2HYXA

Structure of the c-terminal domain of dipz from mycobacterium tuberculosis
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
333
structure length
333
Chain Sequence
GAMEIREQLNLGGIVNAQNAQLSNCSDGAAQLESCGTAPDLKGITGWLNTPGNKPIDLKSLRGKVVLIDFWAYSCINCQRAIPHVVGWYQAYKDSGLAVIGVHTPEYAFEKVPGNVAKGAANLGISYPIALDNNYATWTNYRNRYWPAEYLIDATGTVRHIKFGEGDYNVTETLVRQLLNDAKPGVKLPQPSSTTTPDLTPRAALTPETYFGVGKVVNYGGGGAYDEGSAVFDYPPSLAANSFALRGRWALDYQGATSDGNDAAIKLNYHAKDVYIVVGGTGTLTVVRDGKPATLPISGPPTTHQVVAGYRLASETLEVRPSKGLQVFSFTYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein dipZ
publication title Structure of the C-terminal domain of DipZ from Mycobacterium tuberculosis
rcsb
source organism Mycobacterium tuberculosis
molecule tags Unknown function
total genus 92
structure length 333
sequence length 333
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
A PF17991 Thioredoxin_10 Thioredoxin like C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2hyxA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2hyxA01
3KIJA 2V72A 2MMZA 5ELAA 2PWJA 3TKSA 3EWLA 3BBYA 2H1GA 4GSTA 3ZIJA 5B6MA 3I3DA 3T08A 3N9JA 3VI7A 2VD1A 4FYBA 5KN0A 1UYXA 5HXMA 5A4VA 3CZJA 3LEIA 5JCGA 3HD5A 4Q5FA 2YWIA 2Y6LA 18GSA 2VZRA 1XVQA 1FW1A 2IMDA 2P5QA 1WE0A 1S3DA 4IGJA 2GQLA 1JHJA 3CYNA 2EC4A 1U3IA 1ZYEA 3ZMKA 4MJCA 2VCXA 3F3QA 4ZL7A 2HT9A 1B48A 1OD3A 3HJRA 2DJ2A 2J1AA 3LYPA 4QL9A 1PGTA 3ME7A 1W0NA 3HZ4A 1MPXA 2LV3A 2YOIA 3IC4A 1X9WB 1SL0B 4KH7A 1K0AA 4KB3A 2YFUA 3IK7A 2CA8A 3SKJE 2WJUA 1JZWA 3DMLA 1UXZA 2R3XA 5ABRA 2OE1A 1R7HA 3D3AA 4ZBAA 5ECLB 3I69A 2H73A 4JKLA 4UAPA 3LYKA 2VCZA 4UI9L 1XWAA 1K0OA 2VIMA 1AXDA 2F9SA 2WAAA 3FHAA 3HPNA 1JYXA 4HJMA 1XCCA 2VC9A 2RLIA 2AAWA 2W1WA 2X09A 3EB7A 3WF0A 5D93A 4F82A 2WGRA 5DCHA 4MABA 4QX2A 4D73A 1CIYA 3HVSA 3LGCA 2PUKC 1L7QA 2WDUA 4JZQA 3WNKA 3WNPA 2HSHA 9GSSA 2L57A 4TR1A 5D9WA 4MO3M 4OMDA 1RYYA 5G1KA 2IMFA 5CYYA 5IMZA 2WZEA 3GHAA 3QCPA 1US3A 4A41A 1O6JA 1U87A 3RHCA 2BBAA 4D73B 4AGSA 2VAFA 1KNGA 2BMXA 3J7HA 1AQVA 1BX9A 1TKDB 2I3YA 4MJAA 2H0GA 3DWVA 4KNDA 3NJXA 1HN1A 3LEFA 3TRXA 1H6XA 3GH9A 4ARYA 2QQLA 2BGPA 3FR9A 1YEXA 5C70A 2M80A 1PMJX 1EWXA 4NHWA 2C3QA 2Y6JA 3HXSA 1UA5A 4GSNA 4LHSA 3I2IA 1JLVA 3PH9A 4ECBA 2VO5A 3KXOA 4XS1A 2YN1A 2FY6A 3CXGA 3DD3A 1EGOA 4CU7A 2CX3A 4IHUA 5DAKA 3CDZB 3C7GA 2YWOA 3M1GA 4GWRA 5IMDA 4TVEA 1I5PA 2VMDA 1BG5A 5ECMB 5EIYB 2F8AA 2VZSA 1GUIA 3QAGA 4M4PA 2DBCA 1IQDC 4DVCA 2LUSA 3DYRA 5KEJA 2GGTA 3HCZA 5J5NA 4L0WA 1R64A 3MAKA 4QPWA 2PMTA 2J1TA 4GXZA 3LFLA 5CAXA 3SBCA 4DXTA 4ZZ8A 2ID4A 4WEYA 2XC2A 5IQYA 3TUEA 2H01A 3C73A 4QAWA 4PNFA 2RVAA 1FAAA 3ZREA 2QQNA 3E3EA 2PN8A 4KW6A 1ULOA 2VCTA 2W87A 3F9UA 2GTUA 4LKSA 1PX7A 2KOKA 3A3TA 2IWTA 2FA4A 3QDNA 2H70A 3J7Yk 5ECSA 2AUVA 5IOWA 2B7JA 4NPBA 4QB1A 1GUHA 3VWUA 2VZQA 2MMOA 3D21A 5DJLA 1RQMA 3GNJA 1YKAA 4ILFA 3GKKA 2VCVA 3D22A 1NHOA 3WNLA 1HNBA 3H79A 3S9FA 1W4VA 3M9JA 3HVVA 4GLTA 5CNWA 2CQ9A 4O5RA 1K3YA 2AB6A 3LPFA 2GSQA 3QD9A 2N5BA 2YWNA 3F4SA 2A4VA 4PQIA 2AHEA 1ERUA 2VLTA 2HRNA 3DEXA 1GU3A 3ZYWA 3ZVJA 2ON7A 2E26A 2B1KA 2VMFA 2LKUA 1B4QA 2QGVA 5COHA 4DSQA 4JHZA 2DJKA 3GFKA 2X64A 2HXKA 2Y8KA 2XONA 4MADA 2J7MA 2YPMA 4JR6A 1DUGA 1GSFA 1EUTA 3QAWA 1GNYA 1A0RP 3UJ1A 1HD2A 1TVGA 1QGVA 2RIIA 3NZNA 5J4UA 1T3BA 1J83A 4JBBA 3FY7A 3WGXA 1XWKA 3I2HA 3NJVA 5DPNA 5AGYA 4JE1A 4OO4A 4EL1A 3VPTA 3I97A 5C00A 2VM9A 1J84A 2IIYA 2VZ1A 8GSSA 4TR4A 2AYTA 1I5GA 1SG3A 3TJFA 5L71A 4K9ZA 5ECQB 3G7JA 4G2EA 4BK5A 1SKRB 4PUAA 2V6OA 5HFIA 3JXSA 5INYA 2H1AA 3G7IA 1M9BA 1JZ6A 2VLVA 4I5QA 3WEZA 1TXXA 4QL7A 3ABZA 5CZKA 2DJ3A 3FW2A 1URMA 4BVYA 3PUIA 3WSOA 1PQNA 2H6ZA 5IMCA 3ZFBA 2W46A 5HQPA 3GSSA 2FGXA 2DCJA 3MSZA 5DQSA 2QSIA 1TRUA 4POBA 2LNSA 2H76A 1AQWA 2GS3A 2V6KA 2E31A 2LJRA 5H5RA 3Q18A 4ZIJA 1U6TA 5JWQB 4MGQA 1GMMA 1Q98A 4XRDA 3TKPA 3PUHA 2C0FA 2KD7A 1SKWB 1G7EA 2FUG2 1W9WA 1WIKA 1YY7A 4WR5A 3CRTA 3TJJA 4D8MA 1T4YA 3L9UA 1S3CA 3I3EA 2H75A 3FR6A 3QOUA 3MUY1 4IN0A 1TK0B 4K7NA 4MPGA 3GIXA 2QQJA 1OC3A 4IKHA 11GSA 3W6GA 4K7IA 4WBJA 2L6CA 3HZ8A 5IMVA 5ECRB 4JKMA 1CZSA 2Y6KA 1R5PA 5JXIA 2FWEA 1SENA 3LEKA 1I9DA 4XUPA 4J56E 4LMWA 5JXHA 2GQMA 5J3RA 2TRCP 5ID2B 4YQVA 2H0HA 3DGQA 2AV4A 5G31A 3KP8A 4GCIA 19GSA 2XPEA 2JU5A 3HKRA 1OC9B 5IFTA 1WMJA 3CMIA 1JYWA 3ZMLA 5JCWA 4PNGA 1MD3A 1WOUA 1QUWA 5DDLA 2VL2A 3ZL5A 2VZTA 1UZ0A 5LNKe 3IAPA 1V40A 5DQYA 1MEKA 2QQOA 3EMPA 3OEBA 4GRFA 2JD9A 1WCQA 5FT3A 4MDCA 4BL7A 2GVPA 1UY0A 2ZEYA 3NNGA 4MP4A 1S3AA 4JKKA 2L6DA 2V32A 6GSUA 5GSSA 3BGAA 1M0UA 4XRAA 3HNYM 1SL2B 5F8BA 3PR8A 4HQZA 2J1SA 3K46A 2I9HA 2J1EA 2C0GA 1KBNA 4ZILA 5CRDA 4UOJA 2JZSA 1Z7PA 3C7HA 4W8JA 4J2FA 2D2ZA 2O85A 1X9SB 2B9VA 2H1DA 3VPQA 3IOSA 1YQ1A 3KM6A 5DALA 1JU3A 4QQ7A 4HU7A 2WB9A 5JXGA 3LORA 2LJKA 2ZEXA 4FO5A 3T0DA 4G10A 2X8HA 2C4XA 5EL8A 2OKAA 3I43A 3P6BA 2WN3A 2BZDA 1HNAA 2Y64A 1GWCA 4K1FA 2MYGA 3HVXA 1VF1A 4MMMA 1DP0A 3BJ5A 1QK8A 2JSZA 3ECQA 2VZUA 3W5NA 3LE0A 3TB2A 3A7QA 2V5DA 4RI6A 4IQAA 5DALB 4N0VA 1Y25A 3FN9A 1JZ3A 2WCIA 1ERWA 4XS6A 2J1RA 4NAXA 1FO5A 1NX9A 2K18A 3OG2A 2DJJA 3IBHA 3WT2A 4TKYA 3HA9A 4TW5A 3F3RA 3L0HA 5ECIB 3VDCA 3SEPA 2WZ8A 2C8UA 4RQXA 3QFAC 2ALBA 3FK8A 1AQXA 