1B9XC

Structural analysis of phosducin and its phosphorylation-regulated interaction with transducin
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
217
structure length
169
Chain Sequence
EGQATHTGPKGVINDWRKFKLESEDEGCLRKYRRQCMQDMHQKLSFGPRYGFVYELETGEQFLETIEKEQKVTTIVVNIYEDGVRGCDALNSSLECLAAEYPMVKFCKIRASNTGAGDRFSSDVLPTLLVYKGGELISNFISVAEQFAEDFFAADVESFLNEYGLLPER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (TRANSDUCIN)
publication title A molecular mechanism for the phosphorylation-dependent regulation of heterotrimeric G proteins by phosducin.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
total genus 44
structure length 169
sequence length 217
ec nomenclature
pdb deposition date 1999-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02114 Phosducin Phosducin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.168.10 Mainly Alpha Orthogonal Bundle Phosducin; domain 2 Phosducin, domain 2 1b9xC02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1b9xC01
4I6XA 2R6KA 5CRGA 1F3AA 4ZB9A 4OFMA 5CRWA 1WP0A 5ECLB 1PKWA 5D9XA 3ZIJA 2EC4A 4MABA 4F0BA 3DYRA 1A8YA 1SENA 6GSSA 2FA8A 5IO2A 3OR5A 5HFIA 1O73A 1NW2A 4Q5FA 1SJIA 4NXIA 2IMIA 1PGTA 3L9SA 4TN8A 2J23A 1FHEA 3N5OA 1DE2A 5IMFA 2B7KA 4EO3A 3APSA 2JACA 1XVWA 3MDKA 6GSVA 3TJFA 5CP1A 2VCVA 2L59A 4I8BA 2MMNA 1OE8A 1O8XA 4KNDA 4WKWA 4ZBBA 3APQA 4DSRA 1ON4A 4KDYA 1FG4A 2IJYA 1O85A 4TR3A 3TB2A 2F8FA 4XIHA 3I69A 3C73A 1GULA 2GDRA 4KCEA 4L5LA 2CAQA 3TJGA 2LSTA 2HZEA 2VO4A 5A5KA 2F3MA 3IR4A 1R4WA 2JZSA 3HY2A 3TKSC 4KSOA 3DVWA 2C80A 4XRDA 2VCZA 4ZL9A 2VD0A 4X1UA 4ILFA 3QFAC 4TR4A 3VWVA 1QGVA 3GKMA 4POKA 2GZZA 4HI7A 2DBCA 2G2QA 1BJXA 1USBA 2C1YA 5DQSA 5INYA 1E6BA 1K0BA 1TRWA 5IIZA 1ST9A 4EDYA 4HU9A 4NHWA 3ZZXA 3TOUA 4K7NA 1ZMAA 3CRUA 4HJMA 4N11A 1XWGA 3EMXA 2MMZA 2FLSA 2C3QA 2IMFA 3CRTA 3TOTA 3CXGA 1GWCA 6GSTA 3F3QA 4YQVA 2OE1A 3GA4A 3QAWA 4ZXGA 5ELAA 1WE0A 3CSIA 3CYNA 1A2MA 2YZUA 2YNXA 2VIMA 1QUWA 5JWOB 2GSQA 2F8AA 1I9DA 2B5XA 3DD3A 3BD2A 2KP1A 3VURA 5D9VA 1PN9A 2NTOA 1TU8A 2MZCA 1NHYA 2GQLA 4XS6A 1JFUA 5G1LA 2AJQB 1SJZA 3FZ4A 3WGEA 3HJOA 2YJ7A 16GSA 2YWIA 1ZGNA 1XIYA 3IK7A 4RI7A 1RK4A 3IBHA 1MDKA 4TR1B 4KGIA 4GSTA 1DSBA 3HCZA 3HJPA 2CX3A 5HFKA 1OYJA 1GLQA 4IW9A 3M8NA 14GSA 2I3YA 4V2LA 3A3TA 4TR0A 1ZYQB 4LMWA 3E9JB 3IPZA 1QMVA 3GV1A 3C71A 3TKSE 2FGXA 5IO0A 3L9VA 1JLWA 3Q74A 1XW5A 1JLVA 4F2IA 3WT2A 4OD7A 4V1Ap 3LXTA 1FVJA 1XPVA 5JWRB 1GTUA 2LQOA 1FW1A 1XVQA 4K7IA 1TK8B 3U6VA 1HNBA 1BG5A 3D6IA 3KH7A 3MWHA 4IQ1A 2CZ2A 5EL8A 3TGZA 7GSSA 2X64A 2DJJA 5IMDA 1R7HA 3PGTA 2PGTA 3BOAA 4CHSA 1X9SB 2DC5A 2YWMA 1EEJA 2QSIA 3RBTA 1TKDB 1HNCA 3J7Yk 5F07A 2IWTA 4ECJA 2HE3A 4HQSA 3ZMLA 2V41A 5DJMA 3UVTA 3D22A 2QC7A 2CV4A 2IN3A 5ABRA 2LRNA 3TDGA 4XS1A 2CA8A 1LJRA 1TRVA 2P31A 2PN8A 4HOJA 4MDCA 2HSHA 2TRXA 4WF5A 1G7EA 1JZDA 4I2TA 1U87A 1B9XC 1LU4A 4GSSA 2H71A 1B4PA 2P0GA 1YEPA 5IM9A 4GF0A 3UIWA 4XS4B 4AJ8A 3M9JA 5IMAA 2X8GA 4L0WA 4HEA2 2E7PA 2F9SA 2AB6A 4ZL7A 2I1UA 5CREA 3ED3A 2WJUA 1SL2B 2REMA 2N5BA 1EV9A 3FYGA 3MNGA 3APOA 1JZWA 2YPMA 1DBYA 2TRCP 4OFNA 1XOBA 2RUEA 1V9WA 2O7KA 1GUKA 3HHVA 1J08A 1KBNA 4K1FA 5ECPB 5F05A 1SKRB 2HRNA 5HR2A 5DCHA 1SKWB 5HQPA 2K8SA 3KM6A 5IMVA 2V2GA 1SKSB 4MH3A 4IJ3A 5D9TA 2HZFA 1YJ6A 3UVHA 4GQFA 3QR6A 2DJ3A 3H93A 4HJ2A 4DSQA 4KSMA 3G7JA 1SK1A 1FOVA 3LYPA 1U3AA 2FWHA 4IP6A 3HVVA 4IHUA 3TRQA 4NWYA 4CDOA 2RUFA 3LJRA 4WR5A 4ZILA 5ECMB 2IPAA 2K6VA 5J4UA 2YANA 4BA7A 5KN0A 2LRCA 4OFTA 2H0HA 1A24A 4G9HA 4EF0A 4MZCA 3FHKA 2VL2C 1FO5A 1PMTA 3D4MA 4KCAA 5CO3A 5JCUA 3TCOA 3F4TA 3NIVA 1T3BA 4KW6A 5E4WA 2R2JA 3K8NA 3QAGA 2LEGA 3N9JA 4KA0A 4LA1A 5CYYA 3HD5A 3US3A 1V2AA 4IJIA 1GSFA 4G2EA 5LD0A 1MD3A 2GZPA 3GN3A 1IYHA 1ZZYA 1GH2A 1M2AA 2K8VA 3W6GA 5DDLA 2WRTA 5ECRB 2BMXA 3FEUA 1TRSA 4FO5A 4MMMA 1ZYEA 2C3NA 4IKHA 5IOXA 1ZL9A 2VM1A 1X5CA 3VK9A 20GSA 3LYKA 2L4QA 2H0IA 3ZVJD 1WMJA 3GSTA 2O85A 3FY7A 5ECHB 5IPGA 5G31A 5HFGA 1Z5YE 3LSZA 2HSYA 2B6MA 5DVBA 3Q18A 4D73B 5JCWA 1WIKA 3VI7A 1MDIA 3ZL5A 1VGLA 3SWLA 2VUPA 1MDJA 2A2RA 1BX9A 1K3YA 1SK0A 4V2MA 5A4WA 4K0GA 1X9MB 2OA7A 3ZMKA 2DMMA 3ZFBA 1X5EA 1THOA 1SL1B 1YKAA 1TK5B 3H8QA 2GZYA 5G5FA 1WPIA 2B3SA 5H5QA 4MLYA 1R5AA 3UL3A 3IAM2 8GSSA 1R5PA 1J0FA 3DVXA 2MMOA 3H79A 2IMDA 4KE3A 1S3CA 4F03A 1JHBA 2DMLA 5JCGA 2GVPA 3DMLA 3EVIA 1EOGA 2C8UA 1HNAA 2DJ2A 3IXRA 3U5RE 1YKCA 4HUAA 1TK0B 3HVSA 2OE3A 1B48A 3E0UA 1M7TA 22GSA 2VL9A 1M9AA 2JZTA 3DWVA 1AXDA 1Z7PA 2DLXA 2WCIA 1GSEA 3F3RA 1GSYA 4OCEA 3GRXA 1QK8A 4N0VA 1EP8A 3UMAA 1PQNA 4F9ZA 5KN3A 3IE3A 1A2LA 5ENUA 2H72A 1T7PB 5KN2A 2R4VA 1O6JA 9GSSA 1EZKA 4POMA 3VWWA 3GTUB 5ECNB 4MK3A 2KUCA 3EE2A 4POLA 2TIRA 1GNWA 3PH9A 3W8SA 2H66A 3DRNA 2EIRA 4HZ2A 6GSXA 2E2MA 3KMOA 3WT1A 3GIXA 4JEDA 1QFNA 2X8HA 3IRAA 3IDVA 3EU3A 1K3LA 5KEJA 3ERFA 2KHPA 2MBTA 4K0NA 2ON5A 5CRDA 4ECCA 4MZBA 2H75A 4TR1A 2H30A 2QKEA 4I5QA 3UAPA 1XWKA 1XCCA 3UBLA 4BPYA 2E2GA 6GSYA 2PPTA 3IHQA 3F0IA 1PA3A 2LKUA 3GKNA 3ZLPA 1BYEA 2GT5A 1XWBA 3HKRA 2LTKA 2L6DA 2A4VA 4QL7A 5IOWA 4EL1A 1EWXA 1B4QA 3M3MA 2VCTA 1Y25A 4G19A 4OWYA 2H73A 4MF7A 3EU4A 4BWQA 3GKXA 3F8UA 4DVCA 5GSSA 4KAEA 1ACVA 5GSTA 4J56E 2V1MA 4TKYA 1GSUA 4PXOA 4K9ZA 6GSUA 3L4NA 2PVQA 1K0NA 4YQMA 2H8LA 2IFQB 3HVXA 3ZRDA 4XCSA 3O76A 1Z7RA 2OKAA 2LJKA 4N10A 4P3YB 1EGOA 5FT3A 3TKSA 3E3EA 1EP7A 5D96A 1M2DA 3KEBA 1FAAA 2WGRA 2C0EA 2A2SA 3M9KA 4EC0A 2JSZA 1U3IA 3GURA 3WD6A 2PMTA 3ZITA 3KJYA 4XRAA 5LNKe 2CZ3A 2NPBA 1QXHA 4NHZA 3ME7A 4J57E 2XC2A 1K0DA 2VLVA 2H01A 2CAIA 3QFBC 4XS4A 1DUGA 5IMCA 2OE0A 1TP9A 1UVZA 1YEXA 2WB9A 5CRHA 2AHEA 4KUNA 2HLSA 2PBJA 4TXVA 5F0GA 2H6ZA 2MBSA 5A4UA 3DIEA 4FYUA 3IA1A 1O81A 2C0DA 1ERWA 1AIUA 3IC4A 1N8JA 5FWGA 4YAVA 4K6XA 3VLNA 1G6WA 4ZL8A 2GTUA 3FKFA 1TJDA 2R5GA 2EIQA 1F9MA 4RI6A 1TW9A 2LQQA 1URMA 1FB0A 3HDCA 5GAPD 1J9BA 5HR3A 3TKQA 1Z3EA 2VD1A 4EVMA 1XWCA 5AN1A 2ES7A 3KP8A 3VI5A 1HD2A 1OC9B 3HA9A 2M46A 5DJLA 3A2VA 4GQCA 1RW1A 2GSTA 5IMZA 4IS0A 2VCQA 2YZHA 2HT9A 4WEYA 5EPFA 4MZWA 1GL8A 5DBQA 3F63A 4PQHA 1U6TA 3GH9A 2FWFA 4O7HA 1YF0A 4L8EA 1B9YC 4DSSB 3QCPA 4WF4A 5G30A 4L5OA 3EC3A 1TRUA 1JZRA 1E2YA 4BL7A 1A0FA 2C0GA 3RHCA 4IGJA 1CQGA 3IK9A 4KH7A 2LJRA 2CQ9A 1TU7A 2H6XA 4GXZA 3TJBA 1I5GA 1XW6A 3GSSA 4PNGA 5AGYA 3F6DA 2I9HA 3JCML 4GWRA 1OVNA 3KGKA 1EOHA 1GTAA 3NZNA 2LNSA 3GUSA 1A23A 3BCIA 4V1Ag 3ZFLA 5DAKB 3KXOA 1GUMA 1YQ1A 4IN0A 3TKPA 2R3XA 4MJEA 1B8XA 1TXXA 3GHAA 4ULXA 3GMFA 5C00A 3UBKA 2G0FA 4D73A 4GRFA 2XBIA 3ZREA 4FYCA 1N2AA 1EEMA 4ECIA 4WBJA 2YJHA 2XPEA 1YZXA 2B7JA 1PRXA 2AAWA 2ZCTA 3QPMA 2XPDA 2B1KA 4Q5NA 2JZRA 1TI3A 1W4VA 1BAYA 5DCGA 2PWJA 1KTEA 4EDZA 1Q4JA 3H4KA 2KP2A 2V32A 4IP1A 4E8HA 1XBSA 4AJ7A 3KIJA 2H19A 2XHFA 1S3DA 5CNWA 4HZ4A 4MP4A 3DKSA 2D2ZA 1KEBA 1WOUA 1XOAA 4GCIA 4GSNA 5D9WA 3ZYWA 3IAS2 4G10A 2FWGA 4MF5A 1THXA 1T4ZA 4HU7A 2LV3A 5CAXA 5GAND 2GLRA 3GFKA 1F6MC 4X43A 3I6AA 2MMAA 3KP9A 5A4VA 3P7XA 3I43A 3VWUA 2EIOA 1XWAA 3Q6OA 2C4JA 2YWNA 5C04A 4EXJA 1GSSA 4Q5QA 2YN1A 2WULA 1IYIA 18GSA 1M9BA 2FY6A 2H74A 4MJCA 2VLTA 4NV2A 3AY8A 3O6TA 1AQVA 4PQ1A 1PX6A 1A0RP 4Z7XA 3KTBA 2H6YA 3TJKA 2RM5A 4IQAA 3LXZA 4JR6A 1SD9A 2GSRA 3QDNA 4NMUA 3GTUA 6GSWA 4KB3A 5F06A 2H0GA 2H1DA 4L0UA 1R26A 4OCFA 1ZOFA 1VF4A 2ON7A 5B8BA 1SYRA 4XHMA 4NAXA 3EINA 4K2DA 4TXOB 3ERGA 2E0QA 2WFCA 1F3BA 5ECIB 3TKRA 4PNFA 3QAVA 2CVDA 2DJKA 3EURA 4NV5A 3MAKA 4MPGA 1AW9A 3TRPA 1LBKA 1Z9HA 1NSWA 4PQIA 1T1VA 2LS5A 2MYGA 4WBRD 1EV4A 2X8CA 1KNGA 2R37A 3FZAA 1NM3A 1PX7A 2HRFA 2WDUA 1SYXA 2B1LA 4XTSA 1K0MA 1F37A 4LLRA 2P5RA 1XXUA 5J9BA 5L71A 3RAZA 1VRSD 4LL4B 4E8EA 4ID0A 1SD8A 2IMEA 1ABAA 3LGCA 2GSSA 3D5JA 2AV4A 3J7Yb 2HXKA 2DJ1A 3ZVJA 2B5EA 3WGXA 1WWJA 1Q98A 3CMIA 1ERVA 5J41A 2JSYA 4MJBA 3FR9A 5DALB 2CVKA 3UARA 1PL2A 2L5OA 4DEJA 5KN1A 1ML6A 4YAPA 3CSJA 3ZTLA 1OAZA 2IFQA 4PX1A 1EGRA 2PERA 4OO5A 1MEKA 1DE1A 2WZ9A 3KD0A 3C8EA 4FYBA 3G7YA 2V6OA 2DIYA 3G7IA 3VWXA 1OKTA 4ZB6A 4POBA 4AGSA 3QD9A 2AUVA 1SU9A 5FHIA 2VAFA 2IIYA 2OBKA 3IOSA 3HZ8A 2WS2A 2OACA 2FD3A 1MTCA 2ZNMA 2LJAA 3KZQA 2YV9A 3TRXA 5JWQB 2FHEA 3QOUA 3LORA 2OBIA 1T4YA 3BJ5A 1JZOA 4V2NA 4O92A 2B5YA 5IPHA 1BEDA 2HI7A 5ID2A 3HZ4A 4MA9A 4LL1B 4FH8A 3DGQA 2I4AA 1T00A 5ECSA 5AIVA 4TW5A 4ML1A 3F4SA 4WXTA 4JBBA 4YQUA 2PUKC 3ZIVA 3UJ1A 1AQWA 4ZBAA 5H5RA 4O32A 4TRXA 1AUCA 2L5LA 2L57A 2JU5A 1PSQA 2PU9C 2VCXA 2CT6A 1GSDA 4PUFC 2M72A 2FCHA 1K0CA 4ACSA 1ERTA 2M80A 2VL3A 2DSAA 2RLIA 2P5QA 4RQXA 2VM2A 3FZ9A 4ZIJA 1OC8A 3FZ5A 3FR6A 2K18A 4MH2A 4JU5A 1QQ2A 4JR4A 3HXSA 2VOCA 1G7OA 1AC1A 1TDIA 1OC9A 1U88A 3FW2A 2HZEB 3C1RA 3GL5A 1O7UA 3M1GA 3P8WA 4YH2A 5HR1A 4IELA 4J2FA 3C7MA 3GX0A 3PINA 10GSA 3F6FA 2NBSA 1Y6EA 5ECOB 2DIZA 5B6MA 1RQMA 3S9FA 17GSA 3D4TA 3ISOA 5ID2B 1T8EB 3C1SA 1M2BA 2C3TA 1V98A 11GSA 1M99A 1GTIA 4DSSA 2XBQA 4ISDA 2Z9SA 2J9HA 3V1WA 4HQZA 5D73A 2CX4A 2YCDA 4KDUA 4ZB8A 3MSZA 3HJMA 5B8AA 4PGTA 3PR8A 1AQXA 2YV7A 3EYTA 3UEMA 5ECKB 3ERWA 4HS1A 2CVBA 1FB6A 1K3OA 5B7CA 3I9V2 5EVOA 4TOPA 2OJLA 3H1NA 3DXBA 2I81A 1A2JA 4BVXA 2L4CA 5DAKA 2FNOA 2LUSA 4OMVA 2YOIA 5D8IA 1YF1A 1BQ7A 5HR0A 4OO4A 1A8LA 1XW9A 2H1AA 2O87A 3CSHA 2NDOA 4KDXA 3BCKA 1OE7A 3A2XA 3GNJA 1Z6NA 3KCMA 2RIIA 1SJ6A 1V40A 3LEFA 4JE1A 4JZQA 4AJ6A 5D93A 3KMNA 1X0RA 2VCWA 2GGTA 1G0TA 2IL3A 3A5WA 2H70A 2AYTA 3L0HA 4ML6A 1C72A 4EE0A 4N0ZA 3D0ZA 3HYPA 5H5SA 1PD21 2V6KA 1MD4A 1H75A 4LMVA 3RPPA 3LFLA 3SBCA 5IQYA 4GTUA 2F51A 3CTGA 1HYUA 3CBUA 2FA4A 1GRXA 1SL0B 4FIWA 4EUYA 3QMXA 5J9CA 2GQKA 3EWLA 1TOFA 5AIXA 2VLUA 2ALBA 4PUAA 1ILOA 3TUEA 4Q5RA 3BBYA 2RM6A 1NHOA 2H1GA 4WR4A 1X9WB 3G9BA 2DJ0A 2FWEA 2HNLA 1F2EA 3P2AA 4GLTA 4ZBDA 4IVFA 1GTBA 1M0UA 2H1BA 1OKDA 4TVEA 3VFIA 4I2UA 1YDKA 2H76A 1V58A 4MPFA 5DQYA 1O8WA 1SK2A 2OADA 4O5RA 1K0OA 3KH9A 1PL1A 3GX8A 1XZOA 1GUHA 3FR3A 1V57A 4BVYA 1ZCPA 5F8BA 3EMPA 3L78A 4HDEA 3LWAA 1YY7A 2X99A 1TI1A 5ECQB 4I97A 3F9UA 1GNEA 2IMKA 3UOMA 1S3AA 1WRYA 3GL3A 3W8JA 3VPTA 4TXOA 2JL4A 2GT6A 3GKKA 1XFLA 4QL9A 2N5AA 5G5EA 2HFDA 1G6YA 5G1KA 3Q19A 1TTZA 1OC3A 1VF2A 4MF6A 2GS3A 19GSA 1ERUA 1HQOA 4CW9A 2K9FA 3GH6A 2C0FA 2NVLA 1WJKA 3O3TA 1H4OA 1GSQA 3WGDA 2O89A 4WETA 3KTLA 4H86A 3M0FA 3F4RA 1UC7A 4F82A 3VPQA 1UN2A 2YP6A 5ELGA 5E59A 3FK8A 2ZUPA 1Z6MA 4JRRA 4PURA 1X5DA 1AAZA 2GQMA 3LQ7A 3DEXA 3FRCA 2QGVA 3IV4A 4NPBA 4K7OA 1K0AA 2KOKA 3LG6A 1W89A 2VL2A 1CQHA 3D21A 4KX4A 1GLPA 3RPNA 3RDWA 5B6NA 4N30A 2LNTA 3ME8A 1GP1A 1FVKA 2HYXA 2L6CA 2LRTA 1UA5A 5G2ZA 1VF3A 3NOFA 3RHBA 1PKZA 3L9UA 2KLXA 5DALA 13GSA 5J5NA 3GYKA 5COHA 4QQ7A 4IBPA 3CTFA 12GSA 1VF1A 2BTOT 3A2WA 4BWSA 5GZZB 4F0CA 3P90A 3TJJA 5AISA 2PVOC 4MCUA 4MJAA 3R2QA 5LCZA 2N5FA 4EKZA 2JADA 2YWOA 4X0XA 5J3RA 2O8VB 4AF2A 2FUG2 4RUVA 4ECBA 2BJXA 4K8MA 4RQRA 3WYWA 5EY6A
