4TN8A

Crystal structure of thermus thermophilus thioredoxin solved by sulfur sad using swiss light source data
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
103
structure length
103
Chain Sequence
PIEVTDQNFDETLGQHPLVLVDFWAEWCAPCRMIAPILEEIAKEYEGKLLVAKLDVDENPKTAMRYRVMSIPTVILFKDGQPVEVLVGAQPKRNYQAKIEKHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thioredoxin
publication title Fast native-SAD phasing for routine macromolecular structure determination.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Electron transport
total genus 27
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2014-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4tn8A00
3P7XA 1ZL9A 3CBUA 3KJYA 1O81A 1S3AA 5ECSA 2GS3A 4DSSB 2GVPA 2KUCA 2HFDA 3NOFA 2H1DA 3LSZA 1GLQA 3M9JA 1XW9A 5CRDA 4Q5RA 1B9XC 3UL3A 3P8WA 4K8MA 1K0OA 4P3YB 3VWVA 4NAXA 4XRDA 2KLXA 2P31A 5G30A 4OFNA 3UVHA 2F3MA 3VLNA 1ILOA 2H71A 3KH9A 2I9HA 1EGRA 2R5GA 3D6IA 3PINA 1U3AA 1HNBA 2VD1A 1GH2A 5EL8A 2P5QA 5AN1A 4K0NA 4YQVA 1O73A 1PX7A 4IQAA 4ZILA 1SL0B 4OFMA 2WJUA 1GTBA 5EVOA 4PURA 2O8VB 4L5OA 2RIIA 3FZ9A 4MJAA 4D73B 2C4JA 4EF0A 1ZZYA 1GP1A 5IMDA 1XBSA 2VCXA 3H93A 3TKQA 2RUEA 5COHA 5D96A 2B1LA 4O7HA 5CAXA 4TKYA 4F0BA 2E2MA 1X9MB 4KDUA 2XPEA 3CSIA 3TKSC 5CRGA 1ZMAA 1UVZA 1U3IA 2IMDA 1XW5A 5D93A 4V1Ap 2GSTA 2FHEA 1G7EA 1GNEA 3TJGA 2OE3A 3A3TA 5INYA 1F2EA 3E0UA 3EINA 3UBLA 1AQVA 2D2ZA 3EU4A 3HKRA 2R3XA 3EWLA 1WMJA 3HA9A 1FB6A 1X5CA 4GQCA 3C8EA 3R2QA 5E4WA 2B5EA 4GXZA 3ISOA 1I9DA 2E2GA 2YV7A 2G0FA 3LJRA 3GUSA 1R4WA 3VWWA 4E8EA 1R7HA 6GSXA 2C3NA 2N5FA 2YWIA 2GZYA 2YNXA 3KP8A 4WF5A 3C73A 4GCIA 3UBKA 2VL2C 1Z7RA 4ZBBA 1YZXA 3DGQA 4AF2A 3KMNA 4MMMA 1X5DA 5HFGA 11GSA 5AISA 3TCOA 1I5GA 4F2IA 3FEUA 2GSSA 1DBYA 5B6MA 5IQYA 4NHZA 1DE1A 1R5AA 1WRYA 2YCDA 1KTEA 2GZZA 1X9WB 2CX4A 3HD5A 1UC7A 4XS4B 1WE0A 3A5WA 1BX9A 4I2TA 3TDGA 5DVBA 3HCZA 5IPGA 4OO4A 2HT9A 3LORA 4ECCA 3F4SA 4I8BA 1G6YA 1QGVA 2HRNA 5ECQB 3EMXA 2BJXA 2WULA 1DSBA 3ZMLA 5JCGA 3L0HA 1O7UA 1U88A 3IK7A 3IRAA 1F6MC 3C71A 2IIYA 2L6DA 3HJOA 1FVJA 1MEKA 5H5SA 5LCZA 3KD0A 5GAND 2C80A 3RDWA 1TK0B 4WR5A 1XWKA 4F03A 5D9TA 5G2ZA 3ZVJD 3GNJA 1T1VA 2PVQA 2K8VA 2CQ9A 2H0HA 4IELA 2CVBA 3HY2A 2HNLA 2K18A 3KZQA 2IMFA 4WBJA 3L9UA 4MDCA 3TRXA 4HZ4A 3HHVA 3QR6A 4XS1A 4LLRA 2J9HA 4ECJA 3D4MA 3QAWA 2FWHA 1AXDA 5ID2A 1V2AA 3E3EA 4JE1A 4N0VA 1K3OA 1NHOA 1CQHA 4IW9A 1JZRA 3CYNA 1LBKA 2TRXA 1HQOA 3DKSA 4IVFA 5GZZB 2YWOA 4KCAA 4FYBA 4WETA 2NPBA 5DJMA 3F4TA 2B7JA 2VLTA 2PUKC 3APOA 4KNDA 1EGOA 3Q19A 2HZFA 3GKKA 1A8LA 4JR4A 4HOJA 2VAFA 5CREA 10GSA 1TRVA 2YN1A 4ISDA 1HD2A 3DYRA 2C3TA 3FYGA 5CYYA 1TP9A 2R6KA 3PGTA 5JWRB 4PUFC 2K9FA 1ZYEA 4OMVA 3D22A 1AQXA 3LYPA 1V57A 4QL7A 3GX0A 2CAIA 3TJKA 4PGTA 5A4UA 4WEYA 2XBQA 5LNKe 3TRPA 4TXVA 4TVEA 1TRWA 1WPIA 4IGJA 2IWTA 2LEGA 3M3MA 3RAZA 3QMXA 1K0NA 1EEMA 2AAWA 2O89A 2L4QA 4EKZA 3CSHA 2DJ2A 5HR3A 3LQ7A 3A2XA 2DC5A 1YEXA 2WS2A 2PERA 1TRSA 2XBIA 4IJIA 5F8BA 3ED3A 4G9HA 2DMMA 5JWOB 3GV1A 2N5AA 3FY7A 1SYRA 4PX1A 17GSA 1SKWB 4RUVA 5FT3A 5KN3A 5DQYA 1TRUA 4MPFA 5J9CA 4F9ZA 1ZGNA 2VL3A 4ECIA 3VWXA 2VLUA 4K7IA 1MDJA 3GURA 2FD3A 1ST9A 1EP7A 3APSA 3DEXA 4DSSA 5DCHA 2JZTA 1AUCA 2H6YA 1Z3EA 1Y25A 3N9JA 2YOIA 1J0FA 1BEDA 1ZOFA 1TK8B 22GSA 2CA8A 1K0MA 4MP4A 3VPQA 2GT6A 2FLSA 4KGIA 4N11A 5CRWA 2PU9C 2LQQA 3G9BA 3DRNA 2CZ2A 3TB2A 1O8WA 1PN9A 3VURA 4E8HA 1YF1A 5IO2A 4JR6A 3KTLA 4FYUA 2HE3A 1FG4A 2B5XA 5KN0A 1S3DA 4ML1A 8GSSA 2FGXA 1MTCA 1GNWA 3ZTLA 1N2AA 1MDKA 1DE2A 3HVSA 3M9KA 3OR5A 2NTOA 4KCEA 4EXJA 2H75A 3IC4A 3C7MA 4X0XA 3IDVA 1AAZA 2H6ZA 5H5RA 1BYEA 1KEBA 3ZIVA 4CHSA 2WZ9A 3NZNA 2B1KA 5J9BA 4PQHA 2AV4A 2OE0A 1PSQA 1T8EB 3QPMA 3WGEA 4ZIJA 3U5RE 4ECBA 2H0GA 4KUNA 1ERVA 2FA8A 2YJHA 3TKRA 4EUYA 5JCWA 4BA7A 1Z9HA 4CW9A 3S9FA 2R2JA 2KHPA 3ZFBA 4Z7XA 2CVDA 1R5PA 4RQXA 3VWUA 4HJMA 5B6NA 4IHUA 2LUSA 2LKUA 5ECRB 3LFLA 4G2EA 1K3YA 1RK4A 5IMZA 1TXXA 1FVKA 2V6KA 1OAZA 4TXOB 2I1UA 4MPGA 5J4UA 3HZ4A 4GWRA 3HYPA 4POMA 1SK2A 4IP1A 3HJPA 1ZYQB 1SK1A 3KXOA 3MWHA 1OC9A 1QMVA 3F8UA 3EU3A 3IHQA 4GSTA 1GSEA 1SENA 2EIQA 4KW6A 2YJ7A 1B4PA 3FRCA 3FW2A 2C0EA 4EC0A 2O7KA 1TKDB 1SJZA 4JBBA 1JFUA 2ES7A 3WGXA 2GT5A 5IMAA 2P0GA 1M0UA 1A2LA 1OKTA 5B7CA 1JZWA 2VLVA 3E9JB 1YKAA 1SL2B 2JZRA 4TN8A 3VPTA 4XS4A 4PNFA 3EC3A 3EMPA 4PQIA 5D9WA 4MH3A 1YDKA 4NV5A 5ECNB 3RHCA 4WBRD 3CTFA 1VRSD 3ZIJA 3ZMKA 3FZAA 2VUPA 6GSSA 3LWAA 2LJRA 3KM6A 2V32A 2WRTA 4K7NA 5GSSA 3M0FA 1F37A 2C0FA 2X8CA 2MMNA 5ABRA 4KX4A 1MD3A 2QGVA 2AHEA 1B8XA 4I2UA 1PRXA 4IQ1A 3VI5A 1QUWA 4IKHA 2H66A 4Q5NA 5DQSA 1GSFA 3HZ8A 3FR6A 4N0ZA 2PGTA 1TW9A 4O92A 2VL9A 4BL7A 1PGTA 2ON5A 2ZCTA 4XCSA 5ELAA 2HZEB 1EV4A 1V40A 2AUVA 2H30A 3GFKA 1JLVA 3G7YA 1R26A 2V41A 5IMCA 18GSA 3FHKA 5DAKB 4MZBA 1ERWA 2NVLA 3GH6A 5L71A 2VL2A 1GL8A 3IPZA 3L9SA 5DCGA 4K7OA 1FB0A 3GKMA 1G7OA 3QD9A 2DJ1A 3GSTA 4GF0A 4JEDA 4MLYA 4I97A 3BCKA 1T00A 2H01A 3RPNA 2EIOA 2VCZA 4YAVA 4MABA 4MF6A 4ZL7A 5KEJA 4G10A 4ZBDA 1BQ7A 1NM3A 5IMVA 4KSMA 3I9V2 1SKRB 4TR0A 1T7PB 2JACA 3TKSE 5IOWA 3RPPA 1OE7A 4L5LA 1TDIA 4HQZA 3K8NA 2R4VA 2IFQB 4IP6A 1NHYA 5F0GA 1PL1A 4POBA 4F82A 2VIMA 2OACA 1A0FA 1PD21 4ZL9A 1K0BA 3ZL5A 3TKPA 2L6CA 4QL9A 1HNCA 3TJJA 1SK0A 4BWQA 2LJAA 4WF4A 3M1GA 3C1RA 4YQMA 2OBIA 2YV9A 1GSYA 3FR9A 3IBHA 2FWFA 2E7PA 4HEA2 5KN2A 1T3BA 5IOXA 4AJ7A 2LJKA 1PKWA 2JZSA 1CQGA 1F9MA 3P2AA 2GQKA 2LRNA 4HZ2A 1MDIA 4IJ3A 12GSA 1QXHA 5B8BA 1K3LA 2TRCP 3FK8A 5A4WA 1YQ1A 3F9UA 4V2LA 1B4QA 1BAYA 3ZYWA 2YZHA 2QKEA 4MH2A 1KNGA 2HYXA 2LSTA 3TOTA 1TI1A 2H73A 4OD7A 6GSTA 1M2BA 3IAS2 3DIEA 1YKCA 1M2DA 1FHEA 6GSWA 1XWAA 3BD2A 5F05A 4ACSA 3SWLA 3CTGA 5HR1A 4EL1A 2L5OA 1THXA 1X9SB 3CXGA 1XXUA 1EOGA 2DLXA 3PR8A 1XPVA 4BVYA 4EDZA 5D8IA 3BBYA 1TI3A 4EO3A 3O76A 1THOA 1YY7A 5DALB 4POLA 3V1WA 3ZLPA 5A5KA 4BWSA 3Q74A 3MNGA 2BMXA 1GLPA 1XOAA 2FA4A 4J2FA 2IL3A 4HU9A 1HYUA 2NBSA 2C3QA 1GUMA 5DDLA 3UMAA 4DVCA 3GTUB 1SYXA 2DIZA 2PBJA 1SJIA 5CNWA 5EPFA 3LGCA 1IYHA 2DJ3A 3LG6A 1OE8A 3UJ1A 3P90A 2L4CA 1GSQA 4I5QA 1M2AA 2MMAA 4NMUA 5H5QA 1XW6A 4IN0A 1UN2A 1VF1A 2JADA 2F8AA 1GUHA 3DD3A 1WOUA 2M46A 2H1AA 3FKFA 2GQLA 1W4VA 1RQMA 1PL2A 2GDRA 4MJEA 3TOUA 3ERFA 2FUG2 2VO4A 3GRXA 2HI7A 2K6VA 1QFNA 3UVTA 3QOUA 9GSSA 3IK9A 4JRRA 1X5EA 3F6DA 3TUEA 2C0DA 3BJ5A 2MMZA 3EE2A 2AB6A 4KAEA 1ACVA 1YEPA 3HVXA 3LYKA 20GSA 1T4ZA 3HVVA 3L78A 4LMVA 5D9VA 1GULA 2AYTA 4WKWA 2XC2A 1SKSB 4PUAA 1XCCA 3IA1A 2YANA 5KN1A 2IN3A 2GLRA 3GL5A 3QCPA 3KMOA 2IPAA 3ME8A 4ZB6A 5CP1A 3BCIA 1EEJA 4NPBA 4TRXA 5G5FA 5HR0A 3VK9A 3G7IA 3RHBA 2M72A 5G1KA 1O8XA 3DVWA 1SD9A 1C72A 5ECOB 1XVWA 1GSSA 2GQMA 4KB3A 1TU7A 1WIKA 2CV4A 4KDXA 3KP9A 1DUGA 2VOCA 3D5JA 2CX3A 4V2NA 2H1GA 3A2VA 2M80A 3IV4A 4YAPA 1SJ6A 3GSSA 4FO5A 4J56E 4TR1B 2HLSA 4QQ7A 4D73A 1GTIA 3KIJA 2RLIA 1M99A 1V58A 4MF7A 4MJCA 5HFKA 4GSSA 4TR4A 2I3YA 1A8YA 4XTSA 3JCML 3MDKA 2F8FA 1G6WA 4MK3A 1K0DA 4AJ6A 4XS6A 2PVOC 2VCQA 4F0CA 4I6XA 1SU9A 2JSYA 2GSRA 2YWNA 2DJ0A 3VI7A 1B48A 2CT6A 3CRTA 4OWYA 4ZL8A 3GH9A 2RM6A 4V1Ag 4KDYA 2MZCA 5FHIA 4EE0A 5FWGA 3APQA 3US3A 4XHMA 3GX8A 5G1LA 4WR4A 2EC4A 6GSUA 1J08A 2VCVA 5C00A 4L8EA 5ECPB 2KP1A 16GSA 1FAAA 2X99A 3QAGA 1UA5A 3ZRDA 2C0GA 1OC3A 2RUFA 2HRFA 4XRAA 4OFTA 2MBTA 1GSUA 4TW5A 4K9ZA 2HZEA 5DJLA 3KH7A 4RI7A 1OVNA 2YWMA 5GSTA 2QSIA 1JHBA 3MSZA 3W6GA 3L9VA 3LXTA 5DAKA 4L0UA 1JZOA 2LTKA 4OO5A 5ECKB 5LD0A 2H72A 14GSA 4HDEA 3TRQA 3F63A 4CDOA 2LV3A 4KA0A 3F6FA 5B8AA 2B5YA 4LMWA 1O85A 2XHFA 1A2MA 2ON7A 2KOKA 1J9BA 2PPTA 2OBKA 2OA7A 1S3CA 1B9YC 1O6JA 3LEFA 13GSA 1PQNA 1GWCA 1NSWA 2HSHA 1WWJA 2DBCA 3GL3A 1XZOA 1U6TA 2V1MA 1USBA 1AW9A 4X1UA 3FR3A 1GTUA 1Z7PA 4LL1B 4KE3A 2IFQA 1GRXA 3QAVA 2LRTA 2OKAA 4H86A 2R37A 3TKSA 4PXOA 4JZQA 1AIUA 2DJKA 1OYJA 2X8GA 5G31A 1Z5YE 4XIHA 2H76A 1MD4A 3UARA 1XFLA 3KCMA 4RI6A 2HXKA 5E59A 4TR3A 2CZ3A 3GIXA 3H4KA 4MA9A 4HQSA 3NIVA 1Y6EA 4NV2A 4ID0A 2PN8A 4L0WA 4EVMA 1PX6A 2K8SA 1W89A 1U87A 4ZXGA 5J5NA 1VF2A 3VFIA 4MCUA 2LNSA 2C8UA 4K1FA 4K2DA 1PKZA 1YJ6A 1X0RA 3L4NA 1OKDA 1EWXA 2FNOA 3WD6A 1OC9B 5ECMB 3HXSA 1JLWA 2GGTA 3DXBA 1N8JA 3FZ4A 3GA4A 3Q6OA 2VD0A 1ON4A 1VGLA 2X64A 3W8JA 4NHWA 3CRUA 3CSJA 2MYGA 1BJXA 2BTOT 2JSZA 3ZREA 2V2GA 2A2RA 1ZCPA 2EIRA 1VF4A 2WFCA 3MAKA 3N5OA 1HNAA 4V2MA 4MZCA 3F0IA 4NWYA 4WXTA 1ERUA 3J7Yk 3GHAA 2QC7A 5CO3A 4POKA 1H4OA 1SL1B 3FZ5A 1XWGA 4LL4B 7GSSA 5EY6A 4KH7A 3C1SA 1BG5A 2YP6A 2LNTA 2XPDA 4HUAA 2CAQA 5DALA 1V98A 2AJQB 4FH8A 2LS5A 5G5EA 2V6OA 6GSVA 4GTUA 1GUKA 1F3BA 5IO0A 2DIYA 1LJRA 1AQWA 5AIXA 1VF3A 3Q18A 3GTUA 2NDOA 5ELGA 4HJ2A 3D4TA 3EVIA 2CVKA 4GLTA 5JCUA 3IE3A 2YPMA 1ML6A 2G2QA 4BVXA 4JU5A 2H0IA 3SBCA 3WT2A 3UEMA 3GKNA 2VCWA 3I69A 4FIWA 3GYKA 4O5RA 1WJKA 5ECLB 1EV9A 2H8LA 3RBTA 3J7Yb 1Q98A 1LU4A 2O87A 2I81A 4DSQA 3PH9A 3KTBA 4GSNA 2B6MA 4AGSA 2HSYA 3KGKA 1TU8A 5GAPD 4AJ8A 3ME7A 2X8HA 3O3TA 1Q4JA 2L57A 4IBPA 4MF5A 3KEBA 2F9SA 2VM2A 1RW1A 2JL4A 3H1NA 2MMOA 2J23A 1T4YA 3DMLA 4GQFA 1TTZA 1H75A 1IYIA 1FO5A 3IOSA 2WDUA 19GSA 2FY6A 1PA3A 4NXIA 3DWVA 1ERTA 2REMA 4BPYA 5HQPA 4N30A 1JZDA 2GZPA 4FYCA 3GKXA 2IMEA 3F3QA 4K0GA 2GTUA 1M7TA 1A2JA 5ECIB 5IMFA 2OE1A 5IIZA 3LXZA 2IMIA 2FCHA 5IPHA 5AGYA 1URMA 3WT1A 1QQ2A 1E6BA 3TJBA 3F4RA 2H70A 5DBQA 4HS1A 4OCEA 1OC8A 1M9AA 3ZFLA 5AIVA 3M8NA 2I4AA 1Z6MA 3D21A 2N5BA 1TJDA 4RQRA 2RM5A 3I43A 4TR1A 2YZUA 4PQ1A 1AC1A 2H6XA 1K0AA 3U6VA 4ILFA 1WP0A 3A2WA 4MJBA 4EDYA 2MBSA 1F3AA 2P5RA 3QFBC 3TGZA 1GTAA 3AY8A 2ZUPA 1A24A 4IS0A 1M9BA 4OCFA 3WGDA 2FWGA 2DMLA 1Z6NA 2E0QA 2O85A 2ALBA 3HDCA 2WGRA 2H19A 4DSRA 1TOFA 5CRHA 5J41A 1QK8A 5ID2B 3I6AA 5ENUA 3H79A 2WB9A 3G7JA 3H8QA 4X43A 5IM9A 3UOMA 3QFAC 1TK5B 1XVQA 2TIRA 5F07A 2B7KA 5HR2A 2FWEA 2DSAA 2H74A 2VM1A 3QDNA 4ULXA 3W8SA 4O32A 1A0RP 2F51A 5A4VA 2VCTA 3ZVJA 1G0TA 4TXOA 4TOPA 3EYTA 1XIYA 1PMTA 5D9XA 2C1YA 3GN3A 2OJLA 3O6TA 2H1BA 3UIWA 1XWCA 1EP8A 4KSOA 4J57E 2IMKA 4K6XA 2LQOA 3WYWA 3CMIA 3F3RA 3HJMA 4ML6A 2IJYA 1A23A 2A2SA 1K0CA 3ZITA 4LA1A 1YF0A 3ZZXA 2L5LA 3UAPA 4Q5FA 1V9WA 5F06A 1GSDA 4ZB9A 2GSQA 1XWBA 4GRFA 4ZB8A 1E2YA 4HI7A 3DVXA 4YQUA 1KBNA 5C04A 2PWJA 2OADA 5HFIA 2ZNMA 2B3SA 3EURA 1FW1A 1XOBA 4HU7A 1ABAA 5ECHB 3IAM2 2PMTA 3IXRA 4G19A 5J3RA 1FOVA 4YH2A 4DEJA 1EZKA 3BOAA 4ZBAA 3TJFA 3ERWA 2Z9SA 2DJJA 2A4VA 3ERGA 3GMFA 2KP2A 1NW2A 3D0ZA 3IR4A 2LRCA 5JWQB 6GSYA 2L59A 4N10A 1EOHA 4MZWA 2WCIA 4Q5QA 5D73A 1SD8A 4PNGA 2JU5A
