2HYXA

Structure of the c-terminal domain of dipz from mycobacterium tuberculosis
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
333
structure length
333
Chain Sequence
GAMEIREQLNLGGIVNAQNAQLSNCSDGAAQLESCGTAPDLKGITGWLNTPGNKPIDLKSLRGKVVLIDFWAYSCINCQRAIPHVVGWYQAYKDSGLAVIGVHTPEYAFEKVPGNVAKGAANLGISYPIALDNNYATWTNYRNRYWPAEYLIDATGTVRHIKFGEGDYNVTETLVRQLLNDAKPGVKLPQPSSTTTPDLTPRAALTPETYFGVGKVVNYGGGGAYDEGSAVFDYPPSLAANSFALRGRWALDYQGATSDGNDAAIKLNYHAKDVYIVVGGTGTLTVVRDGKPATLPISGPPTTHQVVAGYRLASETLEVRPSKGLQVFSFTYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein dipZ
publication title Structure of the C-terminal domain of DipZ from Mycobacterium tuberculosis
rcsb
source organism Mycobacterium tuberculosis
molecule tags Unknown function
total genus 92
structure length 333
sequence length 333
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
A PF17991 Thioredoxin_10 Thioredoxin like C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2hyxA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2hyxA01
1TG7A 1ERTA 1HNCA 5D96A 3QAVA 1GOHA 4EDZA 4X0XA 2W5FA 3BD2A 1CIYA 5CRGA 3WT1A 1A8LA 2L5OA 3C7GA 4EE0A 5FWGA 1OAZA 4NPBA 5ABRA 2C4JA 1US2A 3MWHA 2JKXA 3VLNA 1EV4A 1SK2A 1G6WA 5IFPA 3LYPA 1A24A 3FZAA 4EO3A 2LJKA 2KHPA 2YNXA 2W9XA 4LPLA 3CQOA 2V32A 1PN9A 4HUAA 2RUEA 5G30A 5ECNB 4JHZA 4I2TA 2TRXA 4MO3M 2XC2A 1ZL9A 1GUIA 4ARYA 4WR4A 1SK1A 1XWCA 2YN1A 5ID2B 2QQJA 3FEUA 2XHNA 4CDOA 3GX8A 4K6XA 4JR6A 1GUHA 3F0IA 1M9AA 1JHJA 3N9JA 3F4TA 2X99A 4FH8A 2ON5A 2MMAA 1AIUA 4IP1A 1MEKA 4BDVB 1F4HA 3QFAC 1FHEA 2H1DA 1W0NA 3VD3A 2PERA 1U6TA 1JZ2A 1WE0A 2EIDA 5JXIA 4HZ4A 5AGYA 1ACVA 1X5CA 3DECA 4XS4B 3OEBA 5IPGA 2E2GA 4GWJA 1JU3A 3TOTA 3W5MA 2E31A 2EIEA 3FZ4A 4K7NA 3P1IA 4W50A 4NAXA 1UXZA 2C9KA 4AJ7A 2VL9A 2PWJA 2V6OA 2VCTA 2HZEB 3EINA 4YAPA 3MDKA 2QQKA 3UARA 1YEPA 4ZB8A 4POLA 1OKDA 2WQ8A 3PUHA 3D4TA 2HSHA 4DSQA 4WR5A 3F6FA 5H5SA 1UY2A 4PQQA 1WCQA 5ECKB 2R4VA 1JHBA 2H74A 5IIZA 2W1UA 2WDBA 1CZTA 1KEXA 3OGSA 1DUGA 1SJ6A 3GKXA 4TR4A 2R37A 1E2YA 1V40A 2HFDA 2M72A 2CDOA 4BXSV 1DBYA 2DCKA 5JXHA 3M3MA 4PXOA 2DLXA 4IGJA 2LEGA 3CZUA 2C0EA 2QC7A 4POKA 2LNTA 1S3AA 4ULXA 1UZ0A 1O59A 1XVWA 1F3BA 3GRXA 1PGTA 4I6XA 3HZ4A 3KP8A 4V2LA 2VCVA 4J2FA 3LWAA 3TCOA 3HD5A 3EWLA 1T7PB 4DEJA 5LCWL 3JXSA 1PMHX 3PGTA 3WGDA 4EDYA 4DXTA 4Q5QA 4F2IA 5B8BA 1JZDA 1EOHA 2JZSA 4KGIA 2DIZA 3FW2A 5J9BA 3I2FA 4V1Ap 2KLXA 4IW9A 3VWXA 6GSSA 2AUVA 1F9MA 3QCPA 3UAPA 4TR3A 2H0HA 3Q19A 3BCKA 2VCAA 2PBJA 4XS6A 4AJ6A 1KEBA 2IPAA 3M8NA 4CU6A 1N8JA 1GNWA 4MJCA 2KP2A 3TJBA 4WF4A 5A5KA 3APOA 3R2QA 3LE0A 2OBIA 3C71A 1X5EA 4BJ0A 3Q18A 2VLTA 1QQ2A 1JZ4A 3WF4A 4IBPA 1SL1B 1P8JA 5DMYA 4FYUA 5A4WA 1XCCA 4I8BA 3M0FA 2OKXA 3UVHA 2WYSA 1LJRA 4LL1B 2K9FA 4XRDA 1B8XA 5HR3A 3GV1A 2EIOA 2CZ3A 2FD3A 18GSA 4GZ9A 2PVOC 3PINA 3HY2A 2F51A 3NQHA 4G10A 3HVSA 4P5YA 1B9XC 4DVCA 5DPNA 3AY8A 1JYNA 4BWQA 4KE3A 4TN8A 2IL3A 1E6BA 1A2MA 3S9FA 4A45A 2PVQA 3DRNA 4A44A 4ID0A 2PU9C 2IJYA 2ORZA 2J7MA 2WUHA 5DAKA 2GLRA 4ZBBA 1XBSA 1NHYA 3TRPA 4WEYA 1A23A 1H4OA 3M1GA 3GTUB 4QX0A 3ZYWA 2GSSA 3DKSA 4K9ZA 3A23A 5JXJA 4YQVA 4PNFA 1MDKA 3OBAA 3I97A 4W4ZA 1H6YA 3LPFA 3GSTA 3K46A 2LKUA 1I5GA 1O73A 1I9DA 5DJMA 4OMCA 4TXOB 4TXOA 2PMTA 2WAOA 4OFTA 2BJXA 2C26A 4UAPA 4JU5A 1YQ1A 1XWBA 1PX6A 2FCHA 3ZREA 3BN6A 4YPJA 3TKSE 1V9WA 2B3SA 4LA1A 3A2VA 4IUGA 4PURA 4EC0A 2ZEWA 2XOMA 1A0FA 4GXZA 3K4ZA 2RM5A 4HS1A 4RQXA 2BMXA 3UBKA 3CRUA 4OFMA 5G05L 1V57A 3C7HA 4CU7A 1JZ6A 5ENUA 3TB2A 4JEDA 3HKRA 4V2MA 2JSYA 5IMFA 3LJRA 3HDCA 2YANA 4RYDA 2VZRA 4L8EA 2YWOA 5GSSA 4N30A 2VZ3A 3EU3A 5IM9A 1FO5A 1EUUA 4QL7A 2N5AA 3MV11 1O8PA 2BBAA 4A6OA 3HJMA 3A7QA 4AAXA 3KXOA 2B6MA 4Q5RA 2N5FA 1ZMAA 2B1KA 1NSWA 2EICA 1GNYA 1TI1A 2VMFA 5EIYB 4D73B 2WBKA 3IAM2 1HN1A 2LW8A 2VLVA 2FA8A 4ZB6A 3SWLA 3QAGA 1UMHA 4OYUA 4TTGA 1TU8A 1PA3A 2GVPA 2KD7A 1FB6A 2YP6A 4UOJA 5B4XA 5DQSA 5IQYA 2JD9A 1M2BA 4RQRA 4OO5A 1X9WB 3UOMA 2IFQB 4HG6B 3GSSA 4WF5A 1QUWA 2P0GA 2JZRA 4HDEA 4ECCA 1GH2A 4XVHA 1BAYA 4AGSA 4DEQA 3LXZA 5DN2A 2J1UA 2WZ9A 5AIXA 2C0DA 4GLTA 4YH2A 4L0PA 2W46A 1MD4A 3IBHA 2DJKA 1JZWA 4X1UA 3FR9A 4KSMA 2L6CA 2GT5A 2K8VA 1XW9A 1BHGA 1FVKA 1NHOA 2B7JA 1GMMA 2DCJA 5AISA 1W99A 3FZ5A 4RI6A 2Y6HA 3LEKA 4JR4A 5C71A 1GUMA 3J7HA 4I2UA 5J4UA 2BTOT 5GSTA 3KJYA 1DE1A 2VZQA 2IWTA 1JYWA 3LSZA 4ZB9A 2PN8A 6GSWA 1NUKA 2REMA 5ECRB 3KD0A 4TR1B 2D2ZA 4GSNA 4OD7A 4ZL7A 2CX4A 4ZXEA 3LXTA 1VF3A 1J9BA 1BG5A 4EVMA 4LLRA 3IA1A 2ES7A 3GFKA 2ZUPA 1S3DA 1GQPA 4ZXGA 3HJPA 5LD0A 1C72A 3WNLA 4YQUA 1JLVA 3FHQA 1MD3A 3L78A 3W5NA 3HA9A 4YAVA 4OUEA 2GTUA 3CTFA 2DIYA 4GQFA 5IFTA 1YZXA 5KN0A 2VIMA 4XIHA 3Q6OA 3IB3A 2H8LA 1S3CA 1TRUA 2YCDA 3NZNA 5C04A 4O5RA 1XC6A 4MGQA 3ZTLA 1HYUA 1HNBA 1K0BA 3D0ZA 1G6YA 2QSIA 5G2ZA 2CAIA 5AN1A 2I4AA 1GLQA 5D9VA 2YPMA 5EJ1B 4GQCA 4K2DA 2BGOA 4CUBA 16GSA 3HNMA 5G1LA 1Q4JA 4MZBA 2Y6JA 4MF5A 3DEXA 3C1SA 1SDDB 2YG0A 1HNAA 4XUPA 3QPMA 5ECSA 4L0WA 5FUIA 2EIQA 1SHWB 3W8JA 4HJMA 1EZKA 3VDCA 4MH2A 1K3YA 1NAEA 2V4VA 1ML6A 4QDRA 3UIWA 4DSRA 2HE3A 1K45A 1EOGA 5DBQA 3HEIA 1XW5A 4DSSA 2Y6KA 3A3TA 1Z3EA 3SKJE 4FYBA 2VMEA 1M7TA 1M2DA 1US3A 2KP1A 4CU9A 3EVIA 3OR5A 5C00A 11GSA 