2HYXA

Structure of the c-terminal domain of dipz from mycobacterium tuberculosis
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
333
structure length
333
Chain Sequence
GAMEIREQLNLGGIVNAQNAQLSNCSDGAAQLESCGTAPDLKGITGWLNTPGNKPIDLKSLRGKVVLIDFWAYSCINCQRAIPHVVGWYQAYKDSGLAVIGVHTPEYAFEKVPGNVAKGAANLGISYPIALDNNYATWTNYRNRYWPAEYLIDATGTVRHIKFGEGDYNVTETLVRQLLNDAKPGVKLPQPSSTTTPDLTPRAALTPETYFGVGKVVNYGGGGAYDEGSAVFDYPPSLAANSFALRGRWALDYQGATSDGNDAAIKLNYHAKDVYIVVGGTGTLTVVRDGKPATLPISGPPTTHQVVAGYRLASETLEVRPSKGLQVFSFTYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Unknown function
molecule keywords Protein dipZ
publication title Structure of the C-terminal domain of DipZ from Mycobacterium tuberculosis
rcsb
source organism Mycobacterium tuberculosis
total genus 92
structure length 333
sequence length 333
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
A PF17991 Thioredoxin_10 Thioredoxin like C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2hyxA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2hyxA01
3DYOA 5JWOB 1V57A 3ZMKA 1ZYEA 4MDCA 3LXTA 1A8LA 4QQ7A 1T4YA 3G7YA 3KJYA 3I97A 2N5BA 4ARXA 2Z9SA 1ZL9A 5DBQA 3J7Yk 2I4AA 3NJXA 1GUHA 2NVLA 2K8SA 4P08A 2YNXA 4RN5A 5HFIA 4PNGA 4F2IA 5GAPD 3L9VA 2EIDA 3SEPA 1ERVA 3VWUA 4E8HA 3MDKA 3J7HA 4ZIJA 2JD9A 4RQRA 4OMCA 4MH2A 5JWRB 4LPLA 3DYRA 1JYXA 4IVFA 1ULOA 4YQUA 2H66A 3I9V2 5IFPA 1XVWA 2AHEA 1WIKA 2XBIA 1W8NA 4PQIA 1K42A 5CREA 2J23A 1IQDC 2G2QA 3GKMA 1UMHA 5B6MA 2H1DA 2HZFA 2VL2A 2YG0A 4FYCA 4GRFA 4KCAA 5F05A 3KTBA 4DUXA 4ISDA 2YN1A 3NRUA 1TI3A 2OADA 1OD3A 1HD2A 1GH2A 4DXSA 1XZOA 3IDAA 2MZCA 2DMMA 1EOHA 2O89A 3ZLPA 2DBCA 4LQRA 1ULPA 4JRRA 5ENUA 1YF1A 4QX0A 2OBKA 4ZB6A 2R7EB 4HQZA 4AG4A 2HRFA 2YANA 2X99A 2VZQA 2I9HA 4E8EA 3P2AA 1QK8A 3ERGA 5IPGA 1T8EB 1A24A 1XOAA 3ZVJA 1YKAA 2IWTA 1TRVA 4PX1A 10GSA 3IE3A 3QFAC 5HFKA 5ECIB 2XHNA 4V2LA 3HJOA 1M2AA 1RW1A 1JZ6A 4EL1A 3CQOA 1T7PB 2DIYA 3ZYWA 3VWVA 3VWXA 1PQNA 3PGTA 4QB6A 4GXZA 2V6OA 3DVXA 3H4KA 2V4VA 1TKDB 2CX4A 3K77A 5A4WA 2MYGA 1XPVA 3IDVA 1AIUA 2LS6A 3WNPA 1AUCA 1YQ1A 4OUEA 3LEFA 4LHSA 3LG6A 1TRUA 1TK5B 5J3RA 1KTEA 1F2EA 1R4WA 2PU9C 4LMVA 1R26A 2B1KA 3S9FA 3ZRDA 2VQTA 5DALB 4JZQA 3N9JA 3CBUA 4GZ9A 3DD3A 3CDZB 1KGYA 1K3IA 2PBJA 3ED3A 2PMTA 3G9BA 4GSTA 4GSSA 1XIYA 3ZIVA 1TDIA 1JFUA 4G2EA 4WBJA 4BVYA 5ID2B 2Y6JA 3KM6A 3DMLA 1U3AA 4EKZA 4ZB8A 4LMWA 2CAQA 3KXOA 2XONA 5GZZB 1PD21 3MUY1 4QB1A 4MJAA 2R37A 5IFTA 4ZB9A 4V2MA 2AAWA 4ZBAA 1Z5YE 1Y6EA 2JDAA 3L78A 3M9KA 2JE8A 2KLXA 4CHSA 4WKWA 1K12A 5F06A 4G10A 3ZL5A 2H71A 1Y25A 4LL4B 4HDEA 1AW9A 3DYMA 4DSRA 4ECBA 3VWWA 4TXOA 3PH9A 3M9JA 4RUVA 1IYIA 1V98A 1XNTA 5IHRA 3DGQA 5JXJA 5F8BA 3GIXA 3VD7A 1NKGA 4NHWA 4RI7A 1ILOA 2HXKA 1US3A 2H74A 4O5RA 5AIXA 4RQXA 3I3DA 1OC3A 1B4PA 3D21A 2WABA 3A21A 2J1AA 3HCZA 4HZ4A 2GSSA 5IJRA 1O6JA 4BA7A 2R3XA 1N8JA 5G30A 2VZSA 5CRWA 1YQ2A 4P3YB 4W8JA 3EMXA 2VL2C 4BL7A 5H5SA 1SENA 1ZZYA 5A5KA 3TB2A 3DKSA 2VMEA 2WN2A 3LEKA 3WGDA 3QAVA 4NAXA 4JBBA 2W3JA 4J2FA 1JZRA 3O3TA 2VCBA 3KH7A 4TR1B 5FWGA 2RUFA 3L9SA 5J9CA 5ECHB 4PNFA 3TKQA 2DSAA 3C71A 2L6CA 3FYGA 3US3A 2DDUA 2C0FA 1MDIA 1ERUA 2JADA 3WQBA 2L4QA 2A2SA 1EWXA 2VOTA 6GSUA 1PX4A 12GSA 1QGVA 1LBKA 3MV11 1YY7A 2YWNA 1JZ2A 2FCHA 2LKUA 1BYEA 1XWBA 2I3YA 5CO3A 1UY1A 3FZ5A 4K0GA 3C7MA 2WBKA 1GSEA 3GURA 1GSSA 5KN0A 5ECPB 2H0GA 4K7NA 3VLNA 2J1EA 1YJ6A 2KUCA 1KNGA 1MEKA 3LXZA 4I97A 1GLQA 4OMVA 4XS4A 2E2GA 3LEIA 2HLEA 1BX9A 4MCUA 2QKEA 2B4KA 5INYA 3K4DA 4ZL7A 3J7Yb 4XUNA 1H6YA 3LE0A 3TRPA 2H0HA 4TR0A 2AB6A 1KBNA 4IGJA 2PQSA 2G0FA 1CZSA 4P00B 5IMCA 4PUFC 1JZ3A 3GV1A 1GSDA 2FD3A 2LV3A 1GSQA 2VIMA 5B7CA 1PN9A 2EIQA 1U3IA 2LNSA 5DQYA 2VTFA 2WFCA 3A23A 2VCZA 3HY2A 3T2PA 2VZTA 5DCHA 4CW9A 3P7XA 1OAZA 3GX0A 2HZEA 3KMOA 4FIWA 2NPBA 2BGOA 3E3EA 3IOSA 5J5NA 3D0ZA 4CU6A 4PQQA 4XS6A 3DVWA 1FOVA 2MBTA 2IN3A 1X9SB 2M72A 5ECMB 2CAIA 4KA0A 4GLTA 4FYBA 5FT3A 2YJHA 2ON7A 5ECOB 3Q18A 3ISOA 1J83A 4GF0A 2J22A 4MF7A 2V32A 1JZ5A 5DDLA 3WEZA 4A4AA 3NOFA 3WD6A 3F9UA 1M7TA 2R2JA 3H8QA 4BDVB 2YP6A 3ACIA 2A4VA 5LCWL 1F9MA 1AQWA 2FHEA 4MA9A 1G6WA 4BK4A 5ECRB 2W1QA 3UBKA 4ZY9A 2BGPA 2DJ2A 1XW9A 1GRXA 4CUCA 1YDKA 2WS2A 4CU8A 1HNBA 4BJ0A 1TU7A 1TTZA 3OEAA 4HU9A 2H8LA 3TKSE 2C0GA 3U37A 1JU3A 4CU9A 1ERWA 5JXGA 3LSZA 2EICA 4TW5A 1X0RA 4KAEA 5KEJA 2W1UA 1YKCA 3MO4A 5ECSA 3AC0A 1VF1A 3LFLA 4YH2A 1U6TA 1B9XC 1US2A 1XCCA 3ECQA 1BAYA 5DQ0A 5JR2A 1SL1B 4HQSA 1F3AA 2FWFA 1FAAA 2HYXA 2VCCA 4XIHA 3RHCA 2FA8A 4AGSA 1CQGA 4IBPA 3F3RA 2H72A 4OYUA 2VZ3A 1TXXA 2CVKA 2RM5A 3CSHA 1UXZA 5FHIA 2CV4A 1PRXA 3D6IA 4L0WA 3MWHA 1W0NA 4L0PA 1Z6MA 1VGLA 2PUKC 1O8WA 1V2AA 2DMLA 2K9FA 3QPMA 3TKSA 1UYZA 3TJFA 1SYXA 3WYWA 1GOGA 1FW1A 2QQNA 5CZKA 1Z7RA 2H70A 3FY7A 1X9MB 5FUIA 5IOXA 3EWLA 3C7OA 5D9XA 2VCXA 3CZUA 2B3SA 1A2MA 3E0UA 1A23A 1T2XA 2H6XA 2OJLA 2WZ9A 4ARYA 2W5FA 3CYNA 5DQSA 1EUUA 4NV5A 4KWUA 2GQLA 3EU3A 3GSSA 4V1Ag 4QDSA 1SL2B 3FEUA 1GL8A 1VF4A 3OB8A 3WF2A 5EJZB 3UOMA 2DCJA 1GMMA 2LUSA 3GUSA 5B8AA 1C72A 2HSHA 3TOUA 1I5GA 3P8WA 13GSA 2VO4A 4JU5A 4TR3A 1OF3A 3UAPA 3I2FA 2GSQA 4TTGA 3ACFA 3T2QA 3OGSA 5IMZA 3KCMA 3V1WA 2QQKA 4MOAA 2JU5A 5IQYA 1SK0A 2O8VB 2VJXA 