2HYXA

Structure of the c-terminal domain of dipz from mycobacterium tuberculosis
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
333
structure length
333
Chain Sequence
GAMEIREQLNLGGIVNAQNAQLSNCSDGAAQLESCGTAPDLKGITGWLNTPGNKPIDLKSLRGKVVLIDFWAYSCINCQRAIPHVVGWYQAYKDSGLAVIGVHTPEYAFEKVPGNVAKGAANLGISYPIALDNNYATWTNYRNRYWPAEYLIDATGTVRHIKFGEGDYNVTETLVRQLLNDAKPGVKLPQPSSTTTPDLTPRAALTPETYFGVGKVVNYGGGGAYDEGSAVFDYPPSLAANSFALRGRWALDYQGATSDGNDAAIKLNYHAKDVYIVVGGTGTLTVVRDGKPATLPISGPPTTHQVVAGYRLASETLEVRPSKGLQVFSFTYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the C-terminal domain of DipZ from Mycobacterium tuberculosis
rcsb
source organism Mycobacterium tuberculosis
molecule tags Unknown function
molecule keywords Protein dipZ
total genus 92
structure length 333
sequence length 333
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
A PF17991 Thioredoxin_10 Thioredoxin like C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2hyxA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2hyxA01
4EC0A 3UJ1A 4KW6A 1B9XC 2KOKA 2H73A 3GKXA 3QFAC 4L5OA 1SDDB 2V6KA 4CW9A 3VD9A 1ERVA 5J3RA 3VD7A 2FY6A 4PQIA 1SK2A 3PUIA 4BL7A 2IMIA 5B6NA 3FHAA 3LEKA 3KJYA 1H6YA 2YFUA 1GTIA 4CHSA 2HLEA 2WGRA 2OADA 3ZVJD 2GSSA 3WNNA 5D93A 1OT5A 1ZZYA 2YG0A 5IJRA 2YB7A 16GSA 4L0UA 4ZBBA 4KCAA 2C0DA 1A2LA 1K0AA 2JE8A 3VWUA 2QQIA 4ML6A 1V58A 1UY4A 4HU9A 3GKNA 3ERGA 4DXSA 1ZMAA 3L9VA 4HDEA 1J84A 1H4OA 2DSAA 4E8HA 4NAXA 2E2GA 18GSA 3TJBA 3ACIA 2K8VA 4WXTA 4ECIA 3HNMA 4I5QA 3ZIVA 1NHYA 3WEZA 2YOIA 3NZNA 3EE2A 1OYJA 1GSUA 3BN6A 4K7IA 1AC1A 4HEA2 4TXVA 4YH2A 5CO3A 4DEVA 1TRWA 3T08A 4YQVA 2E32A 3WF1A 2GQKA 4OFNA 3QAVA 4MF7A 1DE2A 1AAZA 1J0FA 3AC0A 5H5RA 4EDZA 6GSWA 3GN3A 4V2LA 1GLPA 4N11A 5G2ZA 5IMDA 4GSSA 4NMUA 3DEXA 3TKQA 2K9FA 4DUWA 1YQ2A 3D21A 3FZAA 2QKEA 1ERTA 2VLTA 4ZZ5A 4P00B 3VK9A 2YCDA 2ORZA 3BCKA 5E4WA 3GSSA 1TK0B 3WGEA 3K77A 4MO3M 2VL2C 5KN1A 4IHUA 1TVGA 3HCZA 4MADA 4EO3A 2VL2A 1PD21 4ZBAA 2WZEA 2YFZA 1SD9A 3FR6A 3W5NA 2VZRA 5ECNB 2O89A 3WNPA 2FA8A 4RUVA 3MAKA 4D8MA 2ID4A 1JYWA 1UN2A 2DJ1A 2JD9A 1XVWA 1TJDA 3HVVA 4I8BA 3MDKA 3IV4A 1A8YA 2H0HA 1JYVA 4TOPA 4OZOA 4CDOA 5G5FA 1KBNA 3NJVA 1F4HA 1C72A 1GSQA 3F6FA 3G7YA 2WZ8A 4WF5A 4QDQA 3WNLA 4LA1A 4TXOB 2ALBA 3THDA 2N5FA 2J22A 3EMPA 3GA4A 4MCUA 1UYXA 4G2EA 6GSXA 1G0TA 1SJIA 1PQNA 2WDUA 6GSYA 4BK4A 1XCCA 2YJ7A 5ECQB 4E8DA 2CDOA 4QAWA 3S9FA 3ERWA 3I97A 4IGJA 1TKDB 2FHEA 4F0BA 1EWXA 4KH7A 2GT5A 5AISA 5J41A 2XBQA 4QL9A 2X8GA 2JSZA 2REMA 1PSQA 2V5DA 3C8EA 1SG3A 1QK8A 2NTOA 5LA2A 3VI5A 2R6KA 3BBYA 4MF6A 2RJ2A 4X43A 2LNSA 3ECQA 2R3XA 1AW9A 1HNCA 2FWEA 3GV1A 4FYBA 4K0GA 1T1VA 4W50A 4XUNA 4Q5NA 1JZ4A 1TOFA 1KGYA 3A2XA 1SU9A 1YEPA 5JMOA 3TGZA 1EOHA 5F8BA 2RM6A 3IHQA 5F7UA 3C7MA 4O92A 2GQLA 2V6OA 4OFTA 3W6GA 1SL1B 4MZCA 2V41A 3NNGA 1UMIA 2LRNA 4L0WA 4KCEA 1F3BA 2VMEA 3OB8A 1GTBA 2RUFA 1GTAA 1ZYQB 3I9V2 5D96A 1XOAA 1R7HA 4CUBA 3VDCA 5IO0A 2V4VA 2VL4A 3P6BA 3FHKA 1LBKA 3THCA 3ZM8A 2QQLA 1GULA 2E33A 1PL1A 2AYTA 3BGAA 2EIRA 5AIVA 5F0GA 4JKMA 3R2QA 1JZ5A 2D2ZA 1NKGA 2C3QA 5A5KA 5D9TA 1MDKA 2P5RA 4GZ9A 5G30A 3ZTLA 4V2NA 1NHOA 1BG5A 3IAS2 1NW2A 4V2MA 4AGSA 1GNEA 1XNTA 1MDJA 3CSIA 3N5OA 4D73B 3U5RE 6GSUA 3Q6OA 5IPHA 2L59A 1D7PM 2BJXA 5IO2A 1W8OA 3K46A 2F8AA 4P3YB 4ULXA 3HJOA 5ECKB 4MJAA 4QX2A 2PVOC 3IAPA 2J7MA 4JU5A 3DYOA 2DJ2A 4ECBA 2VO4A 5A4VA 2A4VA 4L0PA 1I5GA 2CZ3A 3G7IA 5EIYB 2E26A 2H66A 3ME8A 1CQGA 1XFLA 2YZHA 4QX3A 2VUPA 3VWWA 3M1GA 4PNGA 4TW5A 1JZWA 5B8AA 2YWNA 2VR4A 4YQMA 1H6XA 1XWKA 4IN0A 5C04A 4GQCA 1OH4A 4KSMA 1F3AA 1HN1A 4ZXEA 2JZSA 4LPLA 2C4JA 2MZCA 2IMFA 5ELAA 4K7OA 2YANA 3QPMA 4KE3A 3I3EA 1VF1A 2AB6A 4GQFA 3FW2A 3HJMA 2H6YA 5JWRB 3C73A 2JDAA 1AXDA 3QAWA 1GNYA 1MEKA 3UEMA 4KGIA 1GUKA 3IDAA 1EOGA 1ZYEA 3ACHA 3M0FA 3F4SA 3WF2A 2OE1A 2O8VB 2PVQA 2H76A 4HQZA 4HS1A 2W1SA 5G1LA 4ARYA 3CKHA 2Y6JA 1F6MC 5J5NA 1PMJX 3L0HA 1JZ7A 1B48A 2NDOA 3FY7A 5CRDA 2J1VA 2HSHA 4EL1A 1PKZA 5HR3A 4XS4A 1ML6A 4XUOA 3VDAA 3LEIA 5L71A 2WB9A 3E9JB 1S3AA 4MJBA 2IMKA 5DAKA 5ID2A 4ZL7A 2IFQA 1SHWB 3GIXA 3EC3A 4XURA 2KHPA 3GHAA 1G7EA 1NUKA 4ECCA 4DSSB 1KEBA 5C00A 5JWQB 2OJLA 2C8UA 1T2XA 1R5AA 2XQXA 3HNBM 1PX4A 3EVIA 1WRYA 2KP1A 1L7QA 1E6BA 2VAFA 2LRTA 1US3A 1ZOFA 1W89A 3HZ4A 2JKXA 2H01A 4E8EA 1GP1A 4GTUA 4KX4A 4BWSA 1UMHA 1EZKA 1EGRA 1WJKA 3A5WA 5EJZB 5ECOB 2EIOA 4K0NA 4GWRA 4LL4B 2B7JA 5JWOB 4TTGA 4TVEA 1X0RA 2GSTA 5ECMB 4PURA 4IP6A 3DRNA 1V57A 4K6XA 2VZ3A 4MA9A 1FVKA 1GSEA 2QC7A 2RLIA 4OYUA 5LNKe 1VF2A 3CRUA 1GU3A 2HT9A 3MO4A 5B4NA 5DAKB 1YKAA 2VM1A 5HR0A 5JXHA 4I2UA 3UNPA 3H79A 4QB2A 2HXKA 4BPYA 4D73A 3HEIA 1ST9A 4MMMA 3WGXA 1FO5A 3D5JA 2VZVA 3CZJA 1K42A 4OCEA 2W9XA 2P5QA 1XW5A 1O85A 3D22A 2J1UA 2VLVA 5DVBA 5C71A 2VTFA 1PX6A 2OACA 4V1Ag 1OE8A 2H71A 2GVPA 2VLUA 2IN3A 4EVMA 1NAEA 4IQ1A 3KEBA 3Q18A 2LV3A 4KDYA 4CU7A 3IOSA 3MWHA 5IMCA 3ZIJA 3CSJA 5CRHA 1SJ6A 3D3AA 1OKDA 2OE3A 2ZUPA 1JFUA 2NVLA 2WABA 2VO5A 2LJRA 2YJHA 2BBAA 1M2AA 2GGTA 3IRAA 2R7EB 4WETA 2KUCA 3T09A 1OKTA 4PX1A 1ZCPA 1MDIA 1T00A 5FT3A 2WCIA 3IDVA 3FZ9A 3JXSA 1MD3A 1M0UA 5ECRB 4RI7A 5JCWA 1HNBA 3BOAA 4GSNA 3C7GA 4Z2AA 3P90A 2YWIA 2VZQA 6GSSA 1A0FA 