5JCWA 1F37A 2B1LA 4MOAA 1H75A 3C7FA 3LYKA 2YB7A 2C3TA 4L5LA 1G7OA 1M2AA 4XUNA 5LA2A 1GNEA 1NKGA 2IN3A 3ABZA 2NDOA 3F2ZA 2JDAA 5ECQB 3KZQA 13GSA 4IJIA 2VMDA 2I81A 2O89A 3GGLA 1ULOA 4PQHA 3D4MA 1RW1A 3U37A 1FW1A 1GTIA 1OKTA 5B7CA 3D3AA 2W94A 3PH9A 4PUAA 1RQMA 2F8FA 3P2AA 5A4VA 4NMUA 2LTKA 4HU9A 5JWQB 2LV3A 1GUKA 1OH4A 4IKHA 3CYNA 4XHMA 2E26A 1SKSB 4Q5FA 3C1RA 1ULPA 2HT9A 3KH9A 5JWOB 3WT2A 1UMIA 2J1SA 3CMIA 2E7PA 1YKAA 4XS1A 2FWHA 2GQKA 1K3IA 3KH7A 3TKSC 5CRWA 4IQAA 5IOWA 6GSYA 1SG3A 5F06A 4XUOA 3WNNA 3VPTA 2DBCA 2X8GA 4HZ2A 2FWFA 5H5RA 1I5PA 3I3BA 2WRTA 3ETPA 1PX7A 1QFNA 4MPGA 5CNWA 3ZVJA 1CQHA 2H72A 3DVXA 1ABAA 4ILFA 3ERWA 2WJUA 1PL1A 4O32A 2J1RA 2X09A 2WABA 4KCAA 1LBKA 2P5RA 2QGVA 1WJKA 2C1YA 4IQ1A 2H01A 4ARXA 5E4WA 1OC9A 1QMVA 2O8VB 4MF7A 2EIRA 2ORXA 4N10A 3DXBA 2DMMA 3VK9A 1GSQA 3KGKA 2GGTA 1YJ6A 2L4QA 3QAWA 1U3IA 2R3XA 3QDNA 3WF3A 4TW5A 2CZ2A 3LGCA 1O85A 3QR6A 1JZ8A 3LPGA 4ACSA 1Z7RA 3W8SA 4P02B 2IMKA 3GN3A 3FKFA 2J22A 4MGSA 1WOUA 3DIEA 4MJAA 5CP1A 4BVXA 1TTZA 4MJEA 1UC7A 3ZMLA 2BGPA 1OT5A 1N2AA 4KUNA 2YOIA 5IO0A 1UY4A 2VD1A 2ZEZA 1J84A 1K0MA 4N0ZA 1TOFA 2GT6A 3DVWA 3FHKA 4TOPA 1CX1A 2RV9A 4XURA 1TK0B 3CMGA 2FY6A 2HSYA 3WF1A 1G0TA 4QL9A 4ZL8A 4ML6A 1TRSA 3IR4A 5JCUA 4KDYA 1GULA 3WNKA 1MDJA 1Z6MA 4OWYA 2JE8A 1GP1A 1KGYA 3RPPA 4G2EA 4DXRA 4NHWA 1GWCA 4D0QA 4PUFC 4ZBDA 1R7HA 3FL7A 3QD9A 4ECIA 2X8CA 2H76A 4GWRA 2H66A 20GSA 1VF1A 3ME8A 2IMFA 2LNSA 3VDBA 3NOFA 1K0AA 3IAS2 4GTUA 2P31A 3UBLA 4WBJA 1O8XA 2P5QA 2ON7A 2PUKC 2XPDA 5JCGA 4PX1A 3ZVJD 2LS6A 2VD0A 3VPQA 2H75A 5LCZA 4CU8A 3ACGA 3M9JA 1TRVA 3G7IA 1OVNA 4GSSA 3WNMA 2VUPA 3ZLPA 4IJ3A 2V5DA 2WZEA 3T0DA 2YJ7A 4OCEA 1O6JA 2LJAA 3APQA 4EXJA 2FLSA 5JXGA 4POMA 3PUIA 4ZY9A 1UY1A 1D7PM 4A41A 3H1NA 2VL2C 2YJHA 1PMJX 1MPXA 1Z7PA 3HVVA 2VO5A 2TRCP 5JWRB 4PT6A 4XTSA 4TR0A 2HXKA 1FVJA 4OFNA 5DAKB 7GSSA 3TJGA 3I2KA 2XHFA 2A2SA 5G5EA 10GSA 2OE1A 4CW9A 3GKNA 5CAXA 4JRRA 3ACIA 4JX0A 3QFBC 5INYA 4CUAA 2FA4A 3RDWA 2C3QA 1T3BA 3FRCA 5C70A 4HQSA 2VCXA 5J9CA 5ECHB 4QQ7A 5F8BA 2XBIA 4K0NA 2J9HA 3HOBA 2VZ1A 4P08A 3OGRA 5C7GA 4MLYA 2HZFA 2W1QA 3F63A 3OGVA 4GF0A 2Y8KA 1GRXA 3I9V2 2FHEA 4WKWA 3WNPA 3EC3A 3FY7A 4XUTA 4KI5M 1GOFA 1SYRA 3L4NA 2V41A 2Z9SA 1WPIA 5ECLB 3SKVA 12GSA 4OMDA 3O6TA 3L9UA 1DLCA 3H79A 2NTOA 5CRHA 2VLUA 5IO2A 1TRWA 3MUZ1 4MK3A 1UWWA 4BVYA 4XCSA 22GSA 5DALA 2ID4A 4P00B 2E2MA 2E0QA 5LNKe 1AAZA 5ECOB 2HI7A 2GZYA 5ELAA 1A2JA 2A4VA 2GDRA 5JR2A 3HN3A 3FZ9A 4F0BA 2LRTA 2X10A 3UEMA 4EKZA 3A22A 4M4RA 2JZTA 4MZCA 4QX2A 4JKKA 3MBWA 4MP4A 3GKKA 1YDKA 4TXVA 3UL3A 1YKCA 1QXHA 1GTUA 1OE7A 2WB9A 3IHQA 1CZSA 3ZL5A 4V1Ag 3APSA 5DDLA 2L5LA 3KEBA 2IMIA 3RBTA 17GSA 1VF4A 3A5WA 1TDIA 3TUEA 6GSUA 3A2WA 1PSQA 5EL8A 3F4SA 1OF4A 2CT6A 3GL5A 5GAND 1GL8A 3MAKA 3ZZXA 2TIRA 2M46A 3EU4A 3WNOA 2VZTA 5F7UA 3TGZA 3MSZA 4XUQA 4WXTA 4GRFA 4HJ2A 4KDUA 5J5NA 1TJDA 2X05A 4MABA 5L71A 2JL4A 4DUWA 4EF0A 1TK5B 3HHVA 1ILOA 2CVKA 2GQLA 4YQMA 2VZVA 4PQIA 4O7HA 3CSJA 2WFCA 3D21A 5IOXA 1NW2A 3UJ1A 1XPVA 3F3RA 3ZIVA 2CV4A 4HQZA 1TXXA 3Q74A 2CDPA 3TDGA 3UNPA 2GZPA 3ME7A 2J1EA 2ALBA 5CRDA 2OA7A 1K3OA 2X8HA 1PMTA 14GSA 4LKSA 5KEJA 5DQ0A 3NJXA 4RN5A 2Y6LA 3WGXA 1PL2A 2CAQA 3SEPA 1J83A 3CRTA 3I69A 3BJ5A 1WIKA 5EY6A 1EEMA 4DUVA 3OEAA 1THXA 8GSSA 3RPNA 2VM1A 2LSTA 1SJIA 1XNAA 5FHIA 3WD6A 2K18A 1BEDA 2WDUA 1JYXA 4PGTA 4XZUG 3HZ8A 2JADA 2DSAA 2QQOA 4KB3A 3BBYA 4BK5A 2I9HA 4KDXA 4OMVA 4F9ZA 4JKMA 2YV9A 3FYGA 3CIHA 1XWAA 1T4ZA 4QB6A 2OBKA 1ZYQB 3I3EA 4L5OA 3FK8A 3ZIJA 1JLWA 3F4RA 1ERVA 2YZHA 4HU7A 4JKLA 2H71A 5COHA 1U3AA 1GSDA 2Y64A 4BPYA 3U6VA 2DDUA 1USBA 3UESA 4ML1A 1UVZA 3I3DA 2O85A 3KP9A 3I2HA 1HQOA 2VZSA 4RUVA 2C0FA 3ZMKA 1EP7A 2NVLA 3TRQA 3KM6A 2AHEA 3TKPA 1F3AA 2GSQA 2PQSA 1X9MB 3IV4A 1QK8A 2C3NA 3KTBA 4M4PA 3LG6A 1Q98A 2VM2A 4MH3A 4AJ8A 3E0UA 1SKRB 4F82A 2LS5A 4DSSB 5A4UA 3CBUA 3HXSA 2C4XA 1ST9A 2B5XA 2CVBA 3MNGA 5HFGA 4A3ZA 4E8EA 1F2EA 4G19A 3KIJA 2RIIA 5D9TA 2RM6A 1AQXA 2XBQA 1QGVA 1THOA 3IPZA 1A8YA 3ED3A 3HNYM 5DVBA 3PR8A 1Z9HA 2MBSA 2G2QA 5B6MA 4JZQA 3LQCA 3K4DA 1YY7A 1LNSA 4KW6A 5J1XA 2R7EB 2LRNA 1K0OA 1XXUA 1SYXA 3I6AA 1FG4A 3VDAA 3HYPA 5HR1A 1DE2A 3VWUA 1L7QA 2GQMA 3IDVA 4NV2A 3WEZA 4V2NA 1BX9A 4NXIA 2YWMA 3GHAA 2I1UA 2MYGA 3VWWA 3NRUA 2V1MA 2FWGA 3I2GA 3E1F1 3WGEA 3LEFA 1UN2A 2VJXA 2V72A 2J1VA 3MO4A 2O87A 4CHSA 2LQOA 5HPOA 2OACA 4IELA 3VURA 4EUYA 2VCZA 4K8MA 1AQVA 4ZBAA 3KMNA 4WBRD 5G1KA 1URMA 4L0UA 5DCHA 1TI3A 2LQQA 4NWYA 2MMZA 3CXGA 4PF1A 3VD7A 4D8MA 4K7IA 3THDA 3U5RE 1XOAA 2H0GA 5F07A 3ZM8A 3OG2A 1G7EA 2V2GA 2RUFA 5ECPB 1T4YA 2MZCA 3IIIA 4LHSA 4DUXA 3UMAA 4EL1A 5JUVA 6GSVA 1TP9A 2VCBA 1J0FA 1JZRA 2O7KA 3FR3A 2WAAA 4KWUA 3W6GA 4IP6A 1SJZA 4F0CA 3IAQA 2WGRA 2ZNMA 3A2XA 1VRSD 5ID2A 3TJJA 4I97A 2VOCA 4QX1A 4LQRA 4QDQA 2FGXA 3KMOA 3DYRA 3ACFA 1OC9B 4MF6A 3EURA 1OE8A 3KCMA 2Z4FA 4ZZ8A 4MCUA 5IMCA 1EGRA 2GSTA 2H19A 1T8EB 2C0GA 1W89A 4W8JA 1UX7A 5ECMB 5FT3A 1SD9A 2H0IA 1K3LA 1M99A 1U87A 2W3JA 2WO1A 3GA4A 2QQMA 1O8WA 4XS4A 2RVAA 4KCEA 1R4WA 1YF0A 1V2AA 2WN3A 3C7EA 4JE1A 4AF2A 2B5EA 3FHAA 5CREA 2AAWA 1W9WA 4P3YB 1EWXA 2BERA 4QAWA 1WMJA 2E33A 1VF2A 4QB2A 1ERUA 4KX4A 2HZEA 4GCIA 4E8HA 4ZZ5A 4PNGA 2VCWA 