1SJZA 1S3CA 4PURA 1M9BA 1M2DA 1F3BA 5CYYA 3RHBA 1ZCPA 2MMAA 1RK4A 1WMJA 1XVQA 3GL5A 2HE3A 4BWSA 3ACGA 2VLVA 2H75A 4A3ZA 1JZ7A 1O73A 1QQ2A 2TRCP 4F03A 2I1UA 4Q5QA 2RVAA 3H79A 2WJUA 5EVOA 2IFQB 3BN6A 4OFMA 4DSSA 1BJXA 1U88A 2WO1A 2JSYA 2VZRA 1MDJA 3GH6A 1R5AA 1OYJA 1DE2A 2YC4A 3I2KA 5DPNA 1WRYA 2JZSA 1K3LA 3VD5A 2TRXA 1JZ4A 3EYPA 5HR2A 2GLRA 4XUQA 2D2ZA 2WGRA 4O7HA 1ZGNA 2X10A 5JXIA 4LKSA 1LU4A 1GNWA 4OD7A 4I2TA 4DUWA 5LA1A 5CP1A 4KUNA 4GWJA 3L4NA 14GSA 1XOBA 2VZ1A 4JKLA 2WB9A 3VI7A 1CZVA 1FG4A 4AJ8A 5DAKA 4E8CA 3A5WA 3QAWA 5HPOA 2OKAA 2DJ3A 3F0IA 2VZPA 1GUKA 1JZOA 4PXOA 3F8UA 5JMOA 1LNSA 3P90A 2OE3A 1K0AA 1UY0A 1QFNA 1M9AA 2F8FA 2YJ7A 4HEA2 5AIVA 4P02B 2FNOA 2E32A 2WAAA 1YEXA 4N10A 2H1GA 3HYPA 4XTSA 1K0BA 4PQ1A 3H93A 4BK5A 1T3BA 2WQ8A 1EUTA 4KB3A 3TKSC 1PX7A 2CA8A 1WP0A 2B7JA 3TCOA 1THXA 4PQHA 2H19A 1E6BA 2GZZA 4XUOA 2YZUA 3G7JA 4MF5A 3GTUB 2LRCA 2WRTA 6GSWA 1XXUA 3I2IA 3O76A 4YAVA 2Y8KA 3CXGA 3OR5A 4JR4A 3THCA 2B5XA 4IHUA 2HSYA 2W87A 3N5OA 2V1MA 3HZ4A 4L5OA 4WF5A 3ACHA 3T0BA 3GMFA 4WETA 4N11A 3D22A 1EV4A 2AYTA 2YC2A 1O81A 4HG6B 1JHJA 3VFIA 3TJBA 3IBHA 2V2GA 2K6VA 4MABA 2B6MA 3FRCA 5J9BA 5JCWA 3D4TA 3U6VA 3P6BA 4HUAA 3W5MA 1GTAA 3HOBA 3MBWA 1K0NA 1T1VA 3F6FA 4NV2A 5D93A 4D73A 4I8BA 1AC1A 2W46A 1H4OA 3UVTA 2ZUPA 1B48A 2YFZA 5D73A 4PT6A 1JI6A 4LLRA 2GGTA 1XPWA 2J1TA 3ABZA 4BWQA 3EE2A 2EC4A 2RJ2A 1TG7A 4JR6A 3IAPA 3EURA 5KN3A 2W91A 4HZ2A 2XOMA 5F07A 4POBA 3CTGA 2QGVA 2J9HA 1OC9A 4K7IA 5IO0A 1MPXA 4K8MA 2DJJA 4GSNA 3KTLA 2OE0A 1X5DA 3FHQA 4XCSA 2BTOT 2JACA 4KX4A 3NNGA 5AGYA 3JCML 2K8VA 1UYXA 2DIZA 4MADA 3JXSA 6GSYA 2IIYA 2MMZA 1UY2A 1TOFA 1V9WA 4F0BA 4HS1A 4KW6A 2F8AA 2C3NA 3HVSA 2L57A 2CT6A 3QOUA 1YEPA 4ML6A 5B6NA 2L9LA 3VDCA 1W4VA 2X8CA 1SK1A 2YWIA 4MLYA 1R5PA 5ABRA 2W1SA 1CIYA 4Z7XA 2EIBA 1AAZA 6GSSA 1SHWB 3CIHA 1ON4A 5JUVA 2RM6A 5B8BA 3DYPA 3QD9A 4ZXGA 3VD3A 4L5LA 5CRHA 2VQUA 4RYDA 3DEXA 4HOJA 1S3AA 3HN3A 1UVZA 1Z7PA 3M8NA 4EE0A 5IMDA 1FVKA 2IMKA 3UBLA 2LSTA 2WO3A 3HNBM 4Q5FA 2BERA 3FHAA 1UWWA 4TKYA 5DJMA 5F0GA 4EF0A 4MP4A 2JL4A 2KP2A 2VZUA 3HJMA 3KP9A 3DWVA 3LPGA 2F3MA 4GWIA 5CNWA 1UN2A 4MJBA 2W94A 3OGRA 1DBYA 1XW6A 1ML6A 2ZXQA 2GT5A 2LQOA 3IPZA 1GTIA 2TIRA 1V58A 3OGVA 2WULA 3HVVA 2LJAA 5ELAA 2L5LA 4LL1B 2Y6GA 3NZNA 4JHZA 3VPTA 3SEEA 2IMIA 3VURA 2LNTA 4DSSB 4QL9A 3BJ5A 1WE0A 2MMOA 4ZL8A 1G0TA 3OG2A 2VAFA 1UY3A 1N2AA 4K6XA 4KSOA 2KD7A 1A8YA 2YCDA 2IL3A 1T00A 1ST9A 1OC8A 3ZFLA 1NUKA 4XUTA 2OACA 4WF4A 4QB2A 4MMMA 5JCGA 2DCKA 3LQCA 3MUZ1 2QSIA 2WN3A 3LPFA 4YAPA 4QAWA 3LWAA 3M1GA 2W47A 3AY8A 1QXHA 2Y6KA 2YFUA 4XHMA 4ZILA 3FR6A 1A2LA 1EV9A 3GFKA 4TR4A 5EL8A 4EUYA 1G6YA 3BD2A 2EIEA 3KZQA 3ZM8A 5C04A 1SK2A 2ZEZA 2ORZA 1SJ6A 3F3QA 4NXIA 2MBSA 3D3AA 5DVBA 5AISA 2BZDA 1EGOA 2NTOA 1OT5A 1XWGA 3CZJA 1TVGA 3I69A 4EDZA 4HI7A 1AQXA 1X5CA 2C0DA 2XC2A 1TK0B 4UI9L 2WUHA 2VL3A 2J1UA 4W4ZA 5IPHA 3UESA 2R4VA 4LA1A 1O85A 1SDDB 4XURA 4WXTA 3W8SA 3FHKA 1H6XA 2B5YA 4BVXA 4QX1A 2FLSA 4F0CA 2VL4A 1GUIA 4IS0A 2RLIA 3IAM2 2LRTA 4NHZA 5CAXA 1NX9A 5IIZA 2HFDA 1GTBA 4V1Ap 1PX6A 5IM9A 3IC4A 3IA1A 1D7PM 4EDYA 3EC3A 4AJ7A 3EU4A 3UVHA 2ID4A 4KH7A 4MK3A 3F4TA 2VOCA 4TVEA 1NHYA 2IJYA 4Q5RA 3FKFA 2CVDA 3IAS2 3SBCA 4PGTA 3VD9A 4O32A 4OMDA 3ZITA 3I2HA 2KOKA 11GSA 3UETA 4XRAA 4YQMA 4Z2AA 1AQVA 3HHVA 4DUVA 2B5EA 2CVBA 6GSTA 2ORXA 2AV4A 5J4UA 2DJ1A 3M0FA 4TN8A 4NMUA 2RIIA 2XQXA 1KEBA 1OKDA 2CZ2A 3Q6OA 4G9HA 4JKKA 3KD0A 1GNYA 4ULXA 5H5RA 3FR3A 5ECQB 2XPDA 22GSA 3A2WA 2X64A 4FYUA 4QDQA 2H1AA 3I3EA 2VMCA 2BBAA 1EP7A 1I9DA 1TW9A 4RI6A 5IMFA 2QBXA 3PR8A 1EGRA 3A2VA 1G7EA 1PX3A 2N5FA 4DEVA 2VCVA 4HJ2A 4TOPA 3HXSA 1Z3EA 1OC9B 2GVPA 3QR6A 3VD4A 17GSA 2LTKA 1GOHA 1FO5A 2K18A 2ES7A 1V40A 5D8IA 3BBYA 3DXBA 1DUGA 3G7IA 2ZEWA 4PUAA 1SU9A 3TGZA 3L9UA 3LYPA 3I6AA 2X09A 4JKMA 3HA9A 2VLTA 20GSA 5EPFA 1EEJA 2WDBA 2L6DA 3GA4A 2E0QA 2B1LA 2B9VA 1GSUA 3A3TA 1B8XA 2L5OA 4X1UA 3A22A 4IW9A 2J7MA 3IXRA 3UJ1A 5D9VA 2YWOA 2LW8A 2VCTA 2HI7A 4KI5M 4L8EA 1NM3A 2PVOC 4TXOB 4IP6A 3VDBA 4ZZ8A 4I2UA 3KMNA 1OH4A 2ZNMA 4CDOA 2HRNA 3GN3A 4ACSA 4N0ZA 3TRQA 4IJ3A 1Z6NA 3WF4A 4MJEA 4Q5NA 1R64A 2VCWA 2AUVA 5A4VA 3ZTLA 2PPTA 2GSTA 1J84A 1HQOA 2ON5A 1ZOFA 1SKRB 1FVJA 4UAPA 1RYYA 4GQFA 4ZXEA 2VCQA 1SD8A 2F51A 2GSRA 4GCIA 2WAOA 1X9WB 2QQMA 4M4PA 3RDWA 3DECA 2C4JA 5JXHA 3F2ZA 2BMXA 2H6ZA 2H30A 3I2GA 1PL1A 3ME7A 3RBTA 3SKVA 5DN2A 2B7KA 5G5FA 1WWJA 1I5PA 2RUEA 1GU3A 3GL3A 1FB6A 5G1LA 1RQMA 4X0XA 3HNMA 4XRDA 3TKRA 2IMEA 1ERTA 1SJIA 3E9JB 5HR1A 2GQMA 4TXWA 2OKXA 4OCFA 1JZ8A 1W89A 2VM1A 1J08A 2HLSA 2R6KA 1AXDA 3APQA 1GUMA 1JLWA 1KEXA 2O7KA 4DXRA 1XNAA 2QQOA 4OCEA 4I5QA 4P5YA 4MH3A 1FHEA 3C7EA 2WCIA 1PSQA 1K45A 2Y6HA 4TR1A 3HNYM 3ERWA 1UC7A 1OE8A 2LJKA 4NPBA 4MZBA 2VO5A 3MSZA 3UIWA 5E59A 4XS4B 4DEQA 4KMQA 2F9SA 2FA4A 2GTUA 1J0FA 1OE7A 3WGEA 3FR9A 1SG3A 1PMTA 4ZL9A 1CX1A 4N30A 2MMNA 4J57E 3KP8A 2W92A 2YWMA 1TJDA 1NW2A 1TU8A 3VK9A 4QX3A 2Z4FA 2H01A 2VUPA 4OO5A 1QMVA 3HDCA 3RPNA 3TJKA 2CQ9A 3UNPA 2IPAA 2YZHA 1DSBA 3CTFA 1MDKA 2ALBA 3FK8A 5JWQB 3QAGA 2NBSA 3A2XA 2X05A 2W95A 1DE1A 4MO3M 1SL0B 3FZ4A 2HZEB 3M3MA 2W1WA 1BEDA 3C7GA 2VD1A 4IUGA 4A45A 1JYNA 3R2QA 5COHA 5J41A 4IELA 5C70A 2H0IA 2YOIA 