chains in the Genus database with same CATH superfamily
3P7XA 1ZL9A 3CBUA 3KJYA 1O81A 1S3AA 5ECSA 2GS3A 4DSSB 2GVPA 2KUCA 2HFDA 3NOFA 2H1DA 3LSZA 1GLQA 3M9JA 1XW9A 5CRDA 4Q5RA 1B9XC 3UL3A 3P8WA 4K8MA 1K0OA 4P3YB 3VWVA 4NAXA 4XRDA 2KLXA 2P31A 5G30A 4OFNA 3UVHA 2F3MA 3VLNA 1ILOA 2H71A 3KH9A 2I9HA 1EGRA 2R5GA 3D6IA 3PINA 1U3AA 1HNBA 2VD1A 1GH2A 5EL8A 2P5QA 5AN1A 4K0NA 4YQVA 1O73A 1PX7A 4IQAA 4ZILA 1SL0B 4OFMA 2WJUA 1GTBA 5EVOA 4PURA 2O8VB 4L5OA 2RIIA 3FZ9A 4MJAA 4D73B 2C4JA 4EF0A 2HRAA 1ZZYA 1GP1A 5IMDA 1XBSA 2VCXA 3H93A 3TKQA 2RUEA 5COHA 5D96A 2B1LA 4O7HA 5CAXA 4TKYA 4F0BA 2E2MA 1X9MB 4KDUA 2XPEA 3CSIA 3TKSC 5CRGA 1ZMAA 1UVZA 1U3IA 2IMDA 1XW5A 5D93A 4V1Ap 2GSTA 2FHEA 1G7EA 1GNEA 3TJGA 2OE3A 3A3TA 5INYA 1F2EA 3E0UA 3EINA 3UBLA 1AQVA 2D2ZA 3EU4A 4CY8A 2R0PA 3HKRA 2A4HA 2R3XA 3EWLA 1WMJA 3HA9A 1FB6A 1X5CA 4GQCA 3C8EA 3R2QA 5E4WA 2B5EA 4GXZA 3ISOA 1I9DA 2E2GA 2YV7A 2G0FA 3LJRA 3GUSA 1R4WA 3VWWA 4E8EA 1R7HA 6GSXA 2C3NA 2N5FA 2YWIA 2GZYA 2YNXA 3KP8A 4WF5A 3C73A 4GCIA 3UBKA 2VL2C 1Z7RA 4ZBBA 1YZXA 3DGQA 4AF2A 3KMNA 4MMMA 1X5DA 4K5SA 5HFGA 11GSA 1ZYPA 5AISA 3TCOA 1I5GA 4F2IA 3FEUA 2GSSA 1DBYA 5B6MA 5IQYA 4NHZA 1DE1A 1R5AA 1WRYA 2YCDA 1KTEA 2GZZA 1X9WB 2CX4A 3HD5A 1UC7A 4XS4B 1WE0A 2A2PA 3A5WA 1BX9A 4I2TA 3TDGA 1PFOA 5DVBA 3HCZA 5IPGA 4OO4A 2HT9A 3LORA 4ECCA 3F4SA 4Z2UA 4I8BA 1G6YA 1QGVA 2HRNA 5ECQB 3EMXA 2BJXA 2WULA 1DSBA 3ZMLA 5JCGA 3L0HA 1O7UA 1U88A 3IK7A 3IRAA 1F6MC 3C71A 2IIYA 2L6DA 3HJOA 1FVJA 1MEKA 5H5SA 5LCZA 3KD0A 5GAND 2C80A 3RDWA 1TK0B 4WR5A 1XWKA 4F03A 5D9TA 5G2ZA 3ZVJD 3GNJA 1T1VA 2PVQA 2K8VA 2CQ9A 2H0HA 4IELA 2CVBA 3HY2A 2HNLA 2K18A 3KZQA 2IMFA 4WBJA 3L9UA 4MDCA 3TRXA 4HZ4A 3HHVA 3QR6A 4XS1A 4LLRA 2J9HA 4ECJA 3D4MA 3QAWA 2FWHA 1AXDA 5ID2A 1V2AA 3E3EA 4JE1A 4N0VA 1K3OA 1NHOA 1CQHA 4IW9A 5KOXA 1JZRA 3CYNA 1LBKA 2TRXA 1HQOA 3DKSA 4IVFA 5GZZB 2YWOA 4KCAA 4FYBA 4WETA 2NPBA 5DJMA 3F4TA 2B7JA 2VLTA 2PUKC 3APOA 4KNDA 1EGOA 3Q19A 2HZFA 3GKKA 1A8LA 4JR4A 4HOJA 2VAFA 5CREA 10GSA 1TRVA 2YN1A 4ISDA 1HD2A 3DYRA 2C3TA 3FYGA 5CYYA 1TP9A 2R6KA 3PGTA 5JWRB 4PUFC 2K9FA 1ZYEA 4OMVA 1S3RA 3D22A 1AQXA 3LYPA 1V57A 4QL7A 3GX0A 2CAIA 3TJKA 4PGTA 3LW9A 4YKGA 5A4UA 4WEYA 2XBQA 5LNKe 3TRPA 4TXVA 4TVEA 1TRWA 1WPIA 4IGJA 2IWTA 2LEGA 3A5IA 3M3MA 3RAZA 3QMXA 1K0NA 1EEMA 2AAWA 2O89A 2L4QA 4EKZA 3CSHA 2DJ2A 5HR3A 3LQ7A 3A2XA 2DC5A 1YEXA 2WS2A 4EIQA 2PERA 1TRSA 2XBIA 4IJIA 5F8BA 3ED3A 4G9HA 2DMMA 5JWOB 3GV1A 2N5AA 3FY7A 1SYRA 4PX1A 17GSA 1SKWB 4RUVA 5FT3A 5KN3A 5DQYA 1TRUA 4MPFA 5J9CA 4F9ZA 1ZGNA 2VL3A 4ECIA 3VWXA 2VLUA 4K7IA 1MDJA 3GURA 2FD3A 1ST9A 1EP7A 3APSA 3DEXA 4DSSA 5DCHA 2JZTA 1AUCA 2H6YA 1Z3EA 1Y25A 3N9JA 2YOIA 1J0FA 1BEDA 1ZOFA 1TK8B 22GSA 2CA8A 4BVYB 1K0MA 4MP4A 3VPQA 2GT6A 2FLSA 4KGIA 4N11A 5CRWA 2PU9C 2LQQA 3G9BA 3DRNA 2CZ2A 3TB2A 1O8WA 1PN9A 3VURA 4E8HA 1YF1A 5IO2A 4JR6A 3KTLA 4FYUA 2HE3A 1FG4A 2B5XA 5KN0A 1S3DA 4ML1A 8GSSA 2FGXA 1MTCA 1GNWA 3ZTLA 1N2AA 1MDKA 1DE2A 2R0GA 3HVSA 3M9KA 3OR5A 2NTOA 4KCEA 4EXJA 2H75A 3IC4A 3C7MA 4X0XA 3IDVA 1AAZA 2H6ZA 5H5RA 1BYEA 1KEBA 3ZIVA 4CHSA 2WZ9A 3NZNA 2B1KA 5J9BA 2X49A 4PQHA 2AV4A 2OE0A 1PSQA 1T8EB 3QPMA 3WGEA 4ZIJA 3U5RE 4ECBA 2H0GA 4KUNA 1ERVA 2FA8A 2YJHA 3TKRA 4EUYA 5JCWA 4BA7A 1Z9HA 4CW9A 3S9FA 2R2JA 2KHPA 3ZFBA 4MNNA 4Z7XA 2CVDA 1R5PA 4RQXA 3VWUA 4A5PA 4HJMA 5B6NA 4IHUA 2LUSA 2LKUA 5ECRB 3LFLA 4G2EA 1K3YA 1RK4A 5IMZA 1TXXA 1FVKA 2V6KA 1OAZA 4TXOB 2I1UA 4MPGA 5J4UA 3HZ4A 4GWRA 3HYPA 4POMA 1SK2A 4IP1A 3HJPA 1ZYQB 1SK1A 3KXOA 3MWHA 1OC9A 1QMVA 3F8UA 3EU3A 3IHQA 4GSTA 1GSEA 1SENA 2EIQA 4KW6A 2YJ7A 1B4PA 3FRCA 3FW2A 2C0EA 4EC0A 2O7KA 1TKDB 1SJZA 4JBBA 1JFUA 2ES7A 3WGXA 2GT5A 5IMAA 2P0GA 1M0UA 1A2LA 1OKTA 5B7CA 1JZWA 2VLVA 3E9JB 1YKAA 1SL2B 2JZRA 4TN8A 3VPTA 4XS4A 4USSA 4PNFA 3EC3A 3EMPA 4PQIA 5D9WA 4MH3A 1YDKA 4NV5A 5ECNB 3RHCA 4WBRD 3CTFA 1VRSD 3ZIJA 3ZMKA 3FZAA 2VUPA 6GSSA 3LWAA 2LJRA 3KM6A 2V32A 2WRTA 4K7NA 5GSSA 3FMWA 3M0FA 1F37A 2C0FA 2X8CA 2MMNA 5ABRA 4KX4A 1MD3A 2QGVA 2AHEA 1B8XA 4I2UA 1PRXA 4IQ1A 3VI5A 1QUWA 4IKHA 2H66A 4Q5NA 5DQSA 1GSFA 3HZ8A 3FR6A 2QA2A 4N0ZA 2PGTA 1TW9A 3MIXA 4O92A 2VL9A 4BL7A 1PGTA 2ON5A 2ZCTA 4XCSA 5ELAA 2HZEB 1EV4A 1V40A 2AUVA 2H30A 3GFKA 1JLVA 3G7YA 1R26A 2V41A 5IMCA 18GSA 3FHKA 5DAKB 4MZBA 1ERWA 2NVLA 3GH6A 5L71A 2VL2A 1GL8A 3IPZA 3L9SA 5DCGA 4K7OA 1FB0A 3GKMA 1G7OA 3QD9A 2DJ1A 3GSTA 4GF0A 4JEDA 4MLYA 4I97A 3BCKA 1T00A 2H01A 3RPNA 2EIOA 2VCZA 4YAVA 4MABA 4MF6A 4ZL7A 5KEJA 4G10A 4ZBDA 1BQ7A 1NM3A 5IMVA 4KSMA 3I9V2 1SKRB 4TR0A 1T7PB 2JACA 3TKSE 5IOWA 3RPPA 1OE7A 4L5LA 1TDIA 4HQZA 3K8NA 2R4VA 2IFQB 5KOWA 4IP6A 1NHYA 5F0GA 1PL1A 4POBA 4Z2TA 4F82A 2VIMA 2OACA 1A0FA 1PD21 4ZL9A 1K0BA 3ZL5A 3TKPA 2L6CA 4QL9A 1HNCA 3TJJA 4CY6A 1SK0A 4BWQA 2LJAA 4WF4A 3M1GA 3C1RA 4YQMA 2OBIA 2YV9A 1GSYA 3FR9A 3IBHA 2FWFA 2E7PA 4HEA2 4KF9A 5KN2A 1T3BA 5IOXA 4AJ7A 2LJKA 1PKWA 2JZSA 2HRKA 1CQGA 1F9MA 4O5UA 3P2AA 2GQKA 2LRNA 4HZ2A 1MDIA 4IJ3A 12GSA 1QXHA 5B8BA 1K3LA 2TRCP 3FK8A 5A4WA 1YQ1A 3F9UA 4V2LA 1B4QA 1BAYA 3ZYWA 2YZHA 2QKEA 1PN0A 4MH2A 1KNGA 2HYXA 2LSTA 3TOTA 1TI1A 2H73A 4OD7A 6GSTA 1M2BA 3IAS2 3DIEA 1YKCA 1M2DA 1FHEA 6GSWA 1XWAA 3BD2A 5F05A 4ACSA 3SWLA 3CTGA 5HR1A 4EL1A 2L5OA 1THXA 5BRTA 1X9SB 3CXGA 1XXUA 1EOGA 2DLXA 3PR8A 1XPVA 4BVYA 4EDZA 5D8IA 3BBYA 1TI3A 4EO3A 3O76A 1THOA 1YY7A 5DALB 4POLA 3V1WA 3ZLPA 5A5KA 4BWSA 3Q74A 3MNGA 2BMXA 1GLPA 1XOAA 2FA4A 4J2FA 2IL3A 4HU9A 1HYUA 2NBSA 2C3QA 1GUMA 5DDLA 3UMAA 4DVCA 3GTUB 1SYXA 3R3EA 2DIZA 2PBJA 1SJIA 5CNWA 5EPFA 3LGCA 1IYHA 2DJ3A 3LG6A 1OE8A 3UJ1A 3P90A 4BVXB 5BMUA 2L4CA 1GSQA 4I5QA 1M2AA 2MMAA 4NMUA 5H5QA 1XW6A 4IN0A 1UN2A 1VF1A 2JADA 2F8AA 1GUHA 3DD3A 1WOUA 2M46A 2H1AA 3FKFA 2GQLA 1W4VA 1RQMA 1PL2A 2GDRA 4MJEA 3TOUA 3ERFA 2FUG2 2VO4A 3GRXA 2HI7A 4ICYA 2K6VA 1QFNA 3UVTA 3QOUA 9GSSA 3IK9A 4JRRA 3CQFA 1X5EA 3F6DA 3TUEA 2C0DA 3BJ5A 2MMZA 3EE2A 2AB6A 4KAEA 1ACVA 1YEPA 3HVXA 3LYKA 20GSA 1T4ZA 3HVVA 3L78A 4LMVA 5D9VA 1GULA 2AYTA 4WKWA 2XC2A 2R0CA 3IC8A 4PUAA 1SKSB 1XCCA 3IA1A 2YANA 5KN1A 2IN3A 2GLRA 3GL5A 3QCPA 3KMOA 2IPAA 3ME8A 4ZB6A 5CP1A 3BCIA 1EEJA 4NPBA 4TRXA 5G5FA 5HR0A 3VK9A 3G7IA 3RHBA 2M72A 5G1KA 1O8XA 3DVWA 1SD9A 1C72A 5ECOB 1XVWA 1GSSA 2GQMA 4KB3A 1TU7A 1WIKA 2CV4A 4KDXA 3KP9A 1DUGA 2VOCA 3D5JA 2CX3A 4V2NA 2H1GA 3A2VA 2M80A 3IV4A 4YAPA 1SJ6A 3GSSA 4FO5A 4J56E 4TR1B 2HLSA 4QQ7A 4D73A 1GTIA 3KIJA 2RLIA 1M99A 1V58A 4MF7A 4MJCA 5HFKA 4GSSA 4TR4A 2I3YA 1A8YA 4XTSA 3JCML 3MDKA 2F8FA 4K2XA 1G6WA 4MK3A 1K0DA 4AJ6A 4XS6A 2PVOC 2VCQA 4F0CA 4I6XA 1SU9A 2JSYA 2GSRA 2YWNA 2DJ0A 3VI7A 1B48A 2CT6A 3CRTA 4OWYA 4ZL8A 3GH9A 2RM6A 4V1Ag 4KDYA 2MZCA 5FHIA 4EE0A 5FWGA 3APQA 3US3A 4XHMA 3GX8A 5G1LA 4G0LA 4WR4A 2EC4A 6GSUA 1J08A 2VCVA 5C00A 4L8EA 5ECPB 2KP1A 16GSA 1FAAA 4FQUA 2X99A 3QAGA 1UA5A 3ZRDA 2C0GA 1OC3A 2RUFA 2HRFA 4G0IA 4XRAA 4OFTA 2MBTA 1GSUA 4TW5A 4K9ZA 2HZEA 5DJLA 3IHGA 3KH7A 4RI7A 4EIPA 1OVNA 2YWMA 5GSTA 2QSIA 1JHBA 3MSZA 3W6GA 3L9VA 3LXTA 5DAKA 4L0UA 1JZOA 2LTKA 4OO5A 5ECKB 5LD0A 2H72A 14GSA 4HDEA 3TRQA 3F63A 4CDOA 2LV3A 4KA0A 3F6FA 5B8AA 2B5YA 4LMWA 1O85A 2XHFA 1A2MA 2ON7A 2KOKA 1J9BA 2PPTA 2OBKA 2OA7A 1S3CA 1B9YC 1O6JA 3LEFA 1ZYNA 13GSA 1PQNA 1GWCA 1NSWA 2HSHA 1WWJA 2DBCA 3GL3A 1XZOA 1U6TA 3PPUA 2V1MA 1USBA 1AW9A 4X1UA 3FR3A 1GTUA 1Z7PA 4LL1B 4KE3A 2IFQA 1GRXA 3QAVA 2LRTA 2OKAA 4H86A 2R37A 3TKSA 4PXOA 4JZQA 1AIUA 2DJKA 1OYJA 2X8GA 5G31A 1Z5YE 4XIHA 2H76A 4HSCX 1MD4A 3UARA 1XFLA 3KCMA 4RI6A 2HXKA 5E59A 4TR3A 2CZ3A 3GIXA 3H4KA 4MA9A 4HQSA 3NIVA 1Y6EA 4NV2A 4ID0A 2PN8A 4K5RA 4L0WA 4EVMA 1PX6A 2K8SA 1W89A 1U87A 4ZXGA 5J5NA 1VF2A 3VFIA 4MCUA 2LNSA 2C8UA 4K1FA 4K2DA 1PKZA 1YJ6A 1X0RA 3L4NA 1OKDA 1EWXA 2FNOA 3WD6A 1OC9B 5ECMB 3HXSA 1JLWA 2GGTA 3DXBA 1N8JA 3FZ4A 2UZ8A 3GA4A 3Q6OA 2VD0A 1ON4A 1VGLA 2X64A 3W8JA 4NHWA 3CRUA 3CSJA 2MYGA 1BJXA 2BTOT 2JSZA 3ZREA 2V2GA 2A2RA 1ZCPA 2EIRA 1VF4A 2WFCA 3MAKA 3N5OA 1HNAA 4V2MA 4MZCA 3F0IA 4NWYA 4WXTA 1ERUA 3J7Yk 2HSMA 3GHAA 2QC7A 5CO3A 4POKA 1H4OA 1SL1B 3FZ5A 1XWGA 4G0KA 4LL4B 7GSSA 5EY6A 4KH7A 3C1SA 1BG5A 2YP6A 2LNTA 2XPDA 4HUAA 2CAQA 5DALA 1V98A 2AJQB 4FH8A 2LS5A 5G5EA 2V6OA 6GSVA 4GTUA 1GUKA 1F3BA 5IO0A 2DIYA 1LJRA 1AQWA 5AIXA 1VF3A 3Q18A 3GTUA 4X4JA 2NDOA 5ELGA 4HJ2A 3D4TA 3EVIA 2CVKA 4GLTA 5JCUA 2DKIA 3IE3A 2YPMA 1ML6A 2G2QA 4BVXA 4JU5A 4YKFA 2H0IA 3SBCA 3WT2A 3UEMA 3GKNA 2VCWA 3I69A 1M3IA 4FIWA 3GYKA 4O5RA 4BL7B 1WJKA 5ECLB 1EV9A 3EPTA 2H8LA 3RBTA 3J7Yb 1Q98A 1LU4A 2O87A 2I81A 4DSQA 3PH9A 3KTBA 4GSNA 2B6MA 4AGSA 3HVNA 