1B9XC

Structural analysis of phosducin and its phosphorylation-regulated interaction with transducin
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
217
structure length
169
Chain Sequence
EGQATHTGPKGVINDWRKFKLESEDEGCLRKYRRQCMQDMHQKLSFGPRYGFVYELETGEQFLETIEKEQKVTTIVVNIYEDGVRGCDALNSSLECLAAEYPMVKFCKIRASNTGAGDRFSSDVLPTLLVYKGGELISNFISVAEQFAEDFFAADVESFLNEYGLLPER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords PROTEIN (TRANSDUCIN)
publication title A molecular mechanism for the phosphorylation-dependent regulation of heterotrimeric G proteins by phosducin.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 44
structure length 169
sequence length 217
ec nomenclature
pdb deposition date 1999-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02114 Phosducin Phosducin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.168.10 Mainly Alpha Orthogonal Bundle Phosducin; domain 2 Phosducin, domain 2 1b9xC02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1b9xC01
4ZBDA 4DSQA 5C00A 5DJLA 4H86A 1O7UA 2IN3A 1CQHA 1GUMA 2H0IA 2N5AA 2MYGA 5A4WA 2M80A 1YQ1A 2DJJA 4K6XA 1K3LA 2H73A 2O8VB 18GSA 2FWEA 1GWCA 4GF0A 5ECSA 3LQ7A 2C80A 1B8XA 3ZITA 2FA4A 3ERWA 2E2MA 2E2GA 4LA1A 2H0HA 2JZRA 1J0FA 3ZZXA 2C3NA 1K0NA 2V1MA 5ELAA 3RPNA 1GSEA 5ECHB 1UN2A 2B5XA 2C1YA 3LGCA 1JZWA 4GSTA 1KBNA 5IOXA 2PBJA 6GSXA 2IIYA 1NM3A 2WJUA 4O32A 3M1GA 4MJCA 5IM9A 2XHFA 1PMTA 4GLTA 2FUG2 1Q4JA 3UBLA 16GSA 2DLXA 3FR6A 2HZEA 4IN0A 7GSSA 2ES7A 6GSYA 4BPYA 2YCDA 5J41A 4ACSA 3QPMA 3GRXA 1ILOA 3IBHA 1HYUA 4ZILA 3NOFA 1I9DA 2TRCP 1SL1B 1O81A 3O3TA 3CTFA 1GSQA 3EE2A 5ECLB 1QK8A 3VWUA 2WDUA 1V9WA 3C71A 1AQVA 5FHIA 3TJJA 3A2WA 2PPTA 3FY7A 1X5DA 4IHUA 1Z5YE 1GNWA 3KD0A 4OCEA 2WULA 1GTBA 3HXSA 3VFIA 2YPMA 2R3XA 1O8XA 4V2LA 4PQ1A 4LL4B 3LFLA 2YWOA 2H1GA 2R4VA 3IHQA 1HD2A 4MF6A 3P8WA 1EOHA 4POLA 1YZXA 4OFMA 3E0UA 1M2BA 2C3QA 1ZYEA 