2P31A 4ECIA 1M2BA 1M0UA 2ZEYA 1L7QA 4EC0A 1EP8A 3W8JA 3EINA 3DRNA 1JHBA 1SKSB 4N0VA 3TDGA 2KP1A 2IMFA 2M80A 2YV7A 4ECJA 3A7QA 2C1YA 2LJRA 1BQ7A 2PVQA 2QQIA 1HN1A 3TJGA 2CZ3A 3F4RA 1IYHA 5GAND 2VZVA 3K8NA 2Y64A 2E2MA 3DIEA 3GYKA 2ZCTA 2YV9A 2W9XA 1UX7A 5DMYA 4DVCA 4JEDA 3C8EA 5G1KA 5EIYB 1JLVA 2PWJA 2C8UA 1CZTA 4K9ZA 4NWYA 1P8JA 5A4UA 2VC9A 2E7PA 4BXSV 1TK8B 4AJ6A 4EXJA 1K0DA 3MNGA 3BCIA 3BGAA 4JX0A 1EZKA 3BOAA 3PUIA 1O8XA 1K0OA 3HKRA 3EMPA 4J56E 2DC5A 4WR5A 1Q98A 3IR4A 2EIOA 4D8MA 2E26A 1MD4A 4F82A 1A0RP 3LYKA 3WNNA 2FGXA 2VCAA 5IOWA 1UXXX 4MGQA 19GSA 2GZYA 2EIRA 3GNJA 1W9SA 1K0CA 3WNKA 1XWAA 1TP9A 5LNKe 3EB7A 3GKXA 3TOTA 3IHQA 4ILFA 3EYTA 1PGTA 3Q19A 3UEMA 3WGXA 1QUWA 3UARA 2VMDA 3L0HA 2VZOA 2LS5A 4AF2A 1PKWA 4V2NA 3ME8A 1THOA 3ZVJD 3WSOA 5B4XA 5C00A 4MF6A 1OF4A 3C1RA 4XZUG 3TJJA 2N5AA 4A6OA 4A42A 8GSSA 5HR3A 4KDUA 2GZPA 2E31A 2O85A 3F6DA 2M46A 4W50A 2A2RA 1NHOA 1ZMAA 1WKYA 1GWCA 3LORA 1ABAA 3K46A 3RAZA 1TRSA 1WJKA 6GSVA 3GGLA 5IMAA 4DXTA 5F7UA 1M99A 1XC6A 5LD0A 1Z9HA 4CU7A 1S3DA 1EEMA 2XPEA 2WO2A 2XHFA 2KHPA 3VPQA 3CRTA 7GSSA 2H6YA 3OEBA 4AAXA 3UMAA 2X8HA 2V5DA 4UOJA 2GQKA 4E8DA 3ZFBA 5LCZA 1JYWA 1ACVA 4A44A 3ZREA 2JKXA 4POLA 5D9WA 1UZ0A 3C7FA 4MJCA 3WT1A 3C1SA 1URMA 2HNLA 18GSA 2C3TA 3WNMA 1TRWA 5ECKB 1EOGA 2NDOA 4OFTA 1UA5A 5KN1A 4IN0A 4MZWA 2VM2A 4EVMA 1A2JA 3ZMLA 5D96A 4CUAA 3CSIA 1CQHA 2QC7A 1VF3A 4ET7A 2V72A 4ZBBA 3APOA 5G2ZA 1VF2A 5D9TA 3HJPA 3RPPA 3GH9A 5HQPA 4MPFA 3SKJE 3I2JA 5HFGA 4OZOA 1VRSD 4ML1A 3PINA 4WEYA 5DCGA 4XVHA 4YQVA 4WR4A 2OA7A 5ELGA 2FUG2 4QX2A 6GSXA 2FY6A 3P1IA 2AJQB 3VI5A 2VLUA 3TKPA 1PA3A 2RV9A 2YB7A 16GSA 3LEGA 3O6TA 2VL9A 5A1AA 3HD5A 3WT2A 4ECCA 1JYVA 2H1BA 3ERFA 4XUPA 3FL7A 1BG5A 2IFQA 3IK9A 5DAKB 3HVXA 1F6MC 3GX8A 3T0AA 5KN2A 2J1VA 1DLCA 1NAEA 3EVIA 5JCUA 1W99A 4KDYA 2XBQA 2X8GA 4H86A 1XW5A 2J1SA 2OE1A 3TUEA 4K0NA 2JZRA 2C9KA 1R7HA 1K3YA 3SWLA 1F4HA 4I6XA 1FB0A 2WZ8A 2DJ0A 4FI9A 1W9WA 2VM9A 1XFLA 1XWKA 2C3QA 3IK7A 4GTUA 3KIJA 1GNEA 2OBIA 5IYYA 3FZAA 3THDA 1T4ZA 5G04L 3PUHA 1YZXA 4EO3A 2WZEA 3E1F1 5LA2A 5HR0A 4K7OA 4KCEA 1JZDA 1B4QA 2JSZA 3GSTA 3H1NA 3F63A 4CVUA 3WF3A 3W5NA 2WDUA 4POMA 4X43A 2VR4A 2DJKA 1MTCA 3ETPA 5CRGA 2C4XA 3IAQA 2GS3A 1WPIA 3LQ7A 4K1FA 3T08A 3BCKA 2REMA 2H76A 2ZEXA 3WF1A 3NQHA 1YF0A 2C0EA 4DEJA 1OKTA 3GRXA 4G19A 2HT9A 5ECLB 1SD9A 1PL2A 2P5QA 5B4NA 3GHAA 4ZZ5A 3K4AA 1O8PA 3APSA 3GTUA 1GQPA 3D4MA 4D73B 1PMJX 3C7HA 1UY4A 4QL7A 3ZZXA 4L0UA 3GM8A 5G05L 3FN9A 3WNLA 1OVNA 3MAKA 4KGIA 4YPJA 4MPGA 4MZCA 1MD3A 4D0QA 1U87A 2P0GA 3W6GA 4WBRD 1UMIA 1W9TA 3NJVA 1O8SA 4KDXA 1DYOA 4IQAA 1GLPA 2VMFA 2L4CA 1L7RA 3OBAA 3ZIJA 1H75A 4ZBDA 1A0FA 5EJ1B 2V41A 3QDNA 3HPNA 2H73A 3T2OA 2R5GA 4KE3A 1Q4JA 3T0DA 1GOFA 2PGTA 4JE1A 5IMVA 2V6KA 4F9ZA 1XBSA 3IB3A 1HYUA 2P5RA 3GKNA 1LJRA 3I43A 3U5RE 2QQJA 3CSJA 3UL3A 5L71A 3F4SA 4BPYA 4GWRA 2PERA 1SYRA 1GTUA 5DJLA 5AN1A 3GXUA 3Q74A 3IRAA 5E4WA 2LEGA 3QFBC 5DALA 5C7GA 2GDRA 3FW2A 1TI1A 2FWEA 4M4RA 4GQCA 3GDBA 1PMHX 1K3OA 2YPMA 4FO5A 3VDAA 1UYYA 3KGKA 2IMDA 3CRUA 4K2DA 1X5EA 4OFNA 2O87A 3IIIA 4MGSA 1NSWA 5ID2A 9GSSA 4HJMA 5GSSA 1G7OA 4HU7A 1B9YC 1GULA 1O7UA 4OO4A 3D5JA 1PKZA 3K75B 1F37A 3WNOA 4QDRA 4KNDA 3MV01 1WOUA 2WYSA 2Y6LA 2VD0A 5LA0A 3TRXA 2CDOA 1USBA 5CRDA 1HNAA 3C8XA 1GSYA 2LQQA 3KH9A 5G31A 3GKKA 3NIVA 1W8OA 2L59A 4IP1A 2GT6A 3KEBA 5ECNB 4QPWA 2C80A 4POKA 5GSTA 2QQLA 5G5EA 4DSQA 1F4AA 5HXMA 3LJRA 2J1RA 4IJIA 1DP0A 3IV4A 2LRNA 4IKHA 5IO2A 3I3BA 5J1XA 5EY6A 1ZYQB 2PN8A 1GSFA 1WCQA 4XS1A 1O59A 1GP1A 3HEIA 3CKHA 3CMIA 2I81A 2FWGA 1E2YA 1JZWA 3HJRA 3CMGA 2JZTA 3FZ9A 2CX3A 4TXVA 2FWHA 1HNCA 3T09A 5H5QA 4OWYA 5I0DA 1K0MA 3LGCA 1JU4A 3C73A 3QCPA 2CDPA 4KSMA 1XWCA 2DLXA 3HZ8A 1J9BA 4PF1A 4FH8A 4CUBA 3K4ZA 4O92A 1BHGA 4TRXA 2E33A 3WF0A 4ID0A 1SKWB 4IQ1A 2BJXA 5C71A 2C26A 4A41A 3QMXA
chains in the Genus database with same CATH superfamily
5JWOB 3LXTA 2B5HA 3WP4A 3MYXA 3VBUC 3G7YA 1HQNA 3I97A 2N5BA 2Z9SA 5DBQA 3GZEA 2NVLA 1YQCA 1YI7A 5F9TA 1YJKA 3L9VA 2EIDA 1ERVA 2OUHA 3AJZA 4RQRA 4MH2A 2P3KA 4EZHA 3CHXA 3DYRA 2VU9A 4JC1A 4IVFA 3W21A 4YRDA 3I9V2 1SPPB 2XBIA 1W8NA 4XJ8A 4RD7A 5CREA 1VBB2 2G2QA 1XU2A 1UMHA 5LEJA 1KXGA 2HJIA 2VL2A 4GRFA 2JJ6A 3KTBA 5LW9A 1YFUA 1GH2A 2QA1A 4QGLA 5BNOA 3ZLPA 4AWDA 1AR73 2BGCA 1GV9A 2XJTA 4Z92B 4B1LA 2OBKA 5FUPA 3VBUB 2HRKA 2YANA 3ERGA 5FOBB 5IPGA 1T8EB 1A24A 3ZVJA 3R4SA 2IWTA 3H3LA 4XILA 4PX1A 10GSA 3IE3A 4V2LA 1M2AA 5FWEA 1X8MA 2DIYA 1TMF1 4DXZA 4F83A 4YZ2A 3DVXA 4HPKA 5D21A 1X50A 3N9MA 4IE4A 2LS6A 4H55A 1AUCA 3LEFA 4Y4YA 1OA4A 4LHSA 3VHRA 5J3RA 3MLKA 1F2EA 2A7AA 5L9BA 1EPWA 1R4WA 2DTYA 3ZFGC 4LMVA 1R26A 4CXYA 4C8DA 1TQ5A 3S9FA 3ZRDA 5DALB 3N9JA 1A6CA 4GZ9A 3DD3A 3CDZB 4LO8A 1CGPA 4CY6A 2JDHA 4NIGA 3KZ4C 1K3IA 4EWAA 3G9BA 3ZFEB 4I30A 1U3AA 4G0KA 4XF3A 3RJRA 4LO5B 2NP0A 3FMGA 4DS0A 5E1RA 1G9FA 3KXOA 2XONA 3KSCA 5FY0A 4MJAA 4ZS2A 5IFTA 3PVOA 1Y6EA 3M9KA 2JE8A 1Y25A 4LL4B 4HDEA 1V6JA 3LOBA 3SXWA 1D2QA 3BODA 4IEVA 4OUSA 1XNTA 5GZDA 5IHRA 3LKJA 2WLQA 4RQXA 1OC3A 1B4PA 4HZ4A 2GSSA 4BA7A 4TLFA 2VZSA 4META 2VOVA 3SHRA 3KVAA 4WVMA 5CRWA 4UF0A 4XIKA 2VL2C 4B4PA 4YW1A 4NHLA 3DKSA 2VMEA 4QHOA 1VBA3 1RUNA 1XNDA 3ZFGB 