4TN8A

Crystal structure of thermus thermophilus thioredoxin solved by sulfur sad using swiss light source data
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
103
structure length
103
Chain Sequence
PIEVTDQNFDETLGQHPLVLVDFWAEWCAPCRMIAPILEEIAKEYEGKLLVAKLDVDENPKTAMRYRVMSIPTVILFKDGQPVEVLVGAQPKRNYQAKIEKHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Thioredoxin
publication title Fast native-SAD phasing for routine macromolecular structure determination.
pubmed doi rcsb
source organism Thermus thermophilus
total genus 27
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2014-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4tn8A00
3FZAA 2H70A 3VK9A 1XXUA 3P90A 1XPVA 2VCWA 2R5GA 2WS2A 2DJ2A 1MD3A 1XWCA 5ECOB 2C0EA 2AV4A 2O8VB 2LUSA 2TRXA 3BOAA 4MA9A 3HVXA 5B7CA 3LWAA 5DQSA 2VIMA 2N5BA 4IJ3A 2C3TA 1K0DA 1LJRA 2B5YA 1ERWA 3ZMKA 2JSZA 1E2YA 5DALA 2VL2A 4POLA 5B8BA 4BPYA 2WB9A 3IK7A 4XS4A 3O3TA 5IMDA 4O5RA 4DSRA 1WPIA 2LRTA 1F9MA 3TJBA 2C8UA 2O85A 2GQLA 2VD0A 4F03A 2RLIA 4ECCA 5DAKA 3TGZA 1XFLA 5HR0A 3FR3A 3DYRA 1M2DA 2DJ1A 1A0RP 2QSIA 2F8FA 4K9ZA 3CSIA 3BCKA 1MDIA 1V98A 2X99A 2FHEA 2JADA 5G2ZA 3HYPA 2LNTA 2KUCA 2D2ZA 2WFCA 5B6NA 1GP1A 4TXOA 4MZBA 1XOBA 2X8CA 3LG6A 1EOGA 3PGTA 1K0MA 3ME7A 4IQ1A 2V2GA 5G5EA 3EYTA 3QCPA 4ZXGA 4LA1A 2HZEA 5HFKA 5F05A 3KGKA 3DWVA 3F6FA 1XWAA 1K3YA 2O87A 3F4SA 4JU5A 1AQVA 5ID2B 1M99A 3KMOA 5FHIA 1PD21 4E8HA 2RM5A 2MZCA 1TRSA 5H5QA 1X5DA 1TRWA 2CA8A 2FWHA 4ZL8A 1SJZA 1TU8A 4N11A 3GNJA 4EO3A 1X9MB 2CZ3A 2GS3A 3A2XA 3LYPA 3LEFA 5CRGA 1XVQA 3RHCA 2DBCA 2MMOA 3LYKA 5JWQB 3GX0A 17GSA 4D73B 1DE1A 1Z9HA 4I5QA 4KH7A 2YWNA 3O6TA 1AUCA 4G10A 3FK8A 2PERA 2CVBA 3P8WA 1A2JA 5J4UA 4NHZA 4KAEA 1EEJA 1UVZA 2PPTA 4TR4A 4J2FA 3WT1A 1Z5YE 2F3MA 3TJJA 1PA3A 10GSA 3I6AA 5G31A 3M1GA 3M0FA 3W8SA 3CMIA 3OR5A 1NSWA 3HVSA 1QMVA 5J9BA 2DMLA 2N5AA 2XBIA 4N10A 5DVBA 2LRNA 1FOVA 5DALB 3L4NA 2MYGA 2KP2A 1TK5B 1GULA 2PWJA 3GX8A 1FB6A 1Z7RA 1ZOFA 3J7Yb 3GKNA 3GTUA 2I3YA 1FHEA 4DVCA 2LTKA 1PSQA 1BG5A 6GSUA 3VWVA 5DAKB 4PQIA 2H1BA 4LLRA 4YAPA 3IAS2 4NWYA 4Q5FA 4IQAA 4I6XA 2R2JA 3KJYA 1EWXA 1ML6A 4J57E 1V40A 2KOKA 4YAVA 5H5RA 3D6IA 1SKRB 4PUFC 5A4WA 3APSA 2JSYA 4GCIA 5D93A 2LJKA 3ZL5A 2RUFA 1FAAA 2H75A 2VLTA 5JCGA 1F6MC 1R26A 5ECQB 3G7IA 5GAPD 3TKRA 3FRCA 2LJAA 4OD7A 2DJ0A 3WYWA 2JZRA 4BVYA 4IN0A 3GL5A 4HI7A 1XIYA 4AGSA 1C72A 4ACSA 18GSA 5IMAA 1JZRA 4JR6A 1F3BA 4HU9A 5H5SA 1TOFA 3CXGA 1B9YC 4POKA 1A8LA 1MD4A 3LXTA 4O32A 5DCGA 4FH8A 4EDZA 3GKXA 3DVWA 5KN3A 2E2MA 1M0UA 2VUPA 3EU4A 3N5OA 2ALBA 5IMFA 5IIZA 4PX1A 2IIYA 2OKAA 2VO4A 4IELA 1T3BA 1T4YA 2FA8A 1OC3A 1QQ2A 1SK2A 2Z9SA 2VCQA 1RK4A 1OE8A 2EIQA 1SJIA 1WP0A 3HJMA 2JU5A 1GLQA 2GSRA 3KTLA 2H01A 1PL2A 2FWEA 3FR9A 9GSSA 4MH2A 1TDIA 5DJLA 5E59A 2HZFA 3MSZA 2KHPA 1M2BA 2JACA 3TB2A 2GGTA 4GQFA 2L6DA 1THXA 3CRTA 8GSSA 3IA1A 5EPFA 2IMIA 4GSSA 1G7EA 1PMTA 4ZIJA 3HY2A 1BYEA 1JZDA 2L5OA 2J9HA 5ECMB 5D96A 5DQYA 2FWGA 2C4JA 3GH6A 2R37A 3WT2A 2GDRA 4NMUA 4NPBA 3ZZXA 5EL8A 1XBSA 1GUHA 3ZIJA 2YV9A 3F8UA 2G2QA 1Y25A 4RUVA 1HNAA 2K8VA 4GTUA 3TKSA 1OKTA 4L0UA 2FLSA 3QD9A 1M9AA 5IOXA 1A2MA 2YP6A 1YQ1A 3F63A 5ECPB 4KSMA 3C8EA 4IP1A 3KH9A 3RHBA 5IO0A 4XHMA 2H0HA 4MABA 1EV4A 3ZTLA 3EMPA 4DSSA 3ZLPA 4WF4A 6GSXA 1DE2A 4IBPA 3G7JA 4KGIA 2LS5A 3QPMA 4WXTA 1EP8A 4BA7A 2XHFA 2VLUA 3HKRA 1ABAA 4TKYA 3ERGA 2IMDA 2LEGA 2GZPA 1V57A 2XPDA 2IN3A 3H4KA 1WE0A 2IMEA 4YH2A 3U6VA 1SK0A 1T1VA 1W4VA 1G6YA 3UIWA 2V32A 5D9VA 3D5JA 14GSA 1M2AA 4N30A 1TI1A 3GFKA 4EL1A 1OKDA 1U3IA 1ILOA 2X64A 2I9HA 2K18A 2C1YA 2ZCTA 1OC9A 3G7YA 3GUSA 1U88A 1UC7A 1SKWB 3TUEA 5CRDA 5AN1A 5IMZA 3HVVA 4JRRA 4CDOA 2EIRA 3IOSA 1KNGA 4XIHA 2OA7A 2IMFA 1USBA 3K8NA 4IS0A 1JLVA 1K3OA 5G5FA 1Y6EA 3IRAA 2KP1A 1BX9A 2VCZA 1YJ6A 2HRFA 3FR6A 3A2WA 4ZB9A 3RPPA 3O76A 1PRXA 4MPFA 2GT5A 2CX4A 3CYNA 1SL2B 2R3XA 3RBTA 3SBCA 3TJFA 3IE3A 4MMMA 2HLSA 1O7UA 1O81A 3VFIA 3BD2A 5IPGA 4NHWA 5AISA 4XTSA 1SKSB 3FZ5A 3PH9A 1CQHA 4WR5A 3KEBA 1R4WA 1SYRA 2DIZA 3W8JA 1ZYEA 4ECBA 1PGTA 2M72A 4V2LA 2HI7A 2L5LA 3M8NA 4ZL7A 1WIKA 2QKEA 2IPAA 1AAZA 5GSSA 1WRYA 1K0CA 3UBLA 2GVPA 2E7PA 4K8MA 5ENUA 4GSTA 4ML1A 5F0GA 4ZBAA 5HR1A 4PUAA 2A4VA 5J9CA 3DXBA 1B9XC 4HQZA 3UAPA 4KSOA 1YY7A 4RI6A 1XCCA 1PKZA 4HUAA 1X9WB 4G2EA 4EKZA 4V1Ap 4MH3A 2V41A 1HD2A 5CREA 3TCOA 3NIVA 1THOA 6GSWA 4GF0A 4POMA 4WF5A 2L4QA 3HCZA 3GN3A 1R5AA 2OE0A 4EC0A 2OACA 2H6ZA 3F9UA 2PUKC 1O6JA 2R6KA 2JZTA 2AB6A 4I2TA 1XW6A 3ZIVA 2I4AA 2YJ7A 3IDVA 3VI5A 5LD0A 2WGRA 3MDKA 1KBNA 1GUMA 4KX4A 1W89A 2GZZA 4FYCA 4TRXA 1MEKA 1J9BA 3RPNA 3IV4A 1OC9B 4IHUA 3Q18A 1TTZA 1JFUA 2H66A 3CSJA 1T4ZA 2DJJA 3FYGA 1N8JA 3APQA 1ZL9A 5LNKe 4EF0A 4JZQA 5F06A 1TW9A 1J0FA 2ES7A 4ILFA 1EZKA 3TKSC 2OE3A 5DCHA 3UJ1A 1GLPA 1MTCA 1RW1A 2WCIA 2CAIA 4XRAA 4LMWA 5CP1A 4MJBA 1FVKA 2L4CA 1I5GA 3IBHA 4K7NA 4PNFA 3FW2A 3TJKA 2CAQA 5D9WA 1OVNA 2CZ2A 2E0QA 1ZYQB 3KM6A 2FY6A 4GSNA 3KCMA 1G6WA 4I8BA 1K0NA 3UMAA 3LQ7A 3SWLA 2AAWA 3HZ4A 4RI7A 3VWWA 1FG4A 2P0GA 2ZNMA 4ISDA 2OE1A 2B7KA 4HOJA 4OCEA 5IM9A 4K6XA 3DKSA 3NZNA 2WDUA 2YWIA 1X9SB 5ECHB 2A2SA 4QQ7A 3ZVJA 2J23A 2IWTA 2MMAA 1ERUA 4XS4B 2A2RA 2YOIA 5AIVA 2YV7A 3JCML 4HZ2A 4X43A 1ZMAA 1QUWA 2IFQA 1JZWA 5ELAA 2GT6A 2K8SA 2L6CA 2NBSA 2K9FA 1HQOA 4HEA2 2DC5A 3VPQA 4O92A 4YQVA 5ABRA 1S3DA 2KLXA 4RQRA 2MMZA 1AQWA 2VD1A 3UEMA 2H76A 4IGJA 1K0OA 5IMCA 1SJ6A 3TJGA 2B5XA 2C3NA 2VLVA 4TXOB 2FWFA 2X8GA 1TRVA 1V2AA 3GHAA 3TOTA 4MLYA 5F07A 6GSVA 2HZEB 4EDYA 4FYBA 12GSA 4OMVA 4TW5A 4OO4A 1WJKA 2GLRA 3GRXA 2YZHA 2BMXA 3ZRDA 2HSYA 2I81A 4E8EA 2OADA 3KTBA 3V1WA 1GSEA 3EVIA 4O7HA 1QFNA 4KB3A 3WGXA 4JE1A 1Z6NA 5GZZB 3HJPA 2AHEA 5INYA 4WBRD 5AGYA 1EP7A 2G0FA 4F0BA 3GMFA 3GV1A 3RAZA 2NPBA 1OC8A 1HYUA 4ZILA 3D22A 1NHYA 3P7XA 3GIXA 1CQGA 2X8HA 4GXZA 2IMKA 1GSUA 2YCDA 3ZFLA 2HFDA 2ON5A 2H6YA 2RUEA 4XRDA 1WWJA 1EOHA 2FCHA 1A8YA 2F51A 2WULA 1ZZYA 1VRSD 3GSSA 3VURA 4BWQA 1XZOA 3CTGA 5EVOA 1VF2A 3I43A 3NOFA 4IKHA 1PL1A 4X1UA 3BCIA 1HNBA 4F9ZA 2H71A 4MK3A 4V1Ag 4K7OA 2O89A 3UOMA 2DJKA 2MBTA 3I9V2 4MZCA 2GSSA 1URMA 3DVXA 2IL3A 1N2AA 3C7MA 2CVKA 3HJOA 4J56E 2AYTA 2LSTA 2C80A 2TIRA 3QOUA 3US3A 2P5QA 3DGQA 2FD3A 3GYKA 4HJ2A 3KIJA 4EUYA 4GQCA 1ST9A 3GTUB 3I69A 1YEXA 3E3EA 3EC3A 1SU9A 3F6DA 1TU7A 2C0FA 5DJMA 1AXDA 3F4RA 3CTFA 3TRPA 1ACVA 2YN1A 3APOA 5EY6A 1XOAA 3HZ8A 2WRTA 4PQHA 5HFIA 3ZFBA 1NM3A 3VWUA 2DIYA 4KCEA 2PU9C 3ERFA 1FW1A 1DSBA 2VM1A 1GUKA 4XS1A 2LKUA 5DBQA 3ME8A 4WR4A 4OWYA 3HXSA 1XWBA 4TR3A 3ZREA 2HRNA 1RQMA 4ECJA 5KN1A 3IC4A 2C3QA 5ECLB 1MDJA 4ECIA 5JWOB 4MDCA 4AJ7A 3QDNA 1YF0A 1Q4JA 1GSYA 2GQKA 3WGEA 3H93A 22GSA 4IP6A 1O73A 1Z3EA 1VF4A 3L9SA 3TRXA 3ZVJD 3G9BA 4FO5A 1GWCA 5JCUA 5IQYA 2VL9A 1PX6A 3J7Yk 2C0DA 2VCTA 7GSSA 3HDCA 1NHOA 1B8XA 1AW9A 5A5KA 4HJMA 4ID0A 1AQXA 3QAWA 3GSTA 2H1DA 2V1MA 4Z7XA 2B5EA 2HE3A 5KN0A 3KXOA 2DSAA 3BJ5A 1BJXA 3L78A 1R5PA 1SD8A 3FHKA 3E0UA 2LQQA 5E4WA 3GL3A 5G30A 2EC4A 4L5LA 5D9XA 1K0AA 4OFMA 5HQPA 4IJIA 1TJDA 5ECKB 2C0GA 3L9VA 3M3MA 4ZBBA 2HYXA 4MCUA 4JEDA 2HT9A 2XBQA 2CQ9A 2DLXA 1GRXA 3CBUA 3LSZA 5ECIB 4OCFA 1VF1A 3A3TA 3DEXA 3DD3A 4I97A 1EGOA 2JZSA 2CX3A 1X5EA 4HDEA 3Q6OA 1GTAA 4H86A 3D4MA 4G19A 4MF5A 2FNOA 1PN9A 16GSA 4ML6A 1M7TA 4LMVA 5AIXA 5ECRB 3MAKA 3EURA 1SL1B 1T00A 2MMNA 3Q19A 1XWGA 1U3AA 1EGRA 3F4TA 4ZBDA 3QFBC 3DIEA 1TK8B 3IR4A 1KTEA 3DRNA 3D0ZA 1YKCA 1EEMA 3UVTA 2JL4A 2PGTA 3MNGA 2YJHA 5J41A 1B48A 1IYIA 2H8LA 5IO2A 1EV9A 3GKMA 1GSSA 4DSSB 3KP9A 3C1RA 5HFGA 5ECSA 2CVDA 3VI7A 3FZ4A 3LXZA 1UN2A 1I9DA 2NDOA 2RIIA 4AJ8A 2H0GA 1OYJA 1UA5A 1ERVA 1F2EA 4BWSA 1TP9A 2YZUA 2GSTA 1A23A 3VPTA 5CYYA 3VLNA 5L71A 3HD5A 3FY7A 1FVJA 1S3AA 3ERWA 4EXJA 4OFTA 3GH9A 3TRQA 1ZCPA 3HA9A 2RM6A 4TN8A 5F8BA 3FEUA 5FT3A 4KDXA 4PQ1A 1GH2A 1JHBA 4KNDA 1PX7A 4PURA 1OAZA 5C00A 6GSTA 3IAM2 3IXRA 2K6VA 1ZGNA 1FO5A 1XVWA 2WJUA 2BTOT 4TOPA 1K0BA 4K7IA 2FA4A 2VAFA 4ULXA 2GQMA 2H74A 1BAYA 2GTUA 1GSQA 1GTBA 5G1KA 4KDUA 5IMVA 5ELGA 2OBIA 1JLWA 4JBBA 2V6KA 4QL7A 1WOUA 4GLTA 3ZITA 1R7HA 2REMA 4FYUA 3EINA 5ECNB 3QAGA 4OFNA 1FB0A 5B8AA 2PBJA 3CSHA 5CO3A 4DSQA 5IPHA 4OO5A 2H30A 2VM2A 4HU7A 3C73A 3R2QA 1VGLA 3WD6A 5JWRB 2YWOA 3PR8A 3ISOA 5CRHA 3U5RE 1YF1A 2YWMA 1S3CA 1PQNA 5D8IA 4V2MA 4ZL9A 3Q74A 1HNCA 4XS6A 4N0VA 1YKAA 4AF2A 1XW5A 1SL0B 3H1NA 4Q5QA 4KUNA 3M9JA 1F37A 2AJQB 3KP8A 1V9WA 3UL3A 1H4OA 1TKDB 4FIWA 1LU4A 5D9TA 2H1AA 3HHVA 3UARA 1PKWA 2M80A 4TR1A 4MZWA 5JCWA 1AIUA 3AY8A 4MJCA 3S9FA 5J5NA 2B1LA 2OJLA 3H8QA 4KDYA 2F9SA 3EU3A 3TKSE 1M9BA 1U87A 1YDKA 2HXKA 3LORA 1Z6MA 2AUVA 2H1GA 3IPZA 4K0GA 4KCAA 3L0HA 3UBKA 3ED3A 5COHA 4JR4A 3F3RA 3F3QA 2GZYA 2R4VA 1SENA 4K0NA 4ZB6A 4NXIA 1A0FA 4MF7A 1O8WA 4N0ZA 1TI3A 2QGVA 4NV2A 1AC1A 3L9UA 2ZUPA 3C1SA 4F2IA 2V6OA 4WKWA 4TVEA 2LQOA 2OBKA 4GRFA 1B4PA 3LGCA 3RDWA 1YEPA 2H6XA 3QAVA 1X5CA 4G9HA 4MP4A 3H79A 4BVXA 1A24A 4F82A 1OE7A 4MF6A 2DJ3A 2M46A 2GSQA 4PNGA 2B7JA 1XW9A 2YANA 3TKPA 4YQUA 3KD0A 2PN8A 2L59A 2VL2C 19GSA 5A4VA 4XCSA 3UVHA 2WZ9A 4HS1A 4EVMA 5A4UA 3CRUA 1GSFA 2O7KA 2XC2A 1WMJA 2XPEA 2VCXA 5IOWA 4EE0A 4X0XA 1TRUA 5KN2A 3A2VA 2LRCA 2H72A 1Z7PA 1SK1A 1Q98A 2MBSA 2QC7A 1B4QA 5KEJA 2FGXA 4HZ4A 2HNLA 2CV4A 3GA4A 2P31A 2HSHA 3GURA 6GSYA 5CNWA 4TXVA 5B6MA 5C04A 1K3LA 1NW2A 4AJ6A 1LBKA 4KA0A 2B1KA 1QXHA 4TR0A 1DBYA 4YQMA 2YPMA 4ZB8A 1BEDA 4K1FA 5GAND 1YZXA 4POBA 2NVLA 3BBYA 3QMXA 13GSA 2IFQB 4MJEA 3GKKA 4DEJA 4QL9A 3PINA 5G1LA 4CHSA 2DMMA 6GSSA 3ZYWA 1A2LA 4L0WA 1G7OA 2LV3A 1GNWA 1QK8A 3D4TA 2VCVA 3A5WA 4L5OA 4TR1B 3LFLA 2IJYA 4NV5A 4P3YB 5CRWA 1XWKA 1GSDA 1T8EB 3IK9A 4IW9A 3KZQA 1ERTA 3EE2A 2PVOC 3QR6A 1X0RA 1DUGA 3F0IA 4L8EA 5FWGA 3TDGA 5LCZA 2B6MA 1ON4A 2P5RA 3FKFA 3MWHA 2FUG2 1O85A 4WBJA 5J3RA 5HR2A 2BJXA 2VOCA 2E2GA 2VL3A 2L57A 2PVQA 4WETA 4PGTA 3ZMLA 2B3SA 1U6TA 2N5FA 4WEYA 1J08A 3KMNA 3N9JA 4KW6A 1VF3A 4RQXA 2H19A 3P2AA 1H75A 3FZ9A 5HR3A 2H73A 1KEBA 3EWLA 3WGDA 5DDLA 1F3AA 2EIOA 1T7PB 3VWXA 3KH7A 4IVFA 4CW9A 2I1UA 1IYHA 4MPGA 4F0CA 4Q5NA 5D73A 4KE3A 5ID2A 1E6BA 3QFAC 1V58A 3LJRA 1SYXA 2H0IA 1O8XA 3D21A 4LL1B 4PXOA 4BL7A 2LNSA 1MDKA 3C71A 20GSA 1GL8A 1TXXA 2YNXA 2PMTA 3M9KA 1QGVA 2LJRA 1BQ7A 3DMLA 4I2UA 5GSTA 2CT6A 4LL4B 1G0TA 1GNEA 11GSA 4D73A 4NAXA 3E9JB 4HQSA 3IHQA 1GTUA 4MJAA 3EMXA 5CAXA 4K2DA 1JZOA 4GWRA 2F8AA 4Q5RA 1GTIA 4V2NA 1TK0B 3TKQA 2NTOA 1SD9A 2TRCP 3W6GA 3TOUA 2ON7A