2EIQA 4TVEA 1WP0A 3TOTA 3APOA 3QAGA 1O6JA 3Q19A 2IPAA 3F6FA 4MF7A 4KCAA 1QFNA 1A8LA 2KHPA 5DJMA 3FHKA 17GSA 2AAWA 2VLVA 2LQQA 1FAAA 4TOPA 1SJ6A 3S9FA 3CSHA 3ZREA 2LRNA 5EVOA 4MPFA 1QUWA 4IS0A 2YP6A 3I69A 2RM5A 3EURA 2XBQA 4MJBA 3UIWA 4JZQA 1K3YA 2F8FA 1THOA 4XRDA 4ZBAA 4PX1A 5D96A 5GSTA 2FD3A 3G7IA 2HRNA 4J57E 3CRUA 2K8VA 2LTKA 4ML1A 4E8HA 1M9BA 3D5JA 4K7OA 1F2EA 4XHMA 2B5EA 4NWYA 3KCMA 1YJ6A 2B5YA 3TJFA 1M2DA 2YANA 1R7HA 4BWSA 1F37A 2YWMA 3APQA 3IDVA 1LBKA 3UAPA 4BL7A 4CW9A 1Q98A 1TW9A 3TOUA 4KUNA 1X9SB 1LJRA 4YQVA 5B8AA 2GQMA 2R37A 1DE1A 3NZNA 2HXKA 2F8AA 3M8NA 2CAIA 4HQZA 1OVNA 1T1VA 5AIVA 5DCGA 5IMCA 2PU9C 2VCQA 3UBKA 2X8CA 2F3MA 2YZHA 4Q5QA 5GAPD 3GMFA 2H75A 6GSTA 1JLVA 2V6OA 3KIJA 1FOVA 1YKCA 5LD0A 3F4RA 1G6WA 2DC5A 5DALB 3MSZA 4TKYA 1ZOFA 4XS6A 1C72A 4XRAA 5AIXA 2KP1A 2DJ3A 4ZIJA 3EMPA 2H0GA 5CRGA 3PH9A 2X99A 3KP9A 1N2AA 2H6ZA 4L0WA 1YEPA 3GKNA 3WT2A 1S3AA 4GWRA 1JLWA 5J9CA 4I5QA 1AQWA 3DKSA 1KNGA 3MWHA 3FW2A 4BWQA 2LRTA 3ED3A 4OFNA 1N8JA 3QR6A 3QD9A 2GDRA 1GSUA 1KTEA 1AXDA 4KH7A 3KMNA 1JZDA 2KLXA 1F9MA 4CDOA 3C73A 2PMTA 4F2IA 2K8SA 2MMNA 1MTCA 1GNEA 3N9JA 1OKTA 4KCEA 4HU9A 3ERGA 3CMIA 4HZ4A 1M7TA 1R26A 5JWRB 4PGTA 3FEUA 2H1AA 2YWIA 1WRYA 4XCSA 2QSIA 4XS4B 4HZ2A 5HQPA 1YY7A 2L59A 3P90A 4V1Ag 4L0UA 1YF1A 4EVMA 1GTIA 2JL4A 3GURA 1EWXA 2IWTA 4PNGA 1B48A 3EC3A 4PUFC 2H76A 2JZTA 3OR5A 5DQYA 1MEKA 3QAWA 2C3TA 3DYRA 4ECBA 2PWJA 4QQ7A 1FHEA 5IMVA 1ZZYA 1U3AA 3KZQA 2V2GA 1PX7A 4MJEA 1DSBA 2WCIA 2FLSA 1OKDA 1OE7A 2CVKA 3D22A 5CAXA 3QDNA 3DIEA 4N0ZA 2VCWA 3UARA 2X8HA 2IFQB 2F51A 1GP1A 4RUVA 3RDWA 4N30A 4MCUA 3TKRA 2FNOA 3M3MA 1XXUA 3O76A 4TR4A 2DJ0A 2VLTA 5ID2B 5G31A 5COHA 1TOFA 1M0UA 3TJGA 4OO4A 4MPGA 4ULXA 3H1NA 4O92A 2GQLA 3Q6OA 4K2DA 2VD0A 1PA3A 2I4AA 2L4QA 4ML6A 2TRXA 3ISOA 1VF1A 20GSA 3UJ1A 5E59A 4OWYA 3TDGA 2HNLA 1CQGA 2HI7A 5KN0A 3VLNA 3EU4A 4HOJA 5ECKB 1W4VA 3TKSE 3U5RE 3WT1A 2O7KA 4LL1B 