4FIWA 1JZDA 5G2ZA 1UYZA 3A23A 3LG6A 1H6YA 3ETPA 3FZ5A 4PQQA 4LQRA 2YP6A 2HE3A 5J9BA 5B8BA 3MV11 4MZCA 3A2WA 4IS0A 5IO2A 2XBQA 3CTFA 3KD0A 1NKGA 5HR0A 2LEGA 4JEDA 2DCKA 1HYUA 4CVUA 4WF4A 2B5EA 4DUXA 1YF0A 4CUAA 6GSYA 6GSXA 2A2RA 3APOA 1SD9A 1GUKA 4DEJA 1M99A 17GSA 3SEEA 3HYPA 4OD7A 4QDSA 1YF1A 1FVKA 3GX8A 1OF4A 1A8YA 2C3NA 2VQUA 1K45A 1NHYA 2V2GA 3GA4A 2W1SA 1CZTA 2DJ1A 1C72A 4ECCA 1EV9A 5DBQA 4A42A 2HLEA 3VD7A 4XIHA 2LQQA 2OJLA 4NV5A 4RI7A 3CBUA 2H1BA 5D9TA 4ARXA 3CIHA 2ZNMA 2FWFA 1PL2A 2XHFA 4P02B 1EEJA 1K3LA 5IOXA 2QBXA 5ECOB 2C9KA 4F0BA 2DDUA 2W94A 3F63A 4XHMA 3VWXA 3VDAA 3FL7A 3I2GA 1ZGNA 1EUUA 1OE7A 1JZRA 2O7KA 2GZYA 3BD2A 1LJRA 4KDUA 1SHWB 1OAZA 2TIRA 4IP1A 3ACIA 3P7XA 3M3MA 2X99A 2C26A 2YC4A 1PKZA 3UVTA 2BERA 5JWOB 4KDYA 4L0UA 4WXTA 1GSUA 1AUCA 3AY8A 3HJOA 4G19A 5CRHA 5ECHB 2VD0A 1EZKA 3UL3A 3C8EA 3LSZA 2QQKA 4PQ1A 5D8IA 1N8JA 3ED3A 3GKNA 3LQ7A 4ACSA 4KCAA 1EP7A 4QB2A 2VZ3A 4LL4B 2F3MA 5D73A 1FB6A 4TR1B 3MBWA 3MNGA 1EEMA 2XBIA 3EMXA 5DN2A 2ON5A 2RJ2A 1K12A 2NTOA 1LU4A 2VL3A 5IIZA 3EU4A 3KP9A 4F9ZA 4NWYA 1X5DA 2MBSA 4V2NA 3GKMA 2I1UA 1OE8A 2VMCA 4HOJA 4K6XA 2VCAA 3ZVJD 2WUHA 5IFPA 1X5CA 3VLNA 1ULPA 4PT6A 5FHIA 3TJBA 4EO3A 5IO0A 2LW8A 3PINA 4EXJA 1F2EA 4CUCA 1M2DA 1OKDA 1TI3A 4EC0A 4GQFA 1GULA 3BN6A 1HNCA 2NBSA 5JCUA 2GDRA 1JLWA 4EKZA 1UVZA 4WETA 4TRXA 3UARA 4PGTA 3FZ9A 3OB8A 2ES7A 3VDBA 3HNBM 1TK8B 1GNWA 2WABA 3I2JA 2V41A 3GL3A 3NOFA 2PVQA 4HQSA 4HU9A 4EE0A 3HEIA 2EIQA 1JHBA 2VCQA 5A1AA 1TRVA 3WGDA 3C8XA 3GTUA 1UC7A 3FR3A 4IJ3A 3DECA 2DIYA 2H8LA 2KLXA 4MF7A 5DAKB 3D4MA 3GYKA 4FYUA 3THDA 2GLRA 1QMVA 2L5LA 2QKEA 3IDVA 4TXWA 4HJ2A 4MJEA 4A44A 1YDKA 3RPPA 3ZM8A 3Q74A 5I0DA 2KP1A 2E32A 1M2AA 1GRXA 5CREA 3UAPA 1E6BA 3IB3A 1LBKA 1MTCA 2YJ7A 1JZ4A 4I2TA 3NIVA 3CTGA 1V57A 2IN3A 3K4DA 1EV4A 3WD6A 2OADA 2W47A 4YPJA 2IFQA 4KAEA 4I6XA 1WJKA 1PMHX 2I4AA 1DE2A 3HOBA 3F2ZA 2OKXA 3GX0A 2IMIA 4D0QA 1VF4A 2FLSA 4MCUA 3QMXA 3F8UA 2LRNA 5FUIA 4AG4A 2N5FA 3JCML 2CVKA 4GQCA 3UEMA 1Y6EA 3GDBA 4H86A 4NV2A 4O32A 1RW1A 3I2FA 4HUAA 5F7UA 1U88A 1CQGA 4QX3A 1J08A 3A2XA 1US2A 3E9JB 2P0GA 4AAXA 3CZUA 2LTKA 4XURA 3H4KA 4TXOA 1YEPA 4KWUA 5H5SA 4P3YB 2HYXA 4A4AA 3CSJA 1W8OA 3DYMA 4I8BA 1X5EA 3UNPA 2P31A 5C7GA 3SKVA 1V2AA 3VD3A 1T2XA 5F0GA 2EIBA 1SD8A 3C1RA 2Y6HA 1M9AA 2HFDA 1EP8A 2G0FA 2X8GA 4X1UA 10GSA 2VZVA 3IK9A 3GSTA 4KSOA 3UETA 3Q6OA 4DEQA 2H66A 2DLXA 3ME8A 1NUKA 2X05A 3HJMA 4TXOB 1L7RA 4ML6A 4ZL8A 3HN3A 4W4ZA 1F37A 3IDAA 4FH8A 5EPFA 4V1Ap 3WQBA 1XFLA 3D0ZA 4XS4A 1K42A 4P5YA 2GQKA 4KSMA 2XOMA 3HJPA 5HFGA 3TKSC 1V9WA 2CAQA 4EVMA 2W92A 4QB6A 2E7PA 4V2LA 4OCFA 2K8VA 2I81A 3L78A 5G1LA 1JI6A 2J1VA 3LPGA 2FHEA 2GT5A 4GF0A 1GNEA 2LQOA 1XNAA 1AC1A 2MBTA 3QFBC 2JZTA 1X9MB 2E0QA 1ERTA 4HZ2A 3DVXA 3C7FA 3EYPA 2CZ3A 3GRXA 3GL5A 2FWHA 5EJZB 3QR6A 3KJYA 3IAM2 5IPGA 1SKSB 3KTLA 4P00B 3F0IA 3TRPA 4ZZ5A 1N2AA 4OWYA 3ZIVA 5JUVA 1ML6A 4PXOA 2C4JA 2EICA 2XQXA 2X10A 4O7HA 2EIDA 4IVFA 2EIEA 3UMAA 2O8VB 3KH7A 2RUEA 4IQ1A 3VWWA 4E8CA 3DXBA 3C1SA 4A6OA 3PGTA 5FWGA 3K8NA 2YNXA 2TRXA 3TOUA 2B7KA 1AIUA 1Z3EA 3L9SA 1V58A 12GSA 2WO3A 5KN3A 1UWWA 1UY4A 2R6KA 2W5FA 1SYRA 3T2QA 4LMVA 2YFZA 3IR4A 2O87A 1UMHA 1T4ZA 1O8WA 2HZEA 4MH3A 5A4WA 3FEUA 3Q19A 1Z6NA 3C71A 1FHEA 1XPWA 3C7MA 3RAZA 4PF1A 4WKWA 1F3BA 2CAIA 4POMA 3U6VA 4AF2A 3UESA 1SK2A 5B6NA 2YANA 1OYJA 4KGIA 4L5OA 5E4WA 1XIYA 1W99A 1JZOA 1ON4A 4X0XA 4MF6A 3KZQA 2WBKA 1XVWA 1ZCPA 4LPLA 3K75B 3M8NA 1ZMAA 2OE3A 1FB0A 1XWBA 1GOFA 2WAOA 3ERWA 2OBIA 2HZEB 5GZZB 3IIIA 3IXRA 1UYYA 1SK1A 2WO1A 4ZXEA 2VZPA 1A23A 2LS5A 4ZBDA 2L9LA 4L0PA 4HS1A 5F05A 4IELA 3WNMA 1JU4A 3E0UA 1TOFA 2LNTA 1OF3A 3GUSA 4BVXA 5IMFA 4AJ7A 2VTFA 3VD5A 1TG7A 4MOAA 1ST9A 1K0DA 3ZFLA 4EDYA 2CX4A 2KUCA 2WFCA 3D6IA 3K77A 3LJRA 5LA2A 1YZXA 3F6FA 4BK4A 1BEDA 5DCGA 4XVHA 1BQ7A 3P1IA 3GN3A 4IP6A 2VR4A 5LD0A 3R2QA 4QDRA 4ZB6A 3WYWA 4JU5A 2IPAA 3P8WA 1Z5YE 3GURA 1A24A 3EURA 1YQ2A 4OMVA 4WBRD 2YWMA 3ERGA 3TKSE 7GSSA 1WPIA 1XWCA 2V1MA 3VK9A 1F4HA 3FHQA 1Z6MA 1FOVA 1F4AA 1XW5A 3APQA 3WGEA 4KX4A 1O8PA 2WQ8A 2VLUA 4E8DA 2H6YA 5IM9A 2YJHA 5B4NA 5CRGA 2B5YA 3IAQA 4BWSA 3OR5A 2DIZA 1KEXA 1GTAA 4HI7A 4ZL9A 3LXZA 3ZZXA 4ZXGA 1W9TA 2CV4A 2VL9A 5F06A 1TI1A 2J22A 3A21A 2N5AA 1UY2A 3OBAA 2K6VA 2EIRA 3VFIA 2K9FA 4XUNA 5D9VA 2W95A 3MDKA 1JZ7A 4OUEA 2V4VA 3OGSA 1A2MA 1G6YA 1TRSA 1QXHA 1GTBA 5HPOA 1SDDB 4ZB8A 2B5XA 5HR1A 1XZOA 4OO5A 2VM2A 2E2MA 1A2LA 4X43A 4RN5A 3VD4A 2E33A 1PA3A 2VL4A 3SWLA 2YG0A 2DSAA 4MF5A 1VF2A 3WF1A 1PX6A 5LCZA 1PD21 1ZYQB 2JACA 4YQUA 2RV9A 2Y6GA 3ISOA 1WP0A 1DYOA 3GGLA 4AJ8A 4LLRA 3TKQA 1E2YA 1GH2A 4K0NA 3IPZA 4GSSA 1WRYA 2ZEZA 2H6XA 2W3JA 4BXSV 3RBTA 3L9VA 4TOPA 3A2VA 1JFUA 1X0RA 3KGKA 1W9SA 3WT1A 3VI5A 4BJ0A 1U3AA 3I6AA 4N10A 2B1LA 3IHQA 1OH4A 4K0GA 5J1XA 2KP2A 3VURA 1DBYA 2BGOA 4TTGA 1UX7A 4RYDA 1K0MA 3TKRA 1XXUA 2BJXA 4OFNA 1G7OA 4JX0A 2RUFA 5ENUA 2WO2A 4ISDA 1JYNA 1O73A 1BYEA 1O85A 4POLA 3TJGA 2YB7A 2QQMA 1JZ5A 1TRWA 1Q4JA 5B4XA 2K8SA 4TR3A 4V2MA 1T8EB 1SK0A 4E8HA 1NW2A 1VF3A 3HY2A 4HEA2 2GSTA 1OT5A 3UIWA 3FZAA 3UOMA 4F2IA 3LEGA 4KI5M 5HFKA 2MMAA 3G9BA 2L59A 4MPFA 4ML1A 2H0IA 1AAZA 4KA0A 5E59A 2VQTA 2J9HA 2FA8A 1SYXA 5GSTA 2PERA 3QAVA 