2LKUA 1JU3A 5D8IA 17GSA 2BERA 5IOXA 2DCJA 3HHVA 5CRWA 4EF0A 4MZBA 4WEYA 3GSTA 5HFKA 3QDNA 3NQHA 4MABA 1NSWA 3OGVA 2VZSA 4M4RA 1ABAA 1F2EA 1TRSA 3EU3A 1OF4A 2FUG2 1E2YA 1F9MA 5D9XA 1I5PA 3TRPA 3EMXA 4OWYA 2WYSA 5IIZA 4UAPA 3QAGA 2IFQB 3DWVA 5CNWA 2IMEA 4FYCA 4NV2A 2FCHA 3C1SA 3A21A 2Z4FA 1YF0A 1UXZA 2VM9A 4CUAA 1W9SA 3RPNA 3IAM2 1RQMA 4K7NA 1SL2B 2FWFA 1GMMA 2H30A 1Z6NA 2RV9A 4ARXA 5D9WA 3GFKA 1PL2A 1PX7A 1FAAA 4N30A 3Q19A 2P0GA 1FB0A 4HZ4A 2WBKA 4QPWA 2H1DA 3UOMA 4IJ3A 2H19A 1XC6A 1TXXA 3MNGA 4MLYA 1O6JA 5LCWL 3UIWA 1K45A 4MP4A 5GSSA 1M9BA 4LKSA 1TTZA 3P8WA 4MF5A 2H0GA 2TIRA 4JEDA 4FYUA 2M72A 2JSYA 4IS0A 3GYKA 2LQQA 3ZMKA 1K0MA 1BEDA 3TJJA 3WF0A 1YJ6A 3P2AA 5DDLA 3CXGA 1TDIA 4WR4A 2YP6A 3LPGA 2YV9A 4ISDA 4KB3A 1JZOA 3SKJE 3GXUA 1TP9A 3FKFA 2PN8A 1XW9A 2LJAA 2C4XA 1JHBA 2A2RA 3ERFA 4OO4A 3L4NA 4RQXA 3BCIA 1WWJA 2XPDA 3ZLPA 6GSTA 2C3TA 3HOBA 2DDUA 4RI6A 3F6DA 4DVCA 4KNDA 1BQ7A 1F37A 1XNAA 1FHEA 5ABRA 3EWLA 5GAPD 3OGRA 1A23A 3SWLA 1PGTA 3PINA 4CU9A 3LG6A 4F2IA 2IJYA 2X8CA 4X1UA 4GLTA 3UMAA 4BWQA 1QQ2A 4XIHA 4Q5RA 1QMVA 2B3SA 1GSYA 1O8WA 4TR1A 1SK0A 2ES7A 2YZUA 4KSOA 2FGXA 1JHJA 2YPMA 3RHBA 3SKVA 2IPAA 3VWVA 2ON5A 4XUPA 1GQPA 2DCKA 2GZZA 1IQDC 2DMMA 2CX4A 1K3IA 2QQMA 1GUIA 2ORXA 2DMLA 1PKWA 3UARA 2IWTA 2H1GA 4W8JA 22GSA 3F3RA 1J08A 2EC4A 3GKMA 1PMHX 5CYYA 5F06A 2EICA 1HNAA 1W4VA 5G04L 4XTSA 5ECIB 2F3MA 3ZVJA 3FEUA 2L4QA 2PERA 4QX1A 4J2FA 5ECHB 5IMAA 4DSQA 2VZPA 2MMAA 1A2MA 2KD7A 1THOA 2J9HA 1UY0A 3A2WA 2VL3A 5DPNA 1OE7A 3OR5A 3LGCA 3EYTA 3DYPA 1YZXA 3ABZA 2HYXA 2X09A 1WKYA 4PT6A 2WULA 2LSTA 1JZ2A 2C0EA 3RHCA 4HUAA 3GTUB 1W0NA 1G7OA 2WJUA 3UBKA 3W8SA 3F9UA 2L5OA 5GAND 3WNKA 2RUEA 3HXSA 2L9LA 1JZ3A 2BGOA 2WDBA 2J23A 4ML1A 2VM2A 3PH9A 1SJZA 3ME7A 1P8JA 1ERWA 1XBSA 3OG2A 1NM3A 3V1WA 1CZTA 3GKKA 1UX7A 5IFPA 3FR9A 2L57A 5FUIA 1MD4A 1B4PA 1CZVA 4OMDA 3VI7A 1BYEA 3DGQA 5ECLB 4DSSA 2GZPA 2HE3A 1N2AA 1UVZA 4MPGA 2O85A 4ZXGA 5LD0A 2X64A 1BAYA 4IQAA 1XPWA 5B6MA 3AY8A 3KH9A 4WKWA 5HPOA 3A2VA 3LEFA 1EEJA 3O76A 4DEQA 1GOHA 3M3MA 2B4KA 1EUTA 1XWCA 1JZ6A 3IE3A 3HNYM 1GRXA 3G9BA 3J7HA 1DSBA 3F0IA 2Y6LA 2ON7A 2VCTA 3EINA 2W47A 5KN0A 3IK7A 1A2JA 1L7RA 4ZB6A 3L78A 3FZ4A 3CTGA 3KP8A 1CZSA 4MZWA 3CDZB 4PF1A 1YQ1A 4POKA 4AJ7A 5D9VA 3FK8A 11GSA 4IUGA 5DALA 3P7XA 2XHNA 1M2DA 3M8NA 5H5SA 3FZ5A 4TR1B 1OD3A 3J7Yb 5J1XA 1ULOA 1AQWA 1ZL9A 3HKRA 3CTFA 1B9YC 3VWXA 4LHSA 2BMXA 2ZXQA 3PGTA 4JBBA 3H8QA 3LJRA 2G0FA 3HN3A 4GWIA 5G05L 3I2HA 5DQYA 1WP0A 1ILOA 3NRUA 5EVOA 3MV01 3KP9A 3L9SA 4G10A 4WR5A 1W99A 4PQQA 1QGVA 4JZQA 4ZY9A 3DECA 4K9ZA 4TXOA 4IJIA 5DJLA 3GRXA 5KN2A 2VCCA 1H75A 4Z7XA 5JCUA 3HYPA 2VCBA 5F05A 3DMLA 1R64A 4POMA 5CAXA 3QCPA 5FWGA 2GT6A 1Z6MA 4MK3A 2E31A 4GF0A 1FVJA 1GSSA 4RYDA 3TB2A 3RAZA 2HRNA 5A1AA 3VPTA 2C26A 4A3ZA 1XZOA 2DJ0A 3FN9A 1AUCA 2WO2A 3QFBC 3QR6A 4PUAA 4Q5QA 1US2A 3EYPA 3KTBA 4M4PA 1U3AA 2WN3A 4JRRA 2CX3A 1Q98A 4EDYA 4A45A 3MUY1 4FI9A 3UETA 5D73A 3TJGA 3F4TA 2C0GA 4P08A 3DIEA 4DUXA 3KMNA 1YDKA 2X8HA 3DYMA 4W4ZA 4PGTA 2VCVA 1GWCA 1O59A 1F4AA 1NX9A 1THXA 3I69A 4MGQA 2W91A 2W1WA 2X99A 3BJ5A 1K3OA 2GDRA 2QQOA 2I1UA 1CIYA 2LTKA 1WCQA 3VDBA 3DVXA 3FL7A 2E0QA 2OBKA 3GURA 5EPFA 2WAAA 4P02B 1UWWA 4CVUA 1OC8A 3J7Yk 1Z7PA 3CMIA 3A23A 1JI6A 3I2JA 1JZDA 3T2OA 5EJ1B 2VCWA 4KMQA 4IELA 3KMOA 4IBPA 2FWHA 1WIKA 5DQ0A 4H86A 3EURA 1EV9A 1K3YA 2W46A 1MPXA 4K8MA 4XS4B 2TRXA 2HLSA 1YY7A 2GZYA 4OUEA 3F3QA 5ELGA 2X05A 3VURA 1JLWA 4FIWA 1X5CA 2H75A 5EY6A 5HFGA 1O81A 3IC4A 4LLRA 2HZEB 2B7KA 2JL4A 4ZL9A 3LYKA 2B5XA 1U88A 3CIHA 4XHMA 1QFNA 1Y6EA 1BX9A 4DXRA 3LFLA 1V98A 4L8EA 3VFIA 2R5GA 4TXWA 4HJMA 4OMVA 2PUKC 1LU4A 3C8XA 2HZFA 4GCIA 2XBIA 3US3A 3TKSA 5E59A 3TKPA 1UZ0A 1LNSA 2FNOA 3H93A 2V2GA 2CVDA 5C7GA 3VPQA 4KWUA 3QOUA 3T0DA 1DYOA 2Z9SA 4BVXA 2HZEA 4OD7A 4XUQA 3QD9A 4KUNA 5HFIA 2HSYA 4PQHA 4Q5FA 2VCAA 2EIDA 1XWBA 3IA1A 3O6TA 5JUVA 4HJ2A 1DLCA 3WF3A 2GS3A 2BGPA 1RW1A 5ENUA 1GNWA 2IIYA 1V2AA 4P5YA 2YC4A 3C71A 1UY2A 3VD3A 3WQBA 5CP1A 4A6OA 3E1F1 3Q74A 2Y6KA 3KM6A 2NPBA 1OC9A 3TOUA 1BHGA 3KCMA 3M9JA 2W87A 2VC9A 4PNFA 4XS1A 4AJ6A 2Y6GA 3FHQA 2WS2A 2W5FA 1URMA 1K0BA 4GWJA 2DJJA 5J9CA 3TRXA 3F63A 2WO1A 4HI7A 3GDBA 2C1YA 1TK5B 4POBA 4ET7A 1IYIA 2CQ9A 3K8NA 1JYNA 1LJRA 1KTEA 3RBTA 4OFMA 2G2QA 3SBCA 1U3IA 2AV4A 5A4WA 2O87A 2PMTA 4ZILA 4GXZA 1W8NA 1HQOA 5HQPA 1X9WB 1K3LA 2I3YA 2DJ3A 2M80A 3K4ZA 2WAOA 4ZL8A 4TN8A 4K1FA 1SKSB 2W1UA 3I43A 2VMCA 3LXTA 2PBJA 2VD1A 3GH6A 3TKSE 4K2DA 4UI9L 3NJXA 2I4AA 3T2QA 3BD2A 1GL8A 3LEGA 3KGKA 4KAEA 2H1BA 5JR2A 2FA4A 2VOTA 2IMDA 3KXOA 4FH8A 5IYYA 4J56E 1SKRB 2LQOA 2R4VA 3HVXA 5G5EA 2ZEYA 3GUSA 2JU5A 1G6YA 1XXUA 3GL5A 3TJKA 5ECSA 5JXJA 2JACA 3HY2A 3DVWA 1UYYA 2LJKA 1AQXA 2AHEA 4TR3A 4XZUG 5FHIA 4NV5A 4A41A 2XPEA 5F07A 2W94A 4XS6A 3DD3A 4BVYA 1M7TA 5JCGA 2I9HA 5AN1A 3CSHA 2B6MA 2N5BA 4HQSA 3T0AA 6GSVA 5DCHA 1VGLA 2HRFA 4DEJA 2VQTA 2K8SA 4NHZA 5HR2A 1N8JA 1XVQA 3HJRA 2AAWA 3HZ8A 4KA0A 4KI5M 5DQSA 3GL3A 4N0VA 4AF2A 2GLRA 2CAQA 5DBQA 2LEGA 1UY1A 4BDVB 3UAPA 3ETPA 2FD3A 2GSQA 2ZEWA 1PA3A 2VJXA 2I81A 2W3JA 1OC3A 2LS5A 2WFCA 3HJPA 1KEXA 3DXBA 2ZEZA 2MYGA 2LS6A 1Z9HA 2FWGA 2B1KA 13GSA 4I6XA 4EUYA 2WO3A 3SEPA 2RIIA 2L6CA 