2HYXA

Structure of the c-terminal domain of dipz from mycobacterium tuberculosis
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
333
structure length
333
Chain Sequence
GAMEIREQLNLGGIVNAQNAQLSNCSDGAAQLESCGTAPDLKGITGWLNTPGNKPIDLKSLRGKVVLIDFWAYSCINCQRAIPHVVGWYQAYKDSGLAVIGVHTPEYAFEKVPGNVAKGAANLGISYPIALDNNYATWTNYRNRYWPAEYLIDATGTVRHIKFGEGDYNVTETLVRQLLNDAKPGVKLPQPSSTTTPDLTPRAALTPETYFGVGKVVNYGGGGAYDEGSAVFDYPPSLAANSFALRGRWALDYQGATSDGNDAAIKLNYHAKDVYIVVGGTGTLTVVRDGKPATLPISGPPTTHQVVAGYRLASETLEVRPSKGLQVFSFTYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the C-terminal domain of DipZ from Mycobacterium tuberculosis
rcsb
source organism Mycobacterium tuberculosis
molecule tags Unknown function
molecule keywords Protein dipZ
total genus 92
structure length 333
sequence length 333
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
A PF17991 Thioredoxin_10 Thioredoxin like C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2hyxA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2hyxA01
2B4KA 3KZQA 2K6VA 2O7KA 1VF2A 3US3A 1XWGA 2WDBA 3RPNA 1ULOA 4ZBBA 4ID0A 2H1DA 1R5PA 3F3RA 4POBA 2XC2A 2DBCA 4ZIJA 3P2AA 2GGTA 4BPYA 3GHAA 4MGQA 2JZRA 1F37A 2JACA 1U3AA 3GH6A 1MDJA 4IQ1A 2FCHA 1VGLA 3LJRA 1O73A 2FY6A 4DXTA 2WO2A 3ME8A 3F2ZA 2JSYA 4QAWA 1V98A 2KUCA 4AF2A 3P90A 3THCA 4L8EA 3NNGA 2H6XA 3CKHA 1B48A 4BVXA 2VL4A 5ECHB 1KEBA 5ID2B 3DXBA 1EV9A 1F4AA 3WNPA 5EVOA 4PQHA 4TKYA 2HXKA 1UMHA 3DWVA 1E2YA 1R7HA 4BVYA 2F51A 3AC0A 4L5LA 2YWIA 3WSOA 4E8EA 3I2IA 2E2GA 4JHZA 4JEDA 3UEMA 3FZ9A 2TRCP 4K9ZA 3A2VA 2C0FA 3IBHA 4MH2A 1GRXA 3CBUA 2CDOA 2W94A 3PH9A 1GH2A 2B7KA 2Z4FA 2E32A 1GTAA 2DJ3A 3VI5A 4MPFA 1K0MA 3OG2A 1DYOA 2LV3A 1NSWA 3BD2A 2P5RA 3F3QA 1FG4A 2VJXA 4KX4A 4UI9L 2CVKA 1JZDA 3UOMA 1L7RA 4CVUA 1CZTA 3QPMA 2EIRA 3UJ1A 1M99A 4OZOA 1YKCA 1AXDA 4MZWA 2M46A 4HDEA 3IAPA 3GMFA 2VZUA 1URMA 3F4TA 2TRXA 4ZY9A 1JFUA 1FB0A 3I2GA 1A0RP 1UA5A 2EIOA 4XS1A 5CNWA 2DC5A 4A44A 1KGYA 1K0CA 2QBXA 3LXZA 3APOA 2LJAA 4F2IA 3IK9A 2EIQA 2O87A 4IS0A 2V6KA 2YN1A 4Q5RA 3TJGA 1T4ZA 4IW9A 4ACSA 1XVWA 4IJ3A 3KH9A 4LQRA 4WBRD 4YQUA 1TVGA 1WCQA 3H79A 1YJ6A 3M9JA 4CUBA 1H75A 3GTUB 3HNBM 4HUAA 3C71A 3VD7A 3IV4A 1HNCA 2ORZA 1SK1A 5JCUA 5JXHA 2XPEA 4I2UA 2L5OA 5ECPB 1VF1A 4G9HA 1V57A 4WF4A 1GNYA 1O6JA 2DMLA 1T00A 1ST9A 3LE0A 1GULA 3D6IA 4GSTA 2LS6A 2PWJA 4K7IA 4XUTA 4MCUA 4GF0A 5DVBA 2F8AA 3HHVA 1KBNA 1QMVA 5GSSA 3HEIA 2L6DA 5KN3A 2GSTA 1BJXA 2J1EA 1T2XA 3D3AA 3T08A 2MMNA 3HXSA 2JKXA 1ZMAA 2AV4A 1XFLA 2VMEA 5F06A 1Q4JA 2IN3A 4BWQA 1WPIA 3EB7A 4DUVA 3ZFLA 3E3EA 4OFMA 5E4WA 2DIZA 1JHBA 3L78A 2ES7A 1BG5A 2RVAA 5CRWA 3CQOA 1ZOFA 3C73A 4LA1A 4TR1A 2VZVA 1RQMA 5COHA 2WYSA 5KN2A 1YZXA 2EIBA 1ACVA 2LUSA 2VD1A 2X99A 3LQ7A 1B9XC 2C80A 2GDRA 3N9JA 5C71A 3ME7A 3UIWA 2LKUA 4QDQA 2ORXA 3FR6A 2R6KA 1JI6A 3MO4A 4BDVB 4POMA 1JZ4A 4TR4A 2RUEA 1O8SA 1PKWA 2MYGA 2G0FA 4P08A 5KN0A 2M72A 1FOVA 5JR2A 2K9FA 4FYBA 2IL3A 3C7EA 3KGKA 4TW5A 3WNOA 2WRTA 3OBAA 2JD9A 3IK7A 4I6XA 4QQ7A 3LXTA 4ZBAA 1CZSA 3C8XA 1AQWA 2KLXA 2J1UA 4OO4A 1O81A 3I2HA 3QMXA 3HJMA 1L7QA 2E7PA 6GSWA 2IMIA 2MZCA 3T0DA 4TR0A 10GSA 2M80A 3CIHA 1H6XA 3ECQA 4QX3A 2YC2A 5CRHA 1QK8A 2X10A 5A4UA 5J3RA 2HLSA 1EV4A 2H75A 1F2EA 4OYUA 3LYKA 4XS4A 3GSTA 3NZNA 4POLA 3CTGA 4JKKA 1W89A 3H93A 3T0BA 2W87A 4YQVA 2WBKA 4RYDA 2PERA 3F8UA 2IMEA 2W95A 4GWIA 4MADA 3OGSA 2YV9A 3IHQA 1WE0A 1WMJA 3FZ4A 3K46A 4YQMA 5JWQB 4UOJA 3JCML 4LLRA 5DN2A 1Z5YE 4K1FA 1GP1A 4PNFA 1NUKA 5D9TA 2W91A 1A8LA 2CAIA 2HRFA 4GQCA 2C4XA 1T1VA 3BJ5A 3D4MA 1EGRA 4E8DA 1JLWA 2DSAA 3A3TA 4LMVA 3GGLA 3UL3A 3VLNA 4WF5A 3SEEA 2H76A 3EMXA 2IMKA 1X9SB 2FWFA 3Q18A 1BQ7A 3TRXA 1SD9A 3M9KA 2C3NA 2VC9A 5JUVA 2GZPA 2LRCA 2FA8A 4OMDA 1TRUA 7GSSA 3IAQA 5LA0A 1PX6A 1SKSB 4MO3M 3GKKA 3ZVJD 5G30A 4N30A 1UY1A 5DPNA 3AY8A 3DVXA 4X43A 5A1AA 3OGVA 2RM6A 1UXZA 1SYXA 2C4JA 4HQSA 3EYPA 3FYGA 4XRAA 1LU4A 4KW6A 1K12A 3C8EA 2X8GA 2CT6A 1WWJA 3F6DA 5ECMB 1PQNA 2L5LA 1KTEA 3HJOA 4HZ2A 1UY0A 2VO4A 5AIXA 4DUXA 3U5RE 2J1VA 2IMDA 3MDKA 3DRNA 1XOAA 3GX0A 1ERUA 3CSJA 2WQ8A 2C9KA 2V1MA 3KJYA 5J9BA 1JZ2A 2XQXA 3MNGA 4KCEA 4I8BA 1XW5A 5HR0A 2DLXA 4ZL7A 1ZGNA 3ACIA 2CV4A 4MJAA 1K0NA 2J7MA 4FH8A 1WKYA 2K18A 3GIXA 1G0TA 2CX3A 3F6FA 3L9VA 2C0DA 3FN9A 5D93A 3IDVA 4DUWA 3G7JA 5LA1A 2XONA 5EJZB 1PMTA 5JWRB 1SL2B 4KWUA 5G5FA 1F6MC 4TXOA 3HNMA 3HPNA 2CX4A 4NAXA 6GSVA 3EINA 3D4TA 4EL1A 4TXOB 1THOA 1HQOA 4TR1B 3QCPA 2VMCA 1SJIA 2ON5A 4IJIA 3K8NA 5ECRB 4HQZA 5G04L 4PURA 3WNNA 1GOFA 2VLTA 3LFLA 1X5EA 4CU8A 2VZPA 4RI7A 5ABRA 3CZJA 2EIEA 1USBA 3IAS2 4EO3A 4WXTA 2J23A 3QOUA 2VO5A 3DGQA 4DXSA 2ZNMA 3WF1A 2FWEA 4CU7A 4ZILA 2H66A 1AW9A 3LEGA 4FYCA 2ZCTA 4MABA 4GTUA 4EKZA 3DKSA 2VR4A 1GOHA 2Y6JA 1GLPA 5IQYA 1XCCA 3FHAA 4KE3A 2H01A 2VM2A 1C72A 1W8OA 2FD3A 3OEBA 1HNBA 2PBJA 3WNLA 1K0AA 2YWOA 5IHRA 1GSFA 1M9BA 5ECKB 4OO5A 2CZ3A 2DIYA 3H4KA 4XRDA 4KSMA 3UMAA 4TRXA 3ACGA 4HOJA 2H0IA 2BJXA 4E8HA 3LYPA 3TJFA 1BAYA 4Q5FA 2N5BA 1R5AA 2W92A 2WZ8A 1XWCA 5FHIA 2E33A 4FI9A 4OFNA 3U37A 1YDKA 1B8XA 3L9UA 1YY7A 3CMGA 1DSBA 2GZYA 3KH7A 1GSDA 4EXJA 5CREA 4ZB8A 1DE2A 3KD0A 5EJ1B 2R2JA 5DJMA 5IMDA 4AG4A 3VFIA 1JZ6A 4A45A 