1WWJA 1T7PB 1S3CA 3F4TA 1TRWA 2GSSA 2WZ9A 2VCTA 3CYNA 3TB2A 5KN3A 2IL3A 3FK8A 3TKSA 3IAS2 4FH8A 2JZSA 4KGIA 1QGVA 4JR4A 4K9ZA 3IE3A 3GX0A 3FZAA 3IK9A 2YNXA 5ENUA 4ZB6A 2L6DA 4K7NA 1TDIA 4HS1A 2GLRA 3BD2A 4NV2A 5IMAA 5DDLA 2MBSA 4F0BA 5KN2A 1VF4A 3ZMKA 4MH2A 5B7CA 4IP1A 1T3BA 4WF5A 2H74A 4E8EA 1K3OA 1G7EA 1F6MC 1GH2A 3TKQA 1ST9A 2DIZA 4MF5A 4KSOA 1YKAA 2GVPA 2CAQA 3EVIA 5DALA 4PUAA 2HRFA 3CSIA 5ECNB 1A24A 3EYTA 1J9BA 4Z7XA 1LU4A 5D8IA 4DEJA 2VL3A 4DVCA 2LNTA 4OCFA 3FZ5A 1JHBA 3WD6A 1SKSB 1XVQA 2VL2A 5EPFA 4LMVA 4I97A 1I5GA 4NPBA 3L9VA 3W6GA 1B4QA 3JCML 5L71A 1Z3EA 1KEBA 3HZ8A 3HDCA 1H75A 4I2TA 1B9YC 1Y6EA 3PGTA 4WEYA 2VIMA 1ML6A 1X9MB 2HLSA 3E3EA 3GL5A 2VM2A 2NPBA 2LJRA 1U87A 1TI1A 4MMMA 1PL2A 2RLIA 4ZB8A 1THXA 5ELGA 3U6VA 3NIVA 2DJ1A 1ZL9A 1SD8A 1PL1A 5JCUA 2DIYA 3GX8A 2DBCA 1WPIA 3SWLA 3GFKA 4O7HA 3K8NA 5J9BA 2H8LA 1SYRA 4HUAA 1GRXA 1XW5A 2CX4A 4J2FA 3RPPA 4WBJA 2FHEA 3F8UA 2RM6A 5CREA 2AB6A 3KTBA 4XS4A 3DRNA 2ZNMA 4QL7A 1SKRB 5ECMB 2V41A 3A2VA 1QQ2A 3QMXA 4RI6A 4YAPA 5D9XA 3IV4A 4XIHA 1EZKA 1UVZA 1GSDA 5IMFA 2YOIA 4BVXA 1V2AA 4IELA 3US3A 3KMOA 1XWGA 3ZVJD 3GIXA 4F03A 1TI3A 1SD9A 3IAM2 2PVOC 3DD3A 3KH7A 2H70A 3FYGA 4YQUA 1HNBA 2ZUPA 1HQOA 4K8MA 2DJ2A 3F9UA 2IMDA 3H93A 4IVFA 1G7OA 3I6AA 3IXRA 2IFQA 5A4VA 3F0IA 1A2MA 2ZCTA 3VI5A 1GL8A 1TXXA 1V57A 5ID2A 1Z7PA 2HYXA 4HI7A 4FYUA 2HT9A 3IPZA 1XPVA 1UA5A 3HCZA 2MMOA 2LS5A 3I43A 5ECPB 4G2EA 4NV5A 2V6KA 3H4KA 2EIRA 3RHCA 1MD4A 4JR6A 3UL3A 4ISDA 3HVVA 1TRVA 1UC7A 3GHAA 3ME7A 1K0BA 1XCCA 1XWBA 2OADA 5JWOB 4KSMA 3HKRA 1TU7A 3KH9A 1ABAA 5IMDA 1NW2A 4RQXA 1SKWB 1M99A 2N5BA 4L5OA 5JCGA 2C4JA 4KW6A 4GXZA 5IQYA 1EGOA 1GLPA 4TN8A 2LJKA 3L0HA 1U6TA 4IQAA 2WFCA 3WGXA 2GZYA 4G9HA 3CXGA 2GGTA 2V32A 2MMZA 2R2JA 5G30A 3LXTA 2OKAA 4Q5RA 5DAKB 3HJOA 2HSHA 1PD21 4YQMA 3P2AA 3TRPA 3G7YA 2GT5A 2PERA 4V1Ap 3I9V2 2LEGA 1SL2B 3CSJA 2LUSA 1B4PA 3Q74A 5B6MA 2YV7A 4LMWA 