1U87A 4QX0A 4IW9A 2CA8A 5HXMA 1JZRA 4XRDA 4NXIA 1OF3A 4OO5A 4LQRA 3F8UA 4BJ0A 2QQNA 2J1EA 2DBCA 4JX0A 3KIJA 5COHA 2VZTA 4QL7A 4BA7A 3D6IA 4OCFA 1VF4A 12GSA 1BJXA 2JZRA 1K0NA 1Z5YE 1O7UA 2F8FA 5INYA 5AGYA 1YEXA 2MBSA 2F51A 1DP0A 1WPIA 1EP8A 3D4MA 3I2FA 5KEJA 3GM8A 3A3TA 2EIEA 4MH3A 4O5RA 2JADA 1JLVA 4DUVA 4AAXA 1W9WA 1K12A 3NOFA 2YWMA 4ILFA 2H6XA 1R26A 2MBTA 3OEBA 4TR0A 4ACSA 2X10A 2LNTA 2IL3A 1T4ZA 2LW8A 3H4KA 2XC2A 5IM9A 2XOMA 2C3NA 4BK5A 3TUEA 4G9HA 4EKZA 2J1TA 3N9JA 3IK9A 1GUMA 4DXTA 2PGTA 1A0RP 3WSOA 4PXOA 4QB6A 4ZB9A 3MV11 1GSFA 3JCML 3U6VA 2L4CA 3I3BA 8GSSA 1TU8A 4D0QA 3F2ZA 1SYRA 1X5DA 3E3EA 4MDCA 3CMGA 3OGSA 2J1SA 3HVSA 2J1RA 3UBLA 1JZ8A 3APQA 2MMOA 19GSA 1DE1A 2C9KA 3O3TA 1ACVA 1ON4A 1FG4A 4ECJA 3GGLA 1UXXX 3OBAA 3IBHA 4HOJA 3WGDA 5J4UA 2LRCA 4A42A 5ECPB 3E0UA 4CUCA 4MJEA 2VZOA 3ACFA 5DMYA 1EEMA 2VD0A 1GH2A 3EB7A 2H74A 3H1NA 1WE0A 5DCGA 1EP7A 2NBSA 2GTUA 1IYHA 5B7CA 1GUHA 1T3BA 3IIIA 3DKSA 2W92A 3VD5A 1O8XA 4V1Ap 2W95A 3APSA 2OKXA 3VD4A 4AJ8A 2R37A 2ZNMA 5IQYA 2YN1A 1SYXA 4FO5A 1A24A 2EIBA 1HD2A 2K18A 5JXGA 3IXRA 4N0ZA 1CQHA 3ISOA 4I2TA 1WMJA 4LL1B 3GX0A 3CQOA 4E8CA 2QQKA 1DBYA 3WT1A 2AJQB 2YWOA 1R5PA 2P31A 2DC5A 3A22A 2HFDA 1X9SB 1SENA 2DLXA 2KP2A 2CVBA 2VMDA 4WBJA 4NPBA 3HD5A 4YAPA 1Y25A 2V32A 3WF4A 2VCQA 2WRTA 10GSA 3LE0A 1WOUA 1V9WA 2H8LA 2WUHA 3QMXA 5IMVA 3WNOA 1SKWB 1XWGA 2Y6HA 2PPTA 2QGVA 3L9UA 1FW1A 1TU7A 20GSA 2CT6A 2VCZA 3C7HA 1K0DA 3ZYWA 4RN5A 5LA1A 1PRXA 3ZFLA 3WT2A 4O7HA 2TRCP 4X0XA 3LXZA 4MH2A 3D4TA 1JYXA 3UESA 3TKRA 2M46A 2CV4A 1V40A 3P1IA 3CRTA 1EGOA 3KD0A 3I2GA 3KH7A 2PU9C 3LQCA 5IFTA 1GOGA 2WZ9A 2DIZA 1GSDA 4QQ7A 3I6AA 3UL3A 4JHZA 1Q4JA 3WD6A 3LPFA 1AIUA 1TI1A 3ZL5A 1S3CA 1XOBA 2V1MA 3IPZA 3TOTA 3ZZXA 1B4QA 3TCOA 3GNJA 4RQRA 1VF3A 4IKHA 2RVAA 2CVKA 14GSA 5I0DA 4ZBDA 1XIYA 1XPVA 3DYRA 3FRCA 3K4DA 1SK1A 2C0FA 4G19A 2MMZA 1O8PA 1PX3A 1S3DA 3TJFA 2L5LA 5IMFA 3OEAA 4CU6A 1O8SA 2VIMA 2BZDA 3ZRDA 4NWYA 3ZFBA 1OC9B 3MUZ1 9GSSA 3WYWA 4BXSV 2OA7A 3MBWA 2H70A 1TW9A 4KDUA 5GSTA 2PWJA 2EIQA 1USBA 4F0CA 4MOAA 2VOCA 1XW6A 1GOFA 5HR1A 4PUFC 4WF4A 1K0OA 3W8JA 4QB1A 3SEEA 2B5EA 2VMFA 2K6VA 3GTUA 4XRAA 3HPNA 5B4XA 1Z7RA 2R2JA 3EU4A 4MPFA 5A4UA 2YV7A 3RPPA 2DJKA 2MMNA 1O73A 2WN2A 1OVNA 1OAZA 5IOWA 2E7PA 1I9DA 1ERUA 3ZITA 1TRUA 2ZEXA 1UY3A 1R4WA 3ACGA 5DALB 3M9KA 4QDRA 1M9AA 4ID0A 7GSSA 1SD8A 2A2SA 3C7EA 1XWAA 3ZREA 1UYZA 3GH9A 3FR3A 1FOVA 3I2KA 3FYGA 1EUUA 2B5YA 5ID2B 2W1QA 4A4AA 5KN3A 3I3DA 5DJMA 2HI7A 3NIVA 3K75B 2XONA 4F9ZA 1TK8B 1TG7A 2B9VA 4AG4A 2H6ZA 2VQUA 1GLQA 2OKAA 1AQVA 4QDSA 5G31A 4KDXA 5H5QA 3CYNA 3WNMA 1A8LA 3CBUA 2L6DA 3TRQA 5CZKA 3LQ7A 2J1AA 3GX8A 1UC7A 1SL0B 3APOA 2Y8KA 1QXHA 1X5EA 2XHFA 1KNGA 3C7OA 2B1LA 4HZ2A 3I2IA 4JKKA 1HYUA 4LMVA 2YC2A 1VRSD 4F82A 3IB3A 4ZZ8A 1T4YA 4A44A 1MTCA 5IPGA 2HNLA 4OMCA 4I97A 2GSRA 1QUWA 3D0ZA 4ZB8A 3K4AA 1Z3EA 2OBIA 5GZZB 2KLXA 2VL9A 4J57E 4DSRA 3LWAA 4XVHA 1M2BA 2QQJA 2AUVA 2VZ1A 4XCSA 2E2MA 2H0IA 5G1KA 4O32A 3UVHA 4MGSA 3U37A 4WBRD 5EL8A 2YNXA 1RYYA 4HG6B 3PUHA 4GSTA 5B8BA 1CX1A 4IP1A 3KTLA 3UVTA 1J9BA 3TDGA 1U6TA 3RDWA 3PR8A 4JE1A 2V72A 1PMTA 4TKYA 4UOJA 4YQUA 2O7KA 2PQSA 2QSIA 3VLNA 3C1RA 5C70A 2LUSA 4L5LA 1T8EB 2CZ2A 3ED3A 3C7FA 1X9MB 1YF1A 3ZMLA 1B8XA 1W9TA 1G6WA 3T0BA 1YKCA 2DIYA 3IAQA 3LYPA 5CREA 2OE0A 5AIXA 2WQ8A 5J9BA 4GRFA 4TR4A 2H72A 5CRGA 4HU7A 1M99A 1TRVA 3IR4A 4POLA 4EE0A 5JXIA 2RM5A 3T2PA 1T7PB 2JZTA 1JU4A 2GQMA 1FB6A 1DUGA 1UA5A 4EXJA 3HA9A 4CU8A 2ZCTA 2VCXA 3MSZA 2CDPA 3CZUA 4YPJA 4TRXA 5IMZA 2QBXA 4JR6A 4IVFA 2CAIA 1J83A 3A7QA 1EV4A 5LA0A 1PN9A 3G7JA 2BTOT 3KZQA 4N10A 3GMFA 3TKSC 4F03A 1TI3A 3F4RA 3W5MA 2Y64A 2FLSA 2F9SA 4XUTA 2VZUA 1ULPA 1GTUA 4LMWA 3LORA 4JR4A 4PQ1A 2C80A 4JKLA 1K0CA 5LCZA 5DN2A 4ZIJA 4YAVA 1RK4A 4NHWA 2H1AA 3HDCA 1ZGNA 4MJCA 5IHRA 2N5AA 3LSZA
chains in the Genus database with same CATH superfamily
4CXYA 5F5AA 3LCPA 5CKQA 1BXHA 4PQIA 1SK2A 3PUAA 3IKWA 3EPTA 3KJYA 2I2SA 3ELNA 2WGRA 1MZ6A 1EV12 5LBEA 1OC1A 4L0UA 1A2LA 1SPPB 3LIHA 3VWUA 4ML6A 4AQTA 3ZFEA 3VHNA 4L92A 5FZKA 3N7MA 3ERGA 4DXSA 1OQ1A 3ES1A 4IEZA 4XBQA 5A33B 4B29A 5T3NA 3TJBA 1RHI2 2F6BA 2QUOA 5FYUA 2WS92 3EE2A 1JN2P 4UW3A 4TXVA 5CO3A 4DEVA 4LKFA 1JH5A 3T08A 1AR82 4MXWB 4YQVA 4Y5SA 1GKBA 3WF1A 1DHKB 4OFNA 1MACA 1J3RA 3QAVA 4P9YA 1W2OA 4URTA 3L2YA 3GN3A 1GLPA 4N11A 3LZZA 3S5AA 1LAJA 5IMDA 2G9ZA 1COV2 3BTAA 2CGPA 4GSSA 3S6PA 3I59A 4XFFA 3FZAA 2QKEA 2YCDA 2ORZA 3ZYBA 5FBJA 2VL2C 4IHUA 4MADA 5JZGB 2VL2A 2WZEA 1QJY3 3W5NA 2ZTNA 4MYEA 1RUI3 3WNPA 4P9LA 5HCBA 2R062 1SFPA 4RUVA 1JYWA 3ILFA 4ISQA 1UN2A 2DJ1A 1C8M1 1TJDA 4ASLA 3MDKA 3IV4A 3ZSMA 3VZJA 1WW5A 4TOPA 4OZOA 4CDOA 1LHVA 1V6JA 2CGOA 2JB8A 3M1HA 4G4FA 4XDPA 3U78A 1H2NA 1C72A 4AWDA 2XJRA 5FIXA 2Y6FA 4GD4A 4ICYA 4QDQA 4LA1A 2D44A 4TXOB 2IVJA 3THDA 1BBT2 3EMPA 3PUQA 3GA4A 1C3HA 2EA7A 1FOD3 4G2EA 4MCUA 5FYVA 6GSYA 2ZPXA 5BV6A 5L7OC 4GXLA 4F0BA 1HRI2 2DVAA 3VBHB 2JSZA 2XJTA 1PSQA 3RZMA 3S0MA 5FXZA 2WZR2 2CWMA 3VI5A 2R6KA 3BOWA 2RJ2A 3J7NA 3HT1A 1Q8PA 1XXNA 4K0GA 3KV9A 1T1VA 4W50A 1XG8A 1KGYA 5JPMB 1SU9A 4Z92B 2D5HA 4Q4W1 1EOHA 4S2HA 3DXUA 1TQ5A 5F7UA 4HZFA 1VBE1 4KU7A 1WLCA 3W6GA 1UMIA 3SC7X 2A5ZA 4L0WA 