3I69A 1JZ5A 3DVWA 2WDUA 1ZYEA 4QB2A 3NJXA 4IUGA 3A2WA 4EC0A 2EICA 1MTCA 3VI7A 2I1UA 3NOFA 3C7FA 4OCEA 1EOHA 2WAAA 5B7CA 4F0BA 5J1XA 3WT1A 3R2QA 4HZ4A 3W6GA 4CDOA 4KMQA 4LPLA 3JXSA 1VF3A 3HDCA 2VZQA 1IQDC 5DQYA 2B7JA 4YAPA 2WABA 1S3CA 5JCGA 2LTKA 2FUG2 1M7TA 4D0QA 4O32A 2LJRA 4JZQA 4PQQA 1TI3A 5ECLB 3RDWA 4Z7XA 3I3BA 4L5OA 2X09A 5F7UA 2B6MA 2VAFA 1YKAA 4JRRA 1T3BA 1GQPA 2HFDA 1UY3A 1VF4A 4J57E 4ZB6A 5IFTA 2LW8A 5HR2A 3GSSA 3SKVA 1EZKA 3G7YA 2W9XA 2LJKA 2VL3A 1BYEA 1GTBA 3ISOA 1IYHA 2JE8A 1RYYA 5G5EA 3KP9A 3VWXA 2DJ2A 2YANA 3EYTA 2JU5A 4JR6A 2FLSA 1W9TA 4QB6A 1A2LA 3GN3A 1YQ2A 3EURA 1OF4A 1QXHA 2H1AA 4ML6A 1O59A 3GXUA 4W4ZA 5EY6A 4UAPA 1WOUA 2GLRA 1O8XA 4DSSB 5H5QA 1W0NA 3CDZB 2WZEA 1SKWB 3Q19A 3VD5A 4MF7A 4G2EA 1NW2A 3I2KA 1O7UA 1DE1A 4I97A 3O76A 2ID4A 1ZZYA 3ZMLA 3W8SA 2FA4A 2CZ2A 4NHWA 4NXIA 1AAZA 3KMOA 4D8MA 2K8VA 3GV1A 2AUVA 4OD7A 1XXUA 5FWGA 4DVCA 5D73A 2W5FA 4IGJA 5F07A 2VMFA 2AYTA 4CW9A 1O8PA 1LBKA 2RJ2A 2VCQA 2VCTA 1VRSD 4JR4A 1BEDA 2QQOA 3M0FA 4DSSA 4N11A 4CU6A 6GSYA 4ECBA 1WIKA 3A22A 11GSA 1F3BA 1TU8A 4GZ9A 3DYRA 5HXMA 4CHSA 2VZRA 1K3YA 2LS5A 4CUAA 5IO0A 3OR5A 2X05A 1Z7PA 5CZKA 3P6BA 5JXIA 5IO2A 4OWYA 2HZEB 2JZTA 3EWLA 2DJJA 1N8JA 3CRTA 1I9DA 2WN3A 4EUYA 3PINA 5JMOA 2H8LA 1IYIA 4OMVA 4HS1A 4KUNA 2IFQB 3KTBA 2JZSA 3TKQA 1K3IA 2B3SA 3GKXA 4IHUA 5CP1A 3ZYWA 3QAGA 3HJRA 3MAKA 4QPWA 1U87A 3TKSA 1TJDA 1KNGA 2OA7A 5IOWA 3KIJA 2VL2A 4I2TA 2R5GA 4ECIA 1K3OA 2X8CA 3VWWA 1N2AA 4HU7A 3EC3A 5DALA 5C00A 2QQMA 3SEPA 2IWTA 1R4WA 3EE2A 4DEVA 4RUVA 2VZ3A 4ARYA 4Z2AA 3FK8A 6GSSA 1BHGA 3HJPA 2I3YA 3TKRA 5GAPD 4KGIA 1DBYA 2FGXA 2IFQA 3SKJE 4MK3A 2F8FA 1B4PA 2H1GA 3GX8A 3W5NA 1YQ1A 3TRPA 2QQJA 3KMNA 4KB3A 2I4AA 3H8QA 3TRQA 2EIDA 3DYPA 4A4AA 5LA2A 1JZOA 1OKTA 1D7PM 1Z7RA 2X64A 2KP2A 2QC7A 5IYYA 3TOUA 3KXOA 2GT6A 2W1QA 1X5CA 4KSOA 5H5RA 3UAPA 3C7GA 3RAZA 4TN8A 4MJCA 1TTZA 5D9WA 5DJLA 3GKNA 5HFGA 5A5KA 2VOCA 1FHEA 2JSZA 4CU9A 3Q6OA 1QFNA 1OH4A 3BCKA 1TK0B 1RW1A 13GSA 1UY2A 2QQIA 5JXJA 3QDNA 1JYXA 3WGEA 1QGVA 4HI7A 2PVOC 2C0EA 2O85A 3GYKA 3C7MA 1W99A 1G6WA 2P0GA 2WJUA 4NPBA 4XHMA 3DD3A 3WNKA 1J08A 1OVNA 2ON7A 4POKA 5C70A 1UX7A 3L9SA 1JZWA 2WULA 4ZBDA 5FUIA 5C7GA 3I6AA 1SENA 1SG3A 2XBIA 2E2MA 2YZUA 1TP9A 4IBPA 2C26A 1O85A 1MD4A 3T2QA 4X1UA 4MZCA 4GSNA 1OAZA 4ML1A 3FY7A 2H30A 2W46A 2Y6GA 4P02B 4XURA 4K7OA 2W1UA 5DQ0A 2YZHA 2CVBA 5AN1A 4DSRA 1TDIA 1S3DA 3G7IA 1OC3A 1T4YA 5IPGA 2VTFA 4F0CA 5G31A 2YB7A 1U88A 3MWHA 1EWXA 4O5RA 4XZUG 2R37A 4EVMA 5G1KA 3LORA 4ARXA 3HKRA 1PGTA 1G7EA 2VIMA 4M4PA 5B4XA 1F9MA 2HZEA 1K45A 3F63A 4JX0A 2VL9A 2V2GA 1OKDA 1UYXA 2DDUA 16GSA 3L0HA 4F82A 1TXXA 1QUWA 2Z9SA 4JBBA 4ZL9A 3I43A 3MBWA 4ULXA 2RLIA 1NHYA 2C8UA 5DDLA 4F9ZA 3J7Yk 1GSUA 2H6ZA 18GSA 3FHQA 3BCIA 4NMUA 3C7OA 1XW6A 1Z6NA 1H4OA 6GSTA 3FL7A 3HNYM 3ZREA 2PU9C 2BGPA 2ZEXA 2ZXQA 1PL2A 4GWRA 2B9VA 2OACA 3RHCA 5DCGA 5J9CA 3GNJA 5ENUA 4DEJA 1AC1A 4RN5A 2DMMA 1MD3A 3VD3A 3K4ZA 1ERWA 4K0GA 1SL0B 3GL5A 2ZEWA 2P31A 5ECNB 3I3EA 1SU9A 1V2AA 2MBSA 2HYXA 2BTOT 2KP1A 3FHKA 1A8YA 2E31A 5INYA 4GQFA 3UBLA 1FVKA 2HLEA 3QD9A 4GRFA 3LEIA 3ACHA 2ALBA 5IIZA 3THDA 1V58A 4PGTA 3TKPA 3ZIJA 1JU4A 5D9VA 1GUKA 5EPFA 4A3ZA 1GWCA 4BJ0A 2WO1A 3HA9A 4ILFA 5HR3A 1PX3A 5EIYB 2K8SA 4KDYA 5KN1A 3HZ4A 4NV2A 4RI6A 1V40A 2GQKA 1GUIA 3MSZA 4MDCA 1TW9A 4AJ7A 1NAEA 2B1LA 1AUCA 4IVFA 5ID2A 3T2OA 5A4WA 3NIVA 2FWGA 1SK0A 2QGVA 2VQUA 1XNTA 4N10A 3TGZA 1K42A 1YEPA 1X0RA 3PR8A 3K4DA 6GSUA 3WD6A 4MMMA 4IQAA 2MMAA 3BBYA 4TXWA 1E6BA 2WB9A 1H6YA 3T0AA 1THXA 3CRUA 1Q98A 1LNSA 5HQPA 3ZVJA 2C3TA 2YJ7A 3LG6A 1UZ0A 5H5SA 1SHWB 2WO3A 2VLVA 5DALB 3IIIA 4TOPA 1AIUA 3ZRDA 1HYUA 3EU4A 1TKDB 2PVQA 2O8VB 3ZM8A 1T7PB 3IPZA 3GUSA 2H19A 2HE3A 3DYOA 2JL4A 4MLYA 2OKXA 2H74A 1PMHX 4AAXA 3A5WA 2LSTA 5HFKA 2LQOA 5JCWA 1SDDB 3ACFA 2PQSA 3DIEA 3ERGA 2RV9A 5DAKA 1OYJA 2XPDA 3BOAA 3A23A 3FZ5A 1UC7A 1GTUA 5HPOA 2VCAA 2B5XA 1X9MB 4ZB9A 4QX2A 3TJBA 22GSA 2F9SA 1PSQA 5IPHA 2IMFA 5D9XA 4LL1B 3PUIA 3FR3A 2GQLA 3M1GA 4KCAA 3MUZ1 1Z9HA 1J9BA 1I5GA 2ZEYA 3VD4A 1GNEA 2H0HA 2BMXA 4EF0A 1EEMA 4AGSA 1V9WA 2YFUA 2VZOA 4N0ZA 1YF1A 1TRSA 1XBSA 3QFBC 5DAKB 2RUFA 1GSEA 2NPBA 2YCDA 2J22A 3IE3A 4EDYA 1GTIA 4V2NA 5CRGA 2C1YA 1A24A 1GLQA 1ZL9A 3N5OA 2QKEA 3WYWA 1U6TA 4J56E 1F4HA 3IRAA 3C1RA 2V72A 4BXSV 1XIYA 1K3LA 1RK4A 5IMFA 3VWVA 4LKSA 3NRUA 4ZXGA 3EMPA 3GRXA 5GAND 3IXRA 1MEKA 2GSSA 19GSA 2GVPA 1TRWA 3MV01 1FAAA 2W47A 3VD9A 2YP6A 1A2MA 2OE3A 2VD0A 2RIIA 3ZTLA 4ET7A 4RQXA 2AB6A 3VDCA 5AGYA 1ILOA 4RQRA 3M3MA 2BGOA 1CX1A 3OB8A 3HY2A 5GSTA 3ETPA 2W1WA 2H6YA 4ISDA 3CYNA 3ZITA 1OC8A 1A2JA 3QAWA 2OKAA 4DSQA 4D73A 1T8EB 3ZLPA 4K6XA 3OGRA 2DCKA 1JZ8A 1M2DA 3F4SA 1CZVA 2PMTA 3GH9A 3CZUA 1EP8A 2B1KA 3GDBA 2VLUA 2Y6LA 1UWWA 4PX1A 1ON4A 4QX0A 4W50A 1JZ3A 2VZ1A 5C04A 2VCZA 2H0GA 4MF5A 4MF6A 4K0NA 3A21A 2GT5A 2OADA 4HJMA 4NWYA 4BK5A 4G10A 3ERFA 3WF0A 3M8NA 1US3A 5E59A 3KM6A 4V2MA 4XS6A 5B6MA 3H1NA 3LEKA 3UVTA 2W1SA 3WGDA 3FRCA 2MBTA 3U6VA 2BZDA 1M2BA 4QL7A 4XTSA 1ERTA 3UNPA 1MDIA 4KNDA 5IJRA 4AJ8A 5ECIB 2YNXA 4H86A 4OCFA 3BN6A 2PPTA 2Y6HA 4M4RA 4KA0A 2BERA 1SYRA 3VK9A 2GS3A 2ZUPA 5LCZA 4KH7A 5CRDA 2N5FA 5F8BA 1ZYQB 5G1LA 2AAWA 1B9YC 3ZMKA 