chains in the Genus database with same CATH superfamily
3FZAA 2H70A 3VK9A 1XXUA 3P90A 1XPVA 2VCWA 2R5GA 2WS2A 2DJ2A 1MD3A 1XWCA 5ECOB 2C0EA 2AV4A 2O8VB 2LUSA 2TRXA 3BOAA 4MA9A 3HVXA 5B7CA 3LWAA 5DQSA 2VIMA 2N5BA 4IJ3A 2C3TA 1K0DA 1LJRA 2B5YA 1ERWA 3ZMKA 2JSZA 1E2YA 5DALA 2VL2A 4POLA 5B8BA 4BPYA 2WB9A 3IK7A 4XS4A 3O3TA 5IMDA 4O5RA 4DSRA 1WPIA 2LRTA 1F9MA 3TJBA 2C8UA 2O85A 2GQLA 2VD0A 4F03A 2RLIA 4ECCA 5DAKA 3TGZA 1XFLA 5HR0A 3FR3A 3DYRA 1M2DA 2DJ1A 1A0RP 2QSIA 2F8FA 4K9ZA 3CSIA 3BCKA 1MDIA 1V98A 2X99A 2FHEA 2JADA 5G2ZA 3HYPA 2LNTA 2KUCA 2D2ZA 2WFCA 5B6NA 1GP1A 2DKIA 4TXOA 4MZBA 1XOBA 2X8CA 3LG6A 1EOGA 3PGTA 1K0MA 3ME7A 4IQ1A 2V2GA 5G5EA 3EYTA 3QCPA 4ZXGA 4LA1A 2HZEA 5HFKA 5F05A 3KGKA 3DWVA 3F6FA 1XWAA 1K3YA 2O87A 3F4SA 4JU5A 1AQVA 5ID2B 1M99A 3KMOA 5FHIA 1PD21 4E8HA 2RM5A 2MZCA 1TRSA 5H5QA 4YKFA 1X5DA 1TRWA 2CA8A 2FWHA 4ZL8A 3A5IA 1SJZA 1TU8A 4N11A 3GNJA 4EO3A 1X9MB 2CZ3A 2GS3A 3A2XA 3LYPA 3LEFA 5CRGA 1XVQA 3RHCA 2DBCA 1PN0A 2MMOA 3LYKA 5JWQB 3GX0A 17GSA 4D73B 1DE1A 1Z9HA 4I5QA 4KH7A 2YWNA 3O6TA 1AUCA 4G10A 3FK8A 2PERA 3P8WA 2CVBA 1A2JA 5J4UA 4NHZA 4KAEA 1EEJA 1UVZA 2PPTA 2R0PA 4TR4A 4J2FA 3WT1A 1Z5YE 2F3MA 3TJJA 1PA3A 10GSA 3I6AA 5G31A 3M1GA 3M0FA 3W8SA 3CMIA 3OR5A 1NSWA 3HVSA 1QMVA 5J9BA 1ZYNA 2DMLA 2N5AA 2XBIA 4N10A 5DVBA 2LRNA 1FOVA 5DALB 3L4NA 2MYGA 2KP2A 1TK5B 1GULA 2PWJA 3GX8A 1FB6A 1Z7RA 1ZOFA 3J7Yb 4FQUA 3GKNA 3GTUA 2I3YA 1FHEA 4DVCA 2LTKA 1PSQA 1BG5A 6GSUA 3VWVA 5DAKB 4PQIA 2H1BA 4LLRA 4YAPA 3IAS2 4NWYA 4Q5FA 4IQAA 4I6XA 2R2JA 3KJYA 1EWXA 1ML6A 4J57E 1V40A 2KOKA 4YAVA 5H5RA 3D6IA 1SKRB 4PUFC 5A4WA 3APSA 2JSYA 4GCIA 5D93A 2LJKA 3ZL5A 2RUFA 1FAAA 2H75A 2VLTA 5JCGA 1F6MC 1R26A 5ECQB 3G7IA 5GAPD 3TKRA 3FRCA 2LJAA 4OD7A 2DJ0A 3WYWA 2JZRA 4BVYA 4IN0A 3GL5A 4HI7A 4PTSA 1XIYA 4AGSA 1C72A 4ACSA 2HRKA 18GSA 5IMAA 1JZRA 4JR6A 1F3BA 4HU9A 5H5SA 1TOFA 3CXGA 1B9YC 4POKA 1A8LA 1MD4A 3LXTA 4O32A 5DCGA 4FH8A 4EDZA 3GKXA 3DVWA 5KN3A 2E2MA 1M0UA 2VUPA 3EU4A 3N5OA 4YKGA 2ALBA 5IMFA 5IIZA 4PX1A 2IIYA 2OKAA 2VO4A 4IELA 1T3BA 2X49A 1T4YA 2FA8A 1OC3A 1QQ2A 1SK2A 2Z9SA 2VCQA 1RK4A 2HRAA 1OE8A 2EIQA 1SJIA 1WP0A 3HJMA 2JU5A 4Z2RA 1GLQA 2GSRA 4Z2TA 3KTLA 2H01A 1PL2A 2FWEA 3FR9A 9GSSA 4MH2A 1TDIA 5DJLA 5E59A 2HZFA 3MSZA 2KHPA 4G0IA 1M2BA 2JACA 3TB2A 2GGTA 4GQFA 2L6DA 1THXA 3CRTA 8GSSA 3IA1A 5EPFA 2IMIA 4GSSA 1G7EA 1PMTA 4ZIJA 3HY2A 1BYEA 1JZDA 2L5OA 2J9HA 5ECMB 5D96A 5DQYA 2FWGA 2C4JA 3GH6A 2R37A 3WT2A 2GDRA 4NMUA 4NPBA 3ZZXA 5EL8A 1XBSA 1GUHA 3ZIJA 2YV9A 3F8UA 2G2QA 1Y25A 4RUVA 1HNAA 2K8VA 4GTUA 3TKSA 1OKTA 4L0UA 2FLSA 3QD9A 1M9AA 5IOXA 2X4AA 1A2MA 2YP6A 1YQ1A 1ZYPA 3F63A 5ECPB 4KSMA 3C8EA 4IP1A 3KH9A 3RHBA 5IO0A 4XHMA 2H0HA 4MABA 1EV4A 3ZTLA 4K5RA 3EMPA 4DSSA 3ZLPA 4WF4A 6GSXA 1DE2A 4IBPA 3G7JA 4KGIA 4BVYB 2LS5A 3QPMA 4WXTA 1EP8A 4BA7A 2XHFA 2VLUA 4K5SA 3HKRA 1ABAA 4TKYA 3ERGA 2IMDA 2LEGA 2GZPA 1V57A 2XPDA 2IN3A 3H4KA 1WE0A 2IMEA 4YH2A 3U6VA 1SK0A 1T1VA 1W4VA 2QA2A 1G6YA 3UIWA 2V32A 5D9VA 3D5JA 14GSA 1M2AA 4N30A 1TI1A 3GFKA 4EL1A 1OKDA 1U3IA 1ILOA 2X64A 2I9HA 2K18A 2C1YA 2ZCTA 1OC9A 3G7YA 3GUSA 1U88A 1UC7A 1SKWB 3TUEA 5CRDA 5AN1A 5IMZA 3HVVA 4JRRA 4CDOA 2EIRA 3IOSA 1KNGA 4XIHA 2OA7A 2IMFA 1USBA 3K8NA 4IS0A 1JLVA 1K3OA 5G5FA 1Y6EA 3IRAA 2KP1A 1BX9A 2VCZA 1YJ6A 2HRFA 3FR6A 3A2WA 4ZB9A 3RPPA 3O76A 1PRXA 4MPFA 2GT5A 2CX4A 3CYNA 1SL2B 2R3XA 3RBTA 3SBCA 3TJFA 3IE3A 4MMMA 2HLSA 1O7UA 1O81A 3VFIA 3BD2A 4HSCX 5IPGA 4NHWA 5AISA 4XTSA 4EIQA 1SKSB 4A5PA 3FZ5A 3PH9A 1CQHA 4WR5A 3KEBA 1R4WA 1SYRA 2DIZA 3W8JA 1ZYEA 4ECBA 1PGTA 2M72A 5BMUA 4V2LA 2HI7A 2L5LA 3M8NA 1PFOA 4ZL7A 1WIKA 2QKEA 2IPAA 1AAZA 5GSSA 1WRYA 1K0CA 3UBLA 2GVPA 2E7PA 4K8MA 5ENUA 4GSTA 4ML1A 5F0GA 4ZBAA 5HR1A 4PUAA 2A4VA 5J9CA 3DXBA 1B9XC 4HQZA 3UAPA 4KSOA 1YY7A 4RI6A 1XCCA 1PKZA 4HUAA 4EIPA 1X9WB 4G2EA 4EKZA 3FMWA 4V1Ap 4MH3A 2V41A 1HD2A 5CREA 3TCOA 3NIVA 1THOA 6GSWA 4GF0A 4POMA 4WF5A 2L4QA 3HCZA 3MIXA 3GN3A 1R5AA 2OE0A 4EC0A 2OACA 2H6ZA 3F9UA 2PUKC 1O6JA 2R6KA 2JZTA 2AB6A 4I2TA 1XW6A 3ZIVA 2I4AA 4CY6A 2YJ7A 3IDVA 3VI5A 5LD0A 2WGRA 3MDKA 1KBNA 1GUMA 4KX4A 1W89A 2GZZA 4FYCA 4TRXA 1MEKA 4BL7B 1J9BA 3RPNA 3IV4A 1OC9B 4IHUA 3Q18A 1TTZA 1JFUA 2H66A 3CSJA 1T4ZA 2DJJA 3FYGA 1N8JA 3APQA 1ZL9A 5LNKe 4EF0A 4JZQA 5F06A 1TW9A 1J0FA 2ES7A 4ILFA 1EZKA 3TKSC 2OE3A 5DCHA 3UJ1A 1GLPA 1MTCA 1RW1A 2WCIA 2CAIA 4XRAA 4LMWA 5CP1A 4KF9A 4MJBA 1FVKA 2L4CA 1I5GA 3IBHA 4K7NA 4PNFA 3FW2A 3TJKA 2CAQA 1OVNA 2CZ2A 2E0QA 5D9WA 1ZYQB 3KM6A 2FY6A 4GSNA 3KCMA 1G6WA 4I8BA 1K0NA 3UMAA 3LQ7A 3SWLA 2AAWA 3HZ4A 4RI7A 3VWWA 1FG4A 2P0GA 2ZNMA 4ISDA 2OE1A 2B7KA 4HOJA 4OCEA 5IM9A 4K6XA 5BRTA 3DKSA 3NZNA 2WDUA 2YWIA 1X9SB 5ECHB 2A2SA 4QQ7A 3ZVJA 2J23A 2IWTA 2MMAA 1ERUA 4XS4B 2A2RA 2YOIA 5AIVA 2YV7A 3JCML 4HZ2A 3HVNA 4X43A 1ZMAA 1QUWA 2IFQA 1JZWA 5ELAA 2GT6A 2K8SA 2L6CA 2NBSA 2K9FA 1HQOA 4HEA2 2DC5A 3VPQA 4O92A 4YQVA 5ABRA 1S3DA 2KLXA 4RQRA 2MMZA 1AQWA 2VD1A 3UEMA 2H76A 4IGJA 1K0OA 5IMCA 1SJ6A 3TJGA 2B5XA 2C3NA 2VLVA 4TXOB 2FWFA 2X8GA 1TRVA 1V2AA 3GHAA 3TOTA 4MLYA 5F07A 6GSVA 2HZEB 4EDYA 4FYBA 12GSA 4OMVA 4TW5A 4OO4A 1WJKA 2GLRA 3GRXA 2YZHA 2BMXA 3ZRDA 2HSYA 2I81A 4E8EA 2OADA 3KTBA 3V1WA 1GSEA 3EVIA 4O7HA 1QFNA 4KB3A 3WGXA 4JE1A 1Z6NA 5GZZB 3HJPA 2AHEA 5INYA 4WBRD 5AGYA 1EP7A 2G0FA 4F0BA 3GMFA 3GV1A 3RAZA 2NPBA 1OC8A 1HYUA 4ZILA 3D22A 1NHYA 3P7XA 3GIXA 1CQGA 2X8HA 4GXZA 2IMKA 1GSUA 2YCDA 3ZFLA 2HFDA 2ON5A 2H6YA 2RUEA 4XRDA 1WWJA 1EOHA 1XG8A 2FCHA 1A8YA 2F51A 2WULA 1ZZYA 3R3EA 1VRSD 3GSSA 3VURA 4BWQA 1XZOA 3CTGA 5EVOA 1VF2A 3I43A 4O5QA 3NOFA 4IKHA 1PL1A 4X1UA 3BCIA 1HNBA 4F9ZA 2H71A 4MK3A 3EPTA 4V1Ag 4K7OA 2O89A 3UOMA 2DJKA 2MBTA 3I9V2 4MZCA 2GSSA 1URMA 3DVXA 2IL3A 1N2AA 3C7MA 2CVKA 2R0CA 3HJOA 4J56E 2AYTA 2LSTA 2C80A 2TIRA 3QOUA 3US3A 2P5QA 3DGQA 2FD3A 3GYKA 4HJ2A 3IHGA 3KIJA 4EUYA 4GQCA 1ST9A 3GTUB 3I69A 1YEXA 3E3EA 3EC3A 1SU9A 3F6DA 1TU7A 2C0FA 5DJMA 1AXDA 3F4RA 3CTFA 3TRPA 1ACVA 2YN1A 3APOA 5EY6A 1XOAA 3HZ8A 2WRTA 4PQHA 5HFIA 3ZFBA 1NM3A 3VWUA 2DIYA 4KCEA 2PU9C 3ERFA 3IC8A 1FW1A 1DSBA 2VM1A 1GUKA 4XS1A 2LKUA 5DBQA 3ME8A 4WR4A 2A2PA 5KOWA 4OWYA 3HXSA 1XWBA 4TR3A 3ZREA 2HRNA 1RQMA 4ECJA 5KN1A 3IC4A 2C3QA 5ECLB 5KOXA 1MDJA 4ECIA 5JWOB 4MDCA 4AJ7A 3QDNA 1YF0A 1Q4JA 1GSYA 2GQKA 3WGEA 3H93A 22GSA 4IP6A 1O73A 1Z3EA 2HSMA 1VF4A 3L9SA 3TRXA 3ZVJD 3G9BA 4FO5A 1GWCA 5JCUA 5IQYA 2VL9A 1PX6A 3J7Yk 2C0DA 2VCTA 7GSSA 3HDCA 1NHOA 1B8XA 1AW9A 5A5KA 4HJMA 4ID0A 1AQXA 3QAWA 3GSTA 2H1DA 2V1MA 4Z7XA 2B5EA 2HE3A 5KN0A 3KXOA 2DSAA 3BJ5A 1BJXA 3L78A 1R5PA 1SD8A 3MYDA 3FHKA 3E0UA 2LQQA 5E4WA 3GL3A 5G30A 2EC4A 4L5LA 5D9XA 1K0AA 4OFMA 5HQPA 4IJIA 1TJDA 5ECKB 2C0GA 3L9VA 3M3MA 4ZBBA 2HYXA 4MCUA 4JEDA 2HT9A 2XBQA 2CQ9A 2DLXA 1GRXA 3CBUA 3LSZA 5ECIB 4OCFA 1VF1A 3A3TA 3DEXA 3DD3A 4I97A 1EGOA 2JZSA 2CX3A 1X5EA 4HDEA 3Q6OA 1GTAA 4H86A 4G0LA 3D4MA 4G19A 4MF5A 2FNOA 1PN9A 2UZ8A 16GSA 4ML6A 1M7TA 4LMVA 5AIXA 5ECRB 3MAKA 3EURA 1SL1B 1T00A 2MMNA 3Q19A 1XWGA 1U3AA 1EGRA 3F4TA 4ZBDA 3QFBC 3DIEA 1TK8B 3IR4A 1KTEA 3DRNA 3D0ZA 1YKCA 1EEMA 3UVTA 2JL4A 2PGTA 3MNGA 2YJHA 2A4HA 5J41A 1B48A 1IYIA 2H8LA 5IO2A 1EV9A 3GKMA 1GSSA 4DSSB 3KP9A 3C1RA 5HFGA 5ECSA 2CVDA 3VI7A 2QA1A 3FZ4A 3LXZA 1UN2A 1I9DA 2NDOA 2RIIA 4AJ8A 2H0GA 1OYJA 1UA5A 1ERVA 3CQFA 1F2EA 4BWSA 1TP9A 2YZUA 2GSTA 1A23A 3VPTA 5CYYA 3VLNA 5L71A 3HD5A 3FY7A 1FVJA 1S3AA 3PPUA 3ERWA 4EXJA 4OFTA 3GH9A 3TRQA 1ZCPA 3HA9A 2RM6A 4TN8A 5F8BA 3FEUA 5FT3A 4KDXA 4PQ1A 4X4JA 1GH2A 1JHBA 4KNDA 1PX7A 4PURA 1OAZA 5C00A 6GSTA 3IAM2 3IXRA 2K6VA 1ZGNA 1FO5A 1XVWA 2WJUA 2BTOT 4TOPA 1K0BA 4K7IA 2FA4A 2VAFA 4ULXA 2GQMA 2H74A 1BAYA 2GTUA 1GSQA 1GTBA 5G1KA 4KDUA 5IMVA 5ELGA 2OBIA 4BIKA 1JLWA 4JBBA 2V6KA 4QL7A 1WOUA 4GLTA 3ZITA 1R7HA 2REMA 4FYUA 3EINA 5ECNB 3QAGA 4OFNA 1FB0A 5B8AA 2PBJA 3CSHA 5CO3A 4DSQA 5IPHA 4OO5A 2H30A 2VM2A 2R0GA 4HU7A 3C73A 3R2QA 1VGLA 3WD6A 5JWRB 2YWOA 3PR8A 3ISOA 5CRHA 3U5RE 1YF1A 1S3RA 2YWMA 4G0KA 1S3CA 1PQNA 5D8IA 3LW9A 4V2MA 4ZL9A 3Q74A 1HNCA 4XS6A 4N0VA 1YKAA 4AF2A 1XW5A 1SL0B 3H1NA 4Q5QA 4KUNA 3M9JA 1F37A 2AJQB 3KP8A 1V9WA 3UL3A 1H4OA 1TKDB 4FIWA 1LU4A 5D9TA 2H1AA 3HHVA 3UARA 1PKWA 4Z2UA 2M80A 4TR1A 4MZWA 5JCWA 1AIUA 3AY8A 4MJCA 3S9FA 5J5NA 2B1LA 2OJLA 3H8QA 4KDYA 2F9SA 3EU3A 3TKSE 1M9BA 1U87A 1YDKA 2HXKA 3LORA 1Z6MA 2AUVA 2H1GA 3IPZA 4K0GA 4KCAA 3L0HA 3UBKA 3ED3A 5COHA 4JR4A 3F3RA 3F3QA 2GZYA 2R4VA 1SENA 4K0NA 4ZB6A 4NXIA 1A0FA 4MF7A 1O8WA 4N0ZA 1TI3A 2QGVA 4NV2A 1AC1A 3L9UA 2ZUPA 3C1SA 4F2IA 2V6OA 4WKWA 4TVEA 2LQOA 2OBKA 4GRFA 1B4PA 3LGCA 