2HSYA 3KGKA 1TU8A 5GAPD 4AJ8A 3ME7A 2X8HA 3O3TA 1Q4JA 2L57A 4IBPA 4MF5A 3KEBA 2F9SA 2VM2A 1RW1A 2JL4A 3H1NA 2MMOA 2J23A 1T4YA 3DMLA 4GQFA 1TTZA 1H75A 1IYIA 1FOHA 1FO5A 3IOSA 2WDUA 19GSA 2FY6A 1PA3A 4NXIA 3DWVA 1ERTA 2REMA 4BPYA 4Z2RA 5HQPA 4N30A 1JZDA 2GZPA 4FYCA 3GKXA 2IMEA 3F3QA 4K0GA 2GTUA 1M7TA 1A2JA 5ECIB 5IMFA 2OE1A 5IIZA 3MYDA 3LXZA 2IMIA 2FCHA 5IPHA 5AGYA 1URMA 3WT1A 1QQ2A 1E6BA 3TJBA 3F4RA 2H70A 5DBQA 1XG8A 4HS1A 4OCEA 1OC8A 1M9AA 3ZFLA 5AIVA 3M8NA 2I4AA 1Z6MA 3D21A 2N5BA 1TJDA 4RQRA 2RM5A 3I43A 4TR1A 2YZUA 4PQ1A 1AC1A 2H6XA 1K0AA 3U6VA 4ILFA 1WP0A 3A2WA 4MJBA 4EDYA 2MBSA 1F3AA 2P5RA 3QFBC 3TGZA 1GTAA 3AY8A 2ZUPA 1A24A 4IS0A 1M9BA 4OCFA 3WGDA 2FWGA 2DMLA 2DKHA 1Z6NA 2E0QA 2O85A 2ALBA 3HDCA 2WGRA 2H19A 4DSRA 1TOFA 5CRHA 5J41A 1QK8A 5ID2B 3I6AA 5ENUA 3H79A 2WB9A 3G7JA 3H8QA 2QA1A 4X43A 5IM9A 3UOMA 3QFAC 1TK5B 1XVQA 2TIRA 5F07A 2B7KA 5HR2A 2FWEA 2DSAA 2H74A 2VM1A 3QDNA 4ULXA 3W8SA 4O32A 1A0RP 2F51A 5A4VA 2VCTA 3ZVJA 1M3JA 1G0TA 4TXOA 4TOPA 3EYTA 1XIYA 1PMTA 5D9XA 2C1YA 3GN3A 4PTSA 2OJLA 3O6TA 2H1BA 4BIKA 4O5QA 3UIWA 1XWCA 2X4AA 1EP8A 4KSOA 4J57E 2IMKA 4K6XA 2LQOA 3WYWA 3CMIA 3F3RA 3HJMA 4ML6A 2IJYA 1A23A 2A2SA 1K0CA 3ZITA 4LA1A 1YF0A 3ZZXA 2L5LA 3UAPA 4Q5FA 1V9WA 5F06A 1GSDA 4ZB9A 2GSQA 1XWBA 4GRFA 4ZB8A 1E2YA 4HI7A 3DVXA 4YQUA 1KBNA 5C04A 2PWJA 2OADA 5HFIA 2ZNMA 2B3SA 3EURA 1FW1A 1XOBA 4HU7A 1ABAA 5ECHB 3IAM2 2PMTA 3IXRA 4G19A 5J3RA 1FOVA 4YH2A 4DEJA 1EZKA 3BOAA 4ZBAA 3TJFA 3ERWA 2Z9SA 2DJJA 2A4VA 3ERGA 3GMFA 2KP2A 1NW2A 3D0ZA 3IR4A 2LRCA 5JWQB 6GSYA 2L59A 4N10A 1EOHA 4MZWA 2WCIA 4Q5QA 5D73A 1SD8A 4PNGA 2JU5A
chains in the Genus database with same CATH topology
3P7XA 1ZL9A 3CBUA 3KJYA 1O81A 1S3AA 5ECSA 2GS3A 4DSSB 2GVPA 2KUCA 2HFDA 3NOFA 2H1DA 3LSZA 1GLQA 3M9JA 1XW9A 5CRDA 4Q5RA 1B9XC 3UL3A 3P8WA 4K8MA 1K0OA 4P3YB 3VWVA 4NAXA 4XRDA 2KLXA 2P31A 5G30A 4OFNA 3UVHA 2F3MA 3VLNA 1ILOA 2H71A 3KH9A 2I9HA 1EGRA 2R5GA 3D6IA 3PINA 1U3AA 1HNBA 2VD1A 1GH2A 5EL8A 2P5QA 5AN1A 4K0NA 4YQVA 1O73A 1PX7A 4IQAA 4ZILA 1SL0B 4OFMA 2WJUA 1GTBA 5EVOA 4PURA 2O8VB 4L5OA 2RIIA 3FZ9A 4MJAA 4D73B 2C4JA 4EF0A 2HRAA 1ZZYA 1GP1A 5IMDA 1XBSA 2VCXA 3H93A 3TKQA 2RUEA 5COHA 5D96A 2B1LA 4O7HA 5CAXA 4TKYA 4F0BA 2E2MA 1X9MB 4KDUA 2XPEA 3CSIA 3TKSC 5CRGA 1ZMAA 1UVZA 1U3IA 2IMDA 1XW5A 5D93A 4V1Ap 2GSTA 2FHEA 1G7EA 1GNEA 3TJGA 2OE3A 3A3TA 5INYA 1F2EA 3E0UA 3EINA 3UBLA 1AQVA 2D2ZA 3EU4A 4CY8A 2R0PA 3HKRA 2A4HA 2R3XA 3EWLA 1WMJA 3HA9A 1FB6A 1X5CA 4GQCA 3C8EA 3R2QA 5E4WA 2B5EA 4GXZA 3ISOA 1I9DA 2E2GA 2YV7A 2G0FA 3LJRA 3GUSA 1R4WA 3VWWA 4E8EA 1R7HA 6GSXA 2C3NA 2N5FA 2YWIA 2GZYA 2YNXA 3KP8A 4WF5A 3C73A 4GCIA 3UBKA 2VL2C 1Z7RA 4ZBBA 1YZXA 3DGQA 4AF2A 3KMNA 4MMMA 1X5DA 4K5SA 5HFGA 11GSA 1ZYPA 5AISA 3TCOA 1I5GA 4F2IA 3FEUA 2GSSA 1DBYA 5B6MA 5IQYA 4NHZA 1DE1A 1R5AA 1WRYA 2YCDA 1KTEA 2GZZA 1X9WB 2CX4A 3HD5A 1UC7A 4XS4B 1WE0A 2A2PA 3A5WA 1BX9A 4I2TA 3TDGA 5DVBA 3HCZA 5IPGA 4OO4A 2HT9A 3LORA 4ECCA 3F4SA 4Z2UA 4I8BA 1G6YA 1QGVA 2HRNA 5ECQB 3EMXA 2BJXA 2WULA 1DSBA 3ZMLA 5JCGA 3L0HA 1O7UA 1U88A 3IK7A 3IRAA 1F6MC 3C71A 2IIYA 2L6DA 3HJOA 1FVJA 1MEKA 5H5SA 5LCZA 3KD0A 5GAND 2C80A 3RDWA 1TK0B 4WR5A 1XWKA 4F03A 5D9TA 5G2ZA 3ZVJD 3GNJA 1T1VA 2PVQA 2K8VA 2CQ9A 2H0HA 4IELA 2CVBA 3HY2A 2HNLA 2K18A 3KZQA 2IMFA 4WBJA 3L9UA 4MDCA 3TRXA 4HZ4A 3HHVA 3QR6A 4XS1A 4LLRA 2J9HA 4ECJA 3D4MA 3QAWA 2FWHA 1AXDA 5ID2A 1V2AA 3E3EA 4JE1A 4N0VA 1K3OA 1NHOA 1CQHA 4IW9A 5KOXA 1JZRA 3CYNA 1LBKA 2TRXA 1HQOA 3DKSA 4IVFA 5GZZB 2YWOA 4KCAA 4FYBA 4WETA 2NPBA 5DJMA 3F4TA 2B7JA 2VLTA 2PUKC 3APOA 4KNDA 1EGOA 3Q19A 2HZFA 3GKKA 1A8LA 4JR4A 4HOJA 2VAFA 5CREA 10GSA 1TRVA 2YN1A 4ISDA 1HD2A 3DYRA 2C3TA 3FYGA 5CYYA 1TP9A 2R6KA 3PGTA 5JWRB 4PUFC 2K9FA 1ZYEA 4OMVA 3D22A 1AQXA 3LYPA 1V57A 4QL7A 3GX0A 2CAIA 3TJKA 4PGTA 3LW9A 4YKGA 5A4UA 4WEYA 2XBQA 5LNKe 3TRPA 4TXVA 4TVEA 1TRWA 1WPIA 4IGJA 2IWTA 2LEGA 3A5IA 3M3MA 3RAZA 3QMXA 1K0NA 1EEMA 2AAWA 2O89A 2L4QA 4EKZA 3CSHA 2DJ2A 5HR3A 3LQ7A 3A2XA 2DC5A 1YEXA 2WS2A 4EIQA 2PERA 1TRSA 2XBIA 4IJIA 5F8BA 3ED3A 4G9HA 2DMMA 5JWOB 3GV1A 2N5AA 3FY7A 1SYRA 4PX1A 17GSA 1SKWB 4RUVA 5FT3A 5KN3A 5DQYA 1TRUA 4MPFA 5J9CA 4F9ZA 1ZGNA 2VL3A 4ECIA 3VWXA 2VLUA 4K7IA 1MDJA 3GURA 2FD3A 1ST9A 1EP7A 3APSA 3DEXA 4DSSA 5DCHA 2JZTA 1AUCA 2H6YA 1Z3EA 1Y25A 3N9JA 2YOIA 1J0FA 1BEDA 1ZOFA 1TK8B 22GSA 2CA8A 4BVYB 1K0MA 4MP4A 3VPQA 2GT6A 2FLSA 4KGIA 4N11A 5CRWA 2PU9C 2LQQA 3G9BA 3DRNA 2CZ2A 3TB2A 1O8WA 1PN9A 3VURA 4E8HA 1YF1A 5IO2A 4JR6A 3KTLA 4FYUA 2HE3A 1FG4A 2B5XA 5KN0A 1S3DA 4ML1A 8GSSA 2FGXA 1MTCA 1GNWA 3ZTLA 1N2AA 1MDKA 1DE2A 2R0GA 3HVSA 3M9KA 3OR5A 2NTOA 4KCEA 4EXJA 2H75A 3IC4A 3C7MA 4X0XA 3IDVA 1AAZA 2H6ZA 5H5RA 1BYEA 1KEBA 3ZIVA 4CHSA 2WZ9A 3NZNA 2B1KA 5J9BA 2X49A 4PQHA 2AV4A 2OE0A 1PSQA 1T8EB 3QPMA 3WGEA 4ZIJA 3U5RE 4ECBA 2H0GA 4KUNA 1ERVA 2FA8A 2YJHA 3TKRA 4EUYA 5JCWA 4BA7A 1Z9HA 4CW9A 3S9FA 2R2JA 2KHPA 3ZFBA 4MNNA 4Z7XA 2CVDA 1R5PA 4RQXA 3VWUA 4A5PA 4HJMA 5B6NA 4IHUA 2LUSA 2LKUA 5ECRB 3LFLA 4G2EA 1K3YA 1RK4A 5IMZA 1TXXA 1FVKA 2V6KA 1OAZA 4TXOB 2I1UA 4MPGA 5J4UA 3HZ4A 4GWRA 3HYPA 4POMA 1SK2A 4IP1A 3HJPA 1ZYQB 1SK1A 3KXOA 3MWHA 1OC9A 1QMVA 3F8UA 3EU3A 3IHQA 4GSTA 1GSEA 1SENA 2EIQA 4KW6A 2YJ7A 1B4PA 3FRCA 3FW2A 2C0EA 4EC0A 2O7KA 1TKDB 1SJZA 4JBBA 1JFUA 2ES7A 3WGXA 2GT5A 5IMAA 2P0GA 1M0UA 1A2LA 1OKTA 5B7CA 1JZWA 2VLVA 3E9JB 1YKAA 1SL2B 2JZRA 4TN8A 3VPTA 4XS4A 4USSA 4PNFA 3EC3A 3EMPA 4PQIA 5D9WA 4MH3A 1YDKA 4NV5A 5ECNB 3RHCA 4WBRD 3CTFA 1VRSD 3ZIJA 3ZMKA 3FZAA 2VUPA 6GSSA 3LWAA 2LJRA 3KM6A 2V32A 2WRTA 4K7NA 5GSSA 3FMWA 3M0FA 1F37A 2C0FA 2X8CA 2MMNA 5ABRA 4KX4A 1MD3A 2QGVA 2AHEA 1B8XA 4I2UA 1PRXA 4IQ1A 3VI5A 1QUWA 4IKHA 2H66A 4Q5NA 5DQSA 1GSFA 3HZ8A 3FR6A 2QA2A 4N0ZA 2PGTA 1TW9A 3MIXA 4O92A 2VL9A 4BL7A 1PGTA 2ON5A 2ZCTA 4XCSA 5ELAA 2HZEB 1EV4A 1V40A 2AUVA 2H30A 3GFKA 1JLVA 3G7YA 1R26A 2V41A 5IMCA 18GSA 3FHKA 5DAKB 4MZBA 1ERWA 2NVLA 3GH6A 5L71A 2VL2A 1GL8A 3IPZA 3L9SA 5DCGA 4K7OA 1FB0A 3GKMA 1G7OA 3QD9A 2DJ1A 3GSTA 4GF0A 4JEDA 4MLYA 4I97A 3BCKA 1T00A 2H01A 3RPNA 2EIOA 2VCZA 4YAVA 4MABA 4MF6A 4ZL7A 5KEJA 4G10A 4ZBDA 1BQ7A 1NM3A 5IMVA 4KSMA 3I9V2 1SKRB 4TR0A 1T7PB 2JACA 3TKSE 5IOWA 3RPPA 1OE7A 4L5LA 1TDIA 4HQZA 3K8NA 2R4VA 2IFQB 5KOWA 4IP6A 1NHYA 5F0GA 1PL1A 4POBA 4Z2TA 4F82A 2VIMA 2OACA 1A0FA 1PD21 4ZL9A 1K0BA 3ZL5A 3TKPA 2L6CA 4QL9A 1HNCA 3TJJA 4CY6A 1SK0A 4BWQA 2LJAA 4WF4A 3M1GA 3C1RA 4YQMA 2OBIA 2YV9A 1GSYA 3FR9A 3IBHA 2FWFA 2E7PA 4HEA2 4KF9A 5KN2A 1T3BA 5IOXA 4AJ7A 2LJKA 1PKWA 2JZSA 2HRKA 1CQGA 1F9MA 4O5UA 3P2AA 2GQKA 2LRNA 4HZ2A 1MDIA 4IJ3A 12GSA 1QXHA 5B8BA 1K3LA 2TRCP 3FK8A 5A4WA 1YQ1A 3F9UA 4V2LA 1B4QA 1BAYA 3ZYWA 2YZHA 2QKEA 1PN0A 4MH2A 1KNGA 2HYXA 2LSTA 3TOTA 1TI1A 2H73A 4OD7A 6GSTA 1M2BA 3IAS2 3DIEA 1YKCA 1M2DA 1FHEA 6GSWA 1XWAA 3BD2A 5F05A 4ACSA 3SWLA 3CTGA 5HR1A 4EL1A 2L5OA 1THXA 5BRTA 1X9SB 3CXGA 1XXUA 1EOGA 2DLXA 3PR8A 1XPVA 4BVYA 4EDZA 5D8IA 3BBYA 1TI3A 4EO3A 3O76A 1THOA 1YY7A 5DALB 4POLA 3V1WA 3ZLPA 5A5KA 4BWSA 3Q74A 3MNGA 2BMXA 1GLPA 1XOAA 2FA4A 4J2FA 2IL3A 4HU9A 1HYUA 2NBSA 2C3QA 1GUMA 5DDLA 3UMAA 4DVCA 3GTUB 1SYXA 3R3EA 2DIZA 2PBJA 1SJIA 5CNWA 5EPFA 3LGCA 1IYHA 2DJ3A 3LG6A 1OE8A 3UJ1A 3P90A 4BVXB 5BMUA 2L4CA 1GSQA 4I5QA 1M2AA 2MMAA 4NMUA 5H5QA 1XW6A 4IN0A 1UN2A 1VF1A 2JADA 2F8AA 1GUHA 3DD3A 1WOUA 2M46A 2H1AA 3FKFA 2GQLA 1W4VA 1RQMA 1PL2A 2GDRA 4MJEA 3TOUA 3ERFA 2FUG2 2VO4A 3GRXA 2HI7A 4ICYA 2K6VA 1QFNA 3UVTA 3QOUA 9GSSA 3IK9A 4JRRA 1X5EA 3F6DA 3TUEA 2C0DA 3BJ5A 2MMZA 3EE2A 2AB6A 4KAEA 1ACVA 1YEPA 3HVXA 3LYKA 20GSA 1T4ZA 3HVVA 3L78A 4LMVA 5D9VA 1GULA 2AYTA 4WKWA 2XC2A 2R0CA 3IC8A 4PUAA 1SKSB 1XCCA 3IA1A 2YANA 5KN1A 2IN3A 2GLRA 3GL5A 3QCPA 3KMOA 2IPAA 3ME8A 4ZB6A 5CP1A 3BCIA 1EEJA 4NPBA 4TRXA 5G5FA 5HR0A 3VK9A 3G7IA 3RHBA 2M72A 5G1KA 1O8XA 3DVWA 1SD9A 1C72A 5ECOB 1XVWA 1GSSA 2GQMA 4KB3A 1TU7A 1WIKA 2CV4A 4KDXA 3KP9A 1DUGA 2VOCA 3D5JA 2CX3A 4V2NA 2H1GA 3A2VA 2M80A 3IV4A 4YAPA 1SJ6A 3GSSA 4FO5A 4J56E 4TR1B 2HLSA 4QQ7A 4D73A 1GTIA 3KIJA 2RLIA 1M99A 1V58A 4MF7A 4MJCA 5HFKA 4GSSA 4TR4A 2I3YA 1A8YA 4XTSA 3JCML 3MDKA 2F8FA 4K2XA 1G6WA 4MK3A 1K0DA 4AJ6A 4XS6A 2PVOC 2VCQA 4F0CA 4I6XA 1SU9A 2JSYA 2GSRA 2YWNA 2DJ0A 3VI7A 1B48A 2CT6A 3CRTA 4OWYA 4ZL8A 3GH9A 2RM6A 4V1Ag 4KDYA 2MZCA 5FHIA 4EE0A 5FWGA 3APQA 3US3A 4XHMA 3GX8A 5G1LA 4G0LA 4WR4A 2EC4A 6GSUA 1J08A 2VCVA 5C00A 4L8EA 5ECPB 2KP1A 16GSA 1FAAA 4FQUA 2X99A 3QAGA 1UA5A 3ZRDA 2C0GA 1OC3A 2RUFA 2HRFA 4G0IA 4XRAA 4OFTA 2MBTA 1GSUA 4TW5A 4K9ZA 2HZEA 5DJLA 3IHGA 3KH7A 4RI7A 4EIPA 1OVNA 2YWMA 5GSTA 2QSIA 1JHBA 3MSZA 3W6GA 3L9VA 3LXTA 5DAKA 4L0UA 1JZOA 2LTKA 4OO5A 5ECKB 5LD0A 2H72A 14GSA 4HDEA 3TRQA 3F63A 4CDOA 2LV3A 4KA0A 3F6FA 5B8AA 2B5YA 4LMWA 1O85A 2XHFA 1A2MA 2ON7A 2KOKA 1J9BA 2PPTA 2OBKA 2OA7A 1S3CA 1B9YC 1O6JA 3LEFA 1ZYNA 13GSA 1PQNA 1GWCA 1NSWA 2HSHA 1WWJA 2DBCA 3GL3A 1XZOA 1U6TA 3PPUA 2V1MA 1USBA 1AW9A 4X1UA 3FR3A 1GTUA 1Z7PA 4LL1B 4KE3A 2IFQA 1GRXA 3QAVA 2LRTA 2OKAA 4H86A 2R37A 3TKSA 4PXOA 4JZQA 1AIUA 2DJKA 1OYJA 2X8GA 5G31A 1Z5YE 4XIHA 2H76A 1MD4A 3UARA 1XFLA 3KCMA 4RI6A 2HXKA 5E59A 4TR3A 2CZ3A 3GIXA 3H4KA 4MA9A 4HQSA 3NIVA 1Y6EA 4NV2A 4ID0A 2PN8A 4K5RA 4L0WA 4EVMA 1PX6A 2K8SA 1W89A 1U87A 4ZXGA 5J5NA 1VF2A 3VFIA 4MCUA 2LNSA 2C8UA 4K1FA 4K2DA 1PKZA 1YJ6A 1X0RA 3L4NA 1OKDA 1EWXA 2FNOA 3WD6A 1OC9B 5ECMB 3HXSA 1JLWA 2GGTA 3DXBA 1N8JA 3FZ4A 2UZ8A 3GA4A 3Q6OA 2VD0A 1ON4A 1VGLA 2X64A 3W8JA 4NHWA 3CRUA 3CSJA 2MYGA 