4EE0A 3RPPA 2H73A 4JKLA 3UETA 1LJRA 1TI1A 2V41A 1MPXA 3WT2A 3ZIVA 4ZXEA 4MGSA 3K75B 1NX9A 1AQXA 1CIYA 5LNKe 4PT6A 1TK5B 1W9WA 4EDZA 4Q5QA 1K0BA 2CQ9A 1YEXA 1EUUA 3W5MA 2GSRA 3K77A 4PUAA 3VPTA 5F05A 4MJBA 2KD7A 4QX1A 2YPMA 3DEXA 2C0GA 1PA3A 2YG0A 4XVHA 2J9HA 4HEA2 3KP8A 1M2AA 5IOXA 1S3AA 1ZCPA 3VWUA 3TCOA 4IKHA 4MPGA 2REMA 1UMIA 2WAOA 1YF0A 3TB2A 4MA9A 3GTUA 5ECSA 5A4VA 1AQVA 3LGCA 4BK4A 5CYYA 5J41A 4AJ6A 1PKZA 1EP7A 1XVQA 2HSYA 1SJ6A 3D22A 3GA4A 3DECA 3HN3A 5CO3A 2R4VA 1PX7A 1XWAA 4ZZ8A 3VDAA 3HVVA 2J1RA 1Z6MA 2FNOA 4K7NA 2Y6KA 1NKGA 4PNGA 4IELA 3LQCA 1ML6A 5IFPA 4IP1A 5I0DA 3HZ8A 2VQTA 1GOGA 1HD2A 1K0DA 3IB3A 4DEQA 2GTUA 5B8BA 3LEFA 2MMZA 4V2LA 1ABAA 3APQA 4YPJA 1I5PA 4P5YA 5B6NA 4LL4B 2X8HA 3F9UA 4CUCA 3ZL5A 2L59A 3CTFA 4MP4A 5DQSA 2I9HA 4O92A 4QDSA 3TJJA 1P8JA 2VOTA 3F0IA 2WS2A 3ERWA 3C1SA 1TU7A 2VCWA 3D21A 5HFIA 2WGRA 1W9SA 2R7EB 3IDAA 4V1Ag 2V5DA 2TIRA 4XUQA 5LD0A 1XW9A 2A2RA 1XPWA 2DJ0A 4IP6A 4JU5A 2VM1A 1GL8A 1JHJA 4WKWA 2BBAA 4HU9A 4PF1A 4LMWA 1OD3A 1R64A 2J1SA 3UBKA 1DUGA 3FZAA 4X0XA 5KEJA 2PN8A 1UN2A 3HYPA 3UVHA 2NTOA 4BA7A 3CSHA 1PD21 3IC4A 3E1F1 3DYMA 4D73B 1B4QA 5CAXA 1JYNA 2VUPA 3WF2A 2H72A 3UESA 4XIHA 2WUHA 4V1Ap 4I5QA 2LQQA 8GSSA 2VCXA 3TOTA 3HCZA 2H1BA 3J7Yb 2HI7A 4LHSA 2VM9A 3O6TA 1XNAA 2OE0A 1G6YA 1US2A 4A41A 2YOIA 1KEXA 3WQBA 4JKMA 3PGTA 1WRYA 2GQMA 2VCBA 1PRXA 5D8IA 2LEGA 3RBTA 5DBQA 1X5DA 2Y64A 5FT3A 5B8AA 1GNWA 4GLTA 2PUKC 1DLCA 2FHEA 3IOSA 2HT9A 3P8WA 2P5QA 2RM5A 4XUOA 1GUHA 1MDKA 4WETA 1OC9B 4GSSA 4XS4B 4NHZA 2E26A 4MH3A 3WF4A 3F4RA 3GM8A 2J1AA 5JWOB 4XUNA 4P3YB 3QAVA 1ERVA 1PX4A 1GSYA 1A23A 4IN0A 2VCCA 4L0UA 3NJVA 2L57A 4Q5NA 3ZZXA 1JU3A 4K2DA 4GWJA 2L4QA 1WP0A 2FWHA 2R3XA 1PMJX 3BGAA 1WJKA 3LPFA 2V6OA 2XOMA 3I3DA 2LNTA 3LSZA 1A0FA 4A42A 1XWBA 3KTLA 3GURA 3IR4A 1JYWA 2H70A 3HVXA 2IJYA 1U3IA 4QDRA 2VL2C 3I97A 4E8CA 1PN9A 2KOKA 4PXOA 2XHNA 4KDXA 4WEYA 3HVSA 3O3TA 3SBCA 1EOGA 5EL8A 2VMDA 2OBKA 2OBIA 5ELGA 2DJ1A 5DCHA 4MJEA 2G2QA 4XUPA 4J2FA 1QQ2A 1BX9A 4QB1A 4TVEA 2C3QA 4FO5A 4OMCA 3T09A 3P1IA 3L4NA 4G19A 1OF3A 3S9FA 4TTGA 4A6OA 2N5AA 3GL3A 3FW2A 4YAVA 1UYZA 1F3AA 1OC9A 3I9V2 2WN2A 3T2PA 3NQHA 3KEBA 1NM3A 2YJHA 1R26A 2L9LA 2YWMA 2YWNA 1CQGA 3G9BA 20GSA 5ECOB 2ZEZA 5F0GA 3V1WA 5IMAA 3KCMA 1M0UA 1TOFA 3I2JA 1GU3A 5IMZA 2QQNA 3VPQA 1JYVA 5IM9A 3MV11 2KHPA 1TK8B 1O8WA 2CVDA 1OT5A 5LCWL 2QQLA 2A4VA 3TUEA 1W8NA 4K8MA 1UVZA 14GSA 1SD8A 5J4UA 3E9JB 2YC4A 3I2FA 1XOBA 3TDGA 5JXGA 2W3JA 5IMCA 1Y25A 2V4VA 3J7HA 3WNMA 1CQHA 2DCJA 3LWAA 1UXXX 2XBQA 4BL7A 1XPVA 3FKFA 2HSHA 3WGXA 1M9AA 2LRNA 2I81A 5ELAA 5IMVA 4MZBA 4PUFC 4DXRA 4GCIA 5L71A 4HJ2A 4MOAA 5B4NA 2HRNA 4P00B 1JLVA 1EEJA 4GXZA 4NV5A 3ED3A 4WR5A 3RHBA 1JZRA 4FIWA 3FR9A 5J5NA 2VZTA 3SWLA 3E0UA 2AJQB 4N0VA 2GSQA 1SJZA 2AHEA 4XCSA 4ECJA 2B5EA 4ZZ5A 4PQ1A 1NHOA 3CMIA 1TRVA 3DMLA 1FVJA 4OFTA 2D2ZA 2HNLA 6GSXA 1J83A 2V32A 3CXGA 2JDAA 1EUTA 2VZSA 4L0PA 1HN1A 3TKSE 9GSSA 2DJKA 3GKMA 2CDPA 1GSSA 2O89A 2YV7A 1SL1B 4HG6B 3A2XA 2L6CA 2CA8A 2E0QA 5ECQB 4JE1A 2OE1A 2WFCA 2NBSA 1SK2A 2WZ9A 1XC6A 2Y8KA 2IIYA 3EU3A 4PQIA 3UARA 1GMMA 3CSIA 5AISA 3QR6A 4L0WA 3VDBA 3PUHA 3WF3A 3WEZA 3K4AA 1XZOA 1EGOA 3D0ZA 3A7QA 3ABZA 3W8JA 3C7HA 4O7HA 1X9WB 2F3MA 3FEUA 1FB6A 4TXVA 4TR3A 3D5JA 3HOBA 5GZZB 3APSA 1GSQA 1FW1A 3IA1A 1J84A 2L4CA 1ULPA 4F03A 2YFZA 3HD5A 4OUEA 1OE7A 1OE8A 1TG7A 2LNSA 4ZL8A 5D96A 3Q74A 5HR1A 5DMYA 2MMOA 4KDUA 1Z3EA 2WCIA 2QQKA 1W4VA 2J1TA 2NVLA 5G05L 3P7XA 2PGTA 2XHFA 4QL9A 1JZ7A 2A2SA 1UYYA 2NDOA 1Y6EA 1HNAA 1XWKA 2QSIA 3MUY1 2LRTA 3TJKA 5G2ZA 3GFKA 17GSA 12GSA 2GZZA 1FO5A 5AIVA 4KI5M 4YH2A 3LPGA 4KAEA 4ECCA 1PL1A 2EC4A 2OJLA 3IAM2 3ZFBA 1K0OA 1J0FA 3VURA 3OEAA 4WBJA 3EVIA 3TKSC 1G7OA 2B5YA 2IPAA 4WR4A 2JADA 3QFAC 2HZFA 1UY4A 2CAQA 4BWSA 4W8JA 2H71A 2VCVA 4FYUA 1DP0A 1GUMA 1SKRB
chains in the Genus database with same CATH superfamily
4I0WB 2E7TA 3DV8A 3U4XA 1UPIA 2GC2A 4Q4W2 1VF2A 2HWB2 2H1DA 4KG8A 2W0XA 1YRZA 2VW1A 4ZIJA 2A6YA 1ZZ8A 5TSWA 2FCHA 1VGLA 3LJRA 1O73A 4DXTA 2WO2A 4HLTA 4A7ZA 1JN2P 3KQ4B 2CNAA 1JMUB 2KUCA 4AF2A 3P90A 4Y4RA 3KF5A 4OHYA 2A6XA 5KHKA 1KEBA 1CJDA 4UYBA 1RVF2 4TKYA 2HXKA 1UMHA 3WVJA 4BCUA 4FP2A 2F51A 4JGYB 4E8EA 1W6OA 4JEDA 5L36A 2TRCP 4K9ZA 2X4AA 1MS9A 2QA1A 4XJWA 1GRXA 5A7WA 3CBUA 4JTNA 2CDOA 1WGPA 4MPFA 5KXBA 3BD2A 2P5RA 3RSJA 2R0FA 1XJAA 3FHIB 1WBFA 3LZZA 4CEYA 4CVUA 3UJ1A 4IEYA 3NMBA 2Y26A 1UAIA 4LBKA 4OZOA 1F15A 1YKCA 3SLIA 3H8RA 2M46A 2BWAA 3F4TA 1X82A 3I2GA 4IGOA 5CNWA 4LNVA 4QU2A 1KGYA 4BVXB 1K0CA 2V5YA 2LJAA 2O87A 1X8EA 2LM3A 1XVWA 3D0JA 4YGCA 1UOJA 3NWKA 3GTUB 3ZFEC 3IV4A 3VD7A 4FPLA 1HNCA 1UMZA 4QWNA 5ECPB 2QKDA 1V57A 4WF4A 1DZRA 2DU1A 2PWJA 5KXCA 4K7IA 3UKTA 4GF0A 3PMEA 5GSSA 3HEIA 3HWJA 2WJSA 3HXSA 2MMNA 2Y33A 1LRHA 4TLFA 1Q4JA 3OY8B 1Y9MA 1C8M3 4DUVA 5EXOA 4WVVA 2DIZA 4H3WA 5CRWA 3PIGA 3CQOA 1WLDA 4XMIA 4LA1A 2VZVA 5KN2A 3WQ0A 2VD1A 2X99A 3LQ7A 1B9XC 1CAVB 4JDNA 3N9PA 4M00A 1W6MA 3NNMA 2LKUA 4AEDC 4BDVB 1VRH3 4P9JA 4JV4A 1NYWA 1JOPA 1PKWA 3URFA 2MYGA 1AXKA 2Y38A 5JLVA 2K9FA 4BPZA 2XH6A 4FYBA 2Z5WA 3IBMA 3FC0A 2CTVA 5T50A 3WNOA 2WRTA 3LSEA 3OBAA 2ZKNA 2AUYA 3C8XA 3W58A 3I2HA 1H1AA 2E7PA 2MZCA 3T0DA 4TR0A 