2HYXA

Structure of the c-terminal domain of dipz from mycobacterium tuberculosis
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
333
structure length
333
Chain Sequence
b'GAMEIREQLNLGGIVNAQNAQLSNCSDGAAQLESCGTAPDLKGITGWLNTPGNKPIDLKSLRGKVVLIDFWAYSCINCQRAIPHVVGWYQAYKDSGLAVIGVHTPEYAFEKVPGNVAKGAANLGISYPIALDNNYATWTNYRNRYWPAEYLIDATGTVRHIKFGEGDYNVTETLVRQLLNDAKPGVKLPQPSSTTTPDLTPRAALTPETYFGVGKVVNYGGGGAYDEGSAVFDYPPSLAANSFALRGRWALDYQGATSDGNDAAIKLNYHAKDVYIVVGGTGTLTVVRDGKPATLPISGPPTTHQVVAGYRLASETLEVRPSKGLQVFSFTYG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein dipZ
publication title Structure of the C-terminal domain of DipZ from Mycobacterium tuberculosis
rcsb
source organism Mycobacterium tuberculosis
molecule tags Unknown function
total genus 92
structure length 333
sequence length 333
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
A PF17991 Thioredoxin_10 Thioredoxin like C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2hyxA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2hyxA01
3IE3A 5C7GA 2V41A 3G7JA 2GDRA 2C0GA 1XOBA 3G7IA 4GQFA 2GSQA 3VWWA 3VK9A 3C7GA 3T2PA 2YANA 1XFLA 3EYTA 1WE0A 2TRCP 1T2XA 2VAFA 3HKRA 3RHBA 2VZPA 2P5QA 2H1GA 2CX3A 1ZOFA 1FOVA 2L6DA 4QDRA 3HDCA 4MA9A 1YF1A 3D5JA 11GSA 4X1UA 2LW8A 4KB3A 5G04L 3T09A 3J7Yb 2W5FA 2WCIA 2FD3A 1GUHA 2AB6A 3WNPA 1UVZA 4TR3A 5B6MA 5J9CA 3F9UA 5ECSA 3VI7A 1CX1A 3HZ4A 1T00A 1CQHA 3IPZA 4KW6A 4XUQA 2KD7A 2VQTA 2LKUA 4IJIA 1UY0A 1GSYA 2P5RA 3P7XA 4HS1A 1X9WB 4UOJA 2C1YA 2H6XA 4OO4A 4PURA 3IAS2 3LPFA 3EYPA 3OEBA 3C7OA 2LS6A 3WF3A 1R4WA 2BJXA 5F0GA 3GKMA 4OUEA 4MJCA 2WAOA 3ME7A 3GNJA 3THCA 4ZB6A 2VCZA 3EC3A 1U88A 5JXIA 4GZ9A 2OJLA 4IS0A 5JXJA 3IA1A 2NVLA 3TOTA 5KEJA 2QQNA 1EUTA 1MDKA 1GOGA 4XRDA 1SKSB 4FH8A 3DYPA 4NWYA 1VGLA 3US3A 2VL3A 2W92A 2V1MA 2I4AA 2KUCA 4TR0A 4ML1A 3LG6A 5C71A 2R7EB 2YPMA 4OYUA 3APQA 3I43A 6GSXA 4IUGA 1O8XA 2CVBA 2L4QA 1OH4A 2RVAA 2YZHA 2XHFA 5DMYA 1EWXA 1PKWA 4PX1A 2B7JA 1UMHA 4MF5A 2CZ3A 5CRWA 1KEXA 2L9LA 4QB2A 1F3AA 1K0MA 1RQMA 5LCWL 3GKKA 2VCQA 3IV4A 4O5RA 3TJGA 1GLPA 2GGTA 1HNCA 2RUEA 3IAM2 2AYTA 3GTUA 3GV1A 2EIEA 3K4DA 2PPTA 1U6TA 1ZMAA 3T0AA 4K8MA 2O89A 5D73A 2QKEA 3DVWA 1THOA 4XRAA 1PL2A 3OB8A 4WXTA 3D4MA 3LQ7A 3FYGA 1VF3A 2VZVA 1XNTA 1V2AA 1H4OA 5G31A 4V2MA 5ECRB 4PUAA 3CSJA 2EIQA 2YP6A 3DWVA 4KWUA 4OFTA 4RI6A 1OC3A 1W89A 4LKSA 1O7UA 2NPBA 4JBBA 4XS4A 3E1F1 3D0ZA 3UIWA 4AAXA 4JU5A 1O85A 1AC1A 1WRYA 1PX7A 5JWQB 1T7PB 4A45A 3J7HA 3GKNA 2H66A 2R4VA 5D96A 4KX4A 4Q5QA 3K4AA 3WGXA 3JCML 4MF7A 1YEPA 3DYOA 1PKZA 3LYKA 2HZEB 1UWWA 4FYUA 3W6GA 4X0XA 1EEJA 1AQVA 2VO5A 5HPOA 1PX6A 4GLTA 2LS5A 1JZ8A 5J41A 10GSA 3ZIJA 1NW2A 1DUGA 4BK5A 2J7MA 3EWLA 5IQYA 2ZEXA 5JR2A 1DBYA 1JYVA 3HOBA 2J1UA 3MNGA 14GSA 5ENUA 5JCWA 3EVIA 3CQOA 3VURA 1Z6MA 4IW9A 4NPBA 4JX0A 3SEPA 1JZ7A 2FWEA 3WNLA 4CDOA 2XC2A 2GSRA 3KMNA 3EMPA 4W50A 3C73A 4J57E 1J9BA 4E8CA 1ON4A 1GOHA 1Z6NA 5CNWA 1K0CA 3CTGA 4L8EA 3HNMA 1R64A 2GT5A 4O32A 4DSRA 4I2UA 5INYA 1TK0B 9GSSA 4NAXA 1TW9A 1UXZA 4YQUA 3FRCA 2VJXA 2I81A 1QXHA 3DVXA 2LQOA 1EOGA 3D21A 2C8UA 4HU7A 2WO2A 3HVSA 6GSUA 1SYRA 1ZL9A 2BBAA 1E6BA 4GF0A 4ML6A 5J3RA 3LFLA 1Q98A 1W8NA 1NHYA 4TXVA 6GSTA 1J0FA 3DEXA 1GTAA 1UY4A 2JZSA 2LTKA 2E2GA 4HOJA 2VZTA 2LJKA 1EV4A 1MD4A 4BL7A 2FA8A 1DP0A 2WYSA 2D2ZA 4HZ2A 2IMFA 2REMA 4KSOA 4GSSA 4HU9A 5D9TA 1YJ6A 1ERVA 3TKSA 2X10A 2W95A 1PX3A 1XW5A 4GWJA 4KA0A 4MJBA 5G5EA 4IKHA 3TOUA 4IN0A 3A2XA 1BJXA 3FW2A 2DJJA 3A23A 3BD2A 2GZYA 3FZ5A 1UMIA 2Y6GA 3I2GA 3VD5A 3ZRDA 2A4VA 1L7QA 2L57A 4F2IA 4ZL8A 4ID0A 3A5WA 2FGXA 5EL8A 5DQ0A 2K8SA 3L9UA 5EPFA 3EMXA 3KD0A 3VD4A 1ZCPA 4XTSA 1OVNA 2YFUA 2HXKA 2CT6A 1HN1A 5IO0A 1W9TA 1XPWA 1GUIA 2VCTA 1LBKA 1V57A 4MDCA 2DJKA 4BVYA 1SJZA 17GSA 3WF2A 1K0BA 1T4ZA 5D9WA 1TTZA 1WCQA 4K6XA 1MDJA 2AJQB 4N0VA 5IOXA 2R3XA 3MV11 1ZYEA 2MMNA 5CO3A 3OBAA 4PT6A 2JADA 2V72A 2FA4A 2HT9A 1WIKA 1OAZA 2H8LA 4MADA 2H71A 4V1Ap 2HFDA 2PMTA 2X8HA 4TKYA 2XOMA 2WZEA 3RPNA 3QFBC 2X05A 3FZ4A 5LD0A 3DGQA 2J1VA 1K3YA 3QAGA 4CUCA 3FZ9A 3LGCA 4TN8A 4DXSA 2QQLA 1F2EA 4HQSA 4HG6B 2BTOT 1JHBA 5ELGA 5ECIB 4PQIA 1DE2A 2VR4A 3HXSA 3SKVA 4HZ4A 4KE3A 3CZJA 2H72A 5DAKB 1TI3A 2E2MA 4KCAA 5ID2B 3A22A 2PQSA 1E2YA 5HR2A 1B8XA 2VM9A 3CKHA 3RHCA 2DJ3A 4K7IA 4ULXA 5DCHA 1PA3A 1BAYA 2VCVA 1WPIA 1PL1A 4XCSA 2E26A 3MWHA 4KNDA 4NV5A 5IJRA 4QX0A 1R26A 4XS1A 2IMDA 2DCJA 2WO3A 2CQ9A 3IAPA 3CMGA 5F7UA 1JYXA 4ECIA 2X09A 5FHIA 4POMA 3UBLA 1P8JA 4MABA 3R2QA 4PNGA 1W9WA 1OE8A 2E0QA 1XXUA 1IYHA 4DSSB 1T1VA 1G7OA 1QFNA 5A1AA 1TDIA 4MPFA 1T8EB 3ZZXA 3HY2A 2GZPA 4GXZA 3RBTA 2W91A 2X64A 3QAVA 4N30A 3P6BA 3ZFBA 4MGQA 4E8HA 2YV9A 5IMZA 4P5YA 5F07A 2I9HA 3IOSA 1Y25A 4MPGA 2RV9A 4K7OA 4BWQA 2NBSA 3FEUA 3HNBM 2MYGA 4A44A 3LSZA 3QD9A 4WETA 3I3EA 2Y6JA 4BJ0A 1MD3A 4N11A 3GURA 4CU9A 3ZLPA 1K0DA 2H76A 3PH9A 5DALA 1O8SA 1Z3EA 1A24A 4KI5M 2ZEZA 4CVUA 3ACIA 4YPJA 2B5YA 4CUAA 1MTCA 3F3RA 1QUWA 3GL5A 3TKSE 1GQPA 3GX8A 3H79A 3I2JA 3U5RE 2F8FA 1QQ2A 1ERUA 1NM3A 1VF1A 2LJAA 5COHA 2VLTA 2W1QA 4ZY9A 1JZ5A 1SENA 3ZREA 2W46A 3F3QA 2N5BA 2IMKA 2V5DA 1O8PA 2MZCA 5IFTA 1OE7A 1GRXA 3C7EA 3I2IA 5ELAA 3I6AA 1DSBA 4FIWA 4L0PA 3QAWA 