3DMLA 3RHBA 1OYJA 4ZIJA 1UA5A 2EIBA 1PQNA 3K75B 3VI5A 1AQWA 2RLIA 4QDSA 1OC3A 3MUY1 1XZOA 1UXXX 3ERFA 3CDZB 1JI6A 3IOSA 5HFIA 5HQPA 3CZJA 1XW6A 3F8UA 3NIVA 3VI7A 4A4AA 4IVFA 3HVXA 1A0RP 4G9HA 2QKEA 1WKYA 2YFUA 3HCZA 4E8DA 3IK7A 3RAZA 1TKDB 2F8AA 5D93A 1WP0A 4IN0A 2YV7A 2FWEA 1RK4A 3M9KA 2C8UA 1SKWB 1SL2B 4MADA 1OC8A 4N0VA 3EB7A 3RHCA 2WCIA 3HPNA 5E59A 2HRNA 2CVDA 3WF2A 4BWSA 2VL3A 3F6DA 2W1WA 1IQDC 1W9TA 2V6KA 2VQTA 3LFLA 2VZOA 1WRYA 4HI7A 3NNGA 1V58A 5I0DA 5IYYA 3L9VA 1KBNA 2OKAA 5HR2A 3TJKA 3GDBA 1Z5YE 1CQGA 1R64A 1GOGA 2ZXQA 2DC5A 5ECIB 5HR0A 4O92A 3WSOA 1JYVA 1W8OA 1Y25A 2HLEA 4MZWA 1M0UA 1F6MC 6GSXA 5IMVA 2AJQB 1FOVA 2VO4A 1EEJA 5LA0A 3BCIA 1AUCA 1K0CA 2CQ9A 2IMEA 5D9WA 3ISOA 2JACA 3DYMA 2LUSA 3GXUA 1UYYA 1MTCA 1R26A 2H1AA 3OB8A 4ZILA 1K12A 3ZFBA 1F4AA 3FN9A 1BJXA 1ON4A 2K6VA 2B7KA 1NM3A 2KOKA 4XRAA 2J1AA 5CYYA 1B48A 1TU7A 2H6YA 3IXRA 3T08A 1Z6NA 2JSZA 3MV01 1BQ7A 2L59A 4QPWA 1K0NA 4ECBA 3LEGA 3TKSA 1UY3A 2QBXA 1JFUA 1PKZA 3V1WA 1TK8B 2WULA 2PGTA 2WO2A 2W92A 1WWJA 4K1FA 3E9JB 2HLSA 4RI7A 4X43A 3L0HA 2W95A 3GL3A 4LMVA 4N11A 4POBA 2AB6A 1KTEA 1PKWA 2DJ3A 1JU4A 3EMXA 1EUTA 2H1GA 5ELGA 2VTFA 2W47A 3C7OA 3CSHA 3F9UA 4K7OA 6GSTA 1FAAA 3GMFA 4Z7XA 1GSFA 9GSSA 2B5YA 3TOUA 1X9SB 2W1SA 3TKQA 1O81A 3GH9A 4DEVA 2DJ1A 4FI9A 3T2QA 2YZUA 3ERGA 1PD21 3GYKA 3UETA 3GNJA 3GTUA 5IMAA 3IAPA 4KNDA 1XPWA 1U88A 4J57E 4ET7A 3K4AA 4TRXA 3TRXA 5B8AA 3J7Yb 3C8XA 19GSA 2H30A 3GURA 3GM8A 3US3A 2WN2A 3ACHA 2LRCA 5HXMA 4H86A 3HJRA 4MPFA 3JCML 3K8NA 4NHZA 1T2XA 3VFIA 5B6NA 4J56E 2YC4A 5DQYA 2OJLA 1EV9A 4WETA 1EGOA 4FO5A 2VCQA 5DALB 1B4QA 2H73A 4TXWA 4F03A 2WO3A 3NJVA 1VGLA 4OCFA 1OF3A 4K0GA 3DWVA 2W87A 2C80A 2A2RA 3QOUA 1ERWA 1GSYA 5EVOA 2L4CA 1ZOFA 2MBTA 2ZCTA 3ZITA 1B4PA 2VL4A 1ZCPA 1XIYA 3O3TA 3CTGA 1O8SA 1SK0A 2OADA 2H6ZA 1FB0A 2VAFA 4BA7A 3BGAA 1GTBA 3G9BA 3H4KA 3D5JA 1JZ5A 1XVQA 2MMNA 2B9VA 3THCA 2KUCA 2YC2A 1RYYA 1A2LA 5LA1A 4PQ1A 3IE3A 4KMQA 2EC4A 3UVTA 5F0GA 5G04L 1YQ2A 3EYTA 2VZPA 2OE3A 2QQLA 1SU9A 1DSBA 4MJBA 2J23A 4IS0A 4MA9A 1H6XA 2X64A 5KN2A 1PX3A 5KN3A 2YFZA 4TKYA 1GSUA 4D73A 4GWIA 5IMDA 2GS3A 1YEXA 3I43A 2DJJA 2VOTA 4LL4B 5J3RA 3DYPA 2FNOA 3FR6A 4KSOA 2H1BA 1R5PA 1UY0A 5DCGA 1NX9A 2H6XA 5D73A 2CX3A 3WYWA 2K8SA 1TVGA 1BYEA 4ISDA 1IYHA 4MMMA 3HNBM 5IMZA 1SD8A 3T2OA 3P7XA 1OD3A 1ZZYA 2NBSA 3SBCA 1MDIA 5GZZB 2B4KA 2AV4A 3D6IA 3SEEA 2IFQA 3EYPA 3WF0A 4OZOA 5D8IA 4TVEA 5DJLA 1EP8A 3A21A 2N5BA 3I2JA 3EMPA 2WZ8A 2XQXA 2VMCA 3WQBA 3C7MA 2QQIA 1JZ7A 1Y6EA 3EE2A 3IDAA 1X0RA 4BL7A 4Q5NA 1CZVA 2LJRA 4AG4A 2R6KA 3DD3A 1ZYEA 2G0FA 1AW9A 5G5FA 4JBBA 3HJOA 4Z2AA 2PPTA 5B4NA 5AIVA 1LU4A 4HOJA 4OO4A 4LMWA 3I2IA 2VL2A 2QQNA 4GSTA 4I5QA 3QMXA 3F3QA 3O76A 1X5DA 5IPHA 2DJ2A 2J1TA 4DXSA 2IIYA 2L57A 2MMOA 2IMDA 1B9YC 2M80A 4A42A 3BOAA 5EPFA 1XFLA 1W4VA 4TR1A 5CZKA 4IHUA 5KN1A 2F9SA 3VWVA 2FUG2 3ECQA 1SENA 1W9SA 1R5AA 3IC4A 4QX3A 3ZFLA 2ZEXA 2YWIA 5EJZB 2WS2A 2L9LA 3LEIA 2BZDA 3GKMA 2R2JA 3N5OA 3T0AA 4MDCA 3T09A 2VQUA 2CA8A 3CSIA 1DP0A 1HD2A 2HRFA 4E8CA 4KH7A 2H70A 2GZZA 3AC0A 2VR4A 3H8QA 3T2PA 4CUCA 5GAPD 4HEA2 3G7YA 3GH6A 3GIXA 1J08A 5A1AA 1DYOA 4BK4A 4KA0A 2HNLA 3P90A 4ECJA 1W8NA 1K0DA 3VD4A 1M9BA 3C8EA 4FYCA 2ZEYA 1T1VA 1SL0B 2VM9A 1YF1A 3ZRDA 5IJRA 2OE0A 3E3EA 1AXDA 3T0BA 3K77A 2HYXA 3J7Yk 2RJ2A 3CKHA 1AC1A 4QB1A 1PX4A 2NPBA 3GX0A 2E32A 3L9SA 2W91A 2Y6GA 1IYIA 5JMOA 1XOBA 2JU5A 2VCCA 2VZUA 2VC9A 5CO3A 1L7RA 1GSEA 2F3MA 1GTAA 1TW9A 1KNGA 4NV5A 3D22A 3VD9A 1PRXA 5H5QA 4FIWA 3G7JA 4ZL9A 4KAEA 1GU3A 3IK9A 3H93A 1XWKA 1UYXA 3P8WA 5G31A 1O7UA 3C73A 3LORA 2AYTA 1XWGA 1T00A 4CVUA 2XPEA 2R5GA 1JZ3A 1GSSA 1XNTA 3DYOA 4UI9L 1UYZA 2I3YA 2L6DA 5D9XA 3DGQA 5IHRA 5F05A 2DJ0A 3KTLA 3TJFA 1GLPA 5J41A 2XONA 2YWNA 1JZOA 2GSRA 3TKRA 3IRAA 3VD5A 1V98A 3LQ7A 1K42A 1ZGNA 3GUSA 5HFKA 2DMLA 3P6BA
chains in the Genus database with same CATH superfamily
1UOGA 1BVVA 2LTNA 1HNCA 1UQXA 5D96A 1ND2B 4X0XA 1CIYA 3RPQA 2DU0A 5CRGA 2L5OA 3C7GA 4NPBA 2C4JA 2JKXA 3P5BA 4GKXA 4XAAA 3FZAA 2LJKA 1SBEA 2W9XA 4LPLA 1AF9A 1ZRRA 3CQOA 5EFUA 1QH7A 5ECNB 4KBBA 4JHZA 4MZUA 4I2TA 1GUIA 2QQJA 1LOFA 3FEUA 2XHNA 3AZZA 4JR6A 1GUHA 3F0IA 1JHJA 3N9JA 5JWPA 2X99A 4FP2A 2ON5A 2MMAA 4IP1A 1MEKA 5JLVA 2PERA 1JZ2A 1WE0A 2EIDA 5JXIA 4MV2A 4GWJA 3W5MA 4K1ZA 4CDQC 4Z07A 3P1IA 4RGAA 2C9KA 1LHOA 2VCTA 4LKEA 2FMDA 2HZEB 2QQKA 4GXLA 5FOBB 2YGLA 2WQ8A 4LO7A 4DSQA 4WR5A 4KBZA 2XJSA 3F6FA 5H5SA 1UY2A 4L8QA 1WCQA 5K7PA 2R4VA 1JHBA 5K8SA 1KEXA 2TEPA 3VBHB 3FFQA 4G3YC 3OGSA 1D2SA 2R37A 1VJ2A 1OVPA 2IUWA 3RGBA 4N53B 2M72A 3AP4A 3HVDA 4R9AA 1B35C 5JXHA 4PXOA 4PDWA 1J1TA 4Y20A 3VBFB 1BMV2 3J9SA 3HZ4A 5BPXA 3TCOA 3HD5A 3GHNA 1T7PB 5FPXA 3JXSA 2RJKA 4F2IA 4YW7A 2MEV1 2DIZA 3E5XA 4KG8A 4R52A 3BCKA 2YC0A 3M8LA 3ZFGC 4CU6A 1I6XA 3VKLA 4MJCA 2KP2A 2RS12 3C71A 4BJ0A 3Q18A 5F5AA 1TNFA 4L2NA 1QJY2 3KLSA 1RUF3 3M0FA 2Z2SB 4ZXKA 2CWSA 5FUPA 2K9FA 1AZDA 5FAXA 1YJKA 1U12A 3O1SA 1B8XA 2E63A 3GV1A 1I9RA 5EQUA 2FD3A 4TSVA 18GSA 4GZ9A 2FDFA 3NQHA 4B1MA 4P5YA 3KGLA 1EAH1 4FPHA 4YSFA 5C9AA 2ZKLA 1IPKA 3MGUA 2RS31 1YLLA 4DY5A 2PQQA 2PU9C 2IJYA 3ZSMA 2ORZA 4LUMA 3H7JA 2J7MA 2WUHA 5DAKA 4AGVA 1G7YA 3MW2A 2UWBA 1XBSA 2P17A 