A 1XW5A 5HR2A 4L0WA 4E8EA 4BWQA 2B7KA 5J41A 2PU9C 1XWCA 3F8UA 5CRHA 5IMVA 1W89A 1ABAA 4WETA 3FR6A 2JZRA 2X99A 5EVOA 5G31A 4EIPA 5JCUA 1GSEA 1T00A 4MPGA 3W8SA 3P2AA 3LYKA 2C0GA 1T4ZA 2B1KA 5D9TA 3VURA 2OBKA 3H93A 4L5OA 3I9V2 4XS4B 1TTZA 4K5RA 5ECNB 3QFAC 2OJLA 1FHEA 3HD5A 1HQOA 3FZ4A 4TR0A 1KBNA 3LWAA 4ML6A 4PGTA 3VPQA 4OWYA 3ED3A 3C1RA 5BRTA 1ERTA 3KJYA 3LJRA 2CVBA 2LSTA 2BTOT 3TJGA 1TU7A 1OE7A 5CAXA 3CSHA 1O81A 4ECJA 4KSOA 2YWIA 3MIXA 2F8FA 2C3TA 3CSIA 5ENUA 3A5IA 4IKHA 3R3EA 1K3YA 4IQ1A 3MYDA 3UEMA 2HYXA 4YQUA 4BVYA 3HVXA 4K7IA 3E3EA 2AJQB 2L5OA 2KHPA 5HQPA 3EVIA 3H8QA 2OA7A 5H5QA 3F4TA 3WGDA 4Z7XA 1SK1A 3HYPA 3QOUA 1RW1A 4N30A 1V57A 4KDUA 5ECKB 4IJIA 3IXRA 3W6GA 5GSSA 3DMLA 2V1MA 5JCWA 3KP8A 3US3A 3GH6A 4AJ6A 1VGLA 1XWKA 1G6YA 1M0UA 4WR5A 4ZILA 5J9BA 2H1AA 4FYUA 3FZAA 3KTBA 1ZCPA 5EY6A 4BL7B 1IYIA 2CZ3A 3L9VA 5HR0A 4ZL8A 2PVQA 1OYJA 4DSSB 1PN9A 3TKSC 3ERFA 1JZWA 3W8JA 3VLNA 4XS1A 1Z6NA 1PX7A 2O87A 1Z3EA 3LQ7A 2HNLA 1JZRA 4F9ZA 2YZHA 3DWVA 1YDKA 4ZB6A 1OC9A 18GSA 1J0FA 4E8HA 2LKUA 1V2AA 3CTFA 1EGRA 1SU9A 1O6JA 2GZPA 4XS6A 4EXJA 1GNWA 4X0XA 4MZCA 5ABRA 1XFLA 1OAZA 3A5WA 5G1KA 1SL2B 1AQVA 4V2LA 3R2QA 4DSRA 6GSSA 2LNTA 2CA8A 2C80A 2HRAA 4NXIA 4PNFA 4Z2RA 4Q5FA 2CV4A 5IPGA 4I97A 5ID2B 3I43A 3JCML 1U88A 1MEKA 3VK9A 4HUAA 2LV3A 5F0GA 2H0GA 4POKA 4KDXA 3D5JA 3L9UA 2FWEA 4H86A 3I69A 1O8XA 2L59A 2VLTA 4NWYA 5CP1A 4KF9A 4USSA 2DLXA 1Z7PA 4XIHA 1ZOFA 3UOMA 1OVNA 2LTKA 1DE1A 2AHEA 2GSTA 1V9WA 1S3DA 1GLPA 1JZDA 4PTSA 1A8LA 2IFQB 2HSHA 3WGXA 4EVMA 2LUSA 8GSSA 4MH2A 3ZRDA 1MDJA 1PL2A 4RQXA 1ST9A 1K0DA 5F07A 1TRWA 3F63A 4HJMA 2DJ2A 4NHZA 4I8BA 4FH8A 1FB0A 4EO3A 1A2JA 4MZWA 3C1SA 5D9VA 5E59A 1R7HA 4O92A 1F3BA 5AGYA 4OFNA 2KUCA 3RDWA 1Z6MA 2DMLA 3A2VA 4KSMA 3BBYA 4BWSA 2MMOA 2RM5A 1O73A 2NDOA 3G7JA 3P8WA 5GZZB 3C8EA 3GKXA 3KTLA 1MDIA 2KLXA 3DEXA 1TJDA 4AJ8A 2X4AA 4EDYA 3LGCA 3LW9A 3QFBC 2VOCA 3MAKA 1QXHA 3VWUA 3UBLA 4F82A 2O85A 1VF2A 2IMFA 2C3NA 5IMZA 1U6TA 1XCCA 4IS0A 1TOFA 4G10A 2VD0A 2CAQA 4I6XA 4GQCA 1ZZYA 2DBCA 2C4JA 1OKDA 2GZYA 4MK3A 3A2WA 4OFTA 2IPAA 3GSSA 2GQMA 4YH2A 4PUFC 1ON4A 1SK2A 3LSZA 2JZTA 4ISDA 2VM2A 1XWBA 2OE0A 2I3YA 3GN3A 3N9JA 2B5YA 1TK0B 4TKYA 1YEXA 2YJHA 4HOJA 5G30A 1AAZA 3C73A 4CW9A 1QK8A 1BQ7A 2WZ9A 5CO3A 2H30A 1K0AA 5IMAA 5BMUA 1QFNA 4AF2A 2PGTA 2FHEA 5H5RA 3GL5A 3ZYWA 3EYTA 4O7HA 6GSUA 2HE3A 2A2RA 3G7IA 5A4UA 4K9ZA 2L5LA 4I5QA 4K6XA 4PQHA 3IE3A 1EZKA 4Z2TA 5KN1A 3GX8A 7GSSA 1O85A 3GTUA 1OE8A 2AAWA 4K7OA 2GSRA 3RAZA 1LU4A 1OC9B 1GH2A 2R6KA 3KGKA 3EMXA 5B8BA 2NPBA 4PXOA 2C3QA 3F4SA 1T7PB 3HZ4A 1EOHA 3VI7A 2JSZA 3EU4A 2YZUA 4G9HA 3SBCA 4N11A 5CYYA 5CRWA 1I5GA 4JRRA 1WPIA 1B48A 1PQNA 1TI1A 3EPTA 4XTSA 4D73A 1SL0B 5ECPB 3GV1A 3NOFA 4GXZA 2XPEA 2OACA 4FO5A 4J57E 3GNJA 2P5QA 5J4UA 1XOAA 3Q19A 3Q74A 2RIIA 2XHFA 3GMFA 2AYTA 2MBTA 2VL2C 1X9WB 1H75A 1FVKA 2H1BA 2JADA 2FWFA 2GTUA 1G7OA 2ZCTA 2WS2A 1SJIA 3DKSA 4Q5QA 1XW9A 3GURA 3J7Yk 1DE2A 3TOTA 1JLWA 5DCGA 1SD8A 5KN0A 5KOXA 2HI7A 5IMCA 1AQXA 1UC7A 3C71A 3KEBA 1FAAA 1AC1A 4OMVA 4JZQA 4BA7A 3VPTA 5IIZA 5CRGA 1TRSA 1ZL9A 5D8IA 1PKZA 1XZOA 1U3IA 2BMXA 2H74A 2VAFA 2LQOA 5ECMB 2JL4A 3IK9A 1M2BA 1GUHA 2MZCA 1USBA 4ECIA 3N5OA 1Y25A 2FLSA 6GSVA 4J56E 20GSA 4HS1A 3WYWA 2YWNA 1JFUA 3BJ5A 2K18A 5GSTA 2VLVA 2R0GA 1RQMA 5DCHA 3K8NA 5INYA 4IVFA 3O76A 4TOPA 5D9XA 1TKDB 5G5FA 2ZUPA 5J5NA 4EDZA 3IR4A 3RHBA 1A24A 1NHOA 4PNGA 4KH7A 4POBA 3Q18A 1ACVA 1TP9A 2H72A 2KP2A 1BX9A 2N5FA 1UVZA 4TXVA 2UZ8A 5DVBA 2PN8A 3RPPA 5ECRB 4J2FA 3KZQA 3Q6OA 4MJEA 1DBYA 1DUGA 4LA1A 3TKRA 1KTEA 11GSA 2YV7A 3TCOA 1GSUA 4ECCA 3F9UA 2GGTA 3HVVA 2N5AA 5EL8A 2L6DA 2WB9A 2GZZA 1PA3A 3KH7A 4TXOB 1JHBA 4O5UA 4ULXA 3D4MA 3F4RA 4HJ2A 3IRAA 1XW6A 3HXSA 4OO5A 2XBIA 4GSSA 3D4TA 2HLSA 4ICYA 2VIMA 2OADA 5J3RA 5ECOB 5DALA 2ES7A 4JBBA 2F3MA 2DSAA 3NIVA 3GHAA 2VD1A 2HRNA 2ON7A 1F3AA 3HA9A 1M99A 3TGZA 1PL1A 3ME8A 5IOWA 4V2NA 3AY8A 1GSFA 2LQQA 2J9HA 4MF6A 4IP1A 4KCEA 1K0CA 1TRUA 4K0GA 2B5EA 5KN2A 1YY7A 5JCGA 1OC3A 1X5CA 5ECIB 1BG5A 2LJAA 3IHGA 2WRTA 2H6XA 1QMVA 1Q98A 1G7EA 1OC8A 1A2MA 1EV4A 1MTCA 2FGXA 2H1DA 4KNDA 2IL3A 4K5SA 1HD2A 4LL4B 4ZBDA 1BEDA 1K3OA 4G2EA 2YNXA 3F3RA 4JEDA 1O7UA 1WWJA 3EINA 2J23A 1SYRA 2V6KA 2F9SA 3GX0A 1QGVA 3UARA 3GKMA 2X64A 3IK7A 6GSWA 2HXKA 4PUAA 12GSA 4MZBA 4DSQA 1JZOA 4L0UA 4MJAA 4MCUA 1U3AA 1SKRB 3IOSA 2H6ZA 4WBRD 3FKFA 5ELAA 2H1GA 4MH3A 2N5BA 1HYUA 3GL3A 2D2ZA 3C7MA 1X9MB 4KW6A 3TJBA 3E0UA 3DIEA 3VWVA 1X5DA 3ZIJA 3DD3A 2A2PA 2VCXA 1AXDA 1N2AA 1PMTA 2H76A 2NBSA 1GRXA 5J9CA 3KIJA 2WCIA 2OE1A 3L0HA 4OO4A 2VCZA 3DVWA 4MMMA 3CSJA 2DJKA 5G1LA 3F6DA 3CXGA 4TR1B 5IO2A 2DJ0A 2R3XA 2K8VA 2V2GA 3PH9A 10GSA 2RUEA 3ZREA 4O5RA 5IMFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MAB A;  2O89 A;  2MMN A;  3UVH A;  4MDC A;  2VCT A;  1KNG A;  3ERG A;  2IMD A;  4NAX A;  2B6M A;  2ALB A;  1E2Y A;  1VF1 A;  2YN1 A;  3BCK A;  2F51 A;  1GSQ A;  1YEP A;  1TDI A;  1NHY A;  3HJM A;  1UA5 A;  2GSS A;  2HFD A;  4KCA A;  3WT2 A;  3RHC A;  4POL A;  1XWA A;  2I1U A;  5IQY A;  1ZYQ B;  2H19 A;  4IGJ A;  1R4W A;  2I4A A;  3TKQ A;  2E0Q A;  2VCV A;  5E4W A;  3WD6 A;  1HNB A;  3LXZ A;  4KDY A;  4JE1 A;  2DJJ A;  4TRX A;  2RLI A;  1VF4 A;  3H79 A;  5DBQ A;  3BCI A;  5F05 A;  1YF0 A;  3GIX A;  1PGT A;  1GUK A;  3UVT A;  2G0F A;  3L78 A;  2VUP A;  2NTO A;  5IPH A;  1PSQ A;  3GH9 A;  3O6T A;  2HRF A;  5CNW A;  3TJK A;  5IMD A;  1NW2 A;  1N8J A;  4GF0 A;  2GQK A;  1M2D A;  1W4V A;  3FYG A;  4YQV A;  5ECL B;  1EGO A;  4ML1 A;  1BAY A;  1AW9 A;  1GP1 A;  1V58 A;  2K8S A;  3LG6 A;  4ZL9 A;  2FA4 A;  4KX4 A;  1THO A;  1J08 A;  1H4O A;  3EWL A;  1B9Y C;  1WE0 A;  2HZE A;  4EL1 A;  3GUS A;  2VO4 A;  3D6I A;  5AIV A;  5AIX A;  4IHU A;  1EWX A;  2Z9S A;  3TUE A;  5C00 A;  2XC2 A;  3IV4 A;  1X0R A;  2R2J A;  3VWW A;  1R5P A;  1EP7 A;  1TRV A;  4JR4 A;  2QKE A;  3OR5 A;  2H8L A;  1EP8 A;  4LLR A;  4BVX A;  1WIK A;  2TIR A;  1WP0 A;  3QPM A;  4WR4 A;  2MYG A;  2K6V A;  3FK8 A;  1GSD A;  4TN8 A;  4EC0 A;  4KUN A;  3EUR A;  3ZLP A;  2DIY A;  1ZMA A;  4F2I A;  2C8U A;  2KOK A;  1YQ1 A;  1CQG A;  1ERW A;  4DSS A;  5DAL B;  3M9K A;  2PER