3WF3A 2ZUPA 2FD3A 1GTIA 2XPDA 1HQOA 2JE8A 4GWIA 2HLSA 5D9XA 2DMMA 1F6MC 2HZFA 3T0BA 3ZLPA 2M72A 5KN1A 3FKFA 1GSYA 4KDXA 4QX1A 3TJKA 2JL4A 2MZCA 3KMNA 1GLQA 6GSVA 1WKYA 5IMAA 2ZCTA 2R5GA 3P90A 2R37A 1ZL9A 1MDKA 4W50A 2VCCA 5JXJA 6GSTA 2PPTA 1KTEA 4M4RA 2GSSA 1ZZYA 3H8QA 4ECJA 2WDBA 22GSA 2JADA 3A5WA 3H1NA 2E2GA 3KTBA 4F03A 4DSRA 3ERFA 3KCMA 4ZB9A 2A2SA 5JR2A 3EYTA 5B7CA 3A22A 1GL8A 3M9KA 5IJRA 5IPHA 4XZUG 4DSSA 4LA1A 2DJ0A 2PVOC 4POKA 1GOHA 4YH2A 2WN2A 2H74A 2PGTA 4G9HA 5DJMA 3W8JA 2LS6A 1XNTA 4CUBA 3BOAA 4BDVB 4OZOA 1T1VA 2NDOA 2Z4FA 1NSWA 3T0AA 1GSQA 1JZ2A 3RPNA 1SL1B 5G5FA 3ZTLA 4YAVA 2R2JA 4Q5RA 2C80A 2XHNA 4I97A 1WWJA 3KEBA 1PX4A 1B9YC 1CQHA 3LWAA 4DSSB 1J0FA 1K3OA 5CO3A 1ZOFA 3GM8A 3LQCA 4XTSA 5AISA 3TGZA 4KMQA 3NQHA 1TU7A 2VM1A 2ZEWA 4XUTA 1SJ6A 2J23A 4MH2A 1GLPA 4O92A 2IMEA 2OBKA 4J57E 1FG4A 1YKCA 1R5AA 4Q5QA 1PX3A 2VL2C 2VJXA 4GTUA 4ULXA 1XOAA 5LA1A 2DMLA 3APSA 3I3BA 1Z9HA 6GSSA 1TW9A 1DE1A 4XUOA 4HG6B 2OA7A 3TRQA 2CVBA 2WS2A 4N0ZA 4MGSA 1T7PB 4N11A 1DLCA 2VO4A 4ET7A 4ID0A 5A4UA 3GTUB 1AW9A 3ACGA 3FZ4A 3RHBA 3IA1A 2L4QA 1XW6A 4V1Ag 1EOHA 3F6DA 1TTZA 2OACA 3EE2A 3F4TA 4FI9A 2B6MA 2IL3A 4NHZA 2J1UA 5DVBA 2YC2A 3T2OA 4L5LA 1GP1A 2HSYA 6GSWA 2QC7A 2CDPA 1OKTA 2ORXA 2RM5A 2BTOT 1F9MA 1H4OA 4EUYA 4WF5A 1W89A 1ACVA 4A45A 1ERVA 3GV1A 1O59A 1V98A 1THOA 2IFQB 4KE3A 4HDEA 2L5OA 3IAS2 5JWRB 2VCWA 2GZZA 2DC5A 1GSSA 5DMYA 1O81A 2C1YA 2ZXQA 1TP9A 4GWJA 3ZITA 1GUMA 3DKSA 3BCKA 5G5EA 5ECNB 5EY6A 1XC6A 3M0FA 3QPMA 3L4NA 2VUPA 5ECPB 3EC3A 2H72A 3AC0A 4OCEA 1BJXA 2W91A 5ELGA 2H19A 1A2JA 2FCHA 2HRFA 1MDIA 1YJ6A 4BWQA 2RM6A 3O76A 3V1WA 3DRNA 3H93A 1O8XA 3ZRDA 3GKXA 5G04L 2ORZA 5CP1A 2C0DA 1MD4A 2L4CA 5F07A 4BPYA 4JRRA 5C71A 1BHGA 1J9BA 2C3TA 4Q5NA 2R7EB 2R4VA 3CKHA 1FVJA 3OGVA 2CDOA 3WNNA 4IUGA 3C7OA 3D4TA 5DQ0A 5J9CA 1EGRA 4XS4B 1PN9A 4AJ6A 5LCWL 4TR0A 3O3TA 2F8FA 4EF0A 4A3ZA 2P5RA 4F0CA 3KMOA 1TDIA 4PUFC 4CU8A 1PMTA 1UMIA 5A5KA 2REMA 3BCIA 1F3AA 2VOCA 3HNMA 1PRXA 1DSBA 3GXUA 1QQ2A 2JDAA 2LRTA 4N30A 1GQPA 3LXTA 2O89A 3HDCA 3G7YA 1UN2A 1IYHA 3HHVA 1ILOA 4K8MA 4KUNA 3WNOA 5LA0A 5IHRA 3CSIA 2YV7A 4DXSA 2YZHA 3KH9A 2M46A 3K4AA 3FRCA 3I9V2 4MLYA 4CU9A 3F4RA 3DIEA 1JYVA 3TOTA 5D96A 3VWVA 3D5JA 4IBPA 2C0EA 4OYUA 1GSDA 3CMGA 1T00A 4OFMA 2YZUA 3TDGA 4ZY9A 1M2BA 2WYSA 13GSA 1QFNA 1MDJA 4NMUA 1B4PA 2VCBA 4E8EA 4I2UA 2VOTA 4Z7XA 3CRUA 4OMCA 4XCSA 2FWGA 1RK4A 4PX1A 3DYOA 4YQMA 1XW9A 1R4WA 3C7EA 3UBLA 2PBJA 1PL1A 3IRAA 3THCA 2IMKA 2IJYA 3ACFA 4CDOA 3UBKA 4FYCA 1SJZA 5ID2A 3IE3A 5H5QA 5ECKB 4PURA 4OFTA 2F51A 3FYGA 1A8LA 2YV9A 3WF2A 2QQIA 1IYIA 1OC9A 4MZBA 5CRWA 1LNSA 5HR3A 1ABAA 2CVDA 4IW9A 4QX0A 3DVWA 5EVOA 1KEBA 4HZ4A 1OVNA 3CQOA 2W1UA 1G6WA 5EJ1B 3MO4A 2WRTA 3N5OA 4YAPA 3WF4A 1W8NA 4WR4A 1BAYA 2EIOA 3O6TA 1NM3A 4K2DA 4CHSA 1PKWA 1Z7RA 2JZRA 2LSTA 1TU8A 4QDQA 20GSA 2GSRA 2NPBA 1XOBA 3DYPA 4CU6A 1GOGA 1R26A 2LJAA 3VD9A 4DUVA 3T2PA 1XBSA 1K0BA 5IYYA 2W1QA 2OE0A 2YCDA 4TN8A 5KN2A 1H75A 3EVIA 3K4ZA 2X8CA 14GSA 1EOGA 1GSEA 3IV4A 5J41A 2VZOA 1USBA 2HI7A 3I2KA 5C04A 1VGLA 5G05L 3OGRA 1VRSD 3J7Yb 1K0CA 4DUWA 2NVLA 5AN1A 3ACHA 2H71A 5JMOA 2W9XA 4JR4A 3MUZ1 4RQRA 2JSYA 4BA7A 1K0NA 4Z2AA 1XPVA 2Z9SA 3FHKA 1O8SA 1GTUA 1SJIA 2CT6A 2PU9C 2FNOA 1P8JA 3US3A 3MV01 4P08A 1JZ8A 3TCOA 1SU9A 1TJDA 2WZ9A 1KGYA 2G2QA 3U5RE 5AIXA 3U37A 2AJQB 1NAEA 3UVHA 2VMEA 2WULA 4MZWA 2JKXA 1O7UA 3GH6A 1PSQA 1D7PM 1B8XA 3NRUA 1B9XC 3MWHA 3W5MA 1A0FA 4ECIA 4MJBA 3GMFA 1OC8A 4MK3A 2KHPA 3W8SA 1UY3A 4LL1B 1THXA 2HNLA 1UXXX 5GAPD 2GZPA 1TK5B 5G30A 4EDZA 4XUQA 2LRCA 4DEVA 4TXVA 4DXRA 2GT6A 2H30A 3CSHA 5AIVA 1UY1A 3RDWA 4K7OA 4KCEA 16GSA 3P2AA 1CZVA 3EU3A 4GZ9A 1CX1A 4IJIA 4MA9A 2PQSA 3E1F1 4PQHA 4RUVA 5B8AA 4NXIA 3OEAA 2B4KA 3EINA 3T09A 1K3IA 5HR2A 2B3SA 2MMNA 4CW9A 1XWGA 4L8EA 2CZ2A 1M7TA 4ZBBA 1G0TA 5GAND
chains in the Genus database with same CATH superfamily
4ZPIA 5ELAA 2WT0A 5E1RA 3EWLA 4GSTA 3ZIJA 1REDA 2LM3A 3I3DA 5JOWA 4BYYA 3H3LA 4FYBA 1UYXA 2AUYA 2V73A 3FMWA 2BGCA 5JCGA 3AZYA 4Q5FA 2F6BA 4ZU5A 3O5SA 1AF9A 1XVQA 2IMDA 4OCTA 3AKRA 3KT1A 1V6JA 2OUHA 3WW3A 1OD3A 4XFCA 3ME7A 5H9QA 3HZ4A 3JUUA 2PYTA 4XDOA 3IC4A 4HETA 4X4JA 3HIFA 3ES4A 4R9CA 4N53A 2R073 3D3AA 4ZBAA 5AFBA 3VB9A 2VIMA 3ZOIA 1NLSA 3HPNA 4CDXA 1O7FA 4AI0A 5IVVA 4Y1VA 4MABA 4TWTA 1CIYA 4Z2UA 1ENXA 3WNKA 3WNPA 1QJY3 2L57A 2RG4A 5D9WA 3ZYPA 4AFMA 4QXCA 2WLPA 5L7OC 4B7KA 3QCPA 4A41A 4DMIA 2BBAA 2VAFA 1KNGA 1D2SA 1A34A 3J7HA 1AQVA 1BX9A 1N1VA 2H0GA 4KNDA 1HN1A 3O1MA 3TRXA 1H6XA 1QOOA 2WNOA 5LWBA 3MF6A 1VBD1 3WZ1A 5C70A 1PGW2 2WNVA 5E8AA 1LGCA 3GALA 5FYVA 3GCXA 4GSNA 3PH9A 1PK6A 4XS1A 1HXS3 1VJ2A 2CX3A 4IHUA 5DAKA 4UWDA 3CDZB 3C7GA 2QA1A 4MHUA 3OUJA 1FATA 1I5PA 2F8AA 2VZSA 2ZGPA 4AVCA 3AZVA 1EPZA 3QAGA 1WUVA 1IQDC 1LU1A 4DVCA 5KEJA 2GGTA 4QX8A 3HCZA 1AXYA 4UBHA 1EP0A 4L0WA 3RS6A 1R64A 4QPWA 1G86A 1S0FA 3VL9A 4CXYA 4YGCA 3LFLA 1Q43A 4DXTA 2ARBA 2OT7A 2VVFA 2XC2A 3C73A 4QAWA 2ZJCA 2RVAA 4LEJA 1FAAA 2QQNA 3E3EA 1LODA 1ENSA 2GTUA 1PX7A 2KOKA 3NWKA 2R0GA 4KWLA 4OQ8A 2TEPA 1YJKA 2H70A 3J7Yk 5ECSA 3W59A 5DZEA 4NPBA 1SLCA 5IAVA 4L97A 5FZ9A 3J7MA 3VWUA 1W8TA 2MMOA 1MS3A 1RQMA 1RXFA 1YKAA 2VCVA 4FAHA 1NHOA 1W6PA 