3RDWA 1YEPA 2H6XA 3QAVA 1X5CA 4G9HA 4MP4A 3H79A 4BVXA 1A24A 4F82A 1OE7A 4MF6A 2DJ3A 2M46A 2GSQA 4PNGA 2B7JA 1XW9A 2YANA 3TKPA 4YQUA 3KD0A 2PN8A 2L59A 2VL2C 19GSA 5A4VA 4XCSA 3UVHA 2WZ9A 4HS1A 4EVMA 5A4UA 3CRUA 1GSFA 2O7KA 4CY8A 2XC2A 1WMJA 2XPEA 2VCXA 5IOWA 4EE0A 4X0XA 1TRUA 5KN2A 3A2VA 2LRCA 2H72A 1Z7PA 1SK1A 1Q98A 2MBSA 2QC7A 1B4QA 5KEJA 2FGXA 4HZ4A 2HNLA 2CV4A 3GA4A 2P31A 2HSHA 3GURA 6GSYA 5CNWA 4TXVA 5B6MA 5C04A 1K3LA 1M3JA 1NW2A 4AJ6A 1LBKA 4KA0A 2B1KA 1QXHA 4TR0A 1DBYA 4YQMA 2YPMA 4ZB8A 1BEDA 4K1FA 2DKHA 5GAND 1YZXA 4POBA 2NVLA 3BBYA 3QMXA 13GSA 2IFQB 4MJEA 3GKKA 4DEJA 4QL9A 3PINA 5G1LA 4CHSA 2DMMA 6GSSA 3ZYWA 1A2LA 4L0WA 1G7OA 2LV3A 1GNWA 1QK8A 3D4TA 2VCVA 3A5WA 4L5OA 4TR1B 3LFLA 2IJYA 4NV5A 4P3YB 4K2XA 5CRWA 1XWKA 1GSDA 1T8EB 3IK9A 4IW9A 3KZQA 1ERTA 3EE2A 2PVOC 3QR6A 1X0RA 1DUGA 3F0IA 4L8EA 5FWGA 3TDGA 5LCZA 2B6MA 1ON4A 2P5RA 3FKFA 3MWHA 2FUG2 1O85A 4WBJA 5J3RA 5HR2A 2BJXA 2VOCA 2E2GA 2VL3A 2L57A 2PVQA 4WETA 4PGTA 1M3IA 3ZMLA 2B3SA 1U6TA 2N5FA 4WEYA 1J08A 3KMNA 3N9JA 4KW6A 1VF3A 4MNNA 4RQXA 2H19A 3P2AA 1H75A 3FZ9A 5HR3A 2H73A 1KEBA 3EWLA 3WGDA 5DDLA 1F3AA 2EIOA 1FOHA 4BVXB 1T7PB 3VWXA 3KH7A 4IVFA 4CW9A 2I1UA 1IYHA 4MPGA 4F0CA 4Q5NA 5D73A 4KE3A 5ID2A 1E6BA 3QFAC 1V58A 3LJRA 1SYXA 2H0IA 1O8XA 3D21A 4ICYA 4LL1B 4USSA 4PXOA 4BL7A 2LNSA 1MDKA 3C71A 20GSA 1GL8A 1TXXA 2YNXA 2PMTA 3M9KA 1QGVA 2LJRA 1BQ7A 3DMLA 4I2UA 5GSTA 2CT6A 4LL4B 1G0TA 1GNEA 11GSA 4D73A 4NAXA 3E9JB 4HQSA 3IHQA 4O5UA 1GTUA 4MJAA 3EMXA 5CAXA 4K2DA 1JZOA 4GWRA 2F8AA 4Q5RA 1GTIA 4V2NA 1TK0B 3TKQA 2NTOA 1SD9A 2TRCP 3W6GA 3TOUA 2ON7A
chains in the Genus database with same CATH topology
3FZAA 2H70A 3VK9A 1XXUA 3P90A 1XPVA 2VCWA 2R5GA 2WS2A 2DJ2A 1MD3A 1XWCA 5ECOB 2C0EA 2AV4A 2O8VB 2LUSA 2TRXA 3BOAA 4MA9A 3HVXA 5B7CA 3LWAA 5DQSA 2VIMA 2N5BA 4IJ3A 2C3TA 1K0DA 1LJRA 2B5YA 1ERWA 3ZMKA 2JSZA 1E2YA 5DALA 2VL2A 4POLA 5B8BA 4BPYA 2WB9A 3IK7A 4XS4A 3O3TA 5IMDA 4O5RA 4DSRA 1WPIA 2LRTA 1F9MA 3TJBA 2C8UA 2O85A 2GQLA 2VD0A 4F03A 2RLIA 4ECCA 5DAKA 3TGZA 1XFLA 5HR0A 3FR3A 3DYRA 1M2DA 2DJ1A 1A0RP 2QSIA 2F8FA 4K9ZA 3CSIA 3BCKA 1MDIA 1V98A 2X99A 2FHEA 2JADA 5G2ZA 3HYPA 2LNTA 2KUCA 2D2ZA 2WFCA 5B6NA 1GP1A 2DKIA 4TXOA 4MZBA 1XOBA 2X8CA 3LG6A 1EOGA 3PGTA 1K0MA 3ME7A 4IQ1A 2V2GA 5G5EA 3EYTA 3QCPA 4ZXGA 4LA1A 2HZEA 5HFKA 5F05A 3KGKA 3DWVA 3F6FA 1XWAA 1K3YA 2O87A 3F4SA 4JU5A 1AQVA 5ID2B 1M99A 3KMOA 5FHIA 1PD21 4E8HA 2RM5A 2MZCA 1TRSA 5H5QA 4YKFA 1X5DA 1TRWA 2CA8A 2FWHA 4ZL8A 3A5IA 1SJZA 1TU8A 4N11A 3GNJA 4EO3A 1X9MB 2CZ3A 2GS3A 3A2XA 3LYPA 3LEFA 5CRGA 1XVQA 3RHCA 2DBCA 1PN0A 2MMOA 3LYKA 5JWQB 3GX0A 17GSA 4D73B 1DE1A 1Z9HA 4I5QA 4KH7A 2YWNA 3O6TA 1AUCA 4G10A 3FK8A 2PERA 2CVBA 3P8WA 1A2JA 5J4UA 4NHZA 4KAEA 1EEJA 1UVZA 2PPTA 2R0PA 4TR4A 4J2FA 3WT1A 1Z5YE 2F3MA 3TJJA 1PA3A 10GSA 3I6AA 5G31A 3M1GA 3M0FA 3W8SA 3CMIA 3OR5A 1NSWA 3HVSA 1QMVA 5J9BA 1ZYNA 2DMLA 2N5AA 2XBIA 4N10A 5DVBA 2LRNA 1FOVA 5DALB 3L4NA 2MYGA 2KP2A 1TK5B 1GULA 2PWJA 3GX8A 1FB6A 1Z7RA 1ZOFA 3J7Yb 4FQUA 3GKNA 3GTUA 2I3YA 1FHEA 4DVCA 2LTKA 1PSQA 1BG5A 6GSUA 3VWVA 5DAKB 4PQIA 2H1BA 4LLRA 4YAPA 3IAS2 4NWYA 4Q5FA 4IQAA 4I6XA 2R2JA 3KJYA 1EWXA 1ML6A 4J57E 1V40A 2KOKA 4YAVA 5H5RA 3D6IA 1SKRB 4PUFC 5A4WA 3APSA 2JSYA 4GCIA 5D93A 2LJKA 3ZL5A 2RUFA 1FAAA 2H75A 2VLTA 5JCGA 1F6MC 1R26A 5ECQB 3G7IA 5GAPD 3TKRA 3FRCA 2LJAA 4OD7A 2DJ0A 3WYWA 2JZRA 4BVYA 4IN0A 3GL5A 4HI7A 4PTSA 1XIYA 4AGSA 1C72A 4ACSA 2HRKA 18GSA 5IMAA 1JZRA 4JR6A 1F3BA 4HU9A 5H5SA 1TOFA 3CXGA 1B9YC 4POKA 1A8LA 1MD4A 3LXTA 4O32A 5DCGA 4FH8A 4EDZA 3GKXA 3DVWA 5KN3A 2E2MA 1M0UA 2VUPA 3EU4A 3N5OA 4YKGA 2ALBA 5IMFA 5IIZA 4PX1A 2IIYA 2OKAA 2VO4A 4IELA 1T3BA 2X49A 1T4YA 2FA8A 1OC3A 1QQ2A 1SK2A 2Z9SA 2VCQA 1RK4A 2HRAA 1OE8A 2EIQA 1SJIA 1WP0A 3HJMA 2JU5A 4Z2RA 1GLQA 2GSRA 4Z2TA 3KTLA 2H01A 1PL2A 2FWEA 3FR9A 9GSSA 4MH2A 1TDIA 5DJLA 5E59A 2HZFA 3MSZA 2KHPA 4G0IA 1M2BA 2JACA 3TB2A 2GGTA 4GQFA 2L6DA 1THXA 3CRTA 8GSSA 3IA1A 5EPFA 2IMIA 4GSSA 1G7EA 1PMTA 4ZIJA 3HY2A 1BYEA 1JZDA 2L5OA 2J9HA 5ECMB 5D96A 5DQYA 2FWGA 2C4JA 3GH6A 2R37A 3WT2A 2GDRA 4NMUA 4NPBA 3ZZXA 5EL8A 1XBSA 1GUHA 3ZIJA 2YV9A 3F8UA 2G2QA 1Y25A 4RUVA 1HNAA 2K8VA 4GTUA 3TKSA 1OKTA 4L0UA 2FLSA 3QD9A 1M9AA 5IOXA 2X4AA 1A2MA 2YP6A 1YQ1A 1ZYPA 3F63A 5ECPB 4KSMA 3C8EA 4IP1A 3KH9A 3RHBA 5IO0A 4XHMA 2H0HA 4MABA 1EV4A 3ZTLA 4K5RA 3EMPA 4DSSA 3ZLPA 4WF4A 6GSXA 1DE2A 4IBPA 3G7JA 4KGIA 4BVYB 2LS5A 3QPMA 4WXTA 1EP8A 4BA7A 2XHFA 2VLUA 4K5SA 3HKRA 1ABAA 4TKYA 3ERGA 2IMDA 2LEGA 2GZPA 1V57A 2XPDA 2IN3A 3H4KA 1WE0A 2IMEA 4YH2A 3U6VA 1SK0A 1T1VA 1W4VA 2QA2A 1G6YA 3UIWA 2V32A 5D9VA 3D5JA 14GSA 1M2AA 4N30A 1TI1A 3GFKA 4EL1A 1OKDA 1U3IA 1ILOA 2X64A 2I9HA 2K18A 2C1YA 2ZCTA 1OC9A 3G7YA 3GUSA 1U88A 1UC7A 1SKWB 3TUEA 5CRDA 5AN1A 5IMZA 3HVVA 4JRRA 4CDOA 2EIRA 3IOSA 1KNGA 4XIHA 2OA7A 2IMFA 1USBA 3K8NA 4IS0A 1JLVA 1K3OA 5G5FA 1Y6EA 3IRAA 2KP1A 1BX9A 2VCZA 1YJ6A 2HRFA 3FR6A 3A2WA 4ZB9A 3RPPA 3O76A 1PRXA 4MPFA 2GT5A 2CX4A 3CYNA 1SL2B 2R3XA 3RBTA 3SBCA 3TJFA 3IE3A 4MMMA 2HLSA 1O7UA 1O81A 3VFIA 3BD2A 5IPGA 4NHWA 5AISA 4XTSA 4EIQA 1SKSB 4A5PA 3FZ5A 3PH9A 1CQHA 4WR5A 3KEBA 1R4WA 1SYRA 2DIZA 3W8JA 1ZYEA 4ECBA 1PGTA 2M72A 5BMUA 4V2LA 2HI7A 2L5LA 3M8NA 4ZL7A 1WIKA 2QKEA 2IPAA 1AAZA 5GSSA 1WRYA 1K0CA 3UBLA 2GVPA 2E7PA 4K8MA 5ENUA 4GSTA 4ML1A 5F0GA 4ZBAA 5HR1A 4PUAA 2A4VA 5J9CA 3DXBA 1B9XC 4HQZA 3UAPA 4KSOA 1YY7A 4RI6A 1XCCA 1PKZA 4HUAA 4EIPA 1X9WB 4G2EA 4EKZA 3FMWA 4V1Ap 4MH3A 2V41A 1HD2A 5CREA 3TCOA 3NIVA 1THOA 6GSWA 4GF0A 4POMA 4WF5A 2L4QA 3HCZA 3MIXA 3GN3A 1R5AA 2OE0A 4EC0A 2OACA 2H6ZA 3F9UA 2PUKC 1O6JA 2R6KA 2JZTA 2AB6A 4I2TA 1XW6A 3ZIVA 2I4AA 4CY6A 2YJ7A 3IDVA 3VI5A 5LD0A 2WGRA 3MDKA 1KBNA 1GUMA 4KX4A 1W89A 2GZZA 4FYCA 4TRXA 1MEKA 4BL7B 1J9BA 3RPNA 3IV4A 1OC9B 4IHUA 3Q18A 1TTZA 1JFUA 2H66A 3CSJA 1T4ZA 2DJJA 3FYGA 1N8JA 3APQA 1ZL9A 5LNKe 4EF0A 4JZQA 5F06A 1TW9A 1J0FA 2ES7A 4ILFA 1EZKA 3TKSC 2OE3A 5DCHA 3UJ1A 1GLPA 1MTCA 1RW1A 2WCIA 2CAIA 4XRAA 4LMWA 5CP1A 4KF9A 4MJBA 1FVKA 2L4CA 1I5GA 3IBHA 4K7NA 4PNFA 3FW2A 3TJKA 2CAQA 1OVNA 2CZ2A 2E0QA 5D9WA 1ZYQB 3KM6A 2FY6A 4GSNA 3KCMA 1G6WA 4I8BA 1K0NA 3UMAA 3LQ7A 3SWLA 2AAWA 3HZ4A 4RI7A 3VWWA 1FG4A 2P0GA 2ZNMA 4ISDA 2OE1A 2B7KA 4HOJA 4OCEA 5IM9A 4K6XA 5BRTA 3DKSA 3NZNA 2WDUA 2YWIA 1X9SB 5ECHB 2A2SA 4QQ7A 3ZVJA 2J23A 2IWTA 2MMAA 1ERUA 4XS4B 2A2RA 2YOIA 5AIVA 2YV7A 3JCML 4HZ2A 4X43A 1ZMAA 1QUWA 2IFQA 1JZWA 5ELAA 2GT6A 2K8SA 2L6CA 2NBSA 2K9FA 1HQOA 4HEA2 2DC5A 3VPQA 4O92A 4YQVA 5ABRA 1S3DA 2KLXA 4RQRA 2MMZA 1AQWA 2VD1A 3UEMA 2H76A 4IGJA 1K0OA 5IMCA 1SJ6A 3TJGA 2B5XA 2C3NA 2VLVA 4TXOB 2FWFA 2X8GA 1TRVA 1V2AA 3GHAA 3TOTA 4MLYA 5F07A 6GSVA 2HZEB 4EDYA 4FYBA 12GSA 4OMVA 4TW5A 4OO4A 1WJKA 2GLRA 3GRXA 2YZHA 2BMXA 3ZRDA 2HSYA 2I81A 4E8EA 2OADA 3KTBA 3V1WA 1GSEA 3EVIA 4O7HA 1QFNA 4KB3A 3WGXA 4JE1A 1Z6NA 5GZZB 3HJPA 2AHEA 5INYA 4WBRD 5AGYA 1EP7A 2G0FA 4F0BA 3GMFA 3GV1A 3RAZA 2NPBA 1OC8A 1HYUA 4ZILA 3D22A 1NHYA 3P7XA 3GIXA 1CQGA 2X8HA 4GXZA 2IMKA 1GSUA 2YCDA 3ZFLA 2HFDA 2ON5A 2H6YA 2RUEA 4XRDA 1WWJA 1EOHA 2FCHA 1A8YA 2F51A 2WULA 1ZZYA 3R3EA 1VRSD 3GSSA 3VURA 4BWQA 1XZOA 3CTGA 5EVOA 1VF2A 3I43A 4O5QA 3NOFA 4IKHA 1PL1A 4X1UA 3BCIA 1HNBA 4F9ZA 2H71A 4MK3A 3EPTA 4V1Ag 4K7OA 2O89A 3UOMA 2DJKA 2MBTA 3I9V2 4MZCA 2GSSA 1URMA 3DVXA 2IL3A 1N2AA 3C7MA 2CVKA 2R0CA 3HJOA 4J56E 2AYTA 2LSTA 2C80A 2TIRA 3QOUA 3US3A 2P5QA 3DGQA 2FD3A 3GYKA 4HJ2A 3IHGA 3KIJA 4EUYA 4GQCA 1ST9A 3GTUB 3I69A 1YEXA 3E3EA 3EC3A 1SU9A 3F6DA 1TU7A 2C0FA 5DJMA 1AXDA 3F4RA 3CTFA 3TRPA 1ACVA 2YN1A 3APOA 5EY6A 1XOAA 3HZ8A 2WRTA 4PQHA 5HFIA 3ZFBA 1NM3A 3VWUA 2DIYA 4KCEA 2PU9C 3ERFA 3IC8A 1FW1A 1DSBA 2VM1A 1GUKA 4XS1A 2LKUA 5DBQA 3ME8A 4WR4A 2A2PA 5KOWA 4OWYA 3HXSA 1XWBA 4TR3A 3ZREA 2HRNA 1RQMA 4ECJA 5KN1A 3IC4A 2C3QA 5ECLB 5KOXA 1MDJA 4ECIA 5JWOB 4MDCA 4AJ7A 3QDNA 1YF0A 1Q4JA 1GSYA 2GQKA 3WGEA 3H93A 22GSA 4IP6A 1O73A 1Z3EA 2HSMA 1VF4A 3L9SA 3TRXA 3ZVJD 3G9BA 4FO5A 1GWCA 5JCUA 5IQYA 2VL9A 1PX6A 3J7Yk 2C0DA 2VCTA 7GSSA 3HDCA 1NHOA 1B8XA 1AW9A 5A5KA 4HJMA 4ID0A 1AQXA 3QAWA 3GSTA 2H1DA 2V1MA 4Z7XA 2B5EA 2HE3A 5KN0A 3KXOA 2DSAA 3BJ5A 1BJXA 3L78A 1R5PA 1SD8A 3MYDA 3FHKA 3E0UA 2LQQA 5E4WA 3GL3A 5G30A 2EC4A 4L5LA 5D9XA 1K0AA 4OFMA 5HQPA 4IJIA 1TJDA 5ECKB 2C0GA 3L9VA 3M3MA 4ZBBA 2HYXA 4MCUA 4JEDA 2HT9A 2XBQA 2CQ9A 2DLXA 1GRXA 3CBUA 3LSZA 5ECIB 4OCFA 1VF1A 3A3TA 3DEXA 3DD3A 4I97A 1EGOA 2JZSA 2CX3A 1X5EA 4HDEA 3Q6OA 1GTAA 4H86A 4G0LA 3D4MA 4G19A 4MF5A 2FNOA 1PN9A 2UZ8A 16GSA 4ML6A 1M7TA 4LMVA 5AIXA 5ECRB 3MAKA 3EURA 1SL1B 1T00A 2MMNA 3Q19A 1XWGA 1U3AA 1EGRA 3F4TA 4ZBDA 3QFBC 3DIEA 1TK8B 3IR4A 1KTEA 3DRNA 3D0ZA 1YKCA 1EEMA 3UVTA 2JL4A 2PGTA 3MNGA 2YJHA 2A4HA 5J41A 1B48A 1IYIA 2H8LA 5IO2A 1EV9A 3GKMA 1GSSA 4DSSB 3KP9A 3C1RA 5HFGA 5ECSA 2CVDA 3VI7A 2QA1A 3FZ4A 3LXZA 1UN2A 1I9DA 2NDOA 2RIIA 4AJ8A 2H0GA 1OYJA 1UA5A 1ERVA 1F2EA 4BWSA 1TP9A 2YZUA 2GSTA 1A23A 3VPTA 5CYYA 3VLNA 5L71A 3HD5A 3FY7A 1FVJA 1S3AA 3PPUA 3ERWA 4EXJA 4OFTA 3GH9A 3TRQA 1ZCPA 3HA9A 2RM6A 4TN8A 5F8BA 3FEUA 5FT3A 4KDXA 4PQ1A 4X4JA 1GH2A 1JHBA 4KNDA 1PX7A 4PURA 1OAZA 5C00A 6GSTA 3IAM2 3IXRA 2K6VA 1ZGNA 1FO5A 1XVWA 2WJUA 2BTOT 4TOPA 1K0BA 4K7IA 2FA4A 2VAFA 4ULXA 2GQMA 2H74A 1BAYA 2GTUA 1GSQA 1GTBA 5G1KA 4KDUA 5IMVA 5ELGA 2OBIA 1JLWA 4JBBA 2V6KA 4QL7A 1WOUA 4GLTA 3ZITA 1R7HA 2REMA 4FYUA 3EINA 5ECNB 3QAGA 4OFNA 1FB0A 5B8AA 2PBJA 3CSHA 5CO3A 4DSQA 5IPHA 4OO5A 2H30A 2VM2A 2R0GA 4HU7A 3C73A 