1R082 2I74A 4DXZA 1A23A 1SACA 1H4OA 3GTUB 1U5YA 2BTVC 1OPMA 4YQVA 4PNFA 1PNGA 4HSCX 2EXKA 2RM23 4FPEA 4W4ZA 3LPFA 3B01A 3K46A 5F39A 4FPKA 5BNPB 5DJMA 1DF0A 5DABA 5EPAA 4E9KA 4YPJA 2HWF3 1V9WA 1LU1A 4LA1A 1LOAA 5C4WB 2VUJA 4DINB 1A0FA 1MS8A 1YRZA 1W3VA 3AMNA 1FV2A 1MQTB 3N7LA 5G05L 3VKNA 4CU7A 3MYDA 3HKRA 5IMFA 3LJRA 2VZRA 4AL9A 5GSSA 3S30A 5A6ZA 1AR72 2IC1A 4QL7A 4P9GA 2W08A 3NAPB 3A7QA 3AXDA 3GBGA 2N5FA 1ZMAA 2B1KA 2IZWA 5FZ7A 2VMFA 1XXNA 1UOBA 4ZB6A 2P3IA 3QAGA 4CUGA 5DAVA 2Q0AA 2ZA9A 4YW4A 4LBKA 5FOJB 1QF3A 3ZFFA 1SLIA 5B4XA 4RQRA 4OO5A 1VAVA 3VBSA 3UOMA 3LGRA 3GSSA 3ON7A 1PO22 4XQ4A 4XXPA 3RQ0A 1RUJ2 4AGSA 3BIEA 5DN2A 4JDOA 5FYZA 2C0DA 1O4ZA 5FP4A 5T50A 3IBHA 4X1UA 2NMOA 2GH8A 5GZFA 5FKBA 4AHXA 4UYBA 1VBE2 1W99A 4YVSA 2QJVA 4RI6A 2Y6HA 4JR4A 4JGZA 5J4UA 5GSTA 3KJYA 1W3XA 3LOIA 1DE1A 1FPN3 1C8NA 4UFMA 3N9MA 3GZEA 2BYVE 1GP5A 4GSNA 4QMAA 2CX4A 4Z2UA 1BG5A 1LOFC 1PVC3 4RD7A 1TMF1 2QTWB 2FZ1A 4ZU7A 5FJHA 5KXDA 1UKRA 1KITA 4LXLA 3WNLA 1JLVA 2NQYA 3ELNA 2ZGOA 5LASA 1VB2A 2DIYA 4GQFA 1V6LA 1JYIA 2WLPA 5KN0A 4PIZA 2BPA2 4RHV2 5FIXA 5C04A 5DDJ1 4MGQA 4WZFA 4Y4YA 1BVP1 2I4AA 1GLQA 5D9VA 4GQCA 4CUBA 16GSA 3N7KA 3VN4A 1FV3A 3DEXA 5EZWA 3BTAA 3QPMA 5ECSA 5DAWA 2F6BA 3MIXA 1CX4A 4HJMA 1VRH2 3VDCA 2JB8A 4Q1PA 5IVJA 4MH2A 1K3YA 1Q43A 4I0WB 4PDWC 1ML6A 1BEV3 3UIWA 4DSRA 3RI9A 3JZVA 2HBTA 2Y6KA 1Z3EA 3SKJE 2VMEA 3RNSA 3PJYA 5A7SA 5IVCA 3EVIA 5M0TA 3I59B 1AJOA 1F37A 1H75A 1MZ6A 4XAEA 3ES4A 1N3PA 4LBQB 4XUNA 3ABZA 5FY8A 1GSLA 4HSLA 2NDOA 2BNNA 5ECQB 4FOVA 1Y9MA 2P5BA 1ULOA 3ETQA 1FW1A 1S0GA 2Q8OA 3U14A 3NL1A 3SISA 3SMHA 2F8FA 5A4VA 1PK6B 5AVAA 4HU9A 4HPKB 4WVMA 4IKHA 5EXOA 3WW3A 2XLFA 4XHMA 3ZKYA 5KBFA 5JWOB 3WT2A 5D8AB 5FKCA 2E7PA 1AXZA 4XS1A 1F5JA 3TKSC 3R05A 6GSYA 4FQZA 4BZ4A 1SG3A 5F06A 1Y9QA 4AAPA 3ATGA 4IEQA 2DKHA 1WA6X 5H5RA 4CCCA 3I3BA 1PX7A 4O32A 1RUF1 1CAUA 1RHI3 2RDNA 1LBKA 1CAWA 3VBOC 1PIV3 1QMVA 5F3CA 3KT4A 2VQAA 3DXBA 3HVNA 5I0RA 5CADA 1G9CA 4BMEA 3U11A 2R3XA 4MLOA 3WF3A 5JPNB 3ZXJA 1O85A 3QR6A 1JZ8A 4O5QA 4CYDA 3AMQA 3WX5A 4XC9A 1WOUA 4BVXB 1TTZA 3WCRA 4I0BA 3ZMLA 2BGPA 5FLHA 2YOIA 2EAAA 1J84A 2CGNA 4LKFA 3FFZA 4NRQA 1TOFA 4YM0A 1H4GA 2RV9A 4XURA 1G0TA 2RM21 3I4IA 3RZMA 3IR4A 1JHNA 1Q8OA 1OI6A 1QMJA 3V0AB 2AYHA 3H9AA 4Q5OA 4XF3A 4G2EA 2AEYA 2JIGA 4CTEA 3FL7A 4ECIA 3S57A 2HWF1 2H66A 20GSA 3AYDA 1N1VA 4XZPA 2LNSA 1REFA 1O3SA 4HLTA 3IAS2 4IGQA 2P31A 3N3HA 1AL21 1O8XA 4U36A 2P5QA 1GV9A 4BHPA 1RUH3 4C1XA 1HJFA 2ZACA 4FBFA 4QM9A 1M4WA 3ZFFC 2O8QA 2FBEA 3VBSC 2AGSA 4GSSA 4KQ7A 2VUPA 2V5DA 4CCDA 3T0DA 2YJ7A 2MEV2 1PVXA 1O6JA 4RA0A 3APQA 1KDKA 4EXJA 2FLSA 1UL9A 2P1BA 3PUIA 4ZY9A 1TME3 1D7PM 1UPSA 1H2LA 3OBZA 2YU1A 4CCMA 4LT5A 4YVSC 3NJZA 4UF0A 2TRCP 3EBRA 3P3PA 2ZPXA 4TR0A 4JGZC 4WV8A 4OFNA 3TJGA 2Q1ZB 3AJZA 2OVUA 3ACIA 4JX0A 1YIFA 1Q8SA 3IIAA 2FA4A 3RDWA 3Q8BA 1QXPA 4Z92B 5FZEA 4CEWC 3B3QE 4ZS2A 1ULCA 2XVLA 4CDWB 4CDXA 4P08A 4EROA 4FFFA 4XFFA 4RQPA 2OW4A 3ZVXA 1EAH2 4KI5M 1SYRA 3L4NA 4CE8A 3POEA 2RS32 4AVBA 12GSA 3SH3A 1H2NA 4EZHA 3O6TA 1FPN1 5CRHA 2D93A 3KVAA 4ASLA 4GH4A 1PVC1 22GSA 5DALA 5ACA3 1J3RA 4P00B 4AF9A 1AAZA 2XLAA 2PFWA 2V73A 3NNLA 3DXTA 3ZYGA 5JR2A 5A1LA 2X10A 4CDUA 2VVEA 3A22A 1AYM3 4MZCA 4RR3B 4QX2A 1UO9A 4JKKA 3ZXAC 3POWA 4N7UA 2VBDA 3IKWA 4XFIA 1W6NB 2ZGQA 1PGL1 2JG8B 2L5LA 1LTEA 1H1MA 3J7MA 5F8PA 2IMIA 3QH6A 3RBTA 17GSA 1NCRA 3H7YA 6GSUA 1NZIA 3ES1A 3VLBB 3USUB 3WDYA 4XUQA 4HJ2A 1BBT3 1TJDA 3DCQA 3JD73 3AFKA 2JL4A 2OXBA 4ZPIA 1TK5B 4YW5A 3HHVA 2PAMA 1BEV1 2ZGNA 3ZIWA 4CP9A 3V64A 3B9CA 3D21A 5IOXA 4C8DA 1YFYA 3F3RA 3Q74A 3TDGA 1G9FA 3OSDA 3K2OA 1QXJA 5EV7A 2OA7A 2X8HA 1REEA 1PMTA 3NV4A 5DQ0A 1LJ7A 3M7AA 3NJXA 1ZX5A 4G9SB 3IPVA 1MVEA 2DF7A 2VQ0A 4H2AA 5FP9A 1WIKA 5EY6A 2I45A 3VHRA 3SCGA 5A6YA 1ZYPA 3RPNA 1XNAA 3POYA 4PGTA 1GZTA 2DSAA 4Z1VA 3VV1A 2GN7A 3IC8A 1NCQB 1GWKA 1F8VA 4JKMA 3FYGA 3CIHA 1QOOA 2CY6A 1T4ZA 1V70A 2OBKA 3AP5A 2BV4A 3I3EA 2BEOA 3POBA 5FPLA 4ZU5A 5CU1A 2MPFA 2GC0A 5J09A 2GAUA 3CJIB 1U3AA 1GSDA 2VMIA 4FAHA 2D3SA 3UESA 2O85A 2EXHA 1TMF2 4M3CE 4U2AA 4RUVA 5JIUA 1I5ZA 3PVNA 1EP7A 1RHI1 4YW2A 2GSQA 3UJOA 2BFUS 3LA2A 4PI0A 2Z5WA 3IN9A 2QCSB 3CBUA 4BOWA 4K2XA 2WNVC 2CVBA 4A3ZA 3SH4A 4BQ3A 4E8EA 3KIJA 2RIIA 5DDJ2 5JI7A 3ED3A 1QIQA 1WLTA 5DVBA 2G2QA 4JZQA 1QOSA 4HANA 3ILNA 1YY7A 1X33A 2NN8A 5J1XA 2GH2A 3Q9OA 1K0OA 1WLWA 1SYXA 3UGHA 4W6XA 2XLGA 3VWUA 4HETA 4RS5B 4IERA 4ASMB 3IDVA 2I1UA 5GJ6A 3VWWA 1ZNPA 1GICA 2J1VA 3EXUA 2O87A 2LQOA 5CKMA 1AQVA 4ZBAA 1H2MA 4HZFA 3KM5A 3WHTA 4L0UA 5G1KA 1TI3A 2DKIA 3CXGA 5JR7B 4YGEA 2DYCA 2JDNA 3OG2A 3JCIA 4LJHA 2V2GA 2RUFA 4PQ9A 1W6PA 4DUXA 5JUVA 4KWUA 4F0CA 2X29A 1OC9B 5DAPA 2HWB1 1ZZ9A 4NHLA 1T8EB 4LK7A 4QPIB 3O0XA 3SCHA 4WBBA 2H0IA 1XNBA 2FCUA 5C8WA 2ZGMA 2QZ3A 2VMHA 4C0BA 1TME1 4LBLA 1R4WA 1YF0A 2VTXJ 1V2AA 4RQPC 3THPA 2GNMA 5BXXA 1EWXA 3JUUA 1X9PA 3LF7A 2BU9A 3ZX7A 1Q8PA 1WMJA 4YKFA 4Q4Y3 2ET7A 4ZIJA 5FY7A 2CGPA 1RUF2 1WW6A 4EYUA 1BK0A 5HQPA 3POSA 2GC3A 3VI7A 4BMBA 4LULA 3VHOA 4CSWA 2OYZA 2BDRA 1LGCA 3IK7A 2F8AA 5D93A 4IN0A 4FSJA 2YV7A 1RK4A 4JC1A 4LO6B 4XHBA 4WVVA 2EA7A 4CDUC 2HRNA 2QDRA 2EXIA 2VQTA 1WRYA 4NRMA 4HI7A 3NNGA 1FNYA 1V58A 1WMDA 