3R4DB 1DGWX 3V0AB 3H79A 3HVVA 4L8QA 2CQ9A 4O5RA 1K3YA 4AYUA 1VAVA 4FPFA 2N5BA 2WJSA 2YWNA 3F4SA 3EO6A 4BA6A 2VLTA 4DB5A 1XSRA 5ACA1 1B4QA 4P9IA 3O14A 2QGVA 4DSQA 4EYUA 5FYBA 1PHMA 2X64A 2Y8KA 2XONA 1C5HA 1GSFA 1GNYA 4CY8A 4FPKA 1TVGA 1EV13 5J4UA 4JBBA 2PFWA 2W68A 2A75A 3FY7A 4Q4V2 4JQTA 5CKQA 5DPNA 4JE1A 4OO4A 4IEVA 4JDMA 3ZMOA 4XEZA 5C00A 4YZ2A 2IIYA 5F3CA 3ZXFA 1SG3A 4XHBA 5L71A 4K9ZA 1AR92 1XSQA 2X5IC 4PUAA 5I0SA 4UW6A 3PVEA 3UGFA 4QMAA 3SC7X 2WZR3 1H4GA 4IERA 3WEZA 3POFA 3FW2A 2WA4A 4CPBD 2QQVA 3WSOA 1UD1A 1PQNA 2H6ZA 1RB8G 4QKDA 4BIFA 1FPN2 1LU2A 3NSTA 2QSIA 4POBA 5JSPA 3VBHA 1DU3D 1V9U2 1AQWA 3WD5A 2GS3A 4J6GA 2V6KA 3Q18A 3VLBB 3U14A 1J59A 3BU0A 3ZLIA 5IVFA 4MGQA 5JWQB 3D82A 2YZ4A 4A7YA 4WR5A 4PDWC 3CRTA 1H2LA 3L9UA 3D4KA 4OI1A 3I3EA 2H75A 3WHUA 4QPGC 3MUY1 4HK9A 4IESA 3SLIA 3W6GA 2RR12 3UGHA 4K7IA 4DIQA 5IMVA 1R083 4LUKA 4OQ9A 4D69A 1OA3A 4D94A 5JIUA 3LEKA 5JOZA 5C8CB 4LMWA 3KVAA 1NCRB 5ID2B 3DGQA 5G31A 4GCIA 2XPEA 1WW6A 1RVF1 1JYWA 4QU1A 4PNGA 4DY3A 1QUWA 3QH6A 5EFUA 1TMF1 3QH7A 4N43A 3IAPA 1HRV2 4UW5A 4TZDA 2K0GA 1JN2P 2XUEA 4BL7A 2F17A 4CCNA 1UY0A 4MP4A 5GKAC 2J42A 3HNYM 4PBOA 4Q4W1 5JI9A 2P3JA 5F8BA 4IE6A 5FRAA 2J1SA 1UNBA 2I9HA 4IV3A 1KBNA 2DBIA 1RXGA 3LA7A 2O85A 2HWD3 5F39A 2B9VA 3HVDA 2H1DA 3KM6A 1A6CA 4N8MA 2Z5WA 2LJKA 4XJWA 2X8HA 2GC1A 3P6BA 2ATFA 4K1FA 3HVXA 3UKVA 3N9OA 1DP0A 4KU7A 1QK8A 3W5NA 1Y9GA 3TB2A 3A7QA 2V5DA 1V6IA 3VDDB 1BQPA 2DTYA 1JZ3A 4NHMA 4XS6A 4NAXA 1FO5A 2K18A 3IBHA 4TKYA 1IHMA 3L0HA 4NOTA 4XJ9A 5A6ZA 1UZZA 5ECIB 3VDCA 4LNVA 3SEPA 4RQXA 3VKMA 2ALBA 4FIWA 5G2ZA 3LG6A 4QXKA 1V6NA 4LQRA 2HE3A 4CP9A 1WW5A 3OUHA 5IO2A 2YGMA 1LOEA 1K5JA 1YQCA 1LRHA 4QT6A 5BNOA 2RS12 4CY6A 2B5EA 1YF0A 1ASJ3 1XG8A 3ZXGA 3APOA 1SD9A 1BEV3 1M99A 17GSA 3ZXDA 4QDSA 1YF1A 1FVKA 5FBJA 1NHYA 4E4ZA 2DURA 1C72A 3WVJA 4JV4A 1EV9A 1RUH1 4XIHA 4RI7A 1ZBA3 5FV3A 1BK0A 1M3JA 3CBUA 3WUCA 1X7NA 5A3OA 1PL2A 3M3OA 2XHFA 5FXWA 5IOXA 5ECOB 1PO21 4F0BA 2W94A 2QQPA 5C3SA 3AJYA 3LKJA 1ZGNA 1W8WA 3O1RA 1LJRA 3LWCA 4N53B 1RUI3 1SHWB 2HWB1 3B69A 4MV2A 2X99A 1NZCA 4KDYA 2VAUA 2XL9A 1W06A 5FUNA 2QQWA 1GSUA 4Q2FA 3AY8A 1D2QA 2VD0A 3UL3A 2QQKA 4PQ1A 4LO6B 4FP3A 3THPA 5C9AA 4KCAA 1ZBE3 5J96B 1EP7A 4XAAA 4YW3A 1RINA 5HCHA 1Q8OA 3DKQA 4TLFA 1X36A 2ON5A 1MZFA 1K12A 2NTOA 4AEKA 4M3CA 5EPAA 4NWYA 3WW2A 3D8CA 4FPGA 5BNNC 1OE8A 2VMCA 5JZGC 4K6XA 3WX5A 5IFPA 5FPVA 3TJBA 4EO3A 2H0BA 4EJRA 1OKDA 2VNOA 4EROA 2DWRA 1HNCA 5JCUA 2GDRA 4EKZA 1UVZA 1Q8QA 4TRXA 2WNVB 2VNVA 4Y24A 2O8OA 3B93A 3I2JA 2V41A 2JKBA 4GMP1 1WLTA 2EIQA 2VCQA 1JHBA 1PK6B 1HB2A 2VGDA 2JECA 4MUVA 4IJ3A 2KLXA 4MF7A 5DAKB 4V1PA 3CJIC 3GYKA 3THDA 2BPA2 4RR3C 4IE7A 4EN6B 2GC0A 3VZJA 1I5ZA 3CO2A 2WKKA 2KP1A 1M2AA 3UAPA 1W2UA 5GLZA 1MTCA 5FP3A 2CWSA 1YLLA 2CSGA 3WD6A 2IFQA 4BB3A 1PO12 1PMHX 3IHGA 3GX0A 1VF4A 4QGNA 2XWBB 3QMXA 3K3OA 3ETQA 1COV3 4CEWC 3SH5A 1TME3 3WW4A 2OQ6A 3JBG3 1QJX1 5F7UA 1UKRA 1UOGA 4XMAA 2XXZA 2QFEA 1PMIA 3V65A 3H4KA 2PAEA 4RS5C 5H5SA 2HYXA 3CSJA 3VBSC 2P31A 3O1UA 4Q4X3 1V2AA 1WWYA 1D4M2 4N7UA 5C33A 1T2XA 3ZKUA 1SD8A 3HBKA 1OLQA 3DXTA 2HFDA 1EP8A 2G0FA 2JXAA 4S2HA 3C3VA 5ANQA 2P34A 1UIJA 4DEQA 5DAXA 2H66A 1NUKA 2X05A 1WLDA 2BOIA 3IDAA 4FH8A 4V1Ap 2ZX1A 4NRPA 3VN4A 4KSMA 5F2SA 1Z7S1 4QB6A 2E7PA 4V2LA 4OCFA 2K8VA 2W0XA 4HFSA 1UX6A 3H3ZA 3LPGA 5IUQA 4GALA 1S0DA 2JZTA 1YEWA 1I9RA 4Z92B 1ERTA 4HZ2A 3DVXA 3OSDA 3EYPA 4PHZA 4Y5SA 1POV1 2RJKA 3QR6A 1W05A 1WCDJ 1DG6A 1OVPA 3F0IA 3TRPA 3SCHA 1ML6A 5C3OA 2R0PA 4WVVA 2D6LX 4FPOB 1R1A2 4YZ4A 4DRRA 2R062 4OI0A 4NAMA 3GZTB 2R0FA 1BJQA 2RUEA 3N4MA 2V4AA 4A3XA 3OD4A 1CAWA 1PNGA 3RZKA 2G4IA 4Y1ZA 1POQA 3TOUA 1Z3EA 1OPMA 3VBHB 2R6KA 2EAKA 2JE7A 5GM0A 4BU2A 1SYRA 4HZFA 2YFZA 5AC93 1UMHA 3FUOA 4YLZA 3C7MA 3G6JB 1F3BA 2CAIA 4K8FA 5L9RA 2DYCA 3ZO0B 5B6NA 3BU7A 2JDPA 4KGIA 1W99A 1JZOA 4MF6A 1G9FA 1IKQA 1AR82 1XVWA 3D5OA 3KF5A 3MIHA 2WO1A 4ZXEA 1JYTA 2JENA 3BTAA 5KHKA 2L9LA 4L0PA 4HS1A 5F05A 3WNMA 1ZNPA 2PLV2 3E0UA 1TOFA 3GUSA 4BVXA 1OOPA 4U36A 4FOQA 3LJRA 3F6FA 4LT5A 2WFF2 1BEDA 4LO5B 3GN3A 4IP6A 5KOXA 3VBFC 3P8WA 2NLRA 1RIRA 1F5JA 5FP9A 1Z5YE 2JIJA 4BM8A 1YQ2A 3KGZA 2YWMA 3ERGA 3T4VA 3TKSE 7GSSA 5A3WA 1XWCA 1VBB1 1F4HA 4C91A 5KWRA 1RHI2 4Q0PA 1PIV1 2A6ZA 1O8PA 4FFHA 4ASLA 2H6YA 4P14A 3GNEA 5IM9A 2B5YA 3IAQA 4BWSA 4BL7B 1OUXA 2CGOA 3BTYA 4M0HA 4C1WA 4Q0VA 3LXZA 2OX0A 3ZMNA 4ZXGA 1C28A 5F06A 3O1OA 2J22A 1TI1A 4BQXA 3D0JA 5H9RA 3VZKA 3TYJA 1OFNA 2DBNA 2C0ZA 1G6YA 1TRSA 3A4UA 3MFCA 5HPOA 4ZB8A 4FTSA 5HR1A 1A8DA 1FMD3 5A7NA 3WLUA 1CX4A 2CHHA 5FMOL 2PHXA 4RN5A 5FZ6A 2ZBJA 2E33A 3PL0A 4ES8A 4NE9A 3VBUC 1ZYQB 4MH0E 1WP0A 3ZKYA 2P3KA 1DYOA 4LLRA 4K0NA 3ZN4A 4TSVA 5FPXA 1YQ6A 2W3JA 2B42B 4D7SA 3KGKA 5FY4A 4N10A 1GWLA 3VURA 5CBLA 1UPIA 4EN7B 3J26N 5ANNA 1K0MA 1XXUA 2BJXA 4OFNA 2C24A 1KJLA 2RUFA 5FZDA 4CP9B 2Y0IA 2VCMA 2WO2A 1BYEA 1O85A 4Y1XA 4YM1A 2VH9A 1F15A 4CP0A 1TRWA 2R072 1VMJA 2ZKNA 1SK0A 4E8HA 1NW2A 1GLHA 2QZ2A 4F2IA 5BNOB 1A8MA 5HFKA 2L59A 3Q8EA 3E97A 1OLME 2VQTA 2CAVA 4AI1A 2ZUPA 5CNAA 2DKIA 2YU1A 2DUPA 1QJY2 1W39A 3ZXAC 4G4FA 3ZLPA 4AEDC 1GSYA 3Q8CA 4I30A 1GANA 2JL4A 1GLQA 5IMAA 2E9QA 2IXLA 4YVSC 3ZN6A 1K5MC 6GSTA 1BVP1 