10GSA 1WCUA 1DCSA 3ECQA 4CTEA 3TYJA 5A4UA 1B35A 1EV4A 2H75A 1DBNA 1BVVA 4NHYA 4IERA 4POLA 5D8AC 1PMIA 1W89A 1NLSA 1AJOA 3T0BA 1LTEA 4YQVA 2BOIA 2PERA 2XJUA 1VPHA 3F8UA 2IMEA 3KS7A 1UKRA 1NQDA 3K2OA 4M01A 1YUDA 3BB6A 3JCML 5K0UB 3POSA 1Z5YE 1XNCA 5D9TA 1HJFA 4WVZA 3V0AB 4CCOA 4NIHA 3A3TA 4LMVA 1AX0A 4WM7A 3ZLIA 3GGLA 3WQ1A 4CPBA 1VBC2 3VLNA 3SEEA 2H76A 3PU3A 4CCJA 3TRXA 1COV3 5A1LA 2HWD3 2VC9A 3O1PA 4OMDA 2RS53 2HWE3 1SKSB 4MO3M 3WY6A 5G30A 1ZYNA 4X43A 2A2PA 3OGVA 5D8AA 2RM6A 1S0JA 4XRAA 4N43B 1LU4A 1K12A 5LBEA 2X8GA 1C28A 3F6DA 3ETQA 2W2IA 1PQNA 1KTEA 3HJOA 1UY0A 1AL22 4FFGA 2VO4A 4DUXA 3RYPA 3DRNA 2IC1A 4DB5A 1JBCA 2V1MA 3KJYA 4BOWA 2D6OX 2IUWA 1XW5A 3V56A 1SPPA 1ZGNA 1S0BA 4FH8A 3IPVA 3F6FA 1ULEA 3B3QE 1XG8A 2WS92 3G7JA 1UOBA 3JD71 4BXFA 1MZ5A 1SBDA 2BDRA 1PGW2 1W9FA 1OC1A 2BTVC 1WLTA 4LOSA 1W2NA 3EINA 3D4TA 5FUNA 5FXWA 5BNOA 3AP4A 3IDCB 2G1MA 3QCPA 3CLPA 5J37A 3K8NA 5ECRB 4BB3A 4HQZA 2PHTA 3VHRA 5FYVA 4QM9A 5DZEA 4KU8A 1PIV1 4EN6B 1OKOA 3MFCA 2FMYA 3AP9A 3CZJA 4IXLA 4RS5C 4YW4A 4WXTA 4Q4V1 1LOFA 1SCRA 1NA1C 3LEGA 4ZU5A 5IVYA 4EKZA 3DKSA 4SLIA 5C9AC 3CL1A 2D5FA 1XCCA 3FHAA 4LUKA 5A70A 1C72A 3WCSA 2FD3A 3OEBA 1HNBA 3NO8A 4QQOA 2YWOA 3UGFA 2XR4A 4TWTA 4YZ1A 1B35C 4OO5A 5FZIA 4AVTA 1SMVA 5FPVA 3DGTA 4KSMA 3ACGA 4HOJA 4E8HA 1EPZA 1BAYA 5FO7B 4Q5FA 2N5BA 1O7FA 3LWCA 4COWA 4N7IA 1YDKA 3VKFC 5HBAA 5C8CB 2YZ4A 3KD0A 5EJ1B 1JZ6A 3NV3A 5I93A 1C8M2 3I69A 2ZGKA 3DVWA 1PGW1 5CU1A 4FPGA 1MTCA 1XSRA 4I0BA 4G4FA 1HXS2 2WAAA 4F0BA 4HN0A 3R2QA 4AHXA 4CDOA 4LPLA 3JXSA 2YROA 4IEPA 5FJKA 2VZQA 1XYOA 4AF9A 4CRQA 2VNOA 2WT2A 3VDDA 2VMIA 4G9SB 5IWFA 4YAPA 1WMDA 1UO9A 4XC9A 4EQVA 3RDWA 3ROUA 2X09A 1W6PB 2D6LX 2PFWA 3UKNA 2O14A 2VAFA 4Q4V2 3O1TA 1YKAA 1JYIA 4JRRA 4ZB6A 1UY3A 1ZZCA 2R0PA 3SKVA 4H2AA 5FZBA 1BYEA 1JW6A 1RYYA 1E57A 2ILMA 2FLSA 1YQ2A 4DRRA 2H1AA 2DUPA 3OOXA 5CG9A 2OZJA 5H5QA 3UL2A 1ZZ7A 1SKWB 3Q19A 1RUF1 1OVSA 3I2KA 1O7UA 1DE1A 4I97A 3NKTA 4BQ4A 4EWDA 2RJLA 2GNMA 5FYHA 2CZ2A 3NAPA 2P1BA 4NHWA 4XBQA 5HCAA 3GV1A 2AUVA 4DVCA 5D73A 1J59A 2W5FA 3ZSEA 3N7KA 5F9TA 1RUF3 2VCQA 4JR4A 2G9FA 1OD5A 4DSSA 2HWF3 6GSYA 4ECBA 3A22A 5HXMA 2QUOA 3AP5A 5EYYA 2X05A 1NQJA 1ULFA 3CEWA 5IO2A 4OWYA 3CJIB 2OX0A 2DJJA 1N8JA 2Y6FA 2AC1A 2ZHNA 4JAAA 4KUNA 2IFQB 1VRBA 2F17A 1VAVA 2RDNA 3GKXA 4XIOA 5CP1A 3ZYWA 3D8CA 2BUKA 4J6GA 4CYDA 2OA7A 3KIJA 4I2TA 1DF0A 2P6HA 2R5GA 4LO5B 4Z82A 5FXVA 1ZBE3 3VKOA 1N2AA 4FPJA 3EC3A 5DALA 1QJY2 2RM23 4B7EA 2QQMA 2VTXJ 1R4WA 4HPKA 2A1XA 2ET7A 2VZ3A 5BYNA 1S0EA 1BHGA 2JG8A 2I3YA 4XF1A 4B7KA 4KGIA 2XMLA 2R49A 2FGXA 1BEV1 2WZR3 3W5NA 1GP4A 1FOHA 1CQ9A 2EXKA 2QQJA 4KB3A 4AEKA 1HV0A 2I4AA 1RMU3 3EQEA 3H8QA 4Z2UA 3RMYA 1D7PM 2GMMA 2X64A 4M3CA 2KP2A 2GT6A 4BA6A 4LBNA 5FIXA 4TN8A 1TTZA 3VBHC 4AEJA 1Y9QA 1Z78A 3GJBA 1MEC2 5A5KA 2HEYF 3VDDC 1W3XA 4PTSA 1MQTB 1VR3A 5JXJA 3QDNA 1JYXA 3WGEA 4MHUA 3B5LB 4QGMA 3GBGA 2YPJA 5BNPC 4X4JA 5A7NA 3NV2A 3Q8BA 3L2YA 4POKA 1NCRC 5C70A 1POV1 1JZWA 2WULA 5A3OA 4ZBDA 5FUIA 3I6AA 4AQTA 1SENA 1SG3A 2XBIA 1TP9A 2C26A 1FMD2 3T4VA 4Y1VA 1S1AA 1FOD3 5ABJA 4RR3A 2ZGUA 3AJYA 2YZHA 1WMFA 5AN1A 4O5UA 1S3DA 4EN8B 2YB7A 1O3QA 4LE3A 3MWHA 5GLZA 2P2KA 5G1KA 1ZNPA 1MS8A 3LFMA 4AHZA 2V2GA 1BJQA 4F8AA 2XHKA 3OUIA 4W6YA 3MBWA 5FZAA 4ZKTB 1NHYA 4K8RB 1GSUA 4R52A 3I49A 3FHQA 1S0CA 4B1LA 1XW6A 3RJ2X 2HYKA 3M3CA 1OHFA 5FY8A 3ZREA 3IPVB 2BGPA 2ZEXA 3J4UH 2WS93 5GKAC 5C3SA 4GWRA 3FX3A 3AKQA 1RJ8A 5J9CA 3GNJA 3WXPA 5ENUA 5F3IA 3A0NA 4SBVA 4UFJA 5BNQA 2DMMA 1W06A 3I3EA 2NPIA 4EYUA 5L9BA 2KP1A 1V0AA 3USSA 4YZ5A 3RWKX 4GQFA 2IVJA 2QNKA 2RMU3 4YSFA 1PO23 3LEIA 2SBAA 4ISRA 3ACHA 5DAWA 5IIZA 4PGTA 3TKPA 5EZWA 1OLMA 1GWCA 3ES1A 4XJ8A 1W6OB 3O5SA 5HR3A 2PLV1 1U5XA 5EIYB 5E89A 3HZ4A 4NV2A 4RI6A 1V40A 4AJ7A 1NCRA 4IEVA 4IVFA 2JXAA 3T2OA 5FO9B 4IW3A 4QGNA 2WT1A 1SK0A 3FMGA 2ZA9A 4A3XA 5D8AB 1H8TB 3BBYA 4PIZA 2WB9A 2HBTA 1THXA 1MS1A 2W39A 4UT5A 1BLZA 2DWRA 1UZ0A 1ND2A 5DG2A 5H5SA 1SHWB 4Y5SA 2DKIA 1QJY3 2RM22 1UU6A 2PVQA 3ZM8A 4ZU7A 2FDFA 3IPZA 1RTVA 3DYOA 1C5HA 2LSTA 2YC0A 3SNMA 3OD4A 2LQOA 1SDDB 4M3CF 3WG2A 3HBKA 2WFF1 3FZ5A 1GTUA 2B5XA 1X9MB 4ZB9A 2JG8C 3THPA 4Q4Y2 2AENA 5D9XA 4LL1B 3BU0A 3FR3A 1Z9HA 3SH3A 3VD4A 2H0HA 3Q8FA 2E53A 1SDWA 3R0RA 2F6BA 5A3PA 2YBSA 1D2SA 3QFBC 5DAKB 1GSEA 1KFUL 2YCDA 1ASJ2 2J22A 5ISLA 4EDYA 5CRGA 2BQPA 1GZWB 1U6TA 1DZTA 2QQWA 3IRAA 3FFQA 5IMFA 3VWVA 3EMPA 1PVC2 1TRWA 3MV01 1SFNA 2RIIA 5BNNA 4S2GA 2AB6A 1ILOA 3SMHA 3WUDA 1VBA3 3OBTA 3OB8A 4LORA 2H6YA 1LGNA 1OC8A 3QAWA 2HWC1 4YGEA 3QLQA 4QX5A 4GH4B 4YVSA 4D73A 3ZLPA 1NXMA 3RI8A 3K3OA 4RL7A 3CZUA 2VLUA 1STMA 2WNUA 3ILNA 2H0GA 2B9UA 4MF5A 3BKZA 4MF6A 5KR7A 3GZAA 2OADA 4BK5A 4G10A 2O8OA 1POV0 2ZHLA 1M4WA 4N53C 2W1SA 4WVMB 4BQ1A 2QFEA 5FP8A 2A70A 3LB9A 3FRCA 1AR62 4UF0A 5ANNA 1ERTA 4KNDA 4B8EA 4NHKA 5HV0A 3DXTA 3WHUA 3N4MA 2PPTA 2BERA 1SYRA 2N5FA 3ZMKA 2H73A 3UETA 3KMHA 3ZIVA 1JHNA 4CDWB 1YI9A 5E88A 5LNKe 2CQ9A 1YEXA 5FUPA 1EUUA 4Q29A 3PJYA 3K77A 4PUAA 2WQ4A 4BIFA 5EHDA 2ZZQA 1W6NA 5CB7A 4HEA2 5BUVA 5IOXA 1F31A 4XAEA 5K0UC 2X5IA 1ZCPA 4LMFA 5SV5A 3TCOA 3U75A 4MPGA 1YF0A 3TB2A 1F5FA 4BK4A 5CYYA 4P9YA 4UFIA 5J41A 4AJ6A 1SJ6A 1OQEA 5C9AB 