A;  4X1U A;  6GSY A;  3FRC A;  4PQI A;  3CYN A;  2AUV A;  1SD9 A;  4NV2 A;  4F0C A;  4ACS A;  2I9H A;  1YKC A;  6GSX A;  2E2M A;  3A2X A;  1QUW A;  2IN3 A;  2V32 A;  2REM A;  1F37 A;  4PUR A;  3KD0 A;  17GS A;  3M3M A;  2QGV A;  1M9A A;  2VM1 A;  1Z7R A;  2LRT A;  3TOU A;  2RM6 A;  4NV5 A;  3IAM 2;  4MJC A;  4XRA A;  2YAN A;  2NVL A;  5G5E A;  4ZB9 A;  3RPN A;  1XXU A;  13GS A;  5B6N A;  3SWL A;  1YKA A;  1SYX A;  4V1A g;  3MDK A;  3D21 A;  1MDK A;  2FA8 A;  4L8E A;  4PQ1 A;  2LJK A;  2M46 A;  5F8B A;  4IJ3 A;  4HU9 A;  4LMW A;  1T1V A;  5COH A;  5AIS A;  2ZNM A;  2E2G A;  3G9B A;  3KCM A;  3PGT A;  3M8N A;  1XWG A;  3VI5 A;  2FY6 A;  5ECS A;  1T3B A;  4GLT A;  5JWO B;  1B8X A;  5KEJ A;  5ELG A;  4EKZ A;  3KH9 A;  3EMP A;  3ZIT A;  1WRY A;  1U87 A;  1ZGN A;  2H01 A;  3A3T A;  3BOA A;  3APQ A;  3ZZX A;  3M9J A;  3QDN A;  2R4V A;  3MNG A;  5DJL A;  3TJF A;  2WUL A;  3FW2 A;  4TR4 A;  1FB6 A;  3ZVJ D;  3ZIV A;  3PR8 A;  1K0N A;  2WJU A;  4HDE A;  3M0F A;  3FZ5 A;  2VL3 A;  1O8W A;  1A0F A;  4ZL7 A;  4HQS A;  4IQA A;  4XRD A;  3GA4 A;  2CT6 A;  5FT3 A;  4XCS A;  2DJ3 A;  4K1F A;  2C0D A;  1SK0 A;  4NMU A;  3P90 A;  3ZFB A;  3HJP A;  3CRT A;  1XVQ A;  3F3Q A;  1R26 A;  2JZS A;  2PPT A;  2YWM A;  2DC5 A;  4I2T A;  2CAI A;  2LRN A;  3HJO A;  3D0Z A;  1YF1 A;  1A2L A;  2M80 A;  5DAK A;  5KN3 A;  2OBI A;  1GUL A;  1YJ6 A;  3HZ8 A;  1HNC A;  3F6F A;  2H70 A;  3APO A;  1MD3 A;  3QAV A;  1YZX A;  1V40 A;  2I81 A;  4ZXG A;  3MWH A;  3FZ9 A;  2F8A A;  2M72 A;  1B9X C;  3DVX A;  5EPF A;  3TKS A;  4IW9 A;  2H0H A;  1M2A A;  4G19 A;  4GST A;  1SEN A;  1NM3 A;  3ZML A;  3M1G A;  5A4W A;  2O8V B;  3ZFL A;  4HU7 A;  5CRD A;  1WMJ A;  5G2Z A;  5B7C A;  2PUK C;  2JU5 A;  5IOX A;  2VCW A;  1KEB A;  4OD7 A;  4N10 A;  3CTG A;  1M7T A;  5IO0 A;  3BD2 A;  4ZBB A;  2HZE B;  9GSS A;  4OCE A;  2PBJ A;  3KMO A;  3D22 A;  3GKK A;  4RI7 A;  1K3L A;  2JAC A;  4ZBA A;  2WFC A;  1FVJ A;  1IYH A;  2DMM A;  4KGI A;  2WDU A;  3EE2 A;  1GTI A;  1E6B A;  3L9S A;  16GS A;  4MP4 A;  1R5A A;  1X9S B;  1GL8 A;  5HFI A;  4IEL A;  1F2E A;  1X5E A;  1FW1 A;  2CQ9 A;  5HFK A;  2HZF A;  3FHK A;  4MJB A;  1GTB A;  3KP9 A;  4F0B A;  4KAE A;  5DQS A;  2GLR A;  1EEM A;  2YOI A;  4TVE A;  3ERW A;  4POM A;  1SJZ A;  3LYP A;  2BJX A;  1XVW A;  1SKS B;  5H5S A;  2GT6 A;  5JWQ B;  2XBQ A;  2A4V A;  1THX A;  1GTU A;  2IIY A;  2R5G A;  4MPF A;  4OCF A;  5DQY A;  2C0F A;  2B5X A;  3L4N A;  3IC4 A;  1GSS A;  5LCZ A;  1GTA A;  3H4K A;  2QSI A;  5L71 A;  2OKA A;  3KXO A;  3F0I A;  3GYK A;  3GRX A;  6GST A;  1B4Q A;  3LEF A;  2K9F A;  2X8C A;  1PD2 1;  4N0Z A;  2FUG 2;  3QR6 A;  2CX3 A;  2V41 A;  3UBK A;  1PKW A;  1WOU A;  5D73 A;  3EC3 A;  4WF5 A;  4QL9 A;  2H0I A;  1K0B A;  2MMZ A;  1K0M A;  2LJR A;  2IJY A;  5AN1 A;  1Z5Y E;  2KP1 A;  3IHQ A;  4FYB A;  3UAP A;  4FYC A;  2FWG A;  2PMT A;  1EEJ A;  1JLV A;  3GTU B;  5FHI A;  4KE3 A;  5F06 A;  2CZ2 A;  4AJ7 A;  4TR3 A;  4V2M A;  1SJ6 A;  2YJ7 A;  4GTU A;  4MF7 A;  5GAP D;  2CVK A;  2IMI A;  2FD3 A;  4ZB8 A;  1UN2 A;  1TK8 B;  1TK5 B;  4AGS A;  3IBH A;  4FIW A;  1XPV A;  3LXT A;  1TW9 A;  1AIU A;  4JU5 A;  4D73 B;  4ZIJ A;  1F9M A;  3TDG A;  3CRU A;  5GAN D;  2X8H A;  1FO5 A;  4N0V A;  2DJ1 A;  4XHM A;  4PX1 A;  4ID0 A;  4KB3 A;  2IMK A;  1VF3 A;  5D9W A;  1LBK A;  2RUF A;  3TJJ A;  5B6M A;  3CBU A;  2H75 A;  3APS A;  3E9J B;  3HVS A;  1GNE A;  2IWT A;  1BJX A;  4HEA 2;  2B1L A;  2L6C A;  5D96 A;  5JWR B;  4RUV A;  2YP6 A;  2LS5 A;  2EIO A;  3VFI A;  5A4V A;  1TU8 A;  3U6V A;  1A23 A;  1PX6 A;  1TXX A;  3V1W A;  4WF4 A;  2WGR A;  3KM6 A;  2AV4 A;  4K2D A;  1Q4J A;  2G2Q A;  4XS4 A;  3UL3 A;  4OFM A;  1S3C A;  1A8Y A;  4YAP A;  3QAW A;  1PRX A;  3TRX A;  2OE3 A;  2V6O A;  3LOR A;  3TRP A;  3LFL A;  5ECQ B;  2H6Y A;  2YWO A;  2X8G A;  3I6A A;  5IM9 A;  1ILO A;  2GT5 A;  2PWJ A;  1F6M C;  4ILF A;  3O3T A;  2O7K A;  2ON5 A;  5DAK B;  2HT9 A;  2L57 A;  4JR6 A;  1C72 A;  1OKT A;  1ERU A;  4GRF A;  1FG4 A;  5HFG A;  4EUY A;  4KA0 A;  3ZL5 A;  2E7P A;  4P3Y B;  4O32 A;  4QQ7 A;  2LEG A;  2C1Y A;  2TRX A;  3UJ1 A;  2YPM A;  1TI3 A;  5CRE A;  4Q5N A;  1FOV A;  2EIR A;  3FR9 A;  1SKW B;  2L4Q A;  2MMA A;  3IAS 2;  4TXO A;  3FEU A;  2GS3 A;  1M9B A;  1HNA A;  2GDR A;  3GFK A;  4I2U A;  4F03 A;  1T4Y A;  1AQW A;  4TW5 A;  3PIN A;  2LRC A;  3U5R E;  3DRN A;  3TB2 A;  4WBJ A;  3ME7 A;  2P31 A;  4HZ2 A;  4MF5 A;  1VRS D;  3S9F A;  1WJK A;  19GS A;  3VWX A;  3IPZ A;  1Y6E A;  5DJM A;  4X43 A;  3GST A;  4WKW A;  1ERV A;  1EOG A;  2EIQ A;  1I9D A;  3WT1 A;  4BL7 A;  1CQH A;  1T8E B;  3CMI A;  2R37 A;  5D93 A;  3WGE A;  1URM A;  4IP6 A;  4ECB A;  4MLY A;  3TRQ A;  4K8M A;  1BYE A;  2YCD A;  2XPD A;  3P7X A;  5B8A A;  3FR3 A;  1K0O A;  3HCZ A;  1GUM A;  1S3A A;  2H66 A;  2VL2 A;  2C0E A;  3ISO A;  1NSW A;  1B4P A;  3UMA A;  2VCQ A;  4GQF A;  1GWC A;  3QMX A;  3RBT A;  2MBS A;  3EU3 A;  4LL1 B;  2FNO A;  2CX4 A;  2FWH A;  5LD0 A;  3ZVJ A;  3HKR A;  2EC4 A;  3HY2 A;  3H1N A;  1Z9H A;  2GQL A;  4K7N A;  3QCP A;  5DDL A;  3TKP A;  3TKS E;  3KMN A;  2A2S A;  4LMV A;  22GS A;  4CHS A;  3IDV A;  4IBP A;  2TRC P;  2VLU A;  1GLQ A;  2PVO C;  4NHW A;  3ZTL A;  3QD9 A;  1EV9 A;  4WXT A;  2P0G A;  2P5R A;  1ZYE A;  3ZMK A;  4YQM A;  2VL9 A;  1V98 A;  3DGQ A;  4GCI A;  3FY7 A;  2GSQ A;  3G7Y A;  5ID2 A;  1G0T A;  1J9B A;  1MD4 A;  2B3S A;  1DSB A;  1GSY A;  3DYR A;  1RK4 A;  2LNS A;  4EF0 A;  5FWG A;  5C04 A;  2FCH A;  5ECH B;  5LNK e;  1QQ2 A;  4V1A p;  2H73 A;  3QAG A;  5HR1 A;  14GS A;  4DVC A;  1SL1 B;  2AB6 A;  4TR1 A;  4WEY A;  3UIW A;  5A5K A;  3DXB A;  4K0N A;  4EE0 A;  4CDO A;  4HZ4 A;  2HSY A;  4QL7 A;  3HHV A;  2IME A;  4IN0 A;  1A0R P;  2DIZ A;  3HDC A;  2L4C A;  2JSY A;  4GWR A;  3J7Y b;  4RQR A;  1ML6 A;  4BPY A;  3GKN A;  4Q5R A;  3IA1 A;  3NZN A;  4MA9 A;  1AUC A;  2CVD A;  5HR3 A;  1XBS A;  4DEJ A;  1XIY A;  3MSZ A;  4L5L A;  1G6W A;  2YV9 A;  2QC7 A;  2IFQ A;  4HI7 A;  1LJR A;  4YAV A;  4GSN A;  2GVP A;  2H71 A;  1XOB A;  4HQZ A;  2B7J A;  