3PINA

Crystal structure of mxr1 from saccharomyces cerevisiae in complex with trx2
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
104
structure length
104
Chain Sequence
MVTQLKSASEYDSALASGDKLVVVDFFATWCGPSKMIAPMIEKFAEQYSDAAFYKLDVDEVSDVAQKAEVSSMPTLIFYKGGKEVTRVVGANPAAIKQAIASNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thioredoxin-2
publication title Structural plasticity of the thioredoxin recognition site of yeast methionine S-sulfoxide reductase Mxr1
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Electron transport/oxidoreductase
total genus 33
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2010-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3pinA00
1X0RA 4Q5NA 1U6TA 1U88A 2F51A 1GSYA 4ZBBA 2R4VA 2TRXA 3DXBA 18GSA 1FOVA 3TKQA 2QKEA 3FZ4A 3PR8A 4MZWA 5IO0A 4FIWA 5JWOB 4OFNA 4D73A 1GUKA 5J9BA 4AJ6A 3HZ8A 4X43A 4NPBA 1O85A 4KE3A 2VL9A 3ERGA 1V57A 1V40A 2V6KA 4IGJA 3CMIA 4G2EA 3VWWA 2FA8A 4OO4A 2GVPA 1O7UA 3IRAA 1THXA 5IMZA 1ERWA 3E0UA 4EUYA 2WB9A 1ST9A 6GSSA 3KMOA 2R5GA 2TIRA 1O8WA 3APOA 4MLYA 4V2LA 3CSJA 2DMLA 2P5RA 2C1YA 1Q4JA 1S3DA 2KUCA 2VCVA 1PX6A 1EOHA 3US3A 4HQZA 4WKWA 1DSBA 4ZL8A 1PSQA 2FWFA 1F9MA 3VWUA 3PH9A 2K8SA 4LA1A 1XCCA 5ECOB 2E2GA 4TR3A 4ILFA 4MJBA 4IELA 4BVXA 1DE2A 3ME8A 3TGZA 1ZMAA 2YOIA 3M8NA 6GSTA 1MDIA 1GSUA 3HJPA 1T4ZA 3IA1A 1T7PB 4KW6A 1PN9A 3Q19A 3RBTA 2JSZA 3E3EA 4Q5QA 4XS4B 4YQUA 4ECBA 1QFNA 4WBJA 1MDJA 2L57A 4KGIA 5D9XA 3LXZA 4HJ2A 4KB3A 1K3LA 5DALA 5A4WA 4N11A 2MYGA 1TRVA 1EP7A 4EVMA 1O8XA 3K8NA 4HQSA 1J08A 1JZOA 4TRXA 5ID2B 2DSAA 1EGOA 3QAGA 5IMVA 1XOAA 2VM2A 5HR2A 4K9ZA 2IL3A 1C72A 3QCPA 4XRAA 4IW9A 2R2JA 3KXOA 1G6YA 1V98A 3M1GA 1XWGA 1OE8A 3ZYWA 3ZZXA 3IAS2 1Z7RA 3TOTA 4GCIA 2PVQA 3FKFA 2GQLA 3QFAC 1IYHA 3TRPA 3M3MA 3GNJA 5IOXA 1G6WA 2I9HA 4EL1A 5B6NA 2O8VB 2C3TA 3UARA 2VOCA 3GHAA 4Z7XA 3TKSA 4YQMA 5G2ZA 2IWTA 1O73A 2YANA 2V32A 1TK0B 1KNGA 2I81A 3F6FA 2JZSA 2L4QA 1XW9A 3TJFA 4POBA 2LQOA 4KSMA 3H4KA 4P3YB 1YY7A 2L6DA 1U3IA 2WS2A 5ELAA 1ZGNA 1GSDA 2FGXA 3A2VA 1Z5YE 3KH9A 4J2FA 1M7TA 1T1VA 3MAKA 1BX9A 2C3QA 5DCGA 4L0UA 2C4JA 3L9VA 3QAVA 4EO3A 2E2MA 2N5FA 2NDOA 5EY6A 2VCWA 3C73A 4DEJA 3GURA 2V2GA 2X8GA 2B1KA 4MK3A 2YZHA 1CQGA 3IAM2 4KDYA 1URMA 1WP0A 3Q74A 4K0NA 2YWNA 3DWVA 4NV5A 3H8QA 3GKXA 5HR3A 4GQCA 1U3AA 2A2RA 4V2NA 1AAZA 2I4AA 4PX1A 3NIVA 2YJHA 3KP8A 1NW2A 3QR6A 3Q6OA 10GSA 2H1DA 5D96A 2MMZA 2AUVA 3F9UA 5CRWA 2B5YA 5G5FA 1EGRA 4JR4A 5FHIA 2DC5A 4DSSA 2GLRA 2YV9A 3FHKA 5DBQA 1QUWA 2GQKA 2H30A 3F4TA 2GTUA 5COHA 1PGTA 2VL2C 1Z9HA 1RK4A 5EPFA 4N0ZA 4Q5FA 2O89A 3F4RA 1Z6NA 3FEUA 3KH7A 4OD7A 1QMVA 5KN0A 1HQOA 1VF1A 4I97A 2PUKC 2ON7A 3GKNA 2I1UA 5IPHA 2LJKA 3DVWA 4O32A 1M9AA 2L6CA 1AQVA 3EC3A 2NVLA 2VCQA 3C7MA 4JRRA 1SKRB 2PWJA 5GSTA 2L4CA 2PMTA 2EIQA 3C1SA 3DGQA 1W4VA 4L5LA 2PPTA 4HZ4A 3U5RE 3TKRA 2H8LA 2GGTA 5ECRB 4KAEA 1LBKA 2FCHA 2H1AA 3Q18A 3D4TA 5ENUA 1OYJA 5HR1A 1EP8A 1B4QA 3EWLA 2FD3A 4F82A 4ISDA 4HS1A 5ECLB 1M0UA 1GUHA 1R5AA 2OKAA 1YZXA 4D73B 1UC7A 2K18A 5F05A 5A4VA 2HNLA 4J57E 3GA4A 1F6MC 3N5OA 3BCIA 1WIKA 3A2XA 2VCZA 4KA0A 4IQ1A 3EMXA 2LRTA 3C8EA 3TRXA 2QSIA 3TKPA 3M9KA 2FA4A 1EV9A 3GV1A 2H01A 1OC8A 2JU5A 3ISOA 4HU7A 3D5JA 1WJKA 3QDNA 4BA7A 1O6JA 5H5RA 1EZKA 3P90A 3MDKA 4E8HA 4NHZA 1ZYEA 1DUGA 3BJ5A 2J9HA 2EIRA 5D9TA 4PQ1A 3D4MA 4L8EA 1OC3A 2GQMA 3BD2A 3GL3A 5G30A 3ZVJA 5J5NA 1IYIA 4ID0A 2HSHA 4G10A 3PINA 1SKWB 3UIWA 4LMWA 4WR4A 4GLTA 2ZNMA 1JHBA 1H4OA 3D22A 2GSRA 3L9SA 3EINA 1VRSD 1F2EA 1TK8B 2VO4A 4TXOA 4MF7A 2WDUA 2ON5A 3TJJA 1GLPA 3UVHA 3LGCA 1SK1A 2GT5A 2R37A 2RM5A 3FY7A 4MCUA 4JEDA 2YWOA 4GWRA 5DALB 2A4VA 1X9SB 2DJ0A 5HQPA 3HHVA 1ILOA 3P2AA 4V2MA 3TB2A 1YJ6A 3HY2A 1R4WA 1LJRA 4KX4A 1GSSA 2OE3A 3IK7A 4F0BA 5EVOA 2LNTA 2GZPA 1Z3EA 1FVJA 2H75A 2C8UA 2B1LA 1YDKA 1A0FA 2IMIA 5ABRA 2YWMA 5DAKA 5DVBA 4K1FA 4L5OA 4TN8A 2DIYA 2GT6A 1PKZA 3F4SA 3I43A 1VGLA 4YAPA 3LFLA 3WT2A 3TRQA 1EWXA 3CBUA 3TCOA 1ML6A 3J7Yb 4N30A 4OMVA 5KEJA 3TKSC 3ERFA 2H72A 2HSYA 1YF0A 3IHQA 1A24A 4BPYA 2N5BA 4KCAA 3GRXA 1W89A 2L59A 4GF0A 2F3MA 1HNBA 3VLNA 4IQAA 3C1RA 3GKKA 3WGEA 1SD8A 4GRFA 4GQFA 2TRCP 1A2LA 2FUG2 3HVXA 2JZRA 1B48A 1X9WB 4MF5A 3GIXA 3I6AA 1YKCA 4HDEA 4ZBDA 4E8EA 1JZDA 2WRTA 4MH3A 3HXSA 3ME7A 1T3BA 3RPNA 2CAQA 2ZUPA 2B5EA 2XPDA 4I6XA 3FK8A 5GAPD 3HVVA 4N10A 3EE2A 4ZIJA 5G5EA 3ED3A 4KNDA 4MZCA 1I9DA 2OA7A 1T4YA 4X0XA 3LYPA 2LS5A 4XCSA 5IMCA 3D6IA 3DKSA 4MH2A 1X5CA 5D93A 5IPGA 1BQ7A 2DJ1A 1ABAA 3LORA 2IIYA 1R26A 3G7IA 4POLA 3ZITA 7GSSA 3O76A 3QPMA 2H6ZA 5G31A 2BJXA 1B4PA 4CHSA 2YN1A 2HRNA 3RDWA 2FNOA 2QGVA 2H0IA 4WF5A 3KM6A 4DSSB 5GAND 3EMPA 3APSA 2CZ2A 3IPZA 3QD9A 1XBSA 3GX0A 2X64A 1MEKA 3TJGA 3JCML 1TU7A 3MSZA 4IN0A 4AGSA 4PNGA 2PERA 2AHEA 2P5QA 2HYXA 4LL1B 2D2ZA 17GSA 3ZRDA 2OE0A 1TK5B 1AQWA 3TJBA 3MWHA 4TR1A 5C04A 1RW1A 2PU9C 4PURA 1PRXA 4AJ7A 1WPIA 4BWQA 2ES7A 2RUEA 2VCTA 5LD0A 4XRDA 5KN2A 3IXRA 5CREA 1JZWA 2NBSA 2HI7A 1XOBA 1Y25A 1E6BA 1GTIA 4MZBA 2NTOA 2YWIA 4IBPA 3A5WA 1GNWA 2IMKA 2LRCA 5ECHB 3GTUA 3HKRA 2VAFA 4ML1A 4XIHA 1K0MA 4OFTA 2GDRA 4RUVA 4EF0A 2MBSA 2HFDA 4GTUA 2F8AA 4ZB8A 2OBKA 3KIJA 1BEDA 1FB0A 5CYYA 1FHEA 5CRHA 2L5LA 5AGYA 3FR6A 4MPGA 3RPPA 2X99A 4WETA 5CRGA 5C00A 5IIZA 1HD2A 2NPBA 2MMNA 3UEMA 3RHCA 2K8VA 3DIEA 1Z7PA 3FYGA 3KZQA 1GUMA 3TDGA 1SYRA 2C0FA 4ECJA 4ULXA 1GRXA 3VPTA 2M72A 4YQVA 1EV4A 4I8BA 1BJXA 3KJYA 1H75A 3ZIJA 4MJEA 1QXHA 2HLSA 2OBIA 1ZZYA 4DVCA 1SD9A 3DVXA 3M9JA 1SENA 1AUCA 3W8JA 1XVQA 1WWJA 4NWYA 2PN8A 1AQXA 5DJLA 4PQHA 4YH2A 3DMLA 1MDKA 3C71A 2A2SA 4FYCA 5JCWA 3BCKA 2GSTA 4OWYA 4PGTA 4PXOA 1SJZA 2B7KA 2PBJA 3QFBC 4TKYA 4TXOB 4YAVA 5E4WA 4XS6A 2JADA 1R7HA 1B9XC 2C0GA 2OJLA 1CQHA 1FVKA 1BG5A 4RI6A 1X9MB 2R3XA 1XFLA 4H86A 3L78A 3QAWA 4K7IA 1XW5A 2O7KA 4EKZA 4K2DA 4OCFA 4PUFC 2C80A 3KCMA 1J9BA 1M2BA 2DJJA 2H73A 2R6KA 2LV3A 4XTSA 3ZVJD 1PD21 2RLIA 1HNCA 2G2QA 2FY6A 5GZZB 3IDVA 5DAKB 1JLWA 5KN3A 4HOJA 2H66A 3N9JA 13GSA 2YCDA 4Q5RA 1TP9A 2DMMA 11GSA 4NAXA 3S9FA 3UBLA 3F63A 1OC9A 3DYRA 2YNXA 2FWGA 5ECMB 2MZCA 4EXJA 4AF2A 2FWHA 2PGTA 3W6GA 3P8WA 6GSYA 4ZB9A 20GSA 2ZCTA 2YPMA 3UAPA 2VD1A 1A2JA 1V9WA 2YP6A 3KD0A 4OFMA 5FT3A 1U87A 5CRDA 5F0GA 5DQYA 2H0GA 4L0WA 2LRNA 3FW2A 3G9BA 3ZFBA 1E2YA 5J41A 2EC4A 2HE3A 2O87A 3EYTA 2H70A 3FZ9A 1ZCPA 1TOFA 4MA9A 2MBTA 4ZBAA 3LYKA 1TKDB 2XHFA 3I9V2 3J7Yk 4LLRA 1A23A 4FH8A 1V58A 4RQXA 2C0EA 2DBCA 3EVIA 3HYPA 3ZMLA 3PGTA 3ZREA 1SK2A 3GSSA 2F8FA 3CYNA 2H6XA 2EIOA 1I5GA 3UVTA 3H79A 3F3QA 5JWQB 4IP6A 3G7YA 2DJ2A 1X5EA 3SWLA 2V6OA 5J3RA 4KDUA 5IMDA 5H5QA 1TJDA 1NSWA 4I5QA 3NZNA 1JFUA 4IJ3A 2HZEA 2CT6A 3HDCA 3BBYA 1GSQA 1TU8A 2QC7A 3IOSA 2H71A 4F0CA 5J4UA 2IFQA 5IQYA 4TW5A 4IP1A 4IJIA 3GL5A 3KTBA 3H1NA 2P0GA 2H6YA 2X8CA 2VIMA 4BVYA 4HUAA 2F9SA 2IMEA 2DJ3A 1PMTA 4QL7A 2IN3A 4O92A 1XWAA 2KHPA 1KBNA 2H1GA 4AJ8A 5FWGA 3O6TA 2MMAA 2C0DA 2K6VA 1KEBA 1VF4A 1NM3A 3CXGA 4V1Ap 3VI7A 1M99A 2VCXA 5B7CA 1MD4A 1K0DA 4ZXGA 2H76A 4TR1B 5F8BA 2B3SA 4KCEA 3HA9A 1UA5A 5ECSA 4HI7A 2LNSA 1GTAA 4MMMA 2C3NA 2GZZA 3LWAA 1BYEA 1ZOFA 3KEBA 1UVZA 5HFIA 1K3OA 3HJMA 1MD3A 5DQSA 2BTOT 1AXDA 1PL1A 1ZYQB 2KP1A 3CTGA 1GULA 2FHEA 3LG6A 4EDZA 4ECIA 1FAAA 1OE7A 2GSQA 1K0AA 3VURA 5CAXA 3GTUB 4ZL9A 2XBQA 2JL4A 4PQIA 4DSRA 5LNKe 3FZAA 1WOUA 1K0OA 4IVFA 2LQQA 3V1WA 3ZL5A 5JCGA 4BWSA 22GSA 2LUSA 3CSIA 4WF4A 1SKSB 5AIXA 5EL8A 2LKUA 2AYTA 1QGVA 3RAZA 1SL2B 4ZL7A 4HZ2A 4KSOA 2IMFA 2JZTA 2AJQB 1DBYA 1K0NA 4FYBA 4NV2A 1XXUA 2LJRA 6GSUA 1OVNA 2PVOC 2WCIA 1JZRA 1F3BA 2MMOA 3MNGA 3KGKA 1GLQA 3ERWA 1AC1A 3TKSE 2REMA 3KTLA 3VK9A 2JSYA 1EEJA 2CVDA 2OE1A 1R5PA 1K0BA 2HT9A 1FB6A 1VF2A 4ML6A 4CDOA 1YEXA 5IM9A 4MJCA 3GX8A 3KP9A 3ZFLA 16GSA 2GSSA 2E7PA 3BOAA 3R2QA 2HZFA 1QQ2A 4I2TA 3UBKA 5ECIB 1X5DA 4K7NA 3L4NA 4MP4A 3QOUA 1WE0A 3L9UA 1SJIA 1GWCA 1FO5A 1A8YA 1M2AA 4MABA 2FLSA 4XHMA 3IE3A 1A8LA 4JE1A 5F06A 4IHUA 2XPEA 4TXVA 2B5XA 3GH9A 3FRCA 2KP2A 2LJAA 1SYXA 3HD5A 1GSEA 3LQ7A 1T00A 5J9CA 4F03A 4X1UA 1M2DA 2YJ7A 4N0VA 2CVKA 4F2IA 3IR4A 3ZMKA 4KUNA 5B8BA 1TI1A 1Q98A 1PA3A 4PUAA 3W8SA 2VUPA 1T8EB 4RQRA 2XC2A 1XVWA 4LL4B 4GSNA 1VF3A 1YF1A 1LU4A 3GUSA 3VPQA 4G9HA 3HZ4A 3RHBA 3WD6A 2DJKA 3CRUA 3VFIA 4QL9A 2WZ9A 1SL0B 5A5KA 1OKTA 1OC9B 3A3TA 19GSA 3FZ5A 2H1BA 2VD0A 4EE0A 2H0HA 3EU4A 2N5AA 1SU9A 4MDCA 1V2AA 1HNAA 2J23A 4JR6A 4NHWA 4JZQA 2CX3A 3LSZA 1KTEA 1QK8A 1BAYA 3F0IA 4MJAA 2P31A 4G19A 3HJOA 4CW9A 5IOWA 1XW6A 1DE1A 5A4UA 1WRYA 2KOKA 4KDXA 1ACVA 1TI3A 3IV4A 5D9VA 3F3RA 2V1MA 3DD3A 14GSA 4XS4A 4RI7A 2HXKA 3I69A 4ZILA 1F37A 2GS3A 1NHYA 2E0QA 12GSA 5H5SA 4FO5A 4LMVA 5KN1A 4XS1A 4TR4A 4JBBA 2BMXA 2HRFA 2WGRA 4TR0A 5JWRB 3UMAA 2FWEA 3APQA 3GMFA 3QMXA 3GFKA 2LSTA 4K8MA 3ZLPA 1F3AA 5CNWA 4POKA 2YZUA 2IPAA 1GP1A 1HYUA 5ID2A 3EU3A 5B6MA 2AV4A 3A2WA 3KMNA 2DLXA 1PKWA 1A0RP 1GTBA 5IMAA 3D0ZA 4ACSA 1GSFA 1WMJA 4IS0A 2HZEB 1PL2A 3CSHA 2JACA 1G7OA 1N2AA 4TVEA 4KH7A 2IFQB 5L71A 4EDYA 1GTUA 5ECKB 4PNFA 4GSTA 1K0CA 1B8XA 1USBA 1AIUA 2CQ9A 5IMFA 2KLXA 4POMA 1UN2A 2CA8A 5INYA 5AIVA 4K0GA 1A2MA 4WXTA 4V1Ag 2X8HA 2IJYA 3F6DA 8GSSA 3ZIVA 1O81A 2OACA 3VI5A 4ECCA 1NHOA 3UJ1A 3LXTA 2VLUA 5HR0A 3AY8A 1ERVA 4WEYA 3CTFA 4OCEA 3E9JB 4K7OA 1SJ6A 3UL3A 1XWCA 2ALBA 5HFKA 1XWBA 3GN3A 3IBHA 2CZ3A 1ERUA 2AAWA 3GH6A 1MTCA 2CV4A 1TXXA 1GH2A 1M9BA 3F8UA 4NXIA 2RIIA 3M0FA 5B8AA 3WGXA 2CX4A 2OADA 5G1KA 5G1LA 3L0HA 3TUEA 1XPVA 4O5RA 4QQ7A 4WBRD 2WULA 3HVSA 6GSVA 2V41A 5GSSA 1XIYA 2H74A 4HEA2 4TOPA 2AB6A 5DJMA 1G7EA 1SK0A 4HU9A 9GSSA 1N8JA 2I3YA 1XWKA 1TDIA 4K6XA 1AW9A 4O7HA 2O85A 1YEPA 6GSXA 4HJMA 2WJUA 4ZB6A 3EURA 1TW9A 3OR5A 1TRSA 2B6MA 2VLTA 4IKHA 1OAZA 3UOMA 1TTZA 1Y6EA 3WT1A 4J56E 5IO2A 4MF6A 1GNEA 3DRNA 2H19A 2XBIA 1Z6MA 5ECQB 1SL1B 1TRUA 5ELGA 2Z9SA 3O3TA 2B7JA 1TRWA 1G0TA 1S3CA 3WGDA 5E59A 2IMDA 5HFGA 4EC0A 1ON4A 1FG4A 1RQMA 3GYKA 4NMUA 5ECPB 3FR9A 4OO5A 2CAIA 3LEFA 2WFCA 1OKDA 2M80A 4WR5A 1YQ1A 2VL3A 4DSQA 3P7XA 1THOA 1JLVA 2GZYA 3CRTA 4JU5A 5D73A 2G0FA 5JCUA 2VM1A 3TOUA 3H93A 3VWXA 2LEGA 1PX7A 4FYUA 3U6VA 2VL2A 5DDLA 1XZOA 3SBCA 3VWVA 1EEMA 1GL8A 1B9YC 3ZTLA 1YKAA 5CO3A 1ZL9A 1S3AA 2DIZA 2RUFA 3FR3A 5F07A 5D8IA 2RM6A 4BL7A 3GKMA 4I2UA 4GXZA 2CVBA 5AN1A 3G7JA 3DEXA 1FW1A 3TJKA 5ECNB 1K3YA 3WYWA 2K9FA 6GSWA 4GSSA 2L5OA 2YV7A 2M46A 1PQNA 2VLVA 3LJRA 3D21A 2LTKA 3IK9A 5DCHA 4F9ZA 5AISA 3HCZA 5CP1A 1EOGA 5LCZA 3IC4A 3NOFA 4MPFA 1ERTA 1J0FA 5D9WA 3GSTA