1BJXA 2BTOT 2JSZA 3ZREA 2V2GA 2A2RA 1ZCPA 2EIRA 1VF4A 2WFCA 3MAKA 3N5OA 1HNAA 4V2MA 4MZCA 3F0IA 4NWYA 4WXTA 1ERUA 3J7Yk 2HSMA 3GHAA 2QC7A 5CO3A 4POKA 1H4OA 1SL1B 3FZ5A 1XWGA 4G0KA 4LL4B 7GSSA 5EY6A 4KH7A 3C1SA 1BG5A 2YP6A 2LNTA 2XPDA 4HUAA 2CAQA 5DALA 1V98A 2AJQB 4FH8A 2LS5A 5G5EA 2V6OA 6GSVA 4GTUA 1GUKA 1F3BA 5IO0A 2DIYA 1LJRA 1AQWA 5AIXA 1VF3A 3Q18A 3GTUA 4X4JA 2NDOA 5ELGA 4HJ2A 3D4TA 3EVIA 2CVKA 4GLTA 5JCUA 2DKIA 3IE3A 2YPMA 1ML6A 2G2QA 4BVXA 4JU5A 4YKFA 2H0IA 3SBCA 3WT2A 3UEMA 3GKNA 2VCWA 3I69A 4FIWA 3GYKA 4O5RA 4BL7B 1WJKA 5ECLB 1EV9A 3EPTA 2H8LA 3RBTA 3J7Yb 1Q98A 1LU4A 2O87A 2I81A 4DSQA 3PH9A 3KTBA 4GSNA 2B6MA 4AGSA 2HSYA 3KGKA 1TU8A 5GAPD 4AJ8A 3ME7A 2X8HA 3O3TA 1Q4JA 2L57A 4IBPA 4MF5A 3KEBA 2F9SA 2VM2A 1RW1A 2JL4A 3H1NA 2MMOA 2J23A 1T4YA 3DMLA 4GQFA 1TTZA 1H75A 1IYIA 1FOHA 1FO5A 3IOSA 2WDUA 19GSA 2FY6A 1PA3A 4NXIA 3DWVA 1ERTA 2REMA 4BPYA 4Z2RA 5HQPA 4N30A 1JZDA 2GZPA 4FYCA 3GKXA 2IMEA 3F3QA 4K0GA 2GTUA 1M7TA 1A2JA 5ECIB 5IMFA 2OE1A 5IIZA 3MYDA 3LXZA 2IMIA 2FCHA 5IPHA 5AGYA 1URMA 3WT1A 1QQ2A 1E6BA 3TJBA 3F4RA 2H70A 5DBQA 4HS1A 4OCEA 1OC8A 1M9AA 3ZFLA 5AIVA 3M8NA 2I4AA 1Z6MA 3D21A 2N5BA 1TJDA 4RQRA 2RM5A 3I43A 4TR1A 2YZUA 4PQ1A 1AC1A 2H6XA 1K0AA 3U6VA 4ILFA 1WP0A 3A2WA 4MJBA 4EDYA 2MBSA 1F3AA 2P5RA 3QFBC 3TGZA 1GTAA 3AY8A 2ZUPA 1A24A 4IS0A 1M9BA 4OCFA 3WGDA 2FWGA 2DMLA 2DKHA 1Z6NA 2E0QA 2O85A 2ALBA 3HDCA 2WGRA 2H19A 4DSRA 1TOFA 5CRHA 5J41A 1QK8A 5ID2B 3I6AA 5ENUA 3H79A 2WB9A 3G7JA 3H8QA 2QA1A 4X43A 5IM9A 3UOMA 3QFAC 1TK5B 1XVQA 2TIRA 5F07A 2B7KA 5HR2A 2FWEA 2DSAA 2H74A 2VM1A 3QDNA 4ULXA 3W8SA 4O32A 1A0RP 2F51A 5A4VA 2VCTA 3ZVJA 1G0TA 4TXOA 4TOPA 3EYTA 1XIYA 1PMTA 5D9XA 2C1YA 3GN3A 4PTSA 2OJLA 3O6TA 2H1BA 4O5QA 3UIWA 1XWCA 2X4AA 1EP8A 4KSOA 4J57E 2IMKA 4K6XA 2LQOA 3WYWA 3CMIA 3F3RA 3HJMA 4ML6A 2IJYA 1A23A 2A2SA 1K0CA 3ZITA 4LA1A 1YF0A 3ZZXA 2L5LA 3UAPA 4Q5FA 1V9WA 5F06A 1GSDA 4ZB9A 2GSQA 1XWBA 4GRFA 4ZB8A 1E2YA 4HI7A 3DVXA 4YQUA 1KBNA 5C04A 2PWJA 2OADA 5HFIA 2ZNMA 2B3SA 3EURA 1FW1A 1XOBA 4HU7A 1ABAA 5ECHB 3IAM2 2PMTA 3IXRA 4G19A 5J3RA 1FOVA 4YH2A 4DEJA 1EZKA 3BOAA 4ZBAA 3TJFA 3ERWA 2Z9SA 2DJJA 2A4VA 3ERGA 3GMFA 2KP2A 1NW2A 3D0ZA 3IR4A 2LRCA 5JWQB 6GSYA 2L59A 4N10A 1EOHA 4MZWA 2WCIA 4Q5QA 5D73A 1SD8A 4PNGA 2JU5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P7X A;  1ZL9 A;  3CBU A;  3KJY A;  1O81 A;  1S3A A;  5ECS A;  2GS3 A;  4DSS B;  2GVP A;  2KUC A;  2HFD A;  3NOF A;  2H1D A;  3LSZ A;  1GLQ A;  3M9J A;  1XW9 A;  5CRD A;  4Q5R A;  1B9X C;  3UL3 A;  3P8W A;  4K8M A;  1K0O A;  4P3Y B;  3VWV A;  4NAX A;  4XRD A;  2KLX A;  2P31 A;  5G30 A;  4OFN A;  3UVH A;  2F3M A;  3VLN A;  1ILO A;  2H71 A;  3KH9 A;  2I9H A;  1EGR A;  2R5G A;  3D6I A;  3PIN A;  1U3A A;  1HNB A;  2VD1 A;  1GH2 A;  5EL8 A;  2P5Q A;  5AN1 A;  4K0N A;  4YQV A;  1O73 A;  1PX7 A;  4IQA A;  4ZIL A;  1SL0 B;  4OFM A;  2WJU A;  1GTB A;  5EVO A;  4PUR A;  2O8V B;  4L5O A;  2RII A;  3FZ9 A;  4MJA A;  4D73 B;  2C4J A;  4EF0 A;  1ZZY A;  1GP1 A;  5IMD A;  1XBS A;  2VCX A;  3H93 A;  3TKQ A;  2RUE A;  5COH A;  5D96 A;  2B1L A;  4O7H A;  5CAX A;  4TKY A;  4F0B A;  2E2M A;  1X9M B;  4KDU A;  2XPE A;  3CSI A;  3TKS C;  5CRG A;  1ZMA A;  1UVZ A;  1U3I A;  2IMD A;  1XW5 A;  5D93 A;  4V1A p;  2GST A;  2FHE A;  1G7E A;  1GNE A;  3TJG A;  2OE3 A;  3A3T A;  5INY A;  1F2E A;  3E0U A;  3EIN A;  3UBL A;  1AQV A;  2D2Z A;  3EU4 A;  3HKR A;  2R3X A;  3EWL A;  1WMJ A;  3HA9 A;  1FB6 A;  1X5C A;  4GQC A;  3C8E A;  3R2Q A;  5E4W A;  2B5E A;  4GXZ A;  3ISO A;  1I9D A;  2E2G A;  2YV7 A;  2G0F A;  3LJR A;  3GUS A;  1R4W A;  3VWW A;  4E8E A;  1R7H A;  6GSX A;  2C3N A;  2N5F A;  2YWI A;  2GZY A;  2YNX A;  3KP8 A;  4WF5 A;  3C73 A;  4GCI A;  3UBK A;  2VL2 C;  1Z7R A;  4ZBB A;  1YZX A;  3DGQ A;  4AF2 A;  3KMN A;  4MMM A;  1X5D A;  5HFG A;  11GS A;  5AIS A;  3TCO A;  1I5G A;  4F2I A;  3FEU A;  2GSS A;  1DBY A;  5B6M A;  5IQY A;  4NHZ A;  1DE1 A;  1R5A A;  1WRY A;  2YCD A;  1KTE A;  2GZZ A;  1X9W B;  2CX4 A;  3HD5 A;  1UC7 A;  4XS4 B;  1WE0 A;  3A5W A;  1BX9 A;  4I2T A;  3TDG A;  5DVB A;  3HCZ A;  5IPG A;  4OO4 A;  2HT9 A;  3LOR A;  4ECC A;  3F4S A;  4I8B A;  1G6Y A;  1QGV A;  2HRN A;  5ECQ B;  3EMX A;  2BJX A;  2WUL A;  1DSB A;  3ZML A;  5JCG A;  3L0H A;  1O7U A;  1U88 A;  3IK7 A;  3IRA A;  1F6M C;  3C71 A;  2IIY A;  2L6D A;  3HJO A;  1FVJ A;  1MEK A;  5H5S A;  5LCZ A;  3KD0 A;  5GAN D;  2C80 A;  3RDW A;  1TK0 B;  4WR5 A;  1XWK A;  4F03 A;  5D9T A;  5G2Z A;  3ZVJ D;  3GNJ A;  1T1V A;  2PVQ A;  2K8V A;  2CQ9 A;  2H0H A;  4IEL A;  2CVB A;  3HY2 A;  2HNL A;  2K18 A;  3KZQ A;  2IMF A;  4WBJ A;  3L9U A;  4MDC A;  3TRX A;  4HZ4 A;  3HHV A;  3QR6 A;  4XS1 A;  4LLR A;  2J9H A;  4ECJ A;  3D4M A;  3QAW A;  2FWH A;  1AXD A;  5ID2 A;  1V2A A;  3E3E A;  4JE1 A;  4N0V A;  1K3O A;  1NHO A;  1CQH A;  4IW9 A;  1JZR A;  3CYN A;  1LBK A;  2TRX A;  1HQO A;  3DKS A;  4IVF A;  5GZZ B;  2YWO A;  4KCA A;  4FYB A;  4WET A;  2NPB A;  5DJM A;  3F4T A;  2B7J A;  2VLT A;  2PUK C;  3APO A;  4KND A;  1EGO A;  3Q19 A;  2HZF A;  3GKK A;  1A8L A;  4JR4 A;  4HOJ A;  2VAF A;  5CRE A;  10GS A;  1TRV A;  2YN1 A;  4ISD A;  1HD2 A;  3DYR A;  2C3T A;  3FYG A;  5CYY A;  1TP9 A;  2R6K A;  3PGT A;  5JWR B;  4PUF C;  2K9F A;  1ZYE A;  4OMV A;  3D22 A;  1AQX A;  3LYP A;  1V57 A;  4QL7 A;  3GX0 A;  2CAI A;  3TJK A;  4PGT A;  5A4U A;  4WEY A;  2XBQ A;  5LNK e;  3TRP A;  4TXV A;  4TVE A;  1TRW A;  1WPI A;  4IGJ A;  2IWT A;  2LEG A;  3M3M A;  3RAZ A;  3QMX A;  1K0N A;  1EEM A;  2AAW A;  2O89 A;  2L4Q A;  4EKZ A;  3CSH A;  2DJ2 A;  5HR3 A;  3LQ7 A;  3A2X A;  2DC5 A;  1YEX A;  2WS2 A;  2PER A;  1TRS A;  2XBI A;  4IJI A;  5F8B A;  3ED3 A;  4G9H A;  2DMM A;  5JWO B;  3GV1 A;  2N5A A;  3FY7 A;  1SYR A;  4PX1 A;  17GS A;  1SKW B;  4RUV A;  5FT3 A;  5KN3 A;  5DQY A;  1TRU A;  4MPF A;  5J9C A;  4F9Z A;  1ZGN A;  2VL3 A;  4ECI A;  3VWX A;  2VLU A;  4K7I A;  1MDJ A;  3GUR A;  2FD3 A;  1ST9 A;  1EP7 A;  3APS A;  3DEX A;  4DSS A;  5DCH A;  2JZT A;  1AUC A;  2H6Y A;  1Z3E A;  1Y25 A;  3N9J A;  2YOI A;  1J0F A;  1BED A;  1ZOF A;  1TK8 B;  22GS A;  2CA8 A;  1K0M A;  4MP4 A;  3VPQ A;  2GT6 A;  2FLS A;  4KGI A;  4N11 A;  5CRW A;  2PU9 C;  2LQQ A;  3G9B A;  3DRN A;  2CZ2 A;  3TB2 A;  1O8W A;  1PN9 A;  3VUR A;  4E8H A;  1YF1 A;  5IO2 A;  4JR6 A;  3KTL A;  4FYU A;  2HE3 A;  1FG4 A;  2B5X A;  5KN0 A;  1S3D A;  4ML1 A;  8GSS A;  2FGX A;  1MTC A;  1GNW A;  3ZTL A;  1N2A A;  1MDK A;  1DE2 A;  3HVS A;  3M9K A;  3OR5 A;  2NTO A;  4KCE A;  4EXJ A;  2H75 A;  3IC4 A;  3C7M A;  4X0X A;  3IDV A;  1AAZ A;  2H6Z A;  5H5R A;  1BYE A;  1KEB A;  3ZIV A;  4CHS A;  2WZ9 A;  3NZN A;  2B1K A;  5J9B A;  4PQH A;  2AV4 A;  2OE0 A;  1PSQ A;  1T8E B;  3QPM A;  3WGE A;  4ZIJ A;  3U5R E;  4ECB A;  2H0G A;  4KUN A;  1ERV A;  2FA8 A;  2YJH A;  3TKR A;  4EUY A;  5JCW A;  4BA7 A;  1Z9H A;  4CW9 A;  3S9F A;  2R2J A;  2KHP A;  3ZFB A;  4Z7X A;  2CVD A;  1R5P A;  4RQX A;  3VWU A;  4HJM A;  5B6N A;  4IHU A;  2LUS A;  2LKU A;  5ECR B;  3LFL A;  4G2E A;  1K3Y A;  1RK4 A;  5IMZ A;  1TXX A;  1FVK A;  2V6K A;  1OAZ A;  4TXO B;  2I1U A;  4MPG A;  5J4U A;  3HZ4 A;  4GWR A;  3HYP A;  4POM A;  1SK2 A;  4IP1 A;  3HJP A;  1ZYQ B;  1SK1 A;  3KXO A;  3MWH A;  1OC9 A;  1QMV A;  3F8U A;  3EU3 A;  3IHQ A;  4GST A;  1GSE A;  1SEN A;  2EIQ A;  4KW6 A;  2YJ7 A;  1B4P A;  3FRC A;  3FW2 A;  2C0E A;  4EC0 A;  2O7K A;  1TKD B;  1SJZ A;  4JBB A;  1JFU A;  2ES7 A;  3WGX A;  2GT5 A;  5IMA A;  2P0G A;  1M0U A;  1A2L A;  1OKT A;  5B7C A;  1JZW A;  2VLV A;  3E9J B;  1YKA A;  1SL2 B;  2JZR A;  4TN8 A;  3VPT A;  4XS4 A;  4PNF A;  3EC3 A;  3EMP A;  4PQI A;  5D9W A;  4MH3 A;  1YDK A;  4NV5 A;  5ECN B;  3RHC A;  4WBR D;  3CTF A;  1VRS D;  3ZIJ A;  3ZMK A;  3FZA A;  2VUP A;  6GSS A;  3LWA A;  2LJR A;  3KM6 A;  2V32 A;  2WRT A;  4K7N A;  5GSS A;  3M0F A;  1F37 A;  2C0F A;  2X8C A;  2MMN A;  5ABR A;  4KX4 A;  1MD3 A;  2QGV A;  2AHE A;  1B8X A;  4I2U A;  1PRX A;  4IQ1 A;  3VI5 A;  1QUW A;  4IKH A;  2H66 A;  4Q5N A;  5DQS A;  1GSF A;  3HZ8 A;  3FR6 A;  4N0Z A;  2PGT A;  1TW9 A;  4O92 A;  2VL9 A;  4BL7 A;  1PGT A;  2ON5 A;  2ZCT A;  4XCS A;  5ELA A;  2HZE B;  1EV4 A;  1V40 A;  2AUV A;  2H30 A;  3GFK A;  1JLV A;  3G7Y A;  1R26 A;  2V41 A;  5IMC A;  18GS A;  3FHK A;  5DAK B;  4MZB A;  1ERW A;  2NVL A;  3GH6 A;  5L71 A;  2VL2 A;  1GL8 A;  3IPZ A;  3L9S A;  5DCG A;  4K7O A;  1FB0 A;  3GKM A;  1G7O A;  3QD9 A;  2DJ1 A;  3GST A;  4GF0 A;  4JED A;  4MLY A;  4I97 A;  3BCK A;  1T00 A;  2H01 A;  3RPN A;  2EIO A;  2VCZ A;  4YAV A;  4MAB A;  4MF6 A;  4ZL7 A;  5KEJ A;  4G10 A;  4ZBD A;  1BQ7 A;  1NM3 A;  5IMV A;  4KSM A;  3I9V 2;  1SKR B;  4TR0 A;  1T7P B;  2JAC A;  3TKS E;  5IOW A;  3RPP A;  1OE7 A;  4L5L A;  1TDI A;  4HQZ A;  3K8N A;  2R4V A;  2IFQ B;  4IP6 A;  1NHY A;  5F0G A;  1PL1 A;  4POB A;  4F82 A;  2VIM A;  2OAC A;  1A0F A;  1PD2 1;  4ZL9 A;  1K0B A;  3ZL5 A;  3TKP A;  2L6C A;  4QL9 A;  1HNC A;  3TJJ A;  1SK0 A;  4BWQ A;  2LJA A;  4WF4 A;  3M1G A;  3C1R A;  4YQM A;  2OBI A;  2YV9 A;  1GSY A;  3FR9 A;  3IBH A;  2FWF A;  2E7P A;  4HEA 2;  5KN2 A;  1T3B A;  5IOX A;  4AJ7 A;  2LJK A;  1PKW A;  2JZS A;  1CQG A;  1F9M A;  3P2A A;  2GQK A;  2LRN A;  4HZ2 A;  1MDI A;  4IJ3 A;  12GS A;  1QXH A;  5B8B