5IYYA 4BPZA 2GNDA 1SLTA 1XE0A 2B5HA 1GBGA 2ZXQA 5ECIB 5HR0A 5I8TA 2JDHA 3WOGA 5ACA1 2WA3A 1W8OA 2HLEA 4QD2A 2RR13 5FY5A 3HAGA 5IMVA 2VO4A 5LA0A 4QKDA 3JQWA 1C57A 3WVJA 2WZPP 2D3PA 2RM22 2CQ9A 2IMEA 4OI2A 2XQRA 1AYM1 3DYMA 1UYYA 3FBMA 2Q8EA 5A7WA 3VBUC 1K12A 1YWKA 2D6LX 3FN9A 1VBA3 2K6VA 2MHFA 2HWF2 4DS0A 2ARXA 3T08A 1BJQA 4LLOA 2ADDA 3LEGA 4B3NA 4IL7A 4D7TA 1JFUA 1RUD1 2VPVA 3ZYFA 1WWJA 4X43A 3GL3A 3VDDB 4POBA 1AL22 4XDPA 2AB6A 2VNGA 3OPTA 1D4VB 4QGNA 4NIHA 1EUTA 1BBT1 5ABJB 4HVRA 2H1GA 2DTYA 5ELGA 1NYWA 5IVEA 3JD71 2W47A 1A78A 1C8M3 3MYXA 3J7NA 5F2WA 1MS3A 4Z7XA 2VUDA 5BRTA 1HV1A 3TOUA 4USSA 2YGMA 3PVOA 2NP0A 4BIFA 4BIOA 2DJ1A 4JVAA 4L97A 3ZFEC 4HFSA 2F4PA 3UETA 3GNJA 2YU2A 3IAPA 3MLLA 4ET7A 5FDBA 5EYXA 5APAA 4TRXA 1HQLA 3FE5A 5B8AA 3UKVA 2H30A 3GURA 1H8TA 3ACHA 4H86A 5AFEA 3HJRA 4YG3A 4MPFA 4Z82A 1RITA 4J56E 3H8OA 4YARA 4WETA 2UYBA 3GNEA 3VHNA 1WBLA 2VCQA 3RG0A 5BYNA 1VGLA 4OCFA 4K0GA 3DWVA 5BNQA 5FZLA 1S2BA 1ERWA 2R1BA 2L4CA 5JZGB 4UXAA 1ZOFA 2ZCTA 2ZHNA 5J37A 1B4PA 1REDA 2VL4A 4LMFA 5LEKA 1GWMA 1XIYA 1AX1A 3CTGA 2H6ZA 2DTWA 1YQ6A 5C8CA 3K48A 2WNUB 3H4KA 4Q27A 4NIGA 4DRRA 1XVQA 2R0PA 1MEC3 4UFKA 1FPN2 3BPZA 2ARCA 2KXLA 1YQ2A 4M3CF 2UYAA 1DSBA 3B93A 3KT1A 4IS0A 1DQ5A 1VMHA 5LW9A 1PVC2 1TQ5A 4QX5A 4E4ZA 5IMDA 3DF0A 1DYPA 3I43A 2DJJA 5J3RA 3FR6A 3AKPA 1R5PA 1XU2A 4A2UA 5CKNA 5BUVA 3KHCA 3WYWA 3KQ4B 4ISDA 5IMZA 1WWYA 1C28A 5CISA 4EN0A 2AV4A 1RVF1 5FP8A 2EVXA 5F32A 1W6QA 4TVEA 5FBZA 4KGGA 2N5BA 2Y33A 1QGLA 1PGL2 4TYSA 3WQBA 4MHUA 1XRUA 3EE2A 3WDWA 3WUDA 4AI2A 4GULA 4JBBA 3ROUA 3HJOA 4Z2AA 4HOJA 3I2IA 2VL2A 5DZGA 4GSTA 4I5QA 4FCAA 1Z7S3 2L57A 3IMMA 2BUKA 1B9YC 2M80A 1BEV2 1CVNA 4TR1A 3C3VA 5FK7A 2F9SA 3VWVA 1BK1A 4O9GA 4HVOA 1CPNA 1GQHA 5FZOB 3RZJA 1LENA 1OA3A 1Q8VA 5LEJA 4PLOA 4J25A 4MDCA 1RUG1 1HB1A 3M3CA 2H70A 5FZDA 1J1LA 2VR4A 2HBUA 4PLNA 3H8QA 3G7YA 3GH6A 3O12A 3ZXGA 4UT5A 4KA0A 3N35A 3P90A 1W8NA 3VD4A 1KJLA 3C8EA 2W68A 1WMEA 3BIWE 1SL0B 2VM9A 1YF1A 5A3LA 2Q30A 1YIPA 3R4DB 4QB1A 2NPBA 3L9SA 1XOBA 2RDRA 2DVGA 2GMEA 4HKLA 1HLCA 3O1PA 4KAEA 2R0CA 3IK9A 2C5DA 5IVYA 1CAXA 3E6BA 4Y26A 1POV0 4JAAA 2CNAA 3WD5A 4K1YA 1WLCA 4Q4Y1 4CEYA 5A1FA 2L6DA 1RHI2 4XFCA 5IHRA 5F05A 4ISRA 1RMU3 3ZYBA 2VOXA 4XQDA 4IEXA 1R093 1LHUA 1X9TA 5TSWA 1AUYA 5A3TA 1WD4A 2GSRA 3TKRA 5DUUA 1V98A 3LQ7A 5HCHA 1K42A 4YYOA 1HB2A 3LIGA 2DMLA 2FDKA 4PTSA 1ERTA 4TLFA 3QAVA 1VBD1 5F3IA 3BD2A 5A80A 4OFGA 4EE0A 1OAZA 2JIJA 5FK8A 1US2A 3MWHA 3ZXLA 1HX6A 4YZ1A 3LYPA 4EO3A 2YNXA 2V32A 4HUAA 1PN9A 5BY5A 2RUEA 2RR11 5F5CA 2XC2A 1ZL9A 4ARYA 2YN1A 5CFCC 1NA1B 2ZGLA 4CDOA 5JSRA 3GX8A 3AP9A 3WXPA 1AIUA 2I07B 4BDVB 1F4HA 3QFAC 3VD3A 4WM7A 5GM0A 1RB8G 1VBA1 4HZ4A 2A3WA 1OFNA 3CJXA 3DECA 5FO9B 4WZCA 1JU3A 3FZ4A 2NM1A 3ZSJA 4K7NA 4NAXA 4AJ7A 2VD7A 1UYPA 3EINA 3MDKA 1YEPA 1UAIA 4ZB8A 4CP0A 4QPGC 1OKDA 1H8TC 4XF9A 2HSHA 3O0VA 1C8M1 2R0FA 1DUGA 4NWWA 4TR4A 2HWB2 3UGGA 5FXZA 1UIJA 3T1LA 2IXKA 2HFDA 2CDOA 2DCKA 4BQYA 5A7PA 2DLXA 3TNQA 2LEGA 3VBFA 2QC7A 1UU6A 2Y26A 1TME2 3ZR5A 1QQP3 2VW1A 2WFF3 5LBBA 2QVSB 3N9PA 3U0ZA 3AZWA 4V2LA 4GB33 5C8CC 1BXHA 4AEMA 3PGTA 3WGDA 4Z2RA 4FAGA 4RGKA 4BM8A 4KGIA 4V1Ap 1D2QA 3B00A 1F9MA 3UAPA 4JGYB 2H0HA 2AACA 2NMNA 3Q19A 3AMMA 1EPWA 2PBJA 4XS6A 4AJ6A 1RUC3 2X4AA 3WP3A 3TJBA 3I3QA 5A5KA 2GNTA 5EYYA 2VLTA 3WF4A 1RTVA 1ZM1A 5A4WA 1XCCA 5CNAA 3UVHA 4K7JA 4UW6A 3BTYA 4I02A 4XRDA 1W2UA 2EIOA 5KXCA 2CWMA 2CZ3A 1SFNA 3JB8A 2PVOC 3PINA 3I3MA 3HY2A 4G10A 4DVCA 3HQXA 5ACA2 4BWQA 4KE3A 1N47A 2IL3A 4XJUA 3S9FA 3AKSA 4YW1A 5FO7B 2D6NA 1AYM2 5A33B 1XG8A 1LEMA 2QDNA 4IEWA 3AZVA 4ZBBA 4K40A 2WT2A 1IQAA 2IXIA 5A6QA 1GZWB 4QX7A 4QX0A 4AZZA 1K5MB 2V5YA 5BNNA 2GSSA 2PHTA 3A23A 3MEPA 3OBAA 5JSOA 1S0DA 5A3OA 3U4XA 1H6YA 4MXVA 4I09A 5EJ3A 4IEVA 4OHVA 4TXOB 1QNYA 2A71A 1BBT2 2PMTA 4OFTA 3JD72 4IV3A 2WJSA 3WINE 1J3PA 1XWBA 1PX6A 3ZREA 3BN6A 3TKSE 1B35B 3M2MA 2HEWF 3OYWB 4QKFA 4PURA 1E5SA 4NR1A 1NXMA 4AI9A 4OFMA 1H4HA 2UURA 3H8XA 3AFGA 4AI3A 4N30A 2PHDA 2VZ3A 3EU3A 3ZDSA 1EUUA 5FY9A 3ZR6A 4H55A 3HJMA 5L9VA 4AAXA 3ZFGB 5I93A 5F3GA 1NSWA 1S2KA 5EIYB 4D73B 3IAM2 2XWJB 2QQVA 1ZA7A 4CCKA 2BFUL 1UMHA 4OYUA 3NSTA 1C5HA 4TTGA 3EQEA 3POGA 4O7XA 1FB6A 2Y0OA 5K0UA 5IQYA 2JD9A 1FYUA 5I8SA 1X9WB 5I0TA 2IFQB 4D7YA 1QUWA 1TE1B 1N3OA 2P0GA 2JZRA 2ZHMA 1GH2A 1BAYA 5DUWA 2J1UA 2WZ9A 5AIXA 2JB4A 4ZKTB 4BL7B 4YH2A 2QE3A 1JH5A 2GDFA 1JZWA 4KSMA 2GT5A 2K8VA 1CJDA 1FVKA 1NHOA 2YBKA 2DCJA 2OQ6A 4D6SA 2BVBA 1GUMA 4M3CA 4XMIA 2VZQA 3R6SA 1RMU1 4ZB9A 5ECRB 2B8MA 2ZGUA 3SLIA 1W04A 4P9IA 1RVF2 4ZXEA 4Y5TA 1J9BA 3WHUA 1OXCA 4EVMA 3AMHA 3GFKA 2ZUPA 4EV0A 1GQPA 4ZXGA 5SV8A 1OQEA 2PTMA 1MD3A 3T30A 3HA9A 4YAVA 3DPRB 1V6JA 4ONUA 1YZXA 2XKOA 2CU5A 1O4YA 4GJYA 2Z79A 3KV9A 1CESA 1F5FA 4AVTA 1ZZ8A 4QQPA 1OC1A 1X8EA 3TWIA 4IV1A 2CAVA 3H3UA 4WVZA 2CAIA 2A73B 1YEWA 2HRKA 2ZZJA 2ZMLA 2XXZA 1KDMA 4MF5A 5FZ8A 4XUPA 3VBHC 3HN1A 3O14A 3LA3A 3W8JA 4EJRA 1EZKA 4LHLA 4N53C 4YG0A 1GR3A 2V4VA 4MXWA 2OT7A 2QNKA 3VBFC 1RUG2 1W8WA 4BH9A 4D94A 1W28A 1M7TA 2E7TA 4QGMA 4QHZA 1PN0A 2WKKA 1GQGA 11GSA 5A7NA 4PIYA 5FQ0A 4ASKA 1OLME 4MHRA 4IE6A 3C7FA 1E57A 5IVFA 1KRIA 4L5LA 1W90A 1DIWA 1NT0A 2IN3A 4Q1RA 4OUMA 