1TZOA 1PNFA 3WGDA 2NPIA 4HLTA 3I4IA 3HAGA 4QPIA 1JZRA 4N8MA 1JBCA 5FWGA 4K1ZA 1DQ6A 5BNOC 3MGUA 4JZRA 2ZPXA 3ZSKA 3FYGA 1QWRA 2ZA9A 2DDUA 1UAIA 1ERUA 2EXIA 5AVPA 5FPZA 2A2SA 1YQ6A 1PIV3 4BXFA 2X8KA 1ODMA 2LKUA 5JDBA 2P2KA 3AP6A 1X9TA 3MZHA 3AYDA 4K0GA 5T52A 2WBKA 3GURA 1GYKA 3AXEA 4DRRA 4DZGA 1YJ6A 1GLQA 5JIUA 2DU1A 4XS4A 3VUOA 2HLEA 4MCUA 2QKEA 5INYA 3J7Yb 3LFIA 3VHPA 3KCYA 3TRPA 2GAUA 1PO21 4TR0A 3K3NA 2AB6A 5A3LA 4IGJA 2G0FA 4PUFC 4CRQA 2LV3A 1GSQA 1PZ7A 2WS91 2XJRA 1G8WA 1R092 2AR6A 5AC93 3BIEA 3ZPOA 5BYNA 3GNEA 4CW9A 4AFMA 2VULA 3GX0A 1RHI3 5BNOB 3MLJA 2AC1A 4FIWA 4FFIA 2QCSB 2NPBA 4M3CE 3WP5A 3IOSA 3WV6A 5FV3A 3AMNA 5J5NA 2RJKA 3I8TA 4PQQA 1FOVA 3U4XA 1QEXA 2RS53 4GLTA 2OVUA 5FOJB 2YJHA 1G6NA 2ON7A 1ZBE2 1HQLA 3ISOA 4ES9A 2XLFA 1J3RA 5DDLA 4A4AA 3NOFA 3WD6A 3F9UA 2A4HA 2R2JA 2P6CA 2HWB3 3ACIA 4QXBA 1VBC3 3ILFA 1AQWA 4HPKB 5ECRB 4CUCA 4CU8A 4AVVA 1A8MA 2ZGOA 5L9RA 1TU7A 3OEAA 5C5TA 2VBPA 3PTRB 1JU3A 5JPNB 3U78A 5JXGA 2XPJA 3LSZA 2EICA 4BCUA 4QKDA 5KEJA 3MO4A 4QPIC 4YH2A 3ECQA 4KH9A 2Q0AA 5EHDA 1BAYA 2FWFA 1CPMA 2DVDA 1AX0A 1RUOA 1W90A 4NIDA 4IBPA 2H72A 1S55A 2ZHMA 2DVGA 2D5FA 1UF2C 4TSVA 2CV4A 4Z2UA 2XG3A 2XUMA 5FXVA 2DMLA 3QPMA 1V6NA 3WYWA 1F15A 1XQNA 1AR71 1X9MB 1J59A 3C7OA 1LCLA 1MEC3 1RUD2 1VLNA 5J48A 2AEYA 4GALA 3RFRA 3Q8CA 2JXAA 2GQLA 3WUDA 4QDSA 3FEUA 4GJZA 4H14A 4FT8A 5EJZB 3ENRA 3GYDA 3UOMA 1ZYPA 3M3EA 1W6PA 3GUSA 4L9BA 4WVMB 2R0GA 1ZRIA 1I5GA 13GSA 1OF3A 3FBYA 2GNTA 4XAEA 3J26N 5BNQA 3T2QA 3OGSA 1DZQA 4MOAA 1SK0A 2C0ZA 4ASMB 4QPIB 3ZSJA 1SJZA 1Q8SA 4P9XA 1M2DA 4GAZA 3OCPA 2YROA 1UKGA 2H75A 3LSDA 2I1UA 4Q5QA 3H79A 2HWC2 2RE9A 1POQA 2IFQB 3WDUA 2WNUA 4DSSA 4YW6A 2VQ0A 5FAXA 4AHZA 2VZRA 1QH6A 2CL2A 3ZYGA 2YC4A 5JCTA 3U07A 3VLBB 1K3LA 2TRXA 3ZYPA 1JUIA 5F3EA 5JXIA 4LKSA 1W6MB 5FYZA 4XAAA 4AOCA 1Y4WA 3I2OA 14GSA 3ACLA 2VZ1A 4JKLA 2WB9A 2I07B 1RUE3 3KWVA 5DAKA 3QAWA 3F0IA 1GUKA 3V0BA 3AXDA 1NCRC 1OMIA 1W2UA 4CPBD 4P02B 5DUUA 1VBA1 3HYPA 1K0BA 1RVF3 3H93A 1T3BA 2R072 2WQ8A 3MFAA 1MACA 4ASKA 4KB3A 1WP0A 2B7JA 1THXA 5H9QA 2GZZA 5BV6A 4XUOA 4NHXA 4MF5A 4RGKA 2WRTA 6GSWA 1CAUA 3TNQA 4JR4A 2B5XA 1Q8PA 1PIV1 2JDYA 4L5OA 1UO9A 4WETA 3ACHA 4XMAA 4CCEA 4HG6B 1O81A 1JHJA 3O1MA 5A33A 3TJBA 2V2GA 4IEXA 5J9BA 3OUIA 4HUAA 3W5MA 3HOBA 3M3IA 1VBE3 2OA2A 3MBWA 4NV2A 3D6EA 4D73A 1KS4A 4QXKA 1KS5A 2JDNA 2HWE1 4CZSA 1NCRB 4PI2A 4G3YC 1XPWA 3ABZA 3EE2A 4YSFA 2EC4A 3NW4A 2RJ2A 3M4FA 5CKQA 5KN3A 3ALQA 1NY71 3RYRA 1WCDJ 3E5UA 2GMPA 2QGVA 4JRAA 3O14A 5AC91 3RZMA 1AXZA 1MPXA 4K8MA 1YJLA 4LK7A 4XEZA 1RHI1 1D0HA 2WNUC 2BTOT 4KX4A 3NNGA 2QZ3A 5AGYA 3JCML 2K8VA 3VKOA 2DIZA 4GWMA 2W68A 3FLRA 1OXCA 3GHNA 1C57A 5K7PA 3AZYA 4QMAA 2CYFA 2GMMA 1POV3 4KU8A 4CXXA 1NCQA 1QXPA 1SK1A 3X29B 4H2AA 1R5PA 2H0VA 2W1SA 1AAZA 6GSSA 4CDXA 1ON4A 1W6PB 5HCAA 1WCUA 2HWB1 5B8BA 3V64A 2HWF3 1VBC1 3VD3A 3JBG3 4L5LA 1UD1A 4RYDA 5J09A 3DEXA 1YHFA 2Q5TA 4LE4A 1FVKA 1WMDA 1AVBA 3PHMA 2KR2A 1F5JA 5CIRA 2JL4A 2KP2A 3HJMA 3KP9A 1H9PA 2DF7A 4URTA 5CNWA 4MJBA 2JIGA 2GT5A 2LQOA 1GTIA 3PURA 3HVDA 3QD6A 4OHZA 2LJAA 2Y6GA 1ULGA 4LTAA 1IZ3A 1I5ZA 1WLWA 1KITA 2IMIA 2VBDA 2LNTA 2WNUB 3MLLA 4DSSB 5LWBA 3N4MA 4FOQA 1BK1A 4WBBA 4KSOA 4PF5A 2IL3A 1OC8A 1NUKA 1S1AA 4XUTA 4WF4A 4UFKA 4GMP3 3MI8A 5DDJ3 2GC2A 3AY8A 1A78A 2YFUA 2JB4A 5EL8A 4EUYA 1SK2A 2ORZA 5FYBA 3P5BA 5A3WA 4NXIA 3V0AA 3V0BB 1EGOA 1OT5A 5JAXA 1O4YA 3DPRA 4EJRA 3I69A 4EDZA 4HKLA 2C0DA 1OFSA 4X4JA 1YNAA 3B9IA 1DGLA 3UESA 1SFNA 4BVXA 4PHZA 4E4HA 5FKBA 3O7OA 4Q0VA 4XCBA 1HLCA 2WA3A 5CADA 1PX6A 1GFF2 1CAUB 5F5QA 5FJKA 4Q8LA 4BQ5A 3URFA 3UVHA 1Z0HA 2YBKA 2ID4A 1ZNPA 4GXLA 2VOCA 1NCQC 4Q5RA 3B69A 2Y38A 2DFCA 5A33B 2MPFA 1UZZA 3SBCA 3VD9A 2R6QA 5GLUA 11GSA 1ZYNA 3UETA 4YQMA 4BHPA 3HHVA 2XJSA 3QOPA 4TN8A 3C3VA 1RL3A 3GHMA 2XQXA 1KEBA 4JTNA 1OKDA 4JKKA 3KD0A 1UOGA 3OD4A 4B1MA 3FR3A 2ARBA 1GBGA 1COV2 4G0LA 1RUE1 5A7OA 2VMCA 5IMFA 2GC3A 4CP2A 1EGRA 3LGRA 5ACA3 1VBD2 1S0JA 4AHXA 3SISA 4DEVA 3VBSA 2JKBA 1YI9A 3U10A 1OQDA 2Z79A 3NV3A 3VD4A 4CEYB 4D7SA 17GSA 2LTKA 5FR3A 5I0UA 1DQ0A 2JDKA 1RVF1 2OS2A 4PUAA 4N90A 3TGZA 3L9UA 3LYPA 3HA9A 2JICA 1EEJA 1ONAA 2B39A 1LGCA 2QFEA 2A73B 4IGOA 1UMZA 1AL23 5IVVA 1GSUA 5SV8A 2L5OA 3A22A 4Z82A 3IXRA 3GALA 5KXDA 3UJ1A 1NCQB 1QJFA 1RXGA 4KI5M 3HT2A 4XOGA 2G1MA 1UPSA 2WA4A 3VDBA 3KMNA 4IXLA 1VB4A 3BPZA 2HRNA 3GN3A 1JW6A 3JD73 3TRQA 1Z6NA 2UY9A 3WF4A 4LBLA 2IC1A 4HOOA 3DPRC 1HB2A 2AUVA 1VBE1 4B7EA 1N47A 1J84A 1JUHA 2ON5A 2TEPA 1ZZBA 3HR9A 5JSOA 5FYYA 2D6MA 4Q2FA 2O8QA 3NVCA 2PHFA 4ZXEA 2JDPA 3V65A 5L9VA 1X9WB 3VBFA 2WINB 3DECA 4Y5SA 3FWEA 1LEDA 5KOXA 1RJ7A 2BMXA 2H6ZA 3H1MA 3VZJA 1PO13 4RFT0 3I2GA 1CX4A 3SKVA 5B2GB 1I5PA 2RUEA 4XJAA 2FHRA 4RA0A 2B8MA 2IMEA 1LULA 1J3QA 3MYDA 1MZFA 4HL0A 5HBAA 4B4RA 4TZDA 1UKRA 5EYYA 4AI2A 1AXDA 1GUMA 1XNAA 4ISRA 4OCEA 4NWVA 5A7WA 1POV1 2LUWA 3ERWA 1UC7A 1OE8A 5F5AA 5JZGA 5E59A 4GH4A 4KMQA 1H2MA 4I0BA 3V0AB 2BPA2 4UFIA 3SCHA 3DGTA 3BKZA 2HWF1 2C5DA 3FR9A 1SG3A 4ZL9A 3JBG1 1CX1A 4O7XA 2W92A 4Q5OA 4D94A 2YWMA 3WG2A 1NW2A 1LR5A 2VUPA 3VBOB 1AYM3 1QMVA 3VBSC 1XYPA 3DV8A 4YGDA 3M7AA 2YZHA 1DSBA 3ES1A 1MDKA 2ZABA 2R49A 4BVXB 2NBSA 4FOWA 3AVRA 3CU7A 3FZ4A 