3D6IA 2P31A 2C0FA 2CA8A 4GSTA 2NDOA 2I3YA 3M0FA 4MLYA 2O8VB 1EP7A 4AJ6A 3SEEA 1BEDA 3WNKA 2VO4A 2VLUA 2L5LA 4LHSA 3NJXA 1QGVA 2B5EA 1I5GA 1NSWA 1N2AA 3HCZA 4IBPA 1V58A 3KP8A 5IMAA 1OKDA 3VWUA 4MH3A 1SU9A 1I5PA 3ECQA 2WZ8A 1GUMA 3U6VA 4IP6A 5EJ1B 5DCGA 1V9WA 3OGRA 3EB7A 1GSSA 2FWGA 4TR1A 3AC0A 4ECCA 1BYEA 2AHEA 2ZUPA 3F0IA 3LQCA 3HJPA 1U3AA 4CU6A 2YWMA 3AY8A 3E0UA 3A2VA 1KGYA 3QMXA 1YY7A 4TXOB 2PERA 1X9SB 2WDBA 4RQXA 4PNFA 1GOFA 1LJRA 2JKXA 3UBKA 1KTEA 1V98A 4HQZA 2PBJA 3PGTA 5G5FA 3WGDA 1KEBA 1GNEA 3K8NA 1JZ6A 2W1SA 4TR4A 2EIBA 3TKPA 4IVFA 2WGRA 3CRUA 3Q18A 3UVTA 2R5GA 5ID2A 2H1AA 2ON7A 2WRTA 4RI7A 2VQUA 5CYYA 2H1BA 3QFAC 2GS3A 1EEMA 2YV7A 4WKWA 4WR4A 4DXTA 2EIOA 4MZCA 4CW9A 3VI5A 3QDNA 2K6VA 2KP2A 3UVHA 1TI1A 2J1TA 2RM6A 1URMA 4DUXA 1R5AA 2L5OA 2DSAA 1JI6A 1ZYQB 4DVCA 1G6WA 2DJ2A 3L4NA 2VZQA 2L4CA 1ILOA 3GMFA 3M8NA 3OR5A 5B6NA 3KJYA 2PVQA 4F9ZA 1DE1A 1A2MA 5HXMA 2O87A 4LQRA 2WJUA 3APSA 3NZNA 3F6DA 2M46A 4DUVA 3WF1A 2G2QA 3FHKA 3MBWA 5A4UA 1M9AA 2H0IA 4DUWA 1PGTA 3D3AA 1JZWA 4EVMA 2VCXA 1FHEA 2W47A 2Y64A 1ACVA 3WYWA 4MCUA 2C0DA 4N0ZA 3UOMA 1AQXA 4DEQA 4BDVB 1U87A 2YG0A 2EIDA 2WO1A 3FN9A 2ON5A 8GSSA 2QQOA 5FUIA 5IMVA 3HHVA 1US3A 1JU3A 4OMCA 4MF6A 2BERA 1XVWA 3GIXA 3MV01 3C71A 1O81A 1HD2A 3KM6A 3C7HA 5ECKB 1O73A 3G9BA 5IMDA 1NUKA 2WABA 2DMMA 1CZVA 4BXSV 2JU5A 1T4YA 3GL3A 1SL0B 1UZ0A 4M4PA 5CAXA 4ZBBA 2VMFA 2HLEA 4IGJA 1PMJX 1SK1A 3WNMA 2DMLA 2VZ3A 1ABAA 5ECLB 3ZITA 3NQHA 4KCEA 1OYJA 3RPPA 2BGPA 3HVXA 1MPXA 3SBCA 4N10A 1GWCA 5E59A 2VZOA 2WB9A 4F03A 5DJLA 2H1DA 3TJKA 3VPTA 1BQ7A 4G2EA 3M9JA 4XUPA 3I2HA 16GSA 3GX0A 4D73B 2FWFA 3KCMA 2EIRA 1WWJA 3LXTA 1J08A 3GGLA 2PWJA 5DQYA 2LEGA 2WDUA 2YWOA 4PF1A 2XBQA 1Z9HA 3OGVA 2N5AA 1SD9A 2AUVA 1YEXA 2Y6LA 2YC4A 2B7KA 3FKFA 3M9KA 4QAWA 1K0OA 4TW5A 2XHNA 4GTUA 1S3CA 3CSIA 3IC4A 5A4VA 3MDKA 3K46A 2EICA 4GSNA 4MZBA 5H5SA 5J5NA 4XUNA 1FO5A 3LPGA 2R2JA 2DIZA 4A3ZA 1TKDB 4I6XA 2WN2A 5JXHA 4LA1A 4HI7A 2C4JA 2M72A 2F51A 4XVHA 2IFQB 1TOFA 2J1RA 1JLVA 3A3TA 3W5MA 2H01A 1AQWA 1B4QA 5JWOB 3HVVA 4Q5RA 2VMCA 2JACA 2DCKA 5ECNB 2YWNA 3M1GA 4POKA 4UI9L 1SJ6A 2R37A 2W3JA 2O85A 4BPYA 1L7RA 2WBKA 1UA5A 1SDDB 2HRNA 4ZZ5A 2YFZA 4A42A 2X8GA 2VL2A 3IDVA 5D9VA 1TRUA 2QSIA 4P08A 2N5FA 1F9MA 2AV4A 1K3LA 3WNOA 2RLIA 3HA9A 1UY3A 1TU8A 2JD9A 5JUVA 5B4NA 2OKAA 4Q5NA 1TP9A 1TJDA 1SG3A 2J22A 2WZ9A 1OT5A 3BN6A 1JZRA 2B5XA 4K0GA 4JE1A 1CIYA 2VL9A 3THDA 3TJFA 3ME8A 1NKGA 4LMVA 2IPAA 1AIUA 5ECMB 4ZIJA 3IAQA 3NRUA 2GQMA 4K0NA 4H86A 3ZM8A 4RN5A 1B4PA 3WGEA 4BA7A 5IMFA 1XWGA 3CYNA 5EVOA 3GA4A 4MP4A 1VRSD 5KN1A 5DBQA 4F0BA 4E8EA 1KNGA 3ZIVA 3F63A 1GL8A 3PUHA 3ABZA 1GU3A 3CDZB 4QX3A 1TU7A 4NHWA 4JKKA 3IRAA 3GM8A 3E3EA 2CDPA 5B7CA 3E9JB 2VZRA 1EGRA 1CZTA 4L5LA 3P90A 4HEA2 1BX9A 1WOUA 3ZMKA 2C3TA 4OD7A 1K0AA 3IIIA 2VZSA 4KH7A 2CAQA 1X9MB 2L6CA 1UC7A 2H70A 2GTUA 2B4KA 2H19A 5C00A 1T3BA 3L9VA 2ALBA 4X43A 2MMAA 4V1Ag 2QQMA 2E32A 4NHZA 4JRRA 3IB3A 5JXGA 1NAEA 3HZ8A 4KDUA 19GSA 3W5NA 3O3TA 2VM1A 2RJ2A 2IMIA 3TKRA 1F4HA 4P02B 2OE1A 1Q4JA 1TRSA 2GLRA 5F05A 1EOHA 3T2OA 1K3OA 3NOFA 1ML6A 1SK2A 2PVOC 1OD3A 3FL7A 2GSTA 1UXXX 2VMEA 4TVEA 2J23A 1SL2B 3ZMLA 2X8CA 4ZBAA 4JKLA 4Q5FA 4ISDA 3EURA 2GQLA 2LRCA 2C26A 4LL1B 1C72A 3WEZA 1YQ1A 2GT6A 4DEVA 2B1KA 4KAEA 2ORZA 2FWHA 3EINA 3I3DA 3TRXA 4XUTA 2HZEA 5H5QA 1TRWA 2IMEA 4OFMA 2MMOA 5E4WA 5LCZA 1MEKA 2VOTA 3KGKA 3GXUA 5HR3A 2WUHA 2VD0A 2OBKA 4O7HA 4POLA 1TXXA 2VCAA 1TRVA 4KGIA 3CXGA 3ACGA 1AUCA 1OC9B 1EZKA 3HEIA 1HNAA 1Z5YE 3QCPA 2V6OA 1X5EA 1JYWA 4K7NA 2IFQA 2C3QA 2BZDA 3PUIA 1XCCA 4MH2A 1SL1B 3F4TA 2DIYA 2W94A 1FG4A 1M7TA 3GUSA 4EDYA 3WSOA 4K9ZA 3DIEA 3D22A 4OWYA 2BGOA 1SHWB 3GDBA 2PN8A 1O59A 1XWBA 5ABRA 3KH7A 1GMMA 4A6OA 1PN9A 3DD3A 1Z7PA 2G0FA 5DQSA 3T2QA 2IIYA 4LL4B 4OFNA 2YWIA 2LRNA 4XHMA 3HNYM 4OCEA 4MZWA 5JCUA 5A4WA 4F82A 3LWAA 4BVXA 1V40A 3ZTLA 1RYYA 2VD1A 2H73A 4IELA 2HNLA 1HYUA 4OMDA 3KMOA 2X99A 4J2FA 2LUSA 2WFCA 5KN3A 4AJ7A 4WF4A 2QQJA 4YQVA 1H75A 2HSYA 3SKJE 1A2JA 1QMVA 5EJZB 2C3NA 4GWRA 4HJ2A 3C1RA 4DEJA 2XBIA 2E31A 3TJJA 1UX7A 3F8UA 4L5OA 1X5DA 1A8YA 3A7QA 2NTOA 5CREA 2VCBA 3W8SA 2RIIA 2VL4A 2IWTA 5AIVA 3N5OA 4FYBA 1X5CA 1I9DA 1UN2A 5D8IA 1YQ2A 3K77A 1W4VA 3OEAA 4RQRA 5ECPB 3M3MA 2XQXA 1GUKA 3N9JA 3GTUB 1GLQA 1LU4A 4A41A 3MSZA 2WULA 1XW6A 2VC9A 3GN3A 4YAVA 3MAKA 4EE0A 1BG5A 4ILFA 3FY7A 4QX2A 5EIYB 1UYZA 1A23A 2F9SA 4CUBA 4XIHA 4EF0A 1TK5B 5D9XA 1XNAA 4K2DA 1FW1A 2YCDA 4TOPA 3Q6OA 4W8JA 2ZNMA 2KLXA 3KZQA 4OMVA 4Z2AA 5J4UA 3EE2A 1AAZA 5ECOB 4GQCA 2F3MA 3EU3A 3CZUA 2A2SA 2AAWA 3KEBA 4TRXA 1UY2A 4ZXEA 3C7FA 3TKQA 4XS4B 2KP1A 5G05L 2H30A 2CDOA 2E33A 4HUAA 5KN0A 1B48A 2JSZA 1X0RA 3FR6A 3LYPA 4I2TA 3P8WA 1XWKA 4XZUG 1XPVA 5HQPA 1FAAA 1JZDA 4A4AA 2I1UA 1GTBA 2OKXA 1F3BA 3F4RA 3L0HA 5IYYA 1HNBA 4KDXA 1GH2A 1VF2A 5GSTA 3LEIA 1A0FA 4XS6A 3C8XA 4V2NA 4ZBDA 2IL3A 3IHQA 1IQDC 2IN3A 4QDQA 3LORA 1ULOA 2VM2A 4PGTA 1U3IA 2VZUA 4J56E 2Z9SA 2W1WA 1USBA 5B8AA 5DAKA 4EUYA 3A21A 3CTFA 1W0NA 1EV9A 1K0NA 1R5PA 3DMLA 2WS2A 3VFIA 2ES7A 2HRFA 2QQIA 5G1KA 4GCIA 1ULPA 3VDAA 3QR6A 2A2RA 3KXOA 2H74A 3MUY1 2QC7A 3BOAA 4I5QA 1FVJA 3IR4A 3ISOA 3BGAA 3LEFA 1D7PM 2DDUA 1OC9A 3BJ5A 2O7KA 3FK8A 