5LA9A 2EXKA 2GSSA 1XU1A 1AL23 1BZWA 3THTA 2ZTNA 4O61A 4LA2A 3H1NA 2WYFA 3KTBA 3LGRA 3AMHA 2A2SA 3EYTA 3A22A 3M9KA 2D6MA 1GOHA 4YH2A 2H74A 2PGTA 1HXS2 5DJMA 2LS6A 3WQ1A 4CUBA 1OA4A 1PN0A 2EA7A 5FBZA 3MZHA 3RYKA 3T0AA 1HQLA 3CQFA 4YAVA 4MGZE 1IS3A 3DV8A 1ZZBA 2Y26A 1WWJA 2P6CA 4JTNA 3AZXA 1NQJA 4DSSB 1K3OA 5CO3A 4M3CB 3LQCA 4NRMA 1MACA 2NQYA 3WV6A 4JRAA 1IS4A 1JODA 4KMQA 4I0AA 1TU7A 1SJ6A 1NXMA 2BFUS 4O92A 1UZVA 2IMEA 4J57E 4Q5QA 1PX3A 2VL2C 5GZCA 1X9TA 3OCPA 4CEYB 4ULXA 4H14A 2DMLA 4RGKA 1PGW1 2ZX4A 4I3GA 3LF7A 2XVKA 4HG6B 4XUOA 4NPLA 2OIIA 3MW4A 2VUJA 4XJZA 1HB4A 5JWPA 3ZYFA 1N3PA 4KBBA 4HOOA 1EOHA 2Q8DA 4X6QB 4FI9A 1GWKA 1PNFA 4K2XA 4NHZA 2JDUA 1C8M3 2DUOA 3D0SA 1GP1A 4XJ8A 2HSYA 2CDPA 4GXLA 3N35A 2RM5A 1GZWA 4O7XA 2BTOT 3S5QA 5FUPA 1ACVA 1LJ7A 1S2KA 1O59A 2IFQB 4B29A 5FYHA 2L5OA 2GZZA 5DMYA 2XB6C 4IL7A 4FT8A 2ZXQA 1TP9A 4GWJA 5FZ1A 5G5EA 4QKFA 1XC6A 2FDJA 3L4NA 3PVOA 4Y5TA 5ECPB 4EQVA 1QKQA 1LEMA 1BJXA 1B35A 1EV12 2RM6A 5FLJA 3DRNA 1O8XA 1YI9A 3AMMA 5E89A 2CNAA 2EIGA 3GKXA 3ZRDA 3SISA 2BFUL 4S2GA 5FLHA 1XE7A 3VBRA 1D4VB 3KSCA 4DPNA 4BHPA 2WZR2 2Y34A 3MDPA 4IUGA 5JLVA 3IIAA 5DQ0A 1EGRA 2ZZQA 5LCWL 2F8FA 4EF0A 4A3ZA 5CVRA 2P5RA 5KXDA 3H0OA 3PIGA 2QCSB 1UOBA 5DUVA 4CU8A 1PMTA 1UMIA 5A5KA 1BVVA 3HNMA 4Y1UA 3GXUA 4YARA 5FQ0B 4N30A 1GQPA 4Q4V1 3HDCA 4GKXA 1DGLA 5FZCA 2A6YA 5FY8A 5LA0A 5I8YA 4B7EA 2P6HA 1X8MA 1AR91 5DZFA 3H3UA 5FZGA 4QXBA 3PU8A 2C0EA 4HMZA 2E6VA 1JS9A 1J3PA 4B1LA 2YZUA 4HN0A 4ZY9A 1M2BA 1R082 2WYSA 1QFNA 1CAWB 3VKNA 1LOFC 5JDBA 2VCBA 1FPN1 4Z7XA 4HSLA 2QKDA 3V64A 3DYOA 1NZIA 4YQMA 1PZ7A 3IKWA 3IRAA 1V9U1 2FDFA 3ZYHA 3HMYA 2IMKA 4FQUA 3UBKA 4D7TA 4Q27A 1FV3A 2YV9A 1A8LA 3GBGA 1OC9A 4MZBA 5CRWA 4IDZA 5HR3A 2Q1ZB 5L36A 2VBPA 1F2NA 4PIXA 4RQPA 3TN93 1OVNA 3MO4A 3R4SA 2WNVC 1UMZA 3N5OA 4UFHA 2HWF1 2YUEA 3I59A 4QPIA 1ZX5A 3BTXA 3PDQA 1W6MA 4CHSA 1O5LA 3GJBA 2LSTA 1TU8A 4QDQA 3DYPA 4AI9A 4BVXB 2E53A 3UJOA 1OOPB 2W1QA 4FFGA 2OE0A 2EXIA 1VBC3 2WS91 3LW9A 1EOGA 2VZOA 3I2KA 4J1XA 3OGRA 2HWD2 3RYRA 2EXHA 1QEXA 2RM21 3ZXEA 3IM0A 3B01A 1S2EA 3ACHA 2H71A 5JMOA 2F4LA 4QWNA 4FAGA 4RQRA 2JSYA 5J48A 2ZX3A 1XPVA 3FHKA 1O8SA 2DVFA 1UU6A 3POGA 1HRV1 3RRDA 2FNOA 1P8JA 1UQXA 5K9YA 1SU9A 3POEA 2VUAA 3B9CA 1EAH1 1W9FA 1KRIA 3S0MA 1GSLA 1CR7A 2OUJA 3GH6A 1B8XA 3NRUA 2A6VA 1Q56A 1DYKA 2KHPA 3RI9A 2GMMA 1UY3A 4WM7A 2HNLA 1DGRN 5ABJA 1FYUA 2JB8A 4IGQA 4XW3A 5FP7A 1X8EA 2F4PA 4XFHA 4LBKA 1RUE1 4XXAA 1RMU1 2A3XA 3RFRA 1JMUB 2E7QA 4XAEA 16GSA 1CX1A 2PQSA 4WVMB 5B8AA 2ZGSA 3OEAA 4HK8A 5HR2A 4L8EA 2CZ2A 2GDFA 1G0TA 3HT1A 2HEYF 2V72A 2MMZA 1ASJ2 5IVEA 5F37A 5F3GA 4C0BA 3ZYJB 1E5IA 3N9JA 1BEV2 3VI7A 4AHZA 5KN0A 5HXMA 2GC3A 3CZJA 5CFCB 4A7KA 3HD5A 1HB3A 2YWIA 1KXGA 4MLOA 4HXCA 1WE0A 1ZBA2 2ZHKA 4IGJA 2GQLA 1JHJA 4YW5A 1GWMA 4Q4Y3 4MJCA 3F3QA 4FFFA 2HT9A 2DJ2A 2J1AA 3LYPA 2LV3A 1SL0B 4MGTA 1JOJA 2CA8A 1RUI2 3U78A 1JZWA 3TBDA 1O5UA 3T30A 2R3XA 4M0NA 5ABRA 1UAIA 2YC0A 2RS11 3LYKA 4UI9L 4HT1T 5FTTC 2NM1A 1EYBA 1JYXA 3KCXA 1F31A 1ZRRA 2VC9A 2RLIA 2HRAA 4TLGA 4LLOA 3FE5A 2TUNA 2ZZJA 5DCHA 1ZBE2 1WCKA 1XQNA 3I3QA 2D98A 3HVSA 2PUKC 4JQRA 1OD5A 2XGXA 3MIXA 2WWJA 4HVRA 4HPKA 1QQP1 2HSHA 5L19A 4TR1A 1CIWA 4XETA 4H55A 3NMBA 1H4HA 1LOAA 3ZN6B 2WZEA 3VBOA 1US3A 1RUOA 4D73B 4AGSA 2BMXA 2I3YA 2ZGTA 1DZQA 4KU8A 2P5BA 3HBZA 3L2HA 5KXEA 2QQLA 2CGNA 1YEXA 1TNRA 5DAWA 1UA5A 1CONA 4WM8A 1JLVA 2FDGA 3KXOA 2FY6A 3CXGA 3NNLA 1SLAA 3KHBA 5BNPA 4CUGA 4RFT0 3WINE 5IMDA 4MXWA 4DQAA 3OGJA 4LBOA 4TVEA 2FD8A 1IPKA 5I8TA 1BG5A 5EIYB 3O1TA 2XJUA 1GUIA 1ND3B 2HKXA 4W6YA 2DBCA 3DYRA 4LBJA 5J5NA 2HEWF 2J1TA 4AHXA 2VVDA 4GXZA 3N7MA 4KL1A 5LASA 2ID4A 4WEYA 5D8AB 1COV2 2H01A 1TME2 3POSA 4HSCX 4CTEA 3USUB 1JOPA 1J1TA 3JBG2 5GJ6A 5A1FA 3WG2A 4KG0A 3A3TA 5F6LB 4XILA 4KWKA 1QWRA 4NIIA 1ULDA 1BKZA 2CAUA 3K48A 5F3IA 2VXJA 2GAUA 4Q4X2 3ASIA 3IT8A 2R16A 1ZRDA 1GZWB 5EWSA 3S9FA 1W4VA 4U2AA 5CNWA 1CQ9A 4E4DX 3H7YA 3QD9A 4HKWA 4CSWA 4EN9B 2A71A 4XF1A 4E2SA 3BKZA 4NWVA 5CIRA 3SITA 4ICYA 5K7PA 3ZYWA 1V0AA 5CG9A 5H9PA 1OVSA 4KG8A 4COYA 1LHNA 4JGYC 4AW7A 3GFKA 1PGL2 1GQGA 2J7MA 2YPMA 4WVZA 4JR6A 1DUGA 1B35B 3QAWA 1A0RP 4LK6A 3NZNA 1T3BA 3HR9A 3I2HA 2NPIA 4AHWA 4GA9A 2WO7A 1MR5A 3VPTA 1PZ9A 3B5LB 3I97A 2VM9A 1CAXB 1D4M1 1J84A 8GSSA 4TR4A 1KD7A 2AYTA 3B9IA 2CWMA 3TJFA 3VBRB 3OBRA 3AL5A 5ECQB 1DQ1A 3G7JA 4G2EA 3I2OA 4BK5A 3R0RA 1JBCA 2D3SA 3N9LA 2ZX0A 5HFIA 1M9BA 2VLVA 4K1YA 4QL7A 1SFYA 4BVYA 1F35A 4I02A 3HVNA 3POJA 3EPTA 2FGXA 2DCJA 2VOXA 1HV0A 1DFQA 2LNSA 1HV1A 5AC92 1TZOA 2A4HA 2FZ2A 1Q98A 2C0FA 2XR4A 1RUD3 4EIQA 2KD7A 2FUG2 1W9WA 4F8AA 2RDRA 1YY7A 4D8MA 1T4YA 1NXD1 4GH4C 1QXRA 1TK0B 2VBDA 4NWWA 4D3WA 2R061 4K7NA 4RFRB 1BK1A 1FOD3 3EXUA 3V0BB 4XCBA 1XOYA 4Y4YA 3FLTA 2AEZA 1CZSA 2FWEA 2ZMKA 4TN7A 4J56E 5JXHA 1TMF3 2GQMA 5J3RA 4OHZA 2TRCP 4AAPA 4AR2A 4YQVA 4K1ZA 2AV4A 3KP8A 2JU5A 3HKRA 1OC9B 1E5HA 4BQ2A 2DVAA 3PJQA 4CEYC 5DDLA 4YYOA 4RQPB 1SLIA 1UZ0A 1V40A 2A3WA 2QQOA 2RS31 4Q4W3 4H3WA 1VP6A 3MLJA 1WD4A 3I59B 4FO9A 1FI2A 1WCQA 1YFWA 4MDCA 3T1MA 2ZEYA 3NNGA 4EWAA 3UKTA 2SBAA 2RS51 1S3AA 6GSUA 3BGAA 1JXNA 1SL2B 3ZFEA 4YRDA 2C0GA 4ZILA 2WFF1 4UOJA 1Z7PA 3C7HA 3WG1A 3LFMA 4J2FA 