4NPB A;  4RI6 A;  1XW5 A;  5HR2 A;  4L0W A;  4E8E A;  4BWQ A;  2B7K A;  5J41 A;  2PU9 C;  1XWC A;  3F8U A;  5CRH A;  5IMV A;  1W89 A;  1ABA A;  4WET A;  3FR6 A;  2JZR A;  2X99 A;  5EVO A;  5G31 A;  5JCU A;  1GSE A;  1T00 A;  4MPG A;  3W8S A;  3P2A A;  3LYK A;  2C0G A;  1T4Z A;  2B1K A;  5D9T A;  3VUR A;  2OBK A;  3H93 A;  4L5O A;  3I9V 2;  4XS4 B;  1TTZ A;  5ECN B;  3QFA C;  2OJL A;  1FHE A;  3HD5 A;  1HQO A;  3FZ4 A;  4TR0 A;  1KBN A;  3LWA A;  4ML6 A;  4PGT A;  3VPQ A;  4OWY A;  3ED3 A;  3C1R A;  1ERT A;  3KJY A;  3LJR A;  2CVB A;  2LST A;  2BTO T;  3TJG A;  1TU7 A;  1OE7 A;  5CAX A;  3CSH A;  1O81 A;  4ECJ A;  4KSO A;  2YWI A;  2F8F A;  2C3T A;  3CSI A;  5ENU A;  4IKH A;  1K3Y A;  4IQ1 A;  3UEM A;  2HYX A;  4YQU A;  4BVY A;  3HVX A;  4K7I A;  3E3E A;  2AJQ B;  2L5O A;  2KHP A;  5HQP A;  3EVI A;  3H8Q A;  2OA7 A;  5H5Q A;  3F4T A;  3WGD A;  4Z7X A;  1SK1 A;  3HYP A;  3QOU A;  1RW1 A;  4N30 A;  1V57 A;  4KDU A;  5ECK B;  4IJI A;  3IXR A;  3W6G A;  5GSS A;  3DML A;  2V1M A;  5JCW A;  3KP8 A;  3US3 A;  3GH6 A;  4AJ6 A;  1VGL A;  1XWK A;  1G6Y A;  1M0U A;  4WR5 A;  4ZIL A;  5J9B A;  2H1A A;  4FYU A;  3FZA A;  3KTB A;  1ZCP A;  5EY6 A;  1IYI A;  2CZ3 A;  3L9V A;  5HR0 A;  4ZL8 A;  2PVQ A;  1OYJ A;  4DSS B;  1PN9 A;  3TKS C;  3ERF A;  1JZW A;  3W8J A;  3VLN A;  4XS1 A;  1Z6N A;  1PX7 A;  2O87 A;  1Z3E A;  3LQ7 A;  2HNL A;  1JZR A;  4F9Z A;  2YZH A;  3DWV A;  1YDK A;  4ZB6 A;  1OC9 A;  18GS A;  1J0F A;  4E8H A;  2LKU A;  1V2A A;  3CTF A;  1EGR A;  1SU9 A;  1O6J A;  2GZP A;  4XS6 A;  4EXJ A;  1GNW A;  4X0X A;  4MZC A;  5ABR A;  1XFL A;  1OAZ A;  3A5W A;  5G1K A;  1SL2 B;  1AQV A;  4V2L A;  3R2Q A;  4DSR A;  6GSS A;  2LNT A;  2CA8 A;  2C80 A;  4NXI A;  4PNF A;  4Q5F A;  2CV4 A;  5IPG A;  4I97 A;  5ID2 B;  3I43 A;  3JCM L;  1U88 A;  1MEK A;  3VK9 A;  4HUA A;  2LV3 A;  5F0G A;  2H0G A;  4POK A;  4KDX A;  3D5J A;  3L9U A;  2FWE A;  4H86 A;  3I69 A;  1O8X A;  2L59 A;  2VLT A;  4NWY A;  5CP1 A;  2DLX A;  1Z7P A;  4XIH A;  1ZOF A;  3UOM A;  1OVN A;  2LTK A;  1DE1 A;  2AHE A;  2GST A;  1V9W A;  1S3D A;  1GLP A;  1JZD A;  1A8L A;  2IFQ B;  2HSH A;  3WGX A;  4EVM A;  2LUS A;  8GSS A;  4MH2 A;  3ZRD A;  1MDJ A;  1PL2 A;  4RQX A;  1ST9 A;  1K0D A;  5F07 A;  1TRW A;  3F63 A;  4HJM A;  2DJ2 A;  4NHZ A;  4I8B A;  4FH8 A;  1FB0 A;  4EO3 A;  1A2J A;  4MZW A;  3C1S A;  5D9V A;  5E59 A;  1R7H A;  4O92 A;  1F3B A;  5AGY A;  4OFN A;  2KUC A;  3RDW A;  1Z6M A;  2DML A;  3A2V A;  4KSM A;  3BBY A;  4BWS A;  2MMO A;  2RM5 A;  1O73 A;  2NDO A;  3G7J A;  3P8W A;  5GZZ B;  3C8E A;  3GKX A;  3KTL A;  1MDI A;  2KLX A;  3DEX A;  1TJD A;  4AJ8 A;  4EDY A;  3LGC A;  3QFB C;  2VOC A;  3MAK A;  1QXH A;  3VWU A;  3UBL A;  4F82 A;  2O85 A;  1VF2 A;  2IMF A;  2C3N A;  5IMZ A;  1U6T A;  1XCC A;  4IS0 A;  1TOF A;  4G10 A;  2VD0 A;  2CAQ A;  4I6X A;  4GQC A;  1ZZY A;  2DBC A;  2C4J A;  1OKD A;  2GZY A;  4MK3 A;  3A2W A;  4OFT A;  2IPA A;  3GSS A;  2GQM A;  4YH2 A;  4PUF C;  1ON4 A;  1SK2 A;  3LSZ A;  2JZT A;  4ISD A;  2VM2 A;  1XWB A;  2OE0 A;  2I3Y A;  3GN3 A;  3N9J A;  2B5Y A;  1TK0 B;  4TKY A;  1YEX A;  2YJH A;  4HOJ A;  5G30 A;  1AAZ A;  3C73 A;  4CW9 A;  1QK8 A;  1BQ7 A;  2WZ9 A;  5CO3 A;  2H30 A;  1K0A A;  5IMA A;  1QFN A;  4AF2 A;  2PGT A;  2FHE A;  5H5R A;  3GL5 A;  3ZYW A;  3EYT A;  4O7H A;  6GSU A;  2HE3 A;  2A2R A;  3G7I A;  5A4U A;  4K9Z A;  2L5L A;  4I5Q A;  4K6X A;  4PQH A;  3IE3 A;  1EZK A;  5KN1 A;  3GX8 A;  7GSS A;  1O85 A;  3GTU A;  1OE8 A;  2AAW A;  4K7O A;  2GSR A;  3RAZ A;  1LU4 A;  1OC9 B;  1GH2 A;  2R6K A;  3KGK A;  3EMX A;  5B8B A;  2NPB A;  4PXO A;  2C3Q A;  3F4S A;  1T7P B;  3HZ4 A;  1EOH A;  3VI7 A;  2JSZ A;  3EU4 A;  2YZU A;  4G9H A;  3SBC A;  4N11 A;  5CYY A;  5CRW A;  1I5G A;  4JRR A;  1WPI A;  1B48 A;  1PQN A;  1TI1 A;  4XTS A;  4D73 A;  1SL0 B;  5ECP B;  3GV1 A;  3NOF A;  4GXZ A;  2XPE A;  2OAC A;  4FO5 A;  4J57 E;  3GNJ A;  2P5Q A;  5J4U A;  1XOA A;  3Q19 A;  3Q74 A;  2RII A;  2XHF A;  3GMF A;  2AYT A;  2MBT A;  2VL2 C;  1X9W B;  1H75 A;  1FVK A;  2H1B A;  2JAD A;  2FWF A;  2GTU A;  1G7O A;  2ZCT A;  2WS2 A;  1SJI A;  3DKS A;  4Q5Q A;  1XW9 A;  3GUR A;  3J7Y k;  1DE2 A;  3TOT A;  1JLW A;  5DCG A;  1SD8 A;  5KN0 A;  2HI7 A;  5IMC A;  1AQX A;  1UC7 A;  3C71 A;  3KEB A;  1FAA A;  1AC1 A;  4OMV A;  4JZQ A;  4BA7 A;  3VPT A;  5IIZ A;  5CRG A;  1TRS A;  1ZL9 A;  5D8I A;  1PKZ A;  1XZO A;  1U3I A;  2BMX A;  2H74 A;  2VAF A;  2LQO A;  5ECM B;  2JL4 A;  3IK9 A;  1M2B A;  1GUH A;  2MZC A;  1USB A;  4ECI A;  3N5O A;  1Y25 A;  2FLS A;  6GSV A;  4J56 E;  20GS A;  4HS1 A;  3WYW A;  2YWN A;  1JFU A;  3BJ5 A;  2K18 A;  5GST A;  2VLV A;  1RQM A;  5DCH A;  3K8N A;  5INY A;  4IVF A;  3O76 A;  4TOP A;  5D9X A;  1TKD B;  5G5F A;  2ZUP A;  5J5N A;  4EDZ A;  3IR4 A;  3RHB A;  1A24 A;  1NHO A;  4PNG A;  4KH7 A;  4POB A;  3Q18 A;  1ACV A;  1TP9 A;  2H72 A;  2KP2 A;  1BX9 A;  2N5F A;  1UVZ A;  4TXV A;  5DVB A;  2PN8 A;  3RPP A;  5ECR B;  4J2F A;  3KZQ A;  3Q6O A;  4MJE A;  1DBY A;  1DUG A;  4LA1 A;  3TKR A;  1KTE A;  11GS A;  2YV7 A;  3TCO A;  1GSU A;  4ECC A;  3F9U A;  2GGT A;  3HVV A;  2N5A A;  5EL8 A;  2L6D A;  2WB9 A;  2GZZ A;  1PA3 A;  3KH7 A;  4TXO B;  1JHB A;  4ULX A;  3D4M A;  3F4R A;  4HJ2 A;  3IRA A;  1XW6 A;  3HXS A;  4OO5 A;  2XBI A;  4GSS A;  3D4T A;  2HLS A;  2VIM A;  2OAD A;  5J3R A;  5ECO B;  5DAL A;  2ES7 A;  4JBB A;  2F3M A;  2DSA A;  3NIV A;  3GHA A;  2VD1 A;  2HRN A;  2ON7 A;  1F3A A;  3HA9 A;  1M99 A;  3TGZ A;  1PL1 A;  3ME8 A;  5IOW A;  4V2N A;  3AY8 A;  1GSF A;  2LQQ A;  2J9H A;  4MF6 A;  4IP1 A;  4KCE A;  1K0C A;  1TRU A;  4K0G A;  2B5E A;  5KN2 A;  1YY7 A;  5JCG A;  1OC3 A;  1X5C A;  5ECI B;  1BG5 A;  2LJA A;  2WRT A;  2H6X A;  1QMV A;  1Q98 A;  1G7E A;  1OC8 A;  1A2M A;  1EV4 A;  1MTC A;  2FGX A;  2H1D A;  4KND A;  2IL3 A;  1HD2 A;  4LL4 B;  4ZBD A;  1BED A;  1K3O A;  4G2E A;  2YNX A;  3F3R A;  4JED A;  1O7U A;  1WWJ A;  3EIN A;  2J23 A;  1SYR A;  2V6K A;  2F9S A;  3GX0 A;  1QGV A;  3UAR A;  3GKM A;  2X64 A;  3IK7 A;  6GSW A;  2HXK A;  4PUA A;  12GS A;  4MZB A;  4DSQ A;  1JZO A;  4L0U A;  4MJA A;  4MCU A;  1U3A A;  1SKR B;  3IOS A;  2H6Z A;  4WBR D;  3FKF A;  5ELA A;  2H1G A;  4MH3 A;  2N5B A;  1HYU A;  3GL3 A;  2D2Z A;  3C7M A;  1X9M B;  4KW6 A;  3TJB A;  3E0U A;  3DIE A;  3VWV A;  1X5D A;  3ZIJ A;  3DD3 A;  2VCX A;  1AXD A;  1N2A A;  1PMT A;  2H76 A;  2NBS A;  1GRX A;  5J9C A;  3KIJ A;  2WCI A;  2OE1 A;  3L0H A;  4OO4 A;  2VCZ A;  3DVW A;  4MMM A;  3CSJ A;  2DJK A;  5G1L A;  3F6D A;  3CXG A;  4TR1 B;  5IO2 A;  2DJ0 A;  2R3X A;  2K8V A;  2V2G A;  3PH9 A;  10GS A;  2RUE A;  3ZRE A;  4O5R A;  5IMF A; 