2K18A 2CVDA 1Y6EA 5DN2A 4MO3M 1GP1A 2JDAA 1GSQA 5CZKA 1Z7RA 2VIMA 3MO4A 4ZILA 2VOCA 3DECA 2C80A 5LA2A 4NMUA 1SK0A 3VD9A 2Y8KA 4DSSA 3Q19A 4HDEA 2KOKA 3HYPA 4EC0A 5J1XA 4HJMA 3H4KA 2K8VA 4YH2A 2FLSA 1XVQA 1A8LA 2VZ1A 1DLCA 1F4AA 3QPMA 3TRPA 5HR0A 3A2WA 5D93A 2LJRA 1XW9A 3ZL5A 1PQNA 1SD8A 3RDWA 3TUEA 2J1SA 1ZZYA 3NNGA 4LPLA 3FZAA 5IPGA 4ZB8A 4ACSA 4LLRA 1M9BA 1W99A 1UYXA 3F2ZA 2C0EA 4P3YB 3HJMA 4DSQA 4EL1A 3P2AA 3WT2A 4PUFC 5FT3A 2HI7A 4TXWA 4XURA 5IPHA 3ETPA 4AJ8A 4WF5A 4ARYA 3C1SA 4JHZA 1JZ2A 2B3SA 1G7EA 2VCWA 2B6MA 3FHAA 1AXDA 2YOIA 3ERGA 2XPEA 1YKAA 3VPQA 5FWGA 3WD6A 3WNNA 5AISA 1JU4A 3P1IA 1PSQA 4ECJA 4ZL7A 4KMQA 1ERWA 1US2A 3DYRA 4JR6A 2GQKA 1GTUA 5LA1A 1FB0A 3GH9A 3UMAA 12GSA 1O6JA 2LV3A 4F0CA 18GSA 2DJ1A 1THXA 1J84A 5CRHA 1OKTA 3ERWA 3VWXA 2E7PA 2JSYA 3FR3A 3G7YA 1GNYA 2DC5A 6GSSA 1M2AA 3IBHA 3KTBA 4IJ3A 2ORXA 3T0BA 3GYKA 4QX1A 1M2BA 5G1LA 1WMJA 3I3BA 3HJOA 3CRTA 2W87A 2B1LA 4IQ1A 3HN3A 2YC2A 3WF4A 2KHPA 4PQQA 5JMOA 2FCHA 2GSSA 1CQGA 4CU8A 5IM9A 5IO2A 3APOA 22GSA 4LMWA 1HQOA 1R7HA 1H6YA 3GFKA 2OBIA 3GRXA 4G9HA 1GSUA 1JFUA 3C7MA 1YKCA 5DDLA 4TXOA 1XZOA 4MOAA 2WAAA 2BMXA 2ZCTA 5HR1A 3PR8A 2WQ8A 2GVPA 1YZXA 1K12A 4FI9A 4TTGA 1QK8A 2LNSA 4OCFA 2OE0A 1F37A 5F8BA 4JZQA 4POBA 4WEYA 4L0UA 2CV4A 3LEGA 4OO5A 4YAPA 5LA0A 4GWIA 3TB2A 3LJRA 1K45A 4NV2A 2OADA 3H1NA 4EKZA 2XONA 4QPWA 3GH6A 5J9BA 1EUUA 1F6MC 4W4ZA 3HJRA 3UAPA 3UARA 5JCGA 5A5KA 4RUVA 2JZRA 3GKXA 5IHRA 5C70A 4IP1A 1XOAA 2J1AA 2OACA 4M4RA 3NJVA 4EO3A 3LXZA 4QL9A 3KP9A 2HYXA 3KH9A 2V2GA 3GSSA 2TRXA 4DXRA 4AGSA 4AG4A 1EP8A 2ZEWA 1RW1A 1PMHX 1OF4A 1TG7A 1K3IA 2YN1A 3UESA 5EY6A 4KDYA 2TIRA 2ZXQA 3K4ZA 4FYCA 1H6XA 3UJ1A 3OGSA 2QQKA 5HFGA 2H0GA 1WJKA 3UNPA 1PMTA 1GSEA 5JWRB 3UL3A 4QDSA 2IJYA 1YDKA 1NX9A 5AN1A 3H93A 3BCKA 1UY1A 2YB7A 2FNOA 2MBTA 2YJHA 2OE3A 4G19A 4WBRD 1S3DA 2W1UA 5DALB 1JZOA 1KBNA 3L9SA 3TJBA 4O92A 5GAND 1OC8A 1XWAA 1XIYA 1GULA 1GSDA 4IHUA 5HFKA 5ECHB 4WBJA 3ACFA 4ET7A 5GZZB 3Q74A 1JZ4A 4E8DA 4D0QA 3ZYWA 3DYMA 1UYYA 4BWSA 2JZTA 1W8OA 3J7Yk 2L59A 4Z7XA 4WR5A 2VCCA 3T0DA 2QGVA 3GHAA 2YJ7A 4YQMA 4ZXGA 4EXJA 2V4VA 1WKYA 2ZEYA 2OA7A 3I9V2 1SYXA 2M80A 3EU4A 1JLWA 2C9KA 3RAZA 3CSHA 2P0GA 3L78A 1CZSA 2C4XA 5AGYA 5G30A 1W9SA 3JXSA 5H5RA 4ZB9A 2MBSA 3BBYA 2R6KA 3KTLA 6GSWA 2V6KA 3F6FA 3IK9A 3QOUA 4NXIA 3GSTA 3TDGA 2CVKA 2JL4A 3F4SA 5C04A 1M2DA 13GSA 1SKRB 1M0UA 2FUG2 1PX4A 3IK7A 3C8EA 4KUNA 1ERTA 3WF0A 3IDAA 3VWVA 3FR9A 1BHGA 3OG2A 1ZGNA 1TK8B 3NIVA 1GSFA 5IIZA 1FB6A 5B4XA 4RYDA 1NHOA 1A0RP 4D73A 4TR1B 4MGSA 2EC4A 5DPNA 2LRTA 4QQ7A 4KSMA 2PGTA 4PQ1A 2K9FA 4G10A 5KN2A 1JYNA 5IMCA 2HLSA 3FHQA 1OF3A 3VLNA 1IYIA 3LE0A 3UEMA 3O76A 5ECQB 3CMIA 2H6YA 3S9FA 3D4TA 5CP1A 5F06A 1A2LA 6GSVA 3PINA 4QB1A 4QL7A 1EGOA 4XUOA 1VF4A 4JR4A 2WN3A 5CRDA 1G0TA 3ACHA 1FVKA 2B9VA 4JEDA 2YZUA 4JKMA 1N8JA 3H8QA 4IQAA 1J83A 20GSA 2H75A 2PU9C 4GRFA 2VL2C 4ZL9A 3ZFLA 3U37A 2FHEA 3W8JA 2VMDA 2LNTA 3DRNA 1XBSA 5L71A 3VDBA 3O6TA 5CRGA 2LQQA 3VD3A 3ED3A 2DJ0A 4MJEA 3ERFA 2F8AA 7GSSA 2HZFA 2J9HA 3HD5A 1LNSA 2HE3A 3T08A 1K42A 2XPDA 4I97A 3TKSC 2GZZA 1JHJA 5I0DA 5HFIA 4ARXA 3I97A 3V1WA 2DBCA 3ZVJA 1GTIA 4P00B 3KIJA 2ID4A 3LEKA 3VD7A 2RUFA 3I2FA 1PD21 3CIHA 4UAPA 1O8WA 2H0HA 2CAIA 5AIXA 2VUPA 1TVGA 3I69A 1DYOA 2VLVA 3HPNA 4FO5A 2RM5A 4ECBA 4AF2A 3TGZA 2Y6HA 1AW9A 2CX4A 2MMZA 2H6ZA 2LSTA 1RK4A 2Y6KA 3IXRA 2CZ2A 5B8BA 4PXOA 2J1EA 1M99A 2V32A 5IOWA 4V2LA 3VDCA 3DKSA 4BK4A 1PRXA 1WP0A 3BCIA 3CBUA 1SKWB 3UETA 4MK3A 3TCOA 1XWCA 4I8BA 4K1FA 3SWLA 1XC6A 2FY6A 5LNKe 1SJIA 4QB6A 2JE8A 4PQHA 1JZ3A 2Z4FA 4OZOA 4ZZ8A 2QBXA 4L0WA 4CU7A 1GNWA 5GAPD 5IFPA 2W9XA 1ST9A 1YF0A 1S3AA 3MUZ1 1MDIA 3DXBA 2DLXA 1B9XC 4MJAA 4MMMA 4EDZA 5GSSA 2YNXA 3TRQA 4CHSA 2PUKC 5DVBA 5G2ZA 2HSHA 5DJMA 6GSYA 3I2KA 4D8MA 2VTFA 3K75B 3WT1A 1G6YA 3ZVJD 1B9YC 3WQBA
chains in the Genus database with same CATH superfamily
3IE3A 3FLPA 2GAUA 2R072 3G7JA 2PHWA 1X8MA 3G7IA 4CXYA 4XAEA 3M1HA 3VWWA 1N3QA 2BU9A 2YANA 1T6GC 2TRCP 1ULGA 3D5OA 2VZPA 2AREA 3ZR5A 2D3RA 1DQ5A 5BNPB 3DL3A 4BHPA 3T09A 2WCIA 1GUHA 3POWA 2HWC1 2E7AA 4HVRA 5B6MA 1YIPA 3F9UA 1OVPA 4YVSA 1JN2P 1CX1A 3HZ4A 1LGBA 2W39A 1FOD2 5TSWA 1XXNA 4IJIA 1GSYA 4QPIC 3P7XA 3KV4A 1MZ5A 4OO4A 3IAS2 1QJU3 3OEBA 3C7OA 2LS6A 1R4WA 4QPGB 1JH5A 3GKMA 2WAOA 1F35A 4QQHA 1U88A 4LORA 2OJLA 2NVLA 1MDKA 1GOGA 3OUIA 4XFAA 2Q5TA 3DYPA 4RR3B 1FPN1 4Q4X2 3H3LA 2V1MA 1Q43A 2Y26A 4TR0A 2A7AA 4M3CE 1S0CA 2R7EB 2YPMA 1Q8PA 3PNAA 4OYUA 6GSXA 1YFUA 1O8XA 2CVBA 2RVAA 1W0OA 4MXWA 2CZ3A 3OY8A 1O4TA 2JD4A 3PMEA 1RQMA 1RGSA 3GKKA 2VCQA 4O5RA 1GLPA 1HNCA 3GTUA 3GV1A 2EIEA 1POV1 3RZGA 5IK5A 3WW4A 3T0AA 1VRH1 3OYWA 4K8MA 5FZIA 2O89A 1UIJA 3APBA 3DVWA 4WXTA 3LQ7A 3SCFA 4AI1A 1XNTA 3MW4A 1V2AA 1IS4A 5G31A 4PUAA 1S2BA 3JQWA 1ULCA 2ZPXA 4OFTA 1O91A 4LKSA 1O7UA 1YQ5A 3S7IA 3MYXA 3UIWA 4AAXA 5I8SA 4JU5A 1WRYA 5LEJA 3SC7X 1X50A 2H66A 1Y3TA 5JPMB 2R073 1F31A 3WGXA 3DYOA 3LKJA 4HXCA 3NJYA 2DU1A 2XJQA 4HK8A 1EEJA 5GZCA 1DCSA 2VO5A 1UN1A 1QHDA 1ULDA 3GZAA 5BNOB 2LS5A 5J41A 10GSA 3ZIJA 1NW2A 2PAMA 4LNVA 3S7EA 2ZEXA 1DBYA 5F3IA 4FPHA 14GSA 5JCWA 1WGPA 3UJOA 3EVIA 1XNCA 1Z6MA 5FPXA 1UOFA 1R081 4JX0A 3I3QA 2TUNA 