chains in the Genus database with same CATH superfamily
5FLXI 4I6XA 2R6KA 5CRGA 1F3AA 4ZB9A 4OFMA 5CRWA 1WP0A 5ECLB 1PKWA 5D9XA 3ZIJA 3FMWA 4CY6A 2EC4A 4MABA 4F0BA 3DYRA 1A8YA 1SENA 6GSSA 2FA8A 5IO2A 3OR5A 5HFIA 1O73A 1NW2A 4Q5FA 1SJIA 4NXIA 2IMIA 1PGTA 3L9SA 4TN8A 2J23A 1FHEA 3N5OA 1DE2A 5IMFA 2R0GA 2B7KA 4EO3A 3APSA 2JACA 1XVWA 4HSCX 3MDKA 6GSVA 3TJFA 5CP1A 2VCVA 2L59A 4I8BA 2MMNA 1OE8A 1O8XA 4KNDA 4WKWA 4ZBBA 3APQA 4DSRA 1ON4A 4KDYA 1FG4A 2IJYA 3IC8A 1O85A 4TR3A 3TB2A 2F8FA 4XIHA 3I69A 3C73A 1GULA 2GDRA 4KCEA 4L5LA 2CAQA 3TJGA 2LSTA 2HRKA 2HZEA 2VO4A 5A5KA 2F3MA 3IR4A 1R4WA 2JZSA 3HY2A 3TKSC 4KSOA 3DVWA 2C80A 4XRDA 2VCZA 4ZL9A 2VD0A 4X1UA 4ILFA 3QFAC 4TR4A 3VWVA 1QGVA 3GKMA 4POKA 2GZZA 4HI7A 2DBCA 2G2QA 1BJXA 5BMUA 1USBA 2C1YA 5DQSA 5INYA 1E6BA 1K0BA 1TRWA 5IIZA 1ST9A 4EDYA 4HU9A 4NHWA 3ZZXA 3TOUA 4K7NA 1ZMAA 3CRUA 4HJMA 4N11A 4ICYA 1XWGA 3EMXA 2MMZA 2FLSA 2C3QA 2IMFA 3CRTA 3TOTA 3CXGA 1GWCA 6GSTA 3F3QA 4YQVA 2OE1A 3GA4A 3QAWA 4ZXGA 5ELAA 1WE0A 3CSIA 3CYNA 1A2MA 2YZUA 2YNXA 2VIMA 1QUWA 5JWOB 2GSQA 2F8AA 1I9DA 2B5XA 3DD3A 4YKGA 3BD2A 2KP1A 3VURA 1PN9A 5D9VA 2NTOA 1TU8A 2MZCA 1NHYA 2X49A 2GQLA 4XS6A 1JFUA 5G1LA 1PFOA 2AJQB 1SJZA 3FZ4A 3WGEA 3HJOA 2YJ7A 16GSA 2YWIA 1ZGNA 1XIYA 3IK7A 4RI7A 1RK4A 3IBHA 1MDKA 4TR1B 4KGIA 4GSTA 1DSBA 3HCZA 3HJPA 2CX3A 5HFKA 1OYJA 1GLQA 4IW9A 3M8NA 14GSA 2I3YA 4V2LA 3A3TA 4TR0A 1ZYQB 1PN0A 4LMWA 3E9JB 3IPZA 1QMVA 2R0PA 3GV1A 3C71A 3TKSE 2FGXA 5IO0A 4CY8A 3L9VA 1JLWA 3Q74A 1XW5A 1JLVA 4F2IA 3WT2A 4OD7A 4V1Ap 3LXTA 1FVJA 3MYDA 1XPVA 5JWRB 1GTUA 5IT9I 2LQOA 1FW1A 1XVQA 4K7IA 1TK8B 3U6VA 1HNBA 1BG5A 3D6IA 3KH7A 3MWHA 4IQ1A 2CZ2A 5EL8A 3TGZA 7GSSA 2X64A 2DJJA 5IMDA 1R7HA 3PGTA 2PGTA 3BOAA 4CHSA 1X9SB 2DC5A 2YWMA 1EEJA 2QSIA 3RBTA 1TKDB 4FQUA 1HNCA 3J7Yk 5F07A 2IWTA 4ECJA 2HE3A 4HQSA 3ZMLA 2V41A 5DJMA 3UVTA 3D22A 2QC7A 2CV4A 2IN3A 5ABRA 2LRNA 3TDGA 4XS1A 2CA8A 1LJRA 1TRVA 2P31A 2PN8A 4HOJA 4MDCA 2HSHA 2TRXA 4WF5A 1G7EA 1JZDA 4I2TA 1U87A 4G0KA 1B9XC 4O5QA 1LU4A 4GSSA 2H71A 1B4PA 2P0GA 1YEPA 5IM9A 4GF0A 3UIWA 4XS4B 4AJ8A 3M9JA 5IMAA 5LL6V 2X8GA 4L0WA 4HEA2 2E7PA 2F9SA 2AB6A 4ZL7A 2I1UA 5CREA 3ED3A 2WJUA 1SL2B 2REMA 2N5BA 1EV9A 3FYGA 3MNGA 3APOA 1JZWA 2YPMA 1XG8A 1DBYA 2TRCP 4OFNA 1XOBA 2RUEA 1V9WA 2O7KA 1GUKA 3HHVA 1J08A 1KBNA 4K1FA 5ECPB 5F05A 1SKRB 2HRNA 5HR2A 5DCHA 1SKWB 5HQPA 2K8SA 3KM6A 5IMVA 2V2GA 1SKSB 4MH3A 5A2QI 4IJ3A 5D9TA 2HZFA 1YJ6A 3UVHA 4GQFA 3QR6A 2DJ3A 3H93A 4HJ2A 4DSQA 4KSMA 3G7JA 1SK1A 1FOVA 3LYPA 1U3AA 2FWHA 2HSMA 4IP6A 3HVVA 4IHUA 3TRQA 4NWYA 4CDOA 2RUFA 3LJRA 4WR5A 4ZILA 5ECMB 2IPAA 2K6VA 5J4UA 2YANA 4BA7A 5KN0A 2LRCA 4OFTA 2H0HA 1A24A 4G9HA 4EF0A 4MZCA 3FHKA 2VL2C 1FO5A 1PMTA 3D4MA 4KCAA 5CO3A 5JCUA 3TCOA 3F4TA 3NIVA 1T3BA 4KW6A 5E4WA 2R2JA 3K8NA 3QAGA 2LEGA 3N9JA 4KA0A 4LA1A 5CYYA 3A5IA 3HD5A 3US3A 1V2AA 4IJIA 1GSFA 4G2EA 5LD0A 1MD3A 2GZPA 3GN3A 1IYHA 4BL7B 1ZZYA 1GH2A 1M2AA 2K8VA 3W6GA 5DDLA 2WRTA 5ECRB 2BMXA 3FEUA 1TRSA 4FO5A 4MMMA 1ZYEA 2C3NA 4IKHA 5IOXA 1ZL9A 2VM1A 1X5CA 3VK9A 20GSA 3LYKA 2L4QA 2H0IA 3ZVJD 1WMJA 3GSTA 2O85A 3FY7A 5ECHB 5IPGA 2QA2A 5G31A 5HFGA 1Z5YE 3LSZA 2HSYA 2B6MA 5DVBA 3Q18A 4D73B 5JCWA 1WIKA 3VI7A 1MDIA 3ZL5A 1VGLA 3SWLA 2VUPA 1MDJA 2A2RA 1BX9A 1K3YA 1SK0A 4V2MA 5A4WA 4K0GA 1X9MB 2OA7A 3ZMKA 2DMMA 3ZFBA 1X5EA 1THOA 1SL1B 1YKAA 1TK5B 3H8QA 2GZYA 5G5FA 1WPIA 2B3SA 5H5QA 4MLYA 1R5AA 4K5RA 3UL3A 3IAM2 8GSSA 1R5PA 1J0FA 3DVXA 2MMOA 3H79A 2IMDA 4KE3A 1S3CA 4F03A 1JHBA 2DMLA 5JCGA 2GVPA 3DMLA 3J81I 3EVIA 1EOGA 2C8UA 1HNAA 2DJ2A 3IXRA 3U5RE 1YKCA 4HUAA 1TK0B 3HVSA 2OE3A 1B48A 3E0UA 1M7TA 22GSA 2VL9A 1M9AA 2JZTA 3DWVA 1AXDA 1Z7PA 2DLXA 2WCIA 1GSEA 3F3RA 1GSYA 4OCEA 3GRXA 1QK8A 4N0VA 1EP8A 3UMAA 1PQNA 4F9ZA 5KN3A 3IE3A 1A2LA 3JAMI 5ENUA 2H72A 1T7PB 5KN2A 2R4VA 4K2XA 1O6JA 9GSSA 1EZKA 4POMA 3VWWA 3GTUB 5ECNB 4MK3A 2KUCA 3EE2A 4POLA 2TIRA 1GNWA 3PH9A 3W8SA 2H66A 3DRNA 2EIRA 4HZ2A 6GSXA 2A4HA 2E2MA 3KMOA 3WT1A 3GIXA 4JEDA 1QFNA 2X8HA 3IRAA 3IDVA 3EU3A 1K3LA 5KEJA 3ERFA 1M3IA 2KHPA 2MBTA 4K0NA 2ON5A 5CRDA 4ECCA 4MZBA 2H75A 4TR1A 2H30A 2QKEA 4I5QA 3UAPA 1XWKA 1XCCA 3UBLA 4BPYA 2E2GA 6GSYA 2PPTA 3IHQA 3F0IA 1PA3A 2LKUA 3GKNA 3ZLPA 1BYEA 2GT5A 1XWBA 3HKRA 2LTKA 2L6DA 2A4VA 4QL7A 5IOWA 4EL1A 1EWXA 1B4QA 3M3MA 2VCTA 1Y25A 4G19A 4OWYA 2H73A 4MF7A 3EU4A 4BWQA 3GKXA 3F8UA 4DVCA 5GSSA 4KAEA 4O5UA 1ACVA 5GSTA 4J56E 2V1MA 4TKYA 1GSUA 4PXOA 4K9ZA 6GSUA 3L4NA 2PVQA 1K0NA 4YQMA 2H8LA 2IFQB 3HVNA 3HVXA 3ZRDA 4XCSA 3O76A 1Z7RA 2OKAA 2LJKA 4N10A 4P3YB 1EGOA 5FT3A 3TKSA 3E3EA 1EP7A 5D96A 1M2DA 3CQFA 3KEBA 1FAAA 2WGRA 2C0EA 2A2SA 3M9KA 4EC0A 2JSZA 1U3IA 3GURA 3WD6A 2PMTA 3ZITA 3KJYA 4XRAA 5LNKe 2CZ3A 2NPBA 3J80I 1QXHA 4NHZA 4Z2UA 3ME7A 4J57E 2XC2A 1K0DA 4USSA 2VLVA 2H01A 2CAIA 3QFBC 4XS4A 1DUGA 5IMCA 2OE0A 1TP9A 1UVZA 1YEXA 2WB9A 5CRHA 2AHEA 4KUNA 2HLSA 2PBJA 4TXVA 5F0GA 2H6ZA 2MBSA 5A4UA 3DIEA 4FYUA 3IA1A 4Z2TA 4A5PA 1O81A 2C0DA 1ERWA 1AIUA 3IC4A 1N8JA 5FWGA 4YAVA 4K6XA 3VLNA 1G6WA 4ZL8A 2GTUA 3FKFA 1TJDA 2R5GA 2EIQA 4K5SA 1F9MA 4RI6A 1TW9A 2LQQA 1URMA 1FB0A 3HDCA 5GAPD 1J9BA 5HR3A 3TKQA 1Z3EA 2VD1A 4EVMA 1XWCA 5AN1A 2ES7A 3KP8A 3VI5A 1HD2A 1OC9B 2R0CA 4EIPA 3HA9A 2M46A 5DJLA 3A2VA 4GQCA 1RW1A 2GSTA 5IMZA 4IS0A 2VCQA 2YZHA 2HT9A 4WEYA 5EPFA 4MZWA 1GL8A 5DBQA 3F63A 4PQHA 1U6TA 3GH9A 2FWFA 4O7HA 1YF0A 4L8EA 1B9YC 4DSSB 3QCPA 4WF4A 5G30A 4L5OA 3EC3A 1TRUA 1JZRA 1E2YA 4BL7A 1A0FA 2C0GA 3RHCA 4IGJA 1CQGA 3IK9A 4KH7A 2A2PA 2LJRA 2CQ9A 4MNNA 1TU7A 2H6XA 4GXZA 3TJBA 1I5GA 1XW6A 3GSSA 4PNGA 5AGYA 3F6DA 1ZYPA 1M3JA 2I9HA 3JCML 4GWRA 1OVNA 3KGKA 1EOHA 1GTAA 3NZNA 2LNSA 3GUSA 1A23A 3BCIA 4V1Ag 3ZFLA 4BVXB 5DAKB 3KXOA 1GUMA 1YQ1A 4IN0A 3TKPA 2R3XA 4MJEA 1B8XA 1TXXA 3GHAA 4ULXA 3GMFA 5C00A 3UBKA 2G0FA 4D73A 4GRFA 2XBIA 3ZREA 4FYCA 1N2AA 1EEMA 4ECIA 4WBJA 2YJHA 2XPEA 1YZXA 2B7JA 1PRXA 2AAWA 2ZCTA 3QPMA 2XPDA 2B1KA 4Q5NA 2JZRA 1TI3A 1W4VA 1BAYA 5DCGA 2PWJA 1KTEA 4EDZA 1Q4JA 3H4KA 2KP2A 2V32A 4IP1A 4E8HA 1XBSA 4AJ7A 3KIJA 2H19A 5KOXA 2XHFA 1S3DA 5CNWA 4HZ4A 4MP4A 3DKSA 2D2ZA 1KEBA 1WOUA 1XOAA 4GCIA 4GSNA 5D9WA 3ZYWA 3IAS2 4G10A 2FWGA 4MF5A 1THXA 1T4ZA 4HU7A 2LV3A 5CAXA 5GAND 2GLRA 3GFKA 1F6MC 4X43A 3IHGA 3I6AA 2MMAA 3KP9A 5A4VA 3P7XA 3I43A 3VWUA 2EIOA 1XWAA 3Q6OA 2C4JA 2YWNA 5C04A 4EXJA 1GSSA 4Q5QA 2YN1A 4Z2RA 2WULA 1IYIA 18GSA 1M9BA 2FY6A 2H74A 4MJCA 2VLTA 4NV2A 3AY8A 3O6TA 4YKFA 1AQVA 5KOWA 4BVYB 4PQ1A 1PX6A 1A0RP 4Z7XA 3KTBA 2H6YA 3TJKA 2RM5A 4IQAA 3LXZA 4JR6A 1SD9A 2GSRA 3QDNA 4NMUA 3GTUA 6GSWA 4KB3A 5F06A 2H0GA 2H1DA 4L0UA 1R26A 4OCFA 1ZOFA 1VF4A 2ON7A 5B8BA 1SYRA 4XHMA 4NAXA 3EINA 4K2DA 4TXOB 3ERGA 2E0QA 2WFCA 1F3BA 5ECIB 3TKRA 4PNFA 3QAVA 2CVDA 2DJKA 3EURA 4NV5A 3MAKA 4MPGA 1AW9A 3TRPA 1LBKA 1Z9HA 1NSWA 4PQIA 1T1VA 2LS5A 2MYGA 4WBRD 4G0LA 1EV4A 2X8CA 1KNGA 2R37A 3FZAA 1NM3A 1PX7A 2HRFA 2WDUA 1SYXA 2B1LA 4XTSA 1K0MA 1F37A 4LLRA 2P5RA 1XXUA 5J9BA 5L71A 3RAZA 1VRSD 4LL4B 4E8EA 4ID0A 1SD8A 2IMEA 1ABAA 3LGCA 2GSSA 3D5JA 2AV4A 3J7Yb 2HXKA 2DJ1A 3ZVJA 2B5EA 3WGXA 1WWJA 1Q98A 3CMIA 3PPUA 1ERVA 5J41A 2JSYA 4MJBA 3FR9A 5DALB 2CVKA 3UARA 1PL2A 2L5OA 4DEJA 5KN1A 1ML6A 4YAPA 3CSJA 3ZTLA 1OAZA 2IFQA 4PX1A 1EGRA 2PERA 4OO5A 1MEKA 1DE1A 2WZ9A 3KD0A 3C8EA 4FYBA 3G7YA 2V6OA 2DIYA 3G7IA 3VWXA 1OKTA 4ZB6A 4POBA 4AGSA 3QD9A 2AUVA 1SU9A 5FHIA 2VAFA 2IIYA 2OBKA 3IOSA 3HZ8A 2WS2A 2OACA 2FD3A 1MTCA 2ZNMA 2LJAA 3KZQA 2YV9A 3TRXA 5JWQB 2FHEA 3QOUA 3LORA 2OBIA 1T4YA 3BJ5A 1JZOA 4V2NA 4O92A 2B5YA 5IPHA 1BEDA 2HI7A 5ID2A 3HZ4A 4MA9A 4LL1B 4FH8A 3DGQA 2I4AA 1T00A 5ECSA 3R3EA 5AIVA 4TW5A 4ML1A 3F4SA 4WXTA 4JBBA 4YQUA 2PUKC 3ZIVA 3UJ1A 1AQWA 4ZBAA 5H5RA 4O32A 4TRXA 1AUCA 2L5LA 2L57A 2JU5A 1PSQA 2PU9C 2VCXA 2CT6A 1GSDA 4PUFC 2DKIA 2M72A 2FCHA 1K0CA 4ACSA 1ERTA 2M80A 2VL3A 2DSAA 2RLIA 2P5QA 4RQXA 2VM2A 3FZ9A 4ZIJA 1OC8A 3FZ5A 3FR6A 2K18A 4EIQA 4MH2A 4JU5A 1QQ2A 4JR4A 3HXSA 2VOCA 1G7OA 1AC1A 1TDIA 1OC9A 1U88A 3FW2A 2HZEB 3C1RA 3GL5A 1O7UA 3M1GA 3P8WA 4YH2A 5HR1A 4IELA 4J2FA 3C7MA 3GX0A 3PINA 10GSA 3F6FA 2NBSA 1Y6EA 5ECOB 2DIZA 5B6MA 1RQMA 3S9FA 17GSA 3D4TA 3ISOA 5ID2B 1T8EB 3C1SA 1M2BA 2C3TA 1V98A 11GSA 1M99A 1GTIA 4DSSA 2XBQA 4ISDA 2Z9SA 2J9HA 3V1WA 4HQZA 5D73A 2CX4A 2YCDA 4KDUA 4ZB8A 3MSZA 4KF9A 3HJMA 5B8AA 4PGTA 3PR8A 1AQXA 2YV7A 