2JG9B 4FTBA 4KCEA 4AFDA 2FCUA 2VQAA 1ZYQB 5D96A 1XOAA 1VBA3 4SBVA 5FOJB 2EIRA 2AYTA 3BGAA 5AIVA 1JZ5A 5K9YA 3VBRA 1G86A 4YYOA 1REFA 4XXAA 4PI2A 2RS32 5FK7A 2QQPA 5I8SA 4V2MA 4TLGA 4JGYB 3U5RE 6GSUA 3U14A 3HQUA 3CQFA 3K46A 2F8AA 3HJOA 1JYCA 5HV4A 2IUWA 4QX2A 3AVRA 3DYOA 2DJ2A 2OQ7A 3G7IA 2FDGA 1CQGA 1OUSA 3M1GA 2VR4A 3SQOA 3KZ4C 3E6CC 2XBO3 2JZSA 4CP1A 4K6BA 3QPMA 2R043 3ZDVA 1IQAA 2R073 1RUF3 1GYKA 4LR4A 1R091 3FW2A 4IEYA 3Q9OA 4RHV3 4KGIA 4Q4X2 4Q2FA 1GUKA 4LBQA 3FBYA 1EOGA 4B4QA 1HIXA 1LECA 3VN4A 4COUA 1PZ9A 2PVQA 3HWJA 3WG3A 1FAYA 3CKHA 1ZZ7A 5FPXA 3M3QA 3O1MA 5CRDA 1DGRA 2DF7A 1PKZA 4H7MA 3O0VA 4FOQA 1ML6A 3MF6A 3KCXA 2XKPA 5ID2A 1IS5A 4JZRA 1AL21 3NV4A 3IDCB 1G7EA 4ECCA 2WSVA 1C1FA 2R32A 1KEBA 3HN1A 5C00A 1R5AA 1RUH2 2XQXA 3EVIA 1H9PA 2IFRA 4EE2A 2O14A 4BOWA 5JDBA 2JKXA 1O4TA 4CXXA 4PLMA 1CN1A 1UMHA 5ECOB 2EIOA 2B7JA 4TTGA 4TVEA 1X0RA 1V6KA 3ZPOA 5ECMB 4PURA 3DRNA 1GZ9A 2XBO1 4BE3A 1V57A 5C33A 4MLOA 1W8HA 4XW3A 3PNAA 3CRUA 1GU3A 5DAKB 1YKAA 5HR0A 1ND2A 1RUH1 3ZXAC 5C9AA 5FZ8A 1K42A 2W9XA 1CAUA 2P5QA 1XW5A 1O85A 3D22A 4L9BA 4LBKA 2VTFA 1PX6A 2Q30A 1O91A 1OE8A 2GVPA 1MEC1 1XQNA 5E6HA 1RITA 3M3OA 1RIRA 3NNJA 3NW4A 1S2EA 3UJOA 1JFUA 2WABA 2YJHA 3PMEA 3ZFEC 5DAQA 4GB33 4L11A 2XKOA 3VBOA 5FT3A 2WCIA 3IDVA 2Y33A 1ZBA1 3B00A 1MD3A 4A3XA 5DABA 5JAXA 5JCWA 1AYN2 3C7GA 2YWIA 1A0FA 5CB7A 4DXZA 4P9GA 5IOXA 5LRSA 2DCJA 3HHVA 1DCSA 1AX1A 4D69A 3POBA 5HFKA 1ABAA 1F2EA 3EU3A 1OF4A 2FUG2 1LESA 1E2YA 5FZBA 1R082 3EMXA 5FZ4A 4GB31 3QAGA 3I49A 4FYCA 1S2BA 2RS12 3A21A 2QKDA 2Z4FA 2WA3A 3URFA 1V70A 3LOIA 3IAM2 1RQMA 4K7NA 2PHWA 1UIKA 1GMMA 3Q8AA 3MIHA 3GFKA 4N30A 1FAAA 3NO8A 1L7LA 4RGKA 3MGUA 1AXKA 1TME3 4K7JA 4WM7A 2P0GA 3I4IA 1E5HA 1EPWA 2WBKA 2H1DA 4PLOA 2HWE3 4E4HA 1XC6A 2BOJA 2HBUA 1CR7A 3MNGA 1O6JA 1ASJ3 5JOWA 4MP4A 3JBG3 1M9BA 4MF5A 1NCQA 4JEDA 1Z7S3 3VL8A 2JSYA 5T5PA 4IS0A 1U12A 3ZN5A 4Z2RA 3J4UH 4IL7A 1ZVFA 1LRHA 1RUG2 2RDRA 1Z78A 4UF0B 2HEVF 4XF9A 1TDIA 4WR4A 4BQYA 1JZOA 1VBC1 1EYBA 4OQ8A 3GXUA 3AP5A 4AEMA 1TP9A 4WZFA 4NIDA 2LJAA 2C4XA 3ERFA 3L4NA 5I0RA 1VMJA 4RQXA 3BCIA 2Z69A 2WFF2 3ZLPA 6GSTA 3HOBA 5ERLA 1HJGA 1F37A 1XNAA 1FHEA 1C1LA 1LENA 5ABRA 3D0SA 2HYKA 3U4XA 4LIUA 5GAPD 1WLWA 3AZZA 1JTZX 2O1QA 3PINA 1BVVA 2X8CA 3FBMA 1JOPA 4TR1A 4XETA 5FYTA 2ES7A 4KSOA 4LUKA 2VE1A 3AM2A 4B4PA 4XUPA 1GQPA 1Y43B 1IQDC 2P2KA 2DCTA 2QQMA 1GUIA 2D3PA 3WW3A 2Q5TA 4W8JA 2P37A 3AL5A 2EC4A 1GANA 3GKMA 1W8UA 4YKGA 1Y4WA 1J58A 2YYOA 4LO6B 5SV5A 4IE5A 3LWCA 1VMFA 3HR9A 3AMHA 4J2FA 1GZWA 3TN92 4QX1A 5KHHA 3UKNA 5ECHB 4DSQA 5FMCA 2MMAA 3I54A 2KD7A 1RUF1 4LBLA 1OE7A 1YZXA 4UFIA 3ABZA 2HYXA 3ZFFC 2X09A 2ZHLA 1ENXA 1RUJ3 2VPVA 5D1IA 2WULA 3ZOIA 2LSTA 1JZ2A 1RGSA 3GTUB 3WQ7A 1W0NA 1CAWB 4XXPA 4XF3A 4IEPA 4AZZA 5FY9A 1WGPA 3F9UA 2RUEA 1FMD2 1Y9QA 2ZGKA 1PGL1 2UZ8A 4NPLA 4OMDA 3DGQA 2GZPA 2O85A 2I45A 5IK4A 4ZXGA 1BAYA 2O0OA 1V6OA 2WFPA 2P17A 3O76A 2B4KA 4FFIA 3HNYM 2F4LA 3G9BA 4OI0A 4O9GA 2VCTA 3EINA 2GMPA 1A2JA 5FP8A 3FZ4A 2ZHKA 2IXHA 3FK8A 3P7XA 1M2DA 5H9SA 3FZ5A 5D8AC 1OD3A 1RMU3 4XILA 5J09A 5FZMA 1RC6A 2HWB1 4JBBA 3HN3A 4GWIA 4R9AA 4WM8B 4Q26A 4QQ2A 4CP2A 1PK6A 5EQUA 4PQQA 4JZQA 1AL23 3DECA 3VUOA 1PK6C 4BQ2A 5DJLA 1W2AX 3GRXA 2QFEA 4UW6A 4UT5A 4AFBA 4G0IA 2GN3A 4RGGA 1VRBA 5JCUA 4C91A 3N4MA 2VCBA 5F05A 2BEOA 4YVWA 2GT6A 3RMYA 4FQUA 4RYDA 3H1YA 1ULEA 4A3ZA 4RSUA 2RM22 4E2SA 1OKQA 3QFBC 3QR6A 1HB2A 2GNBA 3IM0A 3KTBA 5T5OA 4XFBA 2WN3A 4TN7A 1Q98A 4EDYA 4A45A 4AVSA 3BIWE 2UYAA 4FI9A 3UETA 5D73A 2JDKA 1SZBA 4KU8A 2C0GA 4P08A 3KCCA 4ZS3A 4O7XA 5FR3A 1F4AA 4MGQA 4DY3A 2MEV1 3B9CA 2XVLA 2LTKA 1W9YA 3VDBA 2OBKA 4FP3A 4P02B 5AC92 1VRH3 1OC8A 3OF1A 1SLAA 3J7Yk 3I2JA 5J7MA 3T2OA 3ZMNA 4IELA 3M4FA 2E6VA 2P6HA 1S0CA 4Q1RA 2RS53 2FWHA 1ND2C 1H8VA 1JOJA 5DQ0A 2A73B 1FPN3 4NIGA 2GNTA 1MPXA 3OUIA 4XS4B 3U75A 2HLSA 2GZYA 3VURA 5T5LA 3LFIA 1X5CA 2DWRA 3IC4A 5ACA3 3LYKA 2QQVA 3W58A 2E7TA 4MV2A 1U88A 1QFNA 4NHXA 4NROA 3JU9A 4LO7A 5DZFA 2PTMA 4HJMA 1R1A2 1KXGA 2WLQA 1LU4A 2HZFA 4GCIA 2OZJA 5EYXA 2XBIA 4BISA 3TKSA 2EALA 3VGIA 5FPVA 4CEYA 1WW6A 4H2AA 5BMUA 5C7GA 3KQRA 3QOUA 3T0DA 5APAA 2Z9SA 1UCXA 2JEMA 2HZEA 4XUQA 5FKBA 3W21A 2JIGA 5J36A 4LTAA 1GWKA 1Q3EA 5LZ6A 4CY8A 1ZRFA 1AXYA 2JDPA 2GS3A 4LOTA 2PHLA 1GNWA 3J7MA 2YC4A 2RR13 3VD3A 3E1F1 1BYHA 2A70A 4PNFA 4XS1A 2IC1A 4DOUA 2WS2A 2W5FA 5J9CA 3TRXA 3VL9A 3F63A 2YPJA 2C1YA 4YZ2A 4ET7A 4OFMA 3V0AA 4QKFA 4IDZA 3FC0A 2PMTA 2QA2A 3FX3A 4MNNA 3FLPA 1ZBE2 4UWDA 1W8NA 1HQOA 1YQ6A 5HQPA 1OVPA 2RS31 1V0AA 3K4ZA 1SKSB 2VMCA 4I01A 1MR5A 2CAVA 2ZZQA 2PBJA 1ALYA 1W28A 4CCJA 4E9KA 4H3WA 1NCQC 2X4AA 1GL8A 3RWNA 4FPCA 4P5HA 4ASMB 1MVEA 4CDQB 1RUH3 1VP6A 3WXPA 1SKRB 3IMNA 3JD71 1FATA 4CCLA 4O61A 5ECSA 4XF4A 2JACA 4FPYA 1HQNA 5JZGC 4B1LA 1ZRRA 3DN7A 3LB9A 1MZFA 3ACLA 2W94A 2K2SA 1M7TA 2RHPA 5AN1A 3ZN6B 3T0AA 5FZ7A 4JRLA 4ZHNA 4NHZA 2BDRA 4UFMA 1N8JA 3DKQA 3UJQA 4N0VA 1W2TA 2CAQA 2HRAA 5DBQA 2LEGA 1OMIA 4M0HA 3VZMA 2GSQA 1L3JA 2WFCA 4DB5A 1OH3A 4IXLA 4QPGB 2LS6A 2D98A 2FWGA 4AK3A 2ES3A 2R0HA 3NV1A 4ONUA 3AP4A 4QQOA 4QX0A 1W8TA 3AYAA 4GQ7A 1JZRA 4LQRA 3F8UA 4IGPA 5AVAA 5L7OA 4OQ9A 2DBCA 4QL7A 3ZYIB 1M3JA 1SBEA 4OLLA 