#chains in the Genus database with same CATH topology
 4MAB A;  2O89 A;  2MMN A;  3UVH A;  4MDC A;  2VCT A;  4CY6 A;  1KNG A;  3ERG A;  2IMD A;  4O5Q A;  4NAX A;  2B6M A;  2ALB A;  1E2Y A;  1VF1 A;  2YN1 A;  3BCK A;  2F51 A;  1GSQ A;  1YEP A;  1TDI A;  1NHY A;  3HJM A;  1UA5 A;  2GSS A;  2HFD A;  4KCA A;  3WT2 A;  3RHC A;  4POL A;  1XWA A;  2I1U A;  5IQY A;  1ZYQ B;  2H19 A;  4IGJ A;  1R4W A;  2I4A A;  3TKQ A;  2E0Q A;  2VCV A;  3IC8 A;  5E4W A;  3WD6 A;  1HNB A;  3LXZ A;  4KDY A;  4JE1 A;  2DJJ A;  4TRX A;  2RLI A;  1VF4 A;  3H79 A;  5DBQ A;  3BCI A;  5F05 A;  1YF0 A;  3GIX A;  1PGT A;  1GUK A;  3UVT A;  2G0F A;  3L78 A;  1PFO A;  2VUP A;  3HVN A;  2NTO A;  5IPH A;  1PSQ A;  3GH9 A;  3O6T A;  2HRF A;  5CNW A;  3TJK A;  5IMD A;  1NW2 A;  1N8J A;  4GF0 A;  2GQK A;  1M2D A;  1W4V A;  3FYG A;  4CY8 A;  4YQV A;  5ECL B;  1EGO A;  4ML1 A;  1BAY A;  1AW9 A;  1GP1 A;  1V58 A;  2K8S A;  3LG6 A;  4ZL9 A;  2FA4 A;  4KX4 A;  1THO A;  1J08 A;  1H4O A;  3EWL A;  1B9Y C;  1WE0 A;  2HZE A;  4EL1 A;  3GUS A;  2VO4 A;  3D6I A;  5AIV A;  5AIX A;  4IHU A;  1EWX A;  2Z9S A;  3TUE A;  5C00 A;  2XC2 A;  3IV4 A;  1X0R A;  2R2J A;  3VWW A;  1R5P A;  1EP7 A;  1TRV A;  3PPU A;  4JR4 A;  2QKE A;  2QA1 A;  3OR5 A;  2H8L A;  1EP8 A;  4LLR A;  4BVX A;  1WIK A;  2TIR A;  1WP0 A;  3QPM A;  2R0C A;  4BVY B;  4WR4 A;  2MYG A;  2K6V A;  4G0I A;  3FK8 A;  1GSD A;  4TN8 A;  4EC0 A;  4KUN A;  3EUR A;  3ZLP A;  2DIY A;  1ZMA A;  4F2I A;  2C8U A;  2KOK A;  1YQ1 A;  1CQG A;  1ERW A;  4DSS A;  5DAL B;  3M9K A;  2PER A;  4X1U A;  6GSY A;  3FRC A;  4PQI A;  3CYN A;  2AUV A;  1SD9 A;  4NV2 A;  4F0C A;  4ACS A;  2I9H A;  1YKC A;  6GSX A;  2E2M A;  3A2X A;  1QUW A;  2IN3 A;  2V32 A;  2REM A;  1F37 A;  4PUR A;  3KD0 A;  17GS A;  3M3M A;  2QGV A;  1M9A A;  2VM1 A;  1Z7R A;  2LRT A;  3TOU A;  2RM6 A;  1FOH A;  4NV5 A;  3IAM 2;  4MJC A;  4XRA A;  2YAN A;  2NVL A;  5G5E A;  4ZB9 A;  3RPN A;  1XXU A;  13GS A;  5B6N A;  3SWL A;  1YKA A;  1SYX A;  4V1A g;  3MDK A;  3D21 A;  1MDK A;  1ZYN A;  2FA8 A;  4L8E A;  4PQ1 A;  2LJK A;  2M46 A;  5F8B A;  4IJ3 A;  4HU9 A;  4LMW A;  1T1V A;  5COH A;  5AIS A;  2ZNM A;  2E2G A;  3G9B A;  3KCM A;  3PGT A;  3M8N A;  1XWG A;  3VI5 A;  2FY6 A;  5ECS A;  1T3B A;  4GLT A;  5JWO B;  1B8X A;  5KEJ A;  5ELG A;  4EKZ A;  3KH9 A;  3EMP A;  3ZIT A;  2DKH A;  1WRY A;  1U87 A;  1ZGN A;  2H01 A;  3A3T A;  3BOA A;  3APQ A;  3ZZX A;  3M9J A;  3QDN A;  2R4V A;  3MNG A;  5DJL A;  3TJF A;  2WUL A;  3FW2 A;  4TR4 A;  1FB6 A;  3ZVJ D;  3ZIV A;  3PR8 A;  1K0N A;  2WJU A;  4HDE A;  3M0F A;  3FZ5 A;  2VL3 A;  1O8W A;  1A0F A;  4ZL7 A;  4HQS A;  4IQA A;  4XRD A;  3GA4 A;  2CT6 A;  5FT3 A;  4A5P A;  4XCS A;  2DJ3 A;  4G0K A;  4K1F A;  2C0D A;  1SK0 A;  4NMU A;  4MNN A;  3P90 A;  3ZFB A;  3HJP A;  3CRT A;  1XVQ A;  3F3Q A;  1R26 A;  2JZS A;  2PPT A;  2YWM A;  2DC5 A;  4I2T A;  2CAI A;  2LRN A;  3HJO A;  3D0Z A;  1YF1 A;  4HSC X;  1A2L A;  2M80 A;  5DAK A;  5KN3 A;  2OBI A;  1GUL A;  1YJ6 A;  3HZ8 A;  1HNC A;  4YKF A;  3F6F A;  2H70 A;  3APO A;  1MD3 A;  3QAV A;  1YZX A;  1V40 A;  2I81 A;  4ZXG A;  3MWH A;  3FZ9 A;  2F8A A;  2M72 A;  1B9X C;  3DVX A;  5EPF A;  3TKS A;  4IW9 A;  2H0H A;  1M2A A;  4G19 A;  3FMW A;  4GST A;  1SEN A;  1NM3 A;  3ZML A;  3M1G A;  5A4W A;  2O8V B;  3ZFL A;  4HU7 A;  5CRD A;  1WMJ A;  5G2Z A;  2HSM A;  5B7C A;  2PUK C;  2JU5 A;  5IOX A;  2VCW A;  1KEB A;  4OD7 A;  4N10 A;  3CTG A;  1M7T A;  5IO0 A;  3BD2 A;  4ZBB A;  2HZE B;  9GSS A;  4OCE A;  2PBJ A;  3KMO A;  3D22 A;  3GKK A;  4RI7 A;  1K3L A;  2JAC A;  4ZBA A;  2WFC A;  1FVJ A;  1IYH A;  2DMM A;  4KGI A;  2WDU A;  3EE2 A;  1GTI A;  1E6B A;  3L9S A;  16GS A;  4MP4 A;  4BVX B;  1R5A A;  1X9S B;  1GL8 A;  5HFI A;  4IEL A;  1F2E A;  1X5E A;  5KOW A;  1FW1 A;  2CQ9 A;  5HFK A;  4FQU A;  2HZF A;  3FHK A;  4MJB A;  1GTB A;  3KP9 A;  2R0P A;  4F0B A;  4KAE A;  5DQS A;  2GLR A;  1EEM A;  2YOI A;  4TVE A;  3ERW A;  4POM A;  1SJZ A;  3LYP A;  2BJX A;  1XVW A;  1SKS B;  5H5S A;  2GT6 A;  5JWQ B;  1M3J A;  2XBQ A;  2A4V A;  1THX A;  2HRK A;  1GTU A;  2IIY A;  2R5G A;  4MPF A;  4OCF A;  5DQY A;  2C0F A;  2B5X A;  3L4N A;  3IC4 A;  1GSS A;  5LCZ A;  1GTA A;  3H4K A;  2QSI A;  5L71 A;  2OKA A;  3KXO A;  3F0I A;  3GYK A;  3GRX A;  6GST A;  1B4Q A;  3LEF A;  2A4H A;  2K9F A;  2X8C A;  1PD2 1;  4N0Z A;  2FUG 2;  3QR6 A;  2CX3 A;  2V41 A;  4K2X A;  3UBK A;  1PKW A;  1WOU A;  5D73 A;  3EC3 A;  4WF5 A;  4QL9 A;  2H0I A;  1K0B A;  2MMZ A;  1K0M A;  2LJR A;  2IJY A;  5AN1 A;  1Z5Y E;  2KP1 A;  3IHQ A;  4FYB A;  3UAP A;  4FYC A;  2FWG A;  2PMT A;  1EEJ A;  1JLV A;  3GTU B;  5FHI A;  4KE3 A;  5F06 A;  2CZ2 A;  4AJ7 A;  4TR3 A;  4V2M A;  1SJ6 A;  2YJ7 A;  4GTU A;  4MF7 A;  5GAP D;  2CVK A;  2IMI A;  2FD3 A;  4ZB8 A;  1UN2 A;  1TK8 B;  1TK5 B;  4AGS A;  3IBH A;  4FIW A;  1XPV A;  3LXT A;  1TW9 A;  1AIU A;  4Z2U A;  4JU5 A;  4D73 B;  4ZIJ A;  1F9M A;  3TDG A;  3CRU A;  5GAN D;  2X8H A;  1FO5 A;  4N0V A;  2DJ1 A;  4XHM A;  4PX1 A;  4ID0 A;  4KB3 A;  2IMK A;  1VF3 A;  5D9W A;  1LBK A;  2RUF A;  3TJJ A;  5B6M A;  3CBU A;  2H75 A;  3APS A;  3E9J B;  3HVS A;  1GNE A;  2IWT A;  1BJX A;  4HEA 2;  2B1L A;  2L6C A;  5D96 A;  5JWR B;  4RUV A;  2YP6 A;  2LS5 A;  2EIO A;  3VFI A;  4YKG A;  5A4V A;  1TU8 A;  3U6V A;  1A23 A;  1PX6 A;  1TXX A;  3V1W A;  4WF4 A;  2WGR A;  3KM6 A;  2AV4 A;  4K2D A;  1Q4J A;  2G2Q A;  4XS4 A;  3UL3 A;  