3EYTA 3UEMA 5ECKB 3ERWA 4HS1A 2CVBA 1FB6A 1K3OA 4BIKA 5B7CA 3I9V2 5EVOA 4TOPA 2OJLA 3H1NA 3DXBA 2I81A 1A2JA 4BVXA 2L4CA 5DAKA 2FNOA 2LUSA 4OMVA 2YOIA 5D8IA 1YF1A 1BQ7A 5HR0A 4OO4A 1A8LA 1XW9A 2HRAA 2H1AA 2O87A 4X4JA 3CSHA 2NDOA 4KDXA 3BCKA 1OE7A 3A2XA 3GNJA 1Z6NA 3KCMA 2RIIA 1SJ6A 1V40A 3LEFA 4JE1A 4JZQA 4AJ6A 5D93A 1FOHA 3KMNA 1X0RA 2VCWA 2GGTA 1G0TA 4PTSA 2IL3A 3A5WA 2H70A 2AYTA 3L0HA 4ML6A 1C72A 4EE0A 4N0ZA 3D0ZA 3HYPA 5H5SA 1PD21 2V6KA 1MD4A 1H75A 4LMVA 3RPPA 3LFLA 3SBCA 5IQYA 4GTUA 2F51A 3CTGA 1HYUA 2DKHA 3CBUA 2FA4A 1GRXA 1SL0B 4FIWA 4EUYA 3QMXA 5J9CA 2GQKA 3EWLA 1TOFA 5AIXA 2VLUA 2ALBA 4PUAA 1ILOA 3TUEA 4Q5RA 3BBYA 2RM6A 1NHOA 2H1GA 4WR4A 4G0IA 1X9WB 3G9BA 2DJ0A 2FWEA 2HNLA 1F2EA 3P2AA 4GLTA 4ZBDA 4IVFA 2X4AA 1GTBA 1M0UA 2H1BA 1OKDA 4TVEA 3VFIA 2QA1A 4I2UA 1YDKA 2H76A 1V58A 4MPFA 5DQYA 1O8WA 1SK2A 2OADA 4O5RA 1K0OA 3KH9A 1PL1A 3GX8A 1XZOA 1GUHA 3FR3A 1V57A 4BVYA 1ZCPA 3EMPA 3L78A 5F8BA 4HDEA 3LWAA 1YY7A 2X99A 1TI1A 5ECQB 4I97A 3F9UA 1GNEA 2IMKA 3UOMA 1S3AA 1WRYA 3GL3A 3W8JA 3VPTA 4TXOA 2JL4A 2GT6A 3GKKA 1XFLA 4QL9A 2N5AA 5G5EA 2HFDA 1G6YA 5G1KA 3Q19A 1TTZA 1OC3A 1VF2A 4MF6A 2GS3A 19GSA 1ERUA 1HQOA 4CW9A 2K9FA 3GH6A 2C0FA 2NVLA 1WJKA 3O3TA 1H4OA 1GSQA 3MIXA 2O89A 3WGDA 4WETA 3KTLA 4H86A 3M0FA 3F4RA 1UC7A 1S3RA 4F82A 5BRTA 3VPQA 1UN2A 2YP6A 5ELGA 5E59A 3FK8A 2ZUPA 1Z6MA 2UZ8A 4JRRA 4PURA 1X5DA 1AAZA 2GQMA 3LQ7A 3DEXA 3FRCA 2QGVA 3IV4A 4NPBA 4K7OA 1K0AA 2KOKA 3LG6A 1W89A 2VL2A 1CQHA 3D21A 4KX4A 1GLPA 3RPNA 3RDWA 5B6NA 4N30A 2LNTA 3ME8A 1GP1A 1ZYNA 1FVKA 2HYXA 2L6CA 2LRTA 1UA5A 5G2ZA 1VF3A 3NOFA 3RHBA 1PKZA 3L9UA 2KLXA 5DALA 13GSA 5J5NA 3GYKA 5COHA 4QQ7A 4IBPA 3CTFA 12GSA 3LW9A 1VF1A 2BTOT 3A2WA 4BWSA 5GZZB 4F0CA 3P90A 3TJJA 5AISA 3EPTA 2PVOC 4MCUA 4MJAA 3R2QA 5LCZA 2N5FA 4EKZA 2JADA 2YWOA 4X0XA 5J3RA 2O8VB 4AF2A 2FUG2 4RUVA 4ECBA 2BJXA 4K8MA 4RQRA 3WYWA 5EY6A
chains in the Genus database with same CATH topology
4I6XA 2R6KA 5CRGA 1F3AA 4ZB9A 4OFMA 5CRWA 1WP0A 5ECLB 1PKWA 5D9XA 3ZIJA 3FMWA 4CY6A 2EC4A 4MABA 4F0BA 3DYRA 1A8YA 1SENA 6GSSA 2FA8A 5IO2A 3OR5A 5HFIA 1O73A 1NW2A 4Q5FA 1SJIA 4NXIA 2IMIA 1PGTA 3L9SA 4TN8A 2J23A 1FHEA 3N5OA 1DE2A 5IMFA 2R0GA 2B7KA 4EO3A 3APSA 2JACA 1XVWA 3MDKA 6GSVA 3TJFA 5CP1A 2VCVA 2L59A 4I8BA 2MMNA 1OE8A 1O8XA 4KNDA 4WKWA 4ZBBA 3APQA 4DSRA 1ON4A 4KDYA 1FG4A 2IJYA 3IC8A 1O85A 4TR3A 3TB2A 2F8FA 4XIHA 3I69A 3C73A 1GULA 2GDRA 4KCEA 4L5LA 2CAQA 3TJGA 2LSTA 2HRKA 2HZEA 2VO4A 5A5KA 2F3MA 3IR4A 1R4WA 2JZSA 3HY2A 3TKSC 4KSOA 3DVWA 2C80A 4XRDA 2VCZA 4ZL9A 2VD0A 4X1UA 4ILFA 3QFAC 4TR4A 3VWVA 1QGVA 3GKMA 4POKA 2GZZA 4HI7A 2DBCA 2G2QA 1BJXA 5BMUA 1USBA 2C1YA 5DQSA 5INYA 1E6BA 1K0BA 1TRWA 5IIZA 1ST9A 4EDYA 4HU9A 4NHWA 3ZZXA 3TOUA 4K7NA 1ZMAA 3CRUA 4HJMA 4N11A 4ICYA 1XWGA 3EMXA 2MMZA 2FLSA 2C3QA 2IMFA 3CRTA 3TOTA 3CXGA 1GWCA 6GSTA 3F3QA 4YQVA 2OE1A 3GA4A 3QAWA 4ZXGA 5ELAA 1WE0A 3CSIA 3CYNA 1A2MA 2YZUA 2YNXA 2VIMA 1QUWA 5JWOB 2GSQA 2F8AA 1I9DA 2B5XA 3DD3A 4YKGA 3BD2A 2KP1A 3VURA 1PN9A 5D9VA 2NTOA 1TU8A 2MZCA 1NHYA 2X49A 2GQLA 4XS6A 1JFUA 5G1LA 2AJQB 1SJZA 3FZ4A 3WGEA 3HJOA 2YJ7A 16GSA 2YWIA 1ZGNA 1XIYA 3IK7A 4RI7A 1RK4A 3IBHA 1MDKA 4TR1B 4KGIA 4GSTA 1DSBA 3HCZA 3HJPA 2CX3A 5HFKA 1OYJA 1GLQA 4IW9A 3M8NA 14GSA 2I3YA 4V2LA 3A3TA 4TR0A 1ZYQB 1PN0A 4LMWA 3E9JB 3IPZA 1QMVA 2R0PA 3GV1A 3C71A 3TKSE 2FGXA 5IO0A 4CY8A 3L9VA 1JLWA 3Q74A 1XW5A 1JLVA 4F2IA 3WT2A 4OD7A 4V1Ap 3LXTA 1FVJA 3MYDA 1XPVA 5JWRB 1GTUA 2LQOA 1FW1A 1XVQA 4K7IA 1TK8B 3U6VA 1HNBA 1BG5A 3D6IA 3KH7A 3MWHA 4IQ1A 2CZ2A 5EL8A 3TGZA 7GSSA 2X64A 2DJJA 5IMDA 1R7HA 3PGTA 2PGTA 3BOAA 4CHSA 1X9SB 2DC5A 2YWMA 1EEJA 2QSIA 3RBTA 1TKDB 4FQUA 1HNCA 3J7Yk 5F07A 2IWTA 4ECJA 2HE3A 4HQSA 3ZMLA 2V41A 5DJMA 3UVTA 3D22A 2QC7A 2CV4A 2IN3A 5ABRA 2LRNA 3TDGA 4XS1A 2CA8A 1LJRA 1TRVA 2P31A 2PN8A 4HOJA 4MDCA 2HSHA 2TRXA 4WF5A 1G7EA 1JZDA 4I2TA 1U87A 4G0KA 1B9XC 4O5QA 1LU4A 4GSSA 2H71A 1B4PA 2P0GA 1YEPA 5IM9A 4GF0A 3UIWA 4XS4B 4AJ8A 3M9JA 5IMAA 2X8GA 4L0WA 4HEA2 2E7PA 2F9SA 2AB6A 4ZL7A 2I1UA 5CREA 3ED3A 2WJUA 1SL2B 2REMA 2N5BA 1EV9A 3FYGA 3MNGA 3APOA 1JZWA 2YPMA 1DBYA 2TRCP 4OFNA 1XOBA 2RUEA 1V9WA 2O7KA 1GUKA 3HHVA 1J08A 1KBNA 4K1FA 5ECPB 5F05A 1SKRB 2HRNA 5HR2A 5DCHA 1SKWB 5HQPA 2K8SA 3KM6A 5IMVA 2V2GA 1SKSB 4MH3A 4IJ3A 5D9TA 2HZFA 1YJ6A 3UVHA 4GQFA 3QR6A 2DJ3A 3H93A 4HJ2A 4DSQA 4KSMA 3G7JA 1SK1A 1FOVA 3LYPA 1U3AA 2FWHA 2HSMA 4IP6A 3HVVA 4IHUA 3TRQA 4NWYA 4CDOA 2RUFA 3LJRA 4WR5A 4ZILA 5ECMB 2IPAA 2K6VA 5J4UA 2YANA 4BA7A 5KN0A 2LRCA 4OFTA 2H0HA 1A24A 4G9HA 4EF0A 4MZCA 3FHKA 2VL2C 1FO5A 1PMTA 3D4MA 4KCAA 5CO3A 5JCUA 3TCOA 3F4TA 3NIVA 1T3BA 4KW6A 5E4WA 2R2JA 3K8NA 3QAGA 2LEGA 3N9JA 4KA0A 4LA1A 5CYYA 3A5IA 3HD5A 3US3A 1V2AA 4IJIA 1GSFA 4G2EA 5LD0A 1MD3A 2GZPA 3GN3A 1IYHA 4BL7B 1ZZYA 1GH2A 1M2AA 2K8VA 3W6GA 5DDLA 2WRTA 5ECRB 2BMXA 3FEUA 1TRSA 4FO5A 4MMMA 1ZYEA 2C3NA 4IKHA 5IOXA 1ZL9A 2VM1A 1X5CA 3VK9A 20GSA 3LYKA 2L4QA 2H0IA 3ZVJD 1WMJA 3GSTA 2O85A 3FY7A 5ECHB 5IPGA 2QA2A 5G31A 5HFGA 1Z5YE 3LSZA 2HSYA 2B6MA 5DVBA 3Q18A 4D73B 5JCWA 1WIKA 3VI7A 1MDIA 3ZL5A 1VGLA 3SWLA 2VUPA 1MDJA 2A2RA 1BX9A 1K3YA 1SK0A 4V2MA 5A4WA 4K0GA 1X9MB 2OA7A 3ZMKA 2DMMA 3ZFBA 1X5EA 1THOA 1SL1B 1YKAA 1TK5B 3H8QA 2GZYA 5G5FA 1WPIA 2B3SA 5H5QA 4MLYA 1R5AA 4K5RA 3UL3A 3IAM2 8GSSA 1R5PA 1J0FA 3DVXA 2MMOA 3H79A 2IMDA 4KE3A 1S3CA 4F03A 1JHBA 2DMLA 5JCGA 2GVPA 3DMLA 3EVIA 1EOGA 2C8UA 1HNAA 2DJ2A 3IXRA 3U5RE 1YKCA 4HUAA 1TK0B 3HVSA 2OE3A 1B48A 3E0UA 1M7TA 22GSA 2VL9A 1M9AA 2JZTA 3DWVA 1AXDA 1Z7PA 2DLXA 2WCIA 1GSEA 3F3RA 1GSYA 4OCEA 3GRXA 1QK8A 4N0VA 1EP8A 3UMAA 1PQNA 4F9ZA 5KN3A 3IE3A 1A2LA 5ENUA 2H72A 1T7PB 5KN2A 2R4VA 4K2XA 1O6JA 9GSSA 1EZKA 4POMA 3VWWA 3GTUB 5ECNB 4MK3A 2KUCA 3EE2A 4POLA 2TIRA 1GNWA 3PH9A 3W8SA 2H66A 3DRNA 2EIRA 4HZ2A 6GSXA 2A4HA 2E2MA 3KMOA 3WT1A 3GIXA 4JEDA 1QFNA 2X8HA 3IRAA 3IDVA 3EU3A 1K3LA 5KEJA 3ERFA 2KHPA 2MBTA 4K0NA 2ON5A 5CRDA 4ECCA 4MZBA 2H75A 4TR1A 2H30A 2QKEA 4I5QA 3UAPA 1XWKA 1XCCA 3UBLA 4BPYA 2E2GA 6GSYA 2PPTA 3IHQA 3F0IA 1PA3A 2LKUA 3GKNA 3ZLPA 1BYEA 2GT5A 1XWBA 3HKRA 2LTKA 2L6DA 2A4VA 4QL7A 5IOWA 4EL1A 1EWXA 1B4QA 3M3MA 2VCTA 1Y25A 4G19A 4OWYA 2H73A 4MF7A 3EU4A 4BWQA 3GKXA 3F8UA 4DVCA 5GSSA 4KAEA 4O5UA 1ACVA 5GSTA 4J56E 2V1MA 4TKYA 1GSUA 4PXOA 4K9ZA 6GSUA 3L4NA 2PVQA 1K0NA 4YQMA 2H8LA 2IFQB 3HVXA 3ZRDA 4XCSA 3O76A 1Z7RA 2OKAA 2LJKA 4N10A 4P3YB 1EGOA 5FT3A 3TKSA 3E3EA 1EP7A 5D96A 1M2DA 3KEBA 1FAAA 2WGRA 2C0EA 2A2SA 3M9KA 4EC0A 2JSZA 1U3IA 3GURA 3WD6A 2PMTA 3ZITA 3KJYA 4XRAA 5LNKe 2CZ3A 2NPBA 1QXHA 4NHZA 4Z2UA 3ME7A 4J57E 2XC2A 1K0DA 4USSA 2VLVA 2H01A 2CAIA 3QFBC 4XS4A 1DUGA 5IMCA 2OE0A 1TP9A 1UVZA 1YEXA 2WB9A 5CRHA 2AHEA 4KUNA 2HLSA 2PBJA 4TXVA 5F0GA 2H6ZA 2MBSA 5A4UA 3DIEA 4FYUA 3IA1A 4Z2TA 4A5PA 1O81A 2C0DA 1ERWA 1AIUA 3IC4A 1N8JA 5FWGA 4YAVA 4K6XA 3VLNA 1G6WA 4ZL8A 2GTUA 3FKFA 1TJDA 2R5GA 2EIQA 4K5SA 1F9MA 4RI6A 1TW9A 2LQQA 1URMA 1FB0A 3HDCA 5GAPD 1J9BA 5HR3A 3TKQA 1Z3EA 2VD1A 4EVMA 1XWCA 5AN1A 2ES7A 3KP8A 3VI5A 1HD2A 1OC9B 2R0CA 4EIPA 3HA9A 2M46A 5DJLA 3A2VA 4GQCA 1RW1A 2GSTA 5IMZA 4IS0A 2VCQA 2YZHA 2HT9A 4WEYA 5EPFA 4MZWA 1GL8A 5DBQA 3F63A 4PQHA 1U6TA 3GH9A 2FWFA 4O7HA 1YF0A 4L8EA 1B9YC 4DSSB 3QCPA 4WF4A 5G30A 4L5OA 3EC3A 1TRUA 1JZRA 1E2YA 4BL7A 1A0FA 2C0GA 3RHCA 4IGJA 1CQGA 3IK9A 4KH7A 2A2PA 2LJRA 2CQ9A 4MNNA 1TU7A 2H6XA 4GXZA 3TJBA 1I5GA 1XW6A 3GSSA 4PNGA 5AGYA 3F6DA 1ZYPA 2I9HA 3JCML 4GWRA 1OVNA 3KGKA 1EOHA 1GTAA 3NZNA 2LNSA 3GUSA 1A23A 3BCIA 4V1Ag 3ZFLA 4BVXB 5DAKB 3KXOA 1GUMA 1YQ1A 4IN0A 3TKPA 2R3XA 4MJEA 1B8XA 1TXXA 3GHAA 4ULXA 3GMFA 5C00A 3UBKA 2G0FA 4D73A 4GRFA 2XBIA 3ZREA 4FYCA 1N2AA 1EEMA 4ECIA 4WBJA 2YJHA 2XPEA 1YZXA 2B7JA 1PRXA 2AAWA 2ZCTA 3QPMA 2XPDA 2B1KA 4Q5NA 2JZRA 1TI3A 1W4VA 1BAYA 5DCGA 2PWJA 1KTEA 4EDZA 1Q4JA 3H4KA 2KP2A 2V32A 4IP1A 4E8HA 1XBSA 4AJ7A 3KIJA 2H19A 5KOXA 2XHFA 1S3DA 5CNWA 4HZ4A 4MP4A 3DKSA 2D2ZA 1KEBA 1WOUA 1XOAA 4GCIA 4GSNA 5D9WA 3ZYWA 3IAS2 4G10A 2FWGA 4MF5A 1THXA 1T4ZA 4HU7A 2LV3A 5CAXA 5GAND 2GLRA 3GFKA 1F6MC 4X43A 3IHGA 3I6AA 2MMAA 3KP9A 5A4VA 3P7XA 3I43A 3VWUA 2EIOA 1XWAA 3Q6OA 2C4JA 2YWNA 5C04A 4EXJA 1GSSA 4Q5QA 2YN1A 4Z2RA 2WULA 1IYIA 18GSA 1M9BA 2FY6A 2H74A 4MJCA 2VLTA 4NV2A 3AY8A 3O6TA 4YKFA 1AQVA 5KOWA 4BVYB 4PQ1A 1PX6A 1A0RP 4Z7XA 3KTBA 2H6YA 3TJKA 2RM5A 4IQAA 3LXZA 4JR6A 1SD9A 2GSRA 3QDNA 4NMUA 3GTUA 6GSWA 4KB3A 5F06A 2H0GA 2H1DA 4L0UA 1R26A 4OCFA 1ZOFA 1VF4A 2ON7A 5B8BA 1SYRA 4XHMA 4NAXA 3EINA 4K2DA 4TXOB 3ERGA 2E0QA 2WFCA 1F3BA 5ECIB 3TKRA 4PNFA 3QAVA 2CVDA 2DJKA 3EURA 4NV5A 3MAKA 4MPGA 1AW9A 3TRPA 1LBKA 1Z9HA 1NSWA 4PQIA 1T1VA 2LS5A 2MYGA 4WBRD 4G0LA 1EV4A 2X8CA 1KNGA 2R37A 3FZAA 1NM3A 1PX7A 2HRFA 2WDUA 1SYXA 2B1LA 4XTSA 1K0MA 1F37A 4LLRA 2P5RA 1XXUA 5J9BA 5L71A 3RAZA 1VRSD 4LL4B 4E8EA 4ID0A 1SD8A 2IMEA 1ABAA 3LGCA 2GSSA 3D5JA 2AV4A 3J7Yb 2HXKA 2DJ1A 3ZVJA 2B5EA 3WGXA 1WWJA 1Q98A 3CMIA 3PPUA 1ERVA 5J41A 2JSYA 4MJBA 3FR9A 5DALB 2CVKA 3UARA 1PL2A 2L5OA 4DEJA 5KN1A 1ML6A 4YAPA 3CSJA 3ZTLA 1OAZA 2IFQA 4PX1A 1EGRA 2PERA 4OO5A 1MEKA 1DE1A 2WZ9A 3KD0A 3C8EA 4FYBA 3G7YA 2V6OA 2DIYA 3G7IA 3VWXA 1OKTA 4ZB6A 4POBA 4AGSA 3QD9A 2AUVA 1SU9A 5FHIA 2VAFA 2IIYA 2OBKA 3IOSA 3HZ8A 2WS2A 2OACA 2FD3A 1MTCA 2ZNMA 2LJAA 3KZQA 2YV9A 3TRXA 5JWQB 2FHEA 3QOUA 3LORA 2OBIA 1T4YA 3BJ5A 1JZOA 4V2NA 4O92A 2B5YA 5IPHA 1BEDA 2HI7A 5ID2A 3HZ4A 4MA9A 4LL1B 4FH8A 3DGQA 2I4AA 1T00A 5ECSA 3R3EA 5AIVA 4TW5A 4ML1A 3F4SA 4WXTA 4JBBA 4YQUA 2PUKC 3ZIVA 3UJ1A 1AQWA 4ZBAA 5H5RA 4O32A 4TRXA 1AUCA 