4CDOA 4JGYA 4W50A 3C73A 4E8CA 3NMBA 1ZZ9A 1GOHA 4XF9A 2Q30A 4O32A 1W06A 2Q4SA 3ASIA 3VV1A 4I2UA 2E51A 1UXZA 2VJXA 2XLFA 5ISLA 1CVNA 2C8UA 1S4CA 1JHNA 2BBAA 1E6BA 4GF0A 4QHOA 5J3RA 4Q4V2 2RMU1 4TXVA 4BVXB 1RUD2 4Q5OA 2XB6C 1S0EA 4HOJA 1MD4A 5FREA 2D2ZA 1SBEA 1W2TA 4GSSA 2WT0A 2WA4A 4IL7A 5KR7A 1ERVA 3TKSA 4Q4X3 1PX3A 1XW5A 4GWJA 2BBVA 1UKRA 3FW2A 3A23A 5FPAA 3PTRB 1U5YA 1UMIA 3I2GA 2JECA 3IMMA 3WW1A 4F2IA 5C9AB 3A5WA 2JJ6A 4YRDA 5EL8A 4G9SB 2HWC2 4NIDA 1WLCA 4CP1A 1QEXA 3SH4A 3EMXA 1XE8A 3VD4A 3B9IA 1HJGA 4XTSA 1HB2A 1OVNA 1MS0A 1HX6A 1HN1A 1K5MB 2VCTA 1V57A 4BVYA 2YMZA 1WCQA 1MDJA 1PK6C 5IOXA 5FZAA 2D6NA 3R0RA 2VNRA 3O1TA 4PT6A 2V72A 2FA4A 4AXOA 3BCWA 3BIWE 4LLOA 4XTMA 4Y20B 2XOMA 2WZEA 3MLJA 3QFBC 5LD0A 2JDMA 4Q0SA 3EBRA 4DXSA 3RYKA 1ENRA 1F2EA 4HQSA 2BTOT 4HMZA 3USSA 2BNNA 1FPN2 1DE2A 5FZMA 5DAKB 5GLTA 5ID2B 4CYDA 4ATEA 5HR2A 2DJ3A 4ULXA 1BAYA 1PL1A 2P6HA 2E26A 3MWHA 4NV5A 1L3JA 2VOXA 4CDQA 2GH2A 4XS1A 2IMDA 2F4LA 4WBBA 3RVHA 5F7UA 4ECIA 3CJIC 5FHIA 4POMA 3UBLA 1AX0A 3U10A 2WNVB 3J8F1 3WDUA 2E0QA 1IYHA 4L92A 2H6CA 1YFXA 4CP9A 1T1VA 2DFCA 1NE4A 1T8EB 3AVRA 4L8QA 3QAVA 2X64A 3P6BA 4MGQA 5FY4A 2BNOA 1Y25A 1DFQA 2RV9A 2NBSA 3LCPA 1ZYNA 4WM7C 3HNBM 2MYGA 3NV1A 3LSZA 4WETA 3I3EA 5FMOS 5FBZA 2A6VA 1MD3A 4N11A 2BFUS 3GURA 1K0DA 5T55A 3PH9A 3WP3A 5FYIA 2ZMKA 2RE9A 3V0BA 4UXAA 1MTCA 3TNPB 1QUWA 3SITA 4CCJA 3U5RE 2F8FA 1QQ2A 1ERUA 1VF1A 2UWAA 2WA3A 4E9KA 2LJAA 5T5JA 1YLLA 3M3OA 2W1QA 1JZ5A 3WP6A 2IMKA 2MZCA 5IFTA 2EALA 1DQ2A 1QJFA 1IPJA 3MIXA 3OUHA 4BB3A 1DSBA 2HWC3 1L7LA 1RUH1 3D6IA 2OIIA 2P31A 1R082 4UFHA 1QDOA 4XMIA 2NDOA 4O5UA 3WZ1A 4BOWA 3SEEA 3WNKA 1S0FA 2VLUA 4LHSA 4XEZA 2B5EA 5B2GB 1I5GA 2XLAA 1ZVFA 3KP8A 1F5JA 4BQ4A 3VWUA 1QQP1 4MH3A 3V0AA 2WZ8A 4IP6A 5EJ1B 1Q3EA 4XXAA 1RJ7A 2RM21 3EB7A 3PIJA 2RMU2 4ECCA 2D5FA 3HJPA 2GDFA 1U3AA 3VHRA 4CU6A 5FXZA 2XR4A 2YWMA 5BRTA 3AY8A 1W2OA 1KGYA 3QMXA 1NLSA 3KMHA 1YY7A 2ZHKA 4TXOB 2JDKA 2WL1A 2HRKA 1SLIA 4XFFA 5FLIA 3C3VA 1V98A 2PBJA 3N9LA 3PGTA 1FPN3 4P5HA 1KEBA 2YDEA 1JZ6A 1WCSA 1ZBA2 1NA1B 2DYCA 3CRUA 3AZYA 4CDXB 1JS9A 4KGGA 1LOGA 1OOPB 3J7NA 3QFAC 3NL1A 5I0SA 2FCUA 1C8M3 3HQUA 1S2EA 4WR4A 3PUAA 3V56A 4CW9A 4ZKTB 2PHUA 3UJQA 1POV3 1TI1A 4Y1XA 1Z78A 2ES3A 4E2GA 3IIAA 4D69A 2RM6A 4DUXA 2L5OA 4QHZA 3VN4A 2E6VA 5FP9A 2VZQA 3L4NA 3UGFA 4GQ7A 3GMFA 1WBFA 2VBBA 4LQRA 3T1MA 4NR1A 1WWYA 1AR91 1AX2A 2VCXA 1FHEA 4HPKB 2Y64A 3O1MA 1ACVA 3ITQA 2DURA 3THTA 4MCUA 4D7YA 3WYWA 1AQXA 4BDVB 1U87A 1ZZ8A 3OPTA 5FYVA 1XG8A 1US3A 3LOBA 4EIPA 2HEWF 1XVWA 3C71A 1UL9A 1REDA 2QA2A 1IG0A 1LHWA 5H9PA 3G9BA 2PXJA 4HSCX 1CZVA 3LD8A 2CYFA 4UF0B 1SL0B 1UZ0A 4M4PA 5CAXA 2VMFA 5D2AA 3CL1A 4W6XA 2R042 2ZABA 1SK1A 3WNMA 2VZ3A 4H7LA 4NPMA 3JD71 1I6XA 3J8F2 1R083 5FZDA 4IE4A 5CG8A 5IK8A 1UPSA 2BGPA 1MPXA 3SBCA 1EV11 3U1XA 1GWCA 5E59A 2VZOA 4HN1A 5E8AA 3VPTA 1WLTA 2DVDA 3M9JA 3KZ4C 4D73B 2FWFA 3GZUC 4PF1A 1Z9HA 1TE1B 2QUOA 2RMU3 1ZZ7A 4FTEA 2VUCA 4JTNA 2AUVA 2YC4A 3FKFA 4QAWA 1MS3A 2ATFA 5EYXA 4WV8A 1V6IA 3MDKA 1RHI1 5H5SA 3RZMA 4XUNA 5FWEA 3H8OA 3LPGA 4I6XA 2WN2A 2M72A 2F51A 2HJIA 1ZBA3 4IEOA 2J1RA 4AL9A 1JLVA 2H01A 4ZS2A 1AQWA 1B4QA 1LJ7A 4Q5RA 4S2HA 5IUQA 2EXJA 2JACA 2DCKA 4NMIA 3H8RA 4YFZA 5A6XA 3D82A 2W3JA 2NN8A 2WBKA 2XLGA 4A42A 1X9PA 1GYKA 4IESA 1TRUA 1VE0A 4I0AA 1IS6A 5C5TA 1C1LA 3TNQA 2EA7A 5FP4A 3MEPA 4JQTA 2DVBA 3I59A 3WXPA 3CJIA 1PIV2 2JG8B 4AGRA 4K0GA 4OI4A 4JE1A 1ZZ6A 1QQP2 3THDA 3VBRB 1NKGA 4LMVA 3VBSB 4X8PA 3BIEA 1XWGA 1V6KA 4YW7A 3GA4A 4PI2A 5FY9A 4F0BA 4GJYA 2Q1ZB 2R16A 1C5IA 3ABZA 2Q1FA 2NZ9A 3VHPA 4JKKA 1URXA 4WM7A 5B7CA 4GWNA 1S0DA 5D8AB 4OHZA 3OD0A 2RS11 3P90A 4YG6A 4HEA2 2JB8A 1BX9A 2C3TA 4OD7A 2VZSA 1QOTA 4KH7A 2ARCA 3BB6A 2I74A 2GTUA 2YBPA 2QZ2A 5C00A 3L9VA 2ALBA 5FYCA 2MMAA 1HRI1 2BUKA 2R043 3IB3A 4KDUA 2XVLA 19GSA 3W5NA 5IW0A 4YW3A 1F4HA 4L9BA 5JI7A 3AVSA 3PDQA 3HR9A 1UNBA 1TRSA 2JDUA 5F05A 3H42B 1OD3A 4QKBA 1HIXA 2VMEA 1SL2B 3ZMLA 1O6UA 4Q5FA 4ISDA 2C26A 5A7WA 5BYNA 1C72A 3D6EA 2ORZA 3EINA 1H1MA 5LCZA 2ETEA 4QQPA 2ET1A 4POLA 2FD8A 2VCAA 3K2OA 1TRVA 4YVWA 2UY8A 3R4SA 4KGIA 4YVSB 1ZNPA 3QCPA 1ZBE1 5DUVA 3OSDA 2HWD1 1JYWA 1X7NA 4K7NA 1YCIA 2KXLA 1GP6A 3PUIA 5AC91 2DIYA 2RHPA 2VTXJ 4DFSA 4OFGA 1M7TA 2G9FA 4D94A 3BI3A 1PGSA 4XJ8A 2C9AA 1SHWB 2R0GA 2PN8A 1M3JA 1O59A 3KH7A 1YEWA 4A6OA 1D4M2 2IC1A 1H2KA 1CAUA 1GFF2 4IETA 5DZEA 3TN93 3JD72 3UKNA 5L9VA 3AP7A 1EV12 3HBZA 5FZ1A 4OCEA 4F82A 3KB5A 2X99A 5FYTA 1PIV3 2WFCA 3KM5A 4WF4A 3M4FA 2HSYA 1QQP3 1A2JA 1QMVA 2UYAA 3H50A 4RA0A 1G9BA 3EPTA 5EHDA 4L5OA 1A8YA 5F5QA 3O1PA 1PGW1 5FZGA 2A6ZA 2HEYF 2NTOA 1PNGA 2VCBA 1UU6A 2VL4A 2IWTA 3N5OA 4FYBA 1I9DA 1UN2A 1H8TC 3K77A 4QKNA 5ECPB 1RHI2 1PGL1 2XKOA 5A7PA 3BODA 3GTUB 5FYZA 2WULA 3MLKA 3GN3A 4EE0A 5A7NA 2C1FA 4OZXA 3OYWB 5HV4A 5A3NA 1HJFA 2QFEA 4TOPA 2IXLA 3CEWA 2KLXA 2O0OA 1AAZA 1W2UA 1HQWA 2A2SA 2AAWA 4TRXA 4HFSA 4C90A 4PTSA 1IGOA 2DKIA 1YFYA 3B93A 2Q8OA 2YXSA 4HUAA 5KN0A 4KU7A 2JSZA 4LJHA 1HXS3 4HVOA 1GTBA 2OKXA 1VBD1 1F3BA 3E5UA 3L0HA 3NWKA 1HNBA 2MEV3 1LCLA 1JYIA 4OI1A 2C6SA 3LEIA 1YQ6A 3C8XA 4W65A 1IQDC 5F8PA 4OUSA 4QDQA 4AFCA 4QT6A 1APNA 5CFCC 2XJRA 1EV9A 1K0NA 3AP6A 1FI2A 2B42B 