1JTZX 3R4SA 3AMMA 2R4VA 1XWAA 4GH4C 4OI0A 3HVVA 3RMXA 4LLFA 1PGL1 2OZ6A 1GOGA 1JH5A 4C8DA 3AVSA 1W8HA 1RUI1 1ABAA 3APQA 3RZKA 3F9UA 2NQYA 2B39A 4BYYA 3KLSA 3ZMOA 2ZCWA 4F7ZA 3TEXA 1YIFA 4C1XA 2XJPA 4IE5A 4INDA 4LXLA 4W65A 3KSCA 2V5DA 3K48A 5LD0A 2A2RA 1TMF1 2JG8B 2WFF3 2VM1A 2PAKA 3O1UA 4PF1A 2J1SA 5FRAA 1OLRA 2JWPA 2ADEA 3H8XA 3CSHA 4FOVA 1AR82 3DYMA 3X29B 4LBQB 2HRAA 4YWAA 4V1Ap 4I5QA 1AHSA 3MZHA 3FUOA 2YYOA 3AL5A 1OPOA 2VCXA 3TOTA 2VNRA 1ZA4A 2ZZJA 4CP2A 5DUXA 2HI7A 4YM2A 5C8CA 1X9PA 2EAKA 3WQBA 4D94A 1WRYA 1AR61 3NKGA 2VCBA 3RBTA 4QPGB 3KB5A 3VV1A 3N3HA 3KD4A 1H30A 1UL9A 3AP6A 1OC9B 1H0BA 4GSSA 2TBVA 5JIAA 2PLV3 3N7JA 1LECA 2OW4A 4LHNA 3F4RA 4EN9B 2VW0A 4XUNA 4P3YB 3HAGA 4CP0A 5FP3A 1W3VA 1ERVA 4IETA 4IN0A 2E63A 4JDMA 3ZZXA 4XMAA 4K2DA 2FWHA 3MLKA 2WIIB 1PMJX 3BGAA 1WJKA 1LULA 2XOMA 5F2SA 3LSZA 1A0FA 2XDVA 4JQTA 4BQXA 2WRAA 4MVTA 3KTLA 2O0OA 4UFKA 4WV8A 1ULDA 4XXPA 1AR91 5EPAA 1JYWA 1SPPB 2DF7A 4FP3A 4YZ2A 4E8CA 4OHXA 2KOKA 4QHZA 4WEYA 3KV4A 2MEV2 1CWPA 3G7DA 3CHXA 4K40A 3N9NA 5KXEA 4QKDA 2OPWA 5FBZA 4Y20B 1BBT3 3GALA 4XBNA 5FZDA 2XL9A 1QQ2A 2LTNA 1NZIA 4FO5A 3N7MA 2OS2A 3T09A 3P1IA 4G19A 3S9FA 1KS4A 4WVMA 3WR0A 4PLMA 5J7MA 3VBHA 1V9U1 2JG9C 3FW2A 2R041 1V9U2 3RZLA 3I9V2 4HKWA 4AYUA 1DYPA 1V6JA 2YWNA 4LBLA 4NRPA 5IMAA 2WC2A 3I2JA 1WA6X 3MV11 2CVDA 2DFBA 3VZOA 5GZEA 3O1OA 1UVZA 2Q4SA 2HWD1 3OUHA 5J4UA 2XB6C 3ZDSA 2Q8CA 1O3SA 5JI7A 4META 3FLRA 1CQHA 3KGZA 1XPVA 2ATFA 3FKFA 2HSHA 3TBDA 4MZBA 4GB31 3VHPA 4HJ2A 5H9PA 5B4NA 4P00B 2Z79A 3PUSA 4EZ4A 3SITA 1O4TA 3ED3A 4FIWA 3FR9A 2P3YA 3LA3A 3SWLA 2G9ZA 4ECJA 3CMIA 3GZEA 3KWVA 5FWJA 3QACA 1ZA7A 4CSWA 1BEV3 6GSXA 4PDWC 4QHOA 2JDAA 4N9IA 4L0PA 2WFPA 1HN1A 9GSSA 1A3KA 3GHNA 1CAUA 3MIHA 4HG6B 4FPCA 3ILRA 4JE1A 4RHV1 5JWPA 5KWRA 1SK2A 2GNTA 3CJIA 2JB8A 4PQIA 3UARA 4Q5OA 4OI1A 2Q8DA 3JQWA 4Y20A 3K4AA 3D0ZA 2IVIB 1FNZA 3AMNA 2O8QA 2R073 1X9WB 3ME2A 2DTYA 4JQRA 4CEWB 2D7FA 1FATA 1FB6A 4TXVA 4TR3A 1VRH1 1QOTA 1GSQA 3IA1A 1DLLA 3LOIA 3WOGA 2YFZA 1I1EA 3ZFGA 4ZL8A 3PURA 1Z3EA 2QDNA 4CDXB 2J1TA 1OOPB 2NVLA 2XHFA 2Y0IA 5FKCA 2NDOA 2V09A 3ILFA 1J3RA 4LO4B 2DU0A 1FO5A 2VTXA 4KI5M 4LITA 4XQWA 1EV12 5JPMB 3IAM2 3ZFBA 1HW5A 5IAVA 1AR92 1CPMA 4ORFA 5F5QA 1G9DA 1OKQA 1VBD1 5JSRA 1QWRA 2JADA 3IWZA 4XQDA 3QFAC 1UY4A 1A34A 4BWSA 4W8JA 3U4SA 3ACLA 1VBD3 3IMMA 2B4KA 2K6VA 2O7KA 5J36A 2WDBA 1ULOA 2IXJA 3F3RA 3U0ZA 2XC2A 1H4HA 1AF9A 4BPYA 4XHBA 3GHAA 4MGQA 2JZRA 4LA2A 3M8LA 5FZFA 4ICYA 4QXKA 3ME8A 2JSYA 1KDKA 1V98A 2XL7A 3NNLA 4L8EA 1EV13 3LSDA 1JS9A 3ZDVA 1OVPA 3CKHA 2XJVA 5ECHB 3DXBA 3WNPA 5EVOA 1ZREA 2A73B 4HK8A 1E2YA 1RB8G 1R083 4RGGA 5T5JA 3I2IA 2ZMKA 2E2GA 4JHZA 3UEMA 4R4XA 3FZ9A 4O7XA 3U10A 2C0FA 3GCWA 2R071 4MH2A 1PZ7A 2UWCA 1OLME 4PLOA 2EVXA 2LROA 1GH2A 2Z4FA 3TN92 1GTAA 2DJ3A 2LV3A 3F3QA 1FG4A 4KX4A 3AYAA 1YC61 2A6ZA 2EIRA 3AJZA 4I0AA 4HDEA 2ZACA 1RUJ1 5FYBA 3TAYA 3VBSC 3PU8A 1PIV2 1URMA 2TRXA 1JFUA 1UZZA 5D2AA 1A0RP 1UA5A 2EIOA 4XS1A 3SCGA 1QJU2 4A7KA 1GWKA 4YYOA 1QIQA 3LXZA 4LKFA 4LO6B 4O61A 3TJGA 4IQPA 1Z7S2 2P3KA 4ACSA 3AZWA 4YG0A 4FOYA 3ZKYA 3KH9A 3MW4A 3H79A 2AGSA 1H75A 5CBLA 5A3UA 4YG3A 2IXHA 3CU7A 5JCUA 4GB33 2L5OA 1GNYA 1O6JA 3LE0A 4XF9A 2PHXA 5CA6A 2LS6A 4XUTA 5DVBA 1RUD2 1DQ6A 1BJXA 2J1EA 3T08A 2AV4A 3K3NA 2VMEA 4AI0A 1WPIA 1YFWA 3EB7A 4OFMA 4MUVA 1JHBA 3L78A 3WQ7A 3RDIA 1RUC1 1WLCA 2PA7A 3ZXDA 3LEMA 1LGBA 4AW7A 2BPA2 1YQ6A 1RQMA 2BP6A 4QX7A 3E6CC 2EIBA 1PGSA 1ACVA 2C80A 2GDRA 5CKQA 3N9JA 1L3JA 5C71A 1GWMA 3HIFA 3FR6A 5FPLA 2R6KA 3MO4A 3EXUA 4POMA 2F4PA 4NRMA 4LIVA 5CFDA 2RUEA 2ZGOA 2DVGA 4L92A 1K5MA 3ZIXA 5BNPA 5JR2A 4ES9A 1N3PA 2IL3A 1VBC3 1OOPA 1YHFA 2JD9A 3IK7A 3LXTA 1AQWA 1AL0G 1ULGA 3VBRA 2J1UA 3RYRA 2JDMA 1H2LA 4HK9A 3HJMA 1L7QA 2IMIA 2RS51 3WHTA 3VBHB 4NPLA 5GLUA 3CIHA 1UPSA 4GA9A 3LKJA 1Z7S1 2HLSA 4E2QA 4BVYB 2W87A 4RYDA 5BXXA 5GZCA 2W95A 2MEV3 4GWIA 3IHQA 4AI2A 1KFXL 1JYCA 4YW7A 2BJSA 1W90A 5JWQB 3D0SA 4ONUA 1HRI2 4K1FA 3IT8A 1NUKA 2CAIA 1CPNA 2C4XA 2HEWF 4AI9A 4X8NA 4Y22A 1R1A3 1JLWA 4OHZA 1WCDJ 1NE6A 3H1WA 3T3YA 4EROA 3BALA 1W6QA 2IMKA 2FWFA 1BQ7A 2VVFA 4Z2TA 4Z07A 4QT6A 4I30A 2A6VA 2GZPA 3MI8A 4XXAA 2P17A 1QGLA 3IAQA 4CCCA 5LA0A 4UW5A 4OUMA 1UY1A 3AY8A 3DVXA 4GIQA 2ZPXA 1UXZA 1MQTA 4HQSA 4BLJA 3FYGA 1BMV2 4NPRA 2DBIA 2FDKA 1AYN1 2VUAA 3LD8A 5ECMB 4CPBD 2L5LA 5E1RA 5AIXA 3U5RE 2R32A 1RUD1 1XOAA 1R081 3CSJA 1TMF3 3K51A 3MW2A 1JZ2A 3MNGA 2HWD2 1HIXA 5HR0A 2DLXA 4ZL7A 3N9MA 3ACIA 4NR1A 4PI2A 2CV4A 4FSJA 3R3EA 4HOOA 1G0TA 2JECA 4CDQB 1PGL2 4YVSC 3FN9A 2XONA 5EJZB 1O5UA 4LR4A 5G5FA 2ENRA 1GZTA 2OA2A 2D6KA 4NAXA 1DQ4A 6GSVA 2GP5A 4EL1A 5LK7B 4WM8A 4CDWA 1QEXA 2XWJB 4K3UA 3R05A 2CL2A 4IEXA 1BVP1 1R092 2B46X 4PURA 3CBNA 2CY6A 2VLTA 1X5EA 4CU8A 4IV3A 4PDWA 3IAS2 2DCYA 3ZN5A 3QOUA 2VO5A 3DGQA 2ZNMA 3WF1A 2FWEA 1KJRA 4ZILA 2JE9A 1AW9A 4AL9A 1H2MA 5D21A 1RUG2 3VN4A 2OYZA 1YJKA 2VR4A 1GYKA 2Y6JA 4HSJA 4Y26A 1H8TA 5IQYA 1VAMA 1UIJA 2H01A 4N43C 1W8OA 1WW5A 3HT1A 2PBJA 3WNLA 4X8PA 1QY4A 4GJZA 1E5SA 3H4KA 4MGIE 4TRXA 2H0IA 2BJXA 3TJFA 4K21A 2IZWA 2PAEA 4RQPC 3ZSKA 2E33A 2MPFA 4FI9A 3U37A 4ATFA 3Q8EA 3L9UA 1YY7A 4PI0A 3CMGA 4W6XA 1GSDA 4EXJA 2IFRA 5CREA 1DE2A 