4OFM A;  1S3C A;  1A8Y A;  4YAP A;  1M3I A;  3QAW A;  1PRX A;  3TRX A;  2OE3 A;  2V6O A;  3LOR A;  3TRP A;  3LFL A;  5ECQ B;  2H6Y A;  2YWO A;  2X8G A;  3I6A A;  5IM9 A;  1ILO A;  2GT5 A;  2PWJ A;  1F6M C;  4ILF A;  3O3T A;  2O7K A;  2ON5 A;  5DAK B;  2HT9 A;  2L57 A;  4JR6 A;  1C72 A;  1OKT A;  1ERU A;  4GRF A;  1FG4 A;  5HFG A;  4EUY A;  4KA0 A;  3ZL5 A;  2E7P A;  4P3Y B;  4O32 A;  4QQ7 A;  2LEG A;  2C1Y A;  2TRX A;  3UJ1 A;  2YPM A;  1TI3 A;  5CRE A;  4Q5N A;  1FOV A;  2EIR A;  3FR9 A;  1SKW B;  2L4Q A;  2MMA A;  3IAS 2;  4TXO A;  3FEU A;  2GS3 A;  1M9B A;  1HNA A;  2GDR A;  3GFK A;  4I2U A;  4F03 A;  1T4Y A;  1AQW A;  4TW5 A;  3PIN A;  1PN0 A;  2LRC A;  3U5R E;  3DRN A;  3TB2 A;  4WBJ A;  3ME7 A;  2P31 A;  4HZ2 A;  4MF5 A;  1VRS D;  3S9F A;  1WJK A;  1S3R A;  19GS A;  3VWX A;  3IPZ A;  1Y6E A;  5DJM A;  4X43 A;  3GST A;  4WKW A;  3CQF A;  4G0L A;  1ERV A;  1EOG A;  2EIQ A;  1I9D A;  3WT1 A;  4BL7 A;  1CQH A;  1T8E B;  3CMI A;  2R37 A;  5D93 A;  3WGE A;  1URM A;  4IP6 A;  4ECB A;  4MLY A;  3TRQ A;  4K8M A;  1BYE A;  2YCD A;  2XPD A;  3P7X A;  5B8A A;  1ZYP A;  3FR3 A;  1K0O A;  3HCZ A;  1GUM A;  1S3A A;  2H66 A;  2VL2 A;  2C0E A;  3ISO A;  1NSW A;  1B4P A;  3UMA A;  2VCQ A;  4GQF A;  1GWC A;  3QMX A;  3RBT A;  2MBS A;  3EU3 A;  4LL1 B;  2FNO A;  2CX4 A;  2FWH A;  5LD0 A;  3ZVJ A;  3HKR A;  2EC4 A;  3HY2 A;  3H1N A;  1Z9H A;  2GQL A;  4K7N A;  3QCP A;  5DDL A;  3TKP A;  3TKS E;  3KMN A;  2A2S A;  4LMV A;  22GS A;  4CHS A;  3IDV A;  4IBP A;  2TRC P;  2VLU A;  1GLQ A;  2PVO C;  4NHW A;  3ZTL A;  3QD9 A;  1EV9 A;  4WXT A;  2P0G A;  2P5R A;  4X4J A;  1ZYE A;  3ZMK A;  4YQM A;  2DKI A;  2VL9 A;  1V98 A;  3DGQ A;  4GCI A;  3FY7 A;  2GSQ A;  3G7Y A;  5ID2 A;  1G0T A;  1J9B A;  1MD4 A;  2B3S A;  1DSB A;  1GSY A;  3DYR A;  1RK4 A;  2LNS A;  4EF0 A;  5FWG A;  5C04 A;  2FCH A;  5ECH B;  5LNK e;  1QQ2 A;  4V1A p;  2H73 A;  3QAG A;  5HR1 A;  14GS A;  4DVC A;  1SL1 B;  2AB6 A;  4TR1 A;  4WEY A;  3UIW A;  4EIQ A;  5A5K A;  3DXB A;  4K0N A;  4EE0 A;  4CDO A;  4HZ4 A;  2QA2 A;  2HSY A;  4QL7 A;  3HHV A;  2IME A;  4IN0 A;  1A0R P;  2DIZ A;  3HDC A;  2L4C A;  2JSY A;  4GWR A;  3J7Y b;  4RQR A;  1ML6 A;  4BPY A;  3GKN A;  4Q5R A;  3IA1 A;  3NZN A;  4MA9 A;  1AUC A;  2CVD A;  5HR3 A;  1XBS A;  4DEJ A;  1XIY A;  3MSZ A;  4L5L A;  1G6W A;  2YV9 A;  2QC7 A;  2IFQ A;  4HI7 A;  1LJR A;  4YAV A;  2X49 A;  4GSN A;  2GVP A;  2H71 A;  1XOB A;  4HQZ A;  2B7J A;  4NPB A;  4RI6 A;  1XW5 A;  5HR2 A;  4L0W A;  4E8E A;  4BWQ A;  2B7K A;  5J41 A;  2PU9 C;  1XWC A;  3F8U A;  5CRH A;  5IMV A;  1W89 A;  1ABA A;  4WET A;  3FR6 A;  2JZR A;  2X99 A;  5EVO A;  5G31 A;  4EIP A;  5JCU A;  1GSE A;  1T00 A;  4MPG A;  3W8S A;  3P2A A;  3LYK A;  2C0G A;  1T4Z A;  2B1K A;  5D9T A;  3VUR A;  2OBK A;  3H93 A;  4L5O A;  3I9V 2;  4XS4 B;  1TTZ A;  4K5R A;  5ECN B;  3QFA C;  2OJL A;  1FHE A;  3HD5 A;  1HQO A;  3FZ4 A;  4TR0 A;  1KBN A;  3LWA A;  4ML6 A;  4PGT A;  3VPQ A;  4OWY A;  3ED3 A;  3C1R A;  5BRT A;  1ERT A;  3KJY A;  3LJR A;  2CVB A;  2LST A;  2BTO T;  3TJG A;  1TU7 A;  1OE7 A;  5CAX A;  3CSH A;  1O81 A;  4ECJ A;  4KSO A;  2YWI A;  3MIX A;  2F8F A;  2C3T A;  3CSI A;  5ENU A;  3A5I A;  4IKH A;  3R3E A;  1K3Y A;  4IQ1 A;  3MYD A;  3UEM A;  2HYX A;  4YQU A;  4BVY A;  3HVX A;  4K7I A;  3E3E A;  2AJQ B;  2L5O A;  2KHP A;  5HQP A;  3EVI A;  3H8Q A;  2OA7 A;  5H5Q A;  3F4T A;  3WGD A;  4Z7X A;  1SK1 A;  3HYP A;  3QOU A;  1RW1 A;  4N30 A;  1V57 A;  4KDU A;  5ECK B;  4IJI A;  3IXR A;  3W6G A;  5GSS A;  3DML A;  2V1M A;  5JCW A;  3KP8 A;  3US3 A;  3GH6 A;  4AJ6 A;  1VGL A;  1XWK A;  1G6Y A;  1M0U A;  4WR5 A;  4ZIL A;  5J9B A;  2H1A A;  4FYU A;  3FZA A;  3KTB A;  1ZCP A;  5EY6 A;  4BL7 B;  1IYI A;  2CZ3 A;  3L9V A;  5HR0 A;  4ZL8 A;  2PVQ A;  1OYJ A;  4DSS B;  1PN9 A;  3TKS C;  3ERF A;  1JZW A;  3W8J A;  3VLN A;  4XS1 A;  1Z6N A;  1PX7 A;  2O87 A;  1Z3E A;  3LQ7 A;  2HNL A;  1JZR A;  4F9Z A;  2YZH A;  3DWV A;  1YDK A;  4ZB6 A;  1OC9 A;  18GS A;  1J0F A;  4E8H A;  2LKU A;  1V2A A;  3CTF A;  1EGR A;  1SU9 A;  1O6J A;  2GZP A;  4XS6 A;  4EXJ A;  1GNW A;  4X0X A;  4MZC A;  5ABR A;  1XFL A;  1OAZ A;  3A5W A;  5G1K A;  1SL2 B;  1AQV A;  4V2L A;  3R2Q A;  4DSR A;  6GSS A;  2LNT A;  2CA8 A;  2C80 A;  2HRA A;  4NXI A;  4PNF A;  4Z2R A;  4Q5F A;  2CV4 A;  5IPG A;  4I97 A;  5ID2 B;  3I43 A;  3JCM L;  1U88 A;  1MEK A;  3VK9 A;  4HUA A;  2LV3 A;  5F0G A;  2H0G A;  4POK A;  4KDX A;  3D5J A;  3L9U A;  2FWE A;  4H86 A;  3I69 A;  1O8X A;  2L59 A;  2VLT A;  4NWY A;  5CP1 A;  4KF9 A;  4USS A;  2DLX A;  1Z7P A;  4XIH A;  1ZOF A;  3UOM A;  1OVN A;  2LTK A;  1DE1 A;  2AHE A;  2GST A;  1V9W A;  1S3D A;  1GLP A;  1JZD A;  4PTS A;  1A8L A;  2IFQ B;  2HSH A;  3WGX A;  4EVM A;  2LUS A;  8GSS A;  4MH2 A;  3ZRD A;  1MDJ A;  1PL2 A;  4RQX A;  1ST9 A;  1K0D A;  5F07 A;  1TRW A;  3F63 A;  4HJM A;  2DJ2 A;  4NHZ A;  4I8B A;  4FH8 A;  1FB0 A;  4EO3 A;  1A2J A;  4MZW A;  3C1S A;  5D9V A;  5E59 A;  1R7H A;  4O92 A;  1F3B A;  5AGY A;  4OFN A;  2KUC A;  3RDW A;  1Z6M A;  2DML A;  3A2V A;  4KSM A;  3BBY A;  4BWS A;  2MMO A;  2RM5 A;  1O73 A;  2NDO A;  3G7J A;  3P8W A;  5GZZ B;  3C8E A;  3GKX A;  3KTL A;  1MDI A;  2KLX A;  3DEX A;  1TJD A;  4AJ8 A;  2X4A A;  4EDY A;  3LGC A;  3LW9 A;  3QFB C;  2VOC A;  3MAK A;  1QXH A;  3VWU A;  3UBL A;  4F82 A;  2O85 A;  1VF2 A;  2IMF A;  2C3N A;  5IMZ A;  1U6T A;  1XCC A;  4IS0 A;  1TOF A;  4G10 A;  2VD0 A;  2CAQ A;  4I6X A;  4GQC A;  1ZZY A;  2DBC A;  2C4J A;  1OKD A;  2GZY A;  4MK3 A;  3A2W A;  4OFT A;  2IPA A;  3GSS A;  2GQM A;  4YH2 A;  4PUF C;  1ON4 A;  1SK2 A;  3LSZ A;  2JZT A;  4ISD A;  2VM2 A;  1XWB A;  2OE0 A;  2I3Y A;  3GN3 A;  3N9J A;  2B5Y A;  1TK0 B;  4TKY A;  1YEX A;  2YJH A;  4HOJ A;  5G30 A;  1AAZ A;  3C73 A;  4CW9 A;  1QK8 A;  1BQ7 A;  2WZ9 A;  5CO3 A;  1XG8 A;  2H30 A;  1K0A A;  5IMA A;  5BMU A;  1QFN A;  4AF2 A;  2PGT A;  2FHE A;  5H5R A;  3GL5 A;  3ZYW A;  3EYT A;  4O7H A;  6GSU A;  2HE3 A;  2A2R A;  3G7I A;  5A4U A;  4K9Z A;  2L5L A;  4I5Q A;  