2ES7A 2XJSA 2QQIA 1C4RA 4JGZA 2CHHA 3EHKA 3JZVA 2H74A 3SISA 2QC7A 3IR4A 2ZGNA 3LEFA 4JGYB 1U5ZA 2RS12 2K18A 1Y6EA 5DN2A 3VGIA 4MO3M 1GP1A 1Z7RA 3DECA 1V0AA 1WBLA 2VUAA 2P34A 3ZMNA 4EC0A 4HJMA 2PA7A 2VCMA 3QPMA 1REEA 1D4M3 4AE2A 3A2WA 3ZL5A 4KG8A 1WD4A 1XB9A 1ZZYA 3FZAA 2WS91 1HB4A 3GZTB 1LOBA 3BALA 4FXKB 4DSQA 2NYYA 5FWJA 4PUFC 4ASKA 2BOJA 5CKNA 1G7EA 1AXDA 1WZXA 3D0SA 3ZKUA 5BNNA 2XPEA 3BKZA 3VPQA 1J3QA 5FWGA 5AISA 4N53B 1G9AA 4ECJA 3DYRA 4JR6A 4LITA 3GHMA 1O6JA 2LV3A 1ZBE2 2BRTA 3VBOC 18GSA 2DJ1A 1RUJ1 4RFRB 5A3PA 2HWD2 1J84A 5CRHA 3PUSA 3VWXA 4HKWA 1KJRA 2E7PA 3FR3A 3G7YA 3K51A 2DC5A 1QXJA 2CSGA 2JIGA 5AC92 4XFBA 2ADEA 1PMIA 4IJ3A 2VUDA 3U75A 3GYKA 4UWDA 2Y38A 2XJPA 3VKLA 4J25A 3G7DA 3ZXAC 2B1LA 3HN3A 3FMGA 3IN9A 2GSSA 5DG2A 2FDGA 5GZFA 1ZRFA 2HWE3 5IO2A 4B1MA 3APOA 4A7YA 4HKOA 3ES1A 1H6YA 2OBIA 4G9HA 1G8WA 4RFT0 4K20A 1D4VB 2CWSA 5DABA 1XZOA 3VZKA 2ZCTA 2WQ8A 3N3HA 1ENQA 2JWPA 4FI9A 3FWEA 3MFCA 3AM2A 4QPYA 2WSVA 4ZPIA 4NJ4A 4WEYA 4TWTA 2CV4A 3LEGA 4OO5A 3RPQA 1PGW2 4AZZA 4CCDA 4WZFA 4MZUA 4CDQB 4LTAA 3C2UA 2OADA 4EKZA 2IXKA 1E5SA 1EUUA 4BYYA 1F6MC 4W4ZA 3HJRA 1PGL2 2RG4A 4XFIA 2JZRA 3GKXA 4IP1A 4AEJA 3LSEA 1UW8A 3POYA 4AEMA 1ONAA 2RS13 2FMDA 4LBOA 5ANNA 2V2GA 1LHVA 3GSSA 4DINB 2TRXA 2UWBA 1K3IA 2YN1A 1ASJ1 1YJKA 1D2SA 2O8QA 3UKVA 3IPVA 1H6XA 3MZHA 3OGSA 2QQKA 5HFGA 1UAIA 1PMTA 1E5HA 1GSEA 3ZYPA 4X6RB 3KQ4B 2R6QA 2OE3A 1YHFA 1PO22 1VBD2 1KBNA 3L9SA 4O92A 1ND3B 1OC8A 5LA9A 4IHUA 5HFKA 5J96B 3FUOA 1GNHA 4WBJA 4ET7A 3Q8AA 4K5SA 5IVCA 1DZQA 1UYYA 2VUJA 4G4FA 2VCCA 2YJ7A 5JOZA 2ZEYA 3WR0A 2IFRA 1SYXA 2M80A 3CSHA 2RDRA 2P0GA 4BZ4A 3IC8A 3L78A 5AGYA 1HB3A 1W9SA 4KWJA 5JZGC 4WVMA 4ZB9A 1C1FA 3BBYA 2R6KA 3KTLA 6GSWA 5KC6A 3PVOA 5DDJ3 2DBIA 3TDGA 2XL9A 2HWD3 5FMOL 2VQAA 5A7QA 13GSA 3HBKA 3IK7A 2VW1A 2BFUL 1ERTA 3WF0A 3VWVA 2BWCA 1S0JA 3FR9A 3OG2A 1ZGNA 3NIVA 3V0AB 1FB6A 3PVEA 3AFGA 5AFBA 1XQNA 1UX6A 3ZX7A 4XZPA 4MGSA 5CIRA 2RJKA 2EC4A 4QQ7A 3N9MA 2PGTA 4PQ1A 5GLUA 4G10A 5ANQA 5LY2A 4O7XA 1IYIA 3LE0A 4XF3A 4Q29A 4CSWA 3CMIA 2H6YA 3PINA 4QB1A 5EWSA 4QL7A 1EGOA 2WN3A 3GJBA 3PURA 5A1LA 1MS8A 3H8QA 3VL8A 1J83A 2H75A 4HK9A 2VL2C 3ZFLA 3U37A 1AZDA 4QPGC 1IS5A 1U5XA 3DRNA 1VBB1 1RVF1 1ZA7A 2DJ0A 5JOXA 4TZDA 5CFCA 3KF5A 2IXHA 2J9HA 1RUJ2 1Y9MA 4NROA 5GJ6A 2XPDA 4PIXA 4NHLA 4I97A 4FFIA 2GZZA 5HFIA 2JE9A 2LRPA 3I97A 5LBBA 3V1WA 3S5QA 1AF9A 1QOOA 1RB8G 3KIJA 4P00B 2ID4A 4AI8A 1YI7A 3LEKA 5AIXA 2VUPA 1OLRA 1DYOA 2VLVA 3HPNA 2F6BA 3KD4A 3TWIA 1CX4A 3PL0A 3O0WA 3CJXA 2UURA 1RK4A 3IXRA 4ZU4A 2ZHMA 3AKTA 5B8BA 1PO23 1VBD3 5IAXA 4YG3A 5LK7B 3ZOIA 1XU1A 4YM3A 1B09A 1WP0A 3TEXA 5FKCA 1GV9A 1SKWB 3UETA 2B7YA 5FY0A 3NNMA 1XC6A 4AWDA 2FY6A 5LNKe 1SJIA 4QB6A 2CV6A 2Z4FA 4OZOA 4IGPA 5GAPD 5IFPA 3O1SA 1AJKA 3MUZ1 5I8YA 2LALA 1HN0A 3JB8A 1XSQA 4MMMA 5GSSA 2YNXA 4RGAA 5ERLA 2PUKC 4ISQA 4XPVA 3OF1A 4XTPA 5C8CB 3I2KA 2AUYA 5GLWA 1PZ7A 1DQ0A 1ASJ2 5FXVA 3VBOA 3AZVA 4OHVA 5SV5A 5BNOC 1W6OA 2H0BA 2VAUA 2DTWA 1XFLA 3EYTA 2RS51 3GBFA 1AX1A 4Z1VA 2P5QA 2H1GA 1POV0 2CX3A 4XQWA 5FZFA 2L6DA 2A3WA 4CP0A 2WFPA 4MA9A 2XWBB 1MVQA 4DZGA 1CD3G 4XHXA 2ZAAA 1AUYA 3KCCA 5LBFA 1ACCA 1BMV1 4M01A 4RGKA 2D93A 4XUQA 1RUC3 2XG3A 2VQTA 2LKUA 3ZN4A 1N1SA 1GBGA 4HS1A 4LA2A 2P4EA 2H6XA 3OGGA 3H7JA 1RUJ3 3ME7A 4ZB6A 3CJIB 2VCZA 3EC3A 1YQ8A 2ZKNA 5KEJA 3MPPG 4AR2A 1BEV1 1SFYA 3POJA 1SKSB 1W90A 4FH8A 4NWYA 3US3A 2O1QA 5IVYA 4QD2A 2XXZA 5JSRA 2P3JA 4V1PA 5C9AC 5C71A 4URTA 3NNJA 5KHHA 1XOYA 1O4YA 1R1A1 1RC6A 3APQA 3BYWA 4IUGA 1GSLA 2LUWA 4JHTA 1EWXA 3SLIA 3GCXA 4PX1A 2PHLA 3BPSA 2FZ2A 4KF9A 1DBNA 4WM7B 2YROA 1K5MC 1DG6A 1KEXA 5F5IA 3WCRA 2WNUA 3W9AA 2AYTA 3AKSA 5A6ZA 1VB4A 3K4DA 4A2UA 3FC0A 1N47A 1J3PA 1VBB2 1RVF2 2GSYA 3JUUA 4CCNA 1THOA 4XRAA 1GQHA 1PL2A 3FYGA 3PMSA 1VF3A 4GMP3 3M3QA 4YW5A 2OZ6A 3DWVA 1XYOA 3KCXA 4KWUA 1O3TA 1Z7S1 3NKTA 4LHNA 3E1F1 3D0ZA 1W6NA 3ZN6A 1AC1A 4AQTA 4Q8LA 5JWQB 1O5UA 1NY71 4RQPA 3GKNA 4YM1A 5JZGA 4D6SA 2VPVA 2ZGOA 5DUUA 4CY6A 2R4VA 4Q5QA 2WNEA 2OVUA 1WA4A 2WWJA 5LY1A 5A7WB 1YQCA 4P9GA 3LYKA 4IEYA 5FK8A 1UWWA 4X0XA 2YV8A 1NCQC 5HPOA 1H2LA 3DF0A 5FMBA 3BUCA 3L2HA 1DUGA 4YVWB 4ZHNA 4LXLA 1IS3A 1LAJA 5ENUA 3CQOA 4NPBA 2FWEA 3SEPA 4AHWA 1JZ7A 4IERA 3KF3A 4ATFA 4J57E 1J9BA 1AYN1 1COV1 1Y9QA 5CNWA 1YYNA 3CTGA 2ZJCA 1OMIA 4L8EA 1ZRCA 4YARA 5CKQA 3PVNA 1GZWA 1XBFA 5L19A 5JPNB 9GSSA 4AW7A 1TW9A 1ZM1A 1AYM3 3D21A 2WO2A 2NLRA 3BU0A 1W8NA 1J0FA 5L7OA 1YO8A 4AI0A 2JZSA 2LJKA 1EV4A 4NRMA 2FA8A 1DP0A 2XJUA 4I01A 1GKBA 2ZAHA 4KSOA 2YBSA 5D9TA 1SBDA 4C91A 4N9IA 3IDEA 1W05A 2W95A 3I49A 4KA0A 3T2TA 4IKHA 4A6SA 5FYBA 5EZWA 2RS52 4K7JA 4Q1RA 1BJXA 5F9TA 4BLJA 4Z92B 4E4HA 2GALA 2ZX3A 1YWKA 3EQEA 4UBGA 3NW4A 3P3PA 1L7QA 4ZL8A 2ZZJA 4TLGA 2WSUA 2OPKA 4LKEA 5C6CA 1RUNA 2VH9A 3NAPB 1ZCPA 1KD7A 4OHXA 1W9TA 2AH2A 2OPWA 4GXLA 3RG0A 1SJZA 1WW7A 2LTNA 3WF2A 3LOIA 1K0BA 1T4ZA 5D9WA 4K6XA 3ZFFA 2SBAA 4COVA 1ZYEA 2WYFA 5K7PA 5CO3A 3OBAA 1WIKA 2OW4A 1OAZA 4MADA 2H71A 2HFDA 5CADA 1V6OA 2YZ4A 4DXZA 3RPNA 4HN0A 1QJZA 2ILMA 2J1VA 3NKGA 1K3YA 3QAGA 1CPNA 3LGCA 1NA1C 3HQRA 1BEV2 2QQLA 3TEWA 5FZOA 3PUQA 3RZZA 4CDXC 2QA1A 1CPMA 5ECIB 1RUOA 2VR4A 3HXSA 1OOPC 3SKVA 4HZ4A 5FYMA 4KE3A 