3DXTA 2F8FA 3HMYA 3GZEA 1GZWB 4AQ2A 4H7LA 3ZFFA 1WPIA 2IXJA 5IW0A 3MFAA 3HVDA 1RL3A 3RI8A 3GM8A 2FCTA 3A3TA 1W6QA 1W9WA 4YNIA 2MPFA 1S55A 2X5IB 1R26A 3OEBA 4ACSA 2LNTA 5IM9A 3NVCA 2XOMA 3TUEA 4BK5A 4EKZA 1S0GA 5JLVA 3N9JA 5ACA1 3IK9A 2XJQA 1A0RP 4BQ1A 3ATGA 3ROUA 3AZYA 2DUQA 4IEQA 5LW9A 1H1IA 3H7YA 1X5DA 4XJ8A 3OGSA 1GNZA 1JZ8A 1DE1A 3MZHA 2VNVA 4ECJA 1KDMA 3OBAA 4LNVA 3VBRC 1D4M3 2RS13 4CUCA 4FQ4A 3AX4A 1S0IA 4MJEA 1NOVA 5EHDA 4OHWA 1EEMA 2VTXA 3H1NA 1VBB3 1DGRN 1EP7A 1GUHA 4NRMA 3DEMA 3OD0A 2W95A 5HI0A 1AVBA 2OKXA 1WCDJ 3WW1A 1W3VA 4FO5A 2EIBA 2K18A 4D94A 4GB32 4LL1B 5FXVA 4U36A 1YHFA 4MHRA 4ASKA 3WT1A 4Z2TA 2X53S 3E97A 1IG3A 1N3PA 2XXZA 1C28A 3PJYA 2RR11 4WBJA 1O3TA 4YAPA 3LIGA 1Y25A 3WF4A 1WOUA 2H8LA 4RL7A 2WUHA 1CESA 3ME2A 2AEZA 3VZNA 1G9FA 1XWGA 2Y6HA 3ZSJA 2CT6A 1OQDA 3C7HA 4LLFA 2DFBA 4HN0A 2X29A 4O7HA 3LXZA 3BYWA 4MH2A 3AXEA 4D6RA 2M46A 2CV4A 5TSWA 1KDKA 2A6YA 3LQCA 1BKZA 2WZ9A 2V5YA 3KV6A 1GSDA 1OOPB 4X6QB 3UL3A 4JHZA 2YC0A 3H1WA 3WD6A 3ZL5A 4NHMA 2V1MA 3TCOA 1VF3A 2RVAA 4BPZA 2XLGA 4ZBDA 1PIV3 1XIYA 1XPVA 3DYRA 2A75A 4G19A 1GP5A 2AZ5A 3WDXA 1O8PA 1DLLA 1OURA 4S2GA 1S3DA 2E51A 1Y7BA 4A5PA 1PNFA 4PIZA 1YJKA 3O1OA 2CY6A 2ZKLA 3VDDB 1CAXA 2VMGA 2OA7A 4KDUA 4BLJA 1USBA 4F0CA 4MOAA 4EWAA 4EIPA 4GJZA 1QWRA 2NN8A 2Y0IA 3WHTA 3P3PA 1PK6B 4HLTA 2VMFA 2P3IA 4XRAA 3N7LA 5EV7A 1LOAA 2YV7A 5E1RA 5CFCB 1QXJA 1OLME 3CF6E 3MPPG 1OAZA 5IOWA 3MPBA 4CP9A 4INDA 4WVMA 5C8WA 2E7AA 2ZEXA 4PHZA 5K0UA 3ACGA 5LRRA 4C0HA 1B09A 1ZNPA 1UYZA 3GH9A 4BZ4A 3UV9A 4RQPA 2B5YA 4COYA 1H2MA 1O7FA 1SBDA 4F9ZA 1TG7A 1QJEA 5K4LA 2G9FA 4AVVA 2H6ZA 3SCGA 1AR81 3OCPA 5JCTA 1APNA 2B8MA 4PBPA 4CDQA 3CBUA 4IETA 2BQPA 2Y8KA 1YLLA 4XACA 5FZOB 4WVVA 5LWBA 1X82A 4LJHA 1A3KA 4WZCA 3OBZA 4JKKA 4LMVA 2YC2A 3EO6A 4ZZ8A 1QQP3 4MSVA 4A44A 2ADDA 4OMCA 2GSRA 1QUWA 1Z3EA 4HSLA 2KLXA 3LWAA 4XVHA 1M2BA 1QXRA 3WINE 2AUVA 2VZ1A 2Y60A 5CIRA 5G1KA 5LA9A 4EN0A 1CIWA 5FY4A 4W6WA 3LDKA 4A6SA 4HPKA 3KTLA 3RDWA 2ARXA 5FZDA 3PIGA 4Q0UA 3JD73 1BMV2 1JODA 1FOD1 3WCSA 4YVSA 1Y9GA 2YROA 2QSIA 3C1RA 1IG0A 1MQTB 5C70A 4ATEA 3ED3A 4XDQA 1X9MB 3RZLA 1YF1A 3POYA 2DTYA 4GH4A 2DIYA 3IAQA 3VZLA 5AIXA 1XYPA 4EV0A 4QHBA 1LB2A 5CRGA 4CCDA 3BCWA 5JXIA 1T7PB 2GQMA 3WDWA 4FOWA 3MSZA 1W2NA 5IMZA 2QBXA 1WZXA 1EV4A 5LA0A 5LATA 3KZQA 3MW4A 3GMFA 3F4RA 1VRH2 4HKLA 2F9SA 1F15A 2YPDA 1K5MC 1XJAA 4JR4A 3RS6A 1K5MA 1J1TA 4JKLA 2E9QA 3RZGA 1K0CA 2H6CA 3RI9A 4XJWA 1RK4A 3AMNA 4UW4A 1BLZA 3HBKA 2PMWB 3ZXJA 4XZPA 3V0AB 4AI0A 3QFAC 4YW7A 4FP2A 3CJIC 4OUMA 2YU1A 3LEKA 1RXFA 3OUJA 2V09A 2D6OX 2A3WA 3U07A 4HL0A 1SBFA 1FV2A 1NE6A 3WNNA 4M3CA 2YB7A 4NHKA 3DPRB 3B5LB 1V58A 4AI3A 2F4PA 4COVA 4HDEA 1H4OA 3CNAA 5DUUA 2CL2A 1HB3A 4AHXA 2YBKA 4CDWB 3WW4A 2ARBA 2DU0A 4A7KA 1OYJA 4FVVA 3ILNA 1AC1A 4HEA2 4YH2A 4YM2A 3GBWA 2TUNA 1TRWA 1D0HA 4XQDA 2RR12 2GQKA 4AHWA 2IWGB 2XLAA 5C3QA 1DE2A 5F2SA 4IERA 5DAWA 5H5RA 4JC1A 3EXUA 2PELA 4N7UA 4DUWA 1ERTA 4KBBA 4P00B 2ATFA 3BCKA 3ZIXA 3V64A 5KN1A 2ZS6B 4M00A 2ZGOA 5L73A 2PLV3 3POFA 1ND3C 2VOXA 2BGCA 1ND3A 1XE0A 1HJFA 2D7FA 1QJU3 4QGMA 1MS0A 2GMEA 1H0BA 5EWSA 4NRQA 1A8YA 2H0HA 4ZS2A 1AR83 4NHYA 2XWBB 4NOTA 3ENRA 2UYBA 3NJVA 4EN8B 1EAH1 4WF5A 1MS1A 2XJUA 2ALBA 4QQLA 1BMV1 2ZZJA 3Q8BA 1UYXA 6GSXA 5IT6A 2WDUA 2X5IC 1AR93 3AYCA 1VBE3 1XCCA 2YGLA 2YJ7A 4D7YA 3ZYHA 3ERWA 3I97A 3TN93 5L36A 1J3QA 4FFGA 2FHEA 4ES8A 2XBQA 2XL9A 3WW2A 5J37A 3RFRA 3TRSB 5E8AA 2X8GA 1RUJ2 1BVP1 4P9JA 1BEV1 2P6CA 2V5DA 5LA2A 2ADEA 2UWAA 4MF6A 5AFBA 1OFSA 2ZA9A 3ECQA 2DCZA 5K7PA 1HNCA 3GV1A 4FYBA 3ZMOA 1HXS3 1VAKA 4PTSA 4XABA 4URAA 1TOFA 3O1TA 4LT5A 1YEPA 1OPOA 1FNZA 4LOSA 2JDHA 2RM6A 2PXJA 1SL1B 4MZCA 2BNOA 1OFNA 3MYXA 1F3BA 5FPAA 1GTBA 3O5SA 3PURA 3O12A 4Z1VA 2XVGA 4AW7A 3P6BA 2EXIA 5M0TA 3THCA 2QQLA 1DGWX 1RUC1 5F0GA 2D2ZA 1NKGA 2AC1A 3KB5A 3ZVXA 1OSGA 4GZ9A 2KM2A 3I8TA 2JWPA 3ZR5A 3IAS2 1NW2A 1D2QA 2AUYA 3WDUA 4LMFA 1GNEA 5FOBB 3RPQA 2L59A 5IO2A 4P3YB 1DQ6A 1GQGA 4WVWA 3IAPA 4ECBA 5EIYB 3H7JA 3ME8A 4LIVA 5C9AC 4NE9A 5L7OB 4RQPC 3VWWA 2YWNA 4YQMA 1H6XA 1XWKA 1ZRDA 5HBAA 5C04A 2ZACA 1D4M2 4ATFA 4LPLA 2HWB3 1QOSA 3I3EA 2J42A 4QQHA 3R4DB 5JWRB 4D6QA 4D6SA 3OPTA 3QAWA 1GNYA 3SH5A 5I8TA 3GF6A 4CDWC 4G0LA 2RS11 1RUC3 4JGYC 1S0EA 2O8VB 4CA9A 3AP9A 4W6XA 2UU8A 5G1LA 1HX6A 2Y6JA 3LAGA 3L0HA 1JZ7A 1B48A 4KG0A 3OJBA 3FY7A 4Q5OA 4CY6A 2YHJA 1F31A 1TEIA 3VBFC 2FMYA 2HSHA 1URXA 5LBCA 2VVDA 4I3GA 4NPMA 2WB9A 3E9JB 1KFUL 1S3AA 4MJBA 3ZFEB 5DAKA 1F5JA 3R3EA 1SHWB 3GIXA 2NMNA 3GHAA 2CWSA 5GLTA 4DSSB 4JTOA 2OIIA 4FT8A 2OJLA 1ZBE1 2YU2A 1DQ1A 3HNBM 1PX4A 5FZ0A 4BQ5A 3POWA 1GQHA 5C3RA 2LRTA 1ZOFA 2H01A 4E8EA 1AXZA 2XDVA 2B42B 4BWSA 2ZMKA 4QM9A 3ZX7A 5J96B 2GALA 3A5WA 4LHNA 5C3PA 4K0NA 4GWRA 1WMEA 5JWOB 3OBRA 4CEYB 1XYOA 1GSEA 5F32A 2RLIA 5FYBA 5A80A 2HT9A 2OQ6A 2VM1A 1RVF1 2LUWA 3POSA 3UNPA 3M3EA 3RZJA 3H79A 4QB2A 2GC0A 2BP6A 3D5JA 2HBTA 3BIEA 4OCEA 5IVYA 2OXBA 2QVSB 1NCRC 3ILRA 3T4VA 2R0PA 3N35A 5JZGA 4NIAA 3WUDA 2PLV1 3KT4A 2VLUA 4GA9A 4EVMA 4CEWC 1PGL2 4IQ1A 4JDMA 3PJQA 3EBRA 3GZTB 4KDYA 1O3SA 3IOSA 5IMCA 1R083 1SJ6A 1OKDA 2OE3A 3USUB 2ZUPA 4YZ1A 5CEHA 2B9UA 3WR0A 2BBAA 5HV0A 1LOEA 4BLIA 4WETA 5JPNB 3T09A 