3R2QA 1VGLA 3WD6A 5JWRB 2YWOA 3PR8A 3ISOA 5CRHA 3U5RE 1YF1A 2YWMA 4G0KA 1S3CA 1PQNA 5D8IA 3LW9A 4V2MA 4ZL9A 3Q74A 1HNCA 4XS6A 4N0VA 1YKAA 4AF2A 1XW5A 1SL0B 3H1NA 4Q5QA 4KUNA 3M9JA 1F37A 2AJQB 3KP8A 1V9WA 3UL3A 1H4OA 1TKDB 4FIWA 1LU4A 5D9TA 2H1AA 3HHVA 3UARA 1PKWA 4Z2UA 2M80A 4TR1A 4MZWA 5JCWA 1AIUA 3AY8A 4MJCA 3S9FA 5J5NA 2B1LA 2OJLA 3H8QA 4KDYA 2F9SA 3EU3A 3TKSE 1M9BA 1U87A 1YDKA 2HXKA 3LORA 1Z6MA 2AUVA 2H1GA 3IPZA 4K0GA 4KCAA 3L0HA 3UBKA 3ED3A 5COHA 4JR4A 3F3RA 3F3QA 2GZYA 2R4VA 1SENA 4K0NA 4ZB6A 4NXIA 1A0FA 4MF7A 1O8WA 4N0ZA 1TI3A 2QGVA 4NV2A 1AC1A 3L9UA 2ZUPA 3C1SA 4F2IA 2V6OA 4WKWA 4TVEA 2LQOA 2OBKA 4GRFA 1B4PA 3LGCA 3RDWA 1YEPA 2H6XA 3QAVA 1X5CA 4G9HA 4MP4A 3H79A 4BVXA 1A24A 4F82A 1OE7A 4MF6A 2DJ3A 2M46A 2GSQA 4PNGA 2B7JA 1XW9A 2YANA 3TKPA 4YQUA 3KD0A 2PN8A 2L59A 2VL2C 19GSA 5A4VA 4XCSA 3UVHA 2WZ9A 4HS1A 4EVMA 5A4UA 3CRUA 1GSFA 2O7KA 4CY8A 2XC2A 1WMJA 2XPEA 2VCXA 5IOWA 4EE0A 4X0XA 1TRUA 5KN2A 3A2VA 2LRCA 2H72A 1Z7PA 1SK1A 1Q98A 2MBSA 2QC7A 1B4QA 5KEJA 2FGXA 4HZ4A 2HNLA 2CV4A 3GA4A 2P31A 2HSHA 3GURA 6GSYA 5CNWA 4TXVA 5B6MA 5C04A 1K3LA 1NW2A 4AJ6A 1LBKA 4KA0A 2B1KA 1QXHA 4TR0A 1DBYA 4YQMA 2YPMA 4ZB8A 1BEDA 4K1FA 2DKHA 5GAND 1YZXA 4POBA 2NVLA 3BBYA 3QMXA 13GSA 2IFQB 4MJEA 3GKKA 4DEJA 4QL9A 3PINA 5G1LA 4CHSA 2DMMA 6GSSA 3ZYWA 1A2LA 4L0WA 1G7OA 2LV3A 1GNWA 1QK8A 3D4TA 2VCVA 3A5WA 4L5OA 4TR1B 3LFLA 2IJYA 4NV5A 4P3YB 4K2XA 5CRWA 1XWKA 1GSDA 1T8EB 3IK9A 4IW9A 3KZQA 1ERTA 3EE2A 2PVOC 3QR6A 1X0RA 1DUGA 3F0IA 4L8EA 5FWGA 3TDGA 5LCZA 2B6MA 1ON4A 2P5RA 3FKFA 3MWHA 2FUG2 1O85A 4WBJA 5J3RA 5HR2A 2BJXA 2VOCA 2E2GA 2VL3A 2L57A 2PVQA 4WETA 4PGTA 3ZMLA 2B3SA 1U6TA 2N5FA 4WEYA 1J08A 3KMNA 3N9JA 4KW6A 1VF3A 4MNNA 4RQXA 2H19A 3P2AA 1H75A 3FZ9A 5HR3A 2H73A 1KEBA 3EWLA 3WGDA 5DDLA 1F3AA 2EIOA 1FOHA 4BVXB 1T7PB 3VWXA 3KH7A 4IVFA 4CW9A 2I1UA 1IYHA 4MPGA 4F0CA 4Q5NA 5D73A 4KE3A 5ID2A 1E6BA 3QFAC 1V58A 3LJRA 1SYXA 2H0IA 1O8XA 3D21A 4ICYA 4LL1B 4USSA 4PXOA 4BL7A 2LNSA 1MDKA 3C71A 20GSA 1GL8A 1TXXA 2YNXA 2PMTA 3M9KA 1QGVA 2LJRA 1BQ7A 3DMLA 4I2UA 5GSTA 2CT6A 4LL4B 1G0TA 1GNEA 11GSA 4D73A 4NAXA 3E9JB 4HQSA 3IHQA 4O5UA 1GTUA 4MJAA 3EMXA 5CAXA 4K2DA 1JZOA 4GWRA 2F8AA 4Q5RA 1GTIA 4V2NA 1TK0B 3TKQA 2NTOA 1SD9A 2TRCP 3W6GA 3TOUA 2ON7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FZA A;  2H70 A;  3VK9 A;  1XXU A;  3P90 A;  1XPV A;  2VCW A;  2R5G A;  2WS2 A;  2DJ2 A;  1MD3 A;  1XWC A;  5ECO B;  2C0E A;  2AV4 A;  2O8V B;  2LUS A;  2TRX A;  3BOA A;  4MA9 A;  3HVX A;  5B7C A;  3LWA A;  5DQS A;  2VIM A;  2N5B A;  4IJ3 A;  2C3T A;  1K0D A;  1LJR A;  2B5Y A;  1ERW A;  3ZMK A;  2JSZ A;  1E2Y A;  5DAL A;  2VL2 A;  4POL A;  5B8B A;  4BPY A;  2WB9 A;  3IK7 A;  4XS4 A;  3O3T A;  5IMD A;  4O5R A;  4DSR A;  1WPI A;  2LRT A;  1F9M A;  3TJB A;  2C8U A;  2O85 A;  2GQL A;  2VD0 A;  4F03 A;  2RLI A;  4ECC A;  5DAK A;  3TGZ A;  1XFL A;  5HR0 A;  3FR3 A;  3DYR A;  1M2D A;  2DJ1 A;  1A0R P;  2QSI A;  2F8F A;  4K9Z A;  3CSI A;  3BCK A;  1MDI A;  1V98 A;  2X99 A;  2FHE A;  2JAD A;  5G2Z A;  3HYP A;  2LNT A;  2KUC A;  2D2Z A;  2WFC A;  5B6N A;  1GP1 A;  4TXO A;  4MZB A;  1XOB A;  2X8C A;  3LG6 A;  1EOG A;  3PGT A;  1K0M A;  3ME7 A;  4IQ1 A;  2V2G A;  5G5E A;  3EYT A;  3QCP A;  4ZXG A;  4LA1 A;  2HZE A;  5HFK A;  5F05 A;  3KGK A;  3DWV A;  3F6F A;  1XWA A;  1K3Y A;  2O87 A;  3F4S A;  4JU5 A;  1AQV A;  5ID2 B;  1M99 A;  3KMO A;  5FHI A;  1PD2 1;  4E8H A;  2RM5 A;  2MZC A;  1TRS A;  5H5Q A;  1X5D A;  1TRW A;  2CA8 A;  2FWH A;  4ZL8 A;  1SJZ A;  1TU8 A;  4N11 A;  3GNJ A;  4EO3 A;  1X9M B;  2CZ3 A;  2GS3 A;  3A2X A;  3LYP A;  3LEF A;  5CRG A;  1XVQ A;  3RHC A;  2DBC A;  2MMO A;  3LYK A;  5JWQ B;  3GX0 A;  17GS A;  4D73 B;  1DE1 A;  1Z9H A;  4I5Q A;  4KH7 A;  2YWN A;  3O6T A;  1AUC A;  4G10 A;  3FK8 A;  2PER A;  2CVB A;  3P8W A;  1A2J A;  5J4U A;  4NHZ A;  4KAE A;  1EEJ A;  1UVZ A;  2PPT A;  4TR4 A;  4J2F A;  3WT1 A;  1Z5Y E;  2F3M A;  3TJJ A;  1PA3 A;  10GS A;  3I6A A;  5G31 A;  3M1G A;  3M0F A;  3W8S A;  3CMI A;  3OR5 A;  1NSW A;  3HVS A;  1QMV A;  5J9B A;  2DML A;  2N5A A;  2XBI A;  4N10 A;  5DVB A;  2LRN A;  1FOV A;  5DAL B;  3L4N A;  2MYG A;  2KP2 A;  1TK5 B;  1GUL A;  2PWJ A;  3GX8 A;  1FB6 A;  1Z7R A;  1ZOF A;  3J7Y b;  3GKN A;  3GTU A;  2I3Y A;  1FHE A;  4DVC A;  2LTK A;  1PSQ A;  1BG5 A;  6GSU A;  3VWV A;  5DAK B;  4PQI A;  2H1B A;  4LLR A;  4YAP A;  3IAS 2;  4NWY A;  4Q5F A;  4IQA A;  4I6X A;  2R2J A;  3KJY A;  1EWX A;  1ML6 A;  4J57 E;  1V40 A;  2KOK A;  4YAV A;  5H5R A;  3D6I A;  1SKR B;  4PUF C;  5A4W A;  3APS A;  2JSY A;  4GCI A;  5D93 A;  2LJK A;  3ZL5 A;  2RUF A;  1FAA A;  2H75 A;  2VLT A;  5JCG A;  1F6M C;  1R26 A;  5ECQ B;  3G7I A;  5GAP D;  3TKR A;  3FRC A;  2LJA A;  4OD7 A;  2DJ0 A;  3WYW A;  2JZR A;  4BVY A;  4IN0 A;  3GL5 A;  4HI7 A;  1XIY A;  4AGS A;  1C72 A;  4ACS A;  18GS A;  5IMA A;  1JZR A;  4JR6 A;  1F3B A;  4HU9 A;  5H5S A;  1TOF A;  3CXG A;  1B9Y C;  4POK A;  1A8L A;  1MD4 A;  3LXT A;  4O32 A;  5DCG A;  4FH8 A;  4EDZ A;  3GKX A;  3DVW A;  5KN3 A;  2E2M A;  1M0U A;  2VUP A;  3EU4 A;  3N5O A;  2ALB A;  5IMF A;  5IIZ A;  4PX1 A;  2IIY A;  2OKA A;  2VO4 A;  4IEL A;  1T3B A;  1T4Y A;  2FA8 A;  1OC3 A;  1QQ2 A;  1SK2 A;  2Z9S A;  2VCQ A;  1RK4 A;  1OE8 A;  2EIQ A;  1SJI A;  1WP0 A;  3HJM A;  2JU5 A;  1GLQ A;  2GSR A;  3KTL A;  2H01 A;  1PL2 A;  2FWE A;  3FR9 A;  9GSS A;  4MH2 A;  1TDI A;  5DJL A;  5E59 A;  2HZF A;  3MSZ A;  2KHP A;  1M2B A;  2JAC A;  3TB2 A;  2GGT A;  4GQF A;  2L6D A;  1THX A;  3CRT A;  8GSS A;  3IA1 A;  5EPF A;  2IMI A;  4GSS A;  1G7E A;  1PMT A;  4ZIJ A;  3HY2 A;  1BYE A;  1JZD A;  2L5O A;  2J9H A;  5ECM B;  5D96 A;  5DQY A;  2FWG A;  2C4J A;  3GH6 A;  2R37 A;  3WT2 A;  2GDR A;  4NMU A;  4NPB A;  3ZZX A;  5EL8 A;  1XBS A;  1GUH A;  3ZIJ A;  2YV9 A;  3F8U A;  2G2Q A;  1Y25 A;  4RUV A;  1HNA A;  2K8V A;  4GTU A;  3TKS A;  1OKT A;  4L0U A;  2FLS A;  3QD9 A;  1M9A A;  5IOX A;  1A2M A;  2YP6 A;  1YQ1 A;  3F63 A;  5ECP B;  4KSM A;  3C8E A;  4IP1 A;  3KH9 A;  3RHB A;  5IO0 A;  4XHM A;  2H0H A;  4MAB A;  1EV4 A;  3ZTL A;  3EMP A;  4DSS A;  3ZLP A;  4WF4 A;  6GSX A;  1DE2 A;  4IBP A;  3G7J A;  4KGI A;  2LS5 A;  3QPM A;  4WXT A;  1EP8 A;  4BA7 A;  2XHF A;  2VLU A;  3HKR A;  1ABA A;  4TKY A;  3ERG A;  2IMD A;  2LEG A;  2GZP A;  1V57 A;  2XPD A;  2IN3 A;  3H4K A;  1WE0 A;  2IME A;  4YH2 A;  3U6V A;  1SK0 A;  1T1V A;  1W4V A;  1G6Y A;  3UIW A;  2V32 A;  5D9V A;  3D5J A;  14GS A;  1M2A A;  4N30 A;  1TI1 A;  3GFK A;  4EL1 A;  1OKD A;  1U3I A;  1ILO A;  2X64 A;  2I9H A;  2K18 A;  2C1Y A;  2ZCT A;  1OC9 A;  3G7Y A;  3GUS A;  1U88 A;  1UC7 A;  1SKW B;  3TUE A;  5CRD A;  5AN1 A;  5IMZ A;  3HVV A;  4JRR A;  4CDO A;  2EIR A;  3IOS A;  1KNG A;  4XIH A;  2OA7 A;  2IMF A;  1USB A;  3K8N A;  4IS0 A;  1JLV A;  1K3O A;  5G5F A;  1Y6E A;  3IRA A;  2KP1 A;  1BX9 A;  2VCZ A;  1YJ6 A;  2HRF A;  3FR6 A;  3A2W A;  4ZB9 A;  3RPP A;  3O76 A;  1PRX A;  4MPF A;  2GT5 A;  2CX4 A;  3CYN A;  1SL2 B;  2R3X A;  3RBT A;  3SBC A;  3TJF A;  3IE3 A;  4MMM A;  2HLS A;  1O7U A;  1O81 A;  3VFI A;  3BD2 A;  5IPG A;  4NHW A;  5AIS A;  4XTS A;  1SKS B;  3FZ5 A;  3PH9 A;  1CQH A;  4WR5 A;  3KEB A;  1R4W A;  1SYR A;  2DIZ A;  3W8J A;  1ZYE A;  4ECB A;  1PGT A;  2M72 A;  4V2L A;  2HI7 A;  2L5L A;  3M8N A;  4ZL7 A;  1WIK A;  2QKE A;  2IPA A;  1AAZ A;  5GSS A;  1WRY A;  1K0C A;  3UBL A;  2GVP A;  2E7P A;  4K8M A;  5ENU A;  4GST A;  4ML1 A;  5F0G A;  4ZBA A;  5HR1 A;  4PUA A;  2A4V A;  5J9C A;  3DXB A;  1B9X C;  4HQZ A;  3UAP A;  4KSO A;  1YY7 A;  4RI6 A;  1XCC A;  1PKZ A;  4HUA A;  1X9W B;  4G2E A;  4EKZ A;  4V1A p;  4MH3 A;  2V41 A;  1HD2 A;  5CRE A;  3TCO A;  3NIV A;  1THO A;  6GSW A;  4GF0 A;  4POM A;  4WF5 A;  2L4Q A;  3HCZ A;  3GN3 A;  1R5A A;  2OE0 A;  4EC0 A;  2OAC A;  2H6Z A;  3F9U A;  2PUK C;  1O6J A;  2R6K A;  2JZT A;  2AB6 A;  4I2T A;  1XW6 A;  3ZIV A;  2I4A A;  2YJ7 A;  3IDV A;  3VI5 A;  5LD0 A;  2WGR A;  3MDK A;  1KBN A;  1GUM A;  4KX4 A;  1W89 A;  2GZZ A;  4FYC A;  4TRX A;  1MEK A;  1J9B A;  3RPN A;  3IV4 A;  1OC9 B;  4IHU A;  3Q18 A;  1TTZ A;  1JFU A;  2H66 A;  3CSJ A;  1T4Z A;  2DJJ A;  3FYG A;  1N8J A;  3APQ A;  1ZL9 A;  5LNK e;  4EF0 A;  4JZQ A;  5F06 A;  1TW9 A;  1J0F A;  2ES7 A;  4ILF A;  1EZK A;  3TKS C;  2OE3 A;  5DCH A;  3UJ1 A;  1GLP A;  1MTC A;  1RW1 A;  2WCI A;  2CAI A;  4XRA A;  4LMW A;  5CP1 A;  4MJB A;  1FVK A;  2L4C A;  1I5G A;  3IBH A;  4K7N A;  4PNF A;  3FW2 A;  3TJK A;  2CAQ A;  5D9W A;  1OVN A;  2CZ2 A;  2E0Q A;  1ZYQ B;  3KM6 A;  2FY6 A;  4GSN A;  3KCM A;  1G6W A;  4I8B A;  1K0N A;  3UMA A;  3LQ7 A;  3SWL A;  2AAW A;  3HZ4 A;  4RI7 A;  3VWW A;  1FG4 A;  2P0G A;  2ZNM A;  4ISD A;  2OE1 A;  2B7K A;  4HOJ A;  4OCE A;  5IM9 A;  4K6X A;  3DKS A;  3NZN A;  2WDU A;  2YWI A;  1X9S B;  5ECH B;  2A2S A;  4QQ7 A;  3ZVJ A;  2J23 A;  2IWT A;  2MMA A;  1ERU A;  4XS4 B;  2A2R A;  2YOI A;  5AIV A;  2YV7 A;  3JCM L;  4HZ2 A;  4X43 A;  1ZMA A;  1QUW A;  2IFQ A;  1JZW A;  5ELA A;  2GT6 A;  2K8S A;  2L6C A;  2NBS A;  2K9F A;  1HQO A;  4HEA 2;  2DC5 A;  3VPQ A;  4O92 A;  4YQV A;  5ABR A;  1S3D A;  2KLX A;  4RQR A;  2MMZ A;  1AQW A;  2VD1 A;  3UEM A;  2H76 A;  4IGJ A;  1K0O A;  5IMC A;  1SJ6 A;  3TJG A;  2B5X A;  2C3N A;  2VLV A;  4TXO