4B8EA 5C3PA 1R1A2 3CHXA 3BTAA 1E2YA 3CKHA 3O1VA 5DCHA 1PA3A 3ZO0B 4XCSA 4JGZB 5BNOA 4KNDA 5IJRA 1R26A 1JXNA 3E5XA 3R2QA 1ZA4A 2BNMA 3NV4A 1PNFA 1W9WA 5LZ6A 1BVVA 3I3MA 5FV3A 1QFNA 5A1AA 4QWNA 2RR11 2VMHA 1RUE3 2GZPA 2QDNA 3WG1A 4GXZA 4N30A 1S0GA 4AHXA 2YV9A 4ASLA 4P5YA 1Z7S2 4GB31 1GWLA 5F07A 3VBHC 3DXTA 3ATGA 3GZEA 4K7OA 4BWQA 2QDRA 3I4IA 4EV0A 5A80A 3QD9A 5GZEA 4BJ0A 1LHUA 1NY72 2IXJA 2XBO3 4MXVA 1QJX1 5BNNB 2ZEZA 4DO0A 2DV9A 2JXAA 4EWEA 3F3RA 3GYDA 1OPOA 4NWVA 3TKSE 5EQUA 1UOJA 2R0CA 4QU1A 5COHA 2G4IA 3N9NA 2VLTA 3ZREA 4XJWA 5F37A 3AYCA 3LSDA 1O8PA 2PTMA 4CDUA 4K8FA 1OE7A 1QH7A 1LKNA 4L0PA 3WUCA 2CA8A 4GSTA 4MLYA 1AYN2 1COV2 4GD4A 4AJ6A 5C3SA 2L5LA 4XC9A 3NJXA 1QGVA 1N2AA 2GNTA 4MLOA 1ZRIA 1UCXA 1DLLA 5J37A 2E63A 1I5PA 3ECQA 4G0LA 1V9WA 1GSSA 4XETA 2JDNA 1BYEA 4BQ3A 1JODA 2AHEA 3F0IA 3LQCA 3DXUA 5FBJA 4S2GA 5LBEA 2VVFA 2PERA 4QQ2A 2WDBA 4RQXA 3UBKA 2WZPP 5G5FA 3WGDA 5T50A 4ASMB 4XJAA 4TR4A 4IVFA 3Q18A 3ZYJB 3UVTA 2R5GA 5ID2A 1SLTA 1MR5A 4H7MA 2H1AA 2WRTA 4RI7A 2Q8EA 2VQUA 3AB0A 1LEMA 2V4AA 3U14A 1OURA 4E4ZA 2WNOA 3PTYA 5FJHA 1NCQA 3MIGA 4AOCA 3QD6A 4MZCA 3NSTA 4CUGA 1HRV1 4MGIE 1OQDA 3UVHA 2J1TA 3VBRC 4AGGA 3ZKYA 1HQLA 1URMA 3LDKA 1R5AA 3IPVB 1QJEA 4DVCA 2DJ2A 2L4CA 3H3UA 1BKZA 3M8NA 3OR5A 3KJYA 2PVQA 1DE1A 5HXMA 2O87A 4XABA 2WJUA 1Z7S3 1HV0A 3NZNA 3WF1A 2G2QA 3FHKA 5A4UA 1M9AA 4L97A 1HKDA 1H9WA 1PGTA 3D3AA 2HSMA 1NZIA 2C0DA 4N0ZA 1GZ9A 2XH6A 2YG0A 2EIDA 2WO1A 4RHV2 3FN9A 8GSSA 5FUIA 3HHVA 2ZGTA 1JU3A 5L9RA 1S2KA 2BERA 3GIXA 1J3RA 1O81A 2B5HA 1HD2A 5FOJB 3N4MA 1O73A 1WLDA 2KM2A 2WO7A 2PHFA 2ZX2A 4BXSV 4Y5Z0 1T4YA 4AGVA 3U07A 4D3WA 5KBFA 3NNFA 3AMQA 4WVMB 1JW6A 4QXCA 2R063 1V00A 2VGDA 4YNIA 5KXCA 2IVIB 4NIGA 1W28A 1POQA 3BTYA 4IGOA 5ECLB 1TZOA 2X5IB 2ZGUA 2OS2A 2DVGA 2BV4A 4BM8A 4N43C 1PN0A 1DYKA 2RR12 4AVAA 2E7QA 3GX0A 1LODA 3ZXGA 1T6BX 3FFZA 1J08A 3GGLA 4WVWA 2R49A 2LEGA 2WDUA 4GB32 3OGVA 1UPIA 4YVSC 1SD9A 3VLBB 3AKRA 1YEXA 4EN9B 1W8TA 2VNVA 1K0OA 4JZRA 4PIZA 1KS5A 2VNGA 1W8ZA 3WW3A 5A4VA 4CEWB 3K46A 2D6LX 2DIZA 2R2JA 1GICA 1EYBA 5JXHA 4HI7A 4IE5A 2IFQB 1TOFA 2JEMA 1NA1A 3W5MA 4MH0E 5JWOB 2CL2A 4CDXA 3RRDA 5ECNB 3WHTA 4POKA 4UI9L 1OOPA 3W20A 1L7RA 2HRNA 2X8GA 3IDVA 2ZGMA 2FDJA 1F9MA 1K3LA 4Q27A 1HV1A 2AACA 3ALQA 2JD9A 1JUHA 2ENRA 1DGWA 5JSOA 5FZ4A 1Y43B 5IT6A 3VBUC 4MVTA 4AVSA 3RYRA 2BPA2 1OT5A 3BN6A 4INDA 1JZRA 2B5XA 4AF9A 3TJFA 3AMHA 4YSFA 2MNGA 2IPAA 4FP2A 5FJKA 2R1DA 3AYEA 2GQMA 4K0NA 4H86A 4IGQA 4MX3A 4COYA 5IMFA 5DG1A 4MP4A 1VRSD 5KN1A 3ZIVA 4RHV3 4QX3A 5DZFA 3VBHA 1YUDA 4FPYA 2HWB3 3E3EA 3E9JB 5GKAC 1KDMA 4L5LA 1WOUA 1UIKA 3IIIA 1MVEA 1H2MA 3POGA 4N90A 3ST7A 1UC7A 2H70A 3EMRA 4UFKA 2B4KA 2H19A 1OBNA 3LGRA 3OBRA 1WMDA 2E32A 5JXGA 2X8KA 3HZ8A 2XMLA 2Q8CA 2VM1A 1HRV2 3QOPA 5F2WA 2IMIA 1TQ5A 4P02B 2OE1A 2VTXA 3BOPA 2D98A 5HCBA 3V65A 1M4WA 3NOFA 4LHKA 1ML6A 4LBLA 2PVOC 1W6OB 1HQNA 1VMJA 4TVEA 5DZGA 4J1XA 4H14A 4YW6A 2LRCA 4GB33 2DU0A 2B1KA 2FWHA 2YUEA 3TRXA 2A70A 4EN6B 2HZEA 4UFIA 5H5QA 4BXFA 1TRWA 3B7MA 3Q8BA 4JGYC 3SHRA 5A3LA 1MEKA 3KGKA 5HR3A 5FZKA 4F83A 4O7HA 5C5UA 3S5AA 3ACGA 2JIJA 4I30A 3WY6A 2VOWA 3ETQA 1BZWA 1OQEA 1XCCA 3HN1A 4Z2RA 1FMD1 2W94A 4QMAA 1GWMA 3DIEA 3D22A 5DUXA 3RYPA 2BGOA 4YZ5A 1I9RA 1E5IA 5ABRA 3CQFA 4CPBA 4I2OA 5A3TA 4I0WB 3OTFA 2IIYA 2JDPA 2C5DA 4LHLA 4OFNA 2LRNA 4XHMA 1IOAA 4AEDA 4MZWA 2QE3A 1X33A 5JCUA 5A4WA 2G9GA 3UT0A 1V40A 3ZTLA 3ZPYA 3IKWA 2HNLA 5KN3A 4AJ7A 1OC1A 3M70A 4N53C 3SKJE 3AFKA 2H6BA 5EJZB 5FZ7A 1W8WA 4GWRA 3C1RA 2PFWA 1W6QA 3TJJA 1UX7A 5FZ3A 4IV3A 2RIIA 2ZGPA 2WNUB 2WR9A 1W4VA 2F17A 3OPWA 1GLQA 1LU4A 2OYZA 1NOVA 3FY7A 4QX2A 4CCEA 1A23A 4EF0A 2A3YA 1LESA 1TK5B 5D9XA 4KG0A 2D40A 1FW1A 2WC2A 5J4UA 2BOIA 4QGLA 3EU3A 5F3EA 3CZUA 3T3YA 1UY2A 4ZXEA 2KP1A 5G05L 1IZ3A 1W6NB 3ZN6B 4BMBA 2E33A 4CE8A 4DRRA 1B48A 2WQZC 5FZ9A 4I2TA 4RQPB 2CTVA 5JZGB 1FAAA 1JZDA 2I1UA 4B7EA 3F4RA 4JC1A 1GH2A 1W6PA 2UYBA 2DVAA 3VZNA 1NXD1 4CDWA 3IHQA 4Y5TA 4CP2A 2BVVA 4CDQC 2VM2A 5IVBA 3HQXA 4N43A 3H1YA 4Y1YA 2Z9SA 2W1WA 1USBA 3ZXLA 1DGWX 3VKNA 3DMLA 2WS2A 2HRFA 3KSCA 4GCIA 2ARAA 3QR6A 5AFEA 3KHCA 3MUY1 3BOAA 3ISOA 3BGAA 2DDUA 5FZEA 5E6HA 3FK8A 2CVDA 2JDAA 4Y1VA 4ZILA 1VIWB 3MO4A 2VOCA 5J09A 1GZWB 2P3YA 3D0JA 4A3XA 4DSSA 3Q19A 3AP5A 2FLSA 1A8LA 1F4AA 3AJZA 4GAZA 1ND3C 2E7TA 1HW5A 5DAXA 5CAZA 3RDWA 5L7OB 3WHUA 4ZB8A 4ACSA 1M9BA 1W99A 1XSRA 3F2ZA 2C0EA 4P3YB 5K0UA 4EL1A 5FCCA 2Z79A 4N7IA 1BQPA 2GC2A 3ETPA 3ZDVA 5KOWA 2PLV3 3PVBB 4ARYA 3C1SA 2VCWA 1PVXA 2B6MA 1W6MA 5J98B 1O3SA 3BTZA 1LEDA 4QHBA 2W08A 3VB9A 4WM8A 3VBUA 3P1IA 5F2SA 1Q8SA 1IPSA 1FB0A 1C8M1 2AEYA 2ZX4A 1THXA 3TB0A 5CG9A 3ERWA 2PN5A 4NAMA 1FMD2 1M2AA 2RJLA 3KVBA 1OUXA 3RJ2X 3ZFFB 1QJY2 3E97A 3KTBA 4XJ9A 4QX1A 3L9JT 2D5HA 4V2WA 3ZXEA 5JMOA 2FCHA 5FTTC 4CU8A 4RL7A 3ZYFA 3UV9A 1G6NA 5FZOB 3GRXA 3MDPA 3N7LA 1YKCA 5DDLA 5K9YA 2OT7A 4ES9A 3PR8A 1K12A 1QK8A 4YW4A 4CXWA 4BE3A 1LR5A 4LULA 1F37A 3V64A 4JZQA 3X29B 1S3RA 5E89A 1W39A 1RITA 4GWIA 3TB2A 5I91A 5L36A 1PHMA 4JRLA 1UOBA 4Q4Y1 5LRRA 5A5KA 4B29A 3ZLIA 4JCKA 2OACA 4EO3A 3A0NA 4F7ZA 3P5BA 2HYXA 4XBLA 4AGSA 3LWCA 4AG4A 3LF7A 2A2PA 1EP8A 3LDRA 5EPAA 4JQRA 1PZ9A 3VHNA 2DFBA 2TIRA 