3ZSEA 4AGGA 1ST8A 2IXIA 5C70A 4LBQB 2P31A 4ECIA 1M2BA 4MZUA 1M0UA 3BPSA 5FZKA 1MQTB 3TDGA 1QQP2 2YV7A 3A7QA 2C1YA 5ANQA 2PVQA 4AHWA 1VBB3 1HN1A 4GMP1 4QGNA 5DDJ1 3LD8A 4DQAA 2YC0A 4MGIE 4HKOA 3DIEA 1UX7A 4LA3A 5DMYA 1GZWB 1GSLA 1CR7A 2PWJA 5A3MA 5C8WA 1P8JA 3RZHA 4HVQA 3VKFC 1ENRA 4EXJA 1K0DA 3MNGA 3GZAA 4XBLA 3BCIA 4JX0A 1EZKA 2QKDA 2VQAA 3VBFC 1K0OA 3HKRA 1WD3A 3VBSB 4XXAA 1Q98A 1STMA 5IVEA 1ZBA2 3PJYA 2MHFA 3KLSA 2FGXA 1APNA 1AXKA 4YARA 1HW5A 2GZYA 2DUOA 1ENQA 1XWAA 5F2SA 1TP9A 1QJY2 3KV5A 4ILFA 1HRI2 3EYTA 1PGTA 3UARA 1FYUA 1PKWA 3AK0A 2KXLA 2P3JA 5B4XA 4E2QA 2VUDA 3ZKUA 3NNFA 2XVKA 4FBFA 4KDUA 1DGRA 1FXZA 5JZGC 2O85A 4GH4C 1W6NA 4W50A 1ZMAA 3WW3A 3QCWA 4PCRA 4QKFA 3K46A 4KG8A 5A70A 3ZXGA 1JMUB 4MV2A 2ARCA 2XHFA 4LE3A 2YY1A 1RUJ2 1O4ZA 1OLME 3DCQA 3M3OA 2G19A 4UOJA 3AKRA 2P3IA 3G7DA 4E8DA 2X4AA 5LCZA 2XJPA 3ZREA 3BVCA 4POLA 3WT1A 3C1SA 2HNLA 1H4HA 1QXJA 4MHUA 5ACA1 5ECKB 2D98A 4XQDA 4S2GA 3AMQA 4LK6A 4IN0A 4MZWA 5CBLA 3H1YA 1G9BA 2D44A 2PMWB 5GLVA 3FC0A 4HT1T 2WZR2 4L92A 4XFFA 2E9QA 3SLIA 2UWAA 1OA3A 3GH9A 4MPFA 2W08A 1AL21 1REDA 3PINA 3B00A 4YQVA 4JDMA 5JZGB 4QX2A 2FY6A 3O1RA 2AJQB 2VLUA 4QWNA 3SH4A 3RRDA 2YGMA 5I91A 3LEGA 3H1WA 1DGWX 3JD71 1TNFA 1GQHA 1VRBA 1V00A 1WGPA 3HVXA 3Q9OA 3GX8A 4INDA 4Q4W3 3ZXJA 5BNPA 2J1VA 1DLCA 4C91A 2Q30A 4KDYA 2XBQA 2IXKA 3TOJA 4A7KA 3PPUA 4Z2TA 1DQ1A 1G9CA 1PGW2 2C9KA 3SWLA 1F4HA 1LHOA 4Y3OA 1NYWA 1FB0A 1CESA 2DJ0A 4FI9A 1XFLA 4CEWA 2C3QA 4GTUA 1QNWA 4HBNA 3ZFFA 5IYYA 1PO11 1YZXA 3IM0A 1S2EA 3AL5A 3R0RA 3M3CA 4AR2A 4HSLA 3WF3A 5FY8A 5FZDA 3ETPA 5CRGA 2C4XA 4AEJA 5IK7A 3T08A 2REMA 2EA7A 1BQPA 1YF0A 3N7KA 1PNGA 4DEJA 4G19A 4RS5A 4LMFA 3AFGA 1SQ4A 1R093 1W6QA 3APSA 1QY4A 1UU4A 1PMJX 1UY4A 4QL7A 3ZZXA 3BTYA 4MPGA 2OPKA 4D0QA 1NQDA 5FTTC 4R4XA 4KQ7A 4KWKA 2P0GA 3W6GA 4OQ8A 1ZA7A 2IVJA 1GLPA 4YKFA 3N36A 4QPGA 1W8WA 2AZ5A 1WLDA 3BU7A 2V41A 3TBDA 1ZBE3 3Q8AA 3QDNA 3HPNA 4NVPA 4LBQD 3T2OA 2R5GA 4KE3A 3KQ4B 3T0DA 4JE1A 1IPKA 5IMVA 2V6KA 2AYHA 4IDZA 2P5RA 1HIXA 3GKNA 3KGZA 5F37A 3HD8B 4DIQA 4GWRA 1W6NB 5HV0A 2QA2A 3Q74A 2LEGA 4GD4A 4KU7A 2UY8A 1VBB1 1PMHX 2YPMA 1X82A 1HX6A 2NZ9A 3FLPA 4MGSA 5GSSA 5FKCA 5BNPC 4Q4X2 1DU3D 3D5JA 3RPQA 3WNOA 4KNDA 1UL9A 4E4SA 2Y6LA 2DU0A 2VD0A 1GSYA 2LQQA 2C24A 5FZ4A 4CEWC 3FLTA 1GP6A 4LHKA 5EXOA 3ZFFC 4JAAA 3PLQA 4IP1A 2GT6A 4JQTA 3KHBA 4POKA 1RUD3 3S57A 2GH2A 1FOD3 1DP0A 2LRNA 1WBFA 5C3SA 5IVJA 4IKHA 1U5ZA 4P9IA 1OLQA 3PL0A 1ZYQB 2PN8A 4XS1A 1WCQA 1JS9A 1QJEA 3HEIA 3WQ0A 4Z8BA 2I81A 1E2YA 1ULDA 3HJRA 3CMGA 3FZ9A 4IV1A 1HNCA 5H5QA 5HCHA 4OWYA 4XFCA 4BIFA 1PZ9A 3C73A 1JU4A 3QCPA 4RS5C 3DKQA 4PF1A 1WCSA 4O92A 1BHGA 3N9QA 4Y33A 2XVGA 3OGJA 1JOBA 1MS1A 3WF0A 4ID0A 2BJXA 2C26A 1VP6A 4PDWA 2E53A 1V57A 5BNPB 1ZYEA 4MDCA 4FPGA 1C5HA 1X9PA 2ET1A 2NLRA 1GUHA 2K8SA 4P08A 4AVSA 4F2IA 4QPGC 1ND2B 5LBBA 2OZ6A 3TAYA 3SEPA 2Y34A 4FFHA 3N9NA 2YXSA 4CEWB 4E8HA 3J7HA 1DYKA 4NN0A 4ZIJA 2JD9A 4OMCA 3RQ0A 3U11A 4CP0A 2YZ4A 3WQ7A 3ZFFB 1JYXA 4EN8B 1ULOA 5FZBA 4CUGA 1XVWA 1JYIA 3LDKA 5CEHA 1RMU2 1IQDC 2VW0A 3VKMA 4IV3B 3RZZA 5FWJA 1GR3A 2YG0A 3VZMA 4DUXA 2AREA 2VVDA 2YN1A 1TI3A 1OD3A 5H9RA 4Q1PA 3IDAA 1MS5A 2I74A 2MZCA 1GNZA 3HQRA 2YPDA 3GBFA 2P6HA 2DBCA 4JRRA 2IVIB 4YKGA 4QX0A 1YEWA 3NKTA 4HQZA 2TUNA 4AG4A 5DXDA 2I9HA 5IVYA 1QK8A 3AZVA 1LESA 1WW4A 2J42A 1YKAA 4P9JA 1YUDA 4CYDA 1QNYA 4QPGB 2CHHA 1AJOA 4YW4A 4R9AA 1RW1A 2O8OA 4FTEA 1T7PB 1AR92 3ZYWA 1JODA 4GXZA 3WD5A 2WO7A 3POBA 2V4VA 2OX0A 1TKDB 3KD4A 2MYGA 3IDVA 2AGSA 3WNPA 1NXD1 4D7TA 1TRUA 3TEXA 3H8OA 1XOYA 4LLFA 1H2LA 2VQTA 1SBEA 3CBUA 3RYKA 1D0GA 4OULA 2EIGA 1KRIA 1KGYA 4Z2RA 4IETA 2KM2A 4XJWA 4GSSA 3ZIVA 4PDWC 2BNMA 2Y6JA 3KM6A 4EKZA 3NJZA 4RR3A 4NE9A 4LMWA 2BDRA 2CAQA 1YRZA 5GZZB 2VBBA 2BP6A 1R091 4QB1A 2H6CA 3LZZA 3O12A 2AAWA 4ZBAA 3JCIA 3J7MA 4CHSA 2YBSA 2ZMLA 1GZ9A 3DYMA 4DSRA 3ZN6A 1IYIA 1V98A 3VD7A 5C8CA 2FD8A 4NHWA 3JB4C 4JGZA 4O5RA 4BU2A 1ZBE1 4K9SA 2J1AA 3S7EA 5IJRA 5G30A 5DG1A 4NPRA 4P3YB 3EMXA 1CJDA 1FV3A 2WN2A 1GQGA 3UK9A 3QAVA 4JBBA 5DUWA 2DUPA 4TR1B 2FZ2A 5F5IA 3L9SA 4WM7A 4W6WA 5ECHB 4PNFA 2R042 3C71A 3VZLA 1U0AA 4LJHA 5FXWA 4PDWB 5IAXA 1MDIA 1W3VA 2JADA 5HXVA 4QU1A 5LZ6A 4MGKE 5FZ6A 1EWXA 1PX4A 1AJKA 1H0BA 5CO3A 4KGQA 1GSSA 5KN0A 3J4UH 4K7NA 2IWGB 1DHKB 2J1EA 1KNGA 4CTEA 5I8YA 4OMVA 4FPLA 5T5OA 3EBRA 2ETEA 3K4DA 1RUD1 4XUNA 2H0HA 2YPJA 4QQPA 3MIBA 1CZSA 4P00B 1WMEA 5IMCA 1GSDA 3D4KA 1N3QA 2LNSA 1CD3G 2VXJA 1WZXA 3A23A 3HY2A 2RS52 3T2PA 1TME2 2VZTA 4RR3C 3N3HA 4R8HA 1OAZA 2HZEA 1ZVFA 3TN92 2IFWA 1TE1B 4K7JA 1SBFA 2XJVA 3DVWA 2MBTA 2M72A 4JDNA 3U75A 2K9ZA 1FT9A 4KA0A 4FYBA 4O5QA 4NHMA 4GF0A 2J22A 4MF7A 5C8CC 2YDEA 1G9DA 4OZXA 1SLBA 4FPFA 5APAA 2E6VA 4X8PA 4BK4A 4N53B 2W1QA 3UBKA 1AHSA 4M3CA 4ZY9A 2BGPA 1V9U3 2XGXA 3RI9A 1XW9A 4Y4RA 2WS2A 1HNBA 4UW5A 4KBBA 1TTZA 3TKSE 4NPLA 4OI0A 5AFEA 1F31A 2VNRA 2W1UA 2XKOA 2PHXA 1VF1A 4BH9A 1B9XC 4Y1VA 5DQ0A 5JR2A 1SL1B 3VHNA 1F3AA 5LBFA 1J1TA 1QJU2 1COV3 3USUB 4HKWA 2D6NA 2HYXA 3RHCA 2FA8A 4AGSA 4OYUA 1TXXA 1MEC2 5FPBA 2AENA 1PRXA 3D6IA 4L0PA 1Z6MA 1O8WA 1V2AA 5CVRA 1UYZA 2Y60A 1FW1A 5CZKA 1Z7RA 3EWLA 4EN6B 2VCXA 2WNOA 3HMYA 2WWUA 2WSVA 3ZDVA 1VR3A 3ZN6B 