2L5LA 2L57A 2JU5A 1PSQA 2PU9C 2VCXA 2CT6A 1GSDA 4PUFC 2DKIA 2M72A 2FCHA 1K0CA 4ACSA 1ERTA 2M80A 2VL3A 2DSAA 2RLIA 2P5QA 4RQXA 2VM2A 3FZ9A 4ZIJA 1OC8A 3FZ5A 3FR6A 2K18A 4EIQA 4MH2A 4JU5A 1QQ2A 4JR4A 3HXSA 2VOCA 1G7OA 1AC1A 1TDIA 1OC9A 1U88A 3FW2A 2HZEB 3C1RA 3GL5A 1O7UA 3M1GA 3P8WA 4YH2A 5HR1A 4IELA 4J2FA 3C7MA 3GX0A 3PINA 10GSA 3F6FA 2NBSA 1Y6EA 5ECOB 2DIZA 5B6MA 1RQMA 3S9FA 17GSA 3D4TA 3ISOA 5ID2B 1T8EB 3C1SA 1M2BA 2C3TA 1V98A 11GSA 1M99A 1GTIA 4DSSA 2XBQA 4ISDA 2Z9SA 2J9HA 3V1WA 4HQZA 5D73A 2CX4A 2YCDA 4KDUA 4ZB8A 3MSZA 4KF9A 3HJMA 5B8AA 4PGTA 3PR8A 1AQXA 2YV7A 3EYTA 3UEMA 5ECKB 3ERWA 4HS1A 2CVBA 1FB6A 1K3OA 5B7CA 3I9V2 5EVOA 4TOPA 2OJLA 3H1NA 3DXBA 2I81A 1A2JA 4BVXA 2L4CA 5DAKA 2FNOA 2LUSA 4OMVA 2YOIA 5D8IA 1YF1A 1BQ7A 5HR0A 4OO4A 1A8LA 1XW9A 2HRAA 2H1AA 2O87A 4X4JA 3CSHA 2NDOA 4KDXA 3BCKA 1OE7A 3A2XA 3GNJA 1Z6NA 3KCMA 2RIIA 1SJ6A 1V40A 3LEFA 4JE1A 4JZQA 4AJ6A 5D93A 1FOHA 3KMNA 1X0RA 2VCWA 2GGTA 1G0TA 4PTSA 2IL3A 3A5WA 2H70A 2AYTA 3L0HA 4ML6A 1C72A 4EE0A 4N0ZA 3D0ZA 3HYPA 5H5SA 1PD21 2V6KA 1MD4A 1H75A 4LMVA 3RPPA 3LFLA 3SBCA 5IQYA 4GTUA 2F51A 3CTGA 1HYUA 2DKHA 3CBUA 2FA4A 1GRXA 1SL0B 4FIWA 4EUYA 3QMXA 5J9CA 2GQKA 3EWLA 1TOFA 5AIXA 2VLUA 2ALBA 4PUAA 1ILOA 3TUEA 4Q5RA 3BBYA 2RM6A 1NHOA 2H1GA 4WR4A 4G0IA 1X9WB 3G9BA 2DJ0A 2FWEA 2HNLA 1F2EA 3P2AA 4GLTA 4ZBDA 4IVFA 2X4AA 1GTBA 1M0UA 2H1BA 1OKDA 4TVEA 3VFIA 2QA1A 4I2UA 1YDKA 2H76A 1V58A 4MPFA 5DQYA 1O8WA 1SK2A 2OADA 4O5RA 1K0OA 3KH9A 1PL1A 3GX8A 1XZOA 1GUHA 3FR3A 1V57A 4BVYA 1ZCPA 3EMPA 3L78A 5F8BA 4HDEA 3LWAA 1YY7A 2X99A 1TI1A 5ECQB 4I97A 3F9UA 1GNEA 2IMKA 3UOMA 1S3AA 1WRYA 3GL3A 3W8JA 3VPTA 4TXOA 2JL4A 2GT6A 3GKKA 1XFLA 4QL9A 2N5AA 5G5EA 2HFDA 1G6YA 5G1KA 3Q19A 1TTZA 1OC3A 1VF2A 4MF6A 2GS3A 19GSA 1ERUA 1HQOA 4CW9A 2K9FA 3GH6A 2C0FA 2NVLA 1WJKA 3O3TA 1H4OA 1GSQA 3MIXA 2O89A 3WGDA 4WETA 3KTLA 4H86A 3M0FA 3F4RA 1UC7A 4F82A 5BRTA 3VPQA 1UN2A 2YP6A 5ELGA 5E59A 3FK8A 2ZUPA 1Z6MA 2UZ8A 4JRRA 4PURA 1X5DA 1AAZA 2GQMA 3LQ7A 3DEXA 3FRCA 2QGVA 3IV4A 4NPBA 4K7OA 1K0AA 2KOKA 3LG6A 1W89A 2VL2A 1CQHA 3D21A 4KX4A 1GLPA 3RPNA 3RDWA 5B6NA 4N30A 2LNTA 3ME8A 1GP1A 1ZYNA 1FVKA 2HYXA 2L6CA 2LRTA 1UA5A 5G2ZA 1VF3A 3NOFA 3RHBA 1PKZA 3L9UA 2KLXA 5DALA 13GSA 5J5NA 3GYKA 5COHA 4QQ7A 4IBPA 3CTFA 12GSA 3LW9A 1VF1A 2BTOT 3A2WA 4BWSA 5GZZB 4F0CA 3P90A 3TJJA 5AISA 3EPTA 2PVOC 4MCUA 4MJAA 3R2QA 5LCZA 2N5FA 4EKZA 2JADA 2YWOA 4X0XA 5J3RA 2O8VB 4AF2A 2FUG2 4RUVA 4ECBA 2BJXA 4K8MA 4RQRA 3WYWA 5EY6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I6X A;  2R6K A;  5CRG A;  1F3A A;  4ZB9 A;  4OFM A;  5CRW A;  1WP0 A;  5ECL B;  1PKW A;  5D9X A;  3ZIJ A;  2EC4 A;  4MAB A;  4F0B A;  3DYR A;  1A8Y A;  1SEN A;  6GSS A;  2FA8 A;  5IO2 A;  3OR5 A;  5HFI A;  1O73 A;  1NW2 A;  4Q5F A;  1SJI A;  4NXI A;  2IMI A;  1PGT A;  3L9S A;  4TN8 A;  2J23 A;  1FHE A;  3N5O A;  1DE2 A;  5IMF A;  2B7K A;  4EO3 A;  3APS A;  2JAC A;  1XVW A;  3MDK A;  6GSV A;  3TJF A;  5CP1 A;  2VCV A;  2L59 A;  4I8B A;  2MMN A;  1OE8 A;  1O8X A;  4KND A;  4WKW A;  4ZBB A;  3APQ A;  4DSR A;  1ON4 A;  4KDY A;  1FG4 A;  2IJY A;  1O85 A;  4TR3 A;  3TB2 A;  2F8F A;  4XIH A;  3I69 A;  3C73 A;  1GUL A;  2GDR A;  4KCE A;  4L5L A;  2CAQ A;  3TJG A;  2LST A;  2HZE A;  2VO4 A;  5A5K A;  2F3M A;  3IR4 A;  1R4W A;  2JZS A;  3HY2 A;  3TKS C;  4KSO A;  3DVW A;  2C80 A;  4XRD A;  2VCZ A;  4ZL9 A;  2VD0 A;  4X1U A;  4ILF A;  3QFA C;  4TR4 A;  3VWV A;  1QGV A;  3GKM A;  4POK A;  2GZZ A;  4HI7 A;  2DBC A;  2G2Q A;  1BJX A;  1USB A;  2C1Y A;  5DQS A;  5INY A;  1E6B A;  1K0B A;  1TRW A;  5IIZ A;  1ST9 A;  4EDY A;  4HU9 A;  4NHW A;  3ZZX A;  3TOU A;  4K7N A;  1ZMA A;  3CRU A;  4HJM A;  4N11 A;  1XWG A;  3EMX A;  2MMZ A;  2FLS A;  2C3Q A;  2IMF A;  3CRT A;  3TOT A;  3CXG A;  1GWC A;  6GST A;  3F3Q A;  4YQV A;  2OE1 A;  3GA4 A;  3QAW A;  4ZXG A;  5ELA A;  1WE0 A;  3CSI A;  3CYN A;  1A2M A;  2YZU A;  2YNX A;  2VIM A;  1QUW A;  5JWO B;  2GSQ A;  2F8A A;  1I9D A;  2B5X A;  3DD3 A;  3BD2 A;  2KP1 A;  3VUR A;  5D9V A;  1PN9 A;  2NTO A;  1TU8 A;  2MZC A;  1NHY A;  2GQL A;  4XS6 A;  1JFU A;  5G1L A;  2AJQ B;  1SJZ A;  3FZ4 A;  3WGE A;  3HJO A;  2YJ7 A;  16GS A;  2YWI A;  1ZGN A;  1XIY A;  3IK7 A;  4RI7 A;  1RK4 A;  3IBH A;  1MDK A;  4TR1 B;  4KGI A;  4GST A;  1DSB A;  3HCZ A;  3HJP A;  2CX3 A;  5HFK A;  1OYJ A;  1GLQ A;  4IW9 A;  3M8N A;  14GS A;  2I3Y A;  4V2L A;  3A3T A;  4TR0 A;  1ZYQ B;  4LMW A;  3E9J B;  3IPZ A;  1QMV A;  3GV1 A;  3C71 A;  3TKS E;  2FGX A;  5IO0 A;  3L9V A;  1JLW A;  3Q74 A;  1XW5 A;  1JLV A;  4F2I A;  3WT2 A;  4OD7 A;  4V1A p;  3LXT A;  1FVJ A;  1XPV A;  5JWR B;  1GTU A;  2LQO A;  1FW1 A;  1XVQ A;  4K7I A;  1TK8 B;  3U6V A;  1HNB A;  1BG5 A;  3D6I A;  3KH7 A;  3MWH A;  4IQ1 A;  2CZ2 A;  5EL8 A;  3TGZ A;  7GSS A;  2X64 A;  2DJJ A;  5IMD A;  1R7H A;  3PGT A;  2PGT A;  3BOA A;  4CHS A;  1X9S B;  2DC5 A;  2YWM A;  1EEJ A;  2QSI A;  3RBT A;  1TKD B;  1HNC A;  3J7Y k;  5F07 A;  2IWT A;  4ECJ A;  2HE3 A;  4HQS A;  3ZML A;  2V41 A;  5DJM A;  3UVT A;  3D22 A;  2QC7 A;  2CV4 A;  2IN3 A;  5ABR A;  2LRN A;  3TDG A;  4XS1 A;  2CA8 A;  1LJR A;  1TRV A;  2P31 A;  2PN8 A;  4HOJ A;  4MDC A;  2HSH A;  2TRX A;  4WF5 A;  1G7E A;  1JZD A;  4I2T A;  1U87 A;  1B9X C;  1LU4 A;  4GSS A;  2H71 A;  1B4P A;  2P0G A;  1YEP A;  5IM9 A;  4GF0 A;  3UIW A;  4XS4 B;  4AJ8 A;  3M9J A;  5IMA A;  2X8G A;  4L0W A;  4HEA 2;  2E7P A;  2F9S A;  2AB6 A;  4ZL7 A;  2I1U A;  5CRE A;  3ED3 A;  2WJU A;  1SL2 B;  2REM A;  2N5B A;  1EV9 A;  3FYG A;  3MNG A;  3APO A;  1JZW A;  2YPM A;  1DBY A;  2TRC P;  4OFN A;  1XOB A;  2RUE A;  1V9W A;  2O7K A;  1GUK A;  3HHV A;  1J08 A;  1KBN A;  4K1F A;  5ECP B;  5F05 A;  1SKR B;  2HRN A;  5HR2 A;  5DCH A;  1SKW B;  5HQP A;  2K8S A;  3KM6 A;  5IMV A;  2V2G A;  1SKS B;  4MH3 A;  4IJ3 A;  5D9T A;  2HZF A;  1YJ6 A;  3UVH A;  4GQF A;  3QR6 A;  2DJ3 A;  3H93 A;  4HJ2 A;  4DSQ A;  4KSM A;  3G7J A;  1SK1 A;  1FOV A;  3LYP A;  1U3A A;  2FWH A;  4IP6 A;  3HVV A;  4IHU A;  3TRQ A;  4NWY A;  4CDO A;  2RUF A;  3LJR A;  4WR5 A;  4ZIL A;  5ECM B;  2IPA A;  2K6V A;  5J4U A;  2YAN A;  4BA7 A;  5KN0 A;  2LRC A;  4OFT A;  2H0H A;  1A24 A;  4G9H A;  4EF0 A;  4MZC A;  3FHK A;  2VL2 C;  1FO5 A;  1PMT A;  3D4M A;  4KCA A;  5CO3 A;  5JCU A;  3TCO A;  3F4T A;  3NIV A;  1T3B A;  4KW6 A;  5E4W A;  2R2J A;  3K8N A;  3QAG A;  2LEG A;  3N9J A;  4KA0 A;  4LA1 A;  5CYY A;  3HD5 A;  3US3 A;  1V2A A;  4IJI A;  1GSF A;  4G2E A;  5LD0 A;  1MD3 A;  2GZP A;  3GN3 A;  1IYH A;  1ZZY A;  1GH2 A;  1M2A A;  2K8V A;  3W6G A;  5DDL A;  2WRT A;  5ECR B;  2BMX A;  3FEU A;  1TRS A;  4FO5 A;  4MMM A;  1ZYE A;  2C3N A;  4IKH A;  5IOX A;  1ZL9 A;  2VM1 A;  1X5C A;  3VK9 A;  20GS A;  3LYK A;  2L4Q A;  2H0I A;  3ZVJ D;  1WMJ A;  3GST A;  2O85 A;  3FY7 A;  5ECH B;  5IPG A;  5G31 A;  5HFG A;  1Z5Y E;  3LSZ A;  2HSY A;  2B6M A;  5DVB A;  3Q18 A;  4D73 B;  5JCW A;  1WIK A;  3VI7 A;  1MDI A;  3ZL5 A;  1VGL A;  3SWL A;  2VUP A;  1MDJ A;  2A2R A;  1BX9 A;  1K3Y A;  1SK0 A;  4V2M A;  5A4W A;  4K0G A;  1X9M B;  2OA7 A;  3ZMK A;  2DMM A;  3ZFB A;  1X5E A;  1THO A;  1SL1 B;  1YKA A;  1TK5 B;  3H8Q A;  2GZY A;  5G5F A;  1WPI A;  2B3S A;  5H5Q A;  4MLY A;  1R5A A;  3UL3 A;  3IAM 2;  8GSS A;  1R5P A;  1J0F A;  3DVX A;  2MMO A;  3H79 A;  2IMD A;  4KE3 A;  1S3C A;  4F03 A;  1JHB A;  2DML A;  5JCG A;  2GVP A;  3DML A;  3EVI A;  1EOG A;  2C8U A;  1HNA A;  2DJ2 A;  3IXR A;  3U5R E;  1YKC A;  4HUA A;  1TK0 B;  3HVS A;  2OE3 A;  1B48 A;  3E0U A;  1M7T A;  22GS A;  2VL9 A;  1M9A A;  2JZT A;  3DWV A;  1AXD A;  1Z7P A;  2DLX A;  2WCI A;  1GSE A;  3F3R A;  1GSY A;  4OCE A;  3GRX A;  1QK8 A;  4N0V A;  1EP8 A;  3UMA A;  1PQN A;  4F9Z A;  5KN3 A;  3IE3 A;  1A2L A;  5ENU A;  2H72 A;  1T7P B;  5KN2 A;  2R4V A;  1O6J A;  9GSS A;  1EZK A;  4POM A;  3VWW A;  3GTU B;  5ECN B;  4MK3 A;  2KUC A;  3EE2 A;  4POL A;  2TIR A;  1GNW A;  3PH9 A;  3W8S A;  2H66 A;  3DRN A;  2EIR A;  4HZ2 A;  6GSX A;  2E2M A;  3KMO A;  3WT1 A;  3GIX A;  4JED A;  1QFN A;  2X8H A;  3IRA A;  3IDV A;  3EU3 A;  1K3L A;  5KEJ A;  3ERF A;  2KHP A;  2MBT A;  4K0N A;  2ON5 A;  5CRD A;  4ECC A;  4MZB A;  2H75 A;  4TR1 A;  2H30 A;  2QKE A;  4I5Q A;  3UAP A;  1XWK A;  1XCC A;  3UBL A;  4BPY A;  2E2G A;  6GSY A;  2PPT A;  3IHQ A;  3F0I A;  1PA3 A;  2LKU A;  3GKN A;  3ZLP A;  1BYE A;  2GT5 A;  1XWB A;  3HKR A;  2LTK A;  2L6D A;  2A4V A;  4QL7 A;  5IOW A;  4EL1 A;  1EWX A;  1B4Q A;  3M3M A;  2VCT A;  1Y25 A;  4G19 A;  4OWY A;  2H73 A;  4MF7 A;  3EU4 A;  4BWQ A;  3GKX A;  3F8U A;  4DVC A;  5GSS A;  4KAE A;  1ACV A;  5GST A;  4J56 E;  2V1M A;  4TKY A;  1GSU A;  4PXO A;  4K9Z A;  6GSU A;  3L4N A;  2PVQ A;  1K0N A;  4YQM A;  2H8L A;  2IFQ B;  3HVX A;  3ZRD A;  4XCS A;  3O76 A;  1Z7R A;  2OKA A;  2LJK A;  4N10 A;  4P3Y B;  1EGO A;  5FT3 A;  3TKS A;  3E3E A;  1EP7 A;  5D96 A;  1M2D A;  3KEB A;  1FAA A;  2WGR A;  2C0E A;  2A2S A;  3M9K A;  4EC0 A;  2JSZ A;  1U3I A;  3GUR A;  3WD6 A;  2PMT A;  3ZIT A;  3KJY A;  4XRA A;  5LNK e;  2CZ3 A;  2NPB A;  1QXH A;  4NHZ A;  3ME7 A;  4J57 E;  2XC2 A;  1K0D A;  2VLV A;  2H01 A;  2CAI A;  3QFB C;  4XS4 A;  1DUG A;  5IMC A;  2OE0 A;  1TP9 A;  1UVZ A;  1YEX A;  2WB9 A;  5CRH A;  2AHE A;  4KUN A;  2HLS A;  2PBJ A;  4TXV A;  5F0G A;  2H6Z A;  2MBS A;  5A4U A;  3DIE A;  4FYU A;  