chains in the Genus database with same CATH superfamily
1X0RA 4Q5NA 1U6TA 1U88A 2F51A 1GSYA 4ZBBA 2R4VA 2TRXA 4K5RA 3DXBA 18GSA 1FOVA 3TKQA 2QKEA 3FZ4A 3PR8A 4MZWA 5IO0A 4FIWA 5JWOB 4OFNA 4D73A 1GUKA 5J9BA 4AJ6A 3HZ8A 4X43A 4NPBA 1O85A 4KE3A 2VL9A 3ERGA 1V57A 1V40A 2V6KA 4IGJA 3CMIA 2R0GA 4G2EA 3VWWA 2FA8A 4OO4A 2GVPA 1O7UA 3IRAA 1THXA 5IMZA 1ERWA 3E0UA 4EUYA 2WB9A 1ST9A 6GSSA 3KMOA 2R5GA 2QA2A 1PFOA 2TIRA 1O8WA 3APOA 4MLYA 4V2LA 3CSJA 2DMLA 2P5RA 2C1YA 1Q4JA 1S3DA 2KUCA 2VCVA 1PX6A 1EOHA 3US3A 4HQZA 1FOHA 5KOXA 4WKWA 1DSBA 4ZL8A 1PSQA 2FWFA 1F9MA 3VWUA 3PH9A 1PN0A 2K8SA 4LA1A 1XCCA 5ECOB 2E2GA 4TR3A 3FMWA 4ILFA 4MJBA 4IELA 4BVXA 1DE2A 3ME8A 3TGZA 1ZMAA 2YOIA 3M8NA 6GSTA 1MDIA 1GSUA 3HJPA 1T4ZA 3IA1A 1T7PB 4KW6A 1PN9A 3Q19A 3RBTA 2JSZA 3E3EA 4Q5QA 4XS4B 4YQUA 4ECBA 1QFNA 4WBJA 1MDJA 2L57A 4KGIA 5D9XA 3LXZA 4HJ2A 4KB3A 1K3LA 4G0IA 5DALA 5A4WA 4N11A 2MYGA 1TRVA 1EP7A 4EVMA 1O8XA 3K8NA 4HQSA 1J08A 1JZOA 4TRXA 5ID2B 2DSAA 1EGOA 3QAGA 5IMVA 1XOAA 2VM2A 5HR2A 4K9ZA 2IL3A 1C72A 3QCPA 4XRAA 4IW9A 2R2JA 3KXOA 1G6YA 1V98A 3M1GA 1S3RA 1XWGA 1OE8A 3ZYWA 3ZZXA 3IAS2 1Z7RA 3TOTA 4YKFA 4GCIA 2PVQA 3FKFA 2GQLA 3QFAC 1IYHA 3TRPA 3M3MA 3GNJA 5IOXA 3CQFA 1G6WA 2I9HA 4EL1A 5B6NA 2O8VB 2C3TA 3UARA 2VOCA 3GHAA 4Z7XA 3TKSA 4YQMA 5G2ZA 2IWTA 1O73A 2YANA 2V32A 1TK0B 1KNGA 2I81A 3F6FA 2JZSA 2L4QA 1XW9A 3TJFA 4POBA 2LQOA 4KSMA 3H4KA 4P3YB 1YY7A 2L6DA 1U3IA 2WS2A 5ELAA 1ZGNA 2QA1A 1GSDA 2FGXA 3A2VA 1Z5YE 3KH9A 4J2FA 1M7TA 1T1VA 3MAKA 1BX9A 2C3QA 5DCGA 4L0UA 1M3JA 2C4JA 3L9VA 3QAVA 4EO3A 2E2MA 2N5FA 2NDOA 5EY6A 2VCWA 3C73A 4DEJA 3GURA 2V2GA 2X8GA 2B1KA 4MK3A 2YZHA 1CQGA 3IAM2 4KDYA 1URMA 1WP0A 3Q74A 4K0NA 2YWNA 3DWVA 4NV5A 3H8QA 3GKXA 5HR3A 2X49A 4GQCA 1U3AA 2A2RA 4V2NA 1AAZA 2I4AA 4PX1A 3NIVA 2YJHA 3KP8A 1NW2A 3QR6A 3Q6OA 10GSA 2H1DA 5D96A 2MMZA 2AUVA 3F9UA 5CRWA 2B5YA 5G5FA 4EIPA 1EGRA 4JR4A 5FHIA 2DC5A 4DSSA 2GLRA 4FQUA 2YV9A 3FHKA 3MYDA 5DBQA 1QUWA 2GQKA 2H30A 3F4TA 2GTUA 5COHA 1PGTA 4A5PA 2VL2C 1Z9HA 1RK4A 5EPFA 4N0ZA 4Q5FA 2O89A 3F4RA 1Z6NA 3FEUA 3KH7A 4OD7A 1QMVA 5KN0A 1HQOA 1VF1A 4I97A 2PUKC 2ON7A 3GKNA 2I1UA 5IPHA 2LJKA 3DVWA 4O32A 1M9AA 2L6CA 1AQVA 3EC3A 2NVLA 2VCQA 3C7MA 4JRRA 4BL7B 1SKRB 2PWJA 5GSTA 2L4CA 2PMTA 2EIQA 3C1SA 3DGQA 1W4VA 4L5LA 2PPTA 4HZ4A 3U5RE 3TKRA 3R3EA 2H8LA 1ZYNA 2GGTA 5ECRB 4KAEA 1LBKA 2FCHA 2H1AA 3Q18A 3D4TA 5ENUA 1OYJA 5HR1A 1EP8A 1B4QA 3EWLA 2FD3A 4F82A 4ISDA 4HS1A 5ECLB 1M0UA 1GUHA 1R5AA 2OKAA 1YZXA 4D73B 1UC7A 2K18A 5F05A 5A4VA 2HNLA 4J57E 3GA4A 1F6MC 3N5OA 3BCIA 1WIKA 5KOWA 3A2XA 2VCZA 4KA0A 4IQ1A 3EMXA 2LRTA 3C8EA 5BRTA 3TRXA 2QSIA 3TKPA 3M9KA 2FA4A 1EV9A 3GV1A 2H01A 1OC8A 2JU5A 3ISOA 4HU7A 3D5JA 1WJKA 3QDNA 4BA7A 1O6JA 5H5RA 1EZKA 3P90A 3MDKA 4E8HA 4NHZA 1ZYEA 1DUGA 3BJ5A 2J9HA 2EIRA 5D9TA 4PQ1A 3D4MA 4L8EA 1M3IA 1OC3A 2GQMA 3BD2A 3GL3A 5G30A 3ZVJA 5J5NA 1IYIA 4Z2UA 4ID0A 2HSHA 4G10A 3PINA 1SKWB 3UIWA 4BVXB 4LMWA 4WR4A 4GLTA 2ZNMA 1JHBA 1H4OA 3D22A 2GSRA 3L9SA 3EINA 1VRSD 1F2EA 1TK8B 2VO4A 4TXOA 4MF7A 2WDUA 2ON5A 3TJJA 4K5SA 1GLPA 3UVHA 3LGCA 1SK1A 2GT5A 2R37A 2RM5A 3FY7A 4MCUA 4JEDA 2YWOA 4GWRA 5DALB 2A4VA 1X9SB 2DJ0A 5HQPA 3HHVA 1ILOA 3P2AA 4V2MA 3TB2A 1YJ6A 3HY2A 1R4WA 1LJRA 4KX4A 1GSSA 2OE3A 3IK7A 4F0BA 5EVOA 2LNTA 2GZPA 1Z3EA 1FVJA 2H75A 2C8UA 2B1LA 1YDKA 1A0FA 2IMIA 5ABRA 2YWMA 5DAKA 5DVBA 4K1FA 4L5OA 4TN8A 2DIYA 2GT6A 1PKZA 3F4SA 3I43A 4KF9A 1VGLA 4YAPA 3LFLA 3WT2A 3TRQA 1EWXA 3CBUA 3TCOA 3MIXA 1ML6A 3J7Yb 4N30A 4OMVA 5KEJA 3TKSC 3ERFA 4MNNA 2H72A 2HSYA 1YF0A 3IHQA 1A24A 4BPYA 2N5BA 4KCAA 3GRXA 1W89A 2L59A 4GF0A 2F3MA 1HNBA 3VLNA 4IQAA 2DKIA 3C1RA 3GKKA 3WGEA 1SD8A 4GRFA 4GQFA 2TRCP 1A2LA 2FUG2 3HVXA 2JZRA 1B48A 1X9WB 4MF5A 3GIXA 3I6AA 1YKCA 4HDEA 4ZBDA 4E8EA 1JZDA 2WRTA 4MH3A 3HXSA 3ME7A 1T3BA 3RPNA 2CAQA 2ZUPA 2B5EA 2XPDA 4I6XA 3FK8A 5GAPD 3HVVA 4N10A 3EE2A 4ZIJA 5G5EA 3ED3A 4KNDA 4MZCA 1I9DA 2OA7A 1T4YA 4X0XA 3LYPA 2LS5A 4XCSA 5IMCA 3D6IA 3DKSA 4MH2A 1X5CA 5D93A 5IPGA 1BQ7A 2DJ1A 1ABAA 3LORA 2IIYA 1R26A 3G7IA 4POLA 3ZITA 7GSSA 2UZ8A 3O76A 3QPMA 2H6ZA 5G31A 2BJXA 1B4PA 4CHSA 2X4AA 2YN1A 2HRNA 3RDWA 2FNOA 2QGVA 2H0IA 4WF5A 3KM6A 4DSSB 5GAND 3EMPA 3APSA 2CZ2A 3IPZA 3QD9A 1XBSA 3GX0A 2X64A 1MEKA 3TJGA 3JCML 1TU7A 3MSZA 4IN0A 4AGSA 4PNGA 2PERA 2AHEA 2P5QA 2HYXA 4LL1B 2D2ZA 17GSA 3ZRDA 2OE0A 1TK5B 1AQWA 3TJBA 3MWHA 4TR1A 5C04A 1RW1A 2PU9C 4PURA 1PRXA 4AJ7A 1WPIA 4BWQA 2ES7A 2RUEA 2VCTA 5LD0A 4XRDA 5KN2A 3IXRA 5CREA 1JZWA 2NBSA 2HI7A 1XOBA 1Y25A 1E6BA 1GTIA 4MZBA 2NTOA 4PTSA 2YWIA 4IBPA 3A5WA 1GNWA 2IMKA 2LRCA 5ECHB 3GTUA 3HKRA 2VAFA 4ML1A 4XIHA 1K0MA 4OFTA 2GDRA 4RUVA 4EF0A 3IC8A 2MBSA 2HFDA 4GTUA 2F8AA 4ZB8A 2OBKA 3KIJA 1BEDA 1FB0A 5CYYA 1FHEA 5CRHA 2L5LA 5AGYA 3FR6A 4MPGA 3RPPA 2X99A 4WETA 5CRGA 5C00A 5IIZA 1HD2A 2NPBA 2MMNA 3UEMA 3RHCA 2K8VA 3DIEA 1Z7PA 3FYGA 3KZQA 4CY6A 1GUMA 3TDGA 1SYRA 2C0FA 4ECJA 4ULXA 4CY8A 1GRXA 3VPTA 2M72A 4YQVA 1EV4A 4I8BA 1BJXA 3KJYA 1H75A 3ZIJA 4MJEA 1QXHA 2HLSA 2OBIA 1ZZYA 4DVCA 1SD9A 3DVXA 2R0CA 3M9JA 1SENA 1AUCA 3W8JA 1XVQA 1WWJA 4NWYA 2PN8A 1AQXA 5DJLA 4PQHA 4YH2A 3DMLA 1MDKA 3C71A 2A2SA 4FYCA 5JCWA 3BCKA 1XG8A 2GSTA 4OWYA 4PGTA 4PXOA 1SJZA 2B7KA 2PBJA 3QFBC 4TKYA 4TXOB 4YKGA 4YAVA 5E4WA 4XS6A 2JADA 1R7HA 1B9XC 2C0GA 2OJLA 1CQHA 1FVKA 1BG5A 4RI6A 1X9MB 2R3XA 1XFLA 4H86A 3L78A 3QAWA 4K7IA 1XW5A 2O7KA 4EKZA 4K2DA 4OCFA 4PUFC 2C80A 3KCMA 1J9BA 1M2BA 2DJJA 2H73A 2R6KA 2LV3A 4XTSA 3ZVJD 1PD21 2RLIA 1HNCA 2G2QA 2FY6A 5GZZB 3IDVA 5DAKB 1JLWA 3LW9A 5KN3A 4HOJA 2H66A 2A4HA 3N9JA 13GSA 2YCDA 4Q5RA 1TP9A 4K2XA 2DMMA 11GSA 4NAXA 3S9FA 3UBLA 3F63A 1OC9A 3DYRA 2YNXA 2FWGA 5ECMB 2MZCA 4EXJA 4AF2A 2FWHA 2PGTA 3W6GA 4EIQA 3P8WA 6GSYA 4ZB9A 20GSA 2ZCTA 2YPMA 3UAPA 2VD1A 1A2JA 1V9WA 2YP6A 3KD0A 4OFMA 5FT3A 1U87A 5CRDA 5F0GA 5DQYA 2H0GA 4L0WA 2LRNA 3FW2A 3G9BA 3ZFBA 1E2YA 5J41A 2EC4A 2HE3A 2O87A 3EYTA 2H70A 3FZ9A 4USSA 1ZCPA 1TOFA 4MA9A 2MBTA 4ZBAA 3LYKA 1TKDB 2XHFA 3I9V2 3J7Yk 4LLRA 1A23A 4FH8A 1V58A 4RQXA 2C0EA 2DBCA 3EVIA 3HYPA 3ZMLA 3PGTA 3ZREA 1SK2A 3GSSA 2F8FA 3CYNA 2H6XA 2EIOA 1I5GA 3UVTA 3H79A 3F3QA 5JWQB 4IP6A 3G7YA 4HSCX 2DJ2A 1X5EA 3SWLA 2V6OA 5J3RA 4KDUA 5IMDA 5H5QA 1TJDA 1NSWA 4I5QA 3NZNA 1JFUA 4IJ3A 2HZEA 2CT6A 3HDCA 3BBYA 1GSQA 1TU8A 2QC7A 3IOSA 2H71A 4F0CA 5J4UA 2IFQA 5IQYA 4TW5A 4IP1A 4IJIA 3GL5A 3KTBA 2HSMA 3H1NA 2P0GA 2H6YA 2X8CA 2VIMA 4BVYA 4HUAA 2F9SA 2IMEA 2DJ3A 1PMTA 4QL7A 2IN3A 4O92A 1XWAA 2KHPA 1KBNA 2H1GA 4AJ8A 5FWGA 3O6TA 2MMAA 2C0DA 2K6VA 1KEBA 1VF4A 1NM3A 3CXGA 4V1Ap 3VI7A 1M99A 2VCXA 5B7CA 1MD4A 1K0DA 4ZXGA 2H76A 4TR1B 5F8BA 2B3SA 4KCEA 3HA9A 1UA5A 5ECSA 4HI7A 2LNSA 5BMUA 1GTAA 4MMMA 2C3NA 2GZZA 3LWAA 1BYEA 1ZOFA 3KEBA 1UVZA 5HFIA 1K3OA 3HJMA 1MD3A 5DQSA 2BTOT 1AXDA 1PL1A 4Z2TA 1ZYQB 2KP1A 3CTGA 4O5UA 1GULA 2FHEA 3LG6A 4EDZA 4ECIA 1FAAA 1OE7A 2GSQA 1K0AA 3VURA 5CAXA 3GTUB 4ZL9A 2XBQA 4BIKA 2JL4A 4PQIA 4DSRA 5LNKe 3FZAA 1WOUA 1K0OA 4IVFA 2LQQA 3V1WA 3ZL5A 5JCGA 4BWSA 22GSA 2LUSA 3CSIA 4WF4A 1SKSB 5AIXA 5EL8A 2LKUA 2AYTA 1QGVA 3RAZA 1SL2B 4ZL7A 4HZ2A 4KSOA 2IMFA 2JZTA 2AJQB 1DBYA 1K0NA 2HRKA 4FYBA 4NV2A 1XXUA 2LJRA 6GSUA 3PPUA 1OVNA 2PVOC 2WCIA 4X4JA 1JZRA 1F3BA 2A2PA 2MMOA 3MNGA 3KGKA 1GLQA 3ERWA 1AC1A 3TKSE 2REMA 3KTLA 3VK9A 2JSYA 1ZYPA 1EEJA 2CVDA 2OE1A 1R5PA 1K0BA 2HT9A 1FB6A 1VF2A 4ML6A 4CDOA 1YEXA 5IM9A 4MJCA 3GX8A 3KP9A 3ZFLA 16GSA 2GSSA 2E7PA 3BOAA 3R2QA 2HZFA 3A5IA 1QQ2A 4I2TA 3UBKA 5ECIB 1X5DA 4K7NA 3L4NA 4MP4A 3QOUA 1WE0A 3L9UA 1SJIA 1GWCA 1FO5A 1A8YA 1M2AA 4MABA 2FLSA 4XHMA 3IE3A 1A8LA 4JE1A 5F06A 4IHUA 2XPEA 4TXVA 2B5XA 3GH9A 3FRCA 2KP2A 2DKHA 2LJAA 1SYXA 3HD5A 1GSEA 3LQ7A 1T00A 5J9CA 4F03A 4X1UA 1M2DA 2YJ7A 4N0VA 2CVKA 4F2IA 3IR4A 3ZMKA 4KUNA 5B8BA 1TI1A 1Q98A 1PA3A 4PUAA 3W8SA 2VUPA 1T8EB 4RQRA 2XC2A 1XVWA 4LL4B 4GSNA 1VF3A 1YF1A 1LU4A 4G0LA 3GUSA 3VPQA 4G9HA 3HZ4A 3RHBA 3WD6A 2DJKA 3CRUA 3VFIA 4QL9A 2WZ9A 1SL0B 5A5KA 1OKTA 1OC9B 3A3TA 19GSA 3FZ5A 4ICYA 3IHGA 2H1BA 2VD0A 4EE0A 2H0HA 3EU4A 2N5AA 1SU9A 4MDCA 1V2AA 1HNAA 2J23A 4JR6A 4NHWA 4JZQA 2CX3A 3LSZA 1KTEA 1QK8A 1BAYA 3F0IA 4MJAA 2P31A 4G19A 3HJOA 4CW9A 5IOWA 1XW6A 1DE1A 5A4UA 1WRYA 2KOKA 4KDXA 1ACVA 1TI3A 3IV4A 5D9VA 3F3RA 2V1MA 3DD3A 14GSA 2HRAA 4XS4A 4RI7A 2HXKA 3I69A 4ZILA 1F37A 2GS3A 1NHYA 2E0QA 12GSA 5H5SA 4FO5A 4LMVA 5KN1A 4XS1A 4TR4A 4JBBA 2BMXA 2HRFA 2WGRA 4TR0A 5JWRB 3UMAA 2FWEA 3APQA 3GMFA 3QMXA 3GFKA 2LSTA 4K8MA 3ZLPA 1F3AA 5CNWA 4POKA 2YZUA 2IPAA 1GP1A 4Z2RA 1HYUA 5ID2A 3EU3A 5B6MA 