2YU1A 2WZ9A 2W5FA 5DQSA 4NV5A 4KWUA 4V1Ag 3EU3A 1O3SA 5DUVA 1GL8A 1VF4A 3IDBB 3AYCA 3WF2A 4KGGA 4CDUB 4QU2A 1GMMA 2LUSA 4HXCA 1SEFA 3TOUA 4TR3A 3DXTA 2GSQA 4TTGA 4Y1XA 4ONUA 3VZNA 2VJXA 2LTNA 2JENA 1LJ7A 3ES4A 3AYAA 2R0PA 2MMAA 1GWLA 1RK4A 2NN8A 3ACGA 2JIJA 1DYPA 3RMYA 2RVAA 1HRV2 1REFA 5EP9A 2P37A 5KXBA 4MGYE 2ZGTA 4C0HA 4NMIA 4L11A 4LBKA 2PLV2 4IEWA 2G9GA 1MDJA 3AL6A 4Y5Z0 1R5AA 1ASJ2 3R3EA 1KJRA 3LIGA 4JGYB 5FY1A 5DPNA 1WRYA 1ULFA 1YYNA 3KT7A 2WFF3 2GLRA 4XUQA 1RUE2 4O7HA 2K46A 3OYWA 1AR82 4OD7A 4DUWA 4KUNA 1EAH2 2HBUA 1POV0 3MDPA 3ZOIA 1XOBA 4YZ1A 4DB5A 1CZVA 4XCAA 2B9UA 4ZHNA 1XNCA 3ZYHA 2DJ3A 2VZPA 1JZOA 1HV0A 4CCJA 1LNSA 3P90A 2OE3A 1H2KA 4HEA2 2YJ7A 4S2DA 1FMD3 1H8TB 5AIVA 2WAAA 1YEXA 4FPJA 3VKLA 1OPOA 4PQ1A 4BK5A 2DFBA 5A80A 3MIFA 2H19A 2CU5A 5HCBA 3KF5A 4OVEA 3UGHA 1VBE2 2JDMA 3AZZA 4IHUA 4FFGA 3BB6A 4BQWA 3T0BA 3HBKA 4N11A 1EV4A 5FYHA 1X7NA 1HN0A 4Q4Y3 4W6XA 1K5MA 2K6VA 4M3CB 2RG4A 1QQP3 4O61A 3O1UA 1ZZ6A 5JCWA 3D4TA 3P6BA 1GTAA 4GMP0 1K0NA 3SC7X 4HSJA 1UNBA 2YYOA 5D93A 1T6BX 4I8BA 1AC1A 3EPTA 3Q8FA 3L2YA 3WZ1A 3ORJA 2YFZA 4PT6A 2GGTA 2J1TA 5FBZA 2ZGLA 4BWQA 1W39A 4JR6A 4RHV2 3EURA 2W91A 2XOMA 2VOXA 1OA2A 3W59A 2DJJA 1LOCA 5JSRA 4JV4A 3KTLA 1X5DA 4XCSA 1ZBA3 4GWNA 1KD7A 3JXSA 4GQ7A 6GSYA 1DFQA 2MMZA 1UY2A 1V9WA 4F0BA 3B93A 1QJY3 4IESA 5CA6A 2C3NA 3HVSA 2WZPP 4YVWA 4HZFA 1Q5OA 5HV4A 4FPHA 4XIOA 1S0GA 2OZJA 4HSCX 3TRSB 5ABRA 1BJQA 4XETA 1NOVA 4CDWA 4AFAA 4BIOA 5JUVA 2PTMA 2O0OA 3QD9A 4ZXGA 4HOJA 1GWMA 1S3AA 2WWJA 3EO6A 1V9U1 1NA1B 5FZOA 5F1RA 2LSTA 4AW7A 3A5IA 5GLZA 3HNBM 4QXCA 4MP4A 3IT8A 1BVP1 5A32A 4J6GA 4YGBA 2W94A 1GNHA 1RUJ3 2GALA 3OGRA 2AEZA 4DMIA 2TIRA 2WJSA 1COV1 3RZLA 5ELAA 2L5LA 1IKPA 4LITA 4BPZA 3VURA 1WE0A 4UYBA 1VBD1 3B5LB 2PELA 1G0TA 3OG2A 2YUEA 2KD7A 4AFBA 4MMMA 1OQEA 5KHKA 1K5MC 3MUZ1 3LQCA 3VDDB 1W8ZA 1C28A 3LWAA 2WZR3 2W47A 1CQ9A 4ASLA 1OC1A 1QXHA 2Y6KA 3FR6A 1D4VB 4C90A 4AZZA 3W9AA 3BD2A 3VB9A 2EIEA 5F6KA 3T3YA 1OFNA 1NE6A 5DVBA 5AISA 4E2GA 2NTOA 3ZMNA 3B9CA 1RUG2 1WA6X 3K48A 3UGFA 4AI9A 2XC2A 4UI9L 2WUHA 4LXLA 3ATGA 1TNRA 1LOGA 4LA1A 2Q1ZB 3FHKA 1H6XA 4QX1A 1GUIA 2RLIA 3BI3A 5CAXA 1GTBA 4V1Ap 5IM9A 3IA1A 4EDYA 3KV6A 4ATFA 3WLUA 1RUH2 3PUQA 1HJGA 4TVEA 3B3QE 2IJYA 3FKFA 5FYUA 4CDWC 3D0SA 4PGTA 3AP9A 4O32A 3I2HA 2XMLA 3O1PA 4YLZA 5E6HA 3U4SA 5GM0A 4DUVA 2B5EA 2ORXA 2AV4A 3M0FA 1OD5A 5JWPA 2R16A 1W8UA 3Q6OA 1NLRA 1PVC2 1GNYA 3SMHA 4EQVA 5IVCA 3KGLA 5FPUA 22GSA 3NV4A 3AVSA 2X64A 3VBUA 5ERLA 5DAPA 3WY6A 4BQ1A 3I3EA 1TW9A 4X6QB 3A2VA 1SFPA 1PX3A 1SLIA 2N5FA 4TOPA 3P3PA 3HXSA 4USSA 4P9LA 2GVPA 5GJ6A 3HVNA 1PN0A 3OBZA 3VBRA 2JE7A 4Y26A 1DUGA 3RZGA 5A7PA 3G7IA 1SU9A 4COVA 1CN1A 3POIA 2X09A 4JKMA 5EPFA 3I59B 2WDBA 2L6DA 3GA4A 2E0QA 2B9VA 1IQAA 3A3TA 4X1UA 4CP9B 4IW9A 3D5OA 2OQ6A 2LW8A 4Y22A 4L8EA 1NM3A 2DTWA 4CDWB 4TXOB 3ZFEA 4Q0QA 3SCGA 4EE2A 3IMNA 2WIIB 4N0ZA 1QQP1 4Q5NA 1R64A 4JTOA 1ZRDA 4EWDA 5A4VA 3ZR6A 2PPTA 2GSTA 2WQ4A 4NWWA 1SKRB 1PO12 4AEMA 4BL7B 3BOPA 5A32B 1RYYA 2E51A 2F51A 4GCIA 4UBGA 1VALA 1NT0A 2C1FA 2QQMA 3WUCA 1XE7A 4M4PA 3RDWA 3HN1A 2PA7A 2C4JA 5A3PA 4Z1VA 3ZXKA 3SNMA 4MHRA 2H30A 1PL1A 5DN2A 2RDRA 2B7KA 1WWJA 1GU3A 4W65A 1RQMA 3HNMA 1ZBA1 4FFFA 4O9EA 4WZFA 5JSPA 4TXWA 2IXCA 2VM1A 1J08A 3APQA 1JLWA 2FMDA 1UYPA 2PHDA 1QJY1 2WCIA 4CPBA 2Y6HA 3HNYM 4IEYA 2HSMA 1W2NA 3OD0A 3WR0A 1AYM2 4DEQA 2R32A 4OHXA 2FA4A 4N30A 3NV1A 3ZYJB 4QX3A 3THTA 4OO5A 1Q43A 2HBTA 3UNPA 2IPAA 3FK8A 2CAVA 5CFDB 1RIRA 3VBRC 1Y9QA 1REEA 1RUJ1 1SL0B 3PTYA 1O3QA 1UCXA 1C8NA 3DKWA 2W1WA 4MYEA 4A45A 5J41A 2HWD3 4QHBA 1GLHA 4Q27A 4WVVA 1C8M2 1HXS2 4XJZA 5JI9A 3EINA 3MHZA 2VTXJ 2IMFA 4K8RB 1I6XA 4B4QA 2Y0IA 4WVZA 3ZFEC 4CCCA 3WCSA 1RMU3 5E88A 4PJYA 4BE3A 4D3WA 2WZR1 2Y64A 2E2MA 3GYKA 2YV9A 4CCOA 4D6QA 4JEDA 1JLVA 3H8UA 2ZKNA 1CZTA 4K9ZA 4NWYA 2DCTA 3O0XA 4YZ5A 2E7PA 1TK8B 4AJ6A 3M3QA 3PU8A 3ZN4A 3BYWA 2BUKA 2VH9A 1MS3A 5FYIA 4QX5A 1BLZA 4YM1A 5FQ0B 3IR4A 3HQXA 2EIOA 1ZZ8A 4D8MA 2E26A 1MD4A 4F82A 1A0RP 3LYKA 3E97A 3WNNA 2QDRA 3VBRB 2VCAA 1UOJA 3PU3A 4B7KA 4HK8A 4MGQA 19GSA 1PK6B 3EB7A 3GKXA 5KC6A 3I3QA 1FI2A 4G0IA 1PGW1 3ZIXA 3VHOA 3WGXA 1AR93 2VMDA 2VZOA 1A3KA 4AF2A 4V2NA 1THOA 1YCIA 1ULCA 5C00A 4Y22B 1OF4A 1YXWA 4XZUG 3TJJA 4A6OA 2XL7A 4A42A 5HR3A 5JOZA 2GZPA 2GNDA 5JOYA 1U5XA 2WLPA 4DY5A 3LORA 1ABAA 6GSVA 5FBJA 2BW8A 4DXTA 3ZIWA 1WWYA 4CU7A 5DAQA 1S3DA 3FFQA 2XPEA 1DIWA 3CRTA 5IK4A 1HQWA 2LRPA 3U1XA 1RITA 3F95A 4K2XA 2F4PA 5ANNA 2QQVA 1ND3A 4CCMA 2EAKA 4ZU4A 3H3ZA 3C7FA 2RJLA 1IHMA 4ATEA 2C3TA 3THPA 4QXHA 4OFTA 5KN1A 3K51A 2VM2A 4EVMA 3R4UA 2DVAA 4KWJA 3ZMLA 5D96A 1CQHA 2QC7A 3G6JB 2V72A 4QM8A 1OLMA 5FLJA 5IVBA 3FHIB 2MEV2 3C2UA 4LR4A 1GKBA 5D9TA 3HJPA 3RPPA 2N7GA 2VW2A 3WX5A 5HQPA 1OKOA 2OXBA 5DCGA 4XVHA 2OA7A 4Q4W2 2FUG2 5J7MA 3P1IA 3POEA 5FIXA 2RV9A 4QKBA 5F8PA 5ABJA 3O6TA 3K3OA 2VL9A 5A1AA 3HD5A 3WT2A 4ECCA 4LLOA 3WT3A 4XMIA 3ERFA 3FL7A 1BG5A 2IFQA 5D1IA 2R043 1VMHA 1OKQA 5KHHA 1W99A 4P5HA 2R1DA 3FX3A 1XW5A 3FUOA 2J1SA 4Q4X1 1W6OA 4I6XA 4HMZA 2K0GA 1W6MA 4G4FA 1W9WA 2IXHA 1XWKA 1XE8A 3KIJA 4XZPA 1ZZCA 2IUWA 3PUHA 2WZEA 1IOAA 3E1F1 5LA2A 2A3XA 4KCEA 1JZDA 1WLCA 1B4QA 3GSTA 1NZIA 2WDUA 4X43A 