A;  1K3L A;  2TRC P;  3FK8 A;  5A4W A;  1YQ1 A;  3F9U A;  4V2L A;  1B4Q A;  1BAY A;  3ZYW A;  2YZH A;  2QKE A;  4MH2 A;  1KNG A;  2HYX A;  2LST A;  3TOT A;  1TI1 A;  2H73 A;  4OD7 A;  6GST A;  1M2B A;  3IAS 2;  3DIE A;  1YKC A;  1M2D A;  1FHE A;  6GSW A;  1XWA A;  3BD2 A;  5F05 A;  4ACS A;  3SWL A;  3CTG A;  5HR1 A;  4EL1 A;  2L5O A;  1THX A;  1X9S B;  3CXG A;  1XXU A;  1EOG A;  2DLX A;  3PR8 A;  1XPV A;  4BVY A;  4EDZ A;  5D8I A;  3BBY A;  1TI3 A;  4EO3 A;  3O76 A;  1THO A;  1YY7 A;  5DAL B;  4POL A;  3V1W A;  3ZLP A;  5A5K A;  4BWS A;  3Q74 A;  3MNG A;  2BMX A;  1GLP A;  1XOA A;  2FA4 A;  4J2F A;  2IL3 A;  4HU9 A;  1HYU A;  2NBS A;  2C3Q A;  1GUM A;  5DDL A;  3UMA A;  4DVC A;  3GTU B;  1SYX A;  2DIZ A;  2PBJ A;  1SJI A;  5CNW A;  5EPF A;  3LGC A;  1IYH A;  2DJ3 A;  3LG6 A;  1OE8 A;  3UJ1 A;  3P90 A;  2L4C A;  1GSQ A;  4I5Q A;  1M2A A;  2MMA A;  4NMU A;  5H5Q A;  1XW6 A;  4IN0 A;  1UN2 A;  1VF1 A;  2JAD A;  2F8A A;  1GUH A;  3DD3 A;  1WOU A;  2M46 A;  2H1A A;  3FKF A;  2GQL A;  1W4V A;  1RQM A;  1PL2 A;  2GDR A;  4MJE A;  3TOU A;  3ERF A;  2FUG 2;  2VO4 A;  3GRX A;  2HI7 A;  2K6V A;  1QFN A;  3UVT A;  3QOU A;  9GSS A;  3IK9 A;  4JRR A;  1X5E A;  3F6D A;  3TUE A;  2C0D A;  3BJ5 A;  2MMZ A;  3EE2 A;  2AB6 A;  4KAE A;  1ACV A;  1YEP A;  3HVX A;  3LYK A;  20GS A;  1T4Z A;  3HVV A;  3L78 A;  4LMV A;  5D9V A;  1GUL A;  2AYT A;  4WKW A;  2XC2 A;  1SKS B;  4PUA A;  1XCC A;  3IA1 A;  2YAN A;  5KN1 A;  2IN3 A;  2GLR A;  3GL5 A;  3QCP A;  3KMO A;  2IPA A;  3ME8 A;  4ZB6 A;  5CP1 A;  3BCI A;  1EEJ A;  4NPB A;  4TRX A;  5G5F A;  5HR0 A;  3VK9 A;  3G7I A;  3RHB A;  2M72 A;  5G1K A;  1O8X A;  3DVW A;  1SD9 A;  1C72 A;  5ECO B;  1XVW A;  1GSS A;  2GQM A;  4KB3 A;  1TU7 A;  1WIK A;  2CV4 A;  4KDX A;  3KP9 A;  1DUG A;  2VOC A;  3D5J A;  2CX3 A;  4V2N A;  2H1G A;  3A2V A;  2M80 A;  3IV4 A;  4YAP A;  1SJ6 A;  3GSS A;  4FO5 A;  4J56 E;  4TR1 B;  2HLS A;  4QQ7 A;  4D73 A;  1GTI A;  3KIJ A;  2RLI A;  1M99 A;  1V58 A;  4MF7 A;  4MJC A;  5HFK A;  4GSS A;  4TR4 A;  2I3Y A;  1A8Y A;  4XTS A;  3JCM L;  3MDK A;  2F8F A;  1G6W A;  4MK3 A;  1K0D A;  4AJ6 A;  4XS6 A;  2PVO C;  2VCQ A;  4F0C A;  4I6X A;  1SU9 A;  2JSY A;  2GSR A;  2YWN A;  2DJ0 A;  3VI7 A;  1B48 A;  2CT6 A;  3CRT A;  4OWY A;  4ZL8 A;  3GH9 A;  2RM6 A;  4V1A g;  4KDY A;  2MZC A;  5FHI A;  4EE0 A;  5FWG A;  3APQ A;  3US3 A;  4XHM A;  3GX8 A;  5G1L A;  4WR4 A;  2EC4 A;  6GSU A;  1J08 A;  2VCV A;  5C00 A;  4L8E A;  5ECP B;  2KP1 A;  16GS A;  1FAA A;  2X99 A;  3QAG A;  1UA5 A;  3ZRD A;  2C0G A;  1OC3 A;  2RUF A;  2HRF A;  4XRA A;  4OFT A;  2MBT A;  1GSU A;  4TW5 A;  4K9Z A;  2HZE A;  5DJL A;  3KH7 A;  4RI7 A;  1OVN A;  2YWM A;  5GST A;  2QSI A;  1JHB A;  3MSZ A;  3W6G A;  3L9V A;  3LXT A;  5DAK A;  4L0U A;  1JZO A;  2LTK A;  4OO5 A;  5ECK B;  5LD0 A;  2H72 A;  14GS A;  4HDE A;  3TRQ A;  3F63 A;  4CDO A;  2LV3 A;  4KA0 A;  3F6F A;  5B8A A;  2B5Y A;  4LMW A;  1O85 A;  2XHF A;  1A2M A;  2ON7 A;  2KOK A;  1J9B A;  2PPT A;  2OBK A;  2OA7 A;  1S3C A;  1B9Y C;  1O6J A;  3LEF A;  13GS A;  1PQN A;  1GWC A;  1NSW A;  2HSH A;  1WWJ A;  2DBC A;  3GL3 A;  1XZO A;  1U6T A;  2V1M A;  1USB A;  1AW9 A;  4X1U A;  3FR3 A;  1GTU A;  1Z7P A;  4LL1 B;  4KE3 A;  2IFQ A;  1GRX A;  3QAV A;  2LRT A;  2OKA A;  4H86 A;  2R37 A;  3TKS A;  4PXO A;  4JZQ A;  1AIU A;  2DJK A;  1OYJ A;  2X8G A;  5G31 A;  1Z5Y E;  4XIH A;  2H76 A;  1MD4 A;  3UAR A;  1XFL A;  3KCM A;  4RI6 A;  2HXK A;  5E59 A;  4TR3 A;  2CZ3 A;  3GIX A;  3H4K A;  4MA9 A;  4HQS A;  3NIV A;  1Y6E A;  4NV2 A;  4ID0 A;  2PN8 A;  4L0W A;  4EVM A;  1PX6 A;  2K8S A;  1W89 A;  1U87 A;  4ZXG A;  5J5N A;  1VF2 A;  3VFI A;  4MCU A;  2LNS A;  2C8U A;  4K1F A;  4K2D A;  1PKZ A;  1YJ6 A;  1X0R A;  3L4N A;  1OKD A;  1EWX A;  2FNO A;  3WD6 A;  1OC9 B;  5ECM B;  3HXS A;  1JLW A;  2GGT A;  3DXB A;  1N8J A;  3FZ4 A;  3GA4 A;  3Q6O A;  2VD0 A;  1ON4 A;  1VGL A;  2X64 A;  3W8J A;  4NHW A;  3CRU A;  3CSJ A;  2MYG A;  1BJX A;  2BTO T;  2JSZ A;  3ZRE A;  2V2G A;  2A2R A;  1ZCP A;  2EIR A;  1VF4 A;  2WFC A;  3MAK A;  3N5O A;  1HNA A;  4V2M A;  4MZC A;  3F0I A;  4NWY A;  4WXT A;  1ERU A;  3J7Y k;  3GHA A;  2QC7 A;  5CO3 A;  4POK A;  1H4O A;  1SL1 B;  3FZ5 A;  1XWG A;  4LL4 B;  7GSS A;  5EY6 A;  4KH7 A;  3C1S A;  1BG5 A;  2YP6 A;  2LNT A;  2XPD A;  4HUA A;  2CAQ A;  5DAL A;  1V98 A;  2AJQ B;  4FH8 A;  2LS5 A;  5G5E A;  2V6O A;  6GSV A;  4GTU A;  1GUK A;  1F3B A;  5IO0 A;  2DIY A;  1LJR A;  1AQW A;  5AIX A;  1VF3 A;  3Q18 A;  3GTU A;  2NDO A;  5ELG A;  4HJ2 A;  3D4T A;  3EVI A;  2CVK A;  4GLT A;  5JCU A;  3IE3 A;  2YPM A;  1ML6 A;  2G2Q A;  4BVX A;  4JU5 A;  2H0I A;  3SBC A;  3WT2 A;  3UEM A;  3GKN A;  2VCW A;  3I69 A;  4FIW A;  3GYK A;  4O5R A;  1WJK A;  5ECL B;  1EV9 A;  2H8L A;  3RBT A;  3J7Y b;  1Q98 A;  1LU4 A;  2O87 A;  2I81 A;  4DSQ A;  3PH9 A;  3KTB A;  4GSN A;  2B6M A;  4AGS A;  2HSY A;  3KGK A;  1TU8 A;  5GAP D;  4AJ8 A;  3ME7 A;  2X8H A;  3O3T A;  1Q4J A;  2L57 A;  4IBP A;  4MF5 A;  3KEB A;  2F9S A;  2VM2 A;  1RW1 A;  2JL4 A;  3H1N A;  2MMO A;  2J23 A;  1T4Y A;  3DML A;  4GQF A;  1TTZ A;  1H75 A;  1IYI A;  1FO5 A;  3IOS A;  2WDU A;  19GS A;  2FY6 A;  1PA3 A;  4NXI A;  3DWV A;  1ERT A;  2REM A;  4BPY A;  5HQP A;  4N30 A;  1JZD A;  2GZP A;  4FYC A;  3GKX A;  2IME A;  3F3Q A;  4K0G A;  2GTU A;  1M7T A;  1A2J A;  5ECI B;  5IMF A;  2OE1 A;  5IIZ A;  3LXZ A;  2IMI A;  2FCH A;  5IPH A;  5AGY A;  1URM A;  3WT1 A;  1QQ2 A;  1E6B A;  3TJB A;  3F4R A;  2H70 A;  5DBQ A;  4HS1 A;  4OCE A;  1OC8 A;  1M9A A;  3ZFL A;  5AIV A;  3M8N A;  2I4A A;  1Z6M A;  3D21 A;  2N5B A;  1TJD A;  4RQR A;  2RM5 A;  3I43 A;  4TR1 A;  2YZU A;  4PQ1 A;  1AC1 A;  2H6X A;  1K0A A;  3U6V A;  4ILF A;  1WP0 A;  3A2W A;  4MJB A;  4EDY A;  2MBS A;  1F3A A;  2P5R A;  3QFB C;  3TGZ A;  1GTA A;  3AY8 A;  2ZUP A;  1A24 A;  4IS0 A;  1M9B A;  4OCF A;  3WGD A;  2FWG A;  2DML A;  1Z6N A;  2E0Q A;  2O85 A;  2ALB A;  3HDC A;  2WGR A;  2H19 A;  4DSR A;  1TOF A;  5CRH A;  5J41 A;  1QK8 A;  5ID2 B;  3I6A A;  5ENU A;  3H79 A;  2WB9 A;  3G7J A;  3H8Q A;  4X43 A;  5IM9 A;  3UOM A;  3QFA C;  1TK5 B;  1XVQ A;  2TIR A;  5F07 A;  2B7K A;  5HR2 A;  2FWE A;  2DSA A;  2H74 A;  2VM1 A;  3QDN A;  4ULX A;  3W8S A;  4O32 A;  1A0R P;  2F51 A;  5A4V A;  2VCT A;  3ZVJ A;  1G0T A;  4TXO A;  4TOP A;  3EYT A;  1XIY A;  1PMT A;  5D9X A;  2C1Y A;  3GN3 A;  2OJL A;  3O6T A;  2H1B A;  3UIW A;  1XWC A;  1EP8 A;  4KSO A;  4J57 E;  2IMK A;  4K6X A;  2LQO A;  3WYW A;  3CMI A;  3F3R A;  3HJM A;  4ML6 A;  2IJY A;  1A23 A;  2A2S A;  1K0C A;  3ZIT A;  4LA1 A;  1YF0 A;  3ZZX A;  2L5L A;  3UAP A;  4Q5F A;  1V9W A;  5F06 A;  1GSD A;  4ZB9 A;  2GSQ A;  1XWB A;  4GRF A;  4ZB8 A;  1E2Y A;  4HI7 A;  3DVX A;  4YQU A;  1KBN A;  5C04 A;  2PWJ A;  2OAD A;  5HFI A;  2ZNM A;  2B3S A;  3EUR A;  1FW1 A;  1XOB A;  4HU7 A;  1ABA A;  5ECH B;  3IAM 2;  2PMT A;  3IXR A;  4G19 A;  5J3R A;  1FOV A;  4YH2 A;  4DEJ A;  1EZK A;  3BOA A;  4ZBA A;  3TJF A;  3ERW A;  2Z9S A;  2DJJ A;  2A4V A;  3ERG A;  3GMF A;  2KP2 A;  1NW2 A;  3D0Z A;  3IR4 A;  2LRC A;  5JWQ B;  6GSY A;  2L59 A;  4N10 A;  1EOH A;  4MZW A;  2WCI A;  4Q5Q A;  5D73 A;  1SD8 A;  4PNG A;  2JU5 A; 
#chains in the Genus database with same CATH topology
 3P7X A;  1ZL9 A;  3CBU A;  3KJY A;  1O81 A;  1S3A A;  5ECS A;  2GS3 A;  4DSS B;  2GVP A;  2KUC A;  2HFD A;  3NOF A;  2H1D A;  3LSZ A;  1GLQ A;  3M9J A;  1XW9 A;  5CRD A;  4Q5R A;  1B9X C;  3UL3 A;  3P8W A;  4K8M A;  1K0O A;  4P3Y B;  3VWV A;  4NAX A;  4XRD A;  2KLX A;  2P31 A;  5G30 A;  4OFN A;  3UVH A;  2F3M A;  3VLN A;  1ILO A;  2H71 A;  3KH9 A;  2I9H A;  1EGR A;  2R5G A;  3D6I A;  3PIN A;  1U3A A;  1HNB A;  2VD1 A;  1GH2 A;  5EL8 A;  2P5Q A;  5AN1 A;  4K0N A;  4YQV A;  1O73 A;  1PX7 A;  4IQA A;  4ZIL A;  1SL0 B;  4OFM A;  2WJU A;  1GTB A;  5EVO A;  4PUR A;  2O8V B;  4L5O A;  2RII A;  3FZ9 A;  4MJA A;  4D73 B;  2C4J A;  4EF0 A;  2HRA A;  1ZZY A;  1GP1 A;  5IMD A;  1XBS A;  2VCX A;  3H93 A;  3TKQ A;  2RUE A;  5COH A;  5D96 A;  2B1L A;  4O7H A;  5CAX A;  4TKY A;  4F0B A;  2E2M A;  1X9M B;  4KDU A;  2XPE A;  3CSI A;  3TKS C;  5CRG A;  1ZMA A;  1UVZ A;  1U3I A;  2IMD A;  1XW5 A;  5D93 A;  4V1A p;  2GST A;  2FHE A;  1G7E A;  1GNE A;  3TJG A;  2OE3 A;  3A3T A;  5INY A;  1F2E A;  3E0U A;  3EIN A;  3UBL A;  1AQV A;  2D2Z A;  3EU4 A;  4CY8 A;  2R0P A;  3HKR A;  2A4H A;  2R3X A;  3EWL A;  1WMJ A;  3HA9 A;  1FB6 A;  1X5C A;  4GQC A;  3C8E A;  3R2Q A;  5E4W A;  2B5E A;  4GXZ A;  3ISO A;  1I9D A;  2E2G A;  2YV7 A;  2G0F A;  3LJR A;  3GUS A;  1R4W A;  3VWW A;  4E8E A;  1R7H A;  6GSX A;  2C3N A;  2N5F A;  2YWI A;  2GZY A;  2YNX A;  3KP8 A;  4WF5 A;  3C73 A;  4GCI A;  3UBK A;  2VL2 C;  1Z7R A;  4ZBB A;  1YZX A;  3DGQ A;  4AF2 A;  3KMN A;  4MMM A;  1X5D A;  4K5S A;  5HFG A;  11GS A;  1ZYP A;  5AIS A;  3TCO A;  1I5G A;  4F2I A;  3FEU A;  2GSS A;  1DBY A;  5B6M A;  5IQY A;  4NHZ A;  1DE1 A;  1R5A A;  1WRY A;  2YCD A;  1KTE A;  2GZZ A;  1X9W B;  2CX4 A;  3HD5 A;  1UC7 A;  4XS4 B;  1WE0 A;  2A2P A;  3A5W A;  1BX9 A;  4I2T A;  3TDG A;  1PFO A;  5DVB A;  3HCZ A;  5IPG A;  4OO4 A;  2HT9 A;  3LOR A;  4ECC A;  3F4S A;  4Z2U A;  4I8B A;  1G6Y A;  1QGV A;  2HRN A;  