3F2ZA 2WNEA 4IE0A 13GSA 3VBRA 2I81A 4LHNA 1R1A3 4PQHA 3D4MA 1QQP1 2WFF1 1OKTA 5B7CA 1VAMA 3WZ1A 2A3XA 2CSGA 2LTKA 5JWQB 1DQ1A 1OH4A 4Q4Y2 2QQWA 5BNOA 1LR5A 3CYNA 1QKQA 3C1RA 3KH9A 2ZAAA 5LK7B 1UMIA 3CMIA 1XNKA 4URTA 5IW0A 1YKAA 4IQAA 1OH3A 2R30A 1RUC1 2G9ZA 3WNNA 3VPTA 4Y3OA 2A1XA 1TEIA 2FWFA 1D4M3 1SLBA 1I5PA 3POJA 3ETPA 3NVCA 1QFNA 3DVXA 4ILFA 2WJUA 1PL1A 4Y1ZA 4PF5A 5CG9A 1VBD2 4CCOA 2P5RA 1WJKA 1WCSA 4IQ1A 2Q1FA 3OD4A 2H01A 2O8VB 4MF7A 5F6LB 4HN1A 4WVWA 2ORXA 4BWOA 4Q0PA 3UYJA 1EV13 4GIQA 3KGKA 2AEZA 3FWEA 5FZFA 1UOFA 5C6CA 2GGTA 3VL9A 1U3IA 1LOCA 2RR12 5LRSA 3LPGA 1XNDA 4BVXA 2D6MA 4IV3C 4N7IA 4GMP0 1UC7A 1OT5A 4HKWA 4PDWB 1N2AA 4KUNA 4Y20B 5IO0A 1UY4A 2VD1A 1VBA2 1ND3A 5CB7A 3I2DA 2YV8A 3F95A 1CX1A 1TK0B 2HSYA 2C1FA 1GZCA 1MQTC 3WF1A 1OHFA 4XIKA 4Q0UA 4ML6A 2X53S 4LTAA 1GULA 1D0HA 1PO13 3MPPG 1Z6MA 2JE8A 3I7DA 1GP1A 1VE0A 4D0QA 3ZMNA 4XFBA 4ZBDA 1C8M2 3QD9A 3NAPC 2IMFA 3LFIA 2E6VA 4XFGA 3D8CA 4GTUA 1AR63 1EPZA 3I54A 2PUKC 5JCGA 2VUAA 4NE9A 1W2NA 2LS6A 5GZDA 4EQVA 5K0UC 2VE1A 2VD0A 2H6BA 3BKZA 4JHTA 2LUWA 3ACGA 3M9JA 3WW1A 3OPWA 2ZHKA 3ZLPA 4LE3A 1IZ3A 4PCRA 3PMEA 5CIRA 1QXRA 3PHMA 4FQUA 3T1MA 5C9AB 1UZVA 2JEMA 2VECA 4NAOA 2ILMA 2VOKA 4UW5A 2YJHA 1CGPA 1PMJX 3MDPA 5FYYA 2G1MA 5D1IA 2A75A 4PT6A 4INDA 3SH5A 4XTSA 1FVJA 5DAKB 4XFAA 3I2KA 2OA2A 1T3BA 2QZ2A 3AK0A 4LA2A 3MIEA 3FRCA 5C70A 1MEC2 2VCXA 4QQ7A 2XBIA 1QEXA 4K0NA 1RC6A 3J26N 4P9WA 1YC61 5C7GA 4MLYA 2W1QA 1UCXA 4CDQA 3MLJA 3OGVA 4GF0A 3I9V2 4WKWA 5DAQA 3WNPA 3FY7A 5FYUA 3WQ1A 5L36A 2V41A 1MVQA 1HRV1 3OBRA 4LOSA 2RDQA 3CF6E 5LWBA 1OURA 4IW3A 2ZCWA 4YM3A 5FMDA 4MK3A 4R9BA 1DGRN 2HWD3 4OCTA 2HI7A 2R0GA 2GZYA 3HN3A 3FZ9A 4F0BA 2W2IA 3CLPA 3VKOA 4E4SA 3UEMA 1VR3A 3KHBA 4N43A 4M4RA 2JZTA 2K2SA 4HSJA 5FZIA 4QT6A 1S2EA 3MBWA 4L99A 4MP4A 1YDKA 1YKCA 4CCJA 3FLTA 2YPJA 1OE7A 2WB9A 4J1WA 3ZL5A 5DDLA 5FR3A 1Z7S2 1YJLA 2C6SA 4Q4X3 3LIHA 3A5WA 1TDIA 3A2WA 1PSQA 3F4SA 3GL5A 4URAA 3WDUA 3PIJA 4GD4A 1GL8A 4BU2A 3MAKA 2TIRA 3USUA 1UX6A 3ZFFB 2VZTA 1YQ5A 2YXSA 2HYKA 5E6HA 5FWJA 3TGZA 3MSZA 4F7ZA 4WXTA 3T4VA 3M3EA 3ZN4A 3VBSB 2BNMA 5FPVA 5L71A 4NUBA 4DUWA 4EF0A 3PNAA 1PGW1 3VBRC 1Y3TA 2VH9A 1NW2A 3UJ1A 2YY1A 4NJ4A 2CV4A 4HQZA 1JYCA 3KF3A 1MS5A 2AR6A 2GZPA 3ME7A 5LRRA 4YVSB 4AFDA 14GSA 5KEJA 2BBVA 1WW7A 2JECA 4IEPA 1PK6C 2OPKA 4JGZB 1JN2P 5BNOC 5IAVA 2Y6LA 1PL2A 3SEPA 4AI1A 3CRTA 3BJ5A 4LO8A 1VP6A 1NY72 2XJQA 1R1A1 1SJIA 3WD6A 1VRBA 3LFMA 2K18A 4AHZA 3DGTA 4M00A 3BUCA 3PVBB 2DV9A 1JYXA 3HZ8A 4NMIA 2JADA 1LU2A 4CY8A 3BBYA 4EWEA 3WNXA 4BK5A 4KDXA 4LLFA 4YLZA 5JOXA 4Y1YA 4QB6A 1SZBA 3O1RA 2JDYA 3FK8A 3F4RA 3TOJA 1ERVA 2YZHA 1RMU2 4JKLA 2H71A 5COHA 2O1QA 3N7JA 1ENQA 1D4M1 2XBO3 3U6VA 2DDUA 4ML1A 3KP9A 1WA4A 3I2HA 2R071 1XU1A 3TRQA 5K4LA 4N90A 3TKPA 2A5ZA 4XTMA 3IV4A 3AKTA 1IOAA 3LG6A 5C3OA 1Q98A 3S7EA 3E0UA 1XOYA 3RS6A 3WUCA 3AX4A 3MNGA 1F35A 1YO8A 3GYDA 2C24A 3HT2A 5D9TA 2XVGA 3CL1A 1THOA 3IPZA 2R063 1A8YA 5KR7A 5I91A 2X49A 1WW4A 1RXFA 3O1UA 1SPPA 5J48A 3LQCA 4AVAA 4KW6A 2LRNA 2GN3A 2B9UA 1XXUA 3I6AA 1FG4A 2X8KA 5HR1A 1DE2A 3RJ2X 4BQ5A 3WEZA 4V2NA 4NXIA 1W8HA 2MYGA 1DYKA 3KF5A 3GBWA 3I8TA 2XL7A 4WVMB 1UN2A 5IK8A 3MO4A 3T4HB 3AKQA 4CHSA 2OACA 4IELA 1JXNA 1L7LA 3U10A 3KMNA 4WBRD 3BPSA 2LQQA 2MMZA 4D8MA 3THDA 3QLQA 2DVAA 1A8DA 3ZM8A 1G7EA 3PUQA 1IKPA 4XXAA 1AR61 1X36A 1ZRCA 3UMAA 1TP9A 2VCBA 1J0FA 3PU8A 1JZRA 4F8AA 4LA3A 3W6GA 4IP6A 1XSRA 2ZNMA 3SC7X 1QQP2 1IG3A 2WFF2 5ID2A 3D82A 5LK5A 1HRI3 1YUDA 1CAWB 1X50A 1G9AA 4LQRA 4FPYA 2FGXA 3ACFA 2PLV1 3BU7A 4ZZ8A 5IMCA 4DQAA 2GSTA 1Z78A 4W8JA 4P9LA 4EIQA 4MSVA 3ZKUA 5A3WA 5FT3A 1K3LA 3WW2A 3ZO0B 3GA4A 2QQMA 3E97A 3ZYJB 4XS4A 1AYN1 4R8HA 4CDWC 3HQRA 4CA9A 2B5EA 1RUC2 4S2GA 1YNAA 4NN0A 2OZ6A 1VF2A 4QB2A 1ERUA 4N9IA 4GCIA 4E8HA 2D6KA 2VCWA 3DMLA 3VL8A 4O5UA 2OUJA 1OYJA 1PQNA 3VI5A 1AQWA 4MH0E 1O3RA 5HCFA 3MUY1 1XZOA 5ISLA 1UXXX 3IOSA 3NIVA 4H3WA 4A4AA 1S0BA 3WDTA 1WKYA 5IATA 3HCZA 3JBG3 3AB0A 5H9SA 2E7QA 2ARBA 3HD8B 5FYCA 4CP2A 2C8UA 3M9KA 1SL2B 3KCXA 4N0VA 3EB7A 5ANQA 5T5PA 1H9PA 4OHXA 1LEDA 4N43C 4RR3C 2W1WA 2A7AA 1V6KA 1W9TA 1IQDC 1DGWA 1VPHA 4AFBA 1AR93 2ZS6B 2XJPA 4BQ1A 2VUCA 3V0BA 3KVBA 4HL0A 1CQGA 1R64A 2DFCA 1HB4A 2GZWA 4WM8A 3AVSA 2JG8C 2XJTA 4O92A 5FZKA 3WP6A 3WSOA 4BQ4A 1JYVA 4Y1XA 1C3HA 1C4RA 1LAJA 3LA7A 1M0UA 4CXXA 1YQ8A 1FOVA 5K9YA 1QHDA 1EEJA 5BMUA 2NYYA 3J8F1 1RXGA 5F9TA 5LY2A 2HRAA 1CN1A 3ZFBA 1ON4A 1Q3EA 3U4SA 1DGRA 1UKGA 5E88A 2B7KA 3DV8A 4EIPA 4CRQA 1B48A 1TU7A 3IXRA 5A3PA 4Q4X1 1SLAA 3V56A 4QPWA 5KOXA 1YXWA 4ECBA 3TKSA 1UY3A 4I01A 2WO2A 1QU0A 2JG9A 1NLSA 4UF0B 4LMVA 3RMYA 3FMGA 1PKWA 3C7OA 2JDUA 3AJYA 3F9UA 2YROA 3KCYA 3HMYA 1FAAA 4O9EA 1GSFA 2B5YA 4H7MA 1QJFA 2W1SA 4CDXB 3VBOA 3DEMA 2DURA 2WNOA 5JI9A 4RQPB 3N7MA 3SXWA 3T2QA 3R0RA 2QA2A 2VOVA 2YZUA 5JPMB 5KHGA 5DXDA 1ZBE3 2DCZA 4KNDA 1XPWA 1NCQC 4AQTA 1KS5A 3J7Yb 2XG3A 3GM8A 3OUIA 3WG1A 1T2XA 2YBPA 1XBFA 3VZKA 2X5IA 4BQXA 2OJLA 4GH4B 2D97A 5CEHA 2WLQA 5T5OA 4FO5A 5DALB 4TXWA 1OF3A 1W39A 3MFAA 3W20A 5EVOA 4P9YA 4CDUB 1DBNA 4KWJA 1ZCPA 2VAFA 5J98B 1DGLA 2DFBA 4AEJA 2XKPA 1JZ5A 1BCXA 2MMNA 2B9VA 2IWGB 1NXD1 1HRV2 1RYYA 5LA1A 2A6XA 1NCRB 1OQDA 1U5XA 3N9OA 