B;  2FWF A;  2X8G A;  1TRV A;  1V2A A;  3GHA A;  3TOT A;  4MLY A;  5F07 A;  6GSV A;  2HZE B;  4EDY A;  4FYB A;  12GS A;  4OMV A;  4TW5 A;  4OO4 A;  1WJK A;  2GLR A;  3GRX A;  2YZH A;  2BMX A;  3ZRD A;  2HSY A;  2I81 A;  4E8E A;  2OAD A;  3KTB A;  3V1W A;  1GSE A;  3EVI A;  4O7H A;  1QFN A;  4KB3 A;  3WGX A;  4JE1 A;  1Z6N A;  5GZZ B;  3HJP A;  2AHE A;  5INY A;  4WBR D;  5AGY A;  1EP7 A;  2G0F A;  4F0B A;  3GMF A;  3GV1 A;  3RAZ A;  2NPB A;  1OC8 A;  1HYU A;  4ZIL A;  3D22 A;  1NHY A;  3P7X A;  3GIX A;  1CQG A;  2X8H A;  4GXZ A;  2IMK A;  1GSU A;  2YCD A;  3ZFL A;  2HFD A;  2ON5 A;  2H6Y A;  2RUE A;  4XRD A;  1WWJ A;  1EOH A;  2FCH A;  1A8Y A;  2F51 A;  2WUL A;  1ZZY A;  1VRS D;  3GSS A;  3VUR A;  4BWQ A;  1XZO A;  3CTG A;  5EVO A;  1VF2 A;  3I43 A;  3NOF A;  4IKH A;  1PL1 A;  4X1U A;  3BCI A;  1HNB A;  4F9Z A;  2H71 A;  4MK3 A;  4V1A g;  4K7O A;  2O89 A;  3UOM A;  2DJK A;  2MBT A;  3I9V 2;  4MZC A;  2GSS A;  1URM A;  3DVX A;  2IL3 A;  1N2A A;  3C7M A;  2CVK A;  3HJO A;  4J56 E;  2AYT A;  2LST A;  2C80 A;  2TIR A;  3QOU A;  3US3 A;  2P5Q A;  3DGQ A;  2FD3 A;  3GYK A;  4HJ2 A;  3KIJ A;  4EUY A;  4GQC A;  1ST9 A;  3GTU B;  3I69 A;  1YEX A;  3E3E A;  3EC3 A;  1SU9 A;  3F6D A;  1TU7 A;  2C0F A;  5DJM A;  1AXD A;  3F4R A;  3CTF A;  3TRP A;  1ACV A;  2YN1 A;  3APO A;  5EY6 A;  1XOA A;  3HZ8 A;  2WRT A;  4PQH A;  5HFI A;  3ZFB A;  1NM3 A;  3VWU A;  2DIY A;  4KCE A;  2PU9 C;  3ERF A;  1FW1 A;  1DSB A;  2VM1 A;  1GUK A;  4XS1 A;  2LKU A;  5DBQ A;  3ME8 A;  4WR4 A;  4OWY A;  3HXS A;  1XWB A;  4TR3 A;  3ZRE A;  2HRN A;  1RQM A;  4ECJ A;  5KN1 A;  3IC4 A;  2C3Q A;  5ECL B;  1MDJ A;  4ECI A;  5JWO B;  4MDC A;  4AJ7 A;  3QDN A;  1YF0 A;  1Q4J A;  1GSY A;  2GQK A;  3WGE A;  3H93 A;  22GS A;  4IP6 A;  1O73 A;  1Z3E A;  1VF4 A;  3L9S A;  3TRX A;  3ZVJ D;  3G9B A;  4FO5 A;  1GWC A;  5JCU A;  5IQY A;  2VL9 A;  1PX6 A;  3J7Y k;  2C0D A;  2VCT A;  7GSS A;  3HDC A;  1NHO A;  1B8X A;  1AW9 A;  5A5K A;  4HJM A;  4ID0 A;  1AQX A;  3QAW A;  3GST A;  2H1D A;  2V1M A;  4Z7X A;  2B5E A;  2HE3 A;  5KN0 A;  3KXO A;  2DSA A;  3BJ5 A;  1BJX A;  3L78 A;  1R5P A;  1SD8 A;  3FHK A;  3E0U A;  2LQQ A;  5E4W A;  3GL3 A;  5G30 A;  2EC4 A;  4L5L A;  5D9X A;  1K0A A;  4OFM A;  5HQP A;  4IJI A;  1TJD A;  5ECK B;  2C0G A;  3L9V A;  3M3M A;  4ZBB A;  2HYX A;  4MCU A;  4JED A;  2HT9 A;  2XBQ A;  2CQ9 A;  2DLX A;  1GRX A;  3CBU A;  3LSZ A;  5ECI B;  4OCF A;  1VF1 A;  3A3T A;  3DEX A;  3DD3 A;  4I97 A;  1EGO A;  2JZS A;  2CX3 A;  1X5E A;  4HDE A;  3Q6O A;  1GTA A;  4H86 A;  3D4M A;  4G19 A;  4MF5 A;  2FNO A;  1PN9 A;  16GS A;  4ML6 A;  1M7T A;  4LMV A;  5AIX A;  5ECR B;  3MAK A;  3EUR A;  1SL1 B;  1T00 A;  2MMN A;  3Q19 A;  1XWG A;  1U3A A;  1EGR A;  3F4T A;  4ZBD A;  3QFB C;  3DIE A;  1TK8 B;  3IR4 A;  1KTE A;  3DRN A;  3D0Z A;  1YKC A;  1EEM A;  3UVT A;  2JL4 A;  2PGT A;  3MNG A;  2YJH A;  5J41 A;  1B48 A;  1IYI A;  2H8L A;  5IO2 A;  1EV9 A;  3GKM A;  1GSS A;  4DSS B;  3KP9 A;  3C1R A;  5HFG A;  5ECS A;  2CVD A;  3VI7 A;  3FZ4 A;  3LXZ A;  1UN2 A;  1I9D A;  2NDO A;  2RII A;  4AJ8 A;  2H0G A;  1OYJ A;  1UA5 A;  1ERV A;  1F2E A;  4BWS A;  1TP9 A;  2YZU A;  2GST A;  1A23 A;  3VPT A;  5CYY A;  3VLN A;  5L71 A;  3HD5 A;  3FY7 A;  1FVJ A;  1S3A A;  3ERW A;  4EXJ A;  4OFT A;  3GH9 A;  3TRQ A;  1ZCP A;  3HA9 A;  2RM6 A;  4TN8 A;  5F8B A;  3FEU A;  5FT3 A;  4KDX A;  4PQ1 A;  1GH2 A;  1JHB A;  4KND A;  1PX7 A;  4PUR A;  1OAZ A;  5C00 A;  6GST A;  3IAM 2;  3IXR A;  2K6V A;  1ZGN A;  1FO5 A;  1XVW A;  2WJU A;  2BTO T;  4TOP A;  1K0B A;  4K7I A;  2FA4 A;  2VAF A;  4ULX A;  2GQM A;  2H74 A;  1BAY A;  2GTU A;  1GSQ A;  1GTB A;  5G1K A;  4KDU A;  5IMV A;  5ELG A;  2OBI A;  1JLW A;  4JBB A;  2V6K A;  4QL7 A;  1WOU A;  4GLT A;  3ZIT A;  1R7H A;  2REM A;  4FYU A;  3EIN A;  5ECN B;  3QAG A;  4OFN A;  1FB0 A;  5B8A A;  2PBJ A;  3CSH A;  5CO3 A;  4DSQ A;  5IPH A;  4OO5 A;  2H30 A;  2VM2 A;  4HU7 A;  3C73 A;  3R2Q A;  1VGL A;  3WD6 A;  5JWR B;  2YWO A;  3PR8 A;  3ISO A;  5CRH A;  3U5R E;  1YF1 A;  2YWM A;  1S3C A;  1PQN A;  5D8I A;  4V2M A;  4ZL9 A;  3Q74 A;  1HNC A;  4XS6 A;  4N0V A;  1YKA A;  4AF2 A;  1XW5 A;  1SL0 B;  3H1N A;  4Q5Q A;  4KUN A;  3M9J A;  1F37 A;  2AJQ B;  3KP8 A;  1V9W A;  3UL3 A;  1H4O A;  1TKD B;  4FIW A;  1LU4 A;  5D9T A;  2H1A A;  3HHV A;  3UAR A;  1PKW A;  2M80 A;  4TR1 A;  4MZW A;  5JCW A;  1AIU A;  3AY8 A;  4MJC A;  3S9F A;  5J5N A;  2B1L A;  2OJL A;  3H8Q A;  4KDY A;  2F9S A;  3EU3 A;  3TKS E;  1M9B A;  1U87 A;  1YDK A;  2HXK A;  3LOR A;  1Z6M A;  2AUV A;  2H1G A;  3IPZ A;  4K0G A;  4KCA A;  3L0H A;  3UBK A;  3ED3 A;  5COH A;  4JR4 A;  3F3R A;  3F3Q A;  2GZY A;  2R4V A;  1SEN A;  4K0N A;  4ZB6 A;  4NXI A;  1A0F A;  4MF7 A;  1O8W A;  4N0Z A;  1TI3 A;  2QGV A;  4NV2 A;  1AC1 A;  3L9U A;  2ZUP A;  3C1S A;  4F2I A;  2V6O A;  4WKW A;  4TVE A;  2LQO A;  2OBK A;  4GRF A;  1B4P A;  3LGC A;  3RDW A;  1YEP A;  2H6X A;  3QAV A;  1X5C A;  4G9H A;  4MP4 A;  3H79 A;  4BVX A;  1A24 A;  4F82 A;  1OE7 A;  4MF6 A;  2DJ3 A;  2M46 A;  2GSQ A;  4PNG A;  2B7J A;  1XW9 A;  2YAN A;  3TKP A;  4YQU A;  3KD0 A;  2PN8 A;  2L59 A;  2VL2 C;  19GS A;  5A4V A;  4XCS A;  3UVH A;  2WZ9 A;  4HS1 A;  4EVM A;  5A4U A;  3CRU A;  1GSF A;  2O7K A;  2XC2 A;  1WMJ A;  2XPE A;  2VCX A;  5IOW A;  4EE0 A;  4X0X A;  1TRU A;  5KN2 A;  3A2V A;  2LRC A;  2H72 A;  1Z7P A;  1SK1 A;  1Q98 A;  2MBS A;  2QC7 A;  1B4Q A;  5KEJ A;  2FGX A;  4HZ4 A;  2HNL A;  2CV4 A;  3GA4 A;  2P31 A;  2HSH A;  3GUR A;  6GSY A;  5CNW A;  4TXV A;  5B6M A;  5C04 A;  1K3L A;  1NW2 A;  4AJ6 A;  1LBK A;  4KA0 A;  2B1K A;  1QXH A;  4TR0 A;  1DBY A;  4YQM A;  2YPM A;  4ZB8 A;  1BED A;  4K1F A;  5GAN D;  1YZX A;  4POB A;  2NVL A;  3BBY A;  3QMX A;  13GS A;  2IFQ B;  4MJE A;  3GKK A;  4DEJ A;  4QL9 A;  3PIN A;  5G1L A;  4CHS A;  2DMM A;  6GSS A;  3ZYW A;  1A2L A;  4L0W A;  1G7O A;  2LV3 A;  1GNW A;  1QK8 A;  3D4T A;  2VCV A;  3A5W A;  4L5O A;  4TR1 B;  3LFL A;  2IJY A;  4NV5 A;  4P3Y B;  5CRW A;  1XWK A;  1GSD A;  1T8E B;  3IK9 A;  4IW9 A;  3KZQ A;  1ERT A;  3EE2 A;  2PVO C;  3QR6 A;  1X0R A;  1DUG A;  3F0I A;  4L8E A;  5FWG A;  3TDG A;  5LCZ A;  2B6M A;  1ON4 A;  2P5R A;  3FKF A;  3MWH A;  2FUG 2;  1O85 A;  4WBJ A;  5J3R A;  5HR2 A;  2BJX A;  2VOC A;  2E2G A;  2VL3 A;  2L57 A;  2PVQ A;  4WET A;  4PGT A;  3ZML A;  2B3S A;  1U6T A;  2N5F A;  4WEY A;  1J08 A;  3KMN A;  3N9J A;  4KW6 A;  1VF3 A;  4RQX A;  2H19 A;  3P2A A;  1H75 A;  3FZ9 A;  5HR3 A;  2H73 A;  1KEB A;  3EWL A;  3WGD A;  5DDL A;  1F3A A;  2EIO A;  1T7P B;  3VWX A;  3KH7 A;  4IVF A;  4CW9 A;  2I1U A;  1IYH A;  4MPG A;  4F0C A;  4Q5N A;  5D73 A;  4KE3 A;  5ID2 A;  1E6B A;  3QFA C;  1V58 A;  3LJR A;  1SYX A;  2H0I A;  1O8X A;  3D21 A;  4LL1 B;  4PXO A;  4BL7 A;  2LNS A;  1MDK A;  3C71 A;  20GS A;  1GL8 A;  1TXX A;  2YNX A;  2PMT A;  3M9K A;  1QGV A;  2LJR A;  1BQ7 A;  3DML A;  4I2U A;  5GST A;  2CT6 A;  4LL4 B;  1G0T A;  1GNE A;  11GS A;  4D73 A;  4NAX A;  3E9J B;  4HQS A;  3IHQ A;  1GTU A;  4MJA A;  3EMX A;  5CAX A;  4K2D A;  1JZO A;  4GWR A;  2F8A A;  4Q5R A;  1GTI A;  4V2N A;  1TK0 B;  3TKQ A;  2NTO A;  1SD9 A;  2TRC P;  3W6G A;  3TOU A;  2ON7 A; 
#chains in the Genus database with same CATH topology
 3FZA A;  2H70 A;  3VK9 A;  1XXU A;  3P90 A;  1XPV A;  2VCW A;  2R5G A;  2WS2 A;  2DJ2 A;  1MD3 A;  1XWC A;  5ECO B;  2C0E A;  2AV4 A;  2O8V B;  2LUS A;  2TRX A;  3BOA A;  4MA9 A;  3HVX A;  5B7C A;  3LWA A;  5DQS A;  2VIM A;  2N5B A;  4IJ3 A;  2C3T A;  1K0D A;  1LJR A;  2B5Y A;  1ERW A;  3ZMK A;  2JSZ A;  1E2Y A;  5DAL A;  2VL2 A;  4POL A;  5B8B A;  4BPY A;  2WB9 A;  3IK7 A;  4XS4 A;  3O3T A;  5IMD A;  4O5R A;  4DSR A;  1WPI A;  2LRT A;  1F9M A;  3TJB A;  2C8U A;  2O85 A;  2GQL A;  2VD0 A;  4F03 A;  2RLI A;  4ECC A;  5DAK A;  3TGZ A;  1XFL A;  5HR0 A;  3FR3 A;  3DYR A;  1M2D A;  2DJ1 A;  1A0R P;  2QSI A;  2F8F A;  4K9Z A;  3CSI A;  3BCK A;  1MDI A;  1V98 A;  2X99 A;  2FHE A;  2JAD A;  5G2Z A;  3HYP A;  2LNT A;  2KUC A;  2D2Z A;  2WFC A;  5B6N A;  1GP1 A;  2DKI A;  4TXO A;  4MZB A;  1XOB A;  2X8C A;  3LG6 A;  1EOG A;  3PGT A;  1K0M A;  3ME7 A;  4IQ1 A;  2V2G A;  5G5E A;  3EYT A;  3QCP A;  4ZXG A;  4LA1 A;  2HZE A;  5HFK A;  5F05 A;  3KGK A;  3DWV A;  3F6F A;  1XWA A;  1K3Y A;  2O87 A;  3F4S A;  4JU5 A;  1AQV A;  5ID2 B;  1M99 A;  3KMO A;  5FHI A;  1PD2 1;  4E8H A;  2RM5 A;  2MZC A;  1TRS A;  5H5Q A;  4YKF A;  1X5D A;  1TRW A;  2CA8 A;  2FWH A;  4ZL8 A;  3A5I A;  1SJZ A;  1TU8 A;  4N11 A;  3GNJ A;  4EO3 A;  1X9M B;  2CZ3 A;  2GS3 A;  3A2X A;  3LYP A;  3LEF A;  5CRG A;  1XVQ A;  3RHC A;  2DBC A;  1PN0 A;  2MMO A;  3LYK A;  5JWQ B;  3GX0 A;  17GS A;  4D73 B;  1DE1 A;  1Z9H A;  4I5Q A;  4KH7 A;  2YWN A;  3O6T A;  1AUC A;  4G10 A;  3FK8 A;  2PER A;  3P8W A;  2CVB A;  1A2J A;  5J4U A;  4NHZ A;  4KAE A;  1EEJ A;  1UVZ A;  2PPT A;  2R0P A;  4TR4 A;  4J2F A;  3WT1 A;  1Z5Y E;  2F3M A;  3TJJ A;  1PA3 A;  10GS A;  3I6A A;  5G31 A;  3M1G A;  3M0F A;  3W8S A;  3CMI A;  3OR5 A;  1NSW A;  3HVS A;  1QMV A;  5J9B A;  1ZYN A;  2DML A;  2N5A A;  2XBI A;  4N10 A;  5DVB A;  2LRN A;  1FOV A;  5DAL B;  3L4N A;  2MYG A;  2KP2 A;  1TK5 B;  1GUL A;  2PWJ A;  3GX8 A;  1FB6 A;  