2R2JA 3O1SA 5LASA 4CDXA 1JZ5A 3MIEA 2EICA 1V6KA 2I1UA 3NOFA 3QBQA 3C7FA 4OCEA 1EOHA 1W2OA 1RHI2 3I8TA 1TNFA 1RHI1 5J1XA 3CJIC 1DQ0A 4KMQA 1QHDA 4E9KA 1VF3A 1ENSA 5F3GA 1JUHA 4FQUA 3V0BB 4XDQA 4Y24A 3DCQA 4PJYA 2AACA 3J26N 1S3CA 5A3NA 2FUG2 3R4DB 4LKEA 1BXHA 4O32A 4BMBA 4PQQA 3I3BA 4L5OA 2VNVA 1GLHA 1LODA 2B6MA 4MHRA 1T3BA 2DFCA 4J57E 3FZ3A 4QQ2A 5FQ0B 5IFTA 5A80A 5GZDA 3GSSA 5F3CA 1EZKA 3G7YA 2W9XA 3MIGA 2VL3A 1CX4A 4GXLA 3A0KA 3ISOA 1IYHA 1F2NA 3GBWA 1OLQA 4KNCA 2JU5A 2JDUA 5EYXA 2XLAA 1OF4A 4ML6A 4CDXC 5C3OA 1ACCA 2DBNA 1T6BX 3M2MA 2WZEA 4O9GA 4G2EA 3LW9A 5F1RA 2ID4A 1IPSA 3AYDA 1ZZYA 1IS5A 5F2WA 2BNMA 3SH5A 3VDDB 4NXIA 2G4IA 2JB4A 4D8MA 4OD7A 3H1YA 1XXUA 5FOJB 1LOFC 5EV7A 4CW9A 4IGPA 4IEOA 1FPN2 5F5IA 3WD5A 2VCTA 3ZYFA 1VRSD 1BEDA 1SZBA 3KM5A 1R1A1 1F3BA 1TU8A 1HB1A 1FYUA 1CAWA 3DYRA 4IEUA 4QKFA 4CHSA 3P3PA 1QXJA 3VL9A 2GNDA 3OR5A 5CZKA 1SLCA 4YZ3A 5JXIA 3J8F2 4P9GA 4EUYA 3PINA 1KRIA 1VIWB 1H2KA 3AKSA 3M3OA 4K8FA 2CAVA 3KTBA 3T30A 3TKQA 1BBT1 2B3SA 3PDQA 1H1IA 1ENRA 4YW6A 1KNGA 4YFZA 3USUB 4CUGA 1H1MA 4FXKB 4IEQA 4ECIA 4S2DA 4AI8A 2ZGMA 1VBB3 5KHHA 4DZGA 4HU7A 3WX5A 2C6SA 2AREA 3EE2A 4RUVA 1W2TA 4Z2AA 3FK8A 6GSSA 2ZAHA 4B4QA 1CAXB 2OUJA 1DBYA 3RPQA 1PVXA 2F8FA 1WMEA 1B4PA 3EPTA 3TRQA 1WW6A 5A1FA 4Q0VA 1OKTA 3TOUA 5LWBA 2RDQA 4MJCA 5C6CA 5JOYA 2VOCA 1FHEA 3T4HB 1LENA 2ZGNA 3Q6OA 1OMIA 4D6RA 5JOXA 1YIPA 4RS5A 1RW1A 1UY2A 2CGOA 1WWYA 1G7YA 5FZ8A 1QGVA 2WKKA 2WS91 4HI7A 1IKPA 2BNOA 1AR81 2GN7A 3B9CA 1G6WA 4NPBA 4XHMA 3WZ1A 3T1MA 1OVNA 2VW2A 1GFF2 3L9SA 5DDJ1 2E2MA 4RR3B 4Q2FA 4MZCA 1OAZA 5ABJC 4LBJA 3E6BA 2H30A 5LATA 4IE0A 2Y6GA 3VGIA 1Q8OA 4DSRA 1AR72 3G7IA 1I6XA 2YGMA 2GZWA 1T4YA 2UWAA 4F0CA 1NY72 4HT1T 1HRV3 4JVAA 4O5RA 4EVMA 1GR3A 1FOD1 4ARXA 5B4XA 2HZEA 1K45A 2NYYA 4RHV2 2VL9A 4AWDA 1OKDA 3B7MA 2DDUA 2Z9SA 2GH8A 4JBBA 4CCEA 2RLIA 5FY9A 2C8UA 5DDLA 3J7Yk 5LY2A 4AQ2A 6GSTA 3FL7A 3HNYM 2PU9C 4CDQA 1RUI3 1PL2A 1YO8A 3AZZA 3ZPYA 5A6XA 2OACA 4XEZA 1NG0A 1HRI1 3HVDA 1AC1A 1W8ZA 2R1DA 4RN5A 3K4ZA 1ERWA 3VBOB 3VBFB 2P31A 1W6NB 4RD7A 3FHKA 3RRDA 5C4WA 3UBLA 4GRFA 2VULA 2GU9A 2ZGRA 1UN1A 1V58A 1VAKA 1URXA 5D9VA 5EPFA 1GUKA 5A3LA 3MIXA 1D4VB 4AVSA 1PK6B 2WO1A 2WZR1 4NO4A 4ILFA 3R4UA 1PX3A 3NNFA 2WSVA 1QJFA 1X50A 2K8SA 3KGLA 1N1SA 5LRSA 1TW9A 4KWLA 1EV11 2D6NA 3NIVA 5K4LA 2Q5TA 2QGVA 2VQUA 1XNTA 4N10A 1YEPA 2JEMA 3K4DA 3WD6A 4HKLA 4HL0A 5DZFA 4TXWA 5GALA 4AK3A 5IVFA 3WINE 3WDUA 1H6YA 5HCBA 4CCMA 1LNSA 5HQPA 3LG6A 3ZR6A 3O7OA 2WO3A 2VLVA 3ATGA 3IIIA 3ZRDA 3EU4A 1DQ2A 1PM4A 3VKLA 2HE3A 3RVHA 1PMHX 2IWGB 5FP9A 4RFRB 2H0BA 3DIEA 3ERGA 2RV9A 1OYJA 4O65A 2XPDA 4R9BA 3KT7A 3BOAA 3MGUA 4OQ9A 1E5HA 4I3GA 5HPOA 2VCAA 5T55A 4QX2A 2ZX4A 4YM1A 3TJBA 1PSQA 5IPHA 3ZYPA 2IMFA 5HI0A 3MUZ1 1L7LA 4XTMA 1J9BA 3NSTA 4HONA 1GNEA 3M4FA 2MNGA 2YFUA 4DOUA 4XCBA 1TRSA 2RUFA 5H9QA 2GALA 4MXWB 2NPBA 5CKNA 5C8WA 1C4RA 3WYWA 1RJ7A 1Q8VA 3THTA 2CV6A 1LHWA 1QF3A 1G8WA 1E5RA 2RMU2 4OULA 2UURA 4YG6A 2H0VA 4KQ7A 3GRXA 4QKNA 3E5UA 3ZFGB 3VD9A 4AHWA 1A2MA 2CAUA 1S0GA 4KBBA 3W20A 5AGYA 4RQRA 3M3MA 4HANA 4AQSA 5J96B 2ADDA 5GSTA 5AC91 4ISDA 5FLJA 2A7AA 4CEWA 1A2JA 1LOAA 5JOZA 4DSQA 3A5IA 2KA3A 3WDWA 4K6XA 4EWAA 2DCKA 1JZ8A 4RHV3 4MGYE 4EN0A 4MSVA 5A6YA 2PMTA 4YZ4A 4QMAA 4PX1A 4CEYB 1ON4A 4ZONA 4W50A 2VGDA 1YFYA 3MF6A 3ERFA 3M8NA 5E59A 4XS6A 4QPGA 2A6WA 3PL0A 5B6MA 3N7LA 3UVTA 3PVOA 3WGDA 1CVNA 1V6NA 1WCKA 2MBTA 1MQTC 2BZDA 4XTSA 3SCFA 5FK7A 5IJRA 4AJ8A 5ECIB 3UJOA 3U78A 4H86A 2GP3A 2PAMA 3AP7A 1JXNA 2V73A 5FR3A 2GS3A 5LCZA 1NCRB 4QM8A 3J7NA 3ZXLA 5G1LA 3U1XA 1R1ZA 4EE0A 3RPPA 2BVBA 4KL1A 1M3JA 1TI1A 4MXVA 4WBBA 4ZXEA 1W05A 4MGSA 3K75B 1AYM2 1QKQA 3WLUA 1W9WA 1K0BA 1ODNA 2GSRA 1DQ5A 4XILA 5F05A 1Q8PA 2R16A 2Q30A 3GYDA 4GQ7A 1PA3A 4X6QB 1UOFA 3PVBB 1S3AA 2R0GA 5FY5A 1W6QB 3NNJA 3SISA 1J1TA 5ECSA 3LGCA 2GMPA 4GMP3 2HSYA 5CISA 1XVQA 2E9QA 1V9U3 4PIXA 1RVF3 2XJTA 3DECA 1PX7A 4ZZ8A 2FNOA 4IELA 2LUWA 1TNRA 3GHMA 4GWMA 3HZ8A 2VQTA 1HD2A 1Q43A 3R6SA 2XJSA 4CUCA 3ZL5A 1JUIA 2L59A 5IAXA 3O12A 4HZFA 4MP4A 5IK4A 4DY3A 4I02A 1REEA 2WNOA 1YFXA 1AR93 2GDFA 1LESA 2VCWA 3D21A 2WGRA 1W9SA 2R7EB 3IDAA 4CA9A 2TIRA 4XUQA 5AVPA 1XPWA 4LULA 2DJ0A 2XG3A 5FLHA 3ZFFC 2VH9A 5C5UA 3ZN6A 5FMCA 1DUGA 4MGTA 1UN2A 2GC0A 4BA7A 3IC4A 1LEMA 2W52A 2PLV2 1B4QA 2VUPA 4XIHA 5FOBB 3ZXAC 2WUHA 5FZ9A 1ZRRA 1RUNA 2H1BA 3O6TA 2OE0A 1G6YA 1UZVA 2CGNA 4JKMA 3PGTA 1KQRA 4Y5Z0 1OA3A 1PRXA 5CFDC 1X5DA 3POWA 1DLCA 3IOSA 4LE4A 1O3RA 4XUOA 2RHPA 1QOOA 3UJQA 3KF3A 1OA4A 1PNFA 4DFSA 3ZFEA 5FPBA 2VCMA 3GM8A 1K5MB 4GALA 1F8VA 2N7GA 4NMIA 2VCCA 2L57A 4YGBA 3OUJA 2L4QA 3LPFA 4FXGB 2V6OA 2LNTA 2EAAA 2FDJA 3H3UA 4CP9B 5HCHA 4O9EA 3IR4A 2H70A 3HVXA 3BPZA 1U3IA 1IG0A 1UZYA 4COVA 3I97A 3ZXEA 4P9XA 2VOXA 2P5BA 3O1RA 1O6UA 3O3TA 4PHZA 5EL8A 4HKOA 2OXBA 2VMDA 2OBKA 2OBIA 3LIGA 5ELGA 3S5QA 2NN8A 2ZJCA 4OLLA 5A7OA 4QB1A 4OMCA 4PBOA 1NOVA 5D1IA 3GL3A 5FQ0A 5FJHA 1UYZA 4Y22B 2HH9A 5F6KA 2WN2A 5IUQA 3NQHA 3KEBA 1XE0A 5CADA 2YJHA 2L9LA 2D98A 4FFHA 2WNVC 5F0GA 3KCMA 4RS5B 5IMZA 2Q8OA 3NV4A 4K5SA 1OQ1A 2YV8A 5EJ3A 3WW4A 1OT5A 1VE0A 1RGSA 2A4VA 4L99A 1W8NA 3ZSJA 4K8MA 4COYA 3E9JB 4UFHA 3I2FA 1XOBA 5IMCA 3J7HA 3LWAA 