2AV4A 3A2WA 3KMNA 2DLXA 1PKWA 1A0RP 1GTBA 5IMAA 3D0ZA 4O5QA 4ACSA 1GSFA 1WMJA 4IS0A 2HZEB 1PL2A 3CSHA 2JACA 1G7OA 1N2AA 4TVEA 4KH7A 2IFQB 5L71A 4EDYA 1GTUA 5ECKB 4PNFA 4GSTA 1K0CA 1B8XA 1USBA 1AIUA 2CQ9A 5IMFA 2KLXA 4POMA 1UN2A 2CA8A 5INYA 5AIVA 4K0GA 1A2MA 4WXTA 4V1Ag 4BVYB 2X8HA 2IJYA 3F6DA 8GSSA 3ZIVA 1O81A 2OACA 3VI5A 4ECCA 1NHOA 3UJ1A 3LXTA 2R0PA 2VLUA 5HR0A 3AY8A 1ERVA 4WEYA 3CTFA 4OCEA 3E9JB 4K7OA 1SJ6A 3UL3A 1XWCA 2ALBA 5HFKA 1XWBA 3GN3A 3IBHA 2CZ3A 1ERUA 2AAWA 3GH6A 1MTCA 2CV4A 1TXXA 1GH2A 1M9BA 3F8UA 4NXIA 2RIIA 3M0FA 5B8AA 3WGXA 2CX4A 2OADA 5G1KA 5G1LA 3L0HA 3TUEA 1XPVA 4O5RA 4QQ7A 4WBRD 2WULA 3HVSA 6GSVA 2V41A 5GSSA 1XIYA 2H74A 4HEA2 4TOPA 2AB6A 5DJMA 1G7EA 1SK0A 4HU9A 9GSSA 1N8JA 2I3YA 1XWKA 1TDIA 4K6XA 1AW9A 4O7HA 2O85A 1YEPA 6GSXA 4HJMA 2WJUA 4ZB6A 3EURA 1TW9A 3OR5A 1TRSA 2B6MA 2VLTA 4IKHA 1OAZA 3UOMA 1TTZA 1Y6EA 3WT1A 4J56E 5IO2A 4MF6A 1GNEA 3DRNA 2H19A 2XBIA 1Z6MA 5ECQB 1SL1B 1TRUA 5ELGA 2Z9SA 3O3TA 2B7JA 1TRWA 1G0TA 1S3CA 3WGDA 5E59A 2IMDA 5HFGA 4EC0A 1ON4A 1FG4A 1RQMA 3GYKA 4NMUA 5ECPB 3FR9A 4OO5A 2CAIA 3LEFA 2WFCA 1OKDA 2M80A 4WR5A 1YQ1A 2VL3A 4DSQA 3P7XA 1THOA 1JLVA 2GZYA 3CRTA 4JU5A 5D73A 2G0FA 5JCUA 2VM1A 3HVNA 3TOUA 3H93A 3VWXA 2LEGA 1PX7A 4FYUA 3U6VA 2VL2A 5DDLA 1XZOA 3SBCA 3VWVA 1EEMA 1GL8A 1B9YC 3ZTLA 1YKAA 5CO3A 1ZL9A 1S3AA 3EPTA 2DIZA 2RUFA 3FR3A 5F07A 5D8IA 2RM6A 4BL7A 3GKMA 4I2UA 4GXZA 2CVBA 5AN1A 3G7JA 3DEXA 1FW1A 3TJKA 5ECNB 1K3YA 3WYWA 4G0KA 2K9FA 6GSWA 4GSSA 2L5OA 2YV7A 2M46A 1PQNA 2VLVA 3LJRA 3D21A 2LTKA 3IK9A 5DCHA 4F9ZA 5AISA 3HCZA 5CP1A 1EOGA 5LCZA 3IC4A 3NOFA 4MPFA 1ERTA 1J0FA 5D9WA 3GSTA
chains in the Genus database with same CATH topology
1X0RA 4Q5NA 1U6TA 1U88A 2F51A 1GSYA 4ZBBA 2R4VA 2TRXA 4K5RA 3DXBA 18GSA 1FOVA 3TKQA 2QKEA 3FZ4A 3PR8A 4MZWA 5IO0A 4FIWA 5JWOB 4OFNA 4D73A 1GUKA 5J9BA 4AJ6A 3HZ8A 4X43A 4NPBA 1O85A 4KE3A 2VL9A 3ERGA 1V57A 1V40A 2V6KA 4IGJA 3CMIA 2R0GA 4G2EA 3VWWA 2FA8A 4OO4A 2GVPA 1O7UA 3IRAA 1THXA 5IMZA 1ERWA 3E0UA 4EUYA 2WB9A 1ST9A 6GSSA 3KMOA 2R5GA 2QA2A 2TIRA 1O8WA 3APOA 4MLYA 4V2LA 3CSJA 2DMLA 2P5RA 2C1YA 1Q4JA 1S3DA 2KUCA 2VCVA 1PX6A 1EOHA 3US3A 4HQZA 1FOHA 5KOXA 4WKWA 1DSBA 4ZL8A 1PSQA 2FWFA 1F9MA 3VWUA 3PH9A 1PN0A 2K8SA 4LA1A 1XCCA 5ECOB 2E2GA 4TR3A 3FMWA 4ILFA 4MJBA 4IELA 4BVXA 1DE2A 3ME8A 3TGZA 1ZMAA 2YOIA 3M8NA 6GSTA 1MDIA 1GSUA 3HJPA 1T4ZA 3IA1A 1T7PB 4KW6A 1PN9A 3Q19A 3RBTA 2JSZA 3E3EA 4Q5QA 4XS4B 4YQUA 4ECBA 1QFNA 4WBJA 1MDJA 2L57A 4KGIA 5D9XA 3LXZA 4HJ2A 4KB3A 1K3LA 4G0IA 5DALA 5A4WA 4N11A 2MYGA 1TRVA 1EP7A 4EVMA 1O8XA 3K8NA 4HQSA 1J08A 1JZOA 4TRXA 5ID2B 2DSAA 1EGOA 3QAGA 5IMVA 1XOAA 2VM2A 5HR2A 4K9ZA 2IL3A 1C72A 3QCPA 4XRAA 4IW9A 2R2JA 3KXOA 1G6YA 1V98A 3M1GA 1XWGA 1OE8A 3ZYWA 3ZZXA 3IAS2 1Z7RA 3TOTA 4YKFA 4GCIA 2PVQA 3FKFA 2GQLA 3QFAC 1IYHA 3TRPA 3M3MA 3GNJA 5IOXA 1G6WA 2I9HA 4EL1A 5B6NA 2O8VB 2C3TA 3UARA 2VOCA 3GHAA 4Z7XA 3TKSA 4YQMA 5G2ZA 2IWTA 1O73A 2YANA 2V32A 1TK0B 1KNGA 2I81A 3F6FA 2JZSA 2L4QA 1XW9A 3TJFA 4POBA 2LQOA 4KSMA 3H4KA 4P3YB 1YY7A 2L6DA 1U3IA 2WS2A 5ELAA 1ZGNA 2QA1A 1GSDA 2FGXA 3A2VA 1Z5YE 3KH9A 4J2FA 1M7TA 1T1VA 3MAKA 1BX9A 2C3QA 5DCGA 4L0UA 2C4JA 3L9VA 3QAVA 4EO3A 2E2MA 2N5FA 2NDOA 5EY6A 2VCWA 3C73A 4DEJA 3GURA 2V2GA 2X8GA 2B1KA 4MK3A 2YZHA 1CQGA 3IAM2 4KDYA 1URMA 1WP0A 3Q74A 4K0NA 2YWNA 3DWVA 4NV5A 3H8QA 3GKXA 5HR3A 2X49A 4GQCA 1U3AA 2A2RA 4V2NA 1AAZA 2I4AA 4PX1A 3NIVA 2YJHA 3KP8A 1NW2A 3QR6A 3Q6OA 10GSA 2H1DA 5D96A 2MMZA 2AUVA 3F9UA 5CRWA 2B5YA 5G5FA 4EIPA 1EGRA 4JR4A 5FHIA 2DC5A 4DSSA 2GLRA 4FQUA 2YV9A 3FHKA 3MYDA 5DBQA 1QUWA 2GQKA 2H30A 3F4TA 2GTUA 5COHA 1PGTA 4A5PA 2VL2C 1Z9HA 1RK4A 5EPFA 4N0ZA 4Q5FA 2O89A 3F4RA 1Z6NA 3FEUA 3KH7A 4OD7A 1QMVA 5KN0A 1HQOA 1VF1A 4I97A 2PUKC 2ON7A 3GKNA 2I1UA 5IPHA 2LJKA 3DVWA 4O32A 1M9AA 2L6CA 1AQVA 3EC3A 2NVLA 2VCQA 3C7MA 4JRRA 4BL7B 1SKRB 2PWJA 5GSTA 2L4CA 2PMTA 2EIQA 3C1SA 3DGQA 1W4VA 4L5LA 2PPTA 4HZ4A 3U5RE 3TKRA 3R3EA 2H8LA 1ZYNA 2GGTA 5ECRB 4KAEA 1LBKA 2FCHA 2H1AA 3Q18A 3D4TA 5ENUA 1OYJA 5HR1A 1EP8A 1B4QA 3EWLA 2FD3A 4F82A 4ISDA 4HS1A 5ECLB 1M0UA 1GUHA 1R5AA 2OKAA 1YZXA 4D73B 1UC7A 2K18A 5F05A 5A4VA 2HNLA 4J57E 3GA4A 1F6MC 3N5OA 3BCIA 1WIKA 5KOWA 3A2XA 2VCZA 4KA0A 4IQ1A 3EMXA 2LRTA 3C8EA 5BRTA 3TRXA 2QSIA 3TKPA 3M9KA 2FA4A 1EV9A 3GV1A 2H01A 1OC8A 2JU5A 3ISOA 4HU7A 3D5JA 1WJKA 3QDNA 4BA7A 1O6JA 5H5RA 1EZKA 3P90A 3MDKA 4E8HA 4NHZA 1ZYEA 1DUGA 3BJ5A 2J9HA 2EIRA 5D9TA 4PQ1A 3D4MA 4L8EA 1OC3A 2GQMA 3BD2A 3GL3A 5G30A 3ZVJA 5J5NA 1IYIA 4Z2UA 4ID0A 2HSHA 4G10A 3PINA 1SKWB 3UIWA 4BVXB 4LMWA 4WR4A 4GLTA 2ZNMA 1JHBA 1H4OA 3D22A 2GSRA 3L9SA 3EINA 1VRSD 1F2EA 1TK8B 2VO4A 4TXOA 4MF7A 2WDUA 2ON5A 3TJJA 4K5SA 1GLPA 3UVHA 3LGCA 1SK1A 2GT5A 2R37A 2RM5A 3FY7A 4MCUA 4JEDA 2YWOA 4GWRA 5DALB 2A4VA 1X9SB 2DJ0A 5HQPA 3HHVA 1ILOA 3P2AA 4V2MA 3TB2A 1YJ6A 3HY2A 1R4WA 1LJRA 4KX4A 1GSSA 2OE3A 3IK7A 4F0BA 5EVOA 2LNTA 2GZPA 1Z3EA 1FVJA 2H75A 2C8UA 2B1LA 1YDKA 1A0FA 2IMIA 5ABRA 2YWMA 5DAKA 5DVBA 4K1FA 4L5OA 4TN8A 2DIYA 2GT6A 1PKZA 3F4SA 3I43A 4KF9A 1VGLA 4YAPA 3LFLA 3WT2A 3TRQA 1EWXA 3CBUA 3TCOA 3MIXA 1ML6A 3J7Yb 4N30A 4OMVA 5KEJA 3TKSC 3ERFA 4MNNA 2H72A 2HSYA 1YF0A 3IHQA 1A24A 4BPYA 2N5BA 4KCAA 3GRXA 1W89A 2L59A 4GF0A 2F3MA 1HNBA 3VLNA 4IQAA 2DKIA 3C1RA 3GKKA 3WGEA 1SD8A 4GRFA 4GQFA 2TRCP 1A2LA 2FUG2 3HVXA 2JZRA 1B48A 1X9WB 4MF5A 3GIXA 3I6AA 1YKCA 4HDEA 4ZBDA 4E8EA 1JZDA 2WRTA 4MH3A 3HXSA 3ME7A 1T3BA 3RPNA 2CAQA 2ZUPA 2B5EA 2XPDA 4I6XA 3FK8A 5GAPD 3HVVA 4N10A 3EE2A 4ZIJA 5G5EA 3ED3A 4KNDA 4MZCA 1I9DA 2OA7A 1T4YA 4X0XA 3LYPA 2LS5A 4XCSA 5IMCA 3D6IA 3DKSA 4MH2A 1X5CA 5D93A 5IPGA 1BQ7A 2DJ1A 1ABAA 3LORA 2IIYA 1R26A 3G7IA 4POLA 3ZITA 7GSSA 2UZ8A 3O76A 3QPMA 2H6ZA 5G31A 2BJXA 1B4PA 4CHSA 2X4AA 2YN1A 2HRNA 3RDWA 2FNOA 2QGVA 2H0IA 4WF5A 3KM6A 4DSSB 5GAND 3EMPA 3APSA 2CZ2A 3IPZA 3QD9A 1XBSA 3GX0A 2X64A 1MEKA 3TJGA 3JCML 1TU7A 3MSZA 4IN0A 4AGSA 4PNGA 2PERA 2AHEA 2P5QA 2HYXA 4LL1B 2D2ZA 17GSA 3ZRDA 2OE0A 1TK5B 1AQWA 3TJBA 3MWHA 4TR1A 5C04A 1RW1A 2PU9C 4PURA 1PRXA 4AJ7A 1WPIA 4BWQA 2ES7A 2RUEA 2VCTA 5LD0A 4XRDA 5KN2A 3IXRA 5CREA 1JZWA 2NBSA 2HI7A 1XOBA 1Y25A 1E6BA 1GTIA 4MZBA 2NTOA 4PTSA 2YWIA 4IBPA 3A5WA 1GNWA 2IMKA 2LRCA 5ECHB 3GTUA 3HKRA 2VAFA 4ML1A 4XIHA 1K0MA 4OFTA 2GDRA 4RUVA 4EF0A 3IC8A 2MBSA 2HFDA 4GTUA 2F8AA 4ZB8A 2OBKA 3KIJA 1BEDA 1FB0A 5CYYA 1FHEA 5CRHA 2L5LA 5AGYA 3FR6A 4MPGA 3RPPA 2X99A 4WETA 5CRGA 5C00A 5IIZA 1HD2A 2NPBA 2MMNA 3UEMA 3RHCA 2K8VA 3DIEA 1Z7PA 3FYGA 3KZQA 4CY6A 1GUMA 3TDGA 1SYRA 2C0FA 4ECJA 4ULXA 4CY8A 1GRXA 3VPTA 2M72A 4YQVA 1EV4A 4I8BA 1BJXA 3KJYA 1H75A 3ZIJA 4MJEA 1QXHA 2HLSA 2OBIA 1ZZYA 4DVCA 1SD9A 3DVXA 2R0CA 3M9JA 1SENA 1AUCA 3W8JA 1XVQA 1WWJA 4NWYA 2PN8A 1AQXA 5DJLA 4PQHA 4YH2A 3DMLA 1MDKA 3C71A 2A2SA 4FYCA 5JCWA 3BCKA 2GSTA 4OWYA 4PGTA 4PXOA 1SJZA 2B7KA 2PBJA 3QFBC 4TKYA 4TXOB 4YKGA 4YAVA 5E4WA 4XS6A 2JADA 1R7HA 1B9XC 2C0GA 2OJLA 1CQHA 1FVKA 1BG5A 4RI6A 1X9MB 2R3XA 1XFLA 4H86A 3L78A 3QAWA 4K7IA 1XW5A 2O7KA 4EKZA 4K2DA 4OCFA 4PUFC 2C80A 3KCMA 1J9BA 1M2BA 2DJJA 2H73A 2R6KA 2LV3A 4XTSA 3ZVJD 1PD21 2RLIA 1HNCA 2G2QA 2FY6A 5GZZB 3IDVA 5DAKB 1JLWA 3LW9A 5KN3A 4HOJA 2H66A 2A4HA 3N9JA 13GSA 2YCDA 4Q5RA 1TP9A 4K2XA 2DMMA 11GSA 4NAXA 3S9FA 3UBLA 3F63A 1OC9A 3DYRA 2YNXA 2FWGA 5ECMB 2MZCA 4EXJA 4AF2A 2FWHA 2PGTA 3W6GA 4EIQA 3P8WA 6GSYA 4ZB9A 20GSA 2ZCTA 2YPMA 3UAPA 2VD1A 1A2JA 1V9WA 2YP6A 3KD0A 4OFMA 5FT3A 1U87A 5CRDA 5F0GA 5DQYA 2H0GA 4L0WA 2LRNA 3FW2A 3G9BA 3ZFBA 1E2YA 5J41A 2EC4A 2HE3A 2O87A 3EYTA 2H70A 3FZ9A 4USSA 1ZCPA 1TOFA 4MA9A 2MBTA 4ZBAA 3LYKA 1TKDB 2XHFA 3I9V2 3J7Yk 4LLRA 1A23A 4FH8A 1V58A 4RQXA 2C0EA 2DBCA 3EVIA 3HYPA 3ZMLA 3PGTA 3ZREA 1SK2A 3GSSA 2F8FA 3CYNA 2H6XA 2EIOA 1I5GA 3UVTA 3H79A 3F3QA 5JWQB 4IP6A 3G7YA 2DJ2A 1X5EA 3SWLA 2V6OA 5J3RA 4KDUA 5IMDA 5H5QA 1TJDA 1NSWA 4I5QA 3NZNA 1JFUA 4IJ3A 2HZEA 2CT6A 3HDCA 3BBYA 1GSQA 1TU8A 2QC7A 3IOSA 2H71A 4F0CA 5J4UA 2IFQA 5IQYA 4TW5A 4IP1A 4IJIA 3GL5A 3KTBA 2HSMA 3H1NA 2P0GA 2H6YA 2X8CA 2VIMA 4BVYA 4HUAA 2F9SA 2IMEA 2DJ3A 1PMTA 4QL7A 2IN3A 4O92A 1XWAA 2KHPA 1KBNA 2H1GA 4AJ8A 5FWGA 3O6TA 2MMAA 2C0DA 2K6VA 1KEBA 1VF4A 1NM3A 3CXGA 4V1Ap 3VI7A 1M99A 2VCXA 5B7CA 1MD4A 1K0DA 4ZXGA 2H76A 4TR1B 5F8BA 2B3SA 4KCEA 3HA9A 1UA5A 5ECSA 4HI7A 2LNSA 5BMUA 1GTAA 4MMMA 2C3NA 2GZZA 3LWAA 1BYEA 1ZOFA 3KEBA 1UVZA 5HFIA 1K3OA 3HJMA 1MD3A 5DQSA 2BTOT 1AXDA 1PL1A 4Z2TA 1ZYQB 2KP1A 3CTGA 4O5UA 1GULA 2FHEA 3LG6A 4EDZA 4ECIA 1FAAA 1OE7A 2GSQA 1K0AA 3VURA 5CAXA 3GTUB 4ZL9A 2XBQA 2JL4A 4PQIA 4DSRA 5LNKe 3FZAA 1WOUA 1K0OA 4IVFA 2LQQA 3V1WA 3ZL5A 5JCGA 4BWSA 22GSA 2LUSA 3CSIA 4WF4A 1SKSB 5AIXA 5EL8A 2LKUA 2AYTA 1QGVA 3RAZA 1SL2B 4ZL7A 4HZ2A 4KSOA 2IMFA 2JZTA 2AJQB 1DBYA 1K0NA 2HRKA 4FYBA 4NV2A 1XXUA 2LJRA 6GSUA 3PPUA 1OVNA 2PVOC 2WCIA 4X4JA 1JZRA 1F3BA 2A2PA 2MMOA 3MNGA 3KGKA 1GLQA 3ERWA 1AC1A 3TKSE 2REMA 3KTLA 3VK9A 2JSYA 1ZYPA 1EEJA 2CVDA 2OE1A 1R5PA 1K0BA 2HT9A 1FB6A 1VF2A 4ML6A 4CDOA 1YEXA 5IM9A 4MJCA 3GX8A 3KP9A 3ZFLA 16GSA 2GSSA 2E7PA 3BOAA 3R2QA 2HZFA 3A5IA 1QQ2A 4I2TA 3UBKA 5ECIB 1X5DA 4K7NA 3L4NA 4MP4A 3QOUA 1WE0A 3L9UA 1SJIA 1GWCA 1FO5A 1A8YA 1M2AA 4MABA 2FLSA 4XHMA 3IE3A 1A8LA 4JE1A 5F06A 4IHUA 2XPEA 4TXVA 2B5XA 3GH9A 3FRCA 2KP2A 2DKHA 2LJAA 1SYXA 3HD5A 1GSEA 3LQ7A 1T00A 5J9CA 4F03A 4X1UA 1M2DA 2YJ7A 4N0VA 2CVKA 4F2IA 3IR4A 3ZMKA 4KUNA 5B8BA 1TI1A 1Q98A 1PA3A 4PUAA 3W8SA 2VUPA 1T8EB 4RQRA 2XC2A 1XVWA 4LL4B 4GSNA 1VF3A 1YF1A 1LU4A 4G0LA 