1Z7R A;  1ZOF A;  3J7Y b;  4FQU A;  3GKN A;  3GTU A;  2I3Y A;  1FHE A;  4DVC A;  2LTK A;  1PSQ A;  1BG5 A;  6GSU A;  3VWV A;  5DAK B;  4PQI A;  2H1B A;  4LLR A;  4YAP A;  3IAS 2;  4NWY A;  4Q5F A;  4IQA A;  4I6X A;  2R2J A;  3KJY A;  1EWX A;  1ML6 A;  4J57 E;  1V40 A;  2KOK A;  4YAV A;  5H5R A;  3D6I A;  1SKR B;  4PUF C;  5A4W A;  3APS A;  2JSY A;  4GCI A;  5D93 A;  2LJK A;  3ZL5 A;  2RUF A;  1FAA A;  2H75 A;  2VLT A;  5JCG A;  1F6M C;  1R26 A;  5ECQ B;  3G7I A;  5GAP D;  3TKR A;  3FRC A;  2LJA A;  4OD7 A;  2DJ0 A;  3WYW A;  2JZR A;  4BVY A;  4IN0 A;  3GL5 A;  4HI7 A;  4PTS A;  1XIY A;  4AGS A;  1C72 A;  4ACS A;  2HRK A;  18GS A;  5IMA A;  1JZR A;  4JR6 A;  1F3B A;  4HU9 A;  5H5S A;  1TOF A;  3CXG A;  1B9Y C;  4POK A;  1A8L A;  1MD4 A;  3LXT A;  4O32 A;  5DCG A;  4FH8 A;  4EDZ A;  3GKX A;  3DVW A;  5KN3 A;  2E2M A;  1M0U A;  2VUP A;  3EU4 A;  3N5O A;  4YKG A;  2ALB A;  5IMF A;  5IIZ A;  4PX1 A;  2IIY A;  2OKA A;  2VO4 A;  4IEL A;  1T3B A;  2X49 A;  1T4Y A;  2FA8 A;  1OC3 A;  1QQ2 A;  1SK2 A;  2Z9S A;  2VCQ A;  1RK4 A;  2HRA A;  1OE8 A;  2EIQ A;  1SJI A;  1WP0 A;  3HJM A;  2JU5 A;  4Z2R A;  1GLQ A;  2GSR A;  4Z2T A;  3KTL A;  2H01 A;  1PL2 A;  2FWE A;  3FR9 A;  9GSS A;  4MH2 A;  1TDI A;  5DJL A;  5E59 A;  2HZF A;  3MSZ A;  2KHP A;  4G0I A;  1M2B A;  2JAC A;  3TB2 A;  2GGT A;  4GQF A;  2L6D A;  1THX A;  3CRT A;  8GSS A;  3IA1 A;  5EPF A;  2IMI A;  4GSS A;  1G7E A;  1PMT A;  4ZIJ A;  3HY2 A;  1BYE A;  1JZD A;  2L5O A;  2J9H A;  5ECM B;  5D96 A;  5DQY A;  2FWG A;  2C4J A;  3GH6 A;  2R37 A;  3WT2 A;  2GDR A;  4NMU A;  4NPB A;  3ZZX A;  5EL8 A;  1XBS A;  1GUH A;  3ZIJ A;  2YV9 A;  3F8U A;  2G2Q A;  1Y25 A;  4RUV A;  1HNA A;  2K8V A;  4GTU A;  3TKS A;  1OKT A;  4L0U A;  2FLS A;  3QD9 A;  1M9A A;  5IOX A;  2X4A A;  1A2M A;  2YP6 A;  1YQ1 A;  1ZYP A;  3F63 A;  5ECP B;  4KSM A;  3C8E A;  4IP1 A;  3KH9 A;  3RHB A;  5IO0 A;  4XHM A;  2H0H A;  4MAB A;  1EV4 A;  3ZTL A;  4K5R A;  3EMP A;  4DSS A;  3ZLP A;  4WF4 A;  6GSX A;  1DE2 A;  4IBP A;  3G7J A;  4KGI A;  4BVY B;  2LS5 A;  3QPM A;  4WXT A;  1EP8 A;  4BA7 A;  2XHF A;  2VLU A;  4K5S A;  3HKR A;  1ABA A;  4TKY A;  3ERG A;  2IMD A;  2LEG A;  2GZP A;  1V57 A;  2XPD A;  2IN3 A;  3H4K A;  1WE0 A;  2IME A;  4YH2 A;  3U6V A;  1SK0 A;  1T1V A;  1W4V A;  2QA2 A;  1G6Y A;  3UIW A;  2V32 A;  5D9V A;  3D5J A;  14GS A;  1M2A A;  4N30 A;  1TI1 A;  3GFK A;  4EL1 A;  1OKD A;  1U3I A;  1ILO A;  2X64 A;  2I9H A;  2K18 A;  2C1Y A;  2ZCT A;  1OC9 A;  3G7Y A;  3GUS A;  1U88 A;  1UC7 A;  1SKW B;  3TUE A;  5CRD A;  5AN1 A;  5IMZ A;  3HVV A;  4JRR A;  4CDO A;  2EIR A;  3IOS A;  1KNG A;  4XIH A;  2OA7 A;  2IMF A;  1USB A;  3K8N A;  4IS0 A;  1JLV A;  1K3O A;  5G5F A;  1Y6E A;  3IRA A;  2KP1 A;  1BX9 A;  2VCZ A;  1YJ6 A;  2HRF A;  3FR6 A;  3A2W A;  4ZB9 A;  3RPP A;  3O76 A;  1PRX A;  4MPF A;  2GT5 A;  2CX4 A;  3CYN A;  1SL2 B;  2R3X A;  3RBT A;  3SBC A;  3TJF A;  3IE3 A;  4MMM A;  2HLS A;  1O7U A;  1O81 A;  3VFI A;  3BD2 A;  4HSC X;  5IPG A;  4NHW A;  5AIS A;  4XTS A;  4EIQ A;  1SKS B;  4A5P A;  3FZ5 A;  3PH9 A;  1CQH A;  4WR5 A;  3KEB A;  1R4W A;  1SYR A;  2DIZ A;  3W8J A;  1ZYE A;  4ECB A;  1PGT A;  2M72 A;  5BMU A;  4V2L A;  2HI7 A;  2L5L A;  3M8N A;  1PFO A;  4ZL7 A;  1WIK A;  2QKE A;  2IPA A;  1AAZ A;  5GSS A;  1WRY A;  1K0C A;  3UBL A;  2GVP A;  2E7P A;  4K8M A;  5ENU A;  4GST A;  4ML1 A;  5F0G A;  4ZBA A;  5HR1 A;  4PUA A;  2A4V A;  5J9C A;  3DXB A;  1B9X C;  4HQZ A;  3UAP A;  4KSO A;  1YY7 A;  4RI6 A;  1XCC A;  1PKZ A;  4HUA A;  4EIP A;  1X9W B;  4G2E A;  4EKZ A;  3FMW A;  4V1A p;  4MH3 A;  2V41 A;  1HD2 A;  5CRE A;  3TCO A;  3NIV A;  1THO A;  6GSW A;  4GF0 A;  4POM A;  4WF5 A;  2L4Q A;  3HCZ A;  3MIX A;  3GN3 A;  1R5A A;  2OE0 A;  4EC0 A;  2OAC A;  2H6Z A;  3F9U A;  2PUK C;  1O6J A;  2R6K A;  2JZT A;  2AB6 A;  4I2T A;  1XW6 A;  3ZIV A;  2I4A A;  4CY6 A;  2YJ7 A;  3IDV A;  3VI5 A;  5LD0 A;  2WGR A;  3MDK A;  1KBN A;  1GUM A;  4KX4 A;  1W89 A;  2GZZ A;  4FYC A;  4TRX A;  1MEK A;  4BL7 B;  1J9B A;  3RPN A;  3IV4 A;  1OC9 B;  4IHU A;  3Q18 A;  1TTZ A;  1JFU A;  2H66 A;  3CSJ A;  1T4Z A;  2DJJ A;  3FYG A;  1N8J A;  3APQ A;  1ZL9 A;  5LNK e;  4EF0 A;  4JZQ A;  5F06 A;  1TW9 A;  1J0F A;  2ES7 A;  4ILF A;  1EZK A;  3TKS C;  2OE3 A;  5DCH A;  3UJ1 A;  1GLP A;  1MTC A;  1RW1 A;  2WCI A;  2CAI A;  4XRA A;  4LMW A;  5CP1 A;  4KF9 A;  4MJB A;  1FVK A;  2L4C A;  1I5G A;  3IBH A;  4K7N A;  4PNF A;  3FW2 A;  3TJK A;  2CAQ A;  1OVN A;  2CZ2 A;  2E0Q A;  5D9W A;  1ZYQ B;  3KM6 A;  2FY6 A;  4GSN A;  3KCM A;  1G6W A;  4I8B A;  1K0N A;  3UMA A;  3LQ7 A;  3SWL A;  2AAW A;  3HZ4 A;  4RI7 A;  3VWW A;  1FG4 A;  2P0G A;  2ZNM A;  4ISD A;  2OE1 A;  2B7K A;  4HOJ A;  4OCE A;  5IM9 A;  4K6X A;  5BRT A;  3DKS A;  3NZN A;  2WDU A;  2YWI A;  1X9S B;  5ECH B;  2A2S A;  4QQ7 A;  3ZVJ A;  2J23 A;  2IWT A;  2MMA A;  1ERU A;  4XS4 B;  2A2R A;  2YOI A;  5AIV A;  2YV7 A;  3JCM L;  4HZ2 A;  3HVN A;  4X43 A;  1ZMA A;  1QUW A;  2IFQ A;  1JZW A;  5ELA A;  2GT6 A;  2K8S A;  2L6C A;  2NBS A;  2K9F A;  1HQO A;  4HEA 2;  2DC5 A;  3VPQ A;  4O92 A;  4YQV A;  5ABR A;  1S3D A;  2KLX A;  4RQR A;  2MMZ A;  1AQW A;  2VD1 A;  3UEM A;  2H76 A;  4IGJ A;  1K0O A;  5IMC A;  1SJ6 A;  3TJG A;  2B5X A;  2C3N A;  2VLV A;  4TXO B;  2FWF A;  2X8G A;  1TRV A;  1V2A A;  3GHA A;  3TOT A;  4MLY A;  5F07 A;  6GSV A;  2HZE B;  4EDY A;  4FYB A;  12GS A;  4OMV A;  4TW5 A;  4OO4 A;  1WJK A;  2GLR A;  3GRX A;  2YZH A;  2BMX A;  3ZRD A;  2HSY A;  2I81 A;  4E8E A;  2OAD A;  3KTB A;  3V1W A;  1GSE A;  3EVI A;  4O7H A;  1QFN A;  4KB3 A;  3WGX A;  4JE1 A;  1Z6N A;  5GZZ B;  3HJP A;  2AHE A;  5INY A;  4WBR D;  5AGY A;  1EP7 A;  2G0F A;  4F0B A;  3GMF A;  3GV1 A;  3RAZ A;  2NPB A;  1OC8 A;  1HYU A;  4ZIL A;  3D22 A;  1NHY A;  3P7X A;  3GIX A;  1CQG A;  2X8H A;  4GXZ A;  2IMK A;  1GSU A;  2YCD A;  3ZFL A;  2HFD A;  2ON5 A;  2H6Y A;  2RUE A;  4XRD A;  1WWJ A;  1EOH A;  1XG8 A;  2FCH A;  1A8Y A;  2F51 A;  2WUL A;  1ZZY A;  3R3E A;  1VRS D;  3GSS A;  3VUR A;  4BWQ A;  1XZO A;  3CTG A;  5EVO A;  1VF2 A;  3I43 A;  4O5Q A;  3NOF A;  4IKH A;  1PL1 A;  4X1U A;  3BCI A;  1HNB A;  4F9Z A;  2H71 A;  4MK3 A;  3EPT A;  4V1A g;  4K7O A;  2O89 A;  3UOM A;  2DJK A;  2MBT A;  3I9V 2;  4MZC A;  2GSS A;  1URM A;  3DVX A;  2IL3 A;  1N2A A;  3C7M A;  2CVK A;  2R0C A;  3HJO A;  4J56 E;  2AYT A;  2LST A;  2C80 A;  2TIR A;  3QOU A;  3US3 A;  2P5Q A;  3DGQ A;  2FD3 A;  3GYK A;  4HJ2 A;  3IHG A;  3KIJ A;  4EUY A;  4GQC A;  1ST9 A;  3GTU B;  3I69 A;  1YEX A;  3E3E A;  3EC3 A;  1SU9 A;  3F6D A;  1TU7 A;  2C0F A;  5DJM A;  1AXD A;  3F4R A;  3CTF A;  3TRP A;  1ACV A;  2YN1 A;  3APO A;  5EY6 A;  1XOA A;  3HZ8 A;  2WRT A;  4PQH A;  5HFI A;  3ZFB A;  1NM3 A;  3VWU A;  2DIY A;  4KCE A;  2PU9 C;  3ERF A;  3IC8 A;  1FW1 A;  1DSB A;  2VM1 A;  1GUK A;  4XS1 A;  2LKU A;  5DBQ A;  3ME8 A;  4WR4 A;  2A2P A;  5KOW A;  4OWY A;  3HXS A;  1XWB A;  4TR3 A;  3ZRE A;  2HRN A;  1RQM A;  4ECJ A;  5KN1 A;  3IC4 A;  2C3Q A;  5ECL B;  5KOX A;  1MDJ A;  4ECI A;  5JWO B;  4MDC A;  4AJ7 A;  3QDN A;  1YF0 A;  1Q4J A;  1GSY A;  2GQK A;  3WGE A;  3H93 A;  22GS A;  4IP6 A;  1O73 A;  1Z3E A;  2HSM A;  1VF4 A;  3L9S A;  3TRX A;  3ZVJ D;  3G9B A;  4FO5 A;  1GWC A;  5JCU A;  5IQY A;  2VL9 A;  1PX6 A;  3J7Y k;  2C0D A;  2VCT A;  7GSS A;  3HDC A;  1NHO A;  1B8X A;  1AW9 A;  5A5K A;  4HJM A;  4ID0 A;  1AQX A;  3QAW A;  3GST A;  2H1D A;  2V1M A;  4Z7X A;  2B5E A;  2HE3 A;  5KN0 A;  3KXO A;  2DSA A;  3BJ5 A;  1BJX A;  3L78 A;  1R5P A;  1SD8 A;  3MYD A;  3FHK A;  3E0U A;  2LQQ A;  5E4W A;  3GL3 A;  5G30 A;  2EC4 A;  4L5L A;  5D9X A;  1K0A A;  4OFM A;  5HQP A;  4IJI A;  1TJD A;  5ECK B;  2C0G A;  3L9V A;  3M3M A;  4ZBB A;  2HYX A;  4MCU A;  4JED A;  2HT9 A;  2XBQ A;  2CQ9 A;  2DLX A;  1GRX A;  3CBU A;  3LSZ A;  5ECI B;  4OCF A;  1VF1 A;  3A3T A;  3DEX A;  3DD3 A;  4I97 A;  1EGO A;  2JZS A;  2CX3 A;  1X5E A;  4HDE A;  3Q6O A;  1GTA A;  4H86 A;  4G0L A;  3D4M A;  4G19 A;  4MF5 A;  2FNO A;  1PN9 A;  2UZ8 A;  16GS A;  4ML6 A;  1M7T A;  4LMV A;  5AIX A;  5ECR B;  3MAK A;  3EUR A;  1SL1 B;  1T00 A;  2MMN A;  3Q19 A;  1XWG A;  1U3A A;  1EGR A;  3F4T A;  4ZBD A;  3QFB C;  3DIE A;  1TK8 B;  3IR4 A;  1KTE A;  3DRN A;  3D0Z A;  1YKC A;  1EEM A;  3UVT A;  2JL4 A;  2PGT A;  3MNG A;  2YJH A;  2A4H A;  5J41 A;  1B48 A;  1IYI A;  2H8L A;  5IO2 A;  1EV9 A;  3GKM A;  1GSS A;  4DSS B;  3KP9 A;  3C1R A;  5HFG A;  5ECS A;  2CVD A;  3VI7 A;  2QA1 A;  3FZ4 A;  3LXZ A;  1UN2 A;  1I9D A;  2NDO A;  2RII A;  4AJ8 A;  2H0G A;  1OYJ A;  1UA5 A;  1ERV A;  3CQF A;  1F2E A;  4BWS A;  1TP9 A;  2YZU A;  2GST A;  1A23 A;  3VPT A;  5CYY A;  3VLN A;  5L71 A;  3HD5 A;  3FY7 A;  1FVJ A;  1S3A A;  3PPU A;  3ERW A;  4EXJ A;  4OFT A;  3GH9 A;  3TRQ A;  1ZCP A;  3HA9 A;  2RM6 A;  4TN8 A;  5F8B A;  3FEU A;  5FT3 A;  4KDX A;  4PQ1 A;  4X4J A;  1GH2 A;  1JHB A;  4KND A;  1PX7 A;  4PUR A;  1OAZ A;  5C00 A;  6GST A;  3IAM 2;  3IXR A;  2K6V A;  1ZGN A;  1FO5 A;  1XVW A;  2WJU A;  2BTO T;  4TOP A;  1K0B A;  4K7I A;  2FA4 A;  2VAF A;  4ULX A;  2GQM A;  2H74 A;  1BAY A;  2GTU A;  1GSQ A;  1GTB A;  5G1K A;  4KDU A;  5IMV A;  5ELG A;  2OBI A;  4BIK A;  1JLW A;  