2ZXQA 4FYCA 4Q4W2 2H0GA 1WJKA 4U2AA 4EIQA 5AN1A 1YRZA 1OKQA 1UY1A 2YJHA 4G19A 1KS4A 1A8MA 3WW2A 4EWAA 1OA4A 1XWAA 2X4AA 5IAVA 3R6SA 5A3MA 5GZZB 3WNXA 1ZBA1 1Q8QA 4AYUA 5HBAA 4AQSA 1W8OA 1UF2C 1DYPA 3NO8A 2QGVA 3FE5A 4WVVA 4CDUB 1WKYA 4N53A 3I9V2 3WD5A 1SCRA 1QNWA 3USUA 5C8CC 4C0HA 2C4XA 3ZYGA 2MBSA 3F6FA 3QOUA 4Z2TA 1YNAA 4H55A 3F4SA 1M2DA 4XILA 5KC5A 1M0UA 3C8EA 4KUNA 1LGNA 1FMD3 3AJYA 1BHGA 3RNSA 1QJY3 4PF5A 3VBFC 1CQ9A 2MPFA 3RGBA 1CESA 3HVNA 2XGXA 1WLWA 4E4DX 2W68A 2Z5WA 1A0RP 2WWSA 1LECA 5DPNA 3ZXJA 4XAAA 5JOYA 3K3NA 5KN2A 1AL0G 4FOVA 3O76A 1X9TA 1V9U1 2UZ8A 4UT5A 3D4TA 5BPXA 2EF6A 4XF4A 4XUOA 4JR4A 3ACHA 3JU9A 5K4LA 2B9VA 2ZZQA 3PHMA 4JEDA 4E2QA 4COZA 4JKMA 3GF6A 4IQAA 1GNZA 2FHEA 4BCUA 3E6BA 1DZTA 2ZHNA 1XBSA 4BU2A 4LBMA 3ERFA 4EN8B 2R041 1NCQB 4C8DA 1C8M2 2ZTNA 3HD5A 4YW2A 2HE3A 3T08A 4CZSA 1BJQA 1K42A 2GMMA 1GTIA 4RSUA 3VD7A 3CIHA 1FT9A 2D97A 4UAPA 4PLMA 4Q4W3 1TVGA 4NPRA 2YHJA 4KBZA 4KWLA 4QKDA 2PQQA 4AF2A 4XOGA 1AR72 1ZRRA 5HI0A 2MMZA 2H6ZA 2CZ2A 2J1EA 2V32A 1ND3A 1W04A 2FZ1A 1CAXA 1RMU3 4LO4B 5F3GA 5H9QA 3DGTA 1AR82 4UYBA 3R3EA 2D6OX 1S0BA 2DVFA 4XMAA 3GNEA 4PQHA 1DGLA 3AXEA 2W9XA 1NYWA 1BYHA 1S3AA 4Q4Y2 1MDIA 4LEJA 2RDQA 1OH3A 2NM1A 5FPZA 3TN91 1J58A 4EDZA 3RS6A 3I54A 5EV7A 5LWBA 1QY4A 2HSHA 5DVBA 5DJMA 3K75B 1G6YA 1QXRA 4IXLA 1C3HA 1B9YC 5C7GA 2V41A 1PIV1 3UGHA 4B7KA 2WLPA 4MV2A 1EAH3 2GDRA 2Z2SB 4P9XA 4GQFA 4JDOA 4EYUA 3VK9A 4YVWC 3RFRA 4HVQA 3C7GA 5DAVA 3RWKX 1WE0A 4K1ZA 1T2XA 2VAFA 3HKRA 2O14A 2OUJA 1ZOFA 1YJLA 4YZ4A 4QDRA 3HDCA 3W59A 3RMXA 2DF7A 4X1UA 2LW8A 3OUJA 2AB6A 2PMWB 3FLRA 1U0AA 1UKGA 5ECSA 1QOSA 1DDLA 3VI7A 4KH9A 1QKQA 1T00A 1ALYA 3WDXA 3Q8CA 1CQHA 3O1UA 1W9YA 3WQ0A 4KW6A 3O14A 2KD7A 4YM2A 4URAA 4CA9A 2P5RA 1NLQA 4PURA 1BBT2 2ZGRA 3LPFA 3WF3A 4OUEA 4MJCA 1Q8VA 5DUWA 1HXS1 1W3VA 3THCA 4YW1A 2ET7A 1CJDA 2MEV1 4DMIA 5BMUA 2P3KA 5JXJA 1UZVA 5FRAA 1EUTA 5JLVA 4XRDA 4IEWA 2VL3A 2HYKA 4WZCA 2KUCA 4ML1A 1AR73 3R4UA 3I43A 1MS1A 2YZHA 1OH4A 5DMYA 1V9U2 4FQ4A 1PKWA 1OPMA 3NAPC 2WRAA 3VBHB 2L9LA 1F3AA 5LCWL 2GGTA 2DUPA 2P6CA 2RUEA 1AR83 3VZOA 4X6QB 2PPTA 5JIUA 1ZMAA 4Q8KA 5D73A 2QKEA 1SPPA 5A6QA 1VMFA 3WV6A 3OB8A 3D4MA 2YY1A 2VZVA 1H4OA 4Q4Y3 4V2MA 1D4M1 3CSJA 2EIQA 4YZ3A 2YP6A 4TN7A 1VBE1 1OC3A 1W89A 1H4HA 2FCTA 1YFWA 5C8CA 1PX7A 2BDRA 2CAUA 4KX4A 4FPLA 3K4AA 4JGZC 1YEPA 1PKZA 3M3EA 2WFF3 2HZEB 2GU9A 3VBFA 5C3QA 2ZGSA 2KR2A 2GP5A 2AC1A 2IVJA 5C4WC 1JZ8A 2FDHA 1KDKA 3LB9A 4BK5A 3UYJA 3EWLA 1ZZBA 5JR2A 1JYVA 3ZR6A 2J1UA 3MNGA 3GALA 3VURA 2JICA 2WLQA 4XFHA 4IW9A 3WNLA 2ERFA 3KMNA 1SBFA 1ULEA 1Z6NA 5FPLA 4A7KA 3HNMA 3S57A 2A75A 1TK0B 4NAXA 3KLSA 4YQUA 3TN92 1J1LA 2YBKA 1BBT3 3O5SA 1QXHA 4BQXA 2LQOA 3QLQA 4HU7A 4Z8BA 1SYRA 4LK7A 2EXHA 4AEDB 4BQ1A 4ML6A 2HWE1 4HSLA 4UBHA 5BNNC 6GSTA 3H1WA 4IEQA 4XFGA 5H9SA 3WDYA 4YKGA 4MHRA 4USSA 2WYSA 4HZ2A 1G7YA 1CIWA 2REMA 3AXDA 1DQ4A 4HU9A 1OI6A 2ZOEB 1H1IA 1W6QB 3PPUA 4MJBA 5G5EA 4IN0A 3A2XA 2Z69A 4OI0A 4IV3B 2DJJA 5JIAA 1FYUA 4EE2A 1MS9A 1LOEA 1CAVA 1V9U3 3J7MA 3ZRDA 2A4VA 1DF0A 2L57A 2PAEA 4ID0A 3POBA 2FGXA 2BYVE 5DQ0A 3N7MA 4NN0A 5HXVA 1RXFA 3NV2A 4Z2WA 4DQAA 5FYSA 3MLLA 3TYJA 2A5ZA 1XPWA 1FX5A 1GUIA 4MDCA 17GSA 4XQ4A 1VBC3 4N0VA 2WWUA 2R3XA 3MV11 4FTBA 2JADA 4K21A 2H8LA 4V1Ap 1HXS2 2PMTA 2X8HA 1H8VA 3FZ4A 1DGRA 4GWMA 1W6PB 1SACA 2MEV2 1OA3A 3VL9A 2P3IA 3FZ9A 4MGKE 4TN8A 1PFOA 4CDWB 4HG6B 2XPJA 4IEXA 4Y26A 2YYOA 1YC61 4N43B 4XFCA 5DXDA 1UYPA 5BV6A 1W3XA 3CZJA 2H72A 1TI3A 2K0GA 1RUF1 3A22A 2PQSA 2QZ3A 3K3OA 4P9JA 2VM9A 3RHCA 4QM9A 4K7IA 2VCVA 3VDDB 4BIFA 4YWAA 3WP5A 3IAPA 3CMGA 2EXKA 5DDJ1 1P8JA 4MABA 2VOVA 4NO4A 3SMHA 4DSSB 1W9FA 2TEPA 1G7OA 2Q8DA 4HANA 4MPFA 5E1RA 1H4GA 5IMZA 1VBE2 2I9HA 3IOSA 4NWWA 4WVZA 5K8SA 1NCRB 4AK3A 5K0UB 2ZX1A 2VXJA 4CU9A 4FAGA 3O1RA 3B02A 1W6MB 4RS5B 1Z3EA 1A24A 4CEYB 4KI5M 4RD7A 3LFMA 3ACIA 4AQ2A 2B5YA 4CUAA 3KHBA 1GQPA 4WM8B 3H79A 3I2JA 1JOBA 3VBUB 3DCQA 3IBMA 2WZR1 3ENRA 4ZY9A 4FFGA 2W46A 2BQPA 2X5IC 1SLCA 4R9BA 1SZBA 2DKHA 3C7EA 3I2IA 5ELAA 4D6RA 3I6AA 2PAKA 4QM8A 3QAWA 1K5JA 1F5FA 2I3YA 3NAPA 2O8VB 3I2OA 1EP7A 1PM7A 3MHZA 3ZYHA 3JQXA 4O65A 1PO11 1NSWA 3HCZA 4IBPA 2XDVA 4LE3A 1V58A 3U4SA 1YI9A 1PVC3 5KHKA 4N8MA 5JI9A 1VP6A 1F15A 1GUMA 2DCYA 4CEWC 4MYEA 2HWE2 2FWGA 4TR1A 3AC0A 3MYDA 5IWFA 2ZUPA 2A6YA 5FP3A 1PO21 4MG2A 2RDSA 3FBMA 2HBUA 3CU7A 1R091 3AK0A 5EJ3A 1KTEA 4HQZA 4IEUA 3K8NA 1AXKA 2W1SA 4YZ1A 2EIBA 1WUVA 3HMYA 1NLRA 4NHXA 2OQ6A 5H9RA 3OCPA 4PDWC 3J9SA 5FR3A 5FO8B 5JMCA 2ON7A 4KWKA 5CYYA 2H1BA 3S6PA 4KGQA 2GS3A 1O4ZA 3SH3A 1QGLA 4MSVA 4Z2UA 4WKWA 3PIGA 4DXTA 3WDTA 2B45X 3VI5A 3OD4A 5C4WA 2K6VA 2KP2A 2HWF3 2V09A 4DIQA 3NV3A 1MQTA 2CNAA 4P9WA 2DSAA 1JI6A 1ZYQB 3PJQA 1G6WA 3D8CA 1REFA 5J36A 5BUVA 3ZSMA 3CBNA 4K5RA 4F9ZA 1O3RA 1R1ZA 3FBYA 1VBE3 3AZXA 3APSA 4KBBA 2HH9A 4Q0QA 4DY5A 4DUWA 1JZWA 4EVMA 4NUBA 1B35B 2VVEA 2WJSA 1MEC3 1G86A 1J59A 2ON5A 4FOWA 5IMVA 1G9FA 4OMCA 4OVEA 1E5RA 4MF6A 4AHYA 2Y6FA 5J3UA 2YPDA 3MV01 3PU8A 1VB2A 5FYHA 3KM6A 2VY0A 1RUF2 1RUC1 5ECKB 4PQ9A 1NUKA 2WABA 2D43A 3B5LB 3USUB 4R9CA 4AHZA 2JU5A 3HT2A 4D7TA 3E5QA 1IPKA 2HLEA 4LKFA 5KXBA 4IGJA 1S55A 4BQ5A 5DDJ2 2DMLA 4UW5A 5FPVA 4KCEA 3RWNA 