3GUSA 3VPQA 4G9HA 3HZ4A 3RHBA 3WD6A 2DJKA 3CRUA 3VFIA 4QL9A 2WZ9A 1SL0B 5A5KA 1OKTA 1OC9B 3A3TA 19GSA 3FZ5A 4ICYA 3IHGA 2H1BA 2VD0A 4EE0A 2H0HA 3EU4A 2N5AA 1SU9A 4MDCA 1V2AA 1HNAA 2J23A 4JR6A 4NHWA 4JZQA 2CX3A 3LSZA 1KTEA 1QK8A 1BAYA 3F0IA 4MJAA 2P31A 4G19A 3HJOA 4CW9A 5IOWA 1XW6A 1DE1A 5A4UA 1WRYA 2KOKA 4KDXA 1ACVA 1TI3A 3IV4A 5D9VA 3F3RA 2V1MA 3DD3A 14GSA 2HRAA 4XS4A 4RI7A 2HXKA 3I69A 4ZILA 1F37A 2GS3A 1NHYA 2E0QA 12GSA 5H5SA 4FO5A 4LMVA 5KN1A 4XS1A 4TR4A 4JBBA 2BMXA 2HRFA 2WGRA 4TR0A 5JWRB 3UMAA 2FWEA 3APQA 3GMFA 3QMXA 3GFKA 2LSTA 4K8MA 3ZLPA 1F3AA 5CNWA 4POKA 2YZUA 2IPAA 1GP1A 4Z2RA 1HYUA 5ID2A 3EU3A 5B6MA 2AV4A 3A2WA 3KMNA 2DLXA 1PKWA 1A0RP 1GTBA 5IMAA 3D0ZA 4O5QA 4ACSA 1GSFA 1WMJA 4IS0A 2HZEB 1PL2A 3CSHA 2JACA 1G7OA 1N2AA 4TVEA 4KH7A 2IFQB 5L71A 4EDYA 1GTUA 5ECKB 4PNFA 4GSTA 1K0CA 1B8XA 1USBA 1AIUA 2CQ9A 5IMFA 2KLXA 4POMA 1UN2A 2CA8A 5INYA 5AIVA 4K0GA 1A2MA 4WXTA 4V1Ag 4BVYB 2X8HA 2IJYA 3F6DA 8GSSA 3ZIVA 1O81A 2OACA 3VI5A 4ECCA 1NHOA 3UJ1A 3LXTA 2R0PA 2VLUA 5HR0A 3AY8A 1ERVA 4WEYA 3CTFA 4OCEA 3E9JB 4K7OA 1SJ6A 3UL3A 1XWCA 2ALBA 5HFKA 1XWBA 3GN3A 3IBHA 2CZ3A 1ERUA 2AAWA 3GH6A 1MTCA 2CV4A 1TXXA 1GH2A 1M9BA 3F8UA 4NXIA 2RIIA 3M0FA 5B8AA 3WGXA 2CX4A 2OADA 5G1KA 5G1LA 3L0HA 3TUEA 1XPVA 4O5RA 4QQ7A 4WBRD 2WULA 3HVSA 6GSVA 2V41A 5GSSA 1XIYA 2H74A 4HEA2 4TOPA 2AB6A 5DJMA 1G7EA 1SK0A 4HU9A 9GSSA 1N8JA 2I3YA 1XWKA 1TDIA 4K6XA 1AW9A 4O7HA 2O85A 1YEPA 6GSXA 4HJMA 2WJUA 4ZB6A 3EURA 1TW9A 3OR5A 1TRSA 2B6MA 2VLTA 4IKHA 1OAZA 3UOMA 1TTZA 1Y6EA 3WT1A 4J56E 5IO2A 4MF6A 1GNEA 3DRNA 2H19A 2XBIA 1Z6MA 5ECQB 1SL1B 1TRUA 5ELGA 2Z9SA 3O3TA 2B7JA 1TRWA 1G0TA 1S3CA 3WGDA 5E59A 2IMDA 5HFGA 4EC0A 1ON4A 1FG4A 1RQMA 3GYKA 4NMUA 5ECPB 3FR9A 4OO5A 2CAIA 3LEFA 2WFCA 1OKDA 2M80A 4WR5A 1YQ1A 2VL3A 4DSQA 3P7XA 1THOA 1JLVA 2GZYA 3CRTA 4JU5A 5D73A 2G0FA 5JCUA 2VM1A 3TOUA 3H93A 3VWXA 2LEGA 1PX7A 4FYUA 3U6VA 2VL2A 5DDLA 1XZOA 3SBCA 3VWVA 1EEMA 1GL8A 1B9YC 3ZTLA 1YKAA 5CO3A 1ZL9A 1S3AA 3EPTA 2DIZA 2RUFA 3FR3A 5F07A 5D8IA 2RM6A 4BL7A 3GKMA 4I2UA 4GXZA 2CVBA 5AN1A 3G7JA 3DEXA 1FW1A 3TJKA 5ECNB 1K3YA 3WYWA 4G0KA 2K9FA 6GSWA 4GSSA 2L5OA 2YV7A 2M46A 1PQNA 2VLVA 3LJRA 3D21A 2LTKA 3IK9A 5DCHA 4F9ZA 5AISA 3HCZA 5CP1A 1EOGA 5LCZA 3IC4A 3NOFA 4MPFA 1ERTA 1J0FA 5D9WA 3GSTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X0R A;  4Q5N A;  1U6T A;  1U88 A;  2F51 A;  1GSY A;  4ZBB A;  2R4V A;  2TRX A;  3DXB A;  18GS A;  1FOV A;  3TKQ A;  2QKE A;  3FZ4 A;  3PR8 A;  4MZW A;  5IO0 A;  4FIW A;  5JWO B;  4OFN A;  4D73 A;  1GUK A;  5J9B A;  4AJ6 A;  3HZ8 A;  4X43 A;  4NPB A;  1O85 A;  4KE3 A;  2VL9 A;  3ERG A;  1V57 A;  1V40 A;  2V6K A;  4IGJ A;  3CMI A;  4G2E A;  3VWW A;  2FA8 A;  4OO4 A;  2GVP A;  1O7U A;  3IRA A;  1THX A;  5IMZ A;  1ERW A;  3E0U A;  4EUY A;  2WB9 A;  1ST9 A;  6GSS A;  3KMO A;  2R5G A;  2TIR A;  1O8W A;  3APO A;  4MLY A;  4V2L A;  3CSJ A;  2DML A;  2P5R A;  2C1Y A;  1Q4J A;  1S3D A;  2KUC A;  2VCV A;  1PX6 A;  1EOH A;  3US3 A;  4HQZ A;  4WKW A;  1DSB A;  4ZL8 A;  1PSQ A;  2FWF A;  1F9M A;  3VWU A;  3PH9 A;  2K8S A;  4LA1 A;  1XCC A;  5ECO B;  2E2G A;  4TR3 A;  4ILF A;  4MJB A;  4IEL A;  4BVX A;  1DE2 A;  3ME8 A;  3TGZ A;  1ZMA A;  2YOI A;  3M8N A;  6GST A;  1MDI A;  1GSU A;  3HJP A;  1T4Z A;  3IA1 A;  1T7P B;  4KW6 A;  1PN9 A;  3Q19 A;  3RBT A;  2JSZ A;  3E3E A;  4Q5Q A;  4XS4 B;  4YQU A;  4ECB A;  1QFN A;  4WBJ A;  1MDJ A;  2L57 A;  4KGI A;  5D9X A;  3LXZ A;  4HJ2 A;  4KB3 A;  1K3L A;  5DAL A;  5A4W A;  4N11 A;  2MYG A;  1TRV A;  1EP7 A;  4EVM A;  1O8X A;  3K8N A;  4HQS A;  1J08 A;  1JZO A;  4TRX A;  5ID2 B;  2DSA A;  1EGO A;  3QAG A;  5IMV A;  1XOA A;  2VM2 A;  5HR2 A;  4K9Z A;  2IL3 A;  1C72 A;  3QCP A;  4XRA A;  4IW9 A;  2R2J A;  3KXO A;  1G6Y A;  1V98 A;  3M1G A;  1XWG A;  1OE8 A;  3ZYW A;  3ZZX A;  3IAS 2;  1Z7R A;  3TOT A;  4GCI A;  2PVQ A;  3FKF A;  2GQL A;  3QFA C;  1IYH A;  3TRP A;  3M3M A;  3GNJ A;  5IOX A;  1G6W A;  2I9H A;  4EL1 A;  5B6N A;  2O8V B;  2C3T A;  3UAR A;  2VOC A;  3GHA A;  4Z7X A;  3TKS A;  4YQM A;  5G2Z A;  2IWT A;  1O73 A;  2YAN A;  2V32 A;  1TK0 B;  1KNG A;  2I81 A;  3F6F A;  2JZS A;  2L4Q A;  1XW9 A;  3TJF A;  4POB A;  2LQO A;  4KSM A;  3H4K A;  4P3Y B;  1YY7 A;  2L6D A;  1U3I A;  2WS2 A;  5ELA A;  1ZGN A;  1GSD A;  2FGX A;  3A2V A;  1Z5Y E;  3KH9 A;  4J2F A;  1M7T A;  1T1V A;  3MAK A;  1BX9 A;  2C3Q A;  5DCG A;  4L0U A;  2C4J A;  3L9V A;  3QAV A;  4EO3 A;  2E2M A;  2N5F A;  2NDO A;  5EY6 A;  2VCW A;  3C73 A;  4DEJ A;  3GUR A;  2V2G A;  2X8G A;  2B1K A;  4MK3 A;  2YZH A;  1CQG A;  3IAM 2;  4KDY A;  1URM A;  1WP0 A;  3Q74 A;  4K0N A;  2YWN A;  3DWV A;  4NV5 A;  3H8Q A;  3GKX A;  5HR3 A;  4GQC A;  1U3A A;  2A2R A;  4V2N A;  1AAZ A;  2I4A A;  4PX1 A;  3NIV A;  2YJH A;  3KP8 A;  1NW2 A;  3QR6 A;  3Q6O A;  10GS A;  2H1D A;  5D96 A;  2MMZ A;  2AUV A;  3F9U A;  5CRW A;  2B5Y A;  5G5F A;  1EGR A;  4JR4 A;  5FHI A;  2DC5 A;  4DSS A;  2GLR A;  2YV9 A;  3FHK A;  5DBQ A;  1QUW A;  2GQK A;  2H30 A;  3F4T A;  2GTU A;  5COH A;  1PGT A;  2VL2 C;  1Z9H A;  1RK4 A;  5EPF A;  4N0Z A;  4Q5F A;  2O89 A;  3F4R A;  1Z6N A;  3FEU A;  3KH7 A;  4OD7 A;  1QMV A;  5KN0 A;  1HQO A;  1VF1 A;  4I97 A;  2PUK C;  2ON7 A;  3GKN A;  2I1U A;  5IPH A;  2LJK A;  3DVW A;  4O32 A;  1M9A A;  2L6C A;  1AQV A;  3EC3 A;  2NVL A;  2VCQ A;  3C7M A;  4JRR A;  1SKR B;  2PWJ A;  5GST A;  2L4C A;  2PMT A;  2EIQ A;  3C1S A;  3DGQ A;  1W4V A;  4L5L A;  2PPT A;  4HZ4 A;  3U5R E;  3TKR A;  2H8L A;  2GGT A;  5ECR B;  4KAE A;  1LBK A;  2FCH A;  2H1A A;  3Q18 A;  3D4T A;  5ENU A;  1OYJ A;  5HR1 A;  1EP8 A;  1B4Q A;  3EWL A;  2FD3 A;  4F82 A;  4ISD A;  4HS1 A;  5ECL B;  1M0U A;  1GUH A;  1R5A A;  2OKA A;  1YZX A;  4D73 B;  1UC7 A;  2K18 A;  5F05 A;  5A4V A;  2HNL A;  4J57 E;  3GA4 A;  1F6M C;  3N5O A;  3BCI A;  1WIK A;  3A2X A;  2VCZ A;  4KA0 A;  4IQ1 A;  3EMX A;  2LRT A;  3C8E A;  3TRX A;  2QSI A;  3TKP A;  3M9K A;  2FA4 A;  1EV9 A;  3GV1 A;  2H01 A;  1OC8 A;  2JU5 A;  3ISO A;  4HU7 A;  3D5J A;  1WJK A;  3QDN A;  4BA7 A;  1O6J A;  5H5R A;  1EZK A;  3P90 A;  3MDK A;  4E8H A;  4NHZ A;  1ZYE A;  1DUG A;  3BJ5 A;  2J9H A;  2EIR A;  5D9T A;  4PQ1 A;  3D4M A;  4L8E A;  1OC3 A;  2GQM A;  3BD2 A;  3GL3 A;  5G30 A;  3ZVJ A;  5J5N A;  1IYI A;  4ID0 A;  2HSH A;  4G10 A;  3PIN A;  1SKW B;  3UIW A;  4LMW A;  4WR4 A;  4GLT A;  2ZNM A;  1JHB A;  1H4O A;  3D22 A;  2GSR A;  3L9S A;  3EIN A;  1VRS D;  1F2E A;  1TK8 B;  2VO4 A;  4TXO A;  4MF7 A;  2WDU A;  2ON5 A;  3TJJ A;  1GLP A;  3UVH A;  3LGC A;  1SK1 A;  2GT5 A;  2R37 A;  2RM5 A;  3FY7 A;  4MCU A;  4JED A;  2YWO A;  4GWR A;  5DAL B;  2A4V A;  1X9S B;  2DJ0 A;  5HQP A;  3HHV A;  1ILO A;  3P2A A;  4V2M A;  3TB2 A;  1YJ6 A;  3HY2 A;  1R4W A;  1LJR A;  4KX4 A;  1GSS A;  2OE3 A;  3IK7 A;  4F0B A;  5EVO A;  2LNT A;  2GZP A;  1Z3E A;  1FVJ A;  2H75 A;  2C8U A;  2B1L A;  1YDK A;  1A0F A;  2IMI A;  5ABR A;  2YWM A;  5DAK A;  5DVB A;  4K1F A;  4L5O A;  4TN8 A;  2DIY A;  2GT6 A;  1PKZ A;  3F4S A;  3I43 A;  1VGL A;  4YAP A;  3LFL A;  3WT2 A;  3TRQ A;  1EWX A;  3CBU A;  3TCO A;  1ML6 A;  3J7Y b;  4N30 A;  4OMV A;  5KEJ A;  3TKS C;  3ERF A;  2H72 A;  2HSY A;  1YF0 A;  3IHQ A;  1A24 A;  4BPY A;  2N5B A;  4KCA A;  3GRX A;  1W89 A;  2L59 A;  4GF0 A;  2F3M A;  1HNB A;  3VLN A;  4IQA A;  3C1R A;  3GKK A;  3WGE A;  1SD8 A;  4GRF A;  4GQF A;  2TRC P;  1A2L A;  2FUG 2;  3HVX A;  2JZR A;  1B48 A;  1X9W B;  4MF5 A;  3GIX A;  3I6A A;  1YKC A;  4HDE A;  4ZBD A;  4E8E A;  1JZD A;  2WRT A;  4MH3 A;  3HXS A;  3ME7 A;  1T3B A;  3RPN A;  2CAQ A;  2ZUP A;  2B5E A;  2XPD A;  4I6X A;  3FK8 A;  5GAP D;  3HVV A;  4N10 A;  3EE2 A;  4ZIJ A;  5G5E A;  3ED3 A;  4KND A;  4MZC A;  1I9D A;  2OA7 A;  1T4Y A;  4X0X A;  3LYP A;  2LS5 A;  4XCS A;  5IMC A;  3D6I A;  3DKS A;  4MH2 A;  1X5C A;  5D93 A;  5IPG A;  1BQ7 A;  2DJ1 A;  1ABA A;  3LOR A;  2IIY A;  1R26 A;  3G7I A;  4POL A;  3ZIT A;  7GSS A;  3O76 A;  3QPM A;  2H6Z A;  5G31 A;  2BJX A;  1B4P A;  4CHS A;  2YN1 A;  2HRN A;  3RDW A;  2FNO A;  2QGV A;  2H0I A;  4WF5 A;  3KM6 A;  4DSS B;  5GAN D;  3EMP A;  3APS A;  2CZ2 A;  3IPZ A;  3QD9 A;  1XBS A;  3GX0 A;  2X64 A;  1MEK A;  3TJG A;  3JCM L;  1TU7 A;  3MSZ A;  4IN0 A;  4AGS A;  4PNG A;  2PER A;  2AHE A;  2P5Q A;  2HYX A;  4LL1 B;  2D2Z A;  17GS A;  3ZRD A;  2OE0 A;  1TK5 B;  1AQW A;  3TJB A;  3MWH A;  4TR1 A;  5C04 A;  1RW1 A;  2PU9 C;  4PUR A;  1PRX A;  4AJ7 A;  1WPI A;  4BWQ A;  2ES7 A;  2RUE A;  2VCT A;  5LD0 A;  4XRD A;  5KN2 A;  3IXR A;  5CRE A;  1JZW A;  2NBS A;  2HI7 A;  1XOB A;  1Y25 A;  1E6B A;  1GTI A;  4MZB A;  2NTO A;  2YWI A;  4IBP A;  3A5W A;  1GNW A;  2IMK A;  2LRC A;  5ECH B;  3GTU A;  3HKR A;  2VAF A;  4ML1 A;  4XIH A;  1K0M A;  4OFT A;  2GDR A;  4RUV A;  4EF0 A;  2MBS A;  2HFD A;  4GTU A;  2F8A A;  4ZB8 A;  2OBK A;  3KIJ A;  1BED A;  1FB0 A;  5CYY A;  1FHE A;  5CRH A;  2L5L A;  5AGY A;  3FR6 A;  4MPG A;  3RPP A;  2X99 A;  4WET A;  5CRG A;  5C00 A;  5IIZ A;  1HD2 A;  2NPB A;  2MMN A;  3UEM A;  3RHC A;  2K8V A;  3DIE A;  1Z7P A;  3FYG A;  3KZQ A;  1GUM A;  3TDG A;  1SYR A;  2C0F A;  4ECJ A;  4ULX A;  1GRX A;  3VPT A;  2M72 A;  4YQV A;  1EV4 A;  4I8B A;  1BJX A;  3KJY A;  1H75 A;  3ZIJ A;  4MJE A;  1QXH A;  2HLS A;  2OBI A;  1ZZY A;  4DVC