1OKTA 4PX1A 1BZWA 1T00A 1G6NA 1VBB1 1OA4A 1X36A 4OHYA 3SXWA 1LU2A 5ECRB 4RI7A 1HNBA 4JV4A 3HBZA 2RM21 4Z2AA 1F8VA 6GSSA 1C5HA 3MYDA 2LKUA 3ZFFB 3JBG1 3J26N 3H3UA 5A33A 2W39A 3E6BA 1PZ8A 4EF0A 1UZVA 4BU2A 1XB9A 3M70A 4MZBA 5H9PA 4WEYA 2WIIB 3GSTA 1V00A 5FZ9A 1WW4A 2R49A 4MABA 3JB8A 1NSWA 3PHMA 3OGVA 1TRSA 2FQPA 2FCHA 1VBA1 4IESA 2YBSA 2H30A 5D9WA 1PL2A 5FFOC 4M0NA 1FB0A 4HZ4A 4RQPB 5CG8A 1LEDA 4QPWA 4B1MA 5GLWA 1SCSA 2AYHA 2H19A 5GLUA 4AEKA 1TXXA 3LFMA 2IXCA 3UIWA 1K45A 5GSSA 2H0GA 3MFCA 3ZSLA 2TIRA 3ZPYA 1LODA 1RUG1 4XJAA 2BU9A 1H1AA 4M01A 4RFT0 3WF0A 4LBJA 5DDLA 3CXGA 2HWD2 2YP6A 4ISDA 3SKJE 3RWKX 1XBFA 4LEJA 2PN8A 3W59A 2D3RA 1XW9A 4QHZA 1JHBA 4OO4A 1OOPA 2X5IA 4Y5Z0 2HWB2 2UWBA 1TMF1 1R092 4IE0A 1XU2A 5LK5A 4DVCA 3VBUA 1HRI3 3WCRA 2WT2A 3VBUC 1W39A 5A7WB 3OGRA 1A23A 4RD7A 2QA1A 2ZGMA 4QM8A 1COV1 4CTEA 4F2IA 2IJYA 4X1UA 1W6MA 3MW3A 3UMAA 4XIHA 2B3SA 1GSYA 4AEDC 3USSA 3AYDA 2JDZA 1RUD2 1JHJA 3SKVA 4TYSA 3S7EA 1N3OA 2IPAA 2OS2A 3VWVA 2ON5A 3PVOA 3MIXA 4Q0QA 2DMMA 2G4IA 1TZOA 2BNNA 4UYBA 2DMLA 1FOD2 1TNFA 1PKWA 3UARA 2CU5A 2IWTA 2H1GA 4BQWA 1J08A 4EWEA 1PVC3 1UKRA 1YFYA 4I0BA 5CYYA 2BW8A 5F06A 2EICA 3O1UA 3N9NA 3POEA 5G04L 3ZVJA 2WYFA 1YXWA 4DRRA 2VZPA 1A2MA 1VBA2 2VL3A 4ZU7A 4AQSA 2LRPA 3PU8A 3BPSA 1WKYA 2JG9C 4PT6A 2JG9A 4HUAA 1G7OA 2B39A 5F2WA 2WJUA 1REDA 3UBKA 4I2OA 5GAND 2BGOA 2WDBA 5FYIA 2J23A 4ML1A 1PO12 3ME7A 1P8JA 1ERWA 3OG2A 3V1WA 5C3OA 1AR61 2L57A 3LDBA 5FUIA 1BYEA 4DSSA 1OA2A 1XOYA 1UVZA 2P3YA 2VVFA 2X64A 4AI8A 4Y24A 4IQAA 3KH9A 1XRUA 4DEQA 4XPVA 3L9JT 1XWCA 4LBMA 1GRXA 2Q8EA 1DSBA 2ON7A 2WL1A 2W47A 5KN0A 3IK7A 1AR62 1U5ZA 3CTGA 3B9IA 4MZWA 3CDZB 3RYPA 1UAIA 5F5IA 3KF5A 4AJ7A 5D9VA 4YGDA 4IUGA 11GSA 3LF7A 4FTEA 4IV1C 2VG9A 1W6NA 3J7Yb 4FPKA 1K5MB 1BQPA 4FFHA 5J1XA 1AR73 2KA3A 2A1XA 4XFGA 1ZL9A 3HKRA 4LHSA 2BMXA 4F7ZA 5FY0A 3LGRA 1ILOA 3MV01 3AMPA 3KP9A 4G10A 2RDQA 1S0JA 3WG4A 4ZY9A 4K9ZA 2QZ2A 4TXOA 4IJIA 3CJIB 1GZCA 3M7AA 1YFUA 2FDKA 1OA3A 2VCCA 4XC9A 2PQQA 3HYPA 3DMLA 4POMA 2WS91 1E5SA 3AB0A 1Z6MA 4MK3A 2E31A 3ZXFA 3CLPA 1AYM2 1FVJA 1YWKA 2HRNA 5A1AA 1XYNA 3VPTA 2BJSA 2EAKA 2C26A 1XZOA 1WA4A 2GSYA 4OI1A 1AUCA 3AP7A 3TOJA 1US2A 1CAVB 2WWUA 1EV13 1U3AA 2C6SA 4J6GA 4XCBA 1IHMA 3AYEA 5A3UA 3DIEA 4DUXA 3BTZA 3KMNA 2ARCA 2VCVA 1GWCA 3NNLA 4AEDB 1NLRA 1SLIA 3GJAA 1RUNA 1K3OA 4XBNA 2GDRA 2QQOA 5FJKA 3MLJA 4WM8C 1LJ7A 4BM8A 4WM8A 5DUWA 3DVXA 2VMHA 2E0QA 1ZZBA 3WDTA 1UWWA 3K3NA 4CVUA 1PVC2 4JGZB 4ISRA 2GNMA 2ZGNA 3A23A 1JI6A 1JZDA 4YVSC 2VXJA 1DG6A 2W2IA 1WIKA 4H86A 3EURA 1K3YA 3VKNA 3D5OA 4K8MA 4KF9A 1YY7A 3F3QA 1CAUB 5ANNA 5ABJA 1RVF3 4CCCA 4ES9A 2HZEB 3CL1A 3U11A 2IVIB 4J25A 1NCRA 3J8F2 1VBE2 3E5XA 1VBD3 1Y6EA 3LFLA 4L8EA 2A6ZA 3T1LA 1B35B 4AVCA 5FYYA 3H3ZA 5CU1A 4OMVA 3C8XA 3B3QE 4QHOA 2R063 5E59A 1XSQA 1UZ0A 1DGLA 1UOGA 1LNSA 1J59A 4XHXA 3QH7A 1G9AA 2CVDA 3I2OA 3VPQA 3RRDA 4KWUA 5FXXA 4JRAA 3OTFA 5A3MA 4BVXA 2DUPA 4OD7A 1RMU1 2IZWA 2NMOA 4KUNA 3BU7A 4CZSA 4GKYA 4PQHA 4Q5FA 2EIDA 3KHCA 3O6TA 5JUVA 4HJ2A 2GN7A 3WF3A 1ZZ8A 3N9OA 3GBGA 2BGPA 1ZA4A 4JQTA 3CJIA 5ACA2 4AXOA 2IIYA 1V2AA 3GYDA 2ZMNA 3C71A 3NL1A 3WQBA 5CP1A 3MHZA 4A6OA 4BVXB 1SLBA 2Y6KA 1QF3A 5FLHA 2IXIA 3RSJA 2NPBA 5HCHA 4LO5B 4QU2A 4AFAA 1K0BA 4GWJA 2DJJA 3V65A 1N47A 1RUC2 5A32A 4POBA 3SBCA 5A4WA 2O87A 4MHUA 2R0FA 3I3MA 1CD3G 4GXZA 3TAYA 1ENSA 1X9WB 3KT1A 2I3YA 3RG0A 4N7IA 1UOFA 4EJRA 1AYN3 2VCMA 3LXTA 2VD1A 3TKSE 1PMIA 3JD72 1FOHA 4K2DA 3NJXA 1W0PA 3BD2A 1C4RA 3LEGA 4M3CB 2H1BA 1WD4A 1EP0A 3I7DA 3OOXA 3IZOA 3PVEA 2R4VA 3CHXA 1CQ9A 5G5EA 4XBLA 1BBT3 1XXUA 2VH9A 3GL5A 4UBGA 2A6VA 2AR6A 4MGKE 3IDEA 1AQXA 2B45X 4TR3A 5FDBA 4HXCA 4XS6A 4JAAA 1M3IA 5JCGA 3AL6A 2I9HA 2UWCA 2N5BA 4FO9A 4HQSA 2GMMA 5F37A 1VGLA 3KCYA 2VQTA 5HR2A 2RJKA 2WZR3 3JZVA 3N7JA 4R4XA 3HZ8A 1C57A 2GLRA 2Q8CA 1UY1A 4NIIA 2DVFA 4QPIB 2FD3A 2XR4A 3M8LA 2VJXA 2W3JA 5FK8A 3MI8A 1EV11 1YIFA 5HCFA 2WSUA 1HV0A 5KHGA 13GSA 4DPNA 4I6XA 2TBVA 2RIIA 1STMA 4Y20A 3HD8B 5HXMA 2WQ4A 1AJOA 1OF3A 1UNBA 2ZAHA 3OPWA 4BJ0A 2QQNA 2I07B 3KIJA 1GWMA 4OCFA 3VB9A 3WP5A 1VF4A 4BVYB 3NJYA 4RHV2 2JZRA 3KD4A 1N1SA 4IE7A 1YEXA 1DP0A 2NLRA 2B46X 5KEJA 1E5RA 2WZR1 4EZ4A 1POV3 3OSDA 3BUCA 1K12A 5JOZA 2ZGLA 2H6XA 4OUSA 3RZZA 2X10A 1T4ZA 2AH2A 4QU1A 4AEJA 1CAXB 3H4KA 2XC2A 4G9HA 4FAGA 2VAUA 4Y33A 2PGTA 4DIQA 3PTYA 3SLIA 4PXOA 4BQ3A 3DL3A 4UXAA 4ZB9A 1GSFA 4AF9A 3POIA 1QGLA 3JCML 3U6VA 4FPHA 8GSSA 2D43A 4D0QA 1TU8A 1DZRA 1SYRA 4AE2A 3CMGA 2VXRA 4FXKB 1U5XA 5B2GB 2XBO2 2Y34A 1Q8SA 2ETEA 2MMOA 3O3TA 1ACVA 3DGTA 1FG4A 3J8F3 3OY8A 5ECPB 3TEWA 2G19A 4FOYA 5DMYA 4LHKA 2JJ6A 2VD0A 4H14A 1GH2A 1CAWA 1FMD3 3PVBB 1QJX1 4IV1A 5B7CA 3IIIA 1W6OA 3VD5A 1O8XA 2XUEA 1UF2C 5K0UC 2ZGSA 4AJ8A 2YN1A 1SYXA 1EY2A 4XDOA 1Y3TA 4N0ZA 4O5QA 3ISOA 4IGQA 5FY1A 1DBYA 2AJQB 2HFDA 1SENA 5IVJA 2KP2A 2CVBA 1LULA 1VRH1 4XHBA 2ZOEB 4NPBA 1NY72 5FCCA 2V32A 5GZEA 4CDQC 2WRTA 3LE0A 1V9WA 5CVRA 1IS3A 3PVNA 5BNNC 3CO2A 3WNOA 4BQ4A 2PPTA 3L9UA 1FW1A 3VDDA 20GSA 3ZYWA 4RN5A 5LA1A 3LA2A 1PRXA 4HOOA 1O6UA 3ZFLA 3MIEA 2TRCP 4CDWA 1JYXA 3TKRA 4L97A 4XFHA 4MGIE 3KD0A 3I2GA 4YZ5A 1S1AA 2ENRA 2NYYA 1CONA 2VNGA 2D40A 4N90A 1Q4JA 1UKGA 3LPFA 3WDYA 