4JBB A;  2V6K A;  4QL7 A;  1WOU A;  4GLT A;  3ZIT A;  1R7H A;  2REM A;  4FYU A;  3EIN A;  5ECN B;  3QAG A;  4OFN A;  1FB0 A;  5B8A A;  2PBJ A;  3CSH A;  5CO3 A;  4DSQ A;  5IPH A;  4OO5 A;  2H30 A;  2VM2 A;  2R0G A;  4HU7 A;  3C73 A;  3R2Q A;  1VGL A;  3WD6 A;  5JWR B;  2YWO A;  3PR8 A;  3ISO A;  5CRH A;  3U5R E;  1YF1 A;  1S3R A;  2YWM A;  4G0K A;  1S3C A;  1PQN A;  5D8I A;  3LW9 A;  4V2M A;  4ZL9 A;  3Q74 A;  1HNC A;  4XS6 A;  4N0V A;  1YKA A;  4AF2 A;  1XW5 A;  1SL0 B;  3H1N A;  4Q5Q A;  4KUN A;  3M9J A;  1F37 A;  2AJQ B;  3KP8 A;  1V9W A;  3UL3 A;  1H4O A;  1TKD B;  4FIW A;  1LU4 A;  5D9T A;  2H1A A;  3HHV A;  3UAR A;  1PKW A;  4Z2U A;  2M80 A;  4TR1 A;  4MZW A;  5JCW A;  1AIU A;  3AY8 A;  4MJC A;  3S9F A;  5J5N A;  2B1L A;  2OJL A;  3H8Q A;  4KDY A;  2F9S A;  3EU3 A;  3TKS E;  1M9B A;  1U87 A;  1YDK A;  2HXK A;  3LOR A;  1Z6M A;  2AUV A;  2H1G A;  3IPZ A;  4K0G A;  4KCA A;  3L0H A;  3UBK A;  3ED3 A;  5COH A;  4JR4 A;  3F3R A;  3F3Q A;  2GZY A;  2R4V A;  1SEN A;  4K0N A;  4ZB6 A;  4NXI A;  1A0F A;  4MF7 A;  1O8W A;  4N0Z A;  1TI3 A;  2QGV A;  4NV2 A;  1AC1 A;  3L9U A;  2ZUP A;  3C1S A;  4F2I A;  2V6O A;  4WKW A;  4TVE A;  2LQO A;  2OBK A;  4GRF A;  1B4P A;  3LGC A;  3RDW A;  1YEP A;  2H6X A;  3QAV A;  1X5C A;  4G9H A;  4MP4 A;  3H79 A;  4BVX A;  1A24 A;  4F82 A;  1OE7 A;  4MF6 A;  2DJ3 A;  2M46 A;  2GSQ A;  4PNG A;  2B7J A;  1XW9 A;  2YAN A;  3TKP A;  4YQU A;  3KD0 A;  2PN8 A;  2L59 A;  2VL2 C;  19GS A;  5A4V A;  4XCS A;  3UVH A;  2WZ9 A;  4HS1 A;  4EVM A;  5A4U A;  3CRU A;  1GSF A;  2O7K A;  4CY8 A;  2XC2 A;  1WMJ A;  2XPE A;  2VCX A;  5IOW A;  4EE0 A;  4X0X A;  1TRU A;  5KN2 A;  3A2V A;  2LRC A;  2H72 A;  1Z7P A;  1SK1 A;  1Q98 A;  2MBS A;  2QC7 A;  1B4Q A;  5KEJ A;  2FGX A;  4HZ4 A;  2HNL A;  2CV4 A;  3GA4 A;  2P31 A;  2HSH A;  3GUR A;  6GSY A;  5CNW A;  4TXV A;  5B6M A;  5C04 A;  1K3L A;  1M3J A;  1NW2 A;  4AJ6 A;  1LBK A;  4KA0 A;  2B1K A;  1QXH A;  4TR0 A;  1DBY A;  4YQM A;  2YPM A;  4ZB8 A;  1BED A;  4K1F A;  2DKH A;  5GAN D;  1YZX A;  4POB A;  2NVL A;  3BBY A;  3QMX A;  13GS A;  2IFQ B;  4MJE A;  3GKK A;  4DEJ A;  4QL9 A;  3PIN A;  5G1L A;  4CHS A;  2DMM A;  6GSS A;  3ZYW A;  1A2L A;  4L0W A;  1G7O A;  2LV3 A;  1GNW A;  1QK8 A;  3D4T A;  2VCV A;  3A5W A;  4L5O A;  4TR1 B;  3LFL A;  2IJY A;  4NV5 A;  4P3Y B;  4K2X A;  5CRW A;  1XWK A;  1GSD A;  1T8E B;  3IK9 A;  4IW9 A;  3KZQ A;  1ERT A;  3EE2 A;  2PVO C;  3QR6 A;  1X0R A;  1DUG A;  3F0I A;  4L8E A;  5FWG A;  3TDG A;  5LCZ A;  2B6M A;  1ON4 A;  2P5R A;  3FKF A;  3MWH A;  2FUG 2;  1O85 A;  4WBJ A;  5J3R A;  5HR2 A;  2BJX A;  2VOC A;  2E2G A;  2VL3 A;  2L57 A;  2PVQ A;  4WET A;  4PGT A;  1M3I A;  3ZML A;  2B3S A;  1U6T A;  2N5F A;  4WEY A;  1J08 A;  3KMN A;  3N9J A;  4KW6 A;  1VF3 A;  4MNN A;  4RQX A;  2H19 A;  3P2A A;  1H75 A;  3FZ9 A;  5HR3 A;  2H73 A;  1KEB A;  3EWL A;  3WGD A;  5DDL A;  1F3A A;  2EIO A;  1FOH A;  4BVX B;  1T7P B;  3VWX A;  3KH7 A;  4IVF A;  4CW9 A;  2I1U A;  1IYH A;  4MPG A;  4F0C A;  4Q5N A;  5D73 A;  4KE3 A;  5ID2 A;  1E6B A;  3QFA C;  1V58 A;  3LJR A;  1SYX A;  2H0I A;  1O8X A;  3D21 A;  4ICY A;  4LL1 B;  4USS A;  4PXO A;  4BL7 A;  2LNS A;  1MDK A;  3C71 A;  20GS A;  1GL8 A;  1TXX A;  2YNX A;  2PMT A;  3M9K A;  1QGV A;  2LJR A;  1BQ7 A;  3DML A;  4I2U A;  5GST A;  2CT6 A;  4LL4 B;  1G0T A;  1GNE A;  11GS A;  4D73 A;  4NAX A;  3E9J B;  4HQS A;  3IHQ A;  4O5U A;  1GTU A;  4MJA A;  3EMX A;  5CAX A;  4K2D A;  1JZO A;  4GWR A;  2F8A A;  4Q5R A;  1GTI A;  4V2N A;  1TK0 B;  3TKQ A;  2NTO A;  1SD9 A;  2TRC P;  3W6G A;  3TOU A;  2ON7 A; 
#chains in the Genus database with same CATH homology
 3FZA A;  2H70 A;  3VK9 A;  1XXU A;  3P90 A;  1XPV A;  2VCW A;  2R5G A;  2WS2 A;  2DJ2 A;  1MD3 A;  1XWC A;  5ECO B;  2C0E A;  2AV4 A;  2O8V B;  2LUS A;  2TRX A;  3BOA A;  4MA9 A;  3HVX A;  5B7C A;  3LWA A;  5DQS A;  2VIM A;  2N5B A;  4IJ3 A;  2C3T A;  1K0D A;  1LJR A;  2B5Y A;  1ERW A;  3ZMK A;  2JSZ A;  1E2Y A;  5DAL A;  2VL2 A;  4POL A;  5B8B A;  4BPY A;  2WB9 A;  3IK7 A;  4XS4 A;  3O3T A;  5IMD A;  4O5R A;  4DSR A;  1WPI A;  2LRT A;  1F9M A;  3TJB A;  2C8U A;  2O85 A;  2GQL A;  2VD0 A;  4F03 A;  2RLI A;  4ECC A;  5DAK A;  3TGZ A;  1XFL A;  5HR0 A;  3FR3 A;  3DYR A;  1M2D A;  2DJ1 A;  1A0R P;  2QSI A;  2F8F A;  4K9Z A;  3CSI A;  3BCK A;  1MDI A;  1V98 A;  2X99 A;  2FHE A;  2JAD A;  5G2Z A;  3HYP A;  2LNT A;  2KUC A;  2D2Z A;  2WFC A;  5B6N A;  1GP1 A;  2DKI A;  4TXO A;  4MZB A;  1XOB A;  2X8C A;  3LG6 A;  1EOG A;  3PGT A;  1K0M A;  3ME7 A;  4IQ1 A;  2V2G A;  5G5E A;  3EYT A;  3QCP A;  4ZXG A;  4LA1 A;  2HZE A;  5HFK A;  5F05 A;  3KGK A;  3DWV A;  3F6F A;  1XWA A;  1K3Y A;  2O87 A;  3F4S A;  4JU5 A;  1AQV A;  5ID2 B;  1M99 A;  3KMO A;  5FHI A;  1PD2 1;  4E8H A;  2RM5 A;  2MZC A;  1TRS A;  5H5Q A;  4YKF A;  1X5D A;  1TRW A;  2CA8 A;  2FWH A;  4ZL8 A;  3A5I A;  1SJZ A;  1TU8 A;  4N11 A;  3GNJ A;  4EO3 A;  1X9M B;  2CZ3 A;  2GS3 A;  3A2X A;  3LYP A;  3LEF A;  5CRG A;  1XVQ A;  3RHC A;  2DBC A;  1PN0 A;  2MMO A;  3LYK A;  5JWQ B;  3GX0 A;  17GS A;  4D73 B;  1DE1 A;  1Z9H A;  4I5Q A;  4KH7 A;  2YWN A;  3O6T A;  1AUC A;  4G10 A;  3FK8 A;  2PER A;  2CVB A;  3P8W A;  1A2J A;  5J4U A;  4NHZ A;  4KAE A;  1EEJ A;  1UVZ A;  2PPT A;  2R0P A;  4TR4 A;  4J2F A;  3WT1 A;  1Z5Y E;  2F3M A;  3TJJ A;  1PA3 A;  10GS A;  3I6A A;  5G31 A;  3M1G A;  3M0F A;  3W8S A;  3CMI A;  3OR5 A;  1NSW A;  3HVS A;  1QMV A;  5J9B A;  1ZYN A;  2DML A;  2N5A A;  2XBI A;  4N10 A;  5DVB A;  2LRN A;  1FOV A;  5DAL B;  3L4N A;  2MYG A;  2KP2 A;  1TK5 B;  1GUL A;  2PWJ A;  3GX8 A;  1FB6 A;  1Z7R A;  1ZOF A;  3J7Y b;  4FQU A;  3GKN A;  3GTU A;  2I3Y A;  1FHE A;  4DVC A;  2LTK A;  1PSQ A;  1BG5 A;  6GSU A;  3VWV A;  5DAK B;  4PQI A;  2H1B A;  4LLR A;  4YAP A;  3IAS 2;  4NWY A;  4Q5F A;  4IQA A;  4I6X A;  2R2J A;  3KJY A;  1EWX A;  1ML6 A;  4J57 E;  1V40 A;  2KOK A;  4YAV A;  5H5R A;  3D6I A;  1SKR B;  4PUF C;  5A4W A;  3APS A;  2JSY A;  4GCI A;  5D93 A;  2LJK A;  3ZL5 A;  2RUF A;  1FAA A;  2H75 A;  2VLT A;  5JCG A;  1F6M C;  1R26 A;  5ECQ B;  3G7I A;  5GAP D;  3TKR A;  3FRC A;  2LJA A;  4OD7 A;  2DJ0 A;  3WYW A;  2JZR A;  4BVY A;  4IN0 A;  3GL5 A;  4HI7 A;  4PTS A;  1XIY A;  4AGS A;  1C72 A;  4ACS A;  2HRK A;  18GS A;  5IMA A;  1JZR A;  4JR6 A;  1F3B A;  4HU9 A;  5H5S A;  1TOF A;  3CXG A;  1B9Y C;  4POK A;  1A8L A;  1MD4 A;  3LXT A;  4O32 A;  5DCG A;  4FH8 A;  4EDZ A;  3GKX A;  3DVW A;  5KN3 A;  2E2M A;  1M0U A;  2VUP A;  3EU4 A;  3N5O A;  4YKG A;  2ALB A;  5IMF A;  5IIZ A;  4PX1 A;  2IIY A;  2OKA A;  2VO4 A;  4IEL A;  1T3B A;  2X49 A;  1T4Y A;  2FA8 A;  1OC3 A;  1QQ2 A;  1SK2 A;  2Z9S A;  2VCQ A;  1RK4 A;  2HRA A;  1OE8 A;  2EIQ A;  1SJI A;  1WP0 A;  3HJM A;  2JU5 A;  4Z2R A;  1GLQ A;  2GSR A;  4Z2T A;  3KTL A;  2H01 A;  1PL2 A;  2FWE A;  3FR9 A;  9GSS A;  4MH2 A;  1TDI A;  5DJL A;  5E59 A;  2HZF A;  3MSZ A;  2KHP A;  4G0I A;  1M2B A;  2JAC A;  3TB2 A;  2GGT A;  4GQF A;  2L6D A;  1THX A;  3CRT A;  8GSS A;  3IA1 A;  5EPF A;  2IMI A;  4GSS A;  1G7E A;  1PMT A;  4ZIJ A;  3HY2 A;  1BYE A;  1JZD A;  2L5O A;  2J9H A;  5ECM B;  5D96 A;  5DQY A;  2FWG A;  2C4J A;  3GH6 A;  2R37 A;  3WT2 A;  2GDR A;  4NMU A;  4NPB A;  3ZZX A;  5EL8 A;  1XBS A;  1GUH A;  3ZIJ A;  2YV9 A;  3F8U A;  2G2Q A;  1Y25 A;  4RUV A;  1HNA A;  2K8V A;  4GTU A;  3TKS A;  1OKT A;  4L0U A;  2FLS A;  3QD9 A;  1M9A A;  5IOX A;  2X4A A;  1A2M A;  2YP6 A;  1YQ1 A;  1ZYP A;  3F63 A;  5ECP B;  4KSM A;  3C8E A;  4IP1 A;  3KH9 A;  3RHB A;  5IO0 A;  4XHM A;  2H0H A;  4MAB A;  1EV4 A;  3ZTL A;  4K5R A;  3EMP A;  4DSS A;  3ZLP A;  4WF4 A;  6GSX A;  1DE2 A;  4IBP A;  3G7J A;  4KGI A;  4BVY B;  2LS5 A;  3QPM A;  4WXT A;  1EP8 A;  4BA7 A;  2XHF A;  2VLU A;  4K5S A;  3HKR A;  1ABA A;  4TKY A;  3ERG A;  2IMD A;  2LEG A;  2GZP A;  1V57 A;  2XPD A;  2IN3 A;  3H4K A;  1WE0 A;  2IME A;  4YH2 A;  3U6V A;  1SK0 A;  1T1V A;  1W4V A;  2QA2 A;  1G6Y A;  3UIW A;  2V32 A;  5D9V A;  3D5J A;  14GS A;  1M2A A;  4N30 A;  1TI1 A;  3GFK A;  4EL1 A;  1OKD A;  1U3I A;  1ILO A;  2X64 A;  2I9H A;  2K18 A;  2C1Y A;  2ZCT A;  1OC9 A;  3G7Y A;  3GUS A;  1U88 A;  1UC7 A;  1SKW B;  3TUE A;  5CRD A;  5AN1 A;  5IMZ A;  3HVV A;  4JRR A;  4CDO A;  2EIR A;  3IOS A;  1KNG A;  4XIH A;  2OA7 A;  2IMF A;  1USB A;  3K8N A;  4IS0 A;  1JLV A;  1K3O A;  5G5F A;  1Y6E A;  3IRA A;  2KP1 A;  1BX9 A;  2VCZ A;  1YJ6 A;  2HRF A;  3FR6 A;  3A2W A;  4ZB9 A;  3RPP A;  3O76 A;  1PRX A;  4MPF A;  2GT5 A;  2CX4 A;  3CYN A;  1SL2 B;  2R3X A;  3RBT A;  3SBC A;  3TJF A;  3IE3 A;  4MMM A;  2HLS A;  1O7U A;  1O81 A;  3VFI A;  3BD2 A;  5IPG A;  4NHW A;  5AIS A;  4XTS A;  4EIQ A;  1SKS B;  4A5P A;  3FZ5 A;  3PH9 A;  1CQH A;  4WR5 A;  3KEB A;  1R4W A;  1SYR A;  2DIZ A;  3W8J A;  1ZYE A;  4ECB A;  1PGT A;  2M72 A;  5BMU A;  4V2L A;  2HI7 A;  2L5L A;  3M8N A;  4ZL7 A;  1WIK A;  2QKE A;  2IPA A;  1AAZ A;  5GSS A;  1WRY A;  1K0C A;  3UBL A;  2GVP A;  2E7P A;  4K8M A;  5ENU A;  4GST A;  4ML1 A;  5F0G A;  4ZBA A;  5HR1 A;  4PUA A;  2A4V A;  5J9C A;  3DXB A;  1B9X C;  4HQZ A;  3UAP A;  4KSO A;  1YY7 A;  4RI6 A;  1XCC A;  1PKZ A;  4HUA A;  4EIP A;  1X9W B;  4G2E A;  4EKZ A;  3FMW A;  4V1A