5ECQ B;  3EMX A;  2BJX A;  2WUL A;  1DSB A;  3ZML A;  5JCG A;  3L0H A;  1O7U A;  1U88 A;  3IK7 A;  3IRA A;  1F6M C;  3C71 A;  2IIY A;  2L6D A;  3HJO A;  1FVJ A;  1MEK A;  5H5S A;  5LCZ A;  3KD0 A;  5GAN D;  2C80 A;  3RDW A;  1TK0 B;  4WR5 A;  1XWK A;  4F03 A;  5D9T A;  5G2Z A;  3ZVJ D;  3GNJ A;  1T1V A;  2PVQ A;  2K8V A;  2CQ9 A;  2H0H A;  4IEL A;  2CVB A;  3HY2 A;  2HNL A;  2K18 A;  3KZQ A;  2IMF A;  4WBJ A;  3L9U A;  4MDC A;  3TRX A;  4HZ4 A;  3HHV A;  3QR6 A;  4XS1 A;  4LLR A;  2J9H A;  4ECJ A;  3D4M A;  3QAW A;  2FWH A;  1AXD A;  5ID2 A;  1V2A A;  3E3E A;  4JE1 A;  4N0V A;  1K3O A;  1NHO A;  1CQH A;  4IW9 A;  5KOX A;  1JZR A;  3CYN A;  1LBK A;  2TRX A;  1HQO A;  3DKS A;  4IVF A;  5GZZ B;  2YWO A;  4KCA A;  4FYB A;  4WET A;  2NPB A;  5DJM A;  3F4T A;  2B7J A;  2VLT A;  2PUK C;  3APO A;  4KND A;  1EGO A;  3Q19 A;  2HZF A;  3GKK A;  1A8L A;  4JR4 A;  4HOJ A;  2VAF A;  5CRE A;  10GS A;  1TRV A;  2YN1 A;  4ISD A;  1HD2 A;  3DYR A;  2C3T A;  3FYG A;  5CYY A;  1TP9 A;  2R6K A;  3PGT A;  5JWR B;  4PUF C;  2K9F A;  1ZYE A;  4OMV A;  1S3R A;  3D22 A;  1AQX A;  3LYP A;  1V57 A;  4QL7 A;  3GX0 A;  2CAI A;  3TJK A;  4PGT A;  3LW9 A;  4YKG A;  5A4U A;  4WEY A;  2XBQ A;  5LNK e;  3TRP A;  4TXV A;  4TVE A;  1TRW A;  1WPI A;  4IGJ A;  2IWT A;  2LEG A;  3A5I A;  3M3M A;  3RAZ A;  3QMX A;  1K0N A;  1EEM A;  2AAW A;  2O89 A;  2L4Q A;  4EKZ A;  3CSH A;  2DJ2 A;  5HR3 A;  3LQ7 A;  3A2X A;  2DC5 A;  1YEX A;  2WS2 A;  4EIQ A;  2PER A;  1TRS A;  2XBI A;  4IJI A;  5F8B A;  3ED3 A;  4G9H A;  2DMM A;  5JWO B;  3GV1 A;  2N5A A;  3FY7 A;  1SYR A;  4PX1 A;  17GS A;  1SKW B;  4RUV A;  5FT3 A;  5KN3 A;  5DQY A;  1TRU A;  4MPF A;  5J9C A;  4F9Z A;  1ZGN A;  2VL3 A;  4ECI A;  3VWX A;  2VLU A;  4K7I A;  1MDJ A;  3GUR A;  2FD3 A;  1ST9 A;  1EP7 A;  3APS A;  3DEX A;  4DSS A;  5DCH A;  2JZT A;  1AUC A;  2H6Y A;  1Z3E A;  1Y25 A;  3N9J A;  2YOI A;  1J0F A;  1BED A;  1ZOF A;  1TK8 B;  22GS A;  2CA8 A;  4BVY B;  1K0M A;  4MP4 A;  3VPQ A;  2GT6 A;  2FLS A;  4KGI A;  4N11 A;  5CRW A;  2PU9 C;  2LQQ A;  3G9B A;  3DRN A;  2CZ2 A;  3TB2 A;  1O8W A;  1PN9 A;  3VUR A;  4E8H A;  1YF1 A;  5IO2 A;  4JR6 A;  3KTL A;  4FYU A;  2HE3 A;  1FG4 A;  2B5X A;  5KN0 A;  1S3D A;  4ML1 A;  8GSS A;  2FGX A;  1MTC A;  1GNW A;  3ZTL A;  1N2A A;  1MDK A;  1DE2 A;  2R0G A;  3HVS A;  3M9K A;  3OR5 A;  2NTO A;  4KCE A;  4EXJ A;  2H75 A;  3IC4 A;  3C7M A;  4X0X A;  3IDV A;  1AAZ A;  2H6Z A;  5H5R A;  1BYE A;  1KEB A;  3ZIV A;  4CHS A;  2WZ9 A;  3NZN A;  2B1K A;  5J9B A;  2X49 A;  4PQH A;  2AV4 A;  2OE0 A;  1PSQ A;  1T8E B;  3QPM A;  3WGE A;  4ZIJ A;  3U5R E;  4ECB A;  2H0G A;  4KUN A;  1ERV A;  2FA8 A;  2YJH A;  3TKR A;  4EUY A;  5JCW A;  4BA7 A;  1Z9H A;  4CW9 A;  3S9F A;  2R2J A;  2KHP A;  3ZFB A;  4MNN A;  4Z7X A;  2CVD A;  1R5P A;  4RQX A;  3VWU A;  4A5P A;  4HJM A;  5B6N A;  4IHU A;  2LUS A;  2LKU A;  5ECR B;  3LFL A;  4G2E A;  1K3Y A;  1RK4 A;  5IMZ A;  1TXX A;  1FVK A;  2V6K A;  1OAZ A;  4TXO B;  2I1U A;  4MPG A;  5J4U A;  3HZ4 A;  4GWR A;  3HYP A;  4POM A;  1SK2 A;  4IP1 A;  3HJP A;  1ZYQ B;  1SK1 A;  3KXO A;  3MWH A;  1OC9 A;  1QMV A;  3F8U A;  3EU3 A;  3IHQ A;  4GST A;  1GSE A;  1SEN A;  2EIQ A;  4KW6 A;  2YJ7 A;  1B4P A;  3FRC A;  3FW2 A;  2C0E A;  4EC0 A;  2O7K A;  1TKD B;  1SJZ A;  4JBB A;  1JFU A;  2ES7 A;  3WGX A;  2GT5 A;  5IMA A;  2P0G A;  1M0U A;  1A2L A;  1OKT A;  5B7C A;  1JZW A;  2VLV A;  3E9J B;  1YKA A;  1SL2 B;  2JZR A;  4TN8 A;  3VPT A;  4XS4 A;  4USS A;  4PNF A;  3EC3 A;  3EMP A;  4PQI A;  5D9W A;  4MH3 A;  1YDK A;  4NV5 A;  5ECN B;  3RHC A;  4WBR D;  3CTF A;  1VRS D;  3ZIJ A;  3ZMK A;  3FZA A;  2VUP A;  6GSS A;  3LWA A;  2LJR A;  3KM6 A;  2V32 A;  2WRT A;  4K7N A;  5GSS A;  3FMW A;  3M0F A;  1F37 A;  2C0F A;  2X8C A;  2MMN A;  5ABR A;  4KX4 A;  1MD3 A;  2QGV A;  2AHE A;  1B8X A;  4I2U A;  1PRX A;  4IQ1 A;  3VI5 A;  1QUW A;  4IKH A;  2H66 A;  4Q5N A;  5DQS A;  1GSF A;  3HZ8 A;  3FR6 A;  2QA2 A;  4N0Z A;  2PGT A;  1TW9 A;  3MIX A;  4O92 A;  2VL9 A;  4BL7 A;  1PGT A;  2ON5 A;  2ZCT A;  4XCS A;  5ELA A;  2HZE B;  1EV4 A;  1V40 A;  2AUV A;  2H30 A;  3GFK A;  1JLV A;  3G7Y A;  1R26 A;  2V41 A;  5IMC A;  18GS A;  3FHK A;  5DAK B;  4MZB A;  1ERW A;  2NVL A;  3GH6 A;  5L71 A;  2VL2 A;  1GL8 A;  3IPZ A;  3L9S A;  5DCG A;  4K7O A;  1FB0 A;  3GKM A;  1G7O A;  3QD9 A;  2DJ1 A;  3GST A;  4GF0 A;  4JED A;  4MLY A;  4I97 A;  3BCK A;  1T00 A;  2H01 A;  3RPN A;  2EIO A;  2VCZ A;  4YAV A;  4MAB A;  4MF6 A;  4ZL7 A;  5KEJ A;  4G10 A;  4ZBD A;  1BQ7 A;  1NM3 A;  5IMV A;  4KSM A;  3I9V 2;  1SKR B;  4TR0 A;  1T7P B;  2JAC A;  3TKS E;  5IOW A;  3RPP A;  1OE7 A;  4L5L A;  1TDI A;  4HQZ A;  3K8N A;  2R4V A;  2IFQ B;  5KOW A;  4IP6 A;  1NHY A;  5F0G A;  1PL1 A;  4POB A;  4Z2T A;  4F82 A;  2VIM A;  2OAC A;  1A0F A;  1PD2 1;  4ZL9 A;  1K0B A;  3ZL5 A;  3TKP A;  2L6C A;  4QL9 A;  1HNC A;  3TJJ A;  4CY6 A;  1SK0 A;  4BWQ A;  2LJA A;  4WF4 A;  3M1G A;  3C1R A;  4YQM A;  2OBI A;  2YV9 A;  1GSY A;  3FR9 A;  3IBH A;  2FWF A;  2E7P A;  4HEA 2;  4KF9 A;  5KN2 A;  1T3B A;  5IOX A;  4AJ7 A;  2LJK A;  1PKW A;  2JZS A;  2HRK A;  1CQG A;  1F9M A;  4O5U A;  3P2A A;  2GQK A;  2LRN A;  4HZ2 A;  1MDI A;  4IJ3 A;  12GS A;  1QXH A;  5B8B A;  1K3L A;  2TRC P;  3FK8 A;  5A4W A;  1YQ1 A;  3F9U A;  4V2L A;  1B4Q A;  1BAY A;  3ZYW A;  2YZH A;  2QKE A;  1PN0 A;  4MH2 A;  1KNG A;  2HYX A;  2LST A;  3TOT A;  1TI1 A;  2H73 A;  4OD7 A;  6GST A;  1M2B A;  3IAS 2;  3DIE A;  1YKC A;  1M2D A;  1FHE A;  6GSW A;  1XWA A;  3BD2 A;  5F05 A;  4ACS A;  3SWL A;  3CTG A;  5HR1 A;  4EL1 A;  2L5O A;  1THX A;  5BRT A;  1X9S B;  3CXG A;  1XXU A;  1EOG A;  2DLX A;  3PR8 A;  1XPV A;  4BVY A;  4EDZ A;  5D8I A;  3BBY A;  1TI3 A;  4EO3 A;  3O76 A;  1THO A;  1YY7 A;  5DAL B;  4POL A;  3V1W A;  3ZLP A;  5A5K A;  4BWS A;  3Q74 A;  3MNG A;  2BMX A;  1GLP A;  1XOA A;  2FA4 A;  4J2F A;  2IL3 A;  4HU9 A;  1HYU A;  2NBS A;  2C3Q A;  1GUM A;  5DDL A;  3UMA A;  4DVC A;  3GTU B;  1SYX A;  3R3E A;  2DIZ A;  2PBJ A;  1SJI A;  5CNW A;  5EPF A;  3LGC A;  1IYH A;  2DJ3 A;  3LG6 A;  1OE8 A;  3UJ1 A;  3P90 A;  4BVX B;  5BMU A;  2L4C A;  1GSQ A;  4I5Q A;  1M2A A;  2MMA A;  4NMU A;  5H5Q A;  1XW6 A;  4IN0 A;  1UN2 A;  1VF1 A;  2JAD A;  2F8A A;  1GUH A;  3DD3 A;  1WOU A;  2M46 A;  2H1A A;  3FKF A;  2GQL A;  1W4V A;  1RQM A;  1PL2 A;  2GDR A;  4MJE A;  3TOU A;  3ERF A;  2FUG 2;  2VO4 A;  3GRX A;  2HI7 A;  4ICY A;  2K6V A;  1QFN A;  3UVT A;  3QOU A;  9GSS A;  3IK9 A;  4JRR A;  3CQF A;  1X5E A;  3F6D A;  3TUE A;  2C0D A;  3BJ5 A;  2MMZ A;  3EE2 A;  2AB6 A;  4KAE A;  1ACV A;  1YEP A;  3HVX A;  3LYK A;  20GS A;  1T4Z A;  3HVV A;  3L78 A;  4LMV A;  5D9V A;  1GUL A;  2AYT A;  4WKW A;  2XC2 A;  2R0C A;  3IC8 A;  4PUA A;  1SKS B;  1XCC A;  3IA1 A;  2YAN A;  5KN1 A;  2IN3 A;  2GLR A;  3GL5 A;  3QCP A;  3KMO A;  2IPA A;  3ME8 A;  4ZB6 A;  5CP1 A;  3BCI A;  1EEJ A;  4NPB A;  4TRX A;  5G5F A;  5HR0 A;  3VK9 A;  3G7I A;  3RHB A;  2M72 A;  5G1K A;  1O8X A;  3DVW A;  1SD9 A;  1C72 A;  5ECO B;  1XVW A;  1GSS A;  2GQM A;  4KB3 A;  1TU7 A;  1WIK A;  2CV4 A;  4KDX A;  3KP9 A;  1DUG A;  2VOC A;  3D5J A;  2CX3 A;  4V2N A;  2H1G A;  3A2V A;  2M80 A;  3IV4 A;  4YAP A;  1SJ6 A;  3GSS A;  4FO5 A;  4J56 E;  4TR1 B;  2HLS A;  4QQ7 A;  4D73 A;  1GTI A;  3KIJ A;  2RLI A;  1M99 A;  1V58 A;  4MF7 A;  4MJC A;  5HFK A;  4GSS A;  4TR4 A;  2I3Y A;  1A8Y A;  4XTS A;  3JCM L;  3MDK A;  2F8F A;  4K2X A;  1G6W A;  4MK3 A;  1K0D A;  4AJ6 A;  4XS6 A;  2PVO C;  2VCQ A;  4F0C A;  4I6X A;  1SU9 A;  2JSY A;  2GSR A;  2YWN A;  2DJ0 A;  3VI7 A;  1B48 A;  2CT6 A;  3CRT A;  4OWY A;  4ZL8 A;  3GH9 A;  2RM6 A;  4V1A g;  4KDY A;  2MZC A;  5FHI A;  4EE0 A;  5FWG A;  3APQ A;  3US3 A;  4XHM A;  3GX8 A;  5G1L A;  4G0L A;  4WR4 A;  2EC4 A;  6GSU A;  1J08 A;  2VCV A;  5C00 A;  4L8E A;  5ECP B;  2KP1 A;  16GS A;  1FAA A;  4FQU A;  2X99 A;  3QAG A;  1UA5 A;  3ZRD A;  2C0G A;  1OC3 A;  2RUF A;  2HRF A;  4G0I A;  4XRA A;  4OFT A;  2MBT A;  1GSU A;  4TW5 A;  4K9Z A;  2HZE A;  5DJL A;  3IHG A;  3KH7 A;  4RI7 A;  4EIP A;  1OVN A;  2YWM A;  5GST A;  2QSI A;  1JHB A;  3MSZ A;  3W6G A;  3L9V A;  3LXT A;  5DAK A;  4L0U A;  1JZO A;  2LTK A;  4OO5 A;  5ECK B;  5LD0 A;  2H72 A;  14GS A;  4HDE A;  3TRQ A;  3F63 A;  4CDO A;  2LV3 A;  4KA0 A;  3F6F A;  5B8A A;  2B5Y A;  4LMW A;  1O85 A;  2XHF A;  1A2M A;  2ON7 A;  2KOK A;  1J9B A;  2PPT A;  2OBK A;  2OA7 A;  1S3C A;  1B9Y C;  1O6J A;  3LEF A;  1ZYN A;  13GS A;  1PQN A;  1GWC A;  1NSW A;  2HSH A;  1WWJ A;  2DBC A;  3GL3 A;  1XZO A;  1U6T A;  3PPU A;  2V1M A;  1USB A;  1AW9 A;  4X1U A;  3FR3 A;  1GTU A;  1Z7P A;  4LL1 B;  4KE3 A;  2IFQ A;  1GRX A;  3QAV A;  2LRT A;  2OKA A;  4H86 A;  2R37 A;  3TKS A;  4PXO A;  4JZQ A;  1AIU A;  2DJK A;  1OYJ A;  2X8G A;  5G31 A;  1Z5Y E;  4XIH A;  2H76 A;  4HSC X;  1MD4 A;  3UAR A;  1XFL A;  3KCM A;  4RI6 A;  2HXK A;  5E59 A;  4TR3 A;  2CZ3 A;  3GIX A;  3H4K A;  4MA9 A;  4HQS A;  3NIV A;  1Y6E A;  4NV2 A;  4ID0 A;  2PN8 A;  4K5R A;  4L0W A;  4EVM A;  1PX6 A;  2K8S A;  1W89 A;  1U87 A;  4ZXG A;  5J5N A;  1VF2 A;  3VFI A;  4MCU A;  2LNS A;  2C8U A;  4K1F A;  4K2D A;  1PKZ A;  1YJ6 A;  1X0R A;  3L4N A;  1OKD A;  1EWX