3NAPA 2VXRA 1FMD2 4KNCA 1X9SB 5AVAA 3AZZA 3IOSA 1HIXA 3R4UA 1JU3A 1XNCA 2WB9A 5JXGA 4XJAA 2ZEXA 4FO5A 4G10A 2WN3A 1HNAA 1O3QA 1RHI1 4MMMA 1BBT3 4YGEA 2VZUA 3LE0A 2ARAA 4RI6A 5DALB 3FBMA 3PVBB 5FZAA 1Y25A 4XDQA 5F5IA 3AVRA 2J1RA 1OHFA 1NX9A 4WM7B 3WT2A 3H42B 3JB8A 1NLQA 1CPNA 3HA9A 1YYNA 3IZOA 4KH9A 1YC61 2JE9A 2C8UA 2VULA 3FK8A 3ETPA 1NY72 4PQQA 4YM3A 5J9BA 4MYEA 3MPBA 4MZCA 5FYUA 3CTFA 3KD0A 3GHMA 4QQPA 4XPVA 2BWAA 1ZRCA 1Y9MA 4LBMA 3WY6A 5FY5A 3J7LA 5F5AA 4WF4A 4LKDA 3HT2A 3JQWA 3PMEA 1RUH3 2LALA 3O0VA 6GSYA 2A2PA 1U5YA 4YNIA 2R043 1IQAA 4BMBA 3HYPA 3GX8A 1IPJA 2BEOA 5A70A 2VQUA 4EE2A 1PO23 2V2GA 3GA4A 4ECCA 1TEIA 1S2BA 2HLEA 4QM8A 3VD7A 2WNUA 1X50A 1LESA 3APBA 3ENRA 5FO7B 5C3QA 2H1BA 5D9TA 2VW0A 1QXJA 1J3QA 2HWB3 2ZNMA 2FWFA 1I6XA 4P02B 1H8TA 1AL22 1K3LA 3VDAA 3I2GA 2GZYA 3SNMA 1W2TA 3VV1A 1MS1A 5EZWA 4PJYA 4AL9A 1PFOA 3JU9A 3M3MA 2D5HA 2C26A 2QDRA 4LO8A 2NMNA 2W2IA 1AUCA 1GFF2 3C8EA 3LSZA 4JGZA 2WA3A 5D8IA 1QGLA 3N36A 3GKNA 4ACSA 4QB2A 1QJY1 4HPKB 3M3IA 2XJQA 3INAA 4TR1B 2OQ7A 2D43A 2XBIA 1C1LA 5EQUA 3IWZA 5IIZA 3EU4A 4F9ZA 1G9BA 1RITA 3VBOB 4QQHA 2MBSA 4V2NA 1DQ0A 1X33A 2WUHA 1X5CA 4PT6A 4NAOA 4COVA 4CUCA 2NBSA 4L11A 4LA3A 4PGTA 2D6NA 2R32A 2E7TA 5HCFA 3VDBA 3WDWA 3NOFA 4HQSA 2SLIA 5FO8B 1TRVA 3C8XA 3GTUA 2PA7A 4LK7A 2JB4A 5BNPB 2OYZA 1AXZA 3MI8A 4FYUA 1C8M2 2QKEA 4MXWB 4TXWA 3RZMA 4NROA 3BIEA 3TEYA 3Q74A 1AYM1 3BI3A 5I0DA 3UJQA 5EP9A 1LBKA 1Q8PA 3K4DA 2PHRA 4KAEA 3CHXA 1WJKA 2I4AA 1PVC3 1ND2A 4R9AA 2OKXA 1G9DA 3P3PA 1MZEA 1ZM1A 3F8UA 2LRNA 1YHFA 5FUIA 4AG4A 3KV5A 2CVKA 1HRI2 5K0UA 3UEMA 5FZ8A 4DO0A 4O32A 4LBLA 4Y26A 5ERLA 2MPFA 1CQGA 1UOFA 3E9JB 4CDQA 3CZUA 2LTKA 5BPXA 3SQOA 2ZGQA 1JH5A 1W8OA 4I8BA 4IEYA 3UNPA 1X5EA 5C7GA 2G9FA 4LUMA 5A3PA 4Y1YA 3C1RA 3ZYIB 1AYN3 2UURA 2X8GA 4X1UA 1AR71 3RI8A 1Z7S3 3GSTA 2Z69A 3IDBB 4KSOA 2DLXA 3AMPA 3B94A 3HJMA 2BU9A 4TXOB 1L7RA 4ML6A 2A73B 4ZL8A 4IETA 5CFCC 5EPFA 3WQBA 1XFLA 3D0ZA 4XS4A 1K42A 4BISA 4XF4A 1N3OA 4HANA 4URTA 2PN5A 5IVCA 2XOMA 3HJPA 3TKSC 1POV3 2I81A 1EV11 1WMXA 2J1VA 4GF0A 3H50A 1AC1A 2MBTA 4XF9A 2E0QA 3CEWA 3H8XA 3H8UA 3C7FA 2CZ3A 5FKBA 5CU1A 3GL5A 2B8MA 5EJZB 4E2QA 5IPGA 1SKSB 3KTLA 4GKYA 4ZZ5A 1RUJ1 3ZIVA 5JUVA 4MVTA 3DKWA 4PXOA 2WZR1 3WP4A 3ZDVA 2X10A 4O7HA 3ZFFB 2EIEA 1LENA 3KH7A 3J8F1 4BVYB 2KXLA 2JIGA 3LIGA 3DXBA 1V70A 5BYNA 4XOGA 3VZLA 2B7KA 1AIUA 1V58A 12GSA 2WO3A 1UWWA 5L7OA 4LMVA 5J36A 3IR4A 4SBVA 1O8WA 2HZEA 4MH3A 3FEUA 5E16A 1FHEA 3LOIA 3R05A 1XPWA 4A5PA 3TN92 4POMA 1IPSA 3UESA 1YFYA 5E4WA 4L5OA 2G19A 3EMRA 4M01A 1NOVA 1QOSA 2PELA 1ZCPA 4LPLA 3PNAA 5F6KA 1GOFA 1W6QA 1SDWA 3H8RA 4B1MA 5C4WC 4OFGA 1W8HA 4Q26A 3QLQA 3KD4A 4ZBDA 3WG4A 2FQPA 1R081 1JU4A 4MHRA 4OUSA 4D6RA 1RUG3 2ET7A 3V56A 1VBA3 4CCKA 2EXJA 5FZMA 1VBC2 3AFGA 4AJ7A 2VTFA 1TG7A 5FLIA 5FJHA 1FV2A 2RMU2 2ADDA 2CX4A 2KUCA 3MIDA 3K77A 1ND3C 3QCWA 2HYKA 1DHKB 4BK4A 1VBB3 4XVHA 3P1IA 3U0ZA 1PIV3 3WYWA 1G8WA 1NA1C 4WBRD 2A7AA 3LSEA 1WPIA 1V6LA 5D8AC 2W52A 1VRH3 2V1MA 3VK9A 1O3TA 3FHQA 5A3UA 1F4AA 3WGEA 1ODNA 2VLUA 3HQRA 1WBFA 3ZN5A 2DFCA 2BNMA 5I0TA 2DIZA 4ZL9A 1AZDA 3AK0A 1W9TA 2CV4A 4XQWA 4YZ5A 3A21A 3DXUA 1UY2A 2K6VA 2EIRA 2K9FA 2XLAA 5GZEA 3BPSA 3MDKA 2PAKA 3J4UH 1A2MA 1GZCA 4G0KA 2VUDA 1XZOA 2WL1A 3MLLA 3AMNA 4X43A 5FP8A 3O1VA 2YHJA 2YG0A 1Q3EA 4MF5A 3WF1A 1V6KA 2PTMA 4BQYA 5FKCA 1PD21 3AXEA 2RV9A 1N1YA 4AJ8A 3TKQA 2ZGNA 1GH2A 1UKGA 5A32A 4AEMA 2ZEZA 5A7OA 4TOPA 2OPKA 3A0NA 5A7SA 4JCKA 2W39A 3VI5A 4BJ0A 1WCSA 2B1LA 4Z8BA 3POBA 4Q4Y2 2JICA 3WDTA 2KP2A 3NKTA 3ZVXA 1UX7A 3VBRC 3TKRA 4NIHA 3DPRB 4MXVA 2X5IA 3OGGA 4Z07A 3URFA 1JYNA 4XXPA 3TJGA 3VZMA 4BPZA 4YSFA 4W6XA 2K8SA 2Y33A 4Z2TA 5FZIA 3FZAA 3B3QE 1ASJ1 3G9BA 4ML1A 4KA0A 4MGKE 5FOBB 2PERA 5F8PA 4K7JA 1TE1B 5HCAA 1MS0A 2UWAA 2PAMA 2DMMA 4GWNA 2QDNA 3N9QA 1DLLA 4GJYA 1RL3A 3KMNA 5LBFA 1WKYA 2R5GA 1V6OA 4PDWA 2RHPA 4IV1C 5JXJA 3I4IA 1D0GA 1ACCA 4M4RA 1NCQB 4QPGA 2DVBA 3I54A 1RUI1 3I3MA 4AGRA 22GSA 3A5WA 3ZXKA 1SFNA 2BNNA 3UL2A 3KCMA 4DNYA 5B7CA 4COUA 5IPHA 2H0VA 4LA1A 2PVOC 5J98B 4QD2A 3AP9A 3VZNA 1ZBE1 3H7JA 3RYPA 4KGGA 2JEMA 2Q1MA 2NDOA 4ISRA 3DCQA 1S4CA 1W8UA 1AL0G 3RPNA 5G5FA 4MGIE 2EAAA 1RUC1 4Q5OA 1CQHA 3LWAA 4XIOA 1J0FA 1ZOFA 3GM8A 2ZGKA 5E88A 2XBO3 4HN1A 1WMFA 2IVJA 3WP5A 2VM1A 2J23A 2ZEWA 1DGRA 3AB0A 3FZ3A 1FG4A 5LY2A 1YKCA 1R5AA 4JAAA 1KFUL 2VJXA 4P9JA 5BXXA 1XOAA 5LA1A 3APSA 6GSSA 1TW9A 1YIFA 3TRQA 4CCOA 4N0ZA 2HJIA 4ET7A 5A4UA 1QF3A 5ISLA 3GTUB 1AW9A 1FAYA 3RHBA 1W6NB 1SCRA 4V1Ag 2ET1A 4QHZA 2P4EA 4L92A 1O3SA 2MEV3 3F6DA 3BYWA 2OACA 3F4TA 3SH4A 2IL3A 2YC2A 4L5LA 3NKGA 3HWJA 2QC7A 2ORXA 3ZSLA 2YBKA 1H4OA 4WF5A 1W89A 2RDSA 4Q0QA 1ERVA 1V98A 4AI3A 4NO4A 4R4XA 2XG3A 1LHVA 2DC5A 1ND2B 1E5RA 1PGSA 3KWVA 2DCZA 1GUMA 3DKSA 3BCKA 5ECNB 5GLWA 1JYCA 3QPMA 2H72A 3AC0A 5ELGA 4JC1A 4Y3OA 2VVEA 4QPYA 3H93A 4Q4X1 4FXKB 5CP1A 2C0DA 5GZFA 1XE8A 2L4CA 5F07A 1H30A 4JRRA 1ZRIA 5BY5A 1J9BA 3WQ7A 4UXAA 4XFFA 2R4VA 1DCSA 3WNNA 3C7OA 3D4TA 4CYDA 1S0JA 4XBQA 4XS4B 1G7YA 4AJ6A 3S7EA 4F0CA 5GZGA 1MVQA 3TEZA 3T3YA 1GP4A 2REMA 5EYYA 1PRXA 1MQTA 2GMPA 1U12A 1WMDA 4WZCA 2MNGA 2I45A 1RUD2 4AK3A 1UN2A 3LOBA 3HHVA 4KUNA 3WNOA 4LR4A 1W03A 3IBMA 