5F0GA 4GWMA 3NNJA 3EYTA 2WWUA 1SU9A 1E5HA 2J23A 4YFZA 1FOD3 3NW4A 2B42B 2YFZA 2GS3A 4NHKA 2VOTA 4LL4B 2FNOA 2H1BA 5DCGA 2VW0A 1NX9A 2H6XA 5D73A 1YFXA 1W03A 5IT6A 4ZHNA 3HNBM 4MMMA 1SD8A 4CP9B 2WS93 4EWDA 1MDIA 2B4KA 4PHZA 3MFCA 2D44A 4RS5C 4X4JA 1EP8A 2W52A 3ILRA 2DU1A 4K8FA 4XF4A 2WZ8A 1MS0A 4ATEA 1H8VA 3IDAA 1X0RA 1Q5OA 1SBDA 2PAKA 3IPVB 4AG4A 5AIVA 2PPTA 5B4NA 3LSEA 2XDVA 4OO4A 3O76A 5IPHA 1W8TA 2PAEA 4EN7B 3S5AA 1N1TA 2MMOA 3WT3A 4DY3A 1PGW2 3PTYA 1SCSA 1W4VA 2B45X 3QBQA 3U75A 4CEWA 4LR4A 1U0AA 5KN1A 3Q8AA 4IEUA 1PGSA 2FUG2 3ECQA 1SENA 1YCIA 2BGCA 1PO23 4QX3A 4QPIC 1H1AA 2YWIA 5EJZB 2R2JA 1A3KA 1OLMA 2VQUA 5GZGA 3CSIA 4C90A 3UJQA 2P3YA 1DP0A 4KF9A 4KH7A 3A5IA 1W6MA 1J08A 1VBE3 1R1A2 4BK4A 2HNLA 3NMBA 4ECJA 3DL3A 1K0DA 4Q0SA 1HRI1 2D6PA 3ZRDA 3T0BA 1V6MA 3K77A 4PBPA 3J7Yk 4IETA 2GP5A 2XR4A 4A3XA 1IYIA 2VC9A 1L7RA 4XCAA 1GTAA 4RFT0 5H5QA 3IZOA 5G31A 4XOGA 1O7UA 1D4M2 1FATA 3ME2A 2VOWA 2AYTA 1XWGA 4AI8A 3KQRA 5KHHA 4CVUA 1LOEA 2R072 3DYOA 4UI9L 3FHIB 5D9XA 3DGQA 1IS4A 4WM8C 3W21A 5FYSA 1GLPA 4XFHA 3O5SA 2XONA 3KV5A 3JBG1 3M1HA 1ZGNA 4LOTA 3GCXA 4XHXA 3BI3A 4Q2FA 4QU2A 4Q29A 3P6BA 1S0CA 1TG7A 3URFA 1GOHA 4EDZA 4K21A 2W5FA 1VRH3 1PZ9A 3E5QA 3TYJA 4P14A 5FWGA 1AR91 3TN93 2KA3A 1W6PB 3RZHA 1JBCA 1G6WA 1A24A 2KHPA 5G30A 4MO3M 2JG9C 4WR4A 1SK1A 1XWCA 4FTEA 1WUVA 4DO0A 3MIBA 5DUVA 2XVKA 1HJGA 1GZ9A 1M9AA 1IS3A 3F4TA 4FH8A 1G9BA 1XYPA 2H1DA 4IGPA 4G0IA 1ACVA 2OPWA 3OEBA 5IPGA 2E2GA 2CL2A 2E31A 1IHMA 2BW8A 4W50A 3CNAA 2VL9A 2PWJA 2V6OA 3R3EA 1AR62 3UARA 4POLA 3PUHA 1WCKA 1QJU3 1OKQA 3RMXA 2FHRA 4S2HA 5IIZA 2W1UA 1CZTA 2PLV2 2X5IC 4D69A 1FT9A 3GKXA 1NQDA 1CAVA 4P9XA 1V40A 1UMZA 4BXSV 4LBQD 2JXAA 1DBYA 4IGJA 4B4RA 1ZA4A 2LNTA 1ZBE1 1UZ0A 1AYN2 4B4QA 4YWAA 5FPAA 1PGTA 2WNVA 4GJZA 4TN7A 2VCVA 4J2FA 2JDMA 3LWAA 5FP7A 3EWLA 4DEJA 2WNUC 1PMHX 4EDYA 4Q5QA 3E6DA 5LATA 3H3LA 4CCEA 1EOHA 2JZSA 3DN7A 2VCAA 3RYKA 5FLJA 2ET1A 3NKTA 3SITA 1GNWA 2H0VA 4WF4A 3APOA 4IQPA 2GC1A 1NG0A 1VBC3 2JKBA 1SL1B 5A7WB 4FYUA 3BVCA 5DZFA 5L73A 1Y7BA 4ICYA 4FQ4A 1S3RA 1LJRA 4LL1B 1DFQA 1VIWB 5HR3A 2EAKA 3CHXA 1XQNA 1DQ4A 2F51A 1FOD1 2ZX1A 4JCKA 1B9XC 5DPNA 2HEYF 1JYNA 1QJX3 4MUVA 4TN8A 4A45A 2PVQA 3DRNA 1KD7A 2HWE3 2WS91 1CD3G 3J8F2 1KXGA 3OOXA 2GLRA 3N9LA 1NHYA 3TRPA 4WEYA 1QDOA 3UT0A 3M1GA 1GANA 4S2FA 3DKSA 4Q4X2 3ZYIB 2RDSA 4K9ZA 1MDKA 5FBJA 1H8TB 2AUYA 4QWNA 2YBSA 3IWZA 3GSTA 3VHPA 2LKUA 1I5GA 1O73A 1I9DA 4FOQA 4TXOA 2WAOA 3TBDA 2BJXA 2C26A 4UAPA 1YFWA 5FYMA 2G9FA 3HWJA 5A32A 2ATFA 2B3SA 3EPTA 2PA7A 2XOMA 2ZEWA 3BODA 4GXZA 1GKBA 3I49A 3OY8A 4RQXA 3E5UA 5FZBA 3UBKA 3BCWA 4D3WA 5C8CB 4TZDA 5ENUA 3TB2A 4JEDA 4E4HA 2JSYA 4V2MA 2YANA 3KGZA 4RYDA 3HIFA 4SBVA 4YFWA 3VKFC 1OUXA 5F1RA 5IM9A 4IESA 4FFGA 3KXOA 2B6MA 2WO7A 2EICA 1ULEA 4JTNA 1IKQA 1EAH3 5J96B 1HN1A 3G6JB 1DU3D 4Q8KA 2P3JA 3DUIA 3KS7A 5FZ1A 1TU8A 1PA3A 2GVPA 1WGPA 2AC1A 2KD7A 1W2AX 5A7OA 2JDKA 2YP6A 4UOJA 4AHYA 4XIOA 1RJ8A 5FZ3A 2DCTA 1W6QB 4NHXA 4OUSA 1N1YA 4HDEA 2GMPA 4ECCA 1QY4A 4XVHA 1FI2A 3EJKA 4XBNA 3VBUA 2PN5A 4X8PA 4TWTA 4GLTA 4YZ5A 4L0PA 2VW2A 1BLZA 2DJKA 3N9QA 2XBO2 4NAMA 4B1LA 3FR9A 1UZYA 5D21A 4NWVA 2B7JA 1GMMA 5AISA 3FZ5A 2BTOT 2ERFA 4HK8A 1F31A 2IXLA 1JYWA 3LSZA 4X6RB 4Z2TA 6GSWA 1NUKA 1XNCA 2OS2A 1VB4A 2ZKNA 4TR1B 2D2ZA 4LEJA 4OD7A 4ZL7A 3LXTA 2NLRA 2HJIA 2GC2A 1NA1C 1DQ6A 1LCLA 4YGBA 3ZFEA 4AEDA 4K6BA 5LD0A 1C72A 4QU1A 4RGGA 4YQUA 2GALA 2Y0IA 3FHQA 4QXCA 3L78A 2R062 1LOBA 3CTFA 2WINB 5IFTA 3TN91 3CO2A 3WY6A 1LOGA 4XIHA 2VBBA 3IB3A 2XMLA 2H8LA 1S3CA 2YCDA 3MIFA 3QOPA 3NZNA 1C5IA 1VBB3 5FREA 3ZTLA 1HNBA 3D0ZA 2Q8CA 1G6YA 2LM3A 1MS9A 2QSIA 5G2ZA 5AN1A 3B5LB 4K2DA 2BGOA 5F6KA 5JOWA 1Q4JA 2LROA 5F37A 4MZBA 5FJKA 5L7OA 2Y6JA 3C1SA 1SDDB 3AVRA 4OI4A 3CQFA 4R4ZA 5FMOS 1WZXA 2EIQA 3RZLA 1SHWB 1PIV1 5IK5A 1NAEA 4Q4W3 4YKGA 4QDRA 2HE3A 1Y4WA 1EOGA 5DBQA 1XW5A 4DSSA 4JDNA 1OMIA 4FYBA 1US3A 4FPCA 4CEYB 2KP1A 1W6OA 3A4UA 4CU9A 3OR5A 1URXA 4LO4B 5C00A 1QJU1 3T2TA 5JCWA 2B1LA 1HRI2 4MOAA 1IPJA 5C5UA 4OZXA 3LYKA 4W6WA 2XUEA 1MS4A 1M2AA 1SFYA 4UBHA 1UPIA 2GU9A 4LIVA 4QXHA 2JDAA 5SV5A 4AK3A 4OI0A 1TMF3 5JDBA 4IJIA 3GGLA 1ULGA 1RW1A 3U37A 3RFRA 1GTIA 3D3AA 2W94A 3PH9A 4C0HA 2VVDA 4EN6B 1RQMA 1W9YA 4NMUA 1ZZ7A 2R043 3O1MA 1FOHA 1GUKA 1H9WA 2E26A 1SKSB 1ULPA 2VY0A 4Q0VA 1U5IA 2GQKA 1K3IA 5FRAA 1HXS3 3BYWA 2IFRA 5DDJ3 4B7EA 4XUOA 1OOPA 5FZ4A 3S0MA 4HZ2A 5FLIA 3JBG2 1RUOA 4MPGA 1RUH1 1VBC1 1CQHA 2H72A 3MPBA 3L9JT 3IDCB 1ABAA 2J1RA 1Y43B 3ILFA 4WM7B 4LBOA 4KCAA 4S2DA 4BQWA 4A7KA 2QGVA 3ORJA 3AL5A 4BXFA 5JVVA 2EIRA 1AR92 1QOTA 5FMCA 4I30A 2JD4A 3FLPA 1K5MC 2HKXA 4Q0QA 5JSPA 5CFDA 1QJX1 1LESA 2L4QA 3QAWA 3B7MA 2CZ2A 3LGCA 3ZN5A 1UZZA 4ACSA 4P02B 2IMKA 3GN3A 4XCBA 3FKFA 4DPNA 3U07A 2Z42A 2HWE1 3DXUA 3PPUA 1M3IA 4MJEA 5GLUA 2FDJA 2FDHA 1O6UA 2ZEZA 3HBKA 2IVJA 4BYYA 2G19A 1K0MA 3B02A 4N0ZA 1IGOA 3FHKA 3PUSA 3IT8A 3CMGA 2ZTNA 5J3UA 3D6EA 1YHFA 1H2KA 1TRSA 3POFA 1IS5A 4K5SA 5FZ6A 2RG4A 2PHFA 1KGYA 4DXRA 4NHWA 4QHOA 3OGGA 4EN8B 3RZGA 1HQNA 2H76A 1C1LA 1BYHA 1DQ2A 1NLQA 2VNOA 3NOFA 1K0AA 1AX2A 1F15A 1JMUB 5E16A 4NHYA 2ON7A 1ZBE2 4PX1A 3ZVJD 2ZAHA 4IE7A 5DAXA 1FMD3 2E53A 1SDWA 5LCZA 1JUIA 4CU8A 