2D93A 3WGXA 5BPXA 1V70A 1GQHA 3OCPA 1FV3A 5IMVA 3MICA 1BK1A 5L71A 1W9YA 2WZR2 1JLVA 1HJGA 4XW3A 4Q0QA 4WR5A 2QZ2A 5HXVA 3E0UA 2AJQB 1IS4A 4UXAA 4XCSA 4ZZ5A 4FOQA 5C33A 3Q8CA 4PQ1A 1TRVA 3DMLA 4FPOB 4OFTA 1C1FA 1J83A 3UGHA 4OHVA 3CXGA 1OFSA 2HWC2 3OD0A 4UWDA 5FREA 4XJUA 5FK8A 3GKMA 3H42B 3GZUC 1YQCA 2HBUA 1W8FA 1GSSA 2O89A 3A2XA 2L6CA 1C1LA 1AYM1 2E0QA 5ECQB 5JPNB 2WZ9A 2IIYA 1ZRIA 1G9BA 1LU2A 4LK7A 4XF0A 2HWC3 3CSIA 4XE9A 3VDBA 3WEZA 4AI3A 1XZOA 1EGOA 5JVVA 4WVWA 3MIDA 2VMHA 5LZ6A 1VBA1 1G6NA 5FZCA 4O5QA 1W0OA 1J84A 2L4CA 1ULPA 3HD5A 3LGRA 1TG7A 1EP0A 4BM8A 4CDUB 5D96A 5HR1A 5DMYA 2MMOA 3JUUA 2WCIA 5KC5A 4NPMA 4Q27A 3L9JT 5G05L 4ATEA 3P7XA 1JZ7A 3ZYHA 2ARCA 2WFF2 3TB0A 3KV5A 3NJZA 2QSIA 2LRTA 5G2ZA 3VBRC 5J98B 17GSA 2EC4A 2PYTA 2X8KA 3G6JB 3LF7A 2A4HA 5DUVA 4Q4V3 3TKSC 3H7JA 1G7OA 4AFDA 2RS11 2IPAA 4WR4A 1Q8SA 2JDNA 3GF6A 4G0IA 3OPWA 2CAQA 3ZX7A 1PIV3 2H71A 4QU1A 4FYUA 1QJY1 4MGKE 1XWGA 4NAMA 4ZBBA 1DZQA 5BNNC 4POBA 3H0OA 1BK0A 2VE1A 4HXCA 3OBRA 3HVNA 3IM0A 5FZ0A 1F37A 2JACA 3GH6A 1BQPA 2D97A 4IQ1A 1PZ9A 5I8TA 1V6MA 4YNIA 2DUQA 2JJ6A 3F2ZA 4QPIC 4AGGA 4QAWA 2ZGSA 1UZWA 3THCA 2VL4A 5EFUA 1EV9A 4FPYA 1OI6A 3OGGA 4NAOA 3DWVA 3IIAA 3OPTA 4BVYA 3H3LA 3AC0A 4L5LA 3WSOA 3WV6A 3ZXFA 1MS3A 3OSDA 4AVAA 3IBHA 1PO22 2QQVA 2PHUA 4AR2A 1C57A 3JZVA 4A5PA 2BOJA 4MH0E 2BRTA 4XACA 2E32A 4BE3A 4CDUA 1K0MA 3OG2A 1DYOA 1OUSA 2ET1A 4BQYA 4XFAA 1CGPA 3OGJA 4UI9L 1L7RA 1CZTA 1VBB1 3QPMA 4NRQA 2OIIA 5FFOC 1AXDA 2BFUL 4MZWA 2CYFA 3IAPA 3GMFA 1U12A 4P5HA 5AFBA 1G9FA 1FB0A 4M3CE 1UD1A 3MDPA 2WLPA 1HB4A 2DC5A 3H8OA 2WA3A 3APOA 1EYBA 1UX6A 4DY5A 3IK9A 4IE4A 4IS0A 2OVUA 1EPWA 2V6KA 2YN1A 1VMFA 4Q4W1 5DUWA 3J8F3 4LQRA 4WBRD 4EIQA 1WA4A 2AR6A 1XRUA 3M9JA 4CUBA 1U5YA 3HNBM 4OI2A 2ORZA 4G9HA 1Q56A 1T00A 3RZHA 1ST9A 1APNA 3D6IA 1N1VA 2F8AA 3HHVA 1B09A 2YBKA 4WZFA 1POV3 2L6DA 5KN3A 5LW9A 4XIKA 1T2XA 4AEMA 1ZMAA 1XFLA 5FZGA 5M0TA 2IN3A 5F06A 5IVEA 2ZX1A 4JCKA 1ASJ1 5FO8B 2ES7A 1BG5A 1ZOFA 4HMZA 3C73A 2XLFA 1A78A 4TR1A 2WWJA 5COHA 1D0GA 2WYSA 3FMWA 2LUSA 2BYVE 2ZKLA 3ME7A 4GMP1 4QDQA 1ZBA3 4M0NA 1QXRA 3ZPOA 5CKMA 2C24A 1JZ4A 1O8SA 1FI2A 4P08A 2M72A 2QA2A 2F4LA 4ZS3A 3IN9A 3C7EA 1GBGA 4I6XA 4QQ7A 2FZ2A 3RNSA 4USSA 1RXFA 5FYCA 2KLXA 1RIRA 4OO4A 1O81A 3AK0A 6GSWA 2M80A 1ZBE1 3O0WA 1H6XA 3ZR5A 4QX3A 4XJZA 4XBLA 5CRHA 4PIYA 1XE7A 1HLCA 4XPVA 2X10A 4KGGA 5J3RA 5GZGA 1F2EA 2NM1A 1LCLA 5FDBA 3NZNA 1S0DA 3CTGA 4JKKA 3H93A 2ETEA 1ZVFA 5JCTA 4HSLA 4J1XA 2FQPA 5IATA 1VALA 3BTAA 3OGSA 2YV9A 1WMJA 3K46A 3QH6A 1YFUA 1ODMA 3I4IA 4LLRA 4CCLA 5DN2A 1ZX5A 1GP1A 4PNFA 3TEWA 2W91A 2ZTNA 1A8LA 4GQCA 2WT0A 2VOVA 1N47A 1T1VA 3D4MA 1EGRA 2YU2A 4E8DA 1YXWA 2HWF1 2DSAA 4W6WA 4YKGA 2HWF2 3N9OA 3UL3A 3PJQA 4RA0A 3EMXA 1NY71 2R061 3PVNA 1QMJA 1X9SB 3Q18A 2JIJA 3J7LA 3M9KA 1MZEA 2FA8A 1TRUA 4I3PA 7GSSA 2CU5A 5I0TA 4BQWA 1PX6A 2A75A 3ZVJD 4N30A 1DDLA 1SYXA 1QJZA 2C4JA 3EYPA 4AI1A 4KW6A 2CT6A 1WWJA 3SCHA 3BIEA 4HZ2A 1XQNA 5IK8A 3MDKA 3ZN4A 4EJRA 2C9KA 5J9BA 4I8BA 4P14A 5LB6A 4LO8A 3E5XA 1WZXA 4MJAA 5BNPB 1WKYA 1ND3A 2K18A 2PMWB 2I45A 3B01A 5T5PA 4C90A 4R8HA 5D93A 1G86A 3IDVA 4DUWA 5LA1A 1PMTA 5JWRB 1SL2B 4KWUA 5LA9A 2A71A 3HNMA 4AFAA 2HJIA 4TXOB 4KH9A 4E27A 5E8AA 3WDXA 1UU4A 4IJIA 2EXJA 4Q4X2 2ES3A 2H6BA 1O4YA 4IV3B 2BBVA 3B94A 1MEC1 1IG3A 5FZKA 3LFLA 3BVCA 1PK6A 2RDSA 4YARA 4RI7A 5ABRA 2GH2A 1XU1A 1USBA 4IV1C 4EO3A 5ACA1 2J23A 2WNUC 4WM8B 4DXSA 3OYWB 2H66A 2ARAA 3POIA 4YW2A 4FYCA 2ZCTA 3I59A 4MABA 1MS5A 3AMPA 2RG4A 1PVC3 4KE3A 4DMIA 3POEA 3RFRA 3JBG3 1U5IA 4P9LA 2G19A 4CE8A 1GSFA 1M9BA 3WCRA 5ECKB 2XKOA 1GZWA 4Y1YA 3S6PA 2DIYA 4E4SA 5JI9A 3UMAA 1SBEA 3LYPA 2RR12 3LIHA 3F95A 4MV2A 1CAVA 4C91A 4NVPA 1R5AA 2W92A 2WZ8A 4OFNA 5FYSA 1LB2A 1W03A 4KG0A 2B5HA 2GZYA 3KH7A 4E2SA 5DJMA 4AG4A 3MHZA 1H9PA 1VBE2 4QB2A 3NJXA 3A2WA 3VI7A 3ST7A 1V6IA 3AZVA 4NWVA 1LU1A 1VBE3 4FAGA 4LBQD 2DVBA 5FLIA 1A8DA 4HZ4A 4NHLA 5CFCB 1M06G 3KV9A 5CVRA 2KR2A 1TME1 2B7JA 2UU8A 2WABA 2WL1A 5JCGA 3POGA 2LTKA 5CEHA 1M7TA 4JZQA 2R0HA 2D5HA 5ECLB 3RJRA 1VBC1 2X5IB 1QQP2 3MIFA 2LW8A 4BIOA 5HR2A 1GICA 2LJKA 2XUEA 1GTBA 1QDOA 3JBG2 3ELNA 4JC1A 5FXZA 4XOGA 3OY8A 3KP9A 3FLPA 4JDOA 4MXWA 1DFQA 5JZGA 3VWXA 4JR6A 1BEV2 3GN3A 3VBUC 3EURA 1AL23 1QXHA 5F32A 3GXUA 3BTYA 4W4ZA 4GULA 1WOUA 1GZCA 3H1MA 1OSGA 3N35A 3QD6A 4DSSB 1W0NA 3CDZB 5J48A 4XETA 3VD5A 4RGKA 2DV9A 1NW2A 5DDJ3 3O76A 2HWE1 4HPKB 4XZPA 2FA4A 3I2DA 1HQNA 1S0IA 3ZYGA 1AR83 1COV1 2K8VA 5IK7A 4UBHA 1ZZ6A 3AFKA 5FWGA 5F07A 2VMFA 4NN0A 4R4ZA 2QQOA 4FPKA 3HQUA 1EAH3 1S3RA 1WIKA 4V1PA 1WW4A 4GZ9A 1OFNA 4JGZB 3PTYA 4RR3C 2EXIA 4XDPA 2LS5A 5IO0A 1Z7PA 1EY2A 4PQ9A 3EWLA 2JZTA 3IKWA 3RZGA 1OURA 4AVCA 3CRTA 1RUH1 3MPBA 2WN3A 5FZ3A 5JMOA 2H8LA 4OMVA 5FP4A 4HS1A 4B3NA 5KC6A 2OQ7A 1K3IA 3FE5A 4IHUA 5FYUA 3QAGA 2WSUA 5FAXA 4QPWA 3TKSA 1TJDA 1H2NA 5IOWA 5AFEA 4ASMB 2DYCA 1K3OA 2X8CA 3VWWA 5C3QA 4YFWA 3SEPA 2IWTA 4XHXA 4Y1UA 2ZMNA 1LGCA 3UV9A 5JZGC 4N53B 1WD4A 4MK3A 3VBUB 2H1GA 1AUYA 4K5RA 4BIKA 1KDMA 2NMNA 4BMEA 3TRPA 3KMNA 1LOCA 4A4AA 4Q1RA 5LA2A 1Z7RA 5JZGB 2VXRA 3SQOA 5IYYA 2QC7A 2W1QA 1X5CA 1SLLA 4KSOA 3UAPA 3ZFGC 3C7GA 5CIRA 3RAZA 2B7YA 3GKNA 1RUG3 2VECA 2WA4A 