3IA1 A;  1O81 A;  2C0D A;  1ERW A;  1AIU A;  3IC4 A;  1N8J A;  5FWG A;  4YAV A;  4K6X A;  3VLN A;  1G6W A;  4ZL8 A;  2GTU A;  3FKF A;  1TJD A;  2R5G A;  2EIQ A;  1F9M A;  4RI6 A;  1TW9 A;  2LQQ A;  1URM A;  1FB0 A;  3HDC A;  5GAP D;  1J9B A;  5HR3 A;  3TKQ A;  1Z3E A;  2VD1 A;  4EVM A;  1XWC A;  5AN1 A;  2ES7 A;  3KP8 A;  3VI5 A;  1HD2 A;  1OC9 B;  3HA9 A;  2M46 A;  5DJL A;  3A2V A;  4GQC A;  1RW1 A;  2GST A;  5IMZ A;  4IS0 A;  2VCQ A;  2YZH A;  2HT9 A;  4WEY A;  5EPF A;  4MZW A;  1GL8 A;  5DBQ A;  3F63 A;  4PQH A;  1U6T A;  3GH9 A;  2FWF A;  4O7H A;  1YF0 A;  4L8E A;  1B9Y C;  4DSS B;  3QCP A;  4WF4 A;  5G30 A;  4L5O A;  3EC3 A;  1TRU A;  1JZR A;  1E2Y A;  4BL7 A;  1A0F A;  2C0G A;  3RHC A;  4IGJ A;  1CQG A;  3IK9 A;  4KH7 A;  2LJR A;  2CQ9 A;  1TU7 A;  2H6X A;  4GXZ A;  3TJB A;  1I5G A;  1XW6 A;  3GSS A;  4PNG A;  5AGY A;  3F6D A;  2I9H A;  3JCM L;  4GWR A;  1OVN A;  3KGK A;  1EOH A;  1GTA A;  3NZN A;  2LNS A;  3GUS A;  1A23 A;  3BCI A;  4V1A g;  3ZFL A;  5DAK B;  3KXO A;  1GUM A;  1YQ1 A;  4IN0 A;  3TKP A;  2R3X A;  4MJE A;  1B8X A;  1TXX A;  3GHA A;  4ULX A;  3GMF A;  5C00 A;  3UBK A;  2G0F A;  4D73 A;  4GRF A;  2XBI A;  3ZRE A;  4FYC A;  1N2A A;  1EEM A;  4ECI A;  4WBJ A;  2YJH A;  2XPE A;  1YZX A;  2B7J A;  1PRX A;  2AAW A;  2ZCT A;  3QPM A;  2XPD A;  2B1K A;  4Q5N A;  2JZR A;  1TI3 A;  1W4V A;  1BAY A;  5DCG A;  2PWJ A;  1KTE A;  4EDZ A;  1Q4J A;  3H4K A;  2KP2 A;  2V32 A;  4IP1 A;  4E8H A;  1XBS A;  4AJ7 A;  3KIJ A;  2H19 A;  2XHF A;  1S3D A;  5CNW A;  4HZ4 A;  4MP4 A;  3DKS A;  2D2Z A;  1KEB A;  1WOU A;  1XOA A;  4GCI A;  4GSN A;  5D9W A;  3ZYW A;  3IAS 2;  4G10 A;  2FWG A;  4MF5 A;  1THX A;  1T4Z A;  4HU7 A;  2LV3 A;  5CAX A;  5GAN D;  2GLR A;  3GFK A;  1F6M C;  4X43 A;  3I6A A;  2MMA A;  3KP9 A;  5A4V A;  3P7X A;  3I43 A;  3VWU A;  2EIO A;  1XWA A;  3Q6O A;  2C4J A;  2YWN A;  5C04 A;  4EXJ A;  1GSS A;  4Q5Q A;  2YN1 A;  2WUL A;  1IYI A;  18GS A;  1M9B A;  2FY6 A;  2H74 A;  4MJC A;  2VLT A;  4NV2 A;  3AY8 A;  3O6T A;  1AQV A;  4PQ1 A;  1PX6 A;  1A0R P;  4Z7X A;  3KTB A;  2H6Y A;  3TJK A;  2RM5 A;  4IQA A;  3LXZ A;  4JR6 A;  1SD9 A;  2GSR A;  3QDN A;  4NMU A;  3GTU A;  6GSW A;  4KB3 A;  5F06 A;  2H0G A;  2H1D A;  4L0U A;  1R26 A;  4OCF A;  1ZOF A;  1VF4 A;  2ON7 A;  5B8B A;  1SYR A;  4XHM A;  4NAX A;  3EIN A;  4K2D A;  4TXO B;  3ERG A;  2E0Q A;  2WFC A;  1F3B A;  5ECI B;  3TKR A;  4PNF A;  3QAV A;  2CVD A;  2DJK A;  3EUR A;  4NV5 A;  3MAK A;  4MPG A;  1AW9 A;  3TRP A;  1LBK A;  1Z9H A;  1NSW A;  4PQI A;  1T1V A;  2LS5 A;  2MYG A;  4WBR D;  1EV4 A;  2X8C A;  1KNG A;  2R37 A;  3FZA A;  1NM3 A;  1PX7 A;  2HRF A;  2WDU A;  1SYX A;  2B1L A;  4XTS A;  1K0M A;  1F37 A;  4LLR A;  2P5R A;  1XXU A;  5J9B A;  5L71 A;  3RAZ A;  1VRS D;  4LL4 B;  4E8E A;  4ID0 A;  1SD8 A;  2IME A;  1ABA A;  3LGC A;  2GSS A;  3D5J A;  2AV4 A;  3J7Y b;  2HXK A;  2DJ1 A;  3ZVJ A;  2B5E A;  3WGX A;  1WWJ A;  1Q98 A;  3CMI A;  1ERV A;  5J41 A;  2JSY A;  4MJB A;  3FR9 A;  5DAL B;  2CVK A;  3UAR A;  1PL2 A;  2L5O A;  4DEJ A;  5KN1 A;  1ML6 A;  4YAP A;  3CSJ A;  3ZTL A;  1OAZ A;  2IFQ A;  4PX1 A;  1EGR A;  2PER A;  4OO5 A;  1MEK A;  1DE1 A;  2WZ9 A;  3KD0 A;  3C8E A;  4FYB A;  3G7Y A;  2V6O A;  2DIY A;  3G7I A;  3VWX A;  1OKT A;  4ZB6 A;  4POB A;  4AGS A;  3QD9 A;  2AUV A;  1SU9 A;  5FHI A;  2VAF A;  2IIY A;  2OBK A;  3IOS A;  3HZ8 A;  2WS2 A;  2OAC A;  2FD3 A;  1MTC A;  2ZNM A;  2LJA A;  3KZQ A;  2YV9 A;  3TRX A;  5JWQ B;  2FHE A;  3QOU A;  3LOR A;  2OBI A;  1T4Y A;  3BJ5 A;  1JZO A;  4V2N A;  4O92 A;  2B5Y A;  5IPH A;  1BED A;  2HI7 A;  5ID2 A;  3HZ4 A;  4MA9 A;  4LL1 B;  4FH8 A;  3DGQ A;  2I4A A;  1T00 A;  5ECS A;  5AIV A;  4TW5 A;  4ML1 A;  3F4S A;  4WXT A;  4JBB A;  4YQU A;  2PUK C;  3ZIV A;  3UJ1 A;  1AQW A;  4ZBA A;  5H5R A;  4O32 A;  4TRX A;  1AUC A;  2L5L A;  2L57 A;  2JU5 A;  1PSQ A;  2PU9 C;  2VCX A;  2CT6 A;  1GSD A;  4PUF C;  2M72 A;  2FCH A;  1K0C A;  4ACS A;  1ERT A;  2M80 A;  2VL3 A;  2DSA A;  2RLI A;  2P5Q A;  4RQX A;  2VM2 A;  3FZ9 A;  4ZIJ A;  1OC8 A;  3FZ5 A;  3FR6 A;  2K18 A;  4MH2 A;  4JU5 A;  1QQ2 A;  4JR4 A;  3HXS A;  2VOC A;  1G7O A;  1AC1 A;  1TDI A;  1OC9 A;  1U88 A;  3FW2 A;  2HZE B;  3C1R A;  3GL5 A;  1O7U A;  3M1G A;  3P8W A;  4YH2 A;  5HR1 A;  4IEL A;  4J2F A;  3C7M A;  3GX0 A;  3PIN A;  10GS A;  3F6F A;  2NBS A;  1Y6E A;  5ECO B;  2DIZ A;  5B6M A;  1RQM A;  3S9F A;  17GS A;  3D4T A;  3ISO A;  5ID2 B;  1T8E B;  3C1S A;  1M2B A;  2C3T A;  1V98 A;  11GS A;  1M99 A;  1GTI A;  4DSS A;  2XBQ A;  4ISD A;  2Z9S A;  2J9H A;  3V1W A;  4HQZ A;  5D73 A;  2CX4 A;  2YCD A;  4KDU A;  4ZB8 A;  3MSZ A;  3HJM A;  5B8A A;  4PGT A;  3PR8 A;  1AQX A;  2YV7 A;  3EYT A;  3UEM A;  5ECK B;  3ERW A;  4HS1 A;  2CVB A;  1FB6 A;  1K3O A;  5B7C A;  3I9V 2;  5EVO A;  4TOP A;  2OJL A;  3H1N A;  3DXB A;  2I81 A;  1A2J A;  4BVX A;  2L4C A;  5DAK A;  2FNO A;  2LUS A;  4OMV A;  2YOI A;  5D8I A;  1YF1 A;  1BQ7 A;  5HR0 A;  4OO4 A;  1A8L A;  1XW9 A;  2H1A A;  2O87 A;  3CSH A;  2NDO A;  4KDX A;  3BCK A;  1OE7 A;  3A2X A;  3GNJ A;  1Z6N A;  3KCM A;  2RII A;  1SJ6 A;  1V40 A;  3LEF A;  4JE1 A;  4JZQ A;  4AJ6 A;  5D93 A;  3KMN A;  1X0R A;  2VCW A;  2GGT A;  1G0T A;  2IL3 A;  3A5W A;  2H70 A;  2AYT A;  3L0H A;  4ML6 A;  1C72 A;  4EE0 A;  4N0Z A;  3D0Z A;  3HYP A;  5H5S A;  1PD2 1;  2V6K A;  1MD4 A;  1H75 A;  4LMV A;  3RPP A;  3LFL A;  3SBC A;  5IQY A;  4GTU A;  2F51 A;  3CTG A;  1HYU A;  3CBU A;  2FA4 A;  1GRX A;  1SL0 B;  4FIW A;  4EUY A;  3QMX A;  5J9C A;  2GQK A;  3EWL A;  1TOF A;  5AIX A;  2VLU A;  2ALB A;  4PUA A;  1ILO A;  3TUE A;  4Q5R A;  3BBY A;  2RM6 A;  1NHO A;  2H1G A;  4WR4 A;  1X9W B;  3G9B A;  2DJ0 A;  2FWE A;  2HNL A;  1F2E A;  3P2A A;  4GLT A;  4ZBD A;  4IVF A;  1GTB A;  1M0U A;  2H1B A;  1OKD A;  4TVE A;  3VFI A;  4I2U A;  1YDK A;  2H76 A;  1V58 A;  4MPF A;  5DQY A;  1O8W A;  1SK2 A;  2OAD A;  4O5R A;  1K0O A;  3KH9 A;  1PL1 A;  3GX8 A;  1XZO A;  1GUH A;  3FR3 A;  1V57 A;  4BVY A;  1ZCP A;  5F8B A;  3EMP A;  3L78 A;  4HDE A;  3LWA A;  1YY7 A;  2X99 A;  1TI1 A;  5ECQ B;  4I97 A;  3F9U A;  1GNE A;  2IMK A;  3UOM A;  1S3A A;  1WRY A;  3GL3 A;  3W8J A;  3VPT A;  4TXO A;  2JL4 A;  2GT6 A;  3GKK A;  1XFL A;  4QL9 A;  2N5A A;  5G5E A;  2HFD A;  1G6Y A;  5G1K A;  3Q19 A;  1TTZ A;  1OC3 A;  1VF2 A;  4MF6 A;  2GS3 A;  19GS A;  1ERU A;  1HQO A;  4CW9 A;  2K9F A;  3GH6 A;  2C0F A;  2NVL A;  1WJK A;  3O3T A;  1H4O A;  1GSQ A;  3WGD A;  2O89 A;  4WET A;  3KTL A;  4H86 A;  3M0F A;  3F4R A;  1UC7 A;  4F82 A;  3VPQ A;  1UN2 A;  2YP6 A;  5ELG A;  5E59 A;  3FK8 A;  2ZUP A;  1Z6M A;  4JRR A;  4PUR A;  1X5D A;  1AAZ A;  2GQM A;  3LQ7 A;  3DEX A;  3FRC A;  2QGV A;  3IV4 A;  4NPB A;  4K7O A;  1K0A A;  2KOK A;  3LG6 A;  1W89 A;  2VL2 A;  1CQH A;  3D21 A;  4KX4 A;  1GLP A;  3RPN A;  3RDW A;  5B6N A;  4N30 A;  2LNT A;  3ME8 A;  1GP1 A;  1FVK A;  2HYX A;  2L6C A;  2LRT A;  1UA5 A;  5G2Z A;  1VF3 A;  3NOF A;  3RHB A;  1PKZ A;  3L9U A;  2KLX A;  5DAL A;  13GS A;  5J5N A;  3GYK A;  5COH A;  4QQ7 A;  4IBP A;  3CTF A;  12GS A;  1VF1 A;  2BTO T;  3A2W A;  4BWS A;  5GZZ B;  4F0C A;  3P90 A;  3TJJ A;  5AIS A;  2PVO C;  4MCU A;  4MJA A;  3R2Q A;  5LCZ A;  2N5F A;  4EKZ A;  2JAD A;  2YWO A;  4X0X A;  5J3R A;  2O8V B;  4AF2 A;  2FUG 2;  4RUV A;  4ECB A;  2BJX A;  4K8M A;  4RQR A;  3WYW A;  5EY6 A; 
#chains in the Genus database with same CATH topology
 5FLX I;  4I6X A;  2R6K A;  5CRG A;  1F3A A;  4ZB9 A;  4OFM A;  5CRW A;  1WP0 A;  5ECL B;  1PKW A;  5D9X A;  3ZIJ A;  3FMW A;  4CY6 A;  2EC4 A;  4MAB A;  4F0B A;  3DYR A;  1A8Y A;  1SEN A;  6GSS A;  2FA8 A;  5IO2 A;  3OR5 A;  5HFI A;  1O73 A;  1NW2 A;  4Q5F A;  1SJI A;  4NXI A;  2IMI A;  1PGT A;  3L9S A;  4TN8 A;  2J23 A;  1FHE A;  3N5O A;  1DE2 A;  5IMF A;  2R0G A;  2B7K A;  4EO3 A;  3APS A;  2JAC A;  1XVW A;  4HSC X;  3MDK A;  6GSV A;  3TJF A;  5CP1 A;  2VCV A;  2L59 A;  4I8B A;  2MMN A;  1OE8 A;  1O8X A;  4KND A;  4WKW A;  4ZBB A;  3APQ A;  4DSR A;  1ON4 A;  4KDY A;  1FG4 A;  2IJY A;  3IC8 A;  1O85 A;  4TR3 A;  3TB2 A;  2F8F A;  4XIH A;  3I69 A;  3C73 A;  1GUL A;  2GDR A;  4KCE A;  4L5L A;  2CAQ A;  3TJG A;  2LST A;  2HRK A;  2HZE A;  2VO4 A;  5A5K A;  2F3M A;  3IR4 A;  1R4W A;  2JZS A;  3HY2 A;  3TKS C;  4KSO A;  3DVW A;  2C80 A;  4XRD A;  2VCZ A;  4ZL9 A;  2VD0 A;  4X1U A;  4ILF A;  3QFA C;  4TR4 A;  3VWV A;  1QGV A;  3GKM A;  4POK A;  2GZZ A;  4HI7 A;  2DBC A;  2G2Q A;  1BJX A;  5BMU A;  1USB A;  2C1Y A;  5DQS A;  5INY A;  1E6B A;  1K0B A;  1TRW A;  5IIZ A;  1ST9 A;  4EDY A;  4HU9 A;  4NHW A;  3ZZX A;  3TOU A;  4K7N A;  1ZMA A;  3CRU A;  4HJM A;  4N11 A;  4ICY A;  1XWG A;  3EMX A;  2MMZ A;  2FLS A;  2C3Q A;  2IMF A;  3CRT A;  3TOT A;  3CXG A;  1GWC A;  6GST A;  3F3Q A;  4YQV A;  2OE1 A;  3GA4 A;  3QAW A;  4ZXG A;  5ELA A;  1WE0 A;  3CSI A;  3CYN A;  1A2M A;  2YZU A;  2YNX A;  2VIM A;  1QUW A;  5JWO B;  2GSQ A;  2F8A A;  1I9D A;  2B5X A;  3DD3 A;  4YKG A;  3BD2 A;  2KP1 A;  3VUR A;  1PN9 A;  5D9V A;  2NTO A;  1TU8 A;  2MZC A;  1NHY A;  2X49 A;  2GQL A;  4XS6 A;  1JFU A;  5G1L A;  1PFO A;  2AJQ B;  1SJZ A;  3FZ4 A;  3WGE A;  3HJO A;  2YJ7 A;  16GS A;  2YWI A;  1ZGN A;  1XIY A;  3IK7 A;  4RI7 A;  1RK4 A;  3IBH A;  1MDK A;  4TR1 B;  4KGI A;  4GST