A;  1SD9 A;  3DVX A;  3M9J A;  1SEN A;  1AUC A;  3W8J A;  1XVQ A;  1WWJ A;  4NWY A;  2PN8 A;  1AQX A;  5DJL A;  4PQH A;  4YH2 A;  3DML A;  1MDK A;  3C71 A;  2A2S A;  4FYC A;  5JCW A;  3BCK A;  2GST A;  4OWY A;  4PGT A;  4PXO A;  1SJZ A;  2B7K A;  2PBJ A;  3QFB C;  4TKY A;  4TXO B;  4YAV A;  5E4W A;  4XS6 A;  2JAD A;  1R7H A;  1B9X C;  2C0G A;  2OJL A;  1CQH A;  1FVK A;  1BG5 A;  4RI6 A;  1X9M B;  2R3X A;  1XFL A;  4H86 A;  3L78 A;  3QAW A;  4K7I A;  1XW5 A;  2O7K A;  4EKZ A;  4K2D A;  4OCF A;  4PUF C;  2C80 A;  3KCM A;  1J9B A;  1M2B A;  2DJJ A;  2H73 A;  2R6K A;  2LV3 A;  4XTS A;  3ZVJ D;  1PD2 1;  2RLI A;  1HNC A;  2G2Q A;  2FY6 A;  5GZZ B;  3IDV A;  5DAK B;  1JLW A;  5KN3 A;  4HOJ A;  2H66 A;  3N9J A;  13GS A;  2YCD A;  4Q5R A;  1TP9 A;  2DMM A;  11GS A;  4NAX A;  3S9F A;  3UBL A;  3F63 A;  1OC9 A;  3DYR A;  2YNX A;  2FWG A;  5ECM B;  2MZC A;  4EXJ A;  4AF2 A;  2FWH A;  2PGT A;  3W6G A;  3P8W A;  6GSY A;  4ZB9 A;  20GS A;  2ZCT A;  2YPM A;  3UAP A;  2VD1 A;  1A2J A;  1V9W A;  2YP6 A;  3KD0 A;  4OFM A;  5FT3 A;  1U87 A;  5CRD A;  5F0G A;  5DQY A;  2H0G A;  4L0W A;  2LRN A;  3FW2 A;  3G9B A;  3ZFB A;  1E2Y A;  5J41 A;  2EC4 A;  2HE3 A;  2O87 A;  3EYT A;  2H70 A;  3FZ9 A;  1ZCP A;  1TOF A;  4MA9 A;  2MBT A;  4ZBA A;  3LYK A;  1TKD B;  2XHF A;  3I9V 2;  3J7Y k;  4LLR A;  1A23 A;  4FH8 A;  1V58 A;  4RQX A;  2C0E A;  2DBC A;  3EVI A;  3HYP A;  3ZML A;  3PGT A;  3ZRE A;  1SK2 A;  3GSS A;  2F8F A;  3CYN A;  2H6X A;  2EIO A;  1I5G A;  3UVT A;  3H79 A;  3F3Q A;  5JWQ B;  4IP6 A;  3G7Y A;  2DJ2 A;  1X5E A;  3SWL A;  2V6O A;  5J3R A;  4KDU A;  5IMD A;  5H5Q A;  1TJD A;  1NSW A;  4I5Q A;  3NZN A;  1JFU A;  4IJ3 A;  2HZE A;  2CT6 A;  3HDC A;  3BBY A;  1GSQ A;  1TU8 A;  2QC7 A;  3IOS A;  2H71 A;  4F0C A;  5J4U A;  2IFQ A;  5IQY A;  4TW5 A;  4IP1 A;  4IJI A;  3GL5 A;  3KTB A;  3H1N A;  2P0G A;  2H6Y A;  2X8C A;  2VIM A;  4BVY A;  4HUA A;  2F9S A;  2IME A;  2DJ3 A;  1PMT A;  4QL7 A;  2IN3 A;  4O92 A;  1XWA A;  2KHP A;  1KBN A;  2H1G A;  4AJ8 A;  5FWG A;  3O6T A;  2MMA A;  2C0D A;  2K6V A;  1KEB A;  1VF4 A;  1NM3 A;  3CXG A;  4V1A p;  3VI7 A;  1M99 A;  2VCX A;  5B7C A;  1MD4 A;  1K0D A;  4ZXG A;  2H76 A;  4TR1 B;  5F8B A;  2B3S A;  4KCE A;  3HA9 A;  1UA5 A;  5ECS A;  4HI7 A;  2LNS A;  1GTA A;  4MMM A;  2C3N A;  2GZZ A;  3LWA A;  1BYE A;  1ZOF A;  3KEB A;  1UVZ A;  5HFI A;  1K3O A;  3HJM A;  1MD3 A;  5DQS A;  2BTO T;  1AXD A;  1PL1 A;  1ZYQ B;  2KP1 A;  3CTG A;  1GUL A;  2FHE A;  3LG6 A;  4EDZ A;  4ECI A;  1FAA A;  1OE7 A;  2GSQ A;  1K0A A;  3VUR A;  5CAX A;  3GTU B;  4ZL9 A;  2XBQ A;  2JL4 A;  4PQI A;  4DSR A;  5LNK e;  3FZA A;  1WOU A;  1K0O A;  4IVF A;  2LQQ A;  3V1W A;  3ZL5 A;  5JCG A;  4BWS A;  22GS A;  2LUS A;  3CSI A;  4WF4 A;  1SKS B;  5AIX A;  5EL8 A;  2LKU A;  2AYT A;  1QGV A;  3RAZ A;  1SL2 B;  4ZL7 A;  4HZ2 A;  4KSO A;  2IMF A;  2JZT A;  2AJQ B;  1DBY A;  1K0N A;  4FYB A;  4NV2 A;  1XXU A;  2LJR A;  6GSU A;  1OVN A;  2PVO C;  2WCI A;  1JZR A;  1F3B A;  2MMO A;  3MNG A;  3KGK A;  1GLQ A;  3ERW A;  1AC1 A;  3TKS E;  2REM A;  3KTL A;  3VK9 A;  2JSY A;  1EEJ A;  2CVD A;  2OE1 A;  1R5P A;  1K0B A;  2HT9 A;  1FB6 A;  1VF2 A;  4ML6 A;  4CDO A;  1YEX A;  5IM9 A;  4MJC A;  3GX8 A;  3KP9 A;  3ZFL A;  16GS A;  2GSS A;  2E7P A;  3BOA A;  3R2Q A;  2HZF A;  1QQ2 A;  4I2T A;  3UBK A;  5ECI B;  1X5D A;  4K7N A;  3L4N A;  4MP4 A;  3QOU A;  1WE0 A;  3L9U A;  1SJI A;  1GWC A;  1FO5 A;  1A8Y A;  1M2A A;  4MAB A;  2FLS A;  4XHM A;  3IE3 A;  1A8L A;  4JE1 A;  5F06 A;  4IHU A;  2XPE A;  4TXV A;  2B5X A;  3GH9 A;  3FRC A;  2KP2 A;  2LJA A;  1SYX A;  3HD5 A;  1GSE A;  3LQ7 A;  1T00 A;  5J9C A;  4F03 A;  4X1U A;  1M2D A;  2YJ7 A;  4N0V A;  2CVK A;  4F2I A;  3IR4 A;  3ZMK A;  4KUN A;  5B8B A;  1TI1 A;  1Q98 A;  1PA3 A;  4PUA A;  3W8S A;  2VUP A;  1T8E B;  4RQR A;  2XC2 A;  1XVW A;  4LL4 B;  4GSN A;  1VF3 A;  1YF1 A;  1LU4 A;  3GUS A;  3VPQ A;  4G9H A;  3HZ4 A;  3RHB A;  3WD6 A;  2DJK A;  3CRU A;  3VFI A;  4QL9 A;  2WZ9 A;  1SL0 B;  5A5K A;  1OKT A;  1OC9 B;  3A3T A;  19GS A;  3FZ5 A;  2H1B A;  2VD0 A;  4EE0 A;  2H0H A;  3EU4 A;  2N5A A;  1SU9 A;  4MDC A;  1V2A A;  1HNA A;  2J23 A;  4JR6 A;  4NHW A;  4JZQ A;  2CX3 A;  3LSZ A;  1KTE A;  1QK8 A;  1BAY A;  3F0I A;  4MJA A;  2P31 A;  4G19 A;  3HJO A;  4CW9 A;  5IOW A;  1XW6 A;  1DE1 A;  5A4U A;  1WRY A;  2KOK A;  4KDX A;  1ACV A;  1TI3 A;  3IV4 A;  5D9V A;  3F3R A;  2V1M A;  3DD3 A;  14GS A;  4XS4 A;  4RI7 A;  2HXK A;  3I69 A;  4ZIL A;  1F37 A;  2GS3 A;  1NHY A;  2E0Q A;  12GS A;  5H5S A;  4FO5 A;  4LMV A;  5KN1 A;  4XS1 A;  4TR4 A;  4JBB A;  2BMX A;  2HRF A;  2WGR A;  4TR0 A;  5JWR B;  3UMA A;  2FWE A;  3APQ A;  3GMF A;  3QMX A;  3GFK A;  2LST A;  4K8M A;  3ZLP A;  1F3A A;  5CNW A;  4POK A;  2YZU A;  2IPA A;  1GP1 A;  1HYU A;  5ID2 A;  3EU3 A;  5B6M A;  2AV4 A;  3A2W A;  3KMN A;  2DLX A;  1PKW A;  1A0R P;  1GTB A;  5IMA A;  3D0Z A;  4ACS A;  1GSF A;  1WMJ A;  4IS0 A;  2HZE B;  1PL2 A;  3CSH A;  2JAC A;  1G7O A;  1N2A A;  4TVE A;  4KH7 A;  2IFQ B;  5L71 A;  4EDY A;  1GTU A;  5ECK B;  4PNF A;  4GST A;  1K0C A;  1B8X A;  1USB A;  1AIU A;  2CQ9 A;  5IMF A;  2KLX A;  4POM A;  1UN2 A;  2CA8 A;  5INY A;  5AIV A;  4K0G A;  1A2M A;  4WXT A;  4V1A g;  2X8H A;  2IJY A;  3F6D A;  8GSS A;  3ZIV A;  1O81 A;  2OAC A;  3VI5 A;  4ECC A;  1NHO A;  3UJ1 A;  3LXT A;  2VLU A;  5HR0 A;  3AY8 A;  1ERV A;  4WEY A;  3CTF A;  4OCE A;  3E9J B;  4K7O A;  1SJ6 A;  3UL3 A;  1XWC A;  2ALB A;  5HFK A;  1XWB A;  3GN3 A;  3IBH A;  2CZ3 A;  1ERU A;  2AAW A;  3GH6 A;  1MTC A;  2CV4 A;  1TXX A;  1GH2 A;  1M9B A;  3F8U A;  4NXI A;  2RII A;  3M0F A;  5B8A A;  3WGX A;  2CX4 A;  2OAD A;  5G1K A;  5G1L A;  3L0H A;  3TUE A;  1XPV A;  4O5R A;  4QQ7 A;  4WBR D;  2WUL A;  3HVS A;  6GSV A;  2V41 A;  5GSS A;  1XIY A;  2H74 A;  4HEA 2;  4TOP A;  2AB6 A;  5DJM A;  1G7E A;  1SK0 A;  4HU9 A;  9GSS A;  1N8J A;  2I3Y A;  1XWK A;  1TDI A;  4K6X A;  1AW9 A;  4O7H A;  2O85 A;  1YEP A;  6GSX A;  4HJM A;  2WJU A;  4ZB6 A;  3EUR A;  1TW9 A;  3OR5 A;  1TRS A;  2B6M A;  2VLT A;  4IKH A;  1OAZ A;  3UOM A;  1TTZ A;  1Y6E A;  3WT1 A;  4J56 E;  5IO2 A;  4MF6 A;  1GNE A;  3DRN A;  2H19 A;  2XBI A;  1Z6M A;  5ECQ B;  1SL1 B;  1TRU A;  5ELG A;  2Z9S A;  3O3T A;  2B7J A;  1TRW A;  1G0T A;  1S3C A;  3WGD A;  5E59 A;  2IMD A;  5HFG A;  4EC0 A;  1ON4 A;  1FG4 A;  1RQM A;  3GYK A;  4NMU A;  5ECP B;  3FR9 A;  4OO5 A;  2CAI A;  3LEF A;  2WFC A;  1OKD A;  2M80 A;  4WR5 A;  1YQ1 A;  2VL3 A;  4DSQ A;  3P7X A;  1THO A;  1JLV A;  2GZY A;  3CRT A;  4JU5 A;  5D73 A;  2G0F A;  5JCU A;  2VM1 A;  3TOU A;  3H93 A;  3VWX A;  2LEG A;  1PX7 A;  4FYU A;  3U6V A;  2VL2 A;  5DDL A;  1XZO A;  3SBC A;  3VWV A;  1EEM A;  1GL8 A;  1B9Y C;  3ZTL A;  1YKA A;  5CO3 A;  1ZL9 A;  1S3A A;  2DIZ A;  2RUF A;  3FR3 A;  5F07 A;  5D8I A;  2RM6 A;  4BL7 A;  3GKM A;  4I2U A;  4GXZ A;  2CVB A;  5AN1 A;  3G7J A;  3DEX A;  1FW1 A;  3TJK A;  5ECN B;  1K3Y A;  3WYW A;  2K9F A;  6GSW A;  4GSS A;  2L5O A;  2YV7 A;  2M46 A;  1PQN A;  2VLV A;  3LJR A;  3D21 A;  2LTK A;  3IK9 A;  5DCH A;  4F9Z A;  5AIS A;  3HCZ A;  5CP1 A;  1EOG A;  5LCZ A;  3IC4 A;  3NOF A;  4MPF A;  1ERT A;  1J0F A;  5D9W A;  3GST A; 
#chains in the Genus database with same CATH topology
 1X0R A;  4Q5N A;  1U6T A;  1U88 A;  2F51 A;  1GSY A;  4ZBB A;  2R4V A;  2TRX A;  4K5R A;  3DXB A;  18GS A;  1FOV A;  3TKQ A;  2QKE A;  3FZ4 A;  3PR8 A;  4MZW A;  5IO0 A;  4FIW A;  5JWO B;  4OFN A;  4D73 A;  1GUK A;  5J9B A;  4AJ6 A;  3HZ8 A;  4X43 A;  4NPB A;  1O85 A;  4KE3 A;  2VL9 A;  3ERG A;  1V57 A;  1V40 A;  2V6K A;  4IGJ A;  3CMI A;  2R0G A;  4G2E A;  3VWW A;  2FA8 A;  4OO4 A;  2GVP A;  1O7U A;  3IRA A;  1THX A;  5IMZ A;  1ERW A;  3E0U A;  4EUY A;  2WB9 A;  1ST9 A;  6GSS A;  3KMO A;  2R5G A;  2QA2 A;  1PFO A;  2TIR A;  1O8W A;  3APO A;  4MLY A;  4V2L A;  3CSJ A;  2DML A;  2P5R A;  2C1Y A;  1Q4J A;  1S3D A;  2KUC A;  2VCV A;  1PX6 A;  1EOH A;  3US3 A;  4HQZ A;  1FOH A;  5KOX A;  4WKW A;  1DSB A;  4ZL8 A;  1PSQ A;  2FWF A;  1F9M A;  3VWU A;  3PH9 A;  1PN0 A;  2K8S A;  4LA1 A;  1XCC A;  5ECO B;  2E2G A;  4TR3 A;  3FMW A;  4ILF A;  4MJB A;  4IEL A;  4BVX A;  1DE2 A;  3ME8 A;  3TGZ A;  1ZMA A;  2YOI A;  3M8N A;  6GST A;  1MDI A;  1GSU A;  3HJP A;  1T4Z A;  3IA1 A;  1T7P B;  4KW6 A;  1PN9 A;  3Q19 A;  3RBT A;  2JSZ A;  3E3E A;  4Q5Q A;  4XS4 B;  4YQU A;  4ECB A;  1QFN A;  4WBJ A;  1MDJ A;  2L57 A;  4KGI A;  5D9X A;  3LXZ A;  4HJ2 A;  4KB3 A;  1K3L A;  4G0I A;  5DAL A;  5A4W A;  4N11 A;  2MYG A;  1TRV A;  1EP7 A;  4EVM A;  1O8X A;  3K8N A;  4HQS A;  1J08 A;  1JZO A;  4TRX A;  5ID2 B;  2DSA A;  1EGO A;  3QAG A;  5IMV A;  1XOA A;  2VM2 A;  5HR2 A;  4K9Z A;  2IL3 A;  1C72 A;  3QCP A;  4XRA A;  4IW9 A;  2R2J A;  3KXO A;  1G6Y A;  1V98 A;  3M1G A;  1S3R A;  1XWG A;  1OE8 A;  3ZYW A;  3ZZX A;  3IAS 2;  1Z7R A;  3TOT A;  4YKF A;  4GCI A;  2PVQ A;  3FKF A;  2GQL A;  3QFA C;  1IYH A;  3TRP A;  3M3M A;  3GNJ A;  5IOX A;  3CQF A;  1G6W A;  2I9H A;  4EL1 A;  5B6N A;  2O8V B;  2C3T A;  3UAR A;  2VOC A;  3GHA A;  4Z7X A;  3TKS A;  4YQM A;  5G2Z A;  2IWT A;  1O73 A;  2YAN A;  2V32 A;  1TK0 B;  1KNG A;  2I81 A;  3F6F A;  2JZS A;  2L4Q A;  1XW9 A;  3TJF