1C5IA 4HSCX 1OH4A 3BCKA 1FPN3 1TK0B 13GSA 2QQIA 4JRLA 1VB2A 4JRAA 4D6SA 3POFA 1MVQA 2TNFA 4GJYA 2PVOC 2C0EA 5A6QA 2K2SA 3GYKA 3C7MA 1Y4WA 2CWSA 3JBG1 5FY7A 1XB9A 3Q8AA 1PVC1 3TWIA 3WNKA 3BYWA 1CIWA 5K8SA 4LOTA 5APAA 4XDOA 4X1UA 4ASLA 2I2SA 4ML1A 4UW3A 4A2UA 2W46A 2WO7A 4P02B 4XURA 2W1UA 4OFGA 3WG3A 4G3YC 1TDIA 3I3MA 3BCWA 4RFT0 2VTFA 1EWXA 4XZUG 5L73A 2R37A 3HKRA 1G7EA 4LHKA 1NXD1 2P4EA 1F9MA 2HWB1 3F63A 4JX0A 1K5JA 16GSA 2WZPP 4ZL9A 4ULXA 3KCCA 3POYA 3BCIA 5SV8A 4AE2A 1IQAA 3VKNA 3ZKUA 1H4OA 4LKDA 1MZFA 2ZXQA 2GMEA 1VBA2 4L11A 5DCGA 2A3YA 4V2VA 2AEZA 3VD3A 2PHLA 4FCAA 1F5JA 2RR11 3GL5A 1RHI3 1SU9A 4XFCA 3I59B 2HYXA 1AXYA 3GJAA 2ZGPA 5E6HA 1FVKA 2VBPA 2HLEA 4AGVA 3O14A 3PVEA 1J3QA 1JU4A 4A3ZA 3FBYA 5GJ6A 1D4M3 3HA9A 3TNQA 4U2AA 4Q1PA 5H9RA 4GB32 2VUCA 5J3UA 5KN1A 2JE7A 2GQKA 1GUIA 4MDCA 1NAEA 1ENXA 3BTXA 2QQPA 2ERFA 2FWGA 3BI3A 4N9HA 1NA1A 3IZOA 1K42A 1FMD1 1X0RA 3PR8A 6GSUA 4Y5TA 2MMAA 1E6BA 4IV3C 3RS6A 3EHKA 5IVJA 1R082 2JDHA 5FYTA 3ZVJA 2YJ7A 4N90A 3J9SA 3BOWA 3OBZA 3D5OA 2HWB3 3TEZA 1VB4A 1AIUA 1TKDB 2WINB 1FOD2 2H19A 4M0HA 3M3IA 4Q8LA 5CFCA 2JL4A 2OKXA 4CZSA 4AAXA 5T5LA 2R042 4JGYA 3MLLA 3ACFA 2PQSA 2X29A 3M3EA 5L9VA 2DCTA 4Y3OA 3A23A 3NL1A 4JZRA 1UC7A 22GSA 1PO11 2F9SA 3O0VA 4C1WA 4K2XA 5I91A 2FCTA 3VZKA 2GQLA 3M1GA 5FMBA 2JD4A 2WWUA 1I5GA 2SLIA 1ZRFA 2BMXA 5FWEA 4EF0A 3ASIA 4BL7B 2K46A 1UW8A 1XBSA 3H9AA 3KQRA 4AFBA 1GTIA 1KXGA 2A3WA 3SC7X 4Z2WA 2C1YA 1A24A 2OT7A 1ZL9A 3GCXA 3N5OA 4J56E 1UKGA 1FPN1 1F4HA 4F83A 2V72A 1XIYA 2A5ZA 2EA7A 1RUG1 4LKSA 3NRUA 1VLNA 4ZXGA 4Q0SA 5GAND 1MEKA 2GSSA 2GVPA 1FAAA 2JX9A 3UT0A 2W47A 2YP6A 1RUD3 4NUBA 1Q5OA 3ZTLA 4ET7A 3S30A 1O91A 2BGOA 1W8UA 2D3PA 4C0HA 3HY2A 4YLZA 3ETPA 2W1WA 3CYNA 1VBD2 3ZITA 3SXWA 1RUE3 1AR71 1Y43B 2VOKA 3ZMNA 4LK6A 2OKAA 4OZXA 4H14A 4K1YA 4JGZA 4QQPA 1ENQA 5FPXA 4HVRA 1M2DA 3F4SA 1CZVA 3GH9A 1EP8A 2O1QA 2B1KA 3S57A 5DUUA 5K9YA 2Y6LA 1UWWA 3BIWE 4QX0A 4P9IA 1JZ3A 2BVVA 2E6VA 3OPZA 5A3MA 4Q0UA 1LHOA 4K0NA 2GC1A 3A21A 3HR9A 2HRKA 3WF0A 1US3A 1OPMA 1Y9GA 3LEKA 1MVEA 3DEMA 3KVAA 3VZMA 4NE9A 4D69A 2WYFA 3J8F1 3ES4A 1NCQC 3AKPA 3UNPA 1MDIA 4QPIA 2YNXA 1DGRA 4TN7A 3BN6A 4M4RA 2ZGTA 1EAH1 5C5TA 3VK9A 2MEV1 5LK5A 2ZUPA 2MHFA 4COUA 1ZRDA 1W2UA 5F8BA 1ZYQB 4HBNA 2W68A 1B9YC 2YMZA 3C2UA 3IMNA 5BRTA 1MPXA 3WT2A 4UFMA 1S2BA 1NCQA 1QQP1 2YGLA 1LOEA 1NX9A 2YHJA 1CIYA 1TK5B 4EDZA 4Q5QA 2EF6A 1RITA 4MJBA 2YPMA 4QX1A 4YM3A 3VZNA 2C0GA 4XTPA 2X53S 5HCFA 4NHMA 4JTOA 3ZN6B 1QNYA 3ENRA 4IKHA 2REMA 2OQ6A 1AL21 1UMIA 2WAOA 1BKZA 3GTUA 1AQVA 3GA4A 5ANQA 1ZBE2 4X6RB 3VDAA 2TUNA 4K7NA 3WDYA 4MZUA 2Y6KA 3AVRA 3LQCA 1ML6A 2PHDA 5AVAA 5IFPA 1WBLA 4IP1A 1YJLA 4DEQA 4V2LA 2D3RA 4YPJA 4ISQA 5B6NA 2X8HA 1PM7A 2X49A 2Z2SB 1OA2A 3H8UA 5FPAA 3CTFA 1TME3 2C9AA 3DF0A 5A6ZA 3KCYA 1SCSA 1GP5A 2WS2A 1H4GA 1TU7A 3RQ0A 1N1YA 5HFIA 4BISA 4V1Ag 1CAXA 4L8QA 1XW9A 3DPRC 4YRDA 5EWSA 4IP6A 1Y3TA 4JU5A 3T1LA 5FP7A 1GL8A 4WKWA 2BBAA 2Z42A 4CEWC 4LMWA 1R64A 3UBKA 3FZAA 3HYPA 4EIPA 2NTOA 3E1F1 1ZM1A 3MYDA 5DAQA 5CAXA 3MFAA 2H72A 3UESA 2VU9A 2FBEA 1DG6A 8GSSA 1FNYA 1QU0A 3OF1A 4HN1A 1RUE2 3AL6A 3J7Yb 4FQZA 2ZABA 4LHSA 2DVDA 1US2A 5KHJA 2XBO1 4A41A 2UWBA 1KEXA 5JIUA 1DU3D 1A8MA 3VBUA 4XQ4A 2LEGA 5DBQA 2Y64A 1GNWA 4GLTA 3CJXA 2FHEA 3P8WA 3GZTB 2RM5A 5F8PA 1GUHA 3POBA 2ZS6B 1IPJA 4XS4B 5IT6A 4ASKA 4NHZA 2E26A 4MH3A 2HKXA 3VLBB 2J1AA 4AOCA 4TYSA 5L19A 5JWOB 3QAVA 1ZZ9A 2VD7A 1PX4A 1NA1B 2FD8A 1A23A 3WUCA 2QJVA 4Q5NA 1JU3A 4Z1VA 1MEC3 1DHKB 4GWJA 5FMDA 2PTMA 1YCIA 4E4DX 3I3DA 3WP4A 3VZJA 1XWBA 2VQAA 3N36A 3SHRA 2Y34A 3AXEA 5FXXA 4DO0A 1GSLA 4Q26A 5FKBA 2DVFA 1IOAA 5GLWA 2VL2C 5LBCA 1PN0A 2XHNA 4KDXA 1TME2 2Q8EA 4LTAA 3HVSA 4AGRA 3SBCA 1EOGA 1AVBA 4RQPB 2CHHA 1UU5A 4QGLA 5FZOB 4XCAA 2DJ1A 5DCHA 3N9LA 1LHNA 1QXPA 5A32B 4UF0B 1BX9A 4TVEA 4YGDA 4AZZA 3L4NA 1OF3A 4TTGA 1CD3G 1KD7A 3A4UA 4Z92B 4AAPA 2E51A 4YAVA 4Z2RA 1OC9A 5JDBA 2IXCA 4PLNA 1D2QA 1W8WA 1NM3A 1R26A 4XFGA 3FJSA 3RI9A 1CQGA 3G9BA 5A33A 3V1WA 2R1BA 4QPYA 1M0UA 1TOFA 1GU3A 5A32A 2QQNA 1JYTA 1AYN2 1JYVA 2K9ZA 2KHPA 1O8WA 2QQLA 1QH7A 3TUEA 3POJA 2C1FA 2VXJA 2QE3A 4FO9A 1SD8A 14GSA 3TDGA 2W3JA 2C0ZA 5C3RA 2RS33 2VNGA 2DCJA 4K9SA 4ITCA 2WWSA 4BL7A 2LRNA 2BV4A 1XXNA 5ELAA 1GANA 4PUFC 2ZAAA 4DXRA 4FFIA 4XJAA 2FHRA 4MOAA 2HRNA 4LJHA 2QTWB 4GXZA 1MACA 4NV5A 4AFMA 2YPDA 3RHBA 4Q4Y1 1JZRA 5J5NA 4PBPA 2GSQA 1FV2A 4B29A 2VQ0A 2B5EA 3Q9OA 1J58A 3TRSB 5C4WC 1NHOA 1R091 1FVJA 1TE1B 4I2OA 5F6LB 2HNLA 4MNNA 3LDKA 2VZSA 5FMOS 1GP6A 4NWWA 2YBPA 1SL1B 3VL8A 3KCXA 4BQ2A 5K0UA 4OQ8A 2NBSA 1CAUB 2Y8KA 3EU3A 1SFYA 1YWKA 1ND2C 3DPRB 4P9WA 3W21A 5AISA 3QR6A 3ABZA 2PHRA 1JODA 4XYXA 3ZO0B 2XVKA 3D5JA 3OTFA 5GZZB 3APSA 1FW1A 3VB9A 5JMCA 1ZBA1 2WR9A 4L2NA 4B1MA 2ARBA 4OUEA 1HXS3 1MS4A 3UKVA 3FUQA 1OE8A 3ORJA 3PNAA 3AYCA 5H9SA 3Q74A 5I8YA 4OUSA 1U0AA 2Q1ZB 2EIGA 2B8MA 3ZOIA 3KV6A 1DGLA 1VMHA 2Z69A 2QQKA 1W4VA 2PGTA 4QL9A 2A2SA 4QXHA 1ZZBA 3E6DA 1Y6EA 1HNAA 1XWKA 1TEIA 4XJ9A 1O3TA 2XVGA 3TJKA 2E7AA 2GZZA 5AIVA 5GZFA 4KAEA 4ECCA 1PL1A 2ZX0A 1J0FA 5LEKA 1BYHA 4LEJA 3H50A 3OEAA 4WBJA 3WW1A 3RYKA 1NZCA 2VBBA 4CY8A 4MLOA 3PPUA 5A7PA 1WMXA 4NJ4A 3HT2A 2VCVA 1SKRB 3KZQA 4FTBA