A;  1DSB A;  3HCZ A;  3HJP A;  2CX3 A;  5HFK A;  1OYJ A;  1GLQ A;  4IW9 A;  3M8N A;  14GS A;  2I3Y A;  4V2L A;  3A3T A;  4TR0 A;  1ZYQ B;  1PN0 A;  4LMW A;  3E9J B;  3IPZ A;  1QMV A;  2R0P A;  3GV1 A;  3C71 A;  3TKS E;  2FGX A;  5IO0 A;  4CY8 A;  3L9V A;  1JLW A;  3Q74 A;  1XW5 A;  1JLV A;  4F2I A;  3WT2 A;  4OD7 A;  4V1A p;  3LXT A;  1FVJ A;  3MYD A;  1XPV A;  5JWR B;  1GTU A;  5IT9 I;  2LQO A;  1FW1 A;  1XVQ A;  4K7I A;  1TK8 B;  3U6V A;  1HNB A;  1BG5 A;  3D6I A;  3KH7 A;  3MWH A;  4IQ1 A;  2CZ2 A;  5EL8 A;  3TGZ A;  7GSS A;  2X64 A;  2DJJ A;  5IMD A;  1R7H A;  3PGT A;  2PGT A;  3BOA A;  4CHS A;  1X9S B;  2DC5 A;  2YWM A;  1EEJ A;  2QSI A;  3RBT A;  1TKD B;  4FQU A;  1HNC A;  3J7Y k;  5F07 A;  2IWT A;  4ECJ A;  2HE3 A;  4HQS A;  3ZML A;  2V41 A;  5DJM A;  3UVT A;  3D22 A;  2QC7 A;  2CV4 A;  2IN3 A;  5ABR A;  2LRN A;  3TDG A;  4XS1 A;  2CA8 A;  1LJR A;  1TRV A;  2P31 A;  2PN8 A;  4HOJ A;  4MDC A;  2HSH A;  2TRX A;  4WF5 A;  1G7E A;  1JZD A;  4I2T A;  1U87 A;  4G0K A;  1B9X C;  4O5Q A;  1LU4 A;  4GSS A;  2H71 A;  1B4P A;  2P0G A;  1YEP A;  5IM9 A;  4GF0 A;  3UIW A;  4XS4 B;  4AJ8 A;  3M9J A;  5IMA A;  5LL6 V;  2X8G A;  4L0W A;  4HEA 2;  2E7P A;  2F9S A;  2AB6 A;  4ZL7 A;  2I1U A;  5CRE A;  3ED3 A;  2WJU A;  1SL2 B;  2REM A;  2N5B A;  1EV9 A;  3FYG A;  3MNG A;  3APO A;  1JZW A;  2YPM A;  1XG8 A;  1DBY A;  2TRC P;  4OFN A;  1XOB A;  2RUE A;  1V9W A;  2O7K A;  1GUK A;  3HHV A;  1J08 A;  1KBN A;  4K1F A;  5ECP B;  5F05 A;  1SKR B;  2HRN A;  5HR2 A;  5DCH A;  1SKW B;  5HQP A;  2K8S A;  3KM6 A;  5IMV A;  2V2G A;  1SKS B;  4MH3 A;  5A2Q I;  4IJ3 A;  5D9T A;  2HZF A;  1YJ6 A;  3UVH A;  4GQF A;  3QR6 A;  2DJ3 A;  3H93 A;  4HJ2 A;  4DSQ A;  4KSM A;  3G7J A;  1SK1 A;  1FOV A;  3LYP A;  1U3A A;  2FWH A;  2HSM A;  4IP6 A;  3HVV A;  4IHU A;  3TRQ A;  4NWY A;  4CDO A;  2RUF A;  3LJR A;  4WR5 A;  4ZIL A;  5ECM B;  2IPA A;  2K6V A;  5J4U A;  2YAN A;  4BA7 A;  5KN0 A;  2LRC A;  4OFT A;  2H0H A;  1A24 A;  4G9H A;  4EF0 A;  4MZC A;  3FHK A;  2VL2 C;  1FO5 A;  1PMT A;  3D4M A;  4KCA A;  5CO3 A;  5JCU A;  3TCO A;  3F4T A;  3NIV A;  1T3B A;  4KW6 A;  5E4W A;  2R2J A;  3K8N A;  3QAG A;  2LEG A;  3N9J A;  4KA0 A;  4LA1 A;  5CYY A;  3A5I A;  3HD5 A;  3US3 A;  1V2A A;  4IJI A;  1GSF A;  4G2E A;  5LD0 A;  1MD3 A;  2GZP A;  3GN3 A;  1IYH A;  4BL7 B;  1ZZY A;  1GH2 A;  1M2A A;  2K8V A;  3W6G A;  5DDL A;  2WRT A;  5ECR B;  2BMX A;  3FEU A;  1TRS A;  4FO5 A;  4MMM A;  1ZYE A;  2C3N A;  4IKH A;  5IOX A;  1ZL9 A;  2VM1 A;  1X5C A;  3VK9 A;  20GS A;  3LYK A;  2L4Q A;  2H0I A;  3ZVJ D;  1WMJ A;  3GST A;  2O85 A;  3FY7 A;  5ECH B;  5IPG A;  2QA2 A;  5G31 A;  5HFG A;  1Z5Y E;  3LSZ A;  2HSY A;  2B6M A;  5DVB A;  3Q18 A;  4D73 B;  5JCW A;  1WIK A;  3VI7 A;  1MDI A;  3ZL5 A;  1VGL A;  3SWL A;  2VUP A;  1MDJ A;  2A2R A;  1BX9 A;  1K3Y A;  1SK0 A;  4V2M A;  5A4W A;  4K0G A;  1X9M B;  2OA7 A;  3ZMK A;  2DMM A;  3ZFB A;  1X5E A;  1THO A;  1SL1 B;  1YKA A;  1TK5 B;  3H8Q A;  2GZY A;  5G5F A;  1WPI A;  2B3S A;  5H5Q A;  4MLY A;  1R5A A;  4K5R A;  3UL3 A;  3IAM 2;  8GSS A;  1R5P A;  1J0F A;  3DVX A;  2MMO A;  3H79 A;  2IMD A;  4KE3 A;  1S3C A;  4F03 A;  1JHB A;  2DML A;  5JCG A;  2GVP A;  3DML A;  3J81 I;  3EVI A;  1EOG A;  2C8U A;  1HNA A;  2DJ2 A;  3IXR A;  3U5R E;  1YKC A;  4HUA A;  1TK0 B;  3HVS A;  2OE3 A;  1B48 A;  3E0U A;  1M7T A;  22GS A;  2VL9 A;  1M9A A;  2JZT A;  3DWV A;  1AXD A;  1Z7P A;  2DLX A;  2WCI A;  1GSE A;  3F3R A;  1GSY A;  4OCE A;  3GRX A;  1QK8 A;  4N0V A;  1EP8 A;  3UMA A;  1PQN A;  4F9Z A;  5KN3 A;  3IE3 A;  1A2L A;  3JAM I;  5ENU A;  2H72 A;  1T7P B;  5KN2 A;  2R4V A;  4K2X A;  1O6J A;  9GSS A;  1EZK A;  4POM A;  3VWW A;  3GTU B;  5ECN B;  4MK3 A;  2KUC A;  3EE2 A;  4POL A;  2TIR A;  1GNW A;  3PH9 A;  3W8S A;  2H66 A;  3DRN A;  2EIR A;  4HZ2 A;  6GSX A;  2A4H A;  2E2M A;  3KMO A;  3WT1 A;  3GIX A;  4JED A;  1QFN A;  2X8H A;  3IRA A;  3IDV A;  3EU3 A;  1K3L A;  5KEJ A;  3ERF A;  1M3I A;  2KHP A;  2MBT A;  4K0N A;  2ON5 A;  5CRD A;  4ECC A;  4MZB A;  2H75 A;  4TR1 A;  2H30 A;  2QKE A;  4I5Q A;  3UAP A;  1XWK A;  1XCC A;  3UBL A;  4BPY A;  2E2G A;  6GSY A;  2PPT A;  3IHQ A;  3F0I A;  1PA3 A;  2LKU A;  3GKN A;  3ZLP A;  1BYE A;  2GT5 A;  1XWB A;  3HKR A;  2LTK A;  2L6D A;  2A4V A;  4QL7 A;  5IOW A;  4EL1 A;  1EWX A;  1B4Q A;  3M3M A;  2VCT A;  1Y25 A;  4G19 A;  4OWY A;  2H73 A;  4MF7 A;  3EU4 A;  4BWQ A;  3GKX A;  3F8U A;  4DVC A;  5GSS A;  4KAE A;  4O5U A;  1ACV A;  5GST A;  4J56 E;  2V1M A;  4TKY A;  1GSU A;  4PXO A;  4K9Z A;  6GSU A;  3L4N A;  2PVQ A;  1K0N A;  4YQM A;  2H8L A;  2IFQ B;  3HVN A;  3HVX A;  3ZRD A;  4XCS A;  3O76 A;  1Z7R A;  2OKA A;  2LJK A;  4N10 A;  4P3Y B;  1EGO A;  5FT3 A;  3TKS A;  3E3E A;  1EP7 A;  5D96 A;  1M2D A;  3CQF A;  3KEB A;  1FAA A;  2WGR A;  2C0E A;  2A2S A;  3M9K A;  4EC0 A;  2JSZ A;  1U3I A;  3GUR A;  3WD6 A;  2PMT A;  3ZIT A;  3KJY A;  4XRA A;  5LNK e;  2CZ3 A;  2NPB A;  3J80 I;  1QXH A;  4NHZ A;  4Z2U A;  3ME7 A;  4J57 E;  2XC2 A;  1K0D A;  4USS A;  2VLV A;  2H01 A;  2CAI A;  3QFB C;  4XS4 A;  1DUG A;  5IMC A;  2OE0 A;  1TP9 A;  1UVZ A;  1YEX A;  2WB9 A;  5CRH A;  2AHE A;  4KUN A;  2HLS A;  2PBJ A;  4TXV A;  5F0G A;  2H6Z A;  2MBS A;  5A4U A;  3DIE A;  4FYU A;  3IA1 A;  4Z2T A;  4A5P A;  1O81 A;  2C0D A;  1ERW A;  1AIU A;  3IC4 A;  1N8J A;  5FWG A;  4YAV A;  4K6X A;  3VLN A;  1G6W A;  4ZL8 A;  2GTU A;  3FKF A;  1TJD A;  2R5G A;  2EIQ A;  4K5S A;  1F9M A;  4RI6 A;  1TW9 A;  2LQQ A;  1URM A;  1FB0 A;  3HDC A;  5GAP D;  1J9B A;  5HR3 A;  3TKQ A;  1Z3E A;  2VD1 A;  4EVM A;  1XWC A;  5AN1 A;  2ES7 A;  3KP8 A;  3VI5 A;  1HD2 A;  1OC9 B;  2R0C A;  4EIP A;  3HA9 A;  2M46 A;  5DJL A;  3A2V A;  4GQC A;  1RW1 A;  2GST A;  5IMZ A;  4IS0 A;  2VCQ A;  2YZH A;  2HT9 A;  4WEY A;  5EPF A;  4MZW A;  1GL8 A;  5DBQ A;  3F63 A;  4PQH A;  1U6T A;  3GH9 A;  2FWF A;  4O7H A;  1YF0 A;  4L8E A;  1B9Y C;  4DSS B;  3QCP A;  4WF4 A;  5G30 A;  4L5O A;  3EC3 A;  1TRU A;  1JZR A;  1E2Y A;  4BL7 A;  1A0F A;  2C0G A;  3RHC A;  4IGJ A;  1CQG A;  3IK9 A;  4KH7 A;  2A2P A;  2LJR A;  2CQ9 A;  4MNN A;  1TU7 A;  2H6X A;  4GXZ A;  3TJB A;  1I5G A;  1XW6 A;  3GSS A;  4PNG A;  5AGY A;  3F6D A;  1ZYP A;  1M3J A;  2I9H A;  3JCM L;  4GWR A;  1OVN A;  3KGK A;  1EOH A;  1GTA A;  3NZN A;  2LNS A;  3GUS A;  1A23 A;  3BCI A;  4V1A g;  3ZFL A;  4BVX B;  5DAK B;  3KXO A;  1GUM A;  1YQ1 A;  4IN0 A;  3TKP A;  2R3X A;  4MJE A;  1B8X A;  1TXX A;  3GHA A;  4ULX A;  3GMF A;  5C00 A;  3UBK A;  2G0F A;  4D73 A;  4GRF A;  2XBI A;  3ZRE A;  4FYC A;  1N2A A;  1EEM A;  4ECI A;  4WBJ A;  2YJH A;  2XPE A;  1YZX A;  2B7J A;  1PRX A;  2AAW A;  2ZCT A;  3QPM A;  2XPD A;  2B1K A;  4Q5N A;  2JZR A;  1TI3 A;  1W4V A;  1BAY A;  5DCG A;  2PWJ A;  1KTE A;  4EDZ A;  1Q4J A;  3H4K A;  2KP2 A;  2V32 A;  4IP1 A;  4E8H A;  1XBS A;  4AJ7 A;  3KIJ A;  2H19 A;  5KOX A;  2XHF A;  1S3D A;  5CNW A;  4HZ4 A;  4MP4 A;  3DKS A;  2D2Z A;  1KEB A;  1WOU A;  1XOA A;  4GCI A;  4GSN A;  5D9W A;  3ZYW A;  3IAS 2;  4G10 A;  2FWG A;  4MF5 A;  1THX A;  1T4Z A;  4HU7 A;  2LV3 A;  5CAX A;  5GAN D;  2GLR A;  3GFK A;  1F6M C;  4X43 A;  3IHG A;  3I6A A;  2MMA A;  3KP9 A;  5A4V A;  3P7X A;  3I43 A;  3VWU A;  2EIO A;  1XWA A;  3Q6O A;  2C4J A;  2YWN A;  5C04 A;  4EXJ A;  1GSS A;  4Q5Q A;  2YN1 A;  4Z2R A;  2WUL A;  1IYI A;  18GS A;  1M9B A;  2FY6 A;  2H74 A;  4MJC A;  2VLT A;  4NV2 A;  3AY8 A;  3O6T A;  4YKF A;  1AQV A;  5KOW A;  4BVY B;  4PQ1 A;  1PX6 A;  1A0R P;  4Z7X A;  3KTB A;  2H6Y A;  3TJK A;  2RM5 A;  4IQA A;  3LXZ A;  4JR6 A;  1SD9 A;  2GSR A;  3QDN A;  4NMU A;  3GTU A;  6GSW A;  4KB3 A;  5F06 A;  2H0G A;  2H1D A;  4L0U A;  1R26 A;  4OCF A;  1ZOF A;  1VF4 A;  2ON7 A;  5B8B A;  1SYR A;  4XHM A;  4NAX A;  3EIN A;  4K2D A;  4TXO B;  3ERG A;  2E0Q A;  2WFC A;  1F3B A;  5ECI B;  3TKR A;  4PNF A;  3QAV A;  2CVD A;  2DJK A;  3EUR A;  4NV5 A;  3MAK A;  4MPG A;  1AW9 A;  3TRP A;  1LBK A;  1Z9H A;  1NSW A;  4PQI A;  1T1V A;  2LS5 A;  2MYG A;  4WBR D;  4G0L A;  1EV4 A;  2X8C A;  1KNG A;  2R37 A;  3FZA A;  1NM3 A;  1PX7 A;  2HRF A;  2WDU A;  1SYX A;  2B1L A;  4XTS A;  1K0M A;  1F37 A;  4LLR A;  2P5R A;  1XXU A;  5J9B A;  5L71 A;  3RAZ A;  1VRS D;  4LL4 B;  4E8E A;  4ID0 A;  1SD8 A;  2IME A;  1ABA A;  3LGC A;  2GSS A;  3D5J A;  2AV4 A;  3J7Y b;  2HXK A;  2DJ1 A;  3ZVJ A;  2B5E A;  3WGX A;  1WWJ A;  1Q98 A;  3CMI A;  3PPU A;  1ERV A;  5J41 A;  2JSY A;  4MJB A;  3FR9 A;  5DAL B;  2CVK A;  3UAR A;  1PL2 A;  2L5O A;  4DEJ A;  5KN1 A;  1ML6 A;  4YAP A;  3CSJ A;  3ZTL A;  1OAZ A;  2IFQ A;  4PX1 A;  1EGR A;  2PER A;  4OO5 A;  1MEK A;  1DE1 A;  2WZ9 A;  3KD0 A;  3C8E A;  4FYB A;  3G7Y A;  2V6O A;  2DIY A;  3G7I A;  3VWX A;  1OKT A;  4ZB6 A;  4POB A;  4AGS A;  3QD9 A;  2AUV A;  1SU9 A;  5FHI A;  2VAF A;  2IIY A;  2OBK A;  3IOS A;  3HZ8 A;  2WS2 A;  2OAC A;  2FD3 A;  1MTC A;  2ZNM A;  2LJA A;  3KZQ A;  2YV9 A;  3TRX A;  5JWQ B;  2FHE A;  3QOU A;  3LOR A;  2OBI A;  1T4Y A;  3BJ5 A;  1JZO A;  4V2N A;  4O92 A;  2B5Y A;  5IPH A;  1BED A;  2HI7 A;  5ID2 A;  3HZ4 A;  4MA9 A;  4LL1 B;  4FH8 A;  3DGQ A;  2I4A A;  1T00 A;  5ECS A;  3R3E A;  5AIV A;  4TW5 A;  4ML1 A;  3F4S A;  4WXT A;  4JBB A;  4YQU A;  2PUK C;  3ZIV A;  3UJ1 A;  1AQW A;  4ZBA A;  