A;  4POB A;  2LQO A;  4KSM A;  3H4K A;  4P3Y B;  1YY7 A;  2L6D A;  1U3I A;  2WS2 A;  5ELA A;  1ZGN A;  2QA1 A;  1GSD A;  2FGX A;  3A2V A;  1Z5Y E;  3KH9 A;  4J2F A;  1M7T A;  1T1V A;  3MAK A;  1BX9 A;  2C3Q A;  5DCG A;  4L0U A;  1M3J A;  2C4J A;  3L9V A;  3QAV A;  4EO3 A;  2E2M A;  2N5F A;  2NDO A;  5EY6 A;  2VCW A;  3C73 A;  4DEJ A;  3GUR A;  2V2G A;  2X8G A;  2B1K A;  4MK3 A;  2YZH A;  1CQG A;  3IAM 2;  4KDY A;  1URM A;  1WP0 A;  3Q74 A;  4K0N A;  2YWN A;  3DWV A;  4NV5 A;  3H8Q A;  3GKX A;  5HR3 A;  2X49 A;  4GQC A;  1U3A A;  2A2R A;  4V2N A;  1AAZ A;  2I4A A;  4PX1 A;  3NIV A;  2YJH A;  3KP8 A;  1NW2 A;  3QR6 A;  3Q6O A;  10GS A;  2H1D A;  5D96 A;  2MMZ A;  2AUV A;  3F9U A;  5CRW A;  2B5Y A;  5G5F A;  4EIP A;  1EGR A;  4JR4 A;  5FHI A;  2DC5 A;  4DSS A;  2GLR A;  4FQU A;  2YV9 A;  3FHK A;  3MYD A;  5DBQ A;  1QUW A;  2GQK A;  2H30 A;  3F4T A;  2GTU A;  5COH A;  1PGT A;  4A5P A;  2VL2 C;  1Z9H A;  1RK4 A;  5EPF A;  4N0Z A;  4Q5F A;  2O89 A;  3F4R A;  1Z6N A;  3FEU A;  3KH7 A;  4OD7 A;  1QMV A;  5KN0 A;  1HQO A;  1VF1 A;  4I97 A;  2PUK C;  2ON7 A;  3GKN A;  2I1U A;  5IPH A;  2LJK A;  3DVW A;  4O32 A;  1M9A A;  2L6C A;  1AQV A;  3EC3 A;  2NVL A;  2VCQ A;  3C7M A;  4JRR A;  4BL7 B;  1SKR B;  2PWJ A;  5GST A;  2L4C A;  2PMT A;  2EIQ A;  3C1S A;  3DGQ A;  1W4V A;  4L5L A;  2PPT A;  4HZ4 A;  3U5R E;  3TKR A;  3R3E A;  2H8L A;  1ZYN A;  2GGT A;  5ECR B;  4KAE A;  1LBK A;  2FCH A;  2H1A A;  3Q18 A;  3D4T A;  5ENU A;  1OYJ A;  5HR1 A;  1EP8 A;  1B4Q A;  3EWL A;  2FD3 A;  4F82 A;  4ISD A;  4HS1 A;  5ECL B;  1M0U A;  1GUH A;  1R5A A;  2OKA A;  1YZX A;  4D73 B;  1UC7 A;  2K18 A;  5F05 A;  5A4V A;  2HNL A;  4J57 E;  3GA4 A;  1F6M C;  3N5O A;  3BCI A;  1WIK A;  5KOW A;  3A2X A;  2VCZ A;  4KA0 A;  4IQ1 A;  3EMX A;  2LRT A;  3C8E A;  5BRT A;  3TRX A;  2QSI A;  3TKP A;  3M9K A;  2FA4 A;  1EV9 A;  3GV1 A;  2H01 A;  1OC8 A;  2JU5 A;  3ISO A;  4HU7 A;  3D5J A;  1WJK A;  3QDN A;  4BA7 A;  1O6J A;  5H5R A;  1EZK A;  3P90 A;  3MDK A;  4E8H A;  4NHZ A;  1ZYE A;  1DUG A;  3BJ5 A;  2J9H A;  2EIR A;  5D9T A;  4PQ1 A;  3D4M A;  4L8E A;  1M3I A;  1OC3 A;  2GQM A;  3BD2 A;  3GL3 A;  5G30 A;  3ZVJ A;  5J5N A;  1IYI A;  4Z2U A;  4ID0 A;  2HSH A;  4G10 A;  3PIN A;  1SKW B;  3UIW A;  4BVX B;  4LMW A;  4WR4 A;  4GLT A;  2ZNM A;  1JHB A;  1H4O A;  3D22 A;  2GSR A;  3L9S A;  3EIN A;  1VRS D;  1F2E A;  1TK8 B;  2VO4 A;  4TXO A;  4MF7 A;  2WDU A;  2ON5 A;  3TJJ A;  4K5S A;  1GLP A;  3UVH A;  3LGC A;  1SK1 A;  2GT5 A;  2R37 A;  2RM5 A;  3FY7 A;  4MCU A;  4JED A;  2YWO A;  4GWR A;  5DAL B;  2A4V A;  1X9S B;  2DJ0 A;  5HQP A;  3HHV A;  1ILO A;  3P2A A;  4V2M A;  3TB2 A;  1YJ6 A;  3HY2 A;  1R4W A;  1LJR A;  4KX4 A;  1GSS A;  2OE3 A;  3IK7 A;  4F0B A;  5EVO A;  2LNT A;  2GZP A;  1Z3E A;  1FVJ A;  2H75 A;  2C8U A;  2B1L A;  1YDK A;  1A0F A;  2IMI A;  5ABR A;  2YWM A;  5DAK A;  5DVB A;  4K1F A;  4L5O A;  4TN8 A;  2DIY A;  2GT6 A;  1PKZ A;  3F4S A;  3I43 A;  4KF9 A;  1VGL A;  4YAP A;  3LFL A;  3WT2 A;  3TRQ A;  1EWX A;  3CBU A;  3TCO A;  3MIX A;  1ML6 A;  3J7Y b;  4N30 A;  4OMV A;  5KEJ A;  3TKS C;  3ERF A;  4MNN A;  2H72 A;  2HSY A;  1YF0 A;  3IHQ A;  1A24 A;  4BPY A;  2N5B A;  4KCA A;  3GRX A;  1W89 A;  2L59 A;  4GF0 A;  2F3M A;  1HNB A;  3VLN A;  4IQA A;  2DKI A;  3C1R A;  3GKK A;  3WGE A;  1SD8 A;  4GRF A;  4GQF A;  2TRC P;  1A2L A;  2FUG 2;  3HVX A;  2JZR A;  1B48 A;  1X9W B;  4MF5 A;  3GIX A;  3I6A A;  1YKC A;  4HDE A;  4ZBD A;  4E8E A;  1JZD A;  2WRT A;  4MH3 A;  3HXS A;  3ME7 A;  1T3B A;  3RPN A;  2CAQ A;  2ZUP A;  2B5E A;  2XPD A;  4I6X A;  3FK8 A;  5GAP D;  3HVV A;  4N10 A;  3EE2 A;  4ZIJ A;  5G5E A;  3ED3 A;  4KND A;  4MZC A;  1I9D A;  2OA7 A;  1T4Y A;  4X0X A;  3LYP A;  2LS5 A;  4XCS A;  5IMC A;  3D6I A;  3DKS A;  4MH2 A;  1X5C A;  5D93 A;  5IPG A;  1BQ7 A;  2DJ1 A;  1ABA A;  3LOR A;  2IIY A;  1R26 A;  3G7I A;  4POL A;  3ZIT A;  7GSS A;  2UZ8 A;  3O76 A;  3QPM A;  2H6Z A;  5G31 A;  2BJX A;  1B4P A;  4CHS A;  2X4A A;  2YN1 A;  2HRN A;  3RDW A;  2FNO A;  2QGV A;  2H0I A;  4WF5 A;  3KM6 A;  4DSS B;  5GAN D;  3EMP A;  3APS A;  2CZ2 A;  3IPZ A;  3QD9 A;  1XBS A;  3GX0 A;  2X64 A;  1MEK A;  3TJG A;  3JCM L;  1TU7 A;  3MSZ A;  4IN0 A;  4AGS A;  4PNG A;  2PER A;  2AHE A;  2P5Q A;  2HYX A;  4LL1 B;  2D2Z A;  17GS A;  3ZRD A;  2OE0 A;  1TK5 B;  1AQW A;  3TJB A;  3MWH A;  4TR1 A;  5C04 A;  1RW1 A;  2PU9 C;  4PUR A;  1PRX A;  4AJ7 A;  1WPI A;  4BWQ A;  2ES7 A;  2RUE A;  2VCT A;  5LD0 A;  4XRD A;  5KN2 A;  3IXR A;  5CRE A;  1JZW A;  2NBS A;  2HI7 A;  1XOB A;  1Y25 A;  1E6B A;  1GTI A;  4MZB A;  2NTO A;  4PTS A;  2YWI A;  4IBP A;  3A5W A;  1GNW A;  2IMK A;  2LRC A;  5ECH B;  3GTU A;  3HKR A;  2VAF A;  4ML1 A;  4XIH A;  1K0M A;  4OFT A;  2GDR A;  4RUV A;  4EF0 A;  3IC8 A;  2MBS A;  2HFD A;  4GTU A;  2F8A A;  4ZB8 A;  2OBK A;  3KIJ A;  1BED A;  1FB0 A;  5CYY A;  1FHE A;  5CRH A;  2L5L A;  5AGY A;  3FR6 A;  4MPG A;  3RPP A;  2X99 A;  4WET A;  5CRG A;  5C00 A;  5IIZ A;  1HD2 A;  2NPB A;  2MMN A;  3UEM A;  3RHC A;  2K8V A;  3DIE A;  1Z7P A;  3FYG A;  3KZQ A;  4CY6 A;  1GUM A;  3TDG A;  1SYR A;  2C0F A;  4ECJ A;  4ULX A;  4CY8 A;  1GRX A;  3VPT A;  2M72 A;  4YQV A;  1EV4 A;  4I8B A;  1BJX A;  3KJY A;  1H75 A;  3ZIJ A;  4MJE A;  1QXH A;  2HLS A;  2OBI A;  1ZZY A;  4DVC A;  1SD9 A;  3DVX A;  2R0C A;  3M9J A;  1SEN A;  1AUC A;  3W8J A;  1XVQ A;  1WWJ A;  4NWY A;  2PN8 A;  1AQX A;  5DJL A;  4PQH A;  4YH2 A;  3DML A;  1MDK A;  3C71 A;  2A2S A;  4FYC A;  5JCW A;  3BCK A;  1XG8 A;  2GST A;  4OWY A;  4PGT A;  4PXO A;  1SJZ A;  2B7K A;  2PBJ A;  3QFB C;  4TKY A;  4TXO B;  4YKG A;  4YAV A;  5E4W A;  4XS6 A;  2JAD A;  1R7H A;  1B9X C;  2C0G A;  2OJL A;  1CQH A;  1FVK A;  1BG5 A;  4RI6 A;  1X9M B;  2R3X A;  1XFL A;  4H86 A;  3L78 A;  3QAW A;  4K7I A;  1XW5 A;  2O7K A;  4EKZ A;  4K2D A;  4OCF A;  4PUF C;  2C80 A;  3KCM A;  1J9B A;  1M2B A;  2DJJ A;  2H73 A;  2R6K A;  2LV3 A;  4XTS A;  3ZVJ D;  1PD2 1;  2RLI A;  1HNC A;  2G2Q A;  2FY6 A;  5GZZ B;  3IDV A;  5DAK B;  1JLW A;  3LW9 A;  5KN3 A;  4HOJ A;  2H66 A;  2A4H A;  3N9J A;  13GS A;  2YCD A;  4Q5R A;  1TP9 A;  4K2X A;  2DMM A;  11GS A;  4NAX A;  3S9F A;  3UBL A;  3F63 A;  1OC9 A;  3DYR A;  2YNX A;  2FWG A;  5ECM B;  2MZC A;  4EXJ A;  4AF2 A;  2FWH A;  2PGT A;  3W6G A;  4EIQ A;  3P8W A;  6GSY A;  4ZB9 A;  20GS A;  2ZCT A;  2YPM A;  3UAP A;  2VD1 A;  1A2J A;  1V9W A;  2YP6 A;  3KD0 A;  4OFM A;  5FT3 A;  1U87 A;  5CRD A;  5F0G A;  5DQY A;  2H0G A;  4L0W A;  2LRN A;  3FW2 A;  3G9B A;  3ZFB A;  1E2Y A;  5J41 A;  2EC4 A;  2HE3 A;  2O87 A;  3EYT A;  2H70 A;  3FZ9 A;  4USS A;  1ZCP A;  1TOF A;  4MA9 A;  2MBT A;  4ZBA A;  3LYK A;  1TKD B;  2XHF A;  3I9V 2;  3J7Y k;  4LLR A;  1A23 A;  4FH8 A;  1V58 A;  4RQX A;  2C0E A;  2DBC A;  3EVI A;  3HYP A;  3ZML A;  3PGT A;  3ZRE A;  1SK2 A;  3GSS A;  2F8F A;  3CYN A;  2H6X A;  2EIO A;  1I5G A;  3UVT A;  3H79 A;  3F3Q A;  5JWQ B;  4IP6 A;  3G7Y A;  4HSC X;  2DJ2 A;  1X5E A;  3SWL A;  2V6O A;  5J3R A;  4KDU A;  5IMD A;  5H5Q A;  1TJD A;  1NSW A;  4I5Q A;  3NZN A;  1JFU A;  4IJ3 A;  2HZE A;  2CT6 A;  3HDC A;  3BBY A;  1GSQ A;  1TU8 A;  2QC7 A;  3IOS A;  2H71 A;  4F0C A;  5J4U A;  2IFQ A;  5IQY A;  4TW5 A;  4IP1 A;  4IJI A;  3GL5 A;  3KTB A;  2HSM A;  3H1N A;  2P0G A;  2H6Y A;  2X8C A;  2VIM A;  4BVY A;  4HUA A;  2F9S A;  2IME A;  2DJ3 A;  1PMT A;  4QL7 A;  2IN3 A;  4O92 A;  1XWA A;  2KHP A;  1KBN A;  2H1G A;  4AJ8 A;  5FWG A;  3O6T A;  2MMA A;  2C0D A;  2K6V A;  1KEB A;  1VF4 A;  1NM3 A;  3CXG A;  4V1A p;  3VI7 A;  1M99 A;  2VCX A;  5B7C A;  1MD4 A;  1K0D A;  4ZXG A;  2H76 A;  4TR1 B;  5F8B A;  2B3S A;  4KCE A;  3HA9 A;  1UA5 A;  5ECS A;  4HI7 A;  2LNS A;  5BMU A;  1GTA A;  4MMM A;  2C3N A;  2GZZ A;  3LWA A;  1BYE A;  1ZOF A;  3KEB A;  1UVZ A;  5HFI A;  1K3O A;  3HJM A;  1MD3 A;  5DQS A;  2BTO T;  1AXD A;  1PL1 A;  4Z2T A;  1ZYQ B;  2KP1 A;  3CTG A;  4O5U A;  1GUL A;  2FHE A;  3LG6 A;  4EDZ A;  4ECI A;  1FAA A;  1OE7 A;  2GSQ A;  1K0A A;  3VUR A;  5CAX A;  3GTU B;  4ZL9 A;  2XBQ A;  4BIK A;  2JL4 A;  4PQI A;  4DSR A;  5LNK e;  3FZA A;  1WOU A;  1K0O A;  4IVF A;  2LQQ A;  3V1W A;  3ZL5 A;  5JCG A;  4BWS A;  22GS A;  2LUS A;  3CSI A;  4WF4 A;  1SKS B;  5AIX A;  5EL8 A;  2LKU A;  2AYT A;  1QGV A;  3RAZ A;  1SL2 B;  4ZL7 A;  4HZ2 A;  4KSO A;  2IMF A;  2JZT A;  2AJQ B;  1DBY A;  1K0N A;  2HRK A;  4FYB A;  4NV2 A;  1XXU A;  2LJR A;  6GSU A;  3PPU A;  1OVN A;  2PVO C;  2WCI A;  4X4J A;  1JZR A;  1F3B A;  2A2P A;  2MMO A;  3MNG A;  3KGK A;  1GLQ A;  3ERW A;  1AC1 A;  3TKS E;  2REM A;  3KTL A;  3VK9 A;  2JSY A;  1ZYP A;  1EEJ A;  2CVD A;  2OE1 A;  1R5P A;  1K0B A;  2HT9 A;  1FB6 A;  1VF2 A;  4ML6 A;  4CDO A;  1YEX A;  5IM9 A;  4MJC A;  3GX8 A;  3KP9 A;  3ZFL A;  16GS A;  2GSS A;  2E7P A;  3BOA A;  3R2Q A;  2HZF A;  3A5I A;  1QQ2 A;  4I2T A;  3UBK A;  5ECI B;  1X5D A;  4K7N A;  3L4N A;  4MP4 A;  3QOU A;  1WE0 A;  3L9U A;  1SJI A;  1GWC A;  1FO5 A;  1A8Y A;  1M2A A;  4MAB A;  2FLS A;  4XHM A;  3IE3 A;  1A8L A;  4JE1 A;  5F06 A;  4IHU A;  2XPE A;  4TXV A;  2B5X A;  3GH9 A;  3FRC A;  2KP2 A;  2DKH A;  2LJA A;  1SYX A;  3HD5 A;  1GSE A;  3LQ7 A;  1T00 A;  5J9C A;  4F03 A;  4X1U A;  