4L8QA 3IKWA 1MTCA 3IAQA 3CF6E 1WPIA 4LOSA 5FZHA 4K1FA 2ZEXA 4BLIA 2C0EA 2ZZQA 2HT9A 1SCSA 1V6KA 5ECLB 1SD9A 5T50A 4B8EA 1U5YA 4XFIA 1V6LA 2P5QA 3GHAA 5CKMA 1TME3 5C3PA 4EN7B 1C1FA 2D93A 3TN93 3GM8A 5G05L 5FREA 4COWA 1ND3C 5HCFA 4YPJA 2C9AA 2H0BA 4WBRD 1W9TA 1O8SA 1ZZ7A 1DYOA 4WM8B 3WHTA 5LRSA 4IQAA 5FY7A 2A6ZA 3TB0A 1A0FA 5EJ1B 5E89A 5FLIA 1W0OA 4QD2A 3WW1A 2DBNA 3VV1A 4Q29A 1XYOA 2PGTA 5A6YA 2HWD1 2VNVA 5EPAA 2ZX0A 3I43A 3UL3A 5L71A 1NCRA 3F4SA 1BMV2 1V6MA 4BPYA 1H1IA 4DFSA 2PERA 1SYRA 1GTUA 5DJLA 2QDNA 5FZ1A 3UV9A 3QFBC 2PHUA 1TI1A 3R05A 4M4RA 5ABJC 3PUSA 1RMU1 1BBT3 3VDAA 5FPAA 4UW3A 4K2DA 2ZMKA 4OFNA 1QJU3 2XLAA 1G7OA 4HU7A 1GULA 1O7UA 4OO4A 4UFMA 1F37A 1OQ1A 2BVBA 3E6CC 3MV01 5F2WA 4GULA 5LA0A 1ND3B 1FOD2 5CRDA 2ADEA 5G31A 2Q1FA 3GKKA 3NIVA 5GLTA 2L59A 4I3PA 3ZXEA 4NO4A 4PQ9A 4JCKA 5ECNB 4QPWA 5F32A 2GP3A 3O0WA 1WW7A 3V56A 2QQLA 4DSQA 3PVBB 1W8TA 4IJIA 3I3BA 5J1XA 5EY6A 5FO7B 1E5IA 3ME2A 2FWGA 1AR91 1N1TA 2NMOA 2CX3A 1RUF2 4LULA 4NRPA 2OIIA 3LGCA 3RVHA 3KMHA 1QJX3 3KCCA 1MVEA 1ULEA 1XWCA 4FH8A 3AMHA 4CUBA 3K4ZA 5ABJB 5GZEA 4OI1A 4PBPA 2E33A 4EV0A 2OYZA 4IQ1A 4A41A 3QMXA 4ICYA 3ZMKA 1N1VA 2WL1A 4QQ7A 1T4YA 4K20A 3KJYA 3I54A 3ZR5A 1LECA 3J7Yk 2I4AA 3NJXA 3LA2A 3S5AA 1HRV3 2YNXA 4MGZE 4RN5A 2ZCWA 3ELNA 2WWSA 1W6OB 4LHLA 4KNCA 1LTEA 2PLV3 3MDKA 5D8AC 1ASJ3 5JWRB 5KHIA 1PVXA 3HWJA 1WIKA 1W9FA 4IEOA 4PQIA 1K42A 1AR83 3L2HA 1EAH3 5B6MA 1O3TA 4FYCA 4KCAA 5F05A 4K40A 4XFBA 4GB32 2XL9A 3NRUA 1HD2A 1XZOA 3ZYFA 1GICA 5FZMA 4I0WB 5KC5A 3AKTA 4XDQA 4G9SB 4LQRA 3H42B 5L73A 2CAUA 2WT1A 1YF1A 4ZB6A 1OLRA 2R7EB 2CV6A 1VRH2 2HRFA 1HDKA 2VZQA 4E8EA 2R041 1UIJA 2JEMA 5JI7A 4Y1ZA 3E5QA 3AKPA 1XOAA 2BV4A 4HETA 4OHVA 3QFAC 5ECIB 2XHNA 1AYN3 3HJOA 3J7NA 4NIAA 2GSYA 2QZ2A 1JZ6A 4EL1A 4NJ4A 2VOKA 3CL1A 3VWVA 3VWXA 5D8AB 1PQNA 4QB6A 5SV5A 2ZX3A 5BY5A 2CX4A 3K77A 5A4WA 2Q8CA 3BTZA 4OUEA 1SLTA 3LG6A 1J1LA 1DG6A 3ZPYA 2PU9C 4DRVA 5FO9B 2B1KA 1RJ8A 3S30A 2ZGRA 1IG3A 5FMCA 4CEYA 2PMTA 2BFUL 1TDIA 1SDWA 4BVYA 5FMOL 3DMLA 4ZB8A 1RB8G 4RHV3 3MUY1 4HN1A 3PDQA 4ISQA 4FPKA 2RS51 2WRAA 1TME1 4ZB9A 4V2MA 2VG9A 4FQZA 1Z5YE 2JDAA 3TN91 5EZWA 4KF9A 4UFLA 4WKWA 3ZL5A 2H71A 3ZXLA 1SZBA 3ZXAC 1XYNA 4H7MA 1AW9A 2R1BA 3CO2A 1BEV3 4RUVA 1ACCA 3DGQA 3BIWE 4FXGB 5JXJA 2D7FA 1NKGA 5FMDA 4NIIA 4RI7A 1ILOA 2HXKA 2H74A 3RDIA 5AIXA 3I3DA 5T5LA 3A21A 1O6JA 1PZ8A 1YQ2A 2D6OX 1KJLA 3B7MA 5H5SA 1SENA 1ZZYA 3TB2A 4FTBA 4YYOA 5FK8A 3LEKA 4LUMA 4J2FA 3O3TA 4JVAA 2RUFA 5J9CA 2DSAA 3S0MA 2L6CA 1N1YA 3CLPA 5FXZA 3INAA 1FPN2 2C0FA 5BNNA 1CAWB 1QJU1 1DDLA 4CA9A 3MV11 1YY7A 2YWNA 1BYEA 4LBJA 1MEC1 1XWBA 2I3YA 3WDYA 1WD4A 1UY1A 3FZ5A 3C7MA 2A75A 2H0GA 2E7TA 2KUCA 4I97A 4NPMA 1W9YA 2E2GA 1I3HA 3LEIA 3WW4A 2B4KA 2VE1A 1XU1A 1IPJA 2PQSA 1JTZX 3CQFA 3CJXA 3VBOA 2FD3A 5I0RA 4XDOA 3R4DB 5FZAA 3DF0A 1U3IA 4CEYC 1GWKA 5DCHA 1O4TA 3P7XA 1RUG3 1CVNA 3KMOA 1KDMA 2BGOA 1CAVA 2P5BA 1F35A 4LBQA 2AH2A 2DVBA 4CU6A 4CCNA 4XS6A 2IN3A 1X9SB 4Q4V3 2GZWA 2CAIA 2PN5A 1MQTA 1V9U2 3IHGA 3OPTA 3RJ2X 5ECOB 1LB2A 1QOOA 2JDUA 2V32A 1M3IA 1HRV1 4V1PA 2A3YA 1M7TA 1OHFA 5CAZA 1RUH3 5F39A 5DUXA 2YP6A 2A4VA 1F9MA 1R1ZA 1R1A2 2PLV1 2FHEA 3QH6A 4MA9A 1G6WA 4UBHA 4EZ4A 1ASJ1 2HKXA 1GZWA 5GKAC 4W6YA 4BJ0A 1EY2A 5KXCA 4HU9A 3U37A 3J7LA 4AVBA 2I2SA 4KAEA 1AR81 3AC0A 3LFLA 1OURA 4LIVA 1EAH1 1XCCA 5I0TA 1PVC3 4PTSA 5FZ9A 4K6BA 4HQSA 1FAAA 4J25A 2BJSA 4GKXA 4XIHA 4BVYB 4LBOA 5FK7A 5BNNC 2CVKA 3CSHA 1UXZA 5FHIA 4L0WA 2P17A 1VGLA 3TKSA 4A6SA 5FY9A 1SYXA 2ZHLA 4M0NA 1LU2A 2QQNA 3FY7A 5FUIA 5IOXA 2AACA 1YC61 4ES8A 4UFJA 5GZFA 1A2MA 3E0UA 1A23A 2OJLA 4ARYA 2RM23 1EUUA 1RXFA 4NAOA 2VVEA 2WSUA 5H9PA 5J37A 1AYN1 1C4RA 1UOFA 2DCJA 1C72A 5BRTA 5IT6A 4COYA 2HSHA 3P8WA 3VBOC 3I2FA 5FYVA 4XFAA 1GZTA 4Y5TA 3KCMA 5IMZA 3V1WA 3M2MA 2JU5A 5EQUA 1LKNA 4PURA 1F3BA 5FZ3A 3KB5A 1LENA 1ZCPA 1ALYA 4BISA 1XVQA 3GL5A 2HE3A 4BWSA 5DZGA 2VLVA 4JQRA 2A6VA 5BNNB 1JZ7A 1O73A 1QQ2A 2WFF2 4HVRA 1MQTC 4NROA 1ZRFA 1N1SA 2FDGA 4RHV1 4OFMA 5A3TA 1BJXA 3CJIA 1ENSA 1JH5A 3GH6A 1GZCA 5C3QA 4AHYA 4AEDC 1JZ4A 3EYPA 1FATA 2ZOEB 3J9SA 3BOWA 2WGRA 1RUC2 5DAXA 5FPXA 2MNGA 1BEV1 1LU4A 3E5XA 3N9PA 5CP1A 3JB8A 4RL7A 5DZEA 4BQ4A 1MS9A 1FMD2 3WVJA 3UGGA 3UT0A 2GN3A 2FDIA 4TYSA 3KF3A 4E8CA 3A5WA 3WDVA 3RGBA 2QE3A 4XJ9A 5JMOA 4XBNA 4RSUA 1K0AA 1OI6A 4E9KA 2E32A 4FOYA 2YMZA 1XE0A 3QH7A 3AP5A 2H1GA 3K2OA 4XTSA 3LSEA 2YGLA 1WW5A 1CAVB 1EUTA 1V6OA 3TKSC 4XPVA 2CA8A 2DKIA 2DBIA 3TCOA 4PQHA 3POYA 2XH6A 1E6BA 2H6BA 4Q4Y2 4XFHA 3GTUB 1PHMA 2LRCA 4RFRB 4EYUA 4FSJA 4XE9A 3O76A 3OPZA 1MS0A 2Y8KA 3OR5A 3BUCA 3THCA 2HSYA 3N5OA 5FY4A 1C8M3 1HXS3 4WF5A 1D4M3 3GMFA 4YW3A 4AEDB 3D22A 2WC2A 1H2NA 5LY2A 2YC2A 3RZKA 3IBHA 4MABA 1W2AX 4H7LA 3MIXA 3KCXA 5BPXA 5KOWA 2RDQA 3F6FA 1W06A 1H4OA 3IN9A 2RDSA 3UVTA 2ENRA 1VAKA 3OY8B 1TG7A 3IAPA 4HZ2A 5F07A 4N7IA 4LIUA 4I3GA 1OC9A 3VZOA 4GSNA 1RUG1 2OE0A 1F2NA 3CJIC 1UYXA 4J1WA 3ROUA 2IIYA 1YQ5A 1TOFA 4HS1A 1LOFA 4Q4V1 4P9YA 2L57A 5CU1A 2NMNA 1YEPA 4ML6A 5JLVA 3BCWA 1R082 1Q8QA 4LNVA 1W4VA 2X8CA 4MLYA 1N3OA 3TYJA 4Z7XA 2EIBA 3FZ3A 4IE7A 1RUH1 2B7YA 1YQ8A 2A6XA 2RDNA 2VQUA 3H9AA 3HN3A 1Z7PA 3M8NA 5IMDA 2OT7A 5AFBA 2IMKA 1C5IA 2WO3A 3EHKA 