5H5R A;  4O32 A;  4TRX A;  1AUC A;  2L5L A;  2L57 A;  2JU5 A;  1PSQ A;  2PU9 C;  2VCX A;  2CT6 A;  1GSD A;  4PUF C;  2DKI A;  2M72 A;  2FCH A;  1K0C A;  4ACS A;  1ERT A;  2M80 A;  2VL3 A;  2DSA A;  2RLI A;  2P5Q A;  4RQX A;  2VM2 A;  3FZ9 A;  4ZIJ A;  1OC8 A;  3FZ5 A;  3FR6 A;  2K18 A;  4EIQ A;  4MH2 A;  4JU5 A;  1QQ2 A;  4JR4 A;  3HXS A;  2VOC A;  1G7O A;  1AC1 A;  1TDI A;  1OC9 A;  1U88 A;  3FW2 A;  2HZE B;  3C1R A;  3GL5 A;  1O7U A;  3M1G A;  3P8W A;  4YH2 A;  5HR1 A;  4IEL A;  4J2F A;  3C7M A;  3GX0 A;  3PIN A;  10GS A;  3F6F A;  2NBS A;  1Y6E A;  5ECO B;  2DIZ A;  5B6M A;  1RQM A;  3S9F A;  17GS A;  3D4T A;  3ISO A;  5ID2 B;  1T8E B;  3C1S A;  1M2B A;  2C3T A;  1V98 A;  11GS A;  1M99 A;  1GTI A;  4DSS A;  2XBQ A;  4ISD A;  2Z9S A;  2J9H A;  3V1W A;  4HQZ A;  5D73 A;  2CX4 A;  2YCD A;  4KDU A;  4ZB8 A;  3MSZ A;  4KF9 A;  3HJM A;  5B8A A;  4PGT A;  3PR8 A;  1AQX A;  2YV7 A;  3EYT A;  3UEM A;  5ECK B;  3ERW A;  4HS1 A;  2CVB A;  1FB6 A;  1K3O A;  4BIK A;  5B7C A;  3I9V 2;  5EVO A;  4TOP A;  2OJL A;  3H1N A;  3DXB A;  2I81 A;  1A2J A;  4BVX A;  2L4C A;  5DAK A;  2FNO A;  2LUS A;  4OMV A;  2YOI A;  5D8I A;  1YF1 A;  1BQ7 A;  5HR0 A;  4OO4 A;  1A8L A;  1XW9 A;  2HRA A;  2H1A A;  2O87 A;  4X4J A;  3CSH A;  2NDO A;  4KDX A;  3BCK A;  1OE7 A;  3A2X A;  3GNJ A;  1Z6N A;  3KCM A;  2RII A;  1SJ6 A;  1V40 A;  3LEF A;  4JE1 A;  4JZQ A;  4AJ6 A;  5D93 A;  1FOH A;  3KMN A;  1X0R A;  2VCW A;  2GGT A;  1G0T A;  4PTS A;  2IL3 A;  3A5W A;  2H70 A;  2AYT A;  3L0H A;  4ML6 A;  1C72 A;  4EE0 A;  4N0Z A;  3D0Z A;  3HYP A;  5H5S A;  1PD2 1;  2V6K A;  1MD4 A;  1H75 A;  4LMV A;  3RPP A;  3LFL A;  3SBC A;  5IQY A;  4GTU A;  2F51 A;  3CTG A;  1HYU A;  2DKH A;  3CBU A;  2FA4 A;  1GRX A;  1SL0 B;  4FIW A;  4EUY A;  3QMX A;  5J9C A;  2GQK A;  3EWL A;  1TOF A;  5AIX A;  2VLU A;  2ALB A;  4PUA A;  1ILO A;  3TUE A;  4Q5R A;  3BBY A;  2RM6 A;  1NHO A;  2H1G A;  4WR4 A;  4G0I A;  1X9W B;  3G9B A;  2DJ0 A;  2FWE A;  2HNL A;  1F2E A;  3P2A A;  4GLT A;  4ZBD A;  4IVF A;  2X4A A;  1GTB A;  1M0U A;  2H1B A;  1OKD A;  4TVE A;  3VFI A;  2QA1 A;  4I2U A;  1YDK A;  2H76 A;  1V58 A;  4MPF A;  5DQY A;  1O8W A;  1SK2 A;  2OAD A;  4O5R A;  1K0O A;  3KH9 A;  1PL1 A;  3GX8 A;  1XZO A;  1GUH A;  3FR3 A;  1V57 A;  4BVY A;  1ZCP A;  3EMP A;  3L78 A;  5F8B A;  4HDE A;  3LWA A;  1YY7 A;  2X99 A;  1TI1 A;  5ECQ B;  4I97 A;  3F9U A;  1GNE A;  2IMK A;  3UOM A;  1S3A A;  1WRY A;  3GL3 A;  3W8J A;  3VPT A;  4TXO A;  2JL4 A;  2GT6 A;  3GKK A;  1XFL A;  4QL9 A;  2N5A A;  5G5E A;  2HFD A;  1G6Y A;  5G1K A;  3Q19 A;  1TTZ A;  1OC3 A;  1VF2 A;  4MF6 A;  2GS3 A;  19GS A;  1ERU A;  1HQO A;  4CW9 A;  2K9F A;  3GH6 A;  2C0F A;  2NVL A;  1WJK A;  3O3T A;  1H4O A;  1GSQ A;  3MIX A;  2O89 A;  3WGD A;  4WET A;  3KTL A;  4H86 A;  3M0F A;  3F4R A;  1UC7 A;  1S3R A;  4F82 A;  5BRT A;  3VPQ A;  1UN2 A;  2YP6 A;  5ELG A;  5E59 A;  3FK8 A;  2ZUP A;  1Z6M A;  2UZ8 A;  4JRR A;  4PUR A;  1X5D A;  1AAZ A;  2GQM A;  3LQ7 A;  3DEX A;  3FRC A;  2QGV A;  3IV4 A;  4NPB A;  4K7O A;  1K0A A;  2KOK A;  3LG6 A;  1W89 A;  2VL2 A;  1CQH A;  3D21 A;  4KX4 A;  1GLP A;  3RPN A;  3RDW A;  5B6N A;  4N30 A;  2LNT A;  3ME8 A;  1GP1 A;  1ZYN A;  1FVK A;  2HYX A;  2L6C A;  2LRT A;  1UA5 A;  5G2Z A;  1VF3 A;  3NOF A;  3RHB A;  1PKZ A;  3L9U A;  2KLX A;  5DAL A;  13GS A;  5J5N A;  3GYK A;  5COH A;  4QQ7 A;  4IBP A;  3CTF A;  12GS A;  3LW9 A;  1VF1 A;  2BTO T;  3A2W A;  4BWS A;  5GZZ B;  4F0C A;  3P90 A;  3TJJ A;  5AIS A;  3EPT A;  2PVO C;  4MCU A;  4MJA A;  3R2Q A;  5LCZ A;  2N5F A;  4EKZ A;  2JAD A;  2YWO A;  4X0X A;  5J3R A;  2O8V B;  4AF2 A;  2FUG 2;  4RUV A;  4ECB A;  2BJX A;  4K8M A;  4RQR A;  3WYW A;  5EY6 A; 
#chains in the Genus database with same CATH homology
 4I6X A;  2R6K A;  5CRG A;  1F3A A;  4ZB9 A;  4OFM A;  5CRW A;  1WP0 A;  5ECL B;  1PKW A;  5D9X A;  3ZIJ A;  3FMW A;  4CY6 A;  2EC4 A;  4MAB A;  4F0B A;  3DYR A;  1A8Y A;  1SEN A;  6GSS A;  2FA8 A;  5IO2 A;  3OR5 A;  5HFI A;  1O73 A;  1NW2 A;  4Q5F A;  1SJI A;  4NXI A;  2IMI A;  1PGT A;  3L9S A;  4TN8 A;  2J23 A;  1FHE A;  3N5O A;  1DE2 A;  5IMF A;  2R0G A;  2B7K A;  4EO3 A;  3APS A;  2JAC A;  1XVW A;  3MDK A;  6GSV A;  3TJF A;  5CP1 A;  2VCV A;  2L59 A;  4I8B A;  2MMN A;  1OE8 A;  1O8X A;  4KND A;  4WKW A;  4ZBB A;  3APQ A;  4DSR A;  1ON4 A;  4KDY A;  1FG4 A;  2IJY A;  3IC8 A;  1O85 A;  4TR3 A;  3TB2 A;  2F8F A;  4XIH A;  3I69 A;  3C73 A;  1GUL A;  2GDR A;  4KCE A;  4L5L A;  2CAQ A;  3TJG A;  2LST A;  2HRK A;  2HZE A;  2VO4 A;  5A5K A;  2F3M A;  3IR4 A;  1R4W A;  2JZS A;  3HY2 A;  3TKS C;  4KSO A;  3DVW A;  2C80 A;  4XRD A;  2VCZ A;  4ZL9 A;  2VD0 A;  4X1U A;  4ILF A;  3QFA C;  4TR4 A;  3VWV A;  1QGV A;  3GKM A;  4POK A;  2GZZ A;  4HI7 A;  2DBC A;  2G2Q A;  1BJX A;  5BMU A;  1USB A;  2C1Y A;  5DQS A;  5INY A;  1E6B A;  1K0B A;  1TRW A;  5IIZ A;  1ST9 A;  4EDY A;  4HU9 A;  4NHW A;  3ZZX A;  3TOU A;  4K7N A;  1ZMA A;  3CRU A;  4HJM A;  4N11 A;  4ICY A;  1XWG A;  3EMX A;  2MMZ A;  2FLS A;  2C3Q A;  2IMF A;  3CRT A;  3TOT A;  3CXG A;  1GWC A;  6GST A;  3F3Q A;  4YQV A;  2OE1 A;  3GA4 A;  3QAW A;  4ZXG A;  5ELA A;  1WE0 A;  3CSI A;  3CYN A;  1A2M A;  2YZU A;  2YNX A;  2VIM A;  1QUW A;  5JWO B;  2GSQ A;  2F8A A;  1I9D A;  2B5X A;  3DD3 A;  4YKG A;  3BD2 A;  2KP1 A;  3VUR A;  1PN9 A;  5D9V A;  2NTO A;  1TU8 A;  2MZC A;  1NHY A;  2X49 A;  2GQL A;  4XS6 A;  1JFU A;  5G1L A;  2AJQ B;  1SJZ A;  3FZ4 A;  3WGE A;  3HJO A;  2YJ7 A;  16GS A;  2YWI A;  1ZGN A;  1XIY A;  3IK7 A;  4RI7 A;  1RK4 A;  3IBH A;  1MDK A;  4TR1 B;  4KGI A;  4GST A;  1DSB A;  3HCZ A;  3HJP A;  2CX3 A;  5HFK A;  1OYJ A;  1GLQ A;  4IW9 A;  3M8N A;  14GS A;  2I3Y A;  4V2L A;  3A3T A;  4TR0 A;  1ZYQ B;  1PN0 A;  4LMW A;  3E9J B;  3IPZ A;  1QMV A;  2R0P A;  3GV1 A;  3C71 A;  3TKS E;  2FGX A;  5IO0 A;  4CY8 A;  3L9V A;  1JLW A;  3Q74 A;  1XW5 A;  1JLV A;  4F2I A;  3WT2 A;  4OD7 A;  4V1A p;  3LXT A;  1FVJ A;  3MYD A;  1XPV A;  5JWR B;  1GTU A;  2LQO A;  1FW1 A;  1XVQ A;  4K7I A;  1TK8 B;  3U6V A;  1HNB A;  1BG5 A;  3D6I A;  3KH7 A;  3MWH A;  4IQ1 A;  2CZ2 A;  5EL8 A;  3TGZ A;  7GSS A;  2X64 A;  2DJJ A;  5IMD A;  1R7H A;  3PGT A;  2PGT A;  3BOA A;  4CHS A;  1X9S B;  2DC5 A;  2YWM A;  1EEJ A;  2QSI A;  3RBT A;  1TKD B;  4FQU A;  1HNC A;  3J7Y k;  5F07 A;  2IWT A;  4ECJ A;  2HE3 A;  4HQS A;  3ZML A;  2V41 A;  5DJM A;  3UVT A;  3D22 A;  2QC7 A;  2CV4 A;  2IN3 A;  5ABR A;  2LRN A;  3TDG A;  4XS1 A;  2CA8 A;  1LJR A;  1TRV A;  2P31 A;  2PN8 A;  4HOJ A;  4MDC A;  2HSH A;  2TRX A;  4WF5 A;  1G7E A;  1JZD A;  4I2T A;  1U87 A;  4G0K A;  1B9X C;  4O5Q A;  1LU4 A;  4GSS A;  2H71 A;  1B4P A;  2P0G A;  1YEP A;  5IM9 A;  4GF0 A;  3UIW A;  4XS4 B;  4AJ8 A;  3M9J A;  5IMA A;  2X8G A;  4L0W A;  4HEA 2;  2E7P A;  2F9S A;  2AB6 A;  4ZL7 A;  2I1U A;  5CRE A;  3ED3 A;  2WJU A;  1SL2 B;  2REM A;  2N5B A;  1EV9 A;  3FYG A;  3MNG A;  3APO A;  1JZW A;  2YPM A;  1DBY A;  2TRC P;  4OFN A;  1XOB A;  2RUE A;  1V9W A;  2O7K A;  1GUK A;  3HHV A;  1J08 A;  1KBN A;  4K1F A;  5ECP B;  5F05 A;  1SKR B;  2HRN A;  5HR2 A;  5DCH A;  1SKW B;  5HQP A;  2K8S A;  3KM6 A;  5IMV A;  2V2G A;  1SKS B;  4MH3 A;  4IJ3 A;  5D9T A;  2HZF A;  1YJ6 A;  3UVH A;  4GQF A;  3QR6 A;  2DJ3 A;  3H93 A;  4HJ2 A;  4DSQ A;  4KSM A;  3G7J A;  1SK1 A;  1FOV A;  3LYP A;  1U3A A;  2FWH A;  2HSM A;  4IP6 A;  3HVV A;  4IHU A;  3TRQ A;  4NWY A;  4CDO A;  2RUF A;  3LJR A;  4WR5 A;  4ZIL A;  5ECM B;  2IPA A;  2K6V A;  5J4U A;  2YAN A;  4BA7 A;  5KN0 A;  2LRC A;  4OFT A;  2H0H A;  1A24 A;  4G9H A;  4EF0 A;  4MZC A;  3FHK A;  2VL2 C;  1FO5 A;  1PMT A;  3D4M A;  4KCA A;  5CO3 A;  5JCU A;  3TCO A;  3F4T A;  3NIV A;  1T3B A;  4KW6 A;  5E4W A;  2R2J A;  3K8N A;  3QAG A;  2LEG A;  3N9J A;  4KA0 A;  4LA1 A;  5CYY A;  3A5I A;  3HD5 A;  3US3 A;  1V2A A;  4IJI A;  1GSF A;  4G2E A;  5LD0 A;  1MD3 A;  2GZP A;  3GN3 A;  1IYH A;  4BL7 B;  1ZZY A;  1GH2 A;  1M2A A;  2K8V A;  3W6G A;  5DDL A;  2WRT A;  5ECR B;  2BMX A;  3FEU A;  1TRS A;  4FO5 A;  4MMM A;  1ZYE A;  2C3N A;  4IKH A;  5IOX A;  1ZL9 A;  2VM1 A;  1X5C A;  3VK9 A;  20GS A;  3LYK A;  2L4Q A;  2H0I A;  3ZVJ D;  1WMJ A;  3GST A;  2O85 A;  3FY7 A;  5ECH B;  5IPG A;  2QA2 A;  5G31 A;  5HFG A;  1Z5Y E;  3LSZ A;  2HSY A;  2B6M A;  5DVB A;  3Q18 A;  4D73 B;  5JCW A;  1WIK A;  3VI7 A;  1MDI A;  3ZL5 A;  1VGL A;  3SWL A;  2VUP A;  1MDJ A;  2A2R A;  1BX9 A;  1K3Y A;  1SK0 A;  4V2M A;  5A4W A;  4K0G A;  1X9M B;  2OA7 A;  3ZMK A;  2DMM A;  3ZFB A;  1X5E A;  1THO A;  1SL1 B;  1YKA A;  1TK5 B;  3H8Q A;  2GZY A;  5G5F A;  1WPI A;  2B3S A;  5H5Q A;  4MLY A;  1R5A A;  4K5R A;  3UL3 A;  3IAM 2;  8GSS A;  1R5P A;  1J0F A;  3DVX A;  2MMO A;  3H79 A;  2IMD A;  4KE3 A;  1S3C A;  4F03 A;  1JHB A;  2DML A;  5JCG A;  2GVP A;  3DML A;  3EVI A;  1EOG A;  2C8U A;  1HNA A;  2DJ2 A;  3IXR A;  3U5R E;  1YKC A;  4HUA A;  1TK0 B;  3HVS A;  2OE3 A;  1B48 A;  3E0U A;  1M7T A;  22GS A;  2VL9 A;  1M9A A;  2JZT A;  3DWV A;  1AXD A;  1Z7P A;  2DLX A;  2WCI A;  1GSE A;  3F3R A;  1GSY A;  4OCE A;  3GRX A;  1QK8 A;  4N0V A;  1EP8 A;  3UMA A;  1PQN A;  4F9Z A;  5KN3 A;  3IE3 A;  1A2L A;  5ENU A;  2H72 A;  1T7P B;  5KN2 A;  2R4V A;  4K2X A;  1O6J A;  9GSS A;  1EZK A;  4POM A;  3VWW A;  