A;  2FNO A;  3WD6 A;  1OC9 B;  5ECM B;  3HXS A;  1JLW A;  2GGT A;  3DXB A;  1N8J A;  3FZ4 A;  2UZ8 A;  3GA4 A;  3Q6O A;  2VD0 A;  1ON4 A;  1VGL A;  2X64 A;  3W8J A;  4NHW A;  3CRU A;  3CSJ A;  2MYG A;  1BJX A;  2BTO T;  2JSZ A;  3ZRE A;  2V2G A;  2A2R A;  1ZCP A;  2EIR A;  1VF4 A;  2WFC A;  3MAK A;  3N5O A;  1HNA A;  4V2M A;  4MZC A;  3F0I A;  4NWY A;  4WXT A;  1ERU A;  3J7Y k;  2HSM A;  3GHA A;  2QC7 A;  5CO3 A;  4POK A;  1H4O A;  1SL1 B;  3FZ5 A;  1XWG A;  4G0K A;  4LL4 B;  7GSS A;  5EY6 A;  4KH7 A;  3C1S A;  1BG5 A;  2YP6 A;  2LNT A;  2XPD A;  4HUA A;  2CAQ A;  5DAL A;  1V98 A;  2AJQ B;  4FH8 A;  2LS5 A;  5G5E A;  2V6O A;  6GSV A;  4GTU A;  1GUK A;  1F3B A;  5IO0 A;  2DIY A;  1LJR A;  1AQW A;  5AIX A;  1VF3 A;  3Q18 A;  3GTU A;  4X4J A;  2NDO A;  5ELG A;  4HJ2 A;  3D4T A;  3EVI A;  2CVK A;  4GLT A;  5JCU A;  2DKI A;  3IE3 A;  2YPM A;  1ML6 A;  2G2Q A;  4BVX A;  4JU5 A;  4YKF A;  2H0I A;  3SBC A;  3WT2 A;  3UEM A;  3GKN A;  2VCW A;  3I69 A;  1M3I A;  4FIW A;  3GYK A;  4O5R A;  4BL7 B;  1WJK A;  5ECL B;  1EV9 A;  3EPT A;  2H8L A;  3RBT A;  3J7Y b;  1Q98 A;  1LU4 A;  2O87 A;  2I81 A;  4DSQ A;  3PH9 A;  3KTB A;  4GSN A;  2B6M A;  4AGS A;  3HVN A;  2HSY A;  3KGK A;  1TU8 A;  5GAP D;  4AJ8 A;  3ME7 A;  2X8H A;  3O3T A;  1Q4J A;  2L57 A;  4IBP A;  4MF5 A;  3KEB A;  2F9S A;  2VM2 A;  1RW1 A;  2JL4 A;  3H1N A;  2MMO A;  2J23 A;  1T4Y A;  3DML A;  4GQF A;  1TTZ A;  1H75 A;  1IYI A;  1FOH A;  1FO5 A;  3IOS A;  2WDU A;  19GS A;  2FY6 A;  1PA3 A;  4NXI A;  3DWV A;  1ERT A;  2REM A;  4BPY A;  4Z2R A;  5HQP A;  4N30 A;  1JZD A;  2GZP A;  4FYC A;  3GKX A;  2IME A;  3F3Q A;  4K0G A;  2GTU A;  1M7T A;  1A2J A;  5ECI B;  5IMF A;  2OE1 A;  5IIZ A;  3MYD A;  3LXZ A;  2IMI A;  2FCH A;  5IPH A;  5AGY A;  1URM A;  3WT1 A;  1QQ2 A;  1E6B A;  3TJB A;  3F4R A;  2H70 A;  5DBQ A;  1XG8 A;  4HS1 A;  4OCE A;  1OC8 A;  1M9A A;  3ZFL A;  5AIV A;  3M8N A;  2I4A A;  1Z6M A;  3D21 A;  2N5B A;  1TJD A;  4RQR A;  2RM5 A;  3I43 A;  4TR1 A;  2YZU A;  4PQ1 A;  1AC1 A;  2H6X A;  1K0A A;  3U6V A;  4ILF A;  1WP0 A;  3A2W A;  4MJB A;  4EDY A;  2MBS A;  1F3A A;  2P5R A;  3QFB C;  3TGZ A;  1GTA A;  3AY8 A;  2ZUP A;  1A24 A;  4IS0 A;  1M9B A;  4OCF A;  3WGD A;  2FWG A;  2DML A;  2DKH A;  1Z6N A;  2E0Q A;  2O85 A;  2ALB A;  3HDC A;  2WGR A;  2H19 A;  4DSR A;  1TOF A;  5CRH A;  5J41 A;  1QK8 A;  5ID2 B;  3I6A A;  5ENU A;  3H79 A;  2WB9 A;  3G7J A;  3H8Q A;  2QA1 A;  4X43 A;  5IM9 A;  3UOM A;  3QFA C;  1TK5 B;  1XVQ A;  2TIR A;  5F07 A;  2B7K A;  5HR2 A;  2FWE A;  2DSA A;  2H74 A;  2VM1 A;  3QDN A;  4ULX A;  3W8S A;  4O32 A;  1A0R P;  2F51 A;  5A4V A;  2VCT A;  3ZVJ A;  1M3J A;  1G0T A;  4TXO A;  4TOP A;  3EYT A;  1XIY A;  1PMT A;  5D9X A;  2C1Y A;  3GN3 A;  4PTS A;  2OJL A;  3O6T A;  2H1B A;  4BIK A;  4O5Q A;  3UIW A;  1XWC A;  2X4A A;  1EP8 A;  4KSO A;  4J57 E;  2IMK A;  4K6X A;  2LQO A;  3WYW A;  3CMI A;  3F3R A;  3HJM A;  4ML6 A;  2IJY A;  1A23 A;  2A2S A;  1K0C A;  3ZIT A;  4LA1 A;  1YF0 A;  3ZZX A;  2L5L A;  3UAP A;  4Q5F A;  1V9W A;  5F06 A;  1GSD A;  4ZB9 A;  2GSQ A;  1XWB A;  4GRF A;  4ZB8 A;  1E2Y A;  4HI7 A;  3DVX A;  4YQU A;  1KBN A;  5C04 A;  2PWJ A;  2OAD A;  5HFI A;  2ZNM A;  2B3S A;  3EUR A;  1FW1 A;  1XOB A;  4HU7 A;  1ABA A;  5ECH B;  3IAM 2;  2PMT A;  3IXR A;  4G19 A;  5J3R A;  1FOV A;  4YH2 A;  4DEJ A;  1EZK A;  3BOA A;  4ZBA A;  3TJF A;  3ERW A;  2Z9S A;  2DJJ A;  2A4V A;  3ERG A;  3GMF A;  2KP2 A;  1NW2 A;  3D0Z A;  3IR4 A;  2LRC A;  5JWQ B;  6GSY A;  2L59 A;  4N10 A;  1EOH A;  4MZW A;  2WCI A;  4Q5Q A;  5D73 A;  1SD8 A;  4PNG A;  2JU5 A; 
#chains in the Genus database with same CATH homology
 3P7X A;  1ZL9 A;  3CBU A;  3KJY A;  1O81 A;  1S3A A;  5ECS A;  2GS3 A;  4DSS B;  2GVP A;  2KUC A;  2HFD A;  3NOF A;  2H1D A;  3LSZ A;  1GLQ A;  3M9J A;  1XW9 A;  5CRD A;  4Q5R A;  1B9X C;  3UL3 A;  3P8W A;  4K8M A;  1K0O A;  4P3Y B;  3VWV A;  4NAX A;  4XRD A;  2KLX A;  2P31 A;  5G30 A;  4OFN A;  3UVH A;  2F3M A;  3VLN A;  1ILO A;  2H71 A;  3KH9 A;  2I9H A;  1EGR A;  2R5G A;  3D6I A;  3PIN A;  1U3A A;  1HNB A;  2VD1 A;  1GH2 A;  5EL8 A;  2P5Q A;  5AN1 A;  4K0N A;  4YQV A;  1O73 A;  1PX7 A;  4IQA A;  4ZIL A;  1SL0 B;  4OFM A;  2WJU A;  1GTB A;  5EVO A;  4PUR A;  2O8V B;  4L5O A;  2RII A;  3FZ9 A;  4MJA A;  4D73 B;  2C4J A;  4EF0 A;  2HRA A;  1ZZY A;  1GP1 A;  5IMD A;  1XBS A;  2VCX A;  3H93 A;  3TKQ A;  2RUE A;  5COH A;  5D96 A;  2B1L A;  4O7H A;  5CAX A;  4TKY A;  4F0B A;  2E2M A;  1X9M B;  4KDU A;  2XPE A;  3CSI A;  3TKS C;  5CRG A;  1ZMA A;  1UVZ A;  1U3I A;  2IMD A;  1XW5 A;  5D93 A;  4V1A p;  2GST A;  2FHE A;  1G7E A;  1GNE A;  3TJG A;  2OE3 A;  3A3T A;  5INY A;  1F2E A;  3E0U A;  3EIN A;  3UBL A;  1AQV A;  2D2Z A;  3EU4 A;  4CY8 A;  2R0P A;  3HKR A;  2A4H A;  2R3X A;  3EWL A;  1WMJ A;  3HA9 A;  1FB6 A;  1X5C A;  4GQC A;  3C8E A;  3R2Q A;  5E4W A;  2B5E A;  4GXZ A;  3ISO A;  1I9D A;  2E2G A;  2YV7 A;  2G0F A;  3LJR A;  3GUS A;  1R4W A;  3VWW A;  4E8E A;  1R7H A;  6GSX A;  2C3N A;  2N5F A;  2YWI A;  2GZY A;  2YNX A;  3KP8 A;  4WF5 A;  3C73 A;  4GCI A;  3UBK A;  2VL2 C;  1Z7R A;  4ZBB A;  1YZX A;  3DGQ A;  4AF2 A;  3KMN A;  4MMM A;  1X5D A;  4K5S A;  5HFG A;  11GS A;  1ZYP A;  5AIS A;  3TCO A;  1I5G A;  4F2I A;  3FEU A;  2GSS A;  1DBY A;  5B6M A;  5IQY A;  4NHZ A;  1DE1 A;  1R5A A;  1WRY A;  2YCD A;  1KTE A;  2GZZ A;  1X9W B;  2CX4 A;  3HD5 A;  1UC7 A;  4XS4 B;  1WE0 A;  2A2P A;  3A5W A;  1BX9 A;  4I2T A;  3TDG A;  5DVB A;  3HCZ A;  5IPG A;  4OO4 A;  2HT9 A;  3LOR A;  4ECC A;  3F4S A;  4Z2U A;  4I8B A;  1G6Y A;  1QGV A;  2HRN A;  5ECQ B;  3EMX A;  2BJX A;  2WUL A;  1DSB A;  3ZML A;  5JCG A;  3L0H A;  1O7U A;  1U88 A;  3IK7 A;  3IRA A;  1F6M C;  3C71 A;  2IIY A;  2L6D A;  3HJO A;  1FVJ A;  1MEK A;  5H5S A;  5LCZ A;  3KD0 A;  5GAN D;  2C80 A;  3RDW A;  1TK0 B;  4WR5 A;  1XWK A;  4F03 A;  5D9T A;  5G2Z A;  3ZVJ D;  3GNJ A;  1T1V A;  2PVQ A;  2K8V A;  2CQ9 A;  2H0H A;  4IEL A;  2CVB A;  3HY2 A;  2HNL A;  2K18 A;  3KZQ A;  2IMF A;  4WBJ A;  3L9U A;  4MDC A;  3TRX A;  4HZ4 A;  3HHV A;  3QR6 A;  4XS1 A;  4LLR A;  2J9H A;  4ECJ A;  3D4M A;  3QAW A;  2FWH A;  1AXD A;  5ID2 A;  1V2A A;  3E3E A;  4JE1 A;  4N0V A;  1K3O A;  1NHO A;  1CQH A;  4IW9 A;  5KOX A;  1JZR A;  3CYN A;  1LBK A;  2TRX A;  1HQO A;  3DKS A;  4IVF A;  5GZZ B;  2YWO A;  4KCA A;  4FYB A;  4WET A;  2NPB A;  5DJM A;  3F4T A;  2B7J A;  2VLT A;  2PUK C;  3APO A;  4KND A;  1EGO A;  3Q19 A;  2HZF A;  3GKK A;  1A8L A;  4JR4 A;  4HOJ A;  2VAF A;  5CRE A;  10GS A;  1TRV A;  2YN1 A;  4ISD A;  1HD2 A;  3DYR A;  2C3T A;  3FYG A;  5CYY A;  1TP9 A;  2R6K A;  3PGT A;  5JWR B;  4PUF C;  2K9F A;  1ZYE A;  4OMV A;  3D22 A;  1AQX A;  3LYP A;  1V57 A;  4QL7 A;  3GX0 A;  2CAI A;  3TJK A;  4PGT A;  3LW9 A;  4YKG A;  5A4U A;  4WEY A;  2XBQ A;  5LNK e;  3TRP A;  4TXV A;  4TVE A;  1TRW A;  1WPI A;  4IGJ A;  2IWT A;  2LEG A;  3A5I A;  3M3M A;  3RAZ A;  3QMX A;  1K0N A;  1EEM A;  2AAW A;  2O89 A;  2L4Q A;  4EKZ A;  3CSH A;  2DJ2 A;  5HR3 A;  3LQ7 A;  3A2X A;  2DC5 A;  1YEX A;  2WS2 A;  4EIQ A;  2PER A;  1TRS A;  2XBI A;  4IJI A;  5F8B A;  3ED3 A;  4G9H A;  2DMM A;  5JWO B;  3GV1 A;  2N5A A;  3FY7 A;  1SYR A;  4PX1 A;  17GS A;  1SKW B;  4RUV A;  5FT3 A;  5KN3 A;  5DQY A;  1TRU A;  4MPF A;  5J9C A;  4F9Z A;  1ZGN A;  2VL3 A;  4ECI A;  3VWX A;  2VLU A;  4K7I A;  1MDJ A;  3GUR A;  2FD3 A;  1ST9 A;  1EP7 A;  3APS A;  3DEX A;  4DSS A;  5DCH A;  2JZT A;  1AUC A;  2H6Y A;  1Z3E A;  1Y25 A;  3N9J A;  2YOI A;  1J0F A;  1BED A;  1ZOF A;  1TK8 B;  22GS A;  2CA8 A;  4BVY B;  1K0M A;  4MP4 A;  3VPQ A;  2GT6 A;  2FLS A;  4KGI A;  4N11 A;  5CRW A;  2PU9 C;  2LQQ A;  3G9B A;  3DRN A;  2CZ2 A;  3TB2 A;  1O8W A;  1PN9 A;  3VUR A;  4E8H A;  1YF1 A;  5IO2 A;  4JR6 A;  3KTL A;  4FYU A;  2HE3 A;  1FG4 A;  2B5X A;  5KN0 A;  1S3D A;  4ML1 A;  8GSS A;  2FGX A;  1MTC A;  1GNW A;  3ZTL A;  1N2A A;  1MDK A;  1DE2 A;  2R0G A;  3HVS A;  3M9K A;  3OR5 A;  2NTO A;  4KCE A;  4EXJ A;  2H75 A;  3IC4 A;  3C7M A;  4X0X A;  3IDV A;  1AAZ A;  2H6Z A;  5H5R A;  1BYE A;  1KEB A;  3ZIV A;  4CHS A;  2WZ9 A;  3NZN A;  2B1K A;  5J9B A;  2X49 A;  4PQH A;  2AV4 A;  2OE0 A;  1PSQ A;  1T8E B;  3QPM A;  3WGE A;  4ZIJ A;  3U5R E;  4ECB A;  2H0G A;  4KUN A;  1ERV A;  2FA8 A;  2YJH A;  3TKR A;  4EUY A;  5JCW A;  4BA7 A;  1Z9H A;  4CW9 A;  3S9F A;  2R2J A;  2KHP A;  3ZFB A;  4MNN A;  4Z7X A;  2CVD A;  1R5P A;  4RQX A;  3VWU A;  4A5P A;  4HJM A;  5B6N A;  4IHU A;  2LUS A;  2LKU A;  5ECR B;  3LFL A;  4G2E A;  1K3Y A;  1RK4 A;  5IMZ A;  1TXX A;  1FVK A;  2V6K A;  1OAZ A;  4TXO B;  2I1U A;  4MPG A;  5J4U A;  3HZ4 A;  4GWR A;  3HYP A;  4POM A;  1SK2 A;  4IP1 A;  3HJP A;  1ZYQ B;  1SK1 A;  3KXO A;  3MWH A;  1OC9 A;  1QMV A;  3F8U A;  3EU3 A;  3IHQ A;  4GST A;  1GSE A;  1SEN A;  2EIQ A;  4KW6 A;  2YJ7 A;  1B4P A;  3FRC A;  3FW2 A;  2C0E A;  4EC0 A;  2O7K A;  1TKD B;  1SJZ A;  4JBB A;  1JFU A;  2ES7 A;  3WGX A;  2GT5 A;  5IMA A;  2P0G A;  1M0U A;  1A2L A;  1OKT A;  5B7C A;  1JZW A;  2VLV A;  3E9J B;  1YKA A;  1SL2 B;  2JZR A;  4TN8 A;  3VPT A;  4XS4 A;  4USS A;  4PNF A;  3EC3 A;  3EMP A;  4PQI A;  5D9W A;  4MH3 A;  1YDK A;  4NV5 A;  5ECN B;  3RHC A;  