2YZHA 3KH9A 3W58A 1T6BX 2M46A 3K4AA 1OMIA 4RGGA 4CU9A 3F4RA 1QMJA 2VOVA 1FOD2 3D5JA 3RMYA 1T00A 4OLLA 3TDGA 3GZEA 1BLZA 4E4SA 13GSA 4NMUA 4E8EA 2VOTA 4XCSA 2FWGA 1XW9A 1TMF2 2VMIA 1PL1A 2VW1A 3KF3A 2IJYA 3ACFA 5AC91 3POWA 1OC1A 4FYCA 1SJZA 5JAXA 3ZYGA 5BNNA 2HWF3 3NV4A 3WF2A 3AKSA 5JZGA 1LNSA 1ABAA 1IG3A 5F5QA 5IK5A 4G0IA 4IEPA 3NJZA 4ONUA 3GCWA 1JHNA 4PLOA 3CQOA 4Q4W2 4AEJA 3ON7A 3SH3A 2IXCA 4K40A 1W8NA 1GZTA 1S0GA 1W6QB 3Q8AA 4GIQA 5FJKA 3RGBA 1SPPA 3RZZA 3D6EA 1IGOA 2XJSA 5JOXA 1OFSA 1R26A 2LJAA 4AGVA 2X29A 4ISQA 2RM23 1XBSA 3T2PA 4HVOA 1K0BA 2YCDA 4RR3A 3K4ZA 2X8CA 1LKNA 4CCLA 4NMIA 1VGLA 5G05L 1K0CA 4DUWA 5AN1A 1EAH3 3MUZ1 4BA7A 4LBQD 4Z2AA 1K0NA 1KFXL 2Z9SA 2HH9A 1GTUA 1SJIA 1DF0A 2HWC3 4P08A 1BBT2 1JZ8A 5FPAA 1H8VA 3U5RE 2G2QA 2A6WA 1GR3A 1NAEA 4CEWA 3GJAA 1O7UA 4AVVA 2GNMA 3W5MA 2Q5TA 4MJBA 4MK3A 1RMU3 2V09A 3W8SA 3T4HB 1THXA 1UXXX 1TK5B 1RUNA 4LMFA 3VBSA 1N3QA 2LRCA 4DEVA 4TXVA 2Q8OA 5A3NA 3M7AA 3OJBA 2AR6A 2GT6A 2JDNA 2H30A 5AIVA 5FZEA 4K7OA 2QA2A 2JX9A 1OSGA 3P2AA 3U10A 2I2SA 4MA9A 3E1F1 3E5XA 4QGMA 2B4KA 4KBZA 3SMHA 3S30A 2BQPA 2B3SA 4CW9A 1F9KA 1RUH2 2OPWA 2Q1FA 1Y43B 2R042 4BMEA 1STMA 2H1GA 5B6MA 5IK8A 3O12A 4YVWB 5A32B 1HQWA 4CCDA 3BTZA 1PO22 1H2NA 3OOXA 4M3CE 3MHZA 5CFDB 4LOTA 1FW1A 2P5QA 4OI4A 1S3DA 1FXZA 3CYNA 2HWB2 3ZMKA 2VCXA 1NY71 4ZL7A 2XHKA 2O0OA 1B48A 3MIBA 2X5IB 1PGTA 3ZFFC 1M4WA 3BVCA 2IUWA 4KH7A 1K0AA 4KB3A 2YFUA 1DQ5A 1GP5A 1H2MA 2RDNA 3IK7A 1A78A 3ORJA 4A6SA 2G9GA 5DUXA 3ZXJA 5I93A 5ECLB 3I69A 3PJYA 4JKLA 3WNXA 3BALA 4UAPA 2VCZA 1K0OA 3M3EA 1QQP3 2WAAA 3FHAA 4HJMA 1XCCA 2GH2A 2W1WA 2X09A 1VMHA 4F82A 2WGRA 1W2NA 1LHWA 4QX2A 1PM7A 2LRPA 4IE4A 4IEWA 2WDUA 3CU7A 5FP4A 4JZQA 3VKFC 2BYVE 9GSSA 4MO3M 4OMDA 1A3KA 1RYYA 2QTWB 4CXWA 4CDXB 2HWE3 5G1KA 2IMFA 1XB9A 4PDWB 5CYYA 3ITQA 5IMZA 3GHAA 1G6NA 1AL21 2PHTA 1O91A 3ZXLA 4FTBA 3AXDA 4MJAA 3DWVA 4IEZA 3PUSA 3LEFA 5LBEA 3ILFA 2GP5A 3ZIWA 4KF9A 2BGPA 4YGBA 2IFRA 3FR9A 1MS4A 3LZZA 5FK8A 2GU9A 1EWXA 3HXSA 4LHSA 4ECBA 3I49A 1MS9A 1WW7A 5FZHA 1SLTA 1RTVA 5DAQA 5FXXA 2YN1A 2ZGRA 3SHRA 3ZX7A 1EGOA 4CU7A 2A70A 3QBQA 3VBFA 4XYXA 1ULCA 2YWOA 3M1GA 4CZSA 5GALA 4GWRA 1WLWA 5ECMB 4UW4A 2WIIB 3ES1A 3O0WA 4M4PA 4QGLA 2LUSA 2ERFA 4FPHA 3RQ0A 1DQ6A 1XYNA 1KDMA 3MAKA 1PVC2 1IS5A 2OZ6A 1VRBA 3SBCA 4NHYA 4ZZ8A 3TAYA 3OBTA 1ZREA 5IQYA 3TUEA 1XJAA 4C0HA 3VKOA 2PN8A 4KW6A 5T52A 2VCTA 2W87A 4LKSA 3V0AA 4O9EA 4UT5A 5A6XA 4UF0A 5IOWA 2B7JA 5JMCA 4QB1A 2VZQA 5DJLA 1J1LA 3AKPA 3ZFGC 5FMDA 3GNJA 2VPVA 4A2UA 3KVBA 1U5XA 3WNLA 4I09A 1AYN2 4P9WA 1HNBA 1POV0 4P5HA 3EQEA 3HQUA 3OPWA 5LY1A 5FK7A 1ZZ7A 1Z7S2 1VR3A 3VBUA 4AFCA 3BUCA 4GLTA 2ZGUA 3C2UA 3WP3A 4PQ9A 5GLTA 5CKMA 1ERUA 1JYIA 2JG8A 2HRNA 1W6OA 2GNTA 1GU3A 4Y33A 2ON7A 2B1KA 1W6PB 2VMFA 2LKUA 3N9MA 4NIDA 1QJU1 2AZ5A 4JHZA 1QNWA 4YZ3A 2DJKA 4MADA 4IXLA 2QJVA 2PXJA 3DPRC 4CDWA 5FWJA 4P9YA 1HD2A 1QGVA 2RIIA 4ATFA 3WGXA 1XWKA 2WSVA 5AGYA 1NG0A 4MG2A 4RGAA 1WZXA 2VZ1A 1I5GA 3RJ2X 3NO8A 2ZGLA 3G7IA 2ZGOA 2LUWA 4GB33 4I5QA 2WR9A 1AR61 3ILRA 4RHV3 3VZOA 2FBEA 1URMA 3GZAA 3CF6E 3OYWA 5IMCA 3ZFBA 2W46A 3UV9A 5HQPA 4OULA 1ZZ9A 4AEDA 5FY1A 5DQSA 1YWKA 3LD8A 2DKHA 1TRUA 5IVBA 2E31A 4FOYA 5H5RA 1MQTB 4YVSA 1SMVA 1YFXA 1K5MA 2IXHA 1U6TA 4BCUA 1NCQC 1SQ4A 1UU4A 2BUKA 4M00A 3PUHA 3PURA 2JD4A 5FYSA 1SKWB 1G7EA 5IATA 1WIKA 4ZU4A 4PI0A 3R3EA 5KC6A 1S3CA 3OPZA 4Y22A 5CAZA 3FR6A 3QOUA 1ULFA 4GQ7A 2DTWA 2YPJA 4UFLA 4YG0A 2QQJA 1RUG2 11GSA 1VBA2 5I91A 1QH6A 1Y9QA 3HZ8A 3KQ4B 1GYKA 5ECRB 5JPMB 5JXIA 3PIJA 4WZFA 4Q1RA 5JOYA 2RJLA 4B4RA 1VBB2 1WA6X 5IAXA 1UL9A 2D6PA 4YKGA 5D21A 2H0HA 3OUIA 1PIV2 2N7GA 2RS33 4JDOA 1R093 1T6GC 19GSA 5JZGB 4NN0A 1YNAA 4CCMA 1SCSA 4ZS2A 1WOUA 4XFBA 1S1AA 3N9NA 3O0XA 1VRH2 5BMUA 2VL2A 3ZL5A 2UWBA 5A7QA 1JW6A 4UYBA 5J37A 4R8HA 3IMMA 4FPJA 3OEBA 1IZ3A 1DZTA 2E63A 2YY1A 1F5FA 1ZA7A 3R6SA 1SPPB 4O5UA 4Y4RA 5FT3A 5C8WA 2A6XA 2YROA 2GVPA 2FCTA 5FZBA 2Z42A 1M0UA 4N43B 1VBC1 4BQ1A 3HD8B 4I01A 4RR3B 4HQZA 1Q5OA 2J1EA 1DQ4A 4W8JA 5FY0A 4XF3A 4USSA 5LZ6A 1S3RA 3WDYA 3VPQA 1O4TA 1YQ1A 1UF2C 4R4ZA 3ACLA 1XE0A 5FYCA 5EL8A 2OKAA 2BZDA 4IV3B 1GWCA 1VF1A 3O1PA 2ZCWA 3ECQA 1UYPA 3ZR5A 4CEWB 3KT7A 1WW4A 2OA2A 3M70A 4R52A 4IQAA 2RE9A 1U5IA 1MEC1 4N0VA 4QM9A 3FN9A 1PZ8A 4QQLA 3OG2A 2VY0A 1VBE3 4TW5A 5T5OA 3F3RA 5GLUA 2PQQA 1CJPA 1YRZA 3VBSB 2WZ8A 2ADEA 1UYZA 5DDJ3 4URAA 1H6YA 4O9GA 5B8BA 1SBFA 1GBGA 3A2WA 2XBQA 4MSVA 4COWA 5FCCA 2JWPA 1LECA 2LEGA 4JEDA 4BLJA 1XNDA 5DZGA 1ENQA 5JR7B 2ENRA 4FVVA 4CUAA 6GSXA 1VMFA 3E5UA 4MNNA 1CPMA 2KR2A 4DEJA 4YFZA 4OD7A 1A8YA 4PIYA 1K45A 2W1SA 1CZTA 5EHDA 2DJ1A 1GZ9A 4Q4Y1 1YFUA 2LQQA 2OJLA 4NV5A 3RZHA 3O1SA 2BJSA 2R49A 1EEJA 3N7JA 2QBXA 2CTVA 2C9KA 1S0CA 3F63A 3B7MA 4XHMA 3VWXA 1ZYPA 1EUUA 1OE7A 3BD2A 4KDUA 4LLFA 4AHYA 1ZRFA 4LKFA 4XMIA 1H1MA 4S2DA 2TIRA 3ACIA 1LOFA 1ULEA 2BDRA 2JDHA 2BERA 5JWOB 1ZZ6A 5DG1A 4DS0A 3HJOA 1ZZ8A 1MS5A 4N9HA 3LQ7A 2X49A 1IS6A 2F3MA 4DXZA 5D73A 2AC1A 4JZRA 4B4PA 1EEMA 3MNGA 2DVDA 5C8CC 3EMXA 5A7WA 1NCRC 2RJ2A 2BV4A 3KP9A 2XBO2 1LR5A 1X5DA 2I07B 3S5AA 2XJPA 5C9AB 2VCAA 3ZVJD 4RD7A 1ULPA 5FHIA 3FFZA 4EXJA 1F2EA 5GLVA 1M2DA 1TI3A 2B5HA 1Z0HA 4GQFA 4EC0A 1JLWA 1AX0A 