3DN7A 3FHAA 5FP4A 3LPGA 2RS12 4YVSA 3PJQA 5KHGA 1UN2A 5L36A 4NAMA 1DBYA 1D2SA 1PVC1 5IW0A 3IPZA 4IEZA 1V58A 3OGVA 2WULA 4LL1B 3MIGA 3NZNA 3ZSLA 3EMRA 5IUQA 3VPTA 2A5ZA 4F3JA 5TSWA 4QL9A 3BJ5A 3CJIB 2EXHA 2MMOA 2Z5WA 4I09A 3PIGA 2VAFA 1UY3A 2RMU3 2IZWA 1W2TA 2YCDA 4MG2A 1ST9A 5FZ8A 5DAVA 4QB2A 2SLIA 3LDRA 3OOXA 5LY1A 3LPFA 4QAWA 3FMWA 2MEV3 5IK5A 4CCLA 2ZKLA 2RM21 1G9AA 4XHMA 2JWPA 1VB2A 4AI0A 1A2LA 5C04A 4AK3A 3I3MA 2ZEZA 4COUA 4IW3A 1WW6A 4R52A 4Q0UA 1W3XA 3D3AA 2BZDA 4K8FA 1Y3TA 4XQ4A 1TVGA 4XC9A 5FZFA 1AQXA 1X5CA 2HWE3 1ND2A 4E27A 1TK0B 5FJHA 1CWPA 2VL3A 5IPHA 4ZPIA 3QBQA 4CCDA 1O85A 1SDDB 2B5YA 3LA3A 3VZKA 2VL4A 2LRTA 4NHZA 4IE5A 1NX9A 5IIZA 1LOFC 2RR12 4MX3A 5E8AA 4MH0E 2DYCA 3EC3A 2PXJA 1QHDA 1DBNA 2VUAA 4KH7A 3F4TA 1OBNA 2PHTA 4IV3A 1UZVA 2XB6C 3JZVA 2CVDA 4AFDA 4Y20A 2ZAHA 3ZITA 2KOKA 4Z2AA 1AQVA 6GSTA 2VW1A 5LEKA 2IXJA 4NMUA 4O5UA 2CZ2A 4RGAA 4I2OA 2OW4A 5ECQB 1LHUA 3POWA 4OCTA 3A2WA 4YVSC 5F3GA 4FYUA 4QDQA 4YM2A 1AYM1 1IKQA 2BBAA 3PVNA 1I9DA 4A5PA 4FOVA 2W52A 4XF9A 2VCVA 1OC9B 3T2TA 3QR6A 2VECA 3T4HB 1GOHA 4PLMA 3NWKA 4AI3A 2K18A 1V40A 5D8IA 2FDJA 3DXBA 1W0PA 1FOHA 4H3WA 2UU8A 2LM3A 20GSA 2HEYF 1UZWA 1JOJA 3MPPG 1B8XA 1S0FA 3MF6A 5FUNA 4XTMA 2V09A 2HI7A 1BCXA 3IDCB 3O1SA 3T1LA 3ZO0B 2PVOC 1C8M1 1HXS1 1D4M1 4XQWA 4ZZ8A 4YG0A 1OH4A 2ZNMA 3GBGA 2ZGQA 4LOTA 4ACSA 5M0TA 4QPYA 4PBOA 4MJEA 1Q3EA 2GU9A 5FP9A 1M4WA 5HI0A 2VCWA 4DY3A 3GZUC 3ZTLA 4XXPA 2CY6A 2EXJA 1MVQA 4UF0B 1ZOFA 1ND2C 5FP8A 3WQ1A 1YFXA 4YVSB 1PMIA 4GQFA 5JVVA 5JOXA 1XSQA 1VAMA 3I7DA 1G7YA 3F2ZA 3NNJA 2BOIA 4OUMA 1FV2A 4IEPA 3RBTA 3AP7A 1H30A 3RYPA 5L19A 4A3XA 5I93A 3GL3A 2EAAA 2ATFA 5G1LA 4X0XA 1IS6A 2ES3A 4IV3C 5FDBA 4KG0A 2R6KA 1KEXA 2DVFA 2Q8OA 4I5QA 1PSQA 5FZIA 5F5CA 4TR1A 2WNVA 3WHUA 2LJKA 4NPBA 4MZBA 2VO5A 3WG4A 3AMMA 3AZXA 3MSZA 1RUF3 4XS4B 3A0KA 2TBVA 2GTUA 3NMBA 1QH7A 4XF4A 2F4LA 1MS8A 1TJDA 4YG3A 1TU8A 1JXNA 2X5IA 2Z4FA 2WFPA 3HDCA 3WDTA 2HWD2 4IGQA 4Z07A 3TJKA 1Z7S2 3OPWA 5FCCA 2XJUA 1H1AA 4D6RA 4Q1RA 1FNZA 1HV1A 3AFKA 3QAGA 3A2XA 1SLAA 2X05A 1DE1A 5FYTA 4MO3M 1VPHA 2NM1A 3M3MA 2A1XA 3ST7A 5COHA 2R062 1UX6A 4IELA 2H0IA 3MPBA 3GJAA 5JOWA 2ZEYA 1I9RA 1L7QA 2ERFA 4EC0A 4LEJA 2O14A 3DRNA 5CKNA 4Y20B 2KP1A 2Z69A 2RMU1 5A1LA 4MGTA 3NV2A 4BQ3A 1BQ7A 2QQIA 5E16A 4QQHA 1QIQA 2MEV1 3LA7A 1IYHA 2VZVA 4D6SA 3K8NA 5K0UA 2ZCTA 2W9XA 4OLLA 4GB33 3C8EA 3M1HA 4LO4B 2XQRA 4FPCA 5A4UA 2VC9A 4BXSV 4Q4W1 4O9GA 4XDPA 3RG0A 5CG8A 3BGAA 4ORFA 3PUIA 4MSVA 5T54A 4J56E 2DC5A 4IEUA 1VRH3 3R6SA 2NYYA 3IPVA 5IOWA 3CNAA 5LATA 4N53A 1SLLA 2D3SA 3GNJA 4IGPA 3BTAA 5LNKe 1S3RA 1YIFA 5IAVA 3TOTA 3Q19A 3UEMA 1UPIA 3L0HA 2JG9A 2GC1A 2LS5A 3ME8A 3ZVJD 3WSOA 5BUVA 4MF6A 4YG6A 2WNVC 2N5AA 3IBMA 4XF0A 2E31A 3WP3A 5LBCA 3USUA 1NHOA 3J8F2 3UKVA 4A7YA 3RAZA 5LASA 4AGRA 4MUVA 4D7YA 1U12A 5IMAA 1BK0A 2X5IC 2XR4A 1EEMA 1XRUA 3VPQA 5FP3A 1U5IA 3GBWA 1W03A 3OEBA 2FDKA 4KBZA 5J3UA 3UMAA 4YWAA 4I0AA 1X33A 2V5DA 2GQKA 3ZFBA 3AB0A 4A44A 4ZXKA 4YFWA 5D9WA 1NLSA 1UZ0A 4OI4A 4MJCA 1URMA 3JU9A 4V2VA 18GSA 3NKGA 1TRWA 1KDKA 1EOGA 2VNGA 2NDOA 4CDUA 1EV13 5KXEA 3O5SA 5KBFA 1IS5A 1VF3A 4ET7A 4GIQA 4PIXA 3APOA 5G2ZA 1VF2A 5LK5A 3SKJE 3I2JA 1QJZA 4OZOA 2WNVB 2XBO2 5GZGA 1OVPA 1VRSD 4WEYA 1JYCA 2DCYA 3L9JT 4WR4A 5K0UC 5ELGA 4HVOA 4IQPA 1C3HA 1BMV1 3IMMA 1JYVA 2H1BA 4XUPA 1M3JA 2X5IB 5KHJA 5DAKB 1F6MC 3TEZA 3EVIA 4YGCA 1FPN3 1QKQA 2ILMA 4JGYA 4BQXA 5CISA 4H86A 5A3UA 3TUEA 4K0NA 4ZS3A 4K1YA 4ZONA 4N53C 1X36A 1R7HA 1K3YA 1AX2A 1PGSA 2WZ8A 3FUQA 2VM9A 1DZTA 1UOBA 2YBPA 2OBIA 1FOD1 4AVCA 2JG9C 5G04L 4EO3A 3ZYBA 5HR0A 4BQYA 5F6LB 2DV9A 4K7OA 2ZS6B 4QX7A 1UIKA 3W5NA 2DJKA 2E7AA 1H8TA 2GS3A 5GLWA 3LQ7A 4MVTA 3BCKA 4UT5A 4XABA 4CDXC 5K0UB 2JG8A 1MZEA 1NQJA 4LUKA 1OKTA 4K5SA 4XJUA 3HQUA 3IDEA 3CEWA 3LAGA 1RUF1 2Z2SB 5B4NA 2W39A 4UW6A 4I01A 1GQPA 3D4MA 4D73B 3C7HA 5FZEA 1MD3A 5KR7A 1ZA4A 1U87A 1E57A 1UMIA 4YGEA 3IPVB 1I1EA 4M00A 5A7SA 4CDUC 1L7RA 3OBAA 1H75A 4ZBDA 2JDZA 1NXMA 4AE2A 1PFOA 2JG9B 1BBT2 1R1A3 2ZAAA 1XBSA 3IB3A 1LJRA 4UW4A 3U5RE 1LEMA 2QQJA 3CSJA 5LB6A 5AN1A 3GXUA 2GNMA 2GDRA 2FWEA 2X49A 4GQCA 1Q8OA 4CDXB 4FO5A 1AXYA 1DGWA 2IMDA 3CRUA 1X5EA 2O87A 5ID2A 9GSSA 2VMHA 1B9YC 4JGYC 1PKZA 3GCXA 1ENXA 3K75B 4GB31 1LOAA 2WYSA 1RUI2 2WKKA 3UJQA 2FQPA 1AR63 2RS33 1HNAA 1X8EA 1GP5A 3KH9A 4YW5A 1L3JA 3D0JA 4AFCA 2Q8EA 2QVSB 1NE4A 3H7YA 1ZX5A 3KEBA 1VRH1 1LRHA 5CG9A 1PGL2 5GSTA 5G5EA 1F4AA 4NRMA 5HXMA 2J1RA 2VUCA 1QJX2 3IV4A 1NA1A 3E6DA 5IO2A 5CFCA 4EN9B 4CE8A 1O59A 4XTPA 1H8TC 4SBVA 3CKHA 3M8LA 2JZTA 1WUVA 5GALA 4TXVA 2D5HA 5I0DA 2JG8C 3SITA 4OHYA 4AEKA 3H7JA 5A6QA 5FYMA 2VCMA 5C71A 3WW2A 1AF9A 5CNAA 3N7LA 3DYOA 3TWIA 2LALA 1A8LA 3KS7A 3TNPB 5IK8A 2WR9A 1CJPA 4ARXA 3MFCA 1ZL9A 3DPRB 3AP4A 1AL0G 5HFIA 4PNGA 4SLIA 3VDDA 1NLQA 5GAPD 1O3RA 3VWUA 4XHBA 2AUYA 3S7IA 5EJ3A 3KQRA 4HANA 4QT6A 4LPLA 3PVEA 4YQUA 2H66A 5IFPA 2AHEA 5FYCA 2ARAA 1J58A 2XUEA 1RUC3 2YU2A 1EV11 1W04A 1VAVA 2ADDA 3LDBA 2X29A 2J23A 2CGPA 4HK9A 3GKMA 1XSRA 2H1DA 2HZFA 1V0AA 1IG0A 3RZJA 4ISDA 5IWFA 3AX4A 2JG8B 3KV4A 2OADA 3N9LA 4FP2A 5C6CA 4DXSA 4TN7A 1Q56A 1VJ2A 5EWSA 3DEMA 2DMMA 5D2AA 1OVSA 2BYVE 1EOHA 3NNMA 2O89A 4BLJA 1AYN2