1M2D A;  2YJ7 A;  4N0V A;  2CVK A;  4F2I A;  3IR4 A;  3ZMK A;  4KUN A;  5B8B A;  1TI1 A;  1Q98 A;  1PA3 A;  4PUA A;  3W8S A;  2VUP A;  1T8E B;  4RQR A;  2XC2 A;  1XVW A;  4LL4 B;  4GSN A;  1VF3 A;  1YF1 A;  1LU4 A;  4G0L A;  3GUS A;  3VPQ A;  4G9H A;  3HZ4 A;  3RHB A;  3WD6 A;  2DJK A;  3CRU A;  3VFI A;  4QL9 A;  2WZ9 A;  1SL0 B;  5A5K A;  1OKT A;  1OC9 B;  3A3T A;  19GS A;  3FZ5 A;  4ICY A;  3IHG A;  2H1B A;  2VD0 A;  4EE0 A;  2H0H A;  3EU4 A;  2N5A A;  1SU9 A;  4MDC A;  1V2A A;  1HNA A;  2J23 A;  4JR6 A;  4NHW A;  4JZQ A;  2CX3 A;  3LSZ A;  1KTE A;  1QK8 A;  1BAY A;  3F0I A;  4MJA A;  2P31 A;  4G19 A;  3HJO A;  4CW9 A;  5IOW A;  1XW6 A;  1DE1 A;  5A4U A;  1WRY A;  2KOK A;  4KDX A;  1ACV A;  1TI3 A;  3IV4 A;  5D9V A;  3F3R A;  2V1M A;  3DD3 A;  14GS A;  2HRA A;  4XS4 A;  4RI7 A;  2HXK A;  3I69 A;  4ZIL A;  1F37 A;  2GS3 A;  1NHY A;  2E0Q A;  12GS A;  5H5S A;  4FO5 A;  4LMV A;  5KN1 A;  4XS1 A;  4TR4 A;  4JBB A;  2BMX A;  2HRF A;  2WGR A;  4TR0 A;  5JWR B;  3UMA A;  2FWE A;  3APQ A;  3GMF A;  3QMX A;  3GFK A;  2LST A;  4K8M A;  3ZLP A;  1F3A A;  5CNW A;  4POK A;  2YZU A;  2IPA A;  1GP1 A;  4Z2R A;  1HYU A;  5ID2 A;  3EU3 A;  5B6M A;  2AV4 A;  3A2W A;  3KMN A;  2DLX A;  1PKW A;  1A0R P;  1GTB A;  5IMA A;  3D0Z A;  4O5Q A;  4ACS A;  1GSF A;  1WMJ A;  4IS0 A;  2HZE B;  1PL2 A;  3CSH A;  2JAC A;  1G7O A;  1N2A A;  4TVE A;  4KH7 A;  2IFQ B;  5L71 A;  4EDY A;  1GTU A;  5ECK B;  4PNF A;  4GST A;  1K0C A;  1B8X A;  1USB A;  1AIU A;  2CQ9 A;  5IMF A;  2KLX A;  4POM A;  1UN2 A;  2CA8 A;  5INY A;  5AIV A;  4K0G A;  1A2M A;  4WXT A;  4V1A g;  4BVY B;  2X8H A;  2IJY A;  3F6D A;  8GSS A;  3ZIV A;  1O81 A;  2OAC A;  3VI5 A;  4ECC A;  1NHO A;  3UJ1 A;  3LXT A;  2R0P A;  2VLU A;  5HR0 A;  3AY8 A;  1ERV A;  4WEY A;  3CTF A;  4OCE A;  3E9J B;  4K7O A;  1SJ6 A;  3UL3 A;  1XWC A;  2ALB A;  5HFK A;  1XWB A;  3GN3 A;  3IBH A;  2CZ3 A;  1ERU A;  2AAW A;  3GH6 A;  1MTC A;  2CV4 A;  1TXX A;  1GH2 A;  1M9B A;  3F8U A;  4NXI A;  2RII A;  3M0F A;  5B8A A;  3WGX A;  2CX4 A;  2OAD A;  5G1K A;  5G1L A;  3L0H A;  3TUE A;  1XPV A;  4O5R A;  4QQ7 A;  4WBR D;  2WUL A;  3HVS A;  6GSV A;  2V41 A;  5GSS A;  1XIY A;  2H74 A;  4HEA 2;  4TOP A;  2AB6 A;  5DJM A;  1G7E A;  1SK0 A;  4HU9 A;  9GSS A;  1N8J A;  2I3Y A;  1XWK A;  1TDI A;  4K6X A;  1AW9 A;  4O7H A;  2O85 A;  1YEP A;  6GSX A;  4HJM A;  2WJU A;  4ZB6 A;  3EUR A;  1TW9 A;  3OR5 A;  1TRS A;  2B6M A;  2VLT A;  4IKH A;  1OAZ A;  3UOM A;  1TTZ A;  1Y6E A;  3WT1 A;  4J56 E;  5IO2 A;  4MF6 A;  1GNE A;  3DRN A;  2H19 A;  2XBI A;  1Z6M A;  5ECQ B;  1SL1 B;  1TRU A;  5ELG A;  2Z9S A;  3O3T A;  2B7J A;  1TRW A;  1G0T A;  1S3C A;  3WGD A;  5E59 A;  2IMD A;  5HFG A;  4EC0 A;  1ON4 A;  1FG4 A;  1RQM A;  3GYK A;  4NMU A;  5ECP B;  3FR9 A;  4OO5 A;  2CAI A;  3LEF A;  2WFC A;  1OKD A;  2M80 A;  4WR5 A;  1YQ1 A;  2VL3 A;  4DSQ A;  3P7X A;  1THO A;  1JLV A;  2GZY A;  3CRT A;  4JU5 A;  5D73 A;  2G0F A;  5JCU A;  2VM1 A;  3HVN A;  3TOU A;  3H93 A;  3VWX A;  2LEG A;  1PX7 A;  4FYU A;  3U6V A;  2VL2 A;  5DDL A;  1XZO A;  3SBC A;  3VWV A;  1EEM A;  1GL8 A;  1B9Y C;  3ZTL A;  1YKA A;  5CO3 A;  1ZL9 A;  1S3A A;  3EPT A;  2DIZ A;  2RUF A;  3FR3 A;  5F07 A;  5D8I A;  2RM6 A;  4BL7 A;  3GKM A;  4I2U A;  4GXZ A;  2CVB A;  5AN1 A;  3G7J A;  3DEX A;  1FW1 A;  3TJK A;  5ECN B;  1K3Y A;  3WYW A;  4G0K A;  2K9F A;  6GSW A;  4GSS A;  2L5O A;  2YV7 A;  2M46 A;  1PQN A;  2VLV A;  3LJR A;  3D21 A;  2LTK A;  3IK9 A;  5DCH A;  4F9Z A;  5AIS A;  3HCZ A;  5CP1 A;  1EOG A;  5LCZ A;  3IC4 A;  3NOF A;  4MPF A;  1ERT A;  1J0F A;  5D9W A;  3GST A; 
#chains in the Genus database with same CATH homology
 1X0R A;  4Q5N A;  1U6T A;  1U88 A;  2F51 A;  1GSY A;  4ZBB A;  2R4V A;  2TRX A;  4K5R A;  3DXB A;  18GS A;  1FOV A;  3TKQ A;  2QKE A;  3FZ4 A;  3PR8 A;  4MZW A;  5IO0 A;  4FIW A;  5JWO B;  4OFN A;  4D73 A;  1GUK A;  5J9B A;  4AJ6 A;  3HZ8 A;  4X43 A;  4NPB A;  1O85 A;  4KE3 A;  2VL9 A;  3ERG A;  1V57 A;  1V40 A;  2V6K A;  4IGJ A;  3CMI A;  2R0G A;  4G2E A;  3VWW A;  2FA8 A;  4OO4 A;  2GVP A;  1O7U A;  3IRA A;  1THX A;  5IMZ A;  1ERW A;  3E0U A;  4EUY A;  2WB9 A;  1ST9 A;  6GSS A;  3KMO A;  2R5G A;  2QA2 A;  2TIR A;  1O8W A;  3APO A;  4MLY A;  4V2L A;  3CSJ A;  2DML A;  2P5R A;  2C1Y A;  1Q4J A;  1S3D A;  2KUC A;  2VCV A;  1PX6 A;  1EOH A;  3US3 A;  4HQZ A;  1FOH A;  5KOX A;  4WKW A;  1DSB A;  4ZL8 A;  1PSQ A;  2FWF A;  1F9M A;  3VWU A;  3PH9 A;  1PN0 A;  2K8S A;  4LA1 A;  1XCC A;  5ECO B;  2E2G A;  4TR3 A;  3FMW A;  4ILF A;  4MJB A;  4IEL A;  4BVX A;  1DE2 A;  3ME8 A;  3TGZ A;  1ZMA A;  2YOI A;  3M8N A;  6GST A;  1MDI A;  1GSU A;  3HJP A;  1T4Z A;  3IA1 A;  1T7P B;  4KW6 A;  1PN9 A;  3Q19 A;  3RBT A;  2JSZ A;  3E3E A;  4Q5Q A;  4XS4 B;  4YQU A;  4ECB A;  1QFN A;  4WBJ A;  1MDJ A;  2L57 A;  4KGI A;  5D9X A;  3LXZ A;  4HJ2 A;  4KB3 A;  1K3L A;  4G0I A;  5DAL A;  5A4W A;  4N11 A;  2MYG A;  1TRV A;  1EP7 A;  4EVM A;  1O8X A;  3K8N A;  4HQS A;  1J08 A;  1JZO A;  4TRX A;  5ID2 B;  2DSA A;  1EGO A;  3QAG A;  5IMV A;  1XOA A;  2VM2 A;  5HR2 A;  4K9Z A;  2IL3 A;  1C72 A;  3QCP A;  4XRA A;  4IW9 A;  2R2J A;  3KXO A;  1G6Y A;  1V98 A;  3M1G A;  1XWG A;  1OE8 A;  3ZYW A;  3ZZX A;  3IAS 2;  1Z7R A;  3TOT A;  4YKF A;  4GCI A;  2PVQ A;  3FKF A;  2GQL A;  3QFA C;  1IYH A;  3TRP A;  3M3M A;  3GNJ A;  5IOX A;  1G6W A;  2I9H A;  4EL1 A;  5B6N A;  2O8V B;  2C3T A;  3UAR A;  2VOC A;  3GHA A;  4Z7X A;  3TKS A;  4YQM A;  5G2Z A;  2IWT A;  1O73 A;  2YAN A;  2V32 A;  1TK0 B;  1KNG A;  2I81 A;  3F6F A;  2JZS A;  2L4Q A;  1XW9 A;  3TJF A;  4POB A;  2LQO A;  4KSM A;  3H4K A;  4P3Y B;  1YY7 A;  2L6D A;  1U3I A;  2WS2 A;  5ELA A;  1ZGN A;  2QA1 A;  1GSD A;  2FGX A;  3A2V A;  1Z5Y E;  3KH9 A;  4J2F A;  1M7T A;  1T1V A;  3MAK A;  1BX9 A;  2C3Q A;  5DCG A;  4L0U A;  2C4J A;  3L9V A;  3QAV A;  4EO3 A;  2E2M A;  2N5F A;  2NDO A;  5EY6 A;  2VCW A;  3C73 A;  4DEJ A;  3GUR A;  2V2G A;  2X8G A;  2B1K A;  4MK3 A;  2YZH A;  1CQG A;  3IAM 2;  4KDY A;  1URM A;  1WP0 A;  3Q74 A;  4K0N A;  2YWN A;  3DWV A;  4NV5 A;  3H8Q A;  3GKX A;  5HR3 A;  2X49 A;  4GQC A;  1U3A A;  2A2R A;  4V2N A;  1AAZ A;  2I4A A;  4PX1 A;  3NIV A;  2YJH A;  3KP8 A;  1NW2 A;  3QR6 A;  3Q6O A;  10GS A;  2H1D A;  5D96 A;  2MMZ A;  2AUV A;  3F9U A;  5CRW A;  2B5Y A;  5G5F A;  4EIP A;  1EGR A;  4JR4 A;  5FHI A;  2DC5 A;  4DSS A;  2GLR A;  4FQU A;  2YV9 A;  3FHK A;  3MYD A;  5DBQ A;  1QUW A;  2GQK A;  2H30 A;  3F4T A;  2GTU A;  5COH A;  1PGT A;  4A5P A;  2VL2 C;  1Z9H A;  1RK4 A;  5EPF A;  4N0Z A;  4Q5F A;  2O89 A;  3F4R A;  1Z6N A;  3FEU A;  3KH7 A;  4OD7 A;  1QMV A;  5KN0 A;  1HQO A;  1VF1 A;  4I97 A;  2PUK C;  2ON7 A;  3GKN A;  2I1U A;  5IPH A;  2LJK A;  3DVW A;  4O32 A;  1M9A A;  2L6C A;  1AQV A;  3EC3 A;  2NVL A;  2VCQ A;  3C7M A;  4JRR A;  4BL7 B;  1SKR B;  2PWJ A;  5GST A;  2L4C A;  2PMT A;  2EIQ A;  3C1S A;  3DGQ A;  1W4V A;  4L5L A;  2PPT A;  4HZ4 A;  3U5R E;  3TKR A;  3R3E A;  2H8L A;  1ZYN A;  2GGT A;  5ECR B;  4KAE A;  1LBK A;  2FCH A;  2H1A A;  3Q18 A;  3D4T A;  5ENU A;  1OYJ A;  5HR1 A;  1EP8 A;  1B4Q A;  3EWL A;  2FD3 A;  4F82 A;  4ISD A;  4HS1 A;  5ECL B;  1M0U A;  1GUH A;  1R5A A;  2OKA A;  1YZX A;  4D73 B;  1UC7 A;  2K18 A;  5F05 A;  5A4V A;  2HNL A;  4J57 E;  3GA4 A;  1F6M C;  3N5O A;  3BCI A;  1WIK A;  5KOW A;  3A2X A;  2VCZ A;  4KA0 A;  4IQ1 A;  3EMX A;  2LRT A;  3C8E A;  5BRT A;  3TRX A;  2QSI A;  3TKP A;  3M9K A;  2FA4 A;  1EV9 A;  3GV1 A;  2H01 A;  1OC8 A;  2JU5 A;  3ISO A;  4HU7 A;  3D5J A;  1WJK A;  3QDN A;  4BA7 A;  1O6J A;  5H5R A;  1EZK A;  3P90 A;  3MDK A;  4E8H A;  4NHZ A;  1ZYE A;  1DUG A;  3BJ5 A;  2J9H A;  2EIR A;  5D9T A;  4PQ1 A;  3D4M A;  4L8E A;  1OC3 A;  2GQM A;  3BD2 A;  3GL3 A;  5G30 A;  3ZVJ A;  5J5N A;  1IYI A;  4Z2U A;  4ID0 A;  2HSH A;  4G10 A;  3PIN A;  1SKW B;  3UIW A;  4BVX B;  4LMW A;  4WR4 A;  4GLT A;  2ZNM A;  1JHB A;  1H4O A;  3D22 A;  2GSR A;  3L9S A;  3EIN A;  1VRS D;  1F2E A;  1TK8 B;  2VO4 A;  4TXO A;  4MF7 A;  2WDU A;  2ON5 A;  3TJJ A;  4K5S A;  1GLP A;  3UVH A;  3LGC A;  1SK1 A;  2GT5 A;  2R37 A;  2RM5 A;  3FY7 A;  4MCU A;  4JED A;  2YWO A;  4GWR A;  5DAL B;  2A4V A;  1X9S B;  2DJ0 A;  5HQP A;  3HHV A;  1ILO A;  3P2A A;  4V2M A;  3TB2 A;  1YJ6 A;  3HY2 A;  1R4W A;  1LJR A;  4KX4 A;  1GSS A;  2OE3 A;  3IK7 A;  4F0B A;  5EVO A;  2LNT A;  2GZP A;  1Z3E A;  1FVJ A;  2H75 A;  2C8U A;  2B1L A;  1YDK A;  1A0F A;  2IMI A;  5ABR A;  2YWM A;  5DAK A;  5DVB A;  4K1F A;  4L5O A;  4TN8 A;  2DIY A;  2GT6 A;  1PKZ A;  3F4S A;  3I43 A;  4KF9 A;  1VGL A;  4YAP A;  3LFL A;  3WT2 A;  3TRQ A;  1EWX A;  3CBU A;  3TCO A;  3MIX A;  1ML6 A;  3J7Y b;  4N30 A;  4OMV A;  5KEJ A;  3TKS C;  3ERF A;  4MNN A;  2H72 A;  2HSY A;  1YF0 A;  3IHQ A;  1A24 A;  4BPY A;  2N5B A;  4KCA A;  3GRX A;  1W89 A;  2L59 A;  4GF0 A;  2F3M A;  1HNB A;  3VLN A;  4IQA A;  2DKI A;  3C1R A;  3GKK A;  3WGE A;  1SD8 A;  4GRF A;  4GQF A;  2TRC P;  1A2L A;  2FUG 2;  3HVX A;  2JZR A;  1B48 A;  1X9W B;  4MF5 A;  3GIX A;  3I6A A;  1YKC A;  4HDE A;  4ZBD A;  4E8E A;  1JZD A;  2WRT A;  4MH3 A;  3HXS A;  3ME7 A;  1T3B A;  3RPN A;  2CAQ A;  2ZUP A;  2B5E A;  2XPD A;  4I6X A;  3FK8 A;  5GAP D;  3HVV A;  