3UARA 3FZ9A 3JQXA 2K9ZA 4K5RA 3GL3A 3JZVA 5IK4A 5FZ0A 2PVQA 4EE0A 2FCVA 5JCTA 3QACA 5A1AA 5APAA 1AYM3 3GZUC 1UC7A 2MEV2 3FR3A 3DECA 3VBFB 3D4MA 2D93A 1QMVA 1KQRA 2IZWA 2D44A 4A44A 4MJEA 2FDKA 3FUQA 3RPPA 3ZM8A 3IB3A 2YJ7A 3OF1A 3X29B 1SZBA 3HQXA 3CTGA 2IN3A 2OADA 4YPJA 1N47A 1CAVA 3HOBA 1YI7A 1DBNA 2IMIA 1FNZA 1ULGA 5LATA 4Z2WA 2N5FA 2OS2A 1Y6EA 4B3NA 4EZHA 4NV2A 3VDDC 1W90A 3I2FA 3EHKA 1U88A 4UF0B 3A2XA 1US2A 2O1QA 2P0GA 1AR73 1RC6A 5CADA 3AP6A 4KWUA 4A4AA 3SKVA 3NJYA 3A0KA 3VD3A 4Y5Z0 2VTXJ 3WDXA 1HRI3 2UWCA 3VBUB 4Q8KA 1M9AA 1WMEA 5GZDA 10GSA 2VZVA 4N90A 4YVWC 3KCYA 5KXBA 2JG8B 3ME8A 1W6OB 2BOJA 2XL7A 1VPHA 4A7ZA 4YW1A 5CFDC 5HFGA 3MPPG 1V9WA 4I0BA 2CAQA 4QHOA 2W92A 1UZWA 5EYXA 5G1LA 1JI6A 2MHFA 4CDWB 2FHEA 4HKLA 3RWKX 3ZSEA 1XNAA 5FY9A 1RUJ3 5BNQA 1X9MB 1LOBA 1UW8A 2IWGB 2XJRA 5JSRA 4XHXA 4CDUA 5BRTA 3MGUA 1OXCA 2NP0A 2GN3A 3J8F3 4BQ5A 4O5QA 1DQ2A 1FOHA 1VIWB 2CY6A 4P00B 3ILNA 5L73A 1BCXA 4OWYA 4D6SA 1YUDA 2C4JA 4IGOA 2EICA 1URXA 2XQXA 4YW4A 5F32A 5DG2A 1O4ZA 5CB7A 5T5LA 4N53C 3U1XA 3L2YA 4IQ1A 3NNMA 3OYWB 3WCSA 4XIKA 3H1WA 2YU2A 4A6OA 4AEDB 5FWGA 2A3YA 3K8NA 4XJUA 2WRAA 2Y60A 2TRXA 5FZOA 3U11A 4CDXC 3L9SA 1S0IA 1QHDA 1YJLA 5KN3A 4ATEA 2W5FA 3T2QA 4YVSB 1K5MB 2HWF2 1UOJA 2VTXA 4Y20A 2UY9A 4AE2A 1RUD1 5LK7B 3Q19A 3NV1A 4FPCA 4RA0A 4P9GA 2YV8A 1SK2A 4NR1A 2V5YA 2YANA 4MGYE 3K3NA 3I8TA 1XIYA 3RVHA 4X0XA 4BLIA 3KZQA 2WS92 2GSYA 4Y22B 1ZMAA 3ERWA 1XWBA 2WAOA 2O8QA 2ZAAA 5GZZB 1FOD1 3IIIA 3IXRA 1UYYA 2UU8A 3LAGA 1A23A 2D6OX 2LS5A 4OUMA 1SACA 1PM4A 2RM22 3GF6A 1C3HA 3MW3A 1VLNA 4UFMA 3FLPA 2ZHMA 5IMFA 3VD5A 4MOAA 3E5QA 3KV9A 1XBFA 1ST9A 1K0DA 4EN8B 3ZFLA 2XLGA 2WFCA 3JD73 4XQ4A 4EWEA 1PK6C 1AX2A 5DCGA 1EAH2 2VR4A 5J3UA 5LD0A 2RR11 4QDRA 4ZB6A 4JU5A 2IPAA 3GURA 1A24A 2HWC2 4OMVA 3TEXA 4IEXA 1Y3TA 2RMU3 2BBVA 3AFKA 1Z6MA 1VAKA 5A80A 4KX4A 4UFKA 4F7ZA 4E8DA 2YJHA 1W0PA 1HJFA 1RUE2 5FO9B 1RMU2 4CXXA 1M3IA 1GTAA 4HI7A 3UGGA 4S2FA 3IDCB 3ZZXA 3PUQA 2WWSA 5K8SA 3OBAA 1AJOA 2XVGA 4XUNA 4O65A 1UO9A 1QDCA 3OGSA 1ALYA 2B5XA 4OO5A 2VM2A 1HKDA 2P3YA 3FFQA 1RUF3 5KHJA 1A2LA 1ENRA 3VD4A 1F8VA 1PA3A 1BBT1 2VL4A 3SWLA 5IK7A 2DSAA 4LO7A 5LCZA 3U75A 3UYJA 5T5PA 2X4AA 3T2TA 2G1MA 4JGYA 2JACA 4YQUA 2Y6GA 4XF0A 1E2YA 2D6KA 3U07A 3IPZA 4BOWA 1WRYA 4BXSV 3RBTA 3A2VA 1JFUA 2UZ8A 4YG6A 1W9SA 3WT1A 3IHQA 1OH4A 5J1XA 2BGOA 4JX0A 3E6BA 1O73A 2VQ0A 2YB7A 1JZ5A 3RWNA 5B4XA 1T8EB 3AM2A 3HY2A 4HEA2 2GSTA 1OT5A 3UIWA 4AFBA 3LEGA 4LBQA 1QQP2 1VALA 2ZA9A 2R041 3AKQA 2DUQA 3MEPA 4Z82A 1MQTC 1SYXA 4R9BA 1REEA 3QAVA 3WF3A 3Q8FA 1GTIA 2C1FA 1HQOA 5HI0A 4GWIA 1F6MC 3T0BA 4LKEA 5KN1A 3FKFA 4KDXA 4QX1A 2HWE2 2ES3A 3VBHC 2MZCA 6GSVA 2Q4SA 5JVVA 3MYDA 1D0HA 4LE3A 3RZGA 1LTEA 1ZL9A 1MDKA 4HKOA 4ZXKA 2VCCA 2VECA 3RZJA 4K9SA 3CJXA 1VE0A 1KTEA 2YDEA 4GH4A 1SEFA 1ZZYA 3ZSMA 3KV6A 3ZDSA 1BMV2 4F03A 4DSRA 3ERFA 4LITA 2QZ3A 4ZB9A 2BNOA 1RJ8A 5IJRA 2P37A 1L7LA 4DSSA 1VBD3 1RUC3 5JPNB 2DJ0A 4POKA 5CKNA 1XNTA 2VQAA 2UYBA 3WXPA 4BDVB 3H8OA 1T1VA 3B00A 2Z4FA 2WQ4A 3WHTA 1JZ2A 2FCUA 1SL1B 5KXCA 3ZTLA 5KHHA 4Q5RA 2C80A 4I97A 4CEYA 1PX4A 1B9YC 5A7WB 3JB4C 1WLCA 4XTSA 5AISA 3TGZA 3KHCA 2YPDA 3WOGA 2CL2A 2HBTA 3RZLA 1YQ5A 4HLTA 1W3XA 4N43C 1CGPA 1WBLA 3DL3A 1Z9HA 4LHNA 4RSUA 1H9PA 2OA7A 5FZFA 4G0LA 3KV4A 4D7YA 2CVBA 2WS2A 4MGSA 1T7PB 4N11A 1DLCA 3CBNA 3ROUA 1AXKA 1H9WA 4SLIA 3MYXA 3IA1A 5C5UA 1XW6A 3PUAA 3GBFA 3FLRA 1BXHA 1TTZA 1W9YA 1UN1A 3EE2A 4AFDA 4PI2A 2J1UA 1CD3G 5DVBA 1UZYA 4IV3C 3T2OA 1AJKA 2P1BA 6GSWA 3H9AA 1OKTA 1OBNA 2GNDA 1F9MA 3MIEA 1C4RA 1PVXA 1NT0A 4K5SA 3GV1A 1PVC1 4KE3A 4LOSA 4HDEA 5F1RA 3IAS2 1CAVB 5JWRB 2ZPXA 1O81A 2C1YA 3QD6A 4OHYA 5EY6A 3M0FA 1ZYBA 5ACA3 2VUPA 3EC3A 2BVBA 4OCEA 2W91A 2H19A 1A2JA 1PO11 2FCHA 2HRFA 1YJ6A 4K8RB 2A5ZA 3O76A 3V1WA 2JG9A 4BQ3A 3FHIB 3CNAA 5G04L 2ORZA 1MD4A 1AYN1 1OI6A 2WQZC 1JUHA 5T54A 4BPYA 1C57A 5C71A 1WD3A 5TSWA 2R7EB 4GB32 3IPVA 3OGVA 4Q8LA 4RHV2 2CDOA 5J9CA 5FQ0A 1YO8A 1PN9A 4L9BA 4UBGA 4TR0A 2AREA 3NV3A 2YMZA 5BNOC 4NHXA 3KMOA 4PUFC 1QDOA 1X9PA 4XZPA 2XVLA 3BCIA 3RPQA 4XABA 2VOCA 1DSBA 2JDAA 3LXTA 4CDUB 2B7YA 5HV4A 3G7YA 1IYHA 1ILOA 2WFPA 3IC8A 4LTAA 4K8MA 3AYDA 5IHRA 2YV7A 4DXSA 2IC1A 3FRCA 4DZGA 4LORA 3TOTA 4NVPA 5L9VA 3VWVA 4IBPA 3TNPB 4NPMA 1GSDA 3CMGA 1NLRA 5A7PA 3LSDA 3WT3A 1O3RA 1MDJA 1B4PA 4I2UA 4OMCA 3T1LA 1RK4A 5FZOB 1R4WA 3C7EA 5FY7A 2PBJA 4J1WA 1W28A 4XBLA 2XLFA 1R1A1 2RS32 4KQ7A 2ZKLA 1R092 5FMOS 5FWEA 2Q0AA 3WR0A 2OVUA 3IE3A 4Y20B 5C9AC 4YM2A 4OFTA 2F51A 3FYGA 1LCLA 4ITCA 2QQIA 1HB1A 1IYIA 3PLQA 4N9IA 3F95A 1RVF3 2RS52 4IW9A 4QX0A 3DVWA 5EVOA 1KEBA 1I3HA 1MZ5A 4HZ4A 3M2MA 1G6WA 2VMHA 4V2VA 3WF4A 4B8EA 1BAYA 5DXDA 3O6TA 1XNKA 2X53S 4BE3A 1PKWA 2JZRA 3MLKA 1RUG1 2GSRA 1VBA1 1XOBA 2UYAA 1QJZA 4CE8A 1GOGA 2K46A 3VD9A 4DUVA 2P2KA 3H1MA 5IYYA 4TN8A 1S0BA 5KN2A 1H75A 3EVIA 1AR81 4QPIB 1W2OA 1GSEA 3IV4A 5J41A 1W6MB 2LTNA 3WP6A 2D5FA 1GV9A 5D1IA 2ZMNA 5IWFA 2PLV1 3AKTA 2W9XA 4JR4A 4IEOA 3TNQA 3SCFA 1QNYA 3S7IA 1TNFA 2AYHA 2X8KA 2VW2A 1VRH1 2OW4A 3FMGA 2CT6A 3DF0A 2PU9C 5KHIA 3MF9A 3US3A 5FMBA 3TCOA 4JVAA 5FZ3A 2WZ9A 1IG0A 2VMEA 4W6WA 2JKXA 4H7LA 1PSQA 1SBEA 3MWHA 3LDRA 4FPEA 1A0FA 3LDKA 1VBE2 2R0HA