2CTVA 5H9QA 3MHZA 3G7IA 4YZ3A 3WNMA 4HT1T 4QQHA 1ZYNA 4YVWA 1KFUL 5HBAA 2WZEA 4OCEA 4XF0A 2JJ6A 1MS1A 2LJAA 2I2SA 5JXGA 4POMA 1JS9A 1UY1A 4A41A 3UL2A 3ZSKA 1MPXA 3HVVA 1HV0A 5CFCA 2VO5A 5JWRB 2HXKA 2RMU3 2XHFA 2A2SA 5G5EA 10GSA 2OE1A 4CW9A 3GKNA 5CAXA 4JRRA 1ENSA 3OUHA 5FWEA 1G8WA 2RJLA 4IDZA 4A6SA 4CUAA 4E27A 4CXYA 2O0OA 3SHRA 4OLLA 1ACCA 5BNNB 4HQSA 5J9CA 3WCSA 5F8BA 3VZJA 2J9HA 3HOBA 2VZ1A 3OGRA 4AEDC 1FOD2 2Y8KA 3EC3A 1PZ8A 1S0FA 2BOJA 1O7FA 3DPRC 4LE4A 4IV3B 4QPGA 4OMDA 4AI0A 5HCBA 3L9UA 1DLCA 3H79A 4NHMA 2NTOA 2VLUA 2DBIA 2WS92 5IO2A 1TRWA 1UD1A 3MUZ1 3ZSEA 4K9SA 1AR83 2NPIA 4BVYA 2ZJCA 1AL23 3LCPA 2ZX4A 1UU5A 2ID4A 2E0QA 5LNKe 2CAUA 4HKOA 4W65A 4UW4A 2XL9A 5ELAA 5A70A 5FY4A 1A2JA 2A4VA 5L7OC 2QFEA 2E51A 2XJUA 3MIHA 5H9RA 2UY9A 2QA1A 4XBQA 4Y24A 1CZSA 1VBB1 2D40A 1KJRA 1OBNA 1WMFA 2D7FA 2AZ5A 3QACA 3TUEA 3RZZA 1ASJ3 1VMFA 2CT6A 2ADEA 4AHWA 3NWKA 3PL0A 1JW6A 5HV0A 5K0UB 1S0JA 4GRFA 4KDUA 1OA4A 5J5NA 1CIWA 2X05A 4MABA 3KV4A 1OA2A 2WL1A 2P6CA 4BLJA 3ZN6A 2VZVA 4Q4W1 5A3MA 4O7HA 3CSJA 2XJRA 2WFCA 2EIGA 2H6CA 1XPVA 2A2PA 1TXXA 3MF6A 1O5LA 2VNRA 1YI9A 3CU7A 3EO6A 2ALBA 5CRDA 1K3OA 4LKSA 2O14A 4M3CB 4H14A 5KXEA 2ZZQA 1NZCA 1J83A 5T5JA 5KHJA 1ALYA 4NRPA 1OOPC 3OEAA 1THXA 2VM1A 5C33A 5GALA 1BEDA 2WDUA 4XZUG 4J1XA 4KB3A 4COWA 4XDQA 2R041 4K3UA 2I9HA 4MGTA 4F9ZA 3SNMA 2ETEA 2YV9A 4QXKA 3U78A 4DRVA 1ZYQB 1VALA 1HXS1 4L5OA 3ZIJA 3L2HA 4IV1B 4LO5B 3WG4A 4KWLA 2W0XA 5CFDC 2Y64A 4BPYA 1USBA 1UVZA 3I3DA 1COV3 4C91A 4R4XA 3ZMKA 3KM6A 2AHEA 1APNA 3IBMA 4D6RA 1F3AA 2PQSA 1AXYA 4FPJA 1QK8A 2C3NA 4HBNA 3KTBA 2VM2A 3TN92 4MXWB 2GNBA 3RJRA 1SKRB 4XE9A 5FCCA 3HXSA 2C4XA 2B5XA 5J7MA 3WR0A 4I3PA 4DOUA 5FQ0B 1QGVA 3BTXA 3HNYM 2G4IA 2ZGTA 1Z9HA 2MBSA 3ZOIA 4OULA 1OUSA 2R7EB 5FYHA 3VBRB 3P3NA 1PIV2 2GQMA 1ST8A 4NV2A 2WWJA 2JX9A 1NOVA 4FFIA 4Y22B 3GHAA 2V1MA 3D0JA 5T5LA 2JICA 4X8NA 3RWNA 2IXCA 5FPZA 3LEFA 3IDEA 5BNOB 5HPOA 3VURA 2VCZA 4LKDA 4K8MA 4Q8LA 1GP6A 1QJU2 1ND2A 5IK4A 1URMA 3H3ZA 2PHLA 4YVWC 1DG6A 4PF1A 4K7IA 3WW4A 3U5RE 4D6QA 2H0GA 5F07A 1MR5A 5C9AC 5ECPB 3WQ7A 2O7KA 3FR3A 4YG6A 3DKQA 5KHIA 2D5FA 2WAAA 4OHZA 1SJZA 2QQPA 3IAQA 2WGRA 3A2XA 1VRSD 3TJJA 1FMD1 4I97A 3RYPA 2ZMKA 4QDQA 4XABA 3DYRA 3ZMOA 4MF6A 1XE8A 1OE8A 3KCMA 1EGRA 4MCUA 2VNVA 2C0GA 1FX5A 1W89A 5C3PA 5CKQA 2K9ZA 5ECMB 1SD9A 5FYBA 1M99A 1U87A 5JOZA 2W3JA 2WO1A 3KCCA 5FO8B 1O8WA 4EWAA 2RVAA 3AYAA 3D0SA 2WN3A 4MG2A 1LGBA 1W2OA 2BERA 2E33A 4KX4A 2HZEA 4ZZ5A 1YYNA 4PNGA 3RHBA 1RUH2 1VBC2 2EIBA 3R4SA 3K75B 5GLVA 2RMU1 5FZ0A 3ENRA 2RLIA 5F3EA 4QDSA 1OC3A 4C1WA 4IE4A 3CDZB 1ND3B 4B4PA 5HFIA 1XW6A 3VBHA 5L9RA 1A0RP 4G9HA 2QKEA 2YFUA 4UWDA 4N53A 1TKDB 1OVSA 1WP0A 1SKWB 4MADA 4E2GA 1BKZA 1QJX2 3FJSA 3WF2A 2VL3A 5FY1A 3F6DA 3LFLA 2V6KA 2VZOA 4O61A 5I0DA 2HWE2 2VAUA 3TJKA 3GDBA 1V00A 1V9U3 1AR81 3LDKA 1JOJA 3OF1A 2WIIB 4XBLA 1Y25A 3NV1A 4GKYA 4MZWA 4ES9A 3JQXA 1F6MC 6GSXA 5A3UA 3R4UA 3K3OA 3BCIA 1K0CA 3JB4C 4UFJA 4IE5A 4AE2A 3ISOA 1UOJA 2HWB3 2LUSA 2B7YA 1MTCA 4CZSA 2H1AA 4COZA 5FUNA 4ZILA 1NM3A 3L2YA 2KOKA 1O91A 2H6YA 1MEC1 1MZEA 1Z6NA 3MV01 4NROA 1GFF2 3POIA 1K0NA 1ASJ1 3ZXEA 2QBXA 3V1WA 1PKZA 2WULA 2PGTA 2W92A 2HLSA 4XJZA 2VCMA 2W95A 1J3QA 3INAA 4ZONA 1KTEA 2DJ3A 4UW3A 3RI8A 1JU4A 2VTFA 3FBYA 3W9AA 3CSHA 4K7OA 3GZAA 4DNYA 3MICA 4XW3A 1N1SA 1KS4A 2Y60A 3B94A 9GSSA 4G0LA 5KC5A 1X9SB 4FPLA 4RL7A 4FPFA 1O81A 5LBEA 3GH9A 4FTSA 2FMYA 5CVRA 4CDQB 4FI9A 3OTFA 5T52A 1K5JA 3GTUA 4UBGA 3ZLIA 3TRXA 3W59A 4AFMA 3C8XA 3US3A 1OFSA 2IFWA 3OD0A 2HSMA 2LRCA 5HXMA 2Y38A 5BNPA 3VFIA 5B6NA 2QKDA 1ONAA 3M3OA 3JU9A 3PJQA 2PYTA 5D2AA 2EXJA 4NIAA 1B4QA 2DUPA 5KWRA 2H73A 1Z7S1 5C3RA 5HI0A 1G6NA 2W87A 1ZRFA 3O1VA 2FQPA 5C4WA 3T3YA 3QOUA 1GSYA 2SBAA 4SLIA 2W39A 4FVVA 4N43B 2MBTA 3ZITA 1QDCA 1MQTA 3O3TA 1SK0A 2OADA 4BLIA 1FB0A 2HWC3 3AZYA 5DZEA 1ZYBA 4QQLA 2WR9A 3G9BA 1OSGA 3D5JA 4MGYE 4LBNA 3THCA 2KUCA 2WT0A 4PQ1A 3ITQA 3IE3A 4KMQA 1ZZBA 3UVTA 2VZPA 2OE3A 2QQLA 1RUD3 3NAPA 4MJBA 3CBNA 5F5QA 4MA9A 1H6XA 5JMCA 1COV1 1GSUA 4TKYA 3WP5A 5FMOL 2ES3A 1YEXA 4L9BA 3AXEA 3BOPA 3D4KA 4KSOA 1HKDA 3IDBB 2K8SA 1JODA 1TVGA 1BYEA 4RSUA 1J59A 3KSCA 2WSUA 1DHKB 1OD3A 1ZZYA 2NBSA 5IVBA 2YZ4A 2SLIA 3LW9A 1Q8QA 1LKNA 1NY71 3EYPA 2ZBJA 5C5TA 1WCDJ 3ST7A 5DJLA 5LBFA 3H42B 1VBB2 2VMCA 1RUE3 1G86A 4HXCA 2QQIA 1Y6EA 4OQ9A 1YFUA 1CZVA 2LJRA 4DB5A 4EZ4A 2G0FA 1AW9A 3O7OA 1ND2C 2QQNA 5ERLA 1E5RA 3QMXA 3F3QA 4PLMA 5JAXA 5T3NA 2J1TA 3O0WA 4DXSA 2FDGA 1HDKA 3OBTA 1R091 2IMDA 4A42A 4Q4W2 4J6GA 3HR9A 4IEYA 4BQ2A 4IHUA 1WD3A 4FPGA 3KMHA 3ZXKA 4KG0A 1HN0A 1XYNA 5GKAC 3IC4A 2LALA 4NPLA 4CPBD 5J36A 2ZEXA 1LHVA 1HIXA 4M0HA 2Y6FA 3LEIA 2WS2A 3GKMA 3N5OA 3T0AA 1RUNA 2B46X 3T09A 4K5RA 1LB2A 1J58A 2GZZA 3AC0A 4CUCA 2WQ4A 4HEA2 1QNWA 3LB9A 1V6IA 3H50A 3VUOA 2JE9A 4KU8A 4XYXA 2DBNA 1NLRA 3SQOA 5T54A 2VVFA 4E4DX 5AVPA 1M9BA 2LRPA 4FYCA 2ZEYA 3ZYPA 2ZGKA 2P4EA 2V4AA 5IJRA 2OE0A 3E3EA 1AXDA 2TNFA 3IM0A 1IS6A 2HYXA 5HV4A 2RJ2A 3VZLA 2R042 3AP6A 1LECA 3CKHA 4AVCA 4Y4RA 1PX4A 1RVF3 1QWRA 1W8UA 2E32A 2W91A 2Y6GA 4A7YA 2JU5A 3SCFA 2VCCA 2VZUA 4PBOA 1HXS2 1KNGA 2WRAA 4NV5A 3D22A 3VD9A 5FPUA 3G7JA 5A3NA 4ZL9A 4FTBA 3IHGA 1XWKA 3MW4A 2QQUA