1AIUA 1TI1A 3OD4A 2ZJCA 1B4QA 3GNJA 3ZSKA 4W65A 5I0DA 3FRCA 1GR3A 3M3CA 4KG8A 2C0FA 1AYN1 1PX3A 5D21A 4YM1A 4LKDA 2VIMA 2BZDA 5FREA 3ZRDA 4NWYA 4YVSB 2JD4A 5KHIA 3WVJA 5FZLA 2QE3A 1S0FA 3MUZ1 4GH4C 2H70A 1TW9A 4Q4V1 2PHDA 3U1XA 1XW6A 1GOFA 2Y0OA 1K0OA 3W8JA 4YWAA 4QB1A 1HDKA 3SEEA 4QPGA 3KGLA 5B4XA 1Z7RA 2R2JA 1R093 4MPFA 5A4UA 2MMNA 1IZ3A 2WN2A 4Q0PA 1F5FA 3WUCA 1I9DA 2PHXA 2OYZA 5IUQA 2CHHA 4QDRA 1M9AA 1JXNA 4ID0A 4I30A 4HBNA 1FPN1 3I2KA 4CPBD 3FYGA 1EUUA 5FP7A 1G9CA 5ID2B 5A70A 4A4AA 2D6LX 1X9PA 2HI7A 4AG4A 4UFKA 2VQUA 2VW1A 5H5QA 3CYNA 3WNMA 1A8LA 3GX8A 1WCKA 1QXHA 4CEWA 1X5EA 4NO4A 2XHFA 3VV1A 5BY5A 1RUI1 1KNGA 1LGNA 3H8XA 3IWZA 1HYUA 4UFJA 1AR72 4F82A 3IB3A 1T4YA 1YI7A 1MTCA 5IPGA 2HNLA 5CFCC 4ZB8A 3K4AA 1UZZA 2PHRA 2OBIA 4YARA 2EXKA 4J57E 4DSRA 5JI7A 5EPAA 4XCSA 2E2MA 2H0IA 4GAZA 1LCLA 2DTWA 1RYYA 4HG6B 1CX1A 2WFF1 4V2WA 4CP0A 3DPRC 4GJYA 2DUOA 1UYPA 4JHTA 4JE1A 1PO21 3VKLA 1LEMA 3KSCA 1XNCA 2O7KA 3GCXA 2PQSA 3ZN6A 3ZXLA 3VLNA 1ZA7A 2LUSA 2CZ2A 3C7FA 3ZMLA 4XTPA 1W9TA 1G6WA 1QDCA 4IV3B 3AKPA 1V6MA 2OE0A 5CREA 4GMP0 1TRVA 2JECA 3BALA 3ZFGC 1RUE1 4JVAA 1DFQA 1FB6A 3GBFA 4B8EA 1OBNA 1Q43A 4C8DA 3S30A 4CU8A 3HAGA 2CDPA 4D7SA 3DF0A 4JR6A 2RDSA 4IVFA 3V56A 3G7JA 4LORA 1UN1A 4KGQA 4N10A 4BB3A 3DKWA 4XUTA 1ULPA 4XE9A 5F39A 4LMWA 4M3CE 5D2AA 2WNVC 3LORA 2C80A 4YAVA 2RMU1 2A2PA 5FZOA 5C8CB 4MJCA 3N9LA 3UJ1A 4KW6A 1PHMA 4YRDA 1B9XC 3THTA 5FMOL 2KOKA 1SDDB 4CW9A 1W05A 2YUEA 5DZGA 4QKDA 1GFF2 2FY6A 2XJSA 4ZPIA 1PIV1 4BL7A 5B6NA 3FHAA 1VIWB 3BOPA 1H6YA 5I8YA 1GTIA 4CCMA 2HLEA 1ZBA2 1RJ8A 4Y1YA 3VBUB 1SFNA 2OADA 2GSSA 1OT5A 2WT1A 1ZZYA 3FUOA 5IJRA 16GSA 4AGRA 4QXKA 2JE8A 1T6GC 2QQIA 1JYIA 2P1BA 1O3RA 4HU9A 4BIFA 5F5QA 1R081 1J84A 1AX0A 4E8HA 4NAXA 2E2GA 18GSA 4GMP1 1QJZA 5I0UA 3ACIA 3ZYJB 2K8VA 3KM5A 3AMQA 3ZIVA 1NHYA 2EIGA 1A8MA 2BFUL 2YOIA 4COZA 4KH9A 4ZXKA 3I3QA 5A7SA 3NZNA 1GSUA 4B7KA 3VZOA 3FJSA 4K7IA 1ENQA 4N53C 4K40A 4C0BA 2WZPP 4MF7A 4R8HA 5A3PA 1J0FA 3NMBA 3AC0A 4EDZA 6GSWA 2HWC3 4V2LA 5G2ZA 4PCRA 3IPVA 5LBBA 1NCRB 3DEXA 3TKQA 4C1WA 5FUNA 1YQ2A 3L2HA 1RJ7A 2VLTA 4ZZ5A 3VK9A 1XNDA 3GSSA 1TK0B 3WGEA 3C2UA 3HCZA 4GKXA 1W8WA 3WP4A 4EO3A 2Z2SB 4AVAA 1W03A 3A0NA 4ZBAA 1RUF2 2JG8C 2YFZA 3FR6A 2W52A 2VZRA 5ECNB 2O89A 5F1RA 2BUKA 2D6KA 2FA8A 1WD3A 1UX6A 4D8MA 2ID4A 2PHUA 1WUVA 4IEOA 4K2XA 2JD9A 4IQPA 2ZGQA 2C0ZA 4I8BA 1CWPA 2JX9A 1NCQB 3KWVA 4CXWA 4EN9B 4YW2A 5CG9A 1JYVA 2PHFA 1WA6X 2E63A 5G5FA 4NRPA 1HXS2 1F4HA 1HQWA 3F6FA 1AL22 4E2GA 3M3IA 3UKTA 1MS9A 4QKBA 4EZHA 4CE8A 2J22A 1QDOA 5GM0A 1OVSA 4BK4A 5ECQB 2CDOA 4QAWA 5IK8A 3S9FA 2VVEA 3D4KA 5C4WB 2VY0A 5BNNA 4IGJA 1TKDB 4CDUB 5BXXA 2GT5A 5AISA 3SH4A 5J41A 1NLQA 3H8UA 4OHZA 4Z2UA 4Q0SA 1BBT1 4JGYA 1SG3A 4WBBA 2XGXA 3BBYA 4USSA 4X43A 1QQP1 2VTXJ 2LNSA 1OLMA 2R3XA 1MVQA 4Y1UA 5LBFA 2DBNA 3A2XA 3VBFA 5IK5A 5JMOA 3TGZA 5F8BA 3IHQA 5FP3A 3C7MA 4O92A 2GQLA 1UPSA 4EN6B 2WNUC 2LRNA 3TYJA 1LOGA 2WNUA 4Q4W3 3OB8A 2RG4A 2QQUA 2YZ4A 1NZCA 4I0AA 2B5HA 1WW7A 3VDCA 2V4VA 2VL4A 2FDFA 3EQEA 3FHKA 3K48A 4NMIA 1LBKA 3TB0A 4X8PA 1GULA 1PL1A 3CU7A 4I0WB 4N9IA 3R2QA 5FZHA 5A5KA 1AR63 4BL7B 2P5RA 1FI2A 4QPGC 3E6DA 4V2NA 1BG5A 5T54A 3LOBA 2K46A 5IVVA 1XNTA 1MDJA 3CSIA 4EIQA 4D73B 3Q6OA 3MIBA 3MLKA 2EXJA 2BJXA 1ZYPA 4ULXA 1WMDA 4FPGA 1F35A 2PVOC 1W90A 1CAVA 2VO4A 5A4VA 2A4VA 4L0PA 2X49A 1I5GA 2CZ3A 2E26A 4BXFA 4HVRA 3LSDA 4QX3A 2VUPA 1OLRA 1IKQA 5B8AA 3H9AA 2R071 1PNGA 2D5FA 4QXBA 4IN0A 4AHYA 2FDHA 4GQCA 3M2MA 2MZCA 4K7OA 2FD8A 2TEPA 2D6MA 2MEV3 4QQPA 3AKSA 1VF1A 2AB6A 4GQFA 1AXDA 3NKTA 1SLCA 5BRTA 4UF0A 1MEKA 3UEMA 5BNNB 3IDAA 4A2UA 1IPJA 2YGMA 1ZYEA 3VBSB 5CFCA 3M0FA 1VPHA 2XLFA 3F4SA 5DDJ1 2OE1A 2H76A 4HQZA 4HS1A 2W1SA 3HQXA 3N9MA 4OI2A 4ARYA 2ERFA 4Y20B 1F6MC 1PMJX 2P3JA 4K21A 1GICA 4RS5A 1PVXA 3I59B 4RS5C 1PM7A 4XS4A 1GWLA 3LEIA 4B4RA 2OUHA 2IMKA 5T5JA 3QD6A 2YMZA 2IFQA 1QHDA 1NUKA 1NA1A 5JWQB 2C8UA 1T2XA 1NA1C 1WRYA 3JCIA 1US3A 4MUVA 4YW4A 1W89A 4NWVA 4NR1A 3ZFGA 3G6JB 1GP1A 4AVTA 5K8SA 4KX4A 3WV6A 3VKOA 1X8MA 1KRIA 5EJZB 1NE4A 4LL4B 4K1ZA 2P5BA 4RA0A 4MG2A 3KQ4B 1G9BA 1NXD1 5CAZA 5JR7B 2GSTA 3FLRA 4IP6A 3PTRB 1RUE2 3KVBA 2DKIA 1FVKA 1VBC3 4JCKA 1VF2A 1FV3A 1ZYBA 2NZ9A 3MO4A 5B4NA 2Q0AA 3N9PA 4I2UA 4BQXA 3NWKA 4BPYA 2KXLA 3WGXA 1FO5A 3NAPB 4B7EA 3CJXA 1HXS1 3CZJA 3OY8B 4NIHA 2OPWA 4RR3B 4CRQA 5KXBA 2HRKA 5KR7A 1W06A 4ZKTB 5FWEA 2J1UA 2VLVA 3NV3A 1OOPC 3D0JA 4Q4Y1 1SPPA 2H71A 3AFKA 2IN3A 3SISA 1NAEA 5GLVA 3KEBA 5DZEA 2LV3A 3RYRA 3WZ1A 4CPBA 4CU7A 4J1WA 1CJPA 3ZIJA 3CSJA 2R30A 1UU6A 4DINB 2NVLA 2ZX0A 5KWRA 2D3SA 5GLZA 2GGTA 3S7IA 1ODMA 5C6CA 4AEDA 1ZCPA 2BPA2 4GWMA 3FZ9A 3GCWA 3WD5A 1M0UA 3VZKA 5IVFA 4YFWA 4GSNA 5F6LB 3MLLA 2VZQA 2Q8OA 5D8IA 3USUA 4BMEA 1YUDA 4LBQD 17GSA 1O4YA 2BERA 4N53A 4CDXB 4D7TA 4Q4W2 3RDIA 2PN5A 2VOVA 2EF6A 3RGBA 3QDNA 3NQHA 5FP4A 4KGGA 1SMVA 2VZSA 1KITA 3KT7A 3ZIWA 1DQ4A 1F9MA 5D9XA 3WT3A 1I5PA 3TRPA 2WYSA 3DWVA 5CNWA 4FPJA 2H6BA 2NM1A 4WM7B 4NV2A 3C1SA 4ITCA 1UXZA 4QPYA 4CUAA 1W9SA 5CA6A 1SL2B 2FWFA 3KS7A 1Z6NA 2RV9A 3QCWA 4FQZA 5LASA 4R9CA 2JG8A 1QH6A 5KHKA 4MGTA 1AHSA 1VE0A 2ZHMA 3OYWA 3VBSA 4QGLA 1BCXA 2VECA 4QKNA 1PIV2 5LCWL 1KFXL 4LKSA 4BCUA 