4K6X A;  4PQH A;  3IE3 A;  1EZK A;  4Z2T A;  5KN1 A;  3GX8 A;  7GSS A;  1O85 A;  3GTU A;  1OE8 A;  2AAW A;  4K7O A;  2GSR A;  3RAZ A;  1LU4 A;  1OC9 B;  1GH2 A;  2R6K A;  3KGK A;  3EMX A;  5B8B A;  2NPB A;  4PXO A;  2C3Q A;  3F4S A;  1T7P B;  3HZ4 A;  1EOH A;  3VI7 A;  2JSZ A;  3EU4 A;  2YZU A;  4G9H A;  3SBC A;  4N11 A;  5CYY A;  5CRW A;  1I5G A;  4JRR A;  1WPI A;  1B48 A;  1PQN A;  1TI1 A;  3EPT A;  4XTS A;  4D73 A;  1SL0 B;  5ECP B;  3GV1 A;  3NOF A;  4GXZ A;  2XPE A;  2OAC A;  4FO5 A;  4J57 E;  3GNJ A;  2P5Q A;  5J4U A;  1XOA A;  3Q19 A;  3Q74 A;  2RII A;  2XHF A;  3GMF A;  2AYT A;  2MBT A;  2VL2 C;  1X9W B;  1H75 A;  1FVK A;  2H1B A;  2JAD A;  2FWF A;  2GTU A;  1G7O A;  2ZCT A;  2WS2 A;  1SJI A;  3DKS A;  4Q5Q A;  1XW9 A;  3GUR A;  3J7Y k;  1DE2 A;  3TOT A;  1JLW A;  5DCG A;  1SD8 A;  5KN0 A;  5KOX A;  2HI7 A;  5IMC A;  1AQX A;  1UC7 A;  3C71 A;  3KEB A;  1FAA A;  1AC1 A;  4OMV A;  4JZQ A;  4BA7 A;  3VPT A;  5IIZ A;  5CRG A;  1TRS A;  1ZL9 A;  5D8I A;  1PKZ A;  1XZO A;  1U3I A;  2BMX A;  2H74 A;  2VAF A;  2LQO A;  5ECM B;  2JL4 A;  3IK9 A;  1M2B A;  1GUH A;  2MZC A;  1USB A;  4ECI A;  3N5O A;  1Y25 A;  2FLS A;  6GSV A;  4J56 E;  20GS A;  4HS1 A;  3WYW A;  2YWN A;  1JFU A;  3BJ5 A;  2K18 A;  5GST A;  2VLV A;  2R0G A;  1RQM A;  5DCH A;  3K8N A;  5INY A;  4IVF A;  3O76 A;  4TOP A;  5D9X A;  1TKD B;  5G5F A;  2ZUP A;  5J5N A;  4EDZ A;  3IR4 A;  3RHB A;  1A24 A;  1NHO A;  4PNG A;  4KH7 A;  4POB A;  3Q18 A;  1ACV A;  1TP9 A;  2H72 A;  2KP2 A;  1BX9 A;  2N5F A;  1UVZ A;  4TXV A;  2UZ8 A;  5DVB A;  2PN8 A;  3RPP A;  5ECR B;  4J2F A;  3KZQ A;  3Q6O A;  4MJE A;  1DBY A;  1DUG A;  4LA1 A;  3TKR A;  1KTE A;  11GS A;  2YV7 A;  3TCO A;  1GSU A;  4ECC A;  3F9U A;  2GGT A;  3HVV A;  2N5A A;  5EL8 A;  2L6D A;  2WB9 A;  2GZZ A;  1PA3 A;  3KH7 A;  4TXO B;  1JHB A;  4O5U A;  4ULX A;  3D4M A;  3F4R A;  4HJ2 A;  3IRA A;  1XW6 A;  3HXS A;  4OO5 A;  2XBI A;  4GSS A;  3D4T A;  2HLS A;  4ICY A;  2VIM A;  2OAD A;  5J3R A;  5ECO B;  5DAL A;  2ES7 A;  4JBB A;  2F3M A;  2DSA A;  3NIV A;  3GHA A;  2VD1 A;  2HRN A;  2ON7 A;  1F3A A;  3HA9 A;  1M99 A;  3TGZ A;  1PL1 A;  3ME8 A;  5IOW A;  4V2N A;  3AY8 A;  1GSF A;  2LQQ A;  2J9H A;  4MF6 A;  4IP1 A;  4KCE A;  1K0C A;  1TRU A;  4K0G A;  2B5E A;  5KN2 A;  1YY7 A;  5JCG A;  1OC3 A;  1X5C A;  5ECI B;  1BG5 A;  2LJA A;  3IHG A;  2WRT A;  2H6X A;  1QMV A;  1Q98 A;  1G7E A;  1OC8 A;  1A2M A;  1EV4 A;  1MTC A;  2FGX A;  2H1D A;  4KND A;  2IL3 A;  4K5S A;  1HD2 A;  4LL4 B;  4ZBD A;  1BED A;  1K3O A;  4G2E A;  2YNX A;  3F3R A;  4JED A;  1O7U A;  1WWJ A;  3EIN A;  2J23 A;  1SYR A;  2V6K A;  2F9S A;  3GX0 A;  1QGV A;  3UAR A;  3GKM A;  2X64 A;  3IK7 A;  6GSW A;  2HXK A;  4PUA A;  12GS A;  4MZB A;  4DSQ A;  1JZO A;  4BIK A;  4L0U A;  4MJA A;  4MCU A;  1U3A A;  1SKR B;  3IOS A;  2H6Z A;  4WBR D;  3FKF A;  5ELA A;  2H1G A;  4MH3 A;  2N5B A;  1HYU A;  3GL3 A;  2D2Z A;  3C7M A;  1X9M B;  4KW6 A;  3TJB A;  3E0U A;  3DIE A;  3VWV A;  1X5D A;  3ZIJ A;  3DD3 A;  2A2P A;  2VCX A;  1AXD A;  1N2A A;  1PMT A;  2H76 A;  2NBS A;  1GRX A;  5J9C A;  3KIJ A;  2WCI A;  2OE1 A;  3L0H A;  4OO4 A;  2VCZ A;  3DVW A;  4MMM A;  3CSJ A;  2DJK A;  5G1L A;  3F6D A;  3CXG A;  4TR1 B;  5IO2 A;  2DJ0 A;  2R3X A;  2K8V A;  2V2G A;  3PH9 A;  10GS A;  2RUE A;  3ZRE A;  4O5R A;  5IMF A; 
#chains in the Genus database with same CATH homology
 4MAB A;  2O89 A;  2MMN A;  3UVH A;  4MDC A;  2VCT A;  4CY6 A;  1KNG A;  3ERG A;  2IMD A;  4O5Q A;  4NAX A;  2B6M A;  2ALB A;  1E2Y A;  1VF1 A;  2YN1 A;  3BCK A;  2F51 A;  1GSQ A;  1YEP A;  1TDI A;  1NHY A;  3HJM A;  1UA5 A;  2GSS A;  2HFD A;  4KCA A;  3WT2 A;  3RHC A;  4POL A;  1XWA A;  2I1U A;  5IQY A;  1ZYQ B;  2H19 A;  4IGJ A;  1R4W A;  2I4A A;  3TKQ A;  2E0Q A;  2VCV A;  3IC8 A;  5E4W A;  3WD6 A;  1HNB A;  3LXZ A;  4KDY A;  4JE1 A;  2DJJ A;  4TRX A;  2RLI A;  1VF4 A;  3H79 A;  5DBQ A;  3BCI A;  5F05 A;  1YF0 A;  3GIX A;  1PGT A;  1GUK A;  3UVT A;  2G0F A;  3L78 A;  2VUP A;  2NTO A;  5IPH A;  1PSQ A;  3GH9 A;  3O6T A;  2HRF A;  5CNW A;  3TJK A;  5IMD A;  1NW2 A;  1N8J A;  4GF0 A;  2GQK A;  1M2D A;  1W4V A;  3FYG A;  4CY8 A;  4YQV A;  5ECL B;  1EGO A;  4ML1 A;  1BAY A;  1AW9 A;  1GP1 A;  1V58 A;  2K8S A;  3LG6 A;  4ZL9 A;  2FA4 A;  4KX4 A;  1THO A;  1J08 A;  1H4O A;  3EWL A;  1B9Y C;  1WE0 A;  2HZE A;  4EL1 A;  3GUS A;  2VO4 A;  3D6I A;  5AIV A;  5AIX A;  4IHU A;  1EWX A;  2Z9S A;  3TUE A;  5C00 A;  2XC2 A;  3IV4 A;  1X0R A;  2R2J A;  3VWW A;  1R5P A;  1EP7 A;  1TRV A;  3PPU A;  4JR4 A;  2QKE A;  2QA1 A;  3OR5 A;  2H8L A;  1EP8 A;  4LLR A;  4BVX A;  1WIK A;  2TIR A;  1WP0 A;  3QPM A;  2R0C A;  4BVY B;  4WR4 A;  2MYG A;  2K6V A;  4G0I A;  3FK8 A;  1GSD A;  4TN8 A;  4EC0 A;  4KUN A;  3EUR A;  3ZLP A;  2DIY A;  1ZMA A;  4F2I A;  2C8U A;  2KOK A;  1YQ1 A;  1CQG A;  1ERW A;  4DSS A;  5DAL B;  3M9K A;  2PER A;  4X1U A;  6GSY A;  3FRC A;  4PQI A;  3CYN A;  2AUV A;  1SD9 A;  4NV2 A;  4F0C A;  4ACS A;  2I9H A;  1YKC A;  6GSX A;  2E2M A;  3A2X A;  1QUW A;  2IN3 A;  2V32 A;  2REM A;  1F37 A;  4PUR A;  3KD0 A;  17GS A;  3M3M A;  2QGV A;  1M9A A;  2VM1 A;  1Z7R A;  2LRT A;  3TOU A;  2RM6 A;  1FOH A;  4NV5 A;  3IAM 2;  4MJC A;  4XRA A;  2YAN A;  2NVL A;  5G5E A;  4ZB9 A;  3RPN A;  1XXU A;  13GS A;  5B6N A;  3SWL A;  1YKA A;  1SYX A;  4V1A g;  3MDK A;  3D21 A;  1MDK A;  1ZYN A;  2FA8 A;  4L8E A;  4PQ1 A;  2LJK A;  2M46 A;  5F8B A;  4IJ3 A;  4HU9 A;  4LMW A;  1T1V A;  5COH A;  5AIS A;  2ZNM A;  2E2G A;  3G9B A;  3KCM A;  3PGT A;  3M8N A;  1XWG A;  3VI5 A;  2FY6 A;  5ECS A;  1T3B A;  4GLT A;  5JWO B;  1B8X A;  5KEJ A;  5ELG A;  4EKZ A;  3KH9 A;  3EMP A;  3ZIT A;  2DKH A;  1WRY A;  1U87 A;  1ZGN A;  2H01 A;  3A3T A;  3BOA A;  3APQ A;  3ZZX A;  3M9J A;  3QDN A;  2R4V A;  3MNG A;  5DJL A;  3TJF A;  2WUL A;  3FW2 A;  4TR4 A;  1FB6 A;  3ZVJ D;  3ZIV A;  3PR8 A;  1K0N A;  2WJU A;  4HDE A;  3M0F A;  3FZ5 A;  2VL3 A;  1O8W A;  1A0F A;  4ZL7 A;  4HQS A;  4IQA A;  4XRD A;  3GA4 A;  2CT6 A;  5FT3 A;  4A5P A;  4XCS A;  2DJ3 