1NSWA 5H5QA 2NDOA 2YJ7A 4F9ZA 5IO0A 4PURA 2LV3A 5G1LA 4G19A 1T4ZA 3LWAA 2XPDA 6GSWA 4GQFA 2P5QA 4PQHA 2LRCA 4JE1A 4EDYA 3FRCA 3ZLPA 1OC9B 2GT6A 2FGXA 3L4NA 2B3SA 1X9WB 3FKFA 1O85A 3TKPA 5CRWA 1V40A 1WMJA 1Z6NA 1YDKA 3VWVA 1YF0A 4EDZA 4AF2A 2DMMA 2HFDA 2H19A 3BCIA 3DGQA 4TR3A 1TJDA 3BCKA 1XOBA 3DXBA 2CT6A 2O89A 2B1KA 1VRSD 2H72A 1E6BA 3J7Yb 4G10A 2ON5A 1XZOA 4HDEA 3ZRDA 1GSYA 4POBA 5G1KA 2X64A 22GSA 1K0CA 5B6NA 1MD3A 2OA7A 2RIIA 3GSTA 5J3RA 2EIOA 2JADA 8GSSA 4GSNA 4MA9A 1W89A 3EMXA 4NHWA 4EE0A 5LNKe 5CRDA 2JU5A 2ON7A 1QMVA 2GS3A 3GN3A 1GULA 3HJMA 4K0NA 2L5OA 3UEMA 1AC1A 5DQSA 4IP6A 5ABRA 1S3DA 4IKHA 6GSSA 1TK0B 4X1UA 3UVHA 1U3IA 1WIKA 2WB9A 1AQXA 3LSZA 2I3YA 3IA1A 4KDXA 2JSZA 1ERTA 1GUKA 1XBSA 4MABA 2VCXA 1HNAA 4EXJA 2N5FA 3CBUA 3TRQA 5H5RA 3VPQA 3IR4A 5LCZA 5HR3A 3QFBC 4ILFA 4ECJA 3FR9A 2CX3A 3QFAC 4X0XA 5C04A 1V58A 4POMA 5EL8A 5G2ZA 3KP8A 4AJ7A 4EL1A 1T4YA 4MJAA 4JU5A 1XOAA 2CV4A 3C7MA 1FO5A 2YN1A 1SJZA 2GTUA 5F0GA 4KA0A 2OE3A 2PN8A 2J9HA 4EO3A 1WOUA 1AW9A 1SK1A 5GAND 2KOKA 1ZMAA 1ZYQB 4I2UA 4TXVA 3RBTA 2K18A 4PQIA 1OC3A 4EKZA 1GTUA 4Q5NA 3GKMA 3PINA 4L8EA 3LJRA 5D73A 5AGYA 3M0FA 2KUCA 4MK3A 2NBSA 3P7XA 3ZL5A 4QL9A 2LKUA 1A0FA 3HZ4A 3J7Yk 1ZGNA 2PGTA 2FCHA 4K1FA 5IOWA 3MNGA 3D4MA 2OE1A 5KEJA 2GZPA 4XTSA 1AAZA 1F3AA 4YH2A 1T8EB 5DAKA 2O87A 2LJAA 1OE8A 4HJMA 5GSSA 3V1WA 2VAFA 2VCZA 1O8WA 1FVKA 4AJ6A 5AN1A 4N11A 2G0FA 2VOCA 1XWCA 1IYIA 14GSA 3LEFA 4IJIA 5INYA 2VCVA 4TXOB 1U88A 2IMIA 4D73B 2FWFA 2OBIA 1USBA 1MDIA 3A5WA 3VWWA 3QOUA 3EU3A 3ZIJA 3ZMLA 2F9SA 1EEJA 2QGVA 5DBQA 3BJ5A 2A2SA 4WKWA 2YV9A 1A0RP 3FZ4A 2KP2A 1G0TA 5D93A 2OE0A 1FB6A 1OC9A 1ON4A 5A4UA 5G5FA 2H1BA 2I1UA 4RI7A 1J08A 3GTUB 5DCHA 3TJBA 2WS2A 5IPGA 2IMEA 2BTOT 4MLYA 5CNWA 3RAZA 3W8JA 1SENA 2H01A 4DSRA 1MDJA 1OC8A 4MH3A 3KTLA 1H4OA 1XW6A 3GKKA 2PUKC 1TTZA 1BJXA 1AUCA 4KNDA 3HY2A 2H6XA 3MDKA 4MZCA 4YAVA 3M9JA 6GSUA 2L5LA 3SBCA 2VLUA 3