1GLHA 2VULA 1YIPA 1G8WA 1VB4A 2LQQA 1W3XA 1K0MA 3SNMA 4TSVA 3LPGA 2YV9A 4KB3A 1ASJ1 4XQ4A 5AC91 1PGW1 2A2RA 1G7YA 1HRI1 2HWF1 2MEV2 2R061 2DDUA 4RI6A 5JSOA 4KNDA 4XFIA 1BQ7A 5JVVA 3ZO0B 1HB1A 4BHPA 2PLV2 1S2KA 2ZGUA 5LY1A 5KBFA 4WVMB 4Q4X3 3AJZA 2K9ZA 5EJ3A 1KS5A 1IOAA 4CU9A 3LG6A 3WDVA 4BWQA 1QQ2A 1QMVA 1O8WA 1DQ5A 1SK0A 1Q8VA 1PM4A 1O5LA 2VNOA 2YPMA 3RHBA 5I91A 2ZGPA 3AVSA 1U0AA 4J1XA 3C3VA 2DCKA 1K3IA 3OPZA 4XYXA 1AF9A 4IV3A 22GSA 3F3RA 2YY1A 1IGOA 1IS4A 1PMHX 4SLIA 5L19A 2D6NA 2EAAA 3IIAA 1HNAA 2DU1A 1W4VA 4XTSA 5ECIB 2XH6A 2HH9A 4XIOA 5IMAA 3VDDC 2ZKNA 1EPZA 2J9HA 1UY0A 1FT9A 3OR5A 3DYPA 4R9BA 1HRV1 3RHCA 2Z5WA 2CGNA 3BB6A 1CVNA 3ES4A 1DDLA 3VBRB 5FPBA 2GP3A 2L5OA 1ZBE3 2L9LA 1JZ3A 2R16A 2VM2A 3PH9A 1SJZA 4KQ7A 2EXHA 4LE3A 3WOGA 4JDOA 4Y4RA 1CZVA 5FMDA 1RXGA 2VNRA 5FZ1A 4CDUC 1N2AA 4K9SA 3FMWA 1A34A 3IN9A 3ON7A 5B6MA 1JHNA 3AY8A 4WKWA 5HPOA 3LEFA 1GOHA 2CTVA 5ABJC 1JZ6A 3IE3A 3ASIA 3F0IA 4LA2A 3J7HA 4QX7A 5FZAA 2XPJA 1NA1B 1CZSA 4PF1A 1YQ1A 5DALA 2FMDA 3M8NA 1AX2A 5H5SA 4TR1B 3W9AA 1YC61 5A6YA 2XJPA 3VHRA 1AQWA 4Q8LA 1B9YC 3PGTA 3H8QA 4OI4A 1LGCA 5DQYA 4NJ4A 2FZ1A 3L9SA 4WR5A 1W99A 2IXLA 3TWIA 2BWAA 1I3HA 3S57A 5EP9A 5BPXA 2QNKA 1FYUA 1A78A 3RVHA 4XEZA 4YKFA 1XNKA 5K0UB 1N3QA 4CYDA 2WFF3 5A3NA 5C5TA 4GF0A 1YO8A 5L9BA 4MXVA 1GSSA 4EYUA 2DJ0A 4PUAA 4MX3A 3EYPA 5LB6A 3T4HB 4M4PA 5FY5A 1JW6A 1UZYA 4JRRA 1POV1 3TJGA 1QU0A 1FNYA 1YDKA 4CCKA 4W4ZA 1O59A 1THXA 2BVVA 5FKCA 2W1WA 2WO7A 1QJY2 1ONAA 3UGGA 1RTVA 5DG1A 2LM3A 2HWF2 1OUXA 1ND2B 3GURA 3HQRA 5EPFA 3LDRA 1DZTA 2WAAA 1Z7PA 5EJ1B 2VCWA 4KMQA 3RJRA 1Z7S2 3KMOA 4IBPA 4ZU5A 2Y38A 1ZX5A 1PZ7A 4FOVA 2W46A 2TRXA 4OUEA 4IV1B 2WJSA 5HFGA 4LLRA 1N1TA 2C5DA 4Z07A 1OXCA 3CIHA 1X50A 2R5GA 4TXWA 2PUKC 5BNPB 5IAVA 3TKPA 3H93A 2V2GA 4LO4B 3Q8FA 4WV8A 2ZHNA 4QD2A 5C3SA 3D8CA 3ZXEA 3RQ0A 2H0VA 4Y4YA 4NN0A 2XG3A 2WA4A 4YVWB 4Y3OA 5F3GA 2GP5A 5HFIA 2HSYA 3BPZA 1XWBA 1POQA 4CSWA 1YEWA 1FXZA 2VUAA 3J8F1 4KWLA 1QJU1 1UY2A 3PIJA 2H0BA 1H30A 3AKTA 1N1VA 2O8OA 3ZXKA 2W87A 5BNOB 4CDXC 4K1YA 3GJBA 4IW3A 2BBVA 4IEXA 2ZX1A 1MS3A 1W04A 2G9GA 3LEMA 3UT0A 2WO1A 3WG1A 1TK5B 2CQ9A 4Y22A 1AUYA 2AV4A 3D6EA 2VBBA 3OGGA 1I6XA 4XOGA 3J7LA 2V73A 4N9HA 1K3LA 1MEC3 1VAVA 2DJ3A 2M80A 4ZU4A 4ZL8A 4TN8A 4K1FA 4F83A 3I43A 2ZABA 3WNXA 3BTYA 1QJU2 1C8NA 1JUIA 3T2QA 1HRV2 4KAEA 5JR2A 2FA4A 2HWD3 2VOTA 3ZSEA 2IMDA 4FH8A 4K20A 3NV2A 2VOKA 3GUSA 2P34A 1G6YA 1AR92 1PVC1 2DKHA 3T30A 3HY2A 2OPKA 4AQ6A 1UYYA 2LJKA 2AHEA 4XZUG 2OZ6A 3GHNA 4NV5A 4A41A 5F07A 1SLLA 5ISLA 3DD3A 4BVYA 4HKWA 5FYSA 2B6MA 4QGNA 4DEJA 2K8SA 1VBD1 5FP9A 2AAWA 1RUE3 4KI5M 4MXWA 4AF2A 2VUCA 5KXEA 1VBC2 3WQ1A 4O9EA 4BDVB 4ORFA 2RS52 3ETPA 3UGFA 2ZEWA 1PA3A 2NPIA 3LKJA 1KEXA 3DXBA 2ZEZA 2MYGA 5KC6A 1Z9HA 4IGOA 2B1KA 2BOIA 2JXAA 2WO3A 3SEPA 2JICA 4U2AA 5CFDC 2X8KA 4IW9A 1Z0HA 4XRDA 4Y1VA 5JSRA 2J1EA 4JX0A 5CBLA 2VZTA 12GSA 1BJXA 3T2TA 4BH9A 4QWNA 1H8TC 4DY5A 2GH8A 2MBSA 2F51A 3I2FA 3SCHA 3HT2A 1WMFA 4NHLA 4MH3A 4O5RA 3NOFA 2YWMA 4ILFA 2MBTA 5C5UA 2IL3A 2LW8A 1W6QB 3POGA 1GUMA 1CPNA 2Q4SA 2WS93 1LHWA 4CDUA 3AMMA 4QB6A 2VMIA 2CAUA 1ACCA 3B94A 3MV11 4N43B 4DNYA 4MDCA 4AVBA 2J1SA 2J1RA 3UBLA 5CKMA 3APQA 4OHVA 4KL1A 2C9KA 1CPMA 2R1DA 2WR9A 3AZWA 4A42A 4Q4V3 2K0GA 5A32B 3E0UA 3ACFA 1QJX3 5FPUA 3K3OA 1R1A3 1A6CA 2H74A 3VLBB 1WE0A 4PF5A 1IPKA 1TME2 1IYHA 3DKSA 5FLJA 2W92A 5DAPA 3VD4A 2UURA 2R37A 1HD2A 4I2TA 2DURA 1WMJA 1J1LA 2I74A 3E5QA 3CQOA 4E8CA 5IATA 1X9SB 5JWPA 2E53A 2P4EA 1KJRA 4OHXA 2VMDA 4P9WA 1PO23 3IHGA 1SLTA 10GSA 4YG0A 5IMVA 1SQ4A 4HFSA 4XTMA 1VMHA 2QGVA 2VCZA 1XE8A 4LK7A 5DDJ3 3T3YA 2XVKA 1J3PA 3H42B 5AVPA 1V40A 4Q0VA 3CRTA 1EGOA 1LOBA 2PU9C 1GOGA 4G0KA 5ABJB 1H4GA 4Q29A 3I6AA 1YFXA 3ZDSA 2ZCWA 4AGVA 4MVTA 1DIWA 1XOBA 4RQRA 4IKHA 4X8NA 2CVKA 1SFYA 3DPRA 2VBDA 1KD7A 5J48A 3ZR6A 2MMZA 2WC2A 3N36A 1E57A 1AYM3 3OEAA 4M3CF 1O8SA 3SITA 5FPLA 5IWFA 3ZFBA 1OC9B 3KV5A 4JGZC 9GSSA 3WYWA 4BA6A 3MBWA 4JTNA 4NAOA 4TZDA 3TEZA 2A4HA 1HV1A 2PWJA 2EIQA 1QXPA 2VOCA 1N1YA 4PUFC 5BNQA 3PUSA 2B5EA 3GTUA 2C9AA 3TNQA 3HPNA 5FMOS 3EU4A 1YNAA 4Y22B 2RS33 2DJKA 2QDRA 2DFCA 1UW8A 1YI9A 1OVNA 1TMF3 2E7PA 2VBPA 1ENRA 5FWJA 2ZAAA 1TRUA 1R4WA 2YXSA 2BFUS 3M9KA 2C24A 2WNVA 5A3TA 2AREA 5F8PA 3SH3A 5DAXA 3VKFC 1AR71 4XAAA 3FR3A 5BYNA 4META 2W0XA 1D2SA 2JDNA 4IEWA 4AFCA 3KMHA 3APBA 2W1QA 4TLFA 3ST7A 1TK8B 3EMRA 1YRZA 4V1PA 1G9DA 4L2NA 1GLQA 5E88A 1AQVA 2QTWB 4QDSA 4KDXA 2L6DA 5CZKA 3LQ7A 4L99A 1SL0B 3APOA 4MH0E 3C7OA 4HZ2A 3I2IA 4X6RB 1VRSD 1RMU2 4I97A 3D0ZA 1T6BX 5GZZB 5KOWA 4HSCX 2QQJA 5I93A 1LR5A 4YGEA 4O32A 3U37A 2DVGA 4WBRD 2A71A 1QH7A 3PUHA 4GSTA 5B8BA 3FE5A 4IP1A 3RZHA 3TDGA 4KNCA 5I0SA 4MGZE 2V72A 4N8MA 4TKYA 4YQUA 5FZEA 2RM23 1U5YA 4DS0A 4L5LA 1T8EB 5FTTC 2DYCA 1B8XA 2FHRA 5FZ6A 3T0BA 1QNWA 2JG8B 3LYPA 5GZCA 3IC8A 1W9FA 4TR4A 2H72A 3MIDA 4HU7A 3IR4A 4POLA 4H55A 2EVXA 3T2PA 5A1LA 1JU4A 3V0BA 5FAXA 1DUGA 1V9U1 3VBOB 3MW2A 2ZCTA 3VBHC 3LW9A 3CZUA 4YPJA 3WG2A 3VBHA 3A7QA 1Q5OA 1PN9A 3KV4A 1JOBA 4F03A 3VBSC 3B69A 2Y64A 4YG6A 5BNOC 2VZUA 3WY6A 1GTUA 1BEV3 1UIJA 4KBZA 2TNFA 5DN2A 4ZIJA 1MZEA 1IPSA 1RHI3 5IHRA 1QY4A 2N5AA 3LSZA 4GULA 4EC0A 1V6LA 4FPLA 2H73A