A;  4G0K A;  4K1F A;  2C0D A;  1SK0 A;  4NMU A;  4MNN A;  3P90 A;  3ZFB A;  3HJP A;  3CRT A;  1XVQ A;  3F3Q A;  1R26 A;  2JZS A;  2PPT A;  2YWM A;  2DC5 A;  4I2T A;  2CAI A;  2LRN A;  3HJO A;  3D0Z A;  1YF1 A;  1A2L A;  2M80 A;  5DAK A;  5KN3 A;  2OBI A;  1GUL A;  1YJ6 A;  3HZ8 A;  1HNC A;  4YKF A;  3F6F A;  2H70 A;  3APO A;  1MD3 A;  3QAV A;  1YZX A;  1V40 A;  2I81 A;  4ZXG A;  3MWH A;  3FZ9 A;  2F8A A;  2M72 A;  1B9X C;  3DVX A;  5EPF A;  3TKS A;  4IW9 A;  2H0H A;  1M2A A;  4G19 A;  3FMW A;  4GST A;  1SEN A;  1NM3 A;  3ZML A;  3M1G A;  5A4W A;  2O8V B;  3ZFL A;  4HU7 A;  5CRD A;  1WMJ A;  5G2Z A;  2HSM A;  5B7C A;  2PUK C;  2JU5 A;  5IOX A;  2VCW A;  1KEB A;  4OD7 A;  4N10 A;  3CTG A;  1M7T A;  5IO0 A;  3BD2 A;  4ZBB A;  2HZE B;  9GSS A;  4OCE A;  2PBJ A;  3KMO A;  3D22 A;  3GKK A;  4RI7 A;  1K3L A;  2JAC A;  4ZBA A;  2WFC A;  1FVJ A;  1IYH A;  2DMM A;  4KGI A;  2WDU A;  3EE2 A;  1GTI A;  1E6B A;  3L9S A;  16GS A;  4MP4 A;  4BVX B;  1R5A A;  1X9S B;  1GL8 A;  5HFI A;  4IEL A;  1F2E A;  1X5E A;  5KOW A;  1FW1 A;  2CQ9 A;  5HFK A;  4FQU A;  2HZF A;  3FHK A;  4MJB A;  1GTB A;  3KP9 A;  2R0P A;  4F0B A;  4KAE A;  5DQS A;  2GLR A;  1EEM A;  2YOI A;  4TVE A;  3ERW A;  4POM A;  1SJZ A;  3LYP A;  2BJX A;  1XVW A;  1SKS B;  5H5S A;  2GT6 A;  5JWQ B;  2XBQ A;  2A4V A;  1THX A;  2HRK A;  1GTU A;  2IIY A;  2R5G A;  4MPF A;  4OCF A;  5DQY A;  2C0F A;  2B5X A;  3L4N A;  3IC4 A;  1GSS A;  5LCZ A;  1GTA A;  3H4K A;  2QSI A;  5L71 A;  2OKA A;  3KXO A;  3F0I A;  3GYK A;  3GRX A;  6GST A;  1B4Q A;  3LEF A;  2A4H A;  2K9F A;  2X8C A;  1PD2 1;  4N0Z A;  2FUG 2;  3QR6 A;  2CX3 A;  2V41 A;  4K2X A;  3UBK A;  1PKW A;  1WOU A;  5D73 A;  3EC3 A;  4WF5 A;  4QL9 A;  2H0I A;  1K0B A;  2MMZ A;  1K0M A;  2LJR A;  2IJY A;  5AN1 A;  1Z5Y E;  2KP1 A;  3IHQ A;  4FYB A;  3UAP A;  4FYC A;  2FWG A;  2PMT A;  1EEJ A;  1JLV A;  3GTU B;  5FHI A;  4KE3 A;  5F06 A;  2CZ2 A;  4AJ7 A;  4TR3 A;  4V2M A;  1SJ6 A;  2YJ7 A;  4GTU A;  4MF7 A;  5GAP D;  2CVK A;  2IMI A;  2FD3 A;  4ZB8 A;  1UN2 A;  1TK8 B;  1TK5 B;  4AGS A;  3IBH A;  4FIW A;  1XPV A;  3LXT A;  1TW9 A;  1AIU A;  4Z2U A;  4JU5 A;  4D73 B;  4ZIJ A;  1F9M A;  3TDG A;  3CRU A;  5GAN D;  2X8H A;  1FO5 A;  4N0V A;  2DJ1 A;  4XHM A;  4PX1 A;  4ID0 A;  4KB3 A;  2IMK A;  1VF3 A;  5D9W A;  1LBK A;  2RUF A;  3TJJ A;  5B6M A;  3CBU A;  2H75 A;  3APS A;  3E9J B;  3HVS A;  1GNE A;  2IWT A;  1BJX A;  4HEA 2;  2B1L A;  2L6C A;  5D96 A;  5JWR B;  4RUV A;  2YP6 A;  2LS5 A;  2EIO A;  3VFI A;  4YKG A;  5A4V A;  1TU8 A;  3U6V A;  1A23 A;  1PX6 A;  1TXX A;  3V1W A;  4WF4 A;  2WGR A;  3KM6 A;  2AV4 A;  4K2D A;  1Q4J A;  2G2Q A;  4XS4 A;  3UL3 A;  4OFM A;  1S3C A;  1A8Y A;  4YAP A;  3QAW A;  1PRX A;  3TRX A;  2OE3 A;  2V6O A;  3LOR A;  3TRP A;  3LFL A;  5ECQ B;  2H6Y A;  2YWO A;  2X8G A;  3I6A A;  5IM9 A;  1ILO A;  2GT5 A;  2PWJ A;  1F6M C;  4ILF A;  3O3T A;  2O7K A;  2ON5 A;  5DAK B;  2HT9 A;  2L57 A;  4JR6 A;  1C72 A;  1OKT A;  1ERU A;  4GRF A;  1FG4 A;  5HFG A;  4EUY A;  4KA0 A;  3ZL5 A;  2E7P A;  4P3Y B;  4O32 A;  4QQ7 A;  2LEG A;  2C1Y A;  2TRX A;  3UJ1 A;  2YPM A;  1TI3 A;  5CRE A;  4Q5N A;  1FOV A;  2EIR A;  3FR9 A;  1SKW B;  2L4Q A;  2MMA A;  3IAS 2;  4TXO A;  3FEU A;  2GS3 A;  1M9B A;  1HNA A;  2GDR A;  3GFK A;  4I2U A;  4F03 A;  1T4Y A;  1AQW A;  4TW5 A;  3PIN A;  1PN0 A;  2LRC A;  3U5R E;  3DRN A;  3TB2 A;  4WBJ A;  3ME7 A;  2P31 A;  4HZ2 A;  4MF5 A;  1VRS D;  3S9F A;  1WJK A;  19GS A;  3VWX A;  3IPZ A;  1Y6E A;  5DJM A;  4X43 A;  3GST A;  4WKW A;  4G0L A;  1ERV A;  1EOG A;  2EIQ A;  1I9D A;  3WT1 A;  4BL7 A;  1CQH A;  1T8E B;  3CMI A;  2R37 A;  5D93 A;  3WGE A;  1URM A;  4IP6 A;  4ECB A;  4MLY A;  3TRQ A;  4K8M A;  1BYE A;  2YCD A;  2XPD A;  3P7X A;  5B8A A;  1ZYP A;  3FR3 A;  1K0O A;  3HCZ A;  1GUM A;  1S3A A;  2H66 A;  2VL2 A;  2C0E A;  3ISO A;  1NSW A;  1B4P A;  3UMA A;  2VCQ A;  4GQF A;  1GWC A;  3QMX A;  3RBT A;  2MBS A;  3EU3 A;  4LL1 B;  2FNO A;  2CX4 A;  2FWH A;  5LD0 A;  3ZVJ A;  3HKR A;  2EC4 A;  3HY2 A;  3H1N A;  1Z9H A;  2GQL A;  4K7N A;  3QCP A;  5DDL A;  3TKP A;  3TKS E;  3KMN A;  2A2S A;  4LMV A;  22GS A;  4CHS A;  3IDV A;  4IBP A;  2TRC P;  2VLU A;  1GLQ A;  2PVO C;  4NHW A;  3ZTL A;  3QD9 A;  1EV9 A;  4WXT A;  2P0G A;  2P5R A;  4X4J A;  1ZYE A;  3ZMK A;  4YQM A;  2DKI A;  2VL9 A;  1V98 A;  3DGQ A;  4GCI A;  3FY7 A;  2GSQ A;  3G7Y A;  5ID2 A;  1G0T A;  1J9B A;  1MD4 A;  2B3S A;  1DSB A;  1GSY A;  3DYR A;  1RK4 A;  2LNS A;  4EF0 A;  5FWG A;  5C04 A;  2FCH A;  5ECH B;  5LNK e;  1QQ2 A;  4V1A p;  2H73 A;  3QAG A;  5HR1 A;  14GS A;  4DVC A;  1SL1 B;  2AB6 A;  4TR1 A;  4WEY A;  3UIW A;  4EIQ A;  5A5K A;  3DXB A;  4K0N A;  4EE0 A;  4CDO A;  4HZ4 A;  2QA2 A;  2HSY A;  4QL7 A;  3HHV A;  2IME A;  4IN0 A;  1A0R P;  2DIZ A;  3HDC A;  2L4C A;  2JSY A;  4GWR A;  3J7Y b;  4RQR A;  1ML6 A;  4BPY A;  3GKN A;  4Q5R A;  3IA1 A;  3NZN A;  4MA9 A;  1AUC A;  2CVD A;  5HR3 A;  1XBS A;  4DEJ A;  1XIY A;  3MSZ A;  4L5L A;  1G6W A;  2YV9 A;  2QC7 A;  2IFQ A;  4HI7 A;  1LJR A;  4YAV A;  2X49 A;  4GSN A;  2GVP A;  2H71 A;  1XOB A;  4HQZ A;  2B7J A;  4NPB A;  4RI6 A;  1XW5 A;  5HR2 A;  4L0W A;  4E8E A;  4BWQ A;  2B7K A;  5J41 A;  2PU9 C;  1XWC A;  3F8U A;  5CRH A;  5IMV A;  1W89 A;  1ABA A;  4WET A;  3FR6 A;  2JZR A;  2X99 A;  5EVO A;  5G31 A;  4EIP A;  5JCU A;  1GSE A;  1T00 A;  4MPG A;  3W8S A;  3P2A A;  3LYK A;  2C0G A;  1T4Z A;  2B1K A;  5D9T A;  3VUR A;  2OBK A;  3H93 A;  4L5O A;  3I9V 2;  4XS4 B;  1TTZ A;  4K5R A;  5ECN B;  3QFA C;  2OJL A;  1FHE A;  3HD5 A;  1HQO A;  3FZ4 A;  4TR0 A;  1KBN A;  3LWA A;  4ML6 A;  4PGT A;  3VPQ A;  4OWY A;  3ED3 A;  3C1R A;  5BRT A;  1ERT A;  3KJY A;  3LJR A;  2CVB A;  2LST A;  2BTO T;  3TJG A;  1TU7 A;  1OE7 A;  5CAX A;  3CSH A;  1O81 A;  4ECJ A;  4KSO A;  2YWI A;  3MIX A;  2F8F A;  2C3T A;  3CSI A;  5ENU A;  3A5I A;  4IKH A;  3R3E A;  1K3Y A;  4IQ1 A;  3MYD A;  3UEM A;  2HYX A;  4YQU A;  4BVY A;  3HVX A;  4K7I A;  3E3E A;  2AJQ B;  2L5O A;  2KHP A;  5HQP A;  3EVI A;  3H8Q