4WBR D;  3CTF A;  1VRS D;  3ZIJ A;  3ZMK A;  3FZA A;  2VUP A;  6GSS A;  3LWA A;  2LJR A;  3KM6 A;  2V32 A;  2WRT A;  4K7N A;  5GSS A;  3FMW A;  3M0F A;  1F37 A;  2C0F A;  2X8C A;  2MMN A;  5ABR A;  4KX4 A;  1MD3 A;  2QGV A;  2AHE A;  1B8X A;  4I2U A;  1PRX A;  4IQ1 A;  3VI5 A;  1QUW A;  4IKH A;  2H66 A;  4Q5N A;  5DQS A;  1GSF A;  3HZ8 A;  3FR6 A;  2QA2 A;  4N0Z A;  2PGT A;  1TW9 A;  3MIX A;  4O92 A;  2VL9 A;  4BL7 A;  1PGT A;  2ON5 A;  2ZCT A;  4XCS A;  5ELA A;  2HZE B;  1EV4 A;  1V40 A;  2AUV A;  2H30 A;  3GFK A;  1JLV A;  3G7Y A;  1R26 A;  2V41 A;  5IMC A;  18GS A;  3FHK A;  5DAK B;  4MZB A;  1ERW A;  2NVL A;  3GH6 A;  5L71 A;  2VL2 A;  1GL8 A;  3IPZ A;  3L9S A;  5DCG A;  4K7O A;  1FB0 A;  3GKM A;  1G7O A;  3QD9 A;  2DJ1 A;  3GST A;  4GF0 A;  4JED A;  4MLY A;  4I97 A;  3BCK A;  1T00 A;  2H01 A;  3RPN A;  2EIO A;  2VCZ A;  4YAV A;  4MAB A;  4MF6 A;  4ZL7 A;  5KEJ A;  4G10 A;  4ZBD A;  1BQ7 A;  1NM3 A;  5IMV A;  4KSM A;  3I9V 2;  1SKR B;  4TR0 A;  1T7P B;  2JAC A;  3TKS E;  5IOW A;  3RPP A;  1OE7 A;  4L5L A;  1TDI A;  4HQZ A;  3K8N A;  2R4V A;  2IFQ B;  5KOW A;  4IP6 A;  1NHY A;  5F0G A;  1PL1 A;  4POB A;  4Z2T A;  4F82 A;  2VIM A;  2OAC A;  1A0F A;  1PD2 1;  4ZL9 A;  1K0B A;  3ZL5 A;  3TKP A;  2L6C A;  4QL9 A;  1HNC A;  3TJJ A;  4CY6 A;  1SK0 A;  4BWQ A;  2LJA A;  4WF4 A;  3M1G A;  3C1R A;  4YQM A;  2OBI A;  2YV9 A;  1GSY A;  3FR9 A;  3IBH A;  2FWF A;  2E7P A;  4HEA 2;  4KF9 A;  5KN2 A;  1T3B A;  5IOX A;  4AJ7 A;  2LJK A;  1PKW A;  2JZS A;  2HRK A;  1CQG A;  1F9M A;  4O5U A;  3P2A A;  2GQK A;  2LRN A;  4HZ2 A;  1MDI A;  4IJ3 A;  12GS A;  1QXH A;  5B8B A;  1K3L A;  2TRC P;  3FK8 A;  5A4W A;  1YQ1 A;  3F9U A;  4V2L A;  1B4Q A;  1BAY A;  3ZYW A;  2YZH A;  2QKE A;  1PN0 A;  4MH2 A;  1KNG A;  2HYX A;  2LST A;  3TOT A;  1TI1 A;  2H73 A;  4OD7 A;  6GST A;  1M2B A;  3IAS 2;  3DIE A;  1YKC A;  1M2D A;  1FHE A;  6GSW A;  1XWA A;  3BD2 A;  5F05 A;  4ACS A;  3SWL A;  3CTG A;  5HR1 A;  4EL1 A;  2L5O A;  1THX A;  5BRT A;  1X9S B;  3CXG A;  1XXU A;  1EOG A;  2DLX A;  3PR8 A;  1XPV A;  4BVY A;  4EDZ A;  5D8I A;  3BBY A;  1TI3 A;  4EO3 A;  3O76 A;  1THO A;  1YY7 A;  5DAL B;  4POL A;  3V1W A;  3ZLP A;  5A5K A;  4BWS A;  3Q74 A;  3MNG A;  2BMX A;  1GLP A;  1XOA A;  2FA4 A;  4J2F A;  2IL3 A;  4HU9 A;  1HYU A;  2NBS A;  2C3Q A;  1GUM A;  5DDL A;  3UMA A;  4DVC A;  3GTU B;  1SYX A;  3R3E A;  2DIZ A;  2PBJ A;  1SJI A;  5CNW A;  5EPF A;  3LGC A;  1IYH A;  2DJ3 A;  3LG6 A;  1OE8 A;  3UJ1 A;  3P90 A;  4BVX B;  5BMU A;  2L4C A;  1GSQ A;  4I5Q A;  1M2A A;  2MMA A;  4NMU A;  5H5Q A;  1XW6 A;  4IN0 A;  1UN2 A;  1VF1 A;  2JAD A;  2F8A A;  1GUH A;  3DD3 A;  1WOU A;  2M46 A;  2H1A A;  3FKF A;  2GQL A;  1W4V A;  1RQM A;  1PL2 A;  2GDR A;  4MJE A;  3TOU A;  3ERF A;  2FUG 2;  2VO4 A;  3GRX A;  2HI7 A;  4ICY A;  2K6V A;  1QFN A;  3UVT A;  3QOU A;  9GSS A;  3IK9 A;  4JRR A;  1X5E A;  3F6D A;  3TUE A;  2C0D A;  3BJ5 A;  2MMZ A;  3EE2 A;  2AB6 A;  4KAE A;  1ACV A;  1YEP A;  3HVX A;  3LYK A;  20GS A;  1T4Z A;  3HVV A;  3L78 A;  4LMV A;  5D9V A;  1GUL A;  2AYT A;  4WKW A;  2XC2 A;  2R0C A;  3IC8 A;  4PUA A;  1SKS B;  1XCC A;  3IA1 A;  2YAN A;  5KN1 A;  2IN3 A;  2GLR A;  3GL5 A;  3QCP A;  3KMO A;  2IPA A;  3ME8 A;  4ZB6 A;  5CP1 A;  3BCI A;  1EEJ A;  4NPB A;  4TRX A;  5G5F A;  5HR0 A;  3VK9 A;  3G7I A;  3RHB A;  2M72 A;  5G1K A;  1O8X A;  3DVW A;  1SD9 A;  1C72 A;  5ECO B;  1XVW A;  1GSS A;  2GQM A;  4KB3 A;  1TU7 A;  1WIK A;  2CV4 A;  4KDX A;  3KP9 A;  1DUG A;  2VOC A;  3D5J A;  2CX3 A;  4V2N A;  2H1G A;  3A2V A;  2M80 A;  3IV4 A;  4YAP A;  1SJ6 A;  3GSS A;  4FO5 A;  4J56 E;  4TR1 B;  2HLS A;  4QQ7 A;  4D73 A;  1GTI A;  3KIJ A;  2RLI A;  1M99 A;  1V58 A;  4MF7 A;  4MJC A;  5HFK A;  4GSS A;  4TR4 A;  2I3Y A;  1A8Y A;  4XTS A;  3JCM L;  3MDK A;  2F8F A;  4K2X A;  1G6W A;  4MK3 A;  1K0D A;  4AJ6 A;  4XS6 A;  2PVO C;  2VCQ A;  4F0C A;  4I6X A;  1SU9 A;  2JSY A;  2GSR A;  2YWN A;  2DJ0 A;  3VI7 A;  1B48 A;  2CT6 A;  3CRT A;  4OWY A;  4ZL8 A;  3GH9 A;  2RM6 A;  4V1A g;  4KDY A;  2MZC A;  5FHI A;  4EE0 A;  5FWG A;  3APQ A;  3US3 A;  4XHM A;  3GX8 A;  5G1L A;  4G0L A;  4WR4 A;  2EC4 A;  6GSU A;  1J08 A;  2VCV A;  5C00 A;  4L8E A;  5ECP B;  2KP1 A;  16GS A;  1FAA A;  4FQU A;  2X99 A;  3QAG A;  1UA5 A;  3ZRD A;  2C0G A;  1OC3 A;  2RUF A;  2HRF A;  4G0I A;  4XRA A;  4OFT A;  2MBT A;  1GSU A;  4TW5 A;  4K9Z A;  2HZE A;  5DJL A;  3IHG A;  3KH7 A;  4RI7 A;  4EIP A;  1OVN A;  2YWM A;  5GST A;  2QSI A;  1JHB A;  3MSZ A;  3W6G A;  3L9V A;  3LXT A;  5DAK A;  4L0U A;  1JZO A;  2LTK A;  4OO5 A;  5ECK B;  5LD0 A;  2H72 A;  14GS A;  4HDE A;  3TRQ A;  3F63 A;  4CDO A;  2LV3 A;  4KA0 A;  3F6F A;  5B8A A;  2B5Y A;  4LMW A;  1O85 A;  2XHF A;  1A2M A;  2ON7 A;  2KOK A;  1J9B A;  2PPT A;  2OBK A;  2OA7 A;  1S3C A;  1B9Y C;  1O6J A;  3LEF A;  1ZYN A;  13GS A;  1PQN A;  1GWC A;  1NSW A;  2HSH A;  1WWJ A;  2DBC A;  3GL3 A;  1XZO A;  1U6T A;  3PPU A;  2V1M A;  1USB A;  1AW9 A;  4X1U A;  3FR3 A;  1GTU A;  1Z7P A;  4LL1 B;  4KE3 A;  2IFQ A;  1GRX A;  3QAV A;  2LRT A;  2OKA A;  4H86 A;  2R37 A;  3TKS A;  4PXO A;  4JZQ A;  1AIU A;  2DJK A;  1OYJ A;  2X8G A;  5G31 A;  1Z5Y E;  4XIH A;  2H76 A;  1MD4 A;  3UAR A;  1XFL A;  3KCM A;  4RI6 A;  2HXK A;  5E59 A;  4TR3 A;  2CZ3 A;  3GIX A;  3H4K A;  4MA9 A;  4HQS A;  3NIV A;  1Y6E A;  4NV2 A;  4ID0 A;  2PN8 A;  4K5R A;  4L0W A;  4EVM A;  1PX6 A;  2K8S A;  1W89 A;  1U87 A;  4ZXG A;  5J5N A;  1VF2 A;  3VFI A;  4MCU A;  2LNS A;  2C8U A;  4K1F A;  4K2D A;  1PKZ A;  1YJ6 A;  1X0R A;  3L4N A;  1OKD A;  1EWX A;  2FNO A;  3WD6 A;  1OC9 B;  5ECM B;  3HXS A;  1JLW A;  2GGT A;  3DXB A;  1N8J A;  3FZ4 A;  2UZ8 A;  3GA4 A;  3Q6O A;  2VD0 A;  1ON4 A;  1VGL A;  2X64 A;  3W8J A;  4NHW A;  3CRU A;  3CSJ A;  2MYG A;  1BJX A;  2BTO T;  2JSZ A;  3ZRE A;  2V2G A;  2A2R A;  1ZCP A;  2EIR A;  1VF4 A;  2WFC A;  3MAK A;  3N5O A;  1HNA A;  4V2M A;  4MZC A;  3F0I A;  4NWY A;  4WXT A;  1ERU A;  3J7Y k;  2HSM A;  3GHA A;  2QC7 A;  5CO3 A;  4POK A;  1H4O A;  1SL1 B;  3FZ5 A;  1XWG A;  4G0K A;  4LL4 B;  7GSS A;  5EY6 A;  4KH7 A;  3C1S A;  1BG5 A;  2YP6 A;  2LNT A;  2XPD A;  4HUA A;  2CAQ A;  5DAL A;  1V98 A;  2AJQ B;  4FH8 A;  2LS5 A;  5G5E A;  2V6O A;  6GSV A;  4GTU A;  1GUK A;  1F3B A;  5IO0 A;  2DIY A;  1LJR A;  1AQW A;  5AIX A;  1VF3 A;  3Q18 A;  3GTU A;  4X4J A;  2NDO A;  5ELG A;  4HJ2 A;  3D4T A;  3EVI A;  2CVK A;  4GLT A;  5JCU A;  2DKI A;  3IE3 A;  2YPM A;  1ML6 A;  2G2Q A;  4BVX A;  4JU5 A;  4YKF A;  2H0I A;  3SBC A;  3WT2 A;  3UEM A;  3GKN A;  2VCW A;  3I69 A;  4FIW A;  3GYK A;  4O5R A;  4BL7 B;  1WJK A;  5ECL B;  1EV9 A;  3EPT A;  2H8L A;  3RBT A;  3J7Y b;  1Q98 A;  1LU4 A;  2O87 A;  2I81 A;  4DSQ A;  3PH9 A;  3KTB A;  4GSN A;  2B6M A;  4AGS A;  2HSY A;  3KGK A;  1TU8 A;  5GAP D;  4AJ8 A;  3ME7 A;  2X8H A;  3O3T A;  1Q4J A;  2L57 A;  4IBP A;  4MF5 A;  3KEB A;  2F9S A;  2VM2 A;  1RW1 A;  2JL4 A;  3H1N A;  2MMO A;  2J23 A;  1T4Y A;  3DML A;  4GQF A;  1TTZ A;  1H75 A;  1IYI A;  1FOH A;  1FO5 A;  3IOS A;  2WDU A;  19GS A;  2FY6 A;  1PA3 A;  4NXI A;  3DWV A;  1ERT A;  2REM A;  4BPY A;  4Z2R A;  5HQP A;  4N30 A;  1JZD A;  2GZP A;  4FYC A;  3GKX A;  2IME A;  3F3Q A;  4K0G A;  2GTU A;  1M7T A;  1A2J A;  5ECI B;  5IMF A;  2OE1 A;  5IIZ A;  3MYD A;  3LXZ A;  2IMI A;  2FCH A;  5IPH A;  5AGY A;  1URM A;  3WT1 A;  1QQ2 A;  1E6B A;  3TJB A;  3F4R A;  2H70 A;  5DBQ A;  4HS1 A;  4OCE A;  1OC8 A;  1M9A A;  3ZFL A;  5AIV A;  3M8N A;  2I4A A;  1Z6M A;  3D21 A;  2N5B A;  1TJD A;  4RQR A;  2RM5 A;  3I43 A;  4TR1 A;  2YZU A;  4PQ1 A;  1AC1 A;  2H6X A;  1K0A A;  3U6V A;  4ILF A;  1WP0 A;  3A2W A;  4MJB A;  4EDY A;  2MBS A;  1F3A A;  2P5R A;  3QFB C;  3TGZ A;  1GTA A;  3AY8 A;  2ZUP A;  1A24 A;  4IS0 A;  1M9B A;  4OCF A;  3WGD A;  2FWG A;  2DML A;  2DKH A;  1Z6N A;  2E0Q A;  2O85 A;  2ALB A;  3HDC A;  2WGR A;  2H19 A;  4DSR A;  1TOF A;  5CRH A;  5J41 A;  1QK8 A;  5ID2 B;  3I6A A;  5ENU A;  3H79 A;  2WB9 A;  3G7J A;  3H8Q A;  2QA1 A;  4X43 A;  5IM9 A;  3UOM A;  3QFA C;  1TK5 B;  1XVQ A;  2TIR A;  5F07 A;  2B7K A;  5HR2 A;  2FWE A;  2DSA A;  2H74 A;  2VM1 A;  3QDN A;  4ULX A;  3W8S A;  4O32 A;  1A0R P;  2F51 A;  5A4V A;  2VCT A;  3ZVJ A;  1G0T A;  4TXO A;  4TOP A;  3EYT A;  1XIY A;  1PMT A;  5D9X A;  2C1Y A;  3GN3 A;  4PTS A;  2OJL A;  3O6T A;  2H1B A;  4O5Q A;  3UIW A;  1XWC A;  2X4A A;  1EP8 A;  4KSO A;  4J57 E;  2IMK A;  4K6X A;  2LQO A;  3WYW A;  3CMI A;  3F3R A;  3HJM A;  4ML6 A;  2IJY A;  1A23 A;  2A2S A;  1K0C A;  3ZIT A;  4LA1 A;  1YF0 A;  3ZZX A;  2L5L A;  3UAP A;  4Q5F A;  1V9W A;  5F06 A;  1GSD A;  4ZB9 A;  2GSQ A;  1XWB A;  4GRF A;  4ZB8 A;  1E2Y A;  4HI7 A;  3DVX A;  4YQU A;  1KBN A;  5C04 A;  2PWJ A;  2OAD A;  5HFI A;  2ZNM A;  2B3S A;  3EUR A;  1FW1 A;  1XOB A;  4HU7 A;  1ABA A;  5ECH B;  3IAM 2;  2PMT A;  3IXR A;  4G19 A;  5J3R A;  1FOV A;  4YH2 A;  4DEJ A;  1EZK A;  3BOA A;  4ZBA A;  3TJF A;  3ERW A;  2Z9S A;  2DJJ A;  2A4V A;  3ERG A;  3GMF A;  2KP2 A;  1NW2 A;  3D0Z A;  3IR4 A;  2LRC A;  5JWQ B;  6GSY A;  2L59 A;  4N10 A;  1EOH A;  4MZW A;  2WCI A;  4Q5Q A;  5D73 A;  1SD8 A;  4PNG A;  2JU5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...