3GTU B;  5ECN B;  4MK3 A;  2KUC A;  3EE2 A;  4POL A;  2TIR A;  1GNW A;  3PH9 A;  3W8S A;  2H66 A;  3DRN A;  2EIR A;  4HZ2 A;  6GSX A;  2A4H A;  2E2M A;  3KMO A;  3WT1 A;  3GIX A;  4JED A;  1QFN A;  2X8H A;  3IRA A;  3IDV A;  3EU3 A;  1K3L A;  5KEJ A;  3ERF A;  2KHP A;  2MBT A;  4K0N A;  2ON5 A;  5CRD A;  4ECC A;  4MZB A;  2H75 A;  4TR1 A;  2H30 A;  2QKE A;  4I5Q A;  3UAP A;  1XWK A;  1XCC A;  3UBL A;  4BPY A;  2E2G A;  6GSY A;  2PPT A;  3IHQ A;  3F0I A;  1PA3 A;  2LKU A;  3GKN A;  3ZLP A;  1BYE A;  2GT5 A;  1XWB A;  3HKR A;  2LTK A;  2L6D A;  2A4V A;  4QL7 A;  5IOW A;  4EL1 A;  1EWX A;  1B4Q A;  3M3M A;  2VCT A;  1Y25 A;  4G19 A;  4OWY A;  2H73 A;  4MF7 A;  3EU4 A;  4BWQ A;  3GKX A;  3F8U A;  4DVC A;  5GSS A;  4KAE A;  4O5U A;  1ACV A;  5GST A;  4J56 E;  2V1M A;  4TKY A;  1GSU A;  4PXO A;  4K9Z A;  6GSU A;  3L4N A;  2PVQ A;  1K0N A;  4YQM A;  2H8L A;  2IFQ B;  3HVX A;  3ZRD A;  4XCS A;  3O76 A;  1Z7R A;  2OKA A;  2LJK A;  4N10 A;  4P3Y B;  1EGO A;  5FT3 A;  3TKS A;  3E3E A;  1EP7 A;  5D96 A;  1M2D A;  3KEB A;  1FAA A;  2WGR A;  2C0E A;  2A2S A;  3M9K A;  4EC0 A;  2JSZ A;  1U3I A;  3GUR A;  3WD6 A;  2PMT A;  3ZIT A;  3KJY A;  4XRA A;  5LNK e;  2CZ3 A;  2NPB A;  1QXH A;  4NHZ A;  4Z2U A;  3ME7 A;  4J57 E;  2XC2 A;  1K0D A;  4USS A;  2VLV A;  2H01 A;  2CAI A;  3QFB C;  4XS4 A;  1DUG A;  5IMC A;  2OE0 A;  1TP9 A;  1UVZ A;  1YEX A;  2WB9 A;  5CRH A;  2AHE A;  4KUN A;  2HLS A;  2PBJ A;  4TXV A;  5F0G A;  2H6Z A;  2MBS A;  5A4U A;  3DIE A;  4FYU A;  3IA1 A;  4Z2T A;  4A5P A;  1O81 A;  2C0D A;  1ERW A;  1AIU A;  3IC4 A;  1N8J A;  5FWG A;  4YAV A;  4K6X A;  3VLN A;  1G6W A;  4ZL8 A;  2GTU A;  3FKF A;  1TJD A;  2R5G A;  2EIQ A;  4K5S A;  1F9M A;  4RI6 A;  1TW9 A;  2LQQ A;  1URM A;  1FB0 A;  3HDC A;  5GAP D;  1J9B A;  5HR3 A;  3TKQ A;  1Z3E A;  2VD1 A;  4EVM A;  1XWC A;  5AN1 A;  2ES7 A;  3KP8 A;  3VI5 A;  1HD2 A;  1OC9 B;  2R0C A;  4EIP A;  3HA9 A;  2M46 A;  5DJL A;  3A2V A;  4GQC A;  1RW1 A;  2GST A;  5IMZ A;  4IS0 A;  2VCQ A;  2YZH A;  2HT9 A;  4WEY A;  5EPF A;  4MZW A;  1GL8 A;  5DBQ A;  3F63 A;  4PQH A;  1U6T A;  3GH9 A;  2FWF A;  4O7H A;  1YF0 A;  4L8E A;  1B9Y C;  4DSS B;  3QCP A;  4WF4 A;  5G30 A;  4L5O A;  3EC3 A;  1TRU A;  1JZR A;  1E2Y A;  4BL7 A;  1A0F A;  2C0G A;  3RHC A;  4IGJ A;  1CQG A;  3IK9 A;  4KH7 A;  2A2P A;  2LJR A;  2CQ9 A;  4MNN A;  1TU7 A;  2H6X A;  4GXZ A;  3TJB A;  1I5G A;  1XW6 A;  3GSS A;  4PNG A;  5AGY A;  3F6D A;  1ZYP A;  2I9H A;  3JCM L;  4GWR A;  1OVN A;  3KGK A;  1EOH A;  1GTA A;  3NZN A;  2LNS A;  3GUS A;  1A23 A;  3BCI A;  4V1A g;  3ZFL A;  4BVX B;  5DAK B;  3KXO A;  1GUM A;  1YQ1 A;  4IN0 A;  3TKP A;  2R3X A;  4MJE A;  1B8X A;  1TXX A;  3GHA A;  4ULX A;  3GMF A;  5C00 A;  3UBK A;  2G0F A;  4D73 A;  4GRF A;  2XBI A;  3ZRE A;  4FYC A;  1N2A A;  1EEM A;  4ECI A;  4WBJ A;  2YJH A;  2XPE A;  1YZX A;  2B7J A;  1PRX A;  2AAW A;  2ZCT A;  3QPM A;  2XPD A;  2B1K A;  4Q5N A;  2JZR A;  1TI3 A;  1W4V A;  1BAY A;  5DCG A;  2PWJ A;  1KTE A;  4EDZ A;  1Q4J A;  3H4K A;  2KP2 A;  2V32 A;  4IP1 A;  4E8H A;  1XBS A;  4AJ7 A;  3KIJ A;  2H19 A;  5KOX A;  2XHF A;  1S3D A;  5CNW A;  4HZ4 A;  4MP4 A;  3DKS A;  2D2Z A;  1KEB A;  1WOU A;  1XOA A;  4GCI A;  4GSN A;  5D9W A;  3ZYW A;  3IAS 2;  4G10 A;  2FWG A;  4MF5 A;  1THX A;  1T4Z A;  4HU7 A;  2LV3 A;  5CAX A;  5GAN D;  2GLR A;  3GFK A;  1F6M C;  4X43 A;  3IHG A;  3I6A A;  2MMA A;  3KP9 A;  5A4V A;  3P7X A;  3I43 A;  3VWU A;  2EIO A;  1XWA A;  3Q6O A;  2C4J A;  2YWN A;  5C04 A;  4EXJ A;  1GSS A;  4Q5Q A;  2YN1 A;  4Z2R A;  2WUL A;  1IYI A;  18GS A;  1M9B A;  2FY6 A;  2H74 A;  4MJC A;  2VLT A;  4NV2 A;  3AY8 A;  3O6T A;  4YKF A;  1AQV A;  5KOW A;  4BVY B;  4PQ1 A;  1PX6 A;  1A0R P;  4Z7X A;  3KTB A;  2H6Y A;  3TJK A;  2RM5 A;  4IQA A;  3LXZ A;  4JR6 A;  1SD9 A;  2GSR A;  3QDN A;  4NMU A;  3GTU A;  6GSW A;  4KB3 A;  5F06 A;  2H0G A;  2H1D A;  4L0U A;  1R26 A;  4OCF A;  1ZOF A;  1VF4 A;  2ON7 A;  5B8B A;  1SYR A;  4XHM A;  4NAX A;  3EIN A;  4K2D A;  4TXO B;  3ERG A;  2E0Q A;  2WFC A;  1F3B A;  5ECI B;  3TKR A;  4PNF A;  3QAV A;  2CVD A;  2DJK A;  3EUR A;  4NV5 A;  3MAK A;  4MPG A;  1AW9 A;  3TRP A;  1LBK A;  1Z9H A;  1NSW A;  4PQI A;  1T1V A;  2LS5 A;  2MYG A;  4WBR D;  4G0L A;  1EV4 A;  2X8C A;  1KNG A;  2R37 A;  3FZA A;  1NM3 A;  1PX7 A;  2HRF A;  2WDU A;  1SYX A;  2B1L A;  4XTS A;  1K0M A;  1F37 A;  4LLR A;  2P5R A;  1XXU A;  5J9B A;  5L71 A;  3RAZ A;  1VRS D;  4LL4 B;  4E8E A;  4ID0 A;  1SD8 A;  2IME A;  1ABA A;  3LGC A;  2GSS A;  3D5J A;  2AV4 A;  3J7Y b;  2HXK A;  2DJ1 A;  3ZVJ A;  2B5E A;  3WGX A;  1WWJ A;  1Q98 A;  3CMI A;  3PPU A;  1ERV A;  5J41 A;  2JSY A;  4MJB A;  3FR9 A;  5DAL B;  2CVK A;  3UAR A;  1PL2 A;  2L5O A;  4DEJ A;  5KN1 A;  1ML6 A;  4YAP A;  3CSJ A;  3ZTL A;  1OAZ A;  2IFQ A;  4PX1 A;  1EGR A;  2PER A;  4OO5 A;  1MEK A;  1DE1 A;  2WZ9 A;  3KD0 A;  3C8E A;  4FYB A;  3G7Y A;  2V6O A;  2DIY A;  3G7I A;  3VWX A;  1OKT A;  4ZB6 A;  4POB A;  4AGS A;  3QD9 A;  2AUV A;  1SU9 A;  5FHI A;  2VAF A;  2IIY A;  2OBK A;  3IOS A;  3HZ8 A;  2WS2 A;  2OAC A;  2FD3 A;  1MTC A;  2ZNM A;  2LJA A;  3KZQ A;  2YV9 A;  3TRX A;  5JWQ B;  2FHE A;  3QOU A;  3LOR A;  2OBI A;  1T4Y A;  3BJ5 A;  1JZO A;  4V2N A;  4O92 A;  2B5Y A;  5IPH A;  1BED A;  2HI7 A;  5ID2 A;  3HZ4 A;  4MA9 A;  4LL1 B;  4FH8 A;  3DGQ A;  2I4A A;  1T00 A;  5ECS A;  3R3E A;  5AIV A;  4TW5 A;  4ML1 A;  3F4S A;  4WXT A;  4JBB A;  4YQU A;  2PUK C;  3ZIV A;  3UJ1 A;  1AQW A;  4ZBA A;  5H5R A;  4O32 A;  4TRX A;  1AUC A;  2L5L A;  2L57 A;  2JU5 A;  1PSQ A;  2PU9 C;  2VCX A;  2CT6 A;  1GSD A;  4PUF C;  2DKI A;  2M72 A;  2FCH A;  1K0C A;  4ACS A;  1ERT A;  2M80 A;  2VL3 A;  2DSA A;  2RLI A;  2P5Q A;  4RQX A;  2VM2 A;  3FZ9 A;  4ZIJ A;  1OC8 A;  3FZ5 A;  3FR6 A;  2K18 A;  4EIQ A;  4MH2 A;  4JU5 A;  1QQ2 A;  4JR4 A;  3HXS A;  2VOC A;  1G7O A;  1AC1 A;  1TDI A;  1OC9 A;  1U88 A;  3FW2 A;  2HZE B;  3C1R A;  3GL5 A;  1O7U A;  3M1G A;  3P8W A;  4YH2 A;  5HR1 A;  4IEL A;  4J2F A;  3C7M A;  3GX0 A;  3PIN A;  10GS A;  3F6F A;  2NBS A;  1Y6E A;  5ECO B;  2DIZ A;  5B6M A;  1RQM A;  3S9F A;  17GS A;  3D4T A;  3ISO A;  5ID2 B;  1T8E B;  3C1S A;  1M2B A;  2C3T A;  1V98 A;  11GS A;  1M99 A;  1GTI A;  4DSS A;  2XBQ A;  4ISD A;  2Z9S A;  2J9H A;  3V1W A;  4HQZ A;  5D73 A;  2CX4 A;  2YCD A;  4KDU A;  4ZB8 A;  3MSZ A;  4KF9 A;  3HJM A;  5B8A A;  4PGT A;  3PR8 A;  1AQX A;  2YV7 A;  3EYT A;  3UEM A;  5ECK B;  3ERW A;  4HS1 A;  2CVB A;  1FB6 A;  1K3O A;  5B7C A;  3I9V 2;  5EVO A;  4TOP A;  2OJL A;  3H1N A;  3DXB A;  2I81 A;  1A2J A;  4BVX A;  2L4C A;  5DAK A;  2FNO A;  2LUS A;  4OMV A;  2YOI A;  5D8I A;  1YF1 A;  1BQ7 A;  5HR0 A;  4OO4 A;  1A8L A;  1XW9 A;  2HRA A;  2H1A A;  2O87 A;  4X4J A;  3CSH A;  2NDO A;  4KDX A;  3BCK A;  1OE7 A;  3A2X A;  3GNJ A;  1Z6N A;  3KCM A;  2RII A;  1SJ6 A;  1V40 A;  3LEF A;  4JE1 A;  4JZQ A;  4AJ6 A;  5D93 A;  1FOH A;  3KMN A;  1X0R A;  2VCW A;  2GGT A;  1G0T A;  4PTS A;  2IL3 A;  3A5W A;  2H70 A;  2AYT A;  3L0H A;  4ML6 A;  1C72 A;  4EE0 A;  4N0Z A;  3D0Z A;  3HYP A;  5H5S A;  1PD2 1;  2V6K A;  1MD4 A;  1H75 A;  4LMV A;  3RPP A;  3LFL A;  3SBC A;  5IQY A;  4GTU A;  2F51 A;  3CTG A;  1HYU A;  2DKH A;  3CBU A;  2FA4 A;  1GRX A;  1SL0 B;  4FIW A;  4EUY A;  3QMX A;  5J9C A;  2GQK A;  3EWL A;  1TOF A;  5AIX A;  2VLU A;  2ALB A;  4PUA A;  1ILO A;  3TUE A;  4Q5R A;  3BBY A;  2RM6 A;  1NHO A;  2H1G A;  4WR4 A;  4G0I A;  1X9W B;  3G9B A;  2DJ0 A;  2FWE A;  2HNL A;  1F2E A;  3P2A A;  4GLT A;  4ZBD A;  4IVF A;  2X4A A;  1GTB A;  1M0U A;  2H1B A;  1OKD A;  4TVE A;  3VFI A;  2QA1 A;  4I2U A;  1YDK A;  2H76 A;  1V58 A;  4MPF A;  5DQY A;  1O8W A;  1SK2 A;  2OAD A;  4O5R A;  1K0O A;  3KH9 A;  1PL1 A;  3GX8 A;  1XZO A;  1GUH A;  3FR3 A;  1V57 A;  4BVY A;  1ZCP A;  3EMP A;  3L78 A;  5F8B A;  4HDE A;  3LWA A;  1YY7 A;  2X99 A;  1TI1 A;  5ECQ B;  4I97 A;  3F9U A;  1GNE A;  2IMK A;  3UOM A;  1S3A A;  1WRY A;  3GL3 A;  3W8J A;  3VPT A;  4TXO A;  2JL4 A;  2GT6 A;  3GKK A;  1XFL A;  4QL9 A;  2N5A A;  5G5E A;  2HFD A;  1G6Y A;  5G1K A;  3Q19 A;  1TTZ A;  1OC3 A;  1VF2 A;  4MF6 A;  2GS3 A;  19GS A;  1ERU A;  1HQO A;  4CW9 A;  2K9F A;  3GH6 A;  2C0F A;  2NVL A;  1WJK A;  3O3T A;  1H4O A;  1GSQ A;  3MIX A;  2O89 A;  3WGD A;  4WET A;  3KTL A;  4H86 A;  3M0F A;  3F4R A;  1UC7 A;  4F82 A;  5BRT A;  3VPQ A;  1UN2 A;  2YP6 A;  5ELG A;  5E59 A;  3FK8 A;  2ZUP A;  1Z6M A;  2UZ8 A;  4JRR A;  4PUR A;  1X5D A;  1AAZ A;  2GQM A;  3LQ7 A;  3DEX A;  3FRC A;  2QGV A;  3IV4 A;  4NPB A;  4K7O A;  1K0A A;  2KOK A;  3LG6 A;  1W89 A;  2VL2 A;  1CQH A;  3D21 A;  4KX4 A;  1GLP A;  3RPN A;  3RDW A;  5B6N A;  4N30 A;  2LNT A;  3ME8 A;  1GP1 A;  1ZYN A;  1FVK A;  2HYX A;  2L6C A;  2LRT A;  1UA5 A;  5G2Z A;  1VF3 A;  3NOF A;  3RHB A;  1PKZ A;  3L9U A;  2KLX A;  5DAL A;  13GS A;  5J5N A;  3GYK A;  5COH A;  4QQ7 A;  4IBP A;  3CTF A;  12GS A;  3LW9 A;  1VF1 A;  2BTO T;  3A2W A;  4BWS A;  5GZZ B;  4F0C A;  3P90 A;  3TJJ A;  5AIS A;  3EPT A;  2PVO C;  4MCU A;  4MJA A;  3R2Q A;  5LCZ A;  2N5F A;  4EKZ A;  2JAD A;  2YWO A;  4X0X A;  5J3R A;  2O8V B;  4AF2 A;  2FUG 2;  4RUV A;  4ECB A;  2BJX A;  4K8M A;  4RQR A;  3WYW A;  5EY6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...