A;  2OA7 A;  5H5Q A;  3F4T A;  3WGD A;  4Z7X A;  1SK1 A;  3HYP A;  3QOU A;  1RW1 A;  4N30 A;  1V57 A;  4KDU A;  5ECK B;  4IJI A;  3IXR A;  3W6G A;  5GSS A;  3DML A;  2V1M A;  5JCW A;  3KP8 A;  3US3 A;  3GH6 A;  4AJ6 A;  1VGL A;  1XWK A;  1G6Y A;  1M0U A;  4WR5 A;  4ZIL A;  5J9B A;  2H1A A;  4FYU A;  3FZA A;  3KTB A;  1ZCP A;  5EY6 A;  4BL7 B;  1IYI A;  2CZ3 A;  3L9V A;  5HR0 A;  4ZL8 A;  2PVQ A;  1OYJ A;  4DSS B;  1PN9 A;  3TKS C;  3ERF A;  1JZW A;  3W8J A;  3VLN A;  4XS1 A;  1Z6N A;  1PX7 A;  2O87 A;  1Z3E A;  3LQ7 A;  2HNL A;  1JZR A;  4F9Z A;  2YZH A;  3DWV A;  1YDK A;  4ZB6 A;  1OC9 A;  18GS A;  1J0F A;  4E8H A;  2LKU A;  1V2A A;  3CTF A;  1EGR A;  1SU9 A;  1O6J A;  2GZP A;  4XS6 A;  4EXJ A;  1GNW A;  4X0X A;  4MZC A;  5ABR A;  1XFL A;  1OAZ A;  3A5W A;  5G1K A;  1SL2 B;  1AQV A;  4V2L A;  3R2Q A;  4DSR A;  6GSS A;  2LNT A;  2CA8 A;  2C80 A;  2HRA A;  4NXI A;  4PNF A;  4Z2R A;  4Q5F A;  2CV4 A;  5IPG A;  4I97 A;  5ID2 B;  3I43 A;  3JCM L;  1U88 A;  1MEK A;  3VK9 A;  4HUA A;  2LV3 A;  5F0G A;  2H0G A;  4POK A;  4KDX A;  3D5J A;  3L9U A;  2FWE A;  4H86 A;  3I69 A;  1O8X A;  2L59 A;  2VLT A;  4NWY A;  5CP1 A;  4KF9 A;  4USS A;  2DLX A;  1Z7P A;  4XIH A;  1ZOF A;  3UOM A;  1OVN A;  2LTK A;  1DE1 A;  2AHE A;  2GST A;  1V9W A;  1S3D A;  1GLP A;  1JZD A;  4PTS A;  1A8L A;  2IFQ B;  2HSH A;  3WGX A;  4EVM A;  2LUS A;  8GSS A;  4MH2 A;  3ZRD A;  1MDJ A;  1PL2 A;  4RQX A;  1ST9 A;  1K0D A;  5F07 A;  1TRW A;  3F63 A;  4HJM A;  2DJ2 A;  4NHZ A;  4I8B A;  4FH8 A;  1FB0 A;  4EO3 A;  1A2J A;  4MZW A;  3C1S A;  5D9V A;  5E59 A;  1R7H A;  4O92 A;  1F3B A;  5AGY A;  4OFN A;  2KUC A;  3RDW A;  1Z6M A;  2DML A;  3A2V A;  4KSM A;  3BBY A;  4BWS A;  2MMO A;  2RM5 A;  1O73 A;  2NDO A;  3G7J A;  3P8W A;  5GZZ B;  3C8E A;  3GKX A;  3KTL A;  1MDI A;  2KLX A;  3DEX A;  1TJD A;  4AJ8 A;  2X4A A;  4EDY A;  3LGC A;  3LW9 A;  3QFB C;  2VOC A;  3MAK A;  1QXH A;  3VWU A;  3UBL A;  4F82 A;  2O85 A;  1VF2 A;  2IMF A;  2C3N A;  5IMZ A;  1U6T A;  1XCC A;  4IS0 A;  1TOF A;  4G10 A;  2VD0 A;  2CAQ A;  4I6X A;  4GQC A;  1ZZY A;  2DBC A;  2C4J A;  1OKD A;  2GZY A;  4MK3 A;  3A2W A;  4OFT A;  2IPA A;  3GSS A;  2GQM A;  4YH2 A;  4PUF C;  1ON4 A;  1SK2 A;  3LSZ A;  2JZT A;  4ISD A;  2VM2 A;  1XWB A;  2OE0 A;  2I3Y A;  3GN3 A;  3N9J A;  2B5Y A;  1TK0 B;  4TKY A;  1YEX A;  2YJH A;  4HOJ A;  5G30 A;  1AAZ A;  3C73 A;  4CW9 A;  1QK8 A;  1BQ7 A;  2WZ9 A;  5CO3 A;  2H30 A;  1K0A A;  5IMA A;  5BMU A;  1QFN A;  4AF2 A;  2PGT A;  2FHE A;  5H5R A;  3GL5 A;  3ZYW A;  3EYT A;  4O7H A;  6GSU A;  2HE3 A;  2A2R A;  3G7I A;  5A4U A;  4K9Z A;  2L5L A;  4I5Q A;  4K6X A;  4PQH A;  3IE3 A;  1EZK A;  4Z2T A;  5KN1 A;  3GX8 A;  7GSS A;  1O85 A;  3GTU A;  1OE8 A;  2AAW A;  4K7O A;  2GSR A;  3RAZ A;  1LU4 A;  1OC9 B;  1GH2 A;  2R6K A;  3KGK A;  3EMX A;  5B8B A;  2NPB A;  4PXO A;  2C3Q A;  3F4S A;  1T7P B;  3HZ4 A;  1EOH A;  3VI7 A;  2JSZ A;  3EU4 A;  2YZU A;  4G9H A;  3SBC A;  4N11 A;  5CYY A;  5CRW A;  1I5G A;  4JRR A;  1WPI A;  1B48 A;  1PQN A;  1TI1 A;  3EPT A;  4XTS A;  4D73 A;  1SL0 B;  5ECP B;  3GV1 A;  3NOF A;  4GXZ A;  2XPE A;  2OAC A;  4FO5 A;  4J57 E;  3GNJ A;  2P5Q A;  5J4U A;  1XOA A;  3Q19 A;  3Q74 A;  2RII A;  2XHF A;  3GMF A;  2AYT A;  2MBT A;  2VL2 C;  1X9W B;  1H75 A;  1FVK A;  2H1B A;  2JAD A;  2FWF A;  2GTU A;  1G7O A;  2ZCT A;  2WS2 A;  1SJI A;  3DKS A;  4Q5Q A;  1XW9 A;  3GUR A;  3J7Y k;  1DE2 A;  3TOT A;  1JLW A;  5DCG A;  1SD8 A;  5KN0 A;  5KOX A;  2HI7 A;  5IMC A;  1AQX A;  1UC7 A;  3C71 A;  3KEB A;  1FAA A;  1AC1 A;  4OMV A;  4JZQ A;  4BA7 A;  3VPT A;  5IIZ A;  5CRG A;  1TRS A;  1ZL9 A;  5D8I A;  1PKZ A;  1XZO A;  1U3I A;  2BMX A;  2H74 A;  2VAF A;  2LQO A;  5ECM B;  2JL4 A;  3IK9 A;  1M2B A;  1GUH A;  2MZC A;  1USB A;  4ECI A;  3N5O A;  1Y25 A;  2FLS A;  6GSV A;  4J56 E;  20GS A;  4HS1 A;  3WYW A;  2YWN A;  1JFU A;  3BJ5 A;  2K18 A;  5GST A;  2VLV A;  2R0G A;  1RQM A;  5DCH A;  3K8N A;  5INY A;  4IVF A;  3O76 A;  4TOP A;  5D9X A;  1TKD B;  5G5F A;  2ZUP A;  5J5N A;  4EDZ A;  3IR4 A;  3RHB A;  1A24 A;  1NHO A;  4PNG A;  4KH7 A;  4POB A;  3Q18 A;  1ACV A;  1TP9 A;  2H72 A;  2KP2 A;  1BX9 A;  2N5F A;  1UVZ A;  4TXV A;  2UZ8 A;  5DVB A;  2PN8 A;  3RPP A;  5ECR B;  4J2F A;  3KZQ A;  3Q6O A;  4MJE A;  1DBY A;  1DUG A;  4LA1 A;  3TKR A;  1KTE A;  11GS A;  2YV7 A;  3TCO A;  1GSU A;  4ECC A;  3F9U A;  2GGT A;  3HVV A;  2N5A A;  5EL8 A;  2L6D A;  2WB9 A;  2GZZ A;  1PA3 A;  3KH7 A;  4TXO B;  1JHB A;  4O5U A;  4ULX A;  3D4M A;  3F4R A;  4HJ2 A;  3IRA A;  1XW6 A;  3HXS A;  4OO5 A;  2XBI A;  4GSS A;  3D4T A;  2HLS A;  4ICY A;  2VIM A;  2OAD A;  5J3R A;  5ECO B;  5DAL A;  2ES7 A;  4JBB A;  2F3M A;  2DSA A;  3NIV A;  3GHA A;  2VD1 A;  2HRN A;  2ON7 A;  1F3A A;  3HA9 A;  1M99 A;  3TGZ A;  1PL1 A;  3ME8 A;  5IOW A;  4V2N A;  3AY8 A;  1GSF A;  2LQQ A;  2J9H A;  4MF6 A;  4IP1 A;  4KCE A;  1K0C A;  1TRU A;  4K0G A;  2B5E A;  5KN2 A;  1YY7 A;  5JCG A;  1OC3 A;  1X5C A;  5ECI B;  1BG5 A;  2LJA A;  3IHG A;  2WRT A;  2H6X A;  1QMV A;  1Q98 A;  1G7E A;  1OC8 A;  1A2M A;  1EV4 A;  1MTC A;  2FGX A;  2H1D A;  4KND A;  2IL3 A;  4K5S A;  1HD2 A;  4LL4 B;  4ZBD A;  1BED A;  1K3O A;  4G2E A;  2YNX A;  3F3R A;  4JED A;  1O7U A;  1WWJ A;  3EIN A;  2J23 A;  1SYR A;  2V6K A;  2F9S A;  3GX0 A;  1QGV A;  3UAR A;  3GKM A;  2X64 A;  3IK7 A;  6GSW A;  2HXK A;  4PUA A;  12GS A;  4MZB A;  4DSQ A;  1JZO A;  4L0U A;  4MJA A;  4MCU A;  1U3A A;  1SKR B;  3IOS A;  2H6Z A;  4WBR D;  3FKF A;  5ELA A;  2H1G A;  4MH3 A;  2N5B A;  1HYU A;  3GL3 A;  2D2Z A;  3C7M A;  1X9M B;  4KW6 A;  3TJB A;  3E0U A;  3DIE A;  3VWV A;  1X5D A;  3ZIJ A;  3DD3 A;  2A2P A;  2VCX A;  1AXD A;  1N2A A;  1PMT A;  2H76 A;  2NBS A;  1GRX A;  5J9C A;  3KIJ A;  2WCI A;  2OE1 A;  3L0H A;  4OO4 A;  2VCZ A;  3DVW A;  4MMM A;  3CSJ A;  2DJK A;  5G1L A;  3F6D A;  3CXG A;  4TR1 B;  5IO2 A;  2DJ0 A;  2R3X A;  2K8V A;  2V2G A;  3PH9 A;  10GS A;  2RUE A;  3ZRE A;  4O5R A;  5IMF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...