p;  4MH3 A;  2V41 A;  1HD2 A;  5CRE A;  3TCO A;  3NIV A;  1THO A;  6GSW A;  4GF0 A;  4POM A;  4WF5 A;  2L4Q A;  3HCZ A;  3MIX A;  3GN3 A;  1R5A A;  2OE0 A;  4EC0 A;  2OAC A;  2H6Z A;  3F9U A;  2PUK C;  1O6J A;  2R6K A;  2JZT A;  2AB6 A;  4I2T A;  1XW6 A;  3ZIV A;  2I4A A;  4CY6 A;  2YJ7 A;  3IDV A;  3VI5 A;  5LD0 A;  2WGR A;  3MDK A;  1KBN A;  1GUM A;  4KX4 A;  1W89 A;  2GZZ A;  4FYC A;  4TRX A;  1MEK A;  4BL7 B;  1J9B A;  3RPN A;  3IV4 A;  1OC9 B;  4IHU A;  3Q18 A;  1TTZ A;  1JFU A;  2H66 A;  3CSJ A;  1T4Z A;  2DJJ A;  3FYG A;  1N8J A;  3APQ A;  1ZL9 A;  5LNK e;  4EF0 A;  4JZQ A;  5F06 A;  1TW9 A;  1J0F A;  2ES7 A;  4ILF A;  1EZK A;  3TKS C;  2OE3 A;  5DCH A;  3UJ1 A;  1GLP A;  1MTC A;  1RW1 A;  2WCI A;  2CAI A;  4XRA A;  4LMW A;  5CP1 A;  4KF9 A;  4MJB A;  1FVK A;  2L4C A;  1I5G A;  3IBH A;  4K7N A;  4PNF A;  3FW2 A;  3TJK A;  2CAQ A;  1OVN A;  2CZ2 A;  2E0Q A;  5D9W A;  1ZYQ B;  3KM6 A;  2FY6 A;  4GSN A;  3KCM A;  1G6W A;  4I8B A;  1K0N A;  3UMA A;  3LQ7 A;  3SWL A;  2AAW A;  3HZ4 A;  4RI7 A;  3VWW A;  1FG4 A;  2P0G A;  2ZNM A;  4ISD A;  2OE1 A;  2B7K A;  4HOJ A;  4OCE A;  5IM9 A;  4K6X A;  5BRT A;  3DKS A;  3NZN A;  2WDU A;  2YWI A;  1X9S B;  5ECH B;  2A2S A;  4QQ7 A;  3ZVJ A;  2J23 A;  2IWT A;  2MMA A;  1ERU A;  4XS4 B;  2A2R A;  2YOI A;  5AIV A;  2YV7 A;  3JCM L;  4HZ2 A;  4X43 A;  1ZMA A;  1QUW A;  2IFQ A;  1JZW A;  5ELA A;  2GT6 A;  2K8S A;  2L6C A;  2NBS A;  2K9F A;  1HQO A;  4HEA 2;  2DC5 A;  3VPQ A;  4O92 A;  4YQV A;  5ABR A;  1S3D A;  2KLX A;  4RQR A;  2MMZ A;  1AQW A;  2VD1 A;  3UEM A;  2H76 A;  4IGJ A;  1K0O A;  5IMC A;  1SJ6 A;  3TJG A;  2B5X A;  2C3N A;  2VLV A;  4TXO B;  2FWF A;  2X8G A;  1TRV A;  1V2A A;  3GHA A;  3TOT A;  4MLY A;  5F07 A;  6GSV A;  2HZE B;  4EDY A;  4FYB A;  12GS A;  4OMV A;  4TW5 A;  4OO4 A;  1WJK A;  2GLR A;  3GRX A;  2YZH A;  2BMX A;  3ZRD A;  2HSY A;  2I81 A;  4E8E A;  2OAD A;  3KTB A;  3V1W A;  1GSE A;  3EVI A;  4O7H A;  1QFN A;  4KB3 A;  3WGX A;  4JE1 A;  1Z6N A;  5GZZ B;  3HJP A;  2AHE A;  5INY A;  4WBR D;  5AGY A;  1EP7 A;  2G0F A;  4F0B A;  3GMF A;  3GV1 A;  3RAZ A;  2NPB A;  1OC8 A;  1HYU A;  4ZIL A;  3D22 A;  1NHY A;  3P7X A;  3GIX A;  1CQG A;  2X8H A;  4GXZ A;  2IMK A;  1GSU A;  2YCD A;  3ZFL A;  2HFD A;  2ON5 A;  2H6Y A;  2RUE A;  4XRD A;  1WWJ A;  1EOH A;  2FCH A;  1A8Y A;  2F51 A;  2WUL A;  1ZZY A;  3R3E A;  1VRS D;  3GSS A;  3VUR A;  4BWQ A;  1XZO A;  3CTG A;  5EVO A;  1VF2 A;  3I43 A;  4O5Q A;  3NOF A;  4IKH A;  1PL1 A;  4X1U A;  3BCI A;  1HNB A;  4F9Z A;  2H71 A;  4MK3 A;  3EPT A;  4V1A g;  4K7O A;  2O89 A;  3UOM A;  2DJK A;  2MBT A;  3I9V 2;  4MZC A;  2GSS A;  1URM A;  3DVX A;  2IL3 A;  1N2A A;  3C7M A;  2CVK A;  2R0C A;  3HJO A;  4J56 E;  2AYT A;  2LST A;  2C80 A;  2TIR A;  3QOU A;  3US3 A;  2P5Q A;  3DGQ A;  2FD3 A;  3GYK A;  4HJ2 A;  3IHG A;  3KIJ A;  4EUY A;  4GQC A;  1ST9 A;  3GTU B;  3I69 A;  1YEX A;  3E3E A;  3EC3 A;  1SU9 A;  3F6D A;  1TU7 A;  2C0F A;  5DJM A;  1AXD A;  3F4R A;  3CTF A;  3TRP A;  1ACV A;  2YN1 A;  3APO A;  5EY6 A;  1XOA A;  3HZ8 A;  2WRT A;  4PQH A;  5HFI A;  3ZFB A;  1NM3 A;  3VWU A;  2DIY A;  4KCE A;  2PU9 C;  3ERF A;  3IC8 A;  1FW1 A;  1DSB A;  2VM1 A;  1GUK A;  4XS1 A;  2LKU A;  5DBQ A;  3ME8 A;  4WR4 A;  2A2P A;  5KOW A;  4OWY A;  3HXS A;  1XWB A;  4TR3 A;  3ZRE A;  2HRN A;  1RQM A;  4ECJ A;  5KN1 A;  3IC4 A;  2C3Q A;  5ECL B;  5KOX A;  1MDJ A;  4ECI A;  5JWO B;  4MDC A;  4AJ7 A;  3QDN A;  1YF0 A;  1Q4J A;  1GSY A;  2GQK A;  3WGE A;  3H93 A;  22GS A;  4IP6 A;  1O73 A;  1Z3E A;  2HSM A;  1VF4 A;  3L9S A;  3TRX A;  3ZVJ D;  3G9B A;  4FO5 A;  1GWC A;  5JCU A;  5IQY A;  2VL9 A;  1PX6 A;  3J7Y k;  2C0D A;  2VCT A;  7GSS A;  3HDC A;  1NHO A;  1B8X A;  1AW9 A;  5A5K A;  4HJM A;  4ID0 A;  1AQX A;  3QAW A;  3GST A;  2H1D A;  2V1M A;  4Z7X A;  2B5E A;  2HE3 A;  5KN0 A;  3KXO A;  2DSA A;  3BJ5 A;  1BJX A;  3L78 A;  1R5P A;  1SD8 A;  3MYD A;  3FHK A;  3E0U A;  2LQQ A;  5E4W A;  3GL3 A;  5G30 A;  2EC4 A;  4L5L A;  5D9X A;  1K0A A;  4OFM A;  5HQP A;  4IJI A;  1TJD A;  5ECK B;  2C0G A;  3L9V A;  3M3M A;  4ZBB A;  2HYX A;  4MCU A;  4JED A;  2HT9 A;  2XBQ A;  2CQ9 A;  2DLX A;  1GRX A;  3CBU A;  3LSZ A;  5ECI B;  4OCF A;  1VF1 A;  3A3T A;  3DEX A;  3DD3 A;  4I97 A;  1EGO A;  2JZS A;  2CX3 A;  1X5E A;  4HDE A;  3Q6O A;  1GTA A;  4H86 A;  4G0L A;  3D4M A;  4G19 A;  4MF5 A;  2FNO A;  1PN9 A;  2UZ8 A;  16GS A;  4ML6 A;  1M7T A;  4LMV A;  5AIX A;  5ECR B;  3MAK A;  3EUR A;  1SL1 B;  1T00 A;  2MMN A;  3Q19 A;  1XWG A;  1U3A A;  1EGR A;  3F4T A;  4ZBD A;  3QFB C;  3DIE A;  1TK8 B;  3IR4 A;  1KTE A;  3DRN A;  3D0Z A;  1YKC A;  1EEM A;  3UVT A;  2JL4 A;  2PGT A;  3MNG A;  2YJH A;  2A4H A;  5J41 A;  1B48 A;  1IYI A;  2H8L A;  5IO2 A;  1EV9 A;  3GKM A;  1GSS A;  4DSS B;  3KP9 A;  3C1R A;  5HFG A;  5ECS A;  2CVD A;  3VI7 A;  2QA1 A;  3FZ4 A;  3LXZ A;  1UN2 A;  1I9D A;  2NDO A;  2RII A;  4AJ8 A;  2H0G A;  1OYJ A;  1UA5 A;  1ERV A;  1F2E A;  4BWS A;  1TP9 A;  2YZU A;  2GST A;  1A23 A;  3VPT A;  5CYY A;  3VLN A;  5L71 A;  3HD5 A;  3FY7 A;  1FVJ A;  1S3A A;  3PPU A;  3ERW A;  4EXJ A;  4OFT A;  3GH9 A;  3TRQ A;  1ZCP A;  3HA9 A;  2RM6 A;  4TN8 A;  5F8B A;  3FEU A;  5FT3 A;  4KDX A;  4PQ1 A;  4X4J A;  1GH2 A;  1JHB A;  4KND A;  1PX7 A;  4PUR A;  1OAZ A;  5C00 A;  6GST A;  3IAM 2;  3IXR A;  2K6V A;  1ZGN A;  1FO5 A;  1XVW A;  2WJU A;  2BTO T;  4TOP A;  1K0B A;  4K7I A;  2FA4 A;  2VAF A;  4ULX A;  2GQM A;  2H74 A;  1BAY A;  2GTU A;  1GSQ A;  1GTB A;  5G1K A;  4KDU A;  5IMV A;  5ELG A;  2OBI A;  1JLW A;  4JBB A;  2V6K A;  4QL7 A;  1WOU A;  4GLT A;  3ZIT A;  1R7H A;  2REM A;  4FYU A;  3EIN A;  5ECN B;  3QAG A;  4OFN A;  1FB0 A;  5B8A A;  2PBJ A;  3CSH A;  5CO3 A;  4DSQ A;  5IPH A;  4OO5 A;  2H30 A;  2VM2 A;  2R0G A;  4HU7 A;  3C73 A;  3R2Q A;  1VGL A;  3WD6 A;  5JWR B;  2YWO A;  3PR8 A;  3ISO A;  5CRH A;  3U5R E;  1YF1 A;  2YWM A;  4G0K A;  1S3C A;  1PQN A;  5D8I A;  3LW9 A;  4V2M A;  4ZL9 A;  3Q74 A;  1HNC A;  4XS6 A;  4N0V A;  1YKA A;  4AF2 A;  1XW5 A;  1SL0 B;  3H1N A;  4Q5Q A;  4KUN A;  3M9J A;  1F37 A;  2AJQ B;  3KP8 A;  1V9W A;  3UL3 A;  1H4O A;  1TKD B;  4FIW A;  1LU4 A;  5D9T A;  2H1A A;  3HHV A;  3UAR A;  1PKW A;  4Z2U A;  2M80 A;  4TR1 A;  4MZW A;  5JCW A;  1AIU A;  3AY8 A;  4MJC A;  3S9F A;  5J5N A;  2B1L A;  2OJL A;  3H8Q A;  4KDY A;  2F9S A;  3EU3 A;  3TKS E;  1M9B A;  1U87 A;  1YDK A;  2HXK A;  3LOR A;  1Z6M A;  2AUV A;  2H1G A;  3IPZ A;  4K0G A;  4KCA A;  3L0H A;  3UBK A;  3ED3 A;  5COH A;  4JR4 A;  3F3R A;  3F3Q A;  2GZY A;  2R4V A;  1SEN A;  4K0N A;  4ZB6 A;  4NXI A;  1A0F A;  4MF7 A;  1O8W A;  4N0Z A;  1TI3 A;  2QGV A;  4NV2 A;  1AC1 A;  3L9U A;  2ZUP A;  3C1S A;  4F2I A;  2V6O A;  4WKW A;  4TVE A;  2LQO A;  2OBK A;  4GRF A;  1B4P A;  3LGC A;  3RDW A;  1YEP A;  2H6X A;  3QAV A;  1X5C A;  4G9H A;  4MP4 A;  3H79 A;  4BVX A;  1A24 A;  4F82 A;  1OE7 A;  4MF6 A;  2DJ3 A;  2M46 A;  2GSQ A;  4PNG A;  2B7J A;  1XW9 A;  2YAN A;  3TKP A;  4YQU A;  3KD0 A;  2PN8 A;  2L59 A;  2VL2 C;  19GS A;  5A4V A;  4XCS A;  3UVH A;  2WZ9 A;  4HS1 A;  4EVM A;  5A4U A;  3CRU A;  1GSF A;  2O7K A;  4CY8 A;  2XC2 A;  1WMJ A;  2XPE A;  2VCX A;  5IOW A;  4EE0 A;  4X0X A;  1TRU A;  5KN2 A;  3A2V A;  2LRC A;  2H72 A;  1Z7P A;  1SK1 A;  1Q98 A;  2MBS A;  2QC7 A;  1B4Q A;  5KEJ A;  2FGX A;  4HZ4 A;  2HNL A;  2CV4 A;  3GA4 A;  2P31 A;  2HSH A;  3GUR A;  6GSY A;  5CNW A;  4TXV A;  5B6M A;  5C04 A;  1K3L A;  1NW2 A;  4AJ6 A;  1LBK A;  4KA0 A;  2B1K A;  1QXH A;  4TR0 A;  1DBY A;  4YQM A;  2YPM A;  4ZB8 A;  1BED A;  4K1F A;  2DKH A;  5GAN D;  1YZX A;  4POB A;  2NVL A;  3BBY A;  3QMX A;  13GS A;  2IFQ B;  4MJE A;  3GKK A;  4DEJ A;  4QL9 A;  3PIN A;  5G1L A;  4CHS A;  2DMM A;  6GSS A;  3ZYW A;  1A2L A;  4L0W A;  1G7O A;  2LV3 A;  1GNW A;  1QK8 A;  3D4T A;  2VCV A;  3A5W A;  4L5O A;  4TR1 B;  3LFL A;  2IJY A;  4NV5 A;  4P3Y B;  4K2X A;  5CRW A;  1XWK A;  1GSD A;  1T8E B;  3IK9 A;  4IW9 A;  3KZQ A;  1ERT A;  3EE2 A;  2PVO C;  3QR6 A;  1X0R A;  1DUG A;  3F0I A;  4L8E A;  5FWG A;  3TDG A;  5LCZ A;  2B6M A;  1ON4 A;  2P5R A;  3FKF A;  3MWH A;  2FUG 2;  1O85 A;  4WBJ A;  5J3R A;  5HR2 A;  2BJX A;  2VOC A;  2E2G A;  2VL3 A;  2L57 A;  2PVQ A;  4WET A;  4PGT A;  3ZML A;  2B3S A;  1U6T A;  2N5F A;  4WEY A;  1J08 A;  3KMN A;  3N9J A;  4KW6 A;  1VF3 A;  4MNN A;  4RQX A;  2H19 A;  3P2A A;  1H75 A;  3FZ9 A;  5HR3 A;  2H73 A;  1KEB A;  3EWL A;  3WGD A;  5DDL A;  1F3A A;  2EIO A;  1FOH A;  4BVX B;  1T7P B;  3VWX A;  3KH7 A;  4IVF A;  4CW9 A;  2I1U A;  1IYH A;  4MPG A;  4F0C A;  4Q5N A;  5D73 A;  4KE3 A;  5ID2 A;  1E6B A;  3QFA C;  1V58 A;  3LJR A;  1SYX A;  2H0I A;  1O8X A;  3D21 A;  4ICY A;  4LL1 B;  4USS A;  4PXO A;  4BL7 A;  2LNS A;  1MDK A;  3C71 A;  20GS A;  1GL8 A;  1TXX A;  2YNX A;  2PMT A;  3M9K A;  1QGV A;  2LJR A;  1BQ7 A;  3DML A;  4I2U A;  5GST A;  2CT6 A;  4LL4 B;  1G0T A;  1GNE A;  11GS A;  4D73 A;  4NAX A;  3E9J B;  4HQS A;  3IHQ A;  4O5U A;  1GTU A;  4MJA A;  3EMX A;  5CAX A;  4K2D A;  1JZO A;  4GWR A;  2F8A A;  4Q5R A;  1GTI A;  4V2N A;  1TK0 B;  3TKQ A;  2NTO A;  1SD9 A;  2TRC P;  3W6G A;  3TOU A;  2ON7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...