4N10 A;  3EE2 A;  4ZIJ A;  5G5E A;  3ED3 A;  4KND A;  4MZC A;  1I9D A;  2OA7 A;  1T4Y A;  4X0X A;  3LYP A;  2LS5 A;  4XCS A;  5IMC A;  3D6I A;  3DKS A;  4MH2 A;  1X5C A;  5D93 A;  5IPG A;  1BQ7 A;  2DJ1 A;  1ABA A;  3LOR A;  2IIY A;  1R26 A;  3G7I A;  4POL A;  3ZIT A;  7GSS A;  2UZ8 A;  3O76 A;  3QPM A;  2H6Z A;  5G31 A;  2BJX A;  1B4P A;  4CHS A;  2X4A A;  2YN1 A;  2HRN A;  3RDW A;  2FNO A;  2QGV A;  2H0I A;  4WF5 A;  3KM6 A;  4DSS B;  5GAN D;  3EMP A;  3APS A;  2CZ2 A;  3IPZ A;  3QD9 A;  1XBS A;  3GX0 A;  2X64 A;  1MEK A;  3TJG A;  3JCM L;  1TU7 A;  3MSZ A;  4IN0 A;  4AGS A;  4PNG A;  2PER A;  2AHE A;  2P5Q A;  2HYX A;  4LL1 B;  2D2Z A;  17GS A;  3ZRD A;  2OE0 A;  1TK5 B;  1AQW A;  3TJB A;  3MWH A;  4TR1 A;  5C04 A;  1RW1 A;  2PU9 C;  4PUR A;  1PRX A;  4AJ7 A;  1WPI A;  4BWQ A;  2ES7 A;  2RUE A;  2VCT A;  5LD0 A;  4XRD A;  5KN2 A;  3IXR A;  5CRE A;  1JZW A;  2NBS A;  2HI7 A;  1XOB A;  1Y25 A;  1E6B A;  1GTI A;  4MZB A;  2NTO A;  4PTS A;  2YWI A;  4IBP A;  3A5W A;  1GNW A;  2IMK A;  2LRC A;  5ECH B;  3GTU A;  3HKR A;  2VAF A;  4ML1 A;  4XIH A;  1K0M A;  4OFT A;  2GDR A;  4RUV A;  4EF0 A;  3IC8 A;  2MBS A;  2HFD A;  4GTU A;  2F8A A;  4ZB8 A;  2OBK A;  3KIJ A;  1BED A;  1FB0 A;  5CYY A;  1FHE A;  5CRH A;  2L5L A;  5AGY A;  3FR6 A;  4MPG A;  3RPP A;  2X99 A;  4WET A;  5CRG A;  5C00 A;  5IIZ A;  1HD2 A;  2NPB A;  2MMN A;  3UEM A;  3RHC A;  2K8V A;  3DIE A;  1Z7P A;  3FYG A;  3KZQ A;  4CY6 A;  1GUM A;  3TDG A;  1SYR A;  2C0F A;  4ECJ A;  4ULX A;  4CY8 A;  1GRX A;  3VPT A;  2M72 A;  4YQV A;  1EV4 A;  4I8B A;  1BJX A;  3KJY A;  1H75 A;  3ZIJ A;  4MJE A;  1QXH A;  2HLS A;  2OBI A;  1ZZY A;  4DVC A;  1SD9 A;  3DVX A;  2R0C A;  3M9J A;  1SEN A;  1AUC A;  3W8J A;  1XVQ A;  1WWJ A;  4NWY A;  2PN8 A;  1AQX A;  5DJL A;  4PQH A;  4YH2 A;  3DML A;  1MDK A;  3C71 A;  2A2S A;  4FYC A;  5JCW A;  3BCK A;  2GST A;  4OWY A;  4PGT A;  4PXO A;  1SJZ A;  2B7K A;  2PBJ A;  3QFB C;  4TKY A;  4TXO B;  4YKG A;  4YAV A;  5E4W A;  4XS6 A;  2JAD A;  1R7H A;  1B9X C;  2C0G A;  2OJL A;  1CQH A;  1FVK A;  1BG5 A;  4RI6 A;  1X9M B;  2R3X A;  1XFL A;  4H86 A;  3L78 A;  3QAW A;  4K7I A;  1XW5 A;  2O7K A;  4EKZ A;  4K2D A;  4OCF A;  4PUF C;  2C80 A;  3KCM A;  1J9B A;  1M2B A;  2DJJ A;  2H73 A;  2R6K A;  2LV3 A;  4XTS A;  3ZVJ D;  1PD2 1;  2RLI A;  1HNC A;  2G2Q A;  2FY6 A;  5GZZ B;  3IDV A;  5DAK B;  1JLW A;  3LW9 A;  5KN3 A;  4HOJ A;  2H66 A;  2A4H A;  3N9J A;  13GS A;  2YCD A;  4Q5R A;  1TP9 A;  4K2X A;  2DMM A;  11GS A;  4NAX A;  3S9F A;  3UBL A;  3F63 A;  1OC9 A;  3DYR A;  2YNX A;  2FWG A;  5ECM B;  2MZC A;  4EXJ A;  4AF2 A;  2FWH A;  2PGT A;  3W6G A;  4EIQ A;  3P8W A;  6GSY A;  4ZB9 A;  20GS A;  2ZCT A;  2YPM A;  3UAP A;  2VD1 A;  1A2J A;  1V9W A;  2YP6 A;  3KD0 A;  4OFM A;  5FT3 A;  1U87 A;  5CRD A;  5F0G A;  5DQY A;  2H0G A;  4L0W A;  2LRN A;  3FW2 A;  3G9B A;  3ZFB A;  1E2Y A;  5J41 A;  2EC4 A;  2HE3 A;  2O87 A;  3EYT A;  2H70 A;  3FZ9 A;  4USS A;  1ZCP A;  1TOF A;  4MA9 A;  2MBT A;  4ZBA A;  3LYK A;  1TKD B;  2XHF A;  3I9V 2;  3J7Y k;  4LLR A;  1A23 A;  4FH8 A;  1V58 A;  4RQX A;  2C0E A;  2DBC A;  3EVI A;  3HYP A;  3ZML A;  3PGT A;  3ZRE A;  1SK2 A;  3GSS A;  2F8F A;  3CYN A;  2H6X A;  2EIO A;  1I5G A;  3UVT A;  3H79 A;  3F3Q A;  5JWQ B;  4IP6 A;  3G7Y A;  2DJ2 A;  1X5E A;  3SWL A;  2V6O A;  5J3R A;  4KDU A;  5IMD A;  5H5Q A;  1TJD A;  1NSW A;  4I5Q A;  3NZN A;  1JFU A;  4IJ3 A;  2HZE A;  2CT6 A;  3HDC A;  3BBY A;  1GSQ A;  1TU8 A;  2QC7 A;  3IOS A;  2H71 A;  4F0C A;  5J4U A;  2IFQ A;  5IQY A;  4TW5 A;  4IP1 A;  4IJI A;  3GL5 A;  3KTB A;  2HSM A;  3H1N A;  2P0G A;  2H6Y A;  2X8C A;  2VIM A;  4BVY A;  4HUA A;  2F9S A;  2IME A;  2DJ3 A;  1PMT A;  4QL7 A;  2IN3 A;  4O92 A;  1XWA A;  2KHP A;  1KBN A;  2H1G A;  4AJ8 A;  5FWG A;  3O6T A;  2MMA A;  2C0D A;  2K6V A;  1KEB A;  1VF4 A;  1NM3 A;  3CXG A;  4V1A p;  3VI7 A;  1M99 A;  2VCX A;  5B7C A;  1MD4 A;  1K0D A;  4ZXG A;  2H76 A;  4TR1 B;  5F8B A;  2B3S A;  4KCE A;  3HA9 A;  1UA5 A;  5ECS A;  4HI7 A;  2LNS A;  5BMU A;  1GTA A;  4MMM A;  2C3N A;  2GZZ A;  3LWA A;  1BYE A;  1ZOF A;  3KEB A;  1UVZ A;  5HFI A;  1K3O A;  3HJM A;  1MD3 A;  5DQS A;  2BTO T;  1AXD A;  1PL1 A;  4Z2T A;  1ZYQ B;  2KP1 A;  3CTG A;  4O5U A;  1GUL A;  2FHE A;  3LG6 A;  4EDZ A;  4ECI A;  1FAA A;  1OE7 A;  2GSQ A;  1K0A A;  3VUR A;  5CAX A;  3GTU B;  4ZL9 A;  2XBQ A;  2JL4 A;  4PQI A;  4DSR A;  5LNK e;  3FZA A;  1WOU A;  1K0O A;  4IVF A;  2LQQ A;  3V1W A;  3ZL5 A;  5JCG A;  4BWS A;  22GS A;  2LUS A;  3CSI A;  4WF4 A;  1SKS B;  5AIX A;  5EL8 A;  2LKU A;  2AYT A;  1QGV A;  3RAZ A;  1SL2 B;  4ZL7 A;  4HZ2 A;  4KSO A;  2IMF A;  2JZT A;  2AJQ B;  1DBY A;  1K0N A;  2HRK A;  4FYB A;  4NV2 A;  1XXU A;  2LJR A;  6GSU A;  3PPU A;  1OVN A;  2PVO C;  2WCI A;  4X4J A;  1JZR A;  1F3B A;  2A2P A;  2MMO A;  3MNG A;  3KGK A;  1GLQ A;  3ERW A;  1AC1 A;  3TKS E;  2REM A;  3KTL A;  3VK9 A;  2JSY A;  1ZYP A;  1EEJ A;  2CVD A;  2OE1 A;  1R5P A;  1K0B A;  2HT9 A;  1FB6 A;  1VF2 A;  4ML6 A;  4CDO A;  1YEX A;  5IM9 A;  4MJC A;  3GX8 A;  3KP9 A;  3ZFL A;  16GS A;  2GSS A;  2E7P A;  3BOA A;  3R2Q A;  2HZF A;  3A5I A;  1QQ2 A;  4I2T A;  3UBK A;  5ECI B;  1X5D A;  4K7N A;  3L4N A;  4MP4 A;  3QOU A;  1WE0 A;  3L9U A;  1SJI A;  1GWC A;  1FO5 A;  1A8Y A;  1M2A A;  4MAB A;  2FLS A;  4XHM A;  3IE3 A;  1A8L A;  4JE1 A;  5F06 A;  4IHU A;  2XPE A;  4TXV A;  2B5X A;  3GH9 A;  3FRC A;  2KP2 A;  2DKH A;  2LJA A;  1SYX A;  3HD5 A;  1GSE A;  3LQ7 A;  1T00 A;  5J9C A;  4F03 A;  4X1U A;  1M2D A;  2YJ7 A;  4N0V A;  2CVK A;  4F2I A;  3IR4 A;  3ZMK A;  4KUN A;  5B8B A;  1TI1 A;  1Q98 A;  1PA3 A;  4PUA A;  3W8S A;  2VUP A;  1T8E B;  4RQR A;  2XC2 A;  1XVW A;  4LL4 B;  4GSN A;  1VF3 A;  1YF1 A;  1LU4 A;  4G0L A;  3GUS A;  3VPQ A;  4G9H A;  3HZ4 A;  3RHB A;  3WD6 A;  2DJK A;  3CRU A;  3VFI A;  4QL9 A;  2WZ9 A;  1SL0 B;  5A5K A;  1OKT A;  1OC9 B;  3A3T A;  19GS A;  3FZ5 A;  4ICY A;  3IHG A;  2H1B A;  2VD0 A;  4EE0 A;  2H0H A;  3EU4 A;  2N5A A;  1SU9 A;  4MDC A;  1V2A A;  1HNA A;  2J23 A;  4JR6 A;  4NHW A;  4JZQ A;  2CX3 A;  3LSZ A;  1KTE A;  1QK8 A;  1BAY A;  3F0I A;  4MJA A;  2P31 A;  4G19 A;  3HJO A;  4CW9 A;  5IOW A;  1XW6 A;  1DE1 A;  5A4U A;  1WRY A;  2KOK A;  4KDX A;  1ACV A;  1TI3 A;  3IV4 A;  5D9V A;  3F3R A;  2V1M A;  3DD3 A;  14GS A;  2HRA A;  4XS4 A;  4RI7 A;  2HXK A;  3I69 A;  4ZIL A;  1F37 A;  2GS3 A;  1NHY A;  2E0Q A;  12GS A;  5H5S A;  4FO5 A;  4LMV A;  5KN1 A;  4XS1 A;  4TR4 A;  4JBB A;  2BMX A;  2HRF A;  2WGR A;  4TR0 A;  5JWR B;  3UMA A;  2FWE A;  3APQ A;  3GMF A;  3QMX A;  3GFK A;  2LST A;  4K8M A;  3ZLP A;  1F3A A;  5CNW A;  4POK A;  2YZU A;  2IPA A;  1GP1 A;  4Z2R A;  1HYU A;  5ID2 A;  3EU3 A;  5B6M A;  2AV4 A;  3A2W A;  3KMN A;  2DLX A;  1PKW A;  1A0R P;  1GTB A;  5IMA A;  3D0Z A;  4O5Q A;  4ACS A;  1GSF A;  1WMJ A;  4IS0 A;  2HZE B;  1PL2 A;  3CSH A;  2JAC A;  1G7O A;  1N2A A;  4TVE A;  4KH7 A;  2IFQ B;  5L71 A;  4EDY A;  1GTU A;  5ECK B;  4PNF A;  4GST A;  1K0C A;  1B8X A;  1USB A;  1AIU A;  2CQ9 A;  5IMF A;  2KLX A;  4POM A;  1UN2 A;  2CA8 A;  5INY A;  5AIV A;  4K0G A;  1A2M A;  4WXT A;  4V1A g;  4BVY B;  2X8H A;  2IJY A;  3F6D A;  8GSS A;  3ZIV A;  1O81 A;  2OAC A;  3VI5 A;  4ECC A;  1NHO A;  3UJ1 A;  3LXT A;  2R0P A;  2VLU A;  5HR0 A;  3AY8 A;  1ERV A;  4WEY A;  3CTF A;  4OCE A;  3E9J B;  4K7O A;  1SJ6 A;  3UL3 A;  1XWC A;  2ALB A;  5HFK A;  1XWB A;  3GN3 A;  3IBH A;  2CZ3 A;  1ERU A;  2AAW A;  3GH6 A;  1MTC A;  2CV4 A;  1TXX A;  1GH2 A;  1M9B A;  3F8U A;  4NXI A;  2RII A;  3M0F A;  5B8A A;  3WGX A;  2CX4 A;  2OAD A;  5G1K A;  5G1L A;  3L0H A;  3TUE A;  1XPV A;  4O5R A;  4QQ7 A;  4WBR D;  2WUL A;  3HVS A;  6GSV A;  2V41 A;  5GSS A;  1XIY A;  2H74 A;  4HEA 2;  4TOP A;  2AB6 A;  5DJM A;  1G7E A;  1SK0 A;  4HU9 A;  9GSS A;  1N8J A;  2I3Y A;  1XWK A;  1TDI A;  4K6X A;  1AW9 A;  4O7H A;  2O85 A;  1YEP A;  6GSX A;  4HJM A;  2WJU A;  4ZB6 A;  3EUR A;  1TW9 A;  3OR5 A;  1TRS A;  2B6M A;  2VLT A;  4IKH A;  1OAZ A;  3UOM A;  1TTZ A;  1Y6E A;  3WT1 A;  4J56 E;  5IO2 A;  4MF6 A;  1GNE A;  3DRN A;  2H19 A;  2XBI A;  1Z6M A;  5ECQ B;  1SL1 B;  1TRU A;  5ELG A;  2Z9S A;  3O3T A;  2B7J A;  1TRW A;  1G0T A;  1S3C A;  3WGD A;  5E59 A;  2IMD A;  5HFG A;  4EC0 A;  1ON4 A;  1FG4 A;  1RQM A;  3GYK A;  4NMU A;  5ECP B;  3FR9 A;  4OO5 A;  2CAI A;  3LEF A;  2WFC A;  1OKD A;  2M80 A;  4WR5 A;  1YQ1 A;  2VL3 A;  4DSQ A;  3P7X A;  1THO A;  1JLV A;  2GZY A;  3CRT A;  4JU5 A;  5D73 A;  2G0F A;  5JCU A;  2VM1 A;  3TOU A;  3H93 A;  3VWX A;  2LEG A;  1PX7 A;  4FYU A;  3U6V A;  2VL2 A;  5DDL A;  1XZO A;  3SBC A;  3VWV A;  1EEM A;  1GL8 A;  1B9Y C;  3ZTL A;  1YKA A;  5CO3 A;  1ZL9 A;  1S3A A;  3EPT A;  2DIZ A;  2RUF A;  3FR3 A;  5F07 A;  5D8I A;  2RM6 A;  4BL7 A;  3GKM A;  4I2U A;  4GXZ A;  2CVB A;  5AN1 A;  3G7J A;  3DEX A;  1FW1 A;  3TJK A;  5ECN B;  1K3Y A;  3WYW A;  4G0K A;  2K9F A;  6GSW A;  4GSS A;  2L5O A;  2YV7 A;  2M46 A;  1PQN A;  2VLV A;  3LJR A;  3D21 A;  2LTK A;  3IK9 A;  5DCH A;  4F9Z A;  5AIS A;  3HCZ A;  5CP1 A;  1EOG A;  5LCZ A;  3IC4 A;  3NOF A;  4MPF A;  1ERT A;  1J0F A;  5D9W A;  3GST A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...