1OYJA 5CFDA 4N10A 5CISA 2UU8A 4F03A 1GWKA 4NIAA 3TJKA 1BQ7A 3SXWA 4XUPA 3I2HA 4LMFA 1BK1A 3KCMA 1WWJA 5FOBB 3LXTA 4XIKA 5DQYA 1S1AA 4R9DA 2YWOA 4AFBA 4DPNA 1TME2 2N5AA 1WMEA 3POIA 4SLIA 2Y6LA 3M9KA 3ZFEA 4EN0A 1H2NA 2XHNA 3HD8B 4W6YA 3CSIA 3IC4A 2EICA 4BLIA 4GKYA 4A3ZA 1TKDB 3ZIXA 2C4JA 3GBWA 1E57A 1ODMA 3I7DA 3A3TA 1WW5A 1QMJA 2WZR2 2VMCA 1FOD3 3ZSKA 3M1GA 4GMP1 1SJ6A 3VHOA 2R37A 1C8NA 3QH6A 2NMOA 3UKTA 2WT2A 1M3IA 1UA5A 1SDDB 4GALA 2YFZA 5D9VA 4P08A 2N5FA 3WNOA 2RLIA 1AR61 1ZZCA 3S0MA 4Y1UA 4FVVA 3JBG2 1CAWA 5B4NA 4Q5NA 1PO12 1ND2B 5FZ8A 3B69A 1TJDA 1SG3A 1S0IA 2QQVA 2VL9A 4NHYA 3ME8A 1EPZA 2WNUC 4P9IA 2WQ4A 4NPLA 5FAXA 3EXUA 4RN5A 1B4PA 2CGNA 3CYNA 4FOYA 3KWVA 3MFAA 4E8EA 1CAXB 3ROUA 1R092 2JG9C 3WG2A 3PUHA 5A7OA 3FJSA 3L2YA 2JB4A 2XUEA 5DAWA 1RUF3 1HDKA 3ZMKA 3QCWA 4BQYA 4ISRA 2L6CA 5A3OA 1GZCA 4DOUA 1VJ2A 4HSJA 4RQPC 1AYM1 4NIHA 4NHZA 2OX0A 1NAEA 4YGCA 3O3TA 2LROA 4YGBA 3TKRA 2JX9A 2X5IA 4YKFA 4NAOA 3RI8A 1C57A 2GLRA 4L99A 1EOHA 3H3ZA 4AFDA 2GSTA 1SQ4A 1UXXX 2QJVA 5IVJA 3HWJA 2X8CA 4ZBAA 3K48A 4JKLA 1H1AA 2DCZA 2I45A 2HBTA 2A1XA 1YQ1A 1TME3 4DEVA 2DTYA 4GULA 3I3DA 3MGUA 4LUMA 4OFMA 5M0TA 2MMOA 5E4WA 2VOTA 2WUHA 2MHFA 4YYOA 2E53A 1GR3A 4ZXKA 4FP3A 1OLME 4CEWA 5FZCA 1XE0A 3CXGA 1CJPA 4Y22A 1OC9B 3HEIA 1HNAA 2V6OA 1X5EA 3IDBB 3ZYIB 2IFQA 3AYAA 1RUC2 2BZDA 4MH2A 5ABJB 3F4TA 1NT0A 2WZR3 1VRH2 1FG4A 3ZIWA 3GUSA 5L7OC 4EDYA 5FXXA 4FBFA 4OWYA 1F9KA 5F6LB 4EWDA 1KXGA 2YGMA 5A3WA 1XWBA 5A7SA 1EP0A 1XNKA 3DD3A 3MW2A 1Z7PA 2G0FA 1I3HA 4PDWA 4LBQB 3T2QA 1FXZA 4LL4B 2YWIA 4QPIA 3HNYM 3Q8EA 4XXPA 4DY3A 4Q4V3 3JBG3 5FPUA 1RUD3 2DCTA 1RYYA 1PO13 2H73A 3KMOA 1VPHA 2LUSA 4LBKA 1H75A 3ZDSA 1D0HA 2C3NA 4HJ2A 4F3JA 2VULA 4FCAA 4NRPA 1SLBA 3A7QA 4ICYA 5CREA 2DUQA 1R093 1X5CA 4RQRA 3OEAA 1XJAA 2WKKA 3M3MA 2EAKA 3N9JA 3ZFFC 1KFUL 5LRSA 4FPCA 4A41A 3MSZA 4YAVA 3MAKA 3LEMA 1BG5A 4ILFA 3ZFGB 5EIYB 5FXWA 1IKPA 5FPBA 4CUBA 3U4XA 1SPPB 1YXWA 4HL0A 2FQPA 1XNAA 2PHRA 3AMNA 5HCAA 4W8JA 2ZNMA 4OMVA 3KZQA 2D6MA 1RUE1 5ECOB 4GQCA 1OD5A 4CCKA 3OBTA 2F3MA 5BNQA 5GLVA 3KEBA 2BW8A 2H30A 3VUOA 2CDOA 3T30A 1A78A 1AR62 2R0HA 3FR6A 4XZUG 1XPVA 5HQPA 2XBO1 4IEZA 5IYYA 4KDXA 5GSTA 4XS6A 2E9QA 3HT1A 4J1WA 2IN3A 4PGTA 2VZUA 3VBFB 1HLCA 4J56E 1JBCA 3DPRC 4OUMA 3A21A 3CTFA 1N1VA 2WINB 1UZYA 3M2MA 2IXCA 5FDBA 1RXGA 3H7YA 4B4QA 1D7PM 1XRUA 1DQ6A 5I0UA 3J26N 5CZKA 2VIMA 4ONUA 3MICA 2C80A 5LA2A 1SK0A 1VRH3 1MS5A 3T1LA 4HDEA 3ORJA 3H4KA 1AYM2 3E6DA 4S2DA 5KWRA 2HKXA 2TNFA 2VZ1A 3TRPA 2QTWB 2LJRA 1FAYA 3JB4C 5FUNA 3KT7A 3NNGA 4LPLA 5IPGA 2ZS6B 2P17A 2OQ7A 4V2VA 3RSJA 3WCSA 4QXHA 3W21A 1N1TA 3HJMA 2GH8A 2HI7A 2PELA 4FPEA 2NP0A 4Q2FA 2B3SA 4CDUC 4MGYE 4LBJA 2YOIA 2K9ZA 3ERGA 1YKAA 3LW9A 5GM0A 1OUSA 5IK7A 3WNNA 1CAVB 1JU4A 1ZX5A 1PSQA 2WT1A 1OKOA 4ZL7A 1MACA 1US2A 1JMUB 3GH9A 4GH4B 3UMAA 12GSA 3RJRA 4F0CA 3T4VA 2VOKA 2XL7A 1OKTA 3GBGA 1GNYA 2EIGA 2NMNA 2JG9A 3IBHA 2J42A 1SEFA 2B8MA 4PBOA 4Y1ZA 5G1LA 1Y4WA 1WMJA 3HJOA 4IQ1A 2JDHA 3H9AA 4CY8A 4JDMA 4TLFA 5FP7A 2K2SA 1BVP1 1AR63 1CQGA 1KFXL 4K40A 3D4KA 4MGTA 3THPA 5IM9A 1PK6A 1U5IA 4LMWA 1X8EA 3GFKA 3ZYRA 5CNAA 5JWPA 4FOQA 1GSUA 1QU0A 4MOAA 2BMXA 3B94A 5HR1A 1Q5OA 4FTSA 4TTGA 2QKDA 5A70A 3RZJA 2LNSA 2OE0A 5D1IA 4POBA 4L0UA 4I0BA 4YAPA 2GC3A 2BWAA 2R30A 4M00A 2ARBA 2R061 4QU2A 2XONA 4QPWA 5J9BA 1VBA1 3UAPA 5JCGA 5IHRA 4GJZA 2J1AA 4ES8A 4M4RA 3WLUA 1RUH2 1H0BA 3NJVA 3H8XA 3LXZA 1JOPA 2W0XA 2VXRA 3KH9A 3E6CC 4XF0A 3ZYBA 2ZEWA 1ULFA 1OF4A 1RUE2 3FMWA 3OBZA 3UESA 5EY6A 2BGCA 4PHZA 3CLPA 3K4ZA 4YFWA 5JWRB 4QDSA 2RM22 4PCRA 2VG9A 3RZHA 3BCKA 1UQXA 2YB7A 4WBRD 2XBO2 1JZOA 1AHSA 4BMEA 4XHBA 1LRHA 3EO6A 1GULA 2G9ZA 1GSDA 5FFOC 2D44A 5ECHB 4LT5A 3ACFA 3DN7A 5EXOA 1YIFA 4E8DA 3J7Yk 2L59A 4G0IA 1D0GA 4Z7XA 4XDQA 3FHIB 4YQMA 4ZXGA 1JLWA 2C9KA 1CZSA 5G30A 5H5RA 2AYHA 2I2SA 1LHOA 3POFA 5JAXA 1A34A 4NXIA 3GSTA 2FBEA 4IEVA 3J8F3 5KHIA 5C04A 5FLHA 1SKRB 2FUG2 1PX4A 1VLNA 3J7LA 2EAAA 5I0TA 2VMGA 1TK8B 4Y4RA 5CKMA 1GSFA 4OQ8A 4PLOA 1TMF1 4P9LA 2XKPA 1O7FA 4RYDA 1NHOA 1WA6X 2P5BA 4DRVA 4TR1B 1NZCA 1SMVA 2LRTA 1OQ1A 2GNBA 4B1LA 1JYNA 5IMCA 3FHQA 1OF3A 3VLNA 1AR92 4NHKA 1G9CA 1EY2A 5CP1A 5F06A 1RINA 4RHV1 1VF4A 1FVKA 2HWB1 3ILFA 2XUMA 1W0PA 2YZUA 1N8JA 1CGPA 4HONA 4GRFA 4XYXA 3W8JA 2LNTA 4KQ7A 1DQ1A 5L71A 1CR7A 3ED3A 4MJEA 1F2NA 3DPRA 5C4WB 1RUH3 1MQTB 1DZRA 5GLZA 1JHJA 4ARXA 1LU1A 2ADDA 3KT1A 4KL1A 3A4UA 2RUFA 3WUDA 3IDCB 3M8LA 2W52A 5FY8A 1O8WA 4R9AA 2GNMA 3I69A 4LO8A 4FO5A 4M3CA 4FPOB 4ECBA 2RM23 3TGZA 5CU1A 1V6LA 1VAVA 5JOWA 2Y6KA 4PBPA 2PHXA 3AP9A 1UOGA 4MXWB 1M99A 2D3PA 5IOWA 3OY8B 3VDCA 3DKSA 4IE6A 3BCIA 2ZMLA 4BWOA 3CBUA 3TCOA 4MK3A 1XWCA 4I8BA 4K1FA 4OHWA 2JE8A 4GA9A 2X53S 1JZ3A 2QBXA 3ZVXA 4L0WA 4CU7A 1GNWA 3AL6A 1V70A 2R062 1ST9A 1YF0A 4FFFA 1LOFC 1VBA2 1LB2A 1VAMA 1J1TA 2DLXA 2AR6A 5F3CA 5CFDB 4E2SA 2P2KA 3TRQA 4CHSA 3BU7A 4QX8A 5G2ZA 4KNCA 2P37A 3BVCA 1UU5A 4XBNA 5FZLA 3WG3A 4BQWA 3WT1A 1CONA 3WQBA 4YM0A 2C0GA 1XOBA 2ZX0A 2GSQA 1SLAA 5ACA1 3T2PA 4Y24A 3IZOA 4O61A 1ENSA 3ZXDA 3ZFEB 3RHBA 4K6BA 3ZSJA 3RMYA 1FOVA 1AR93 1ST8A 5FZ0A 1YF1A 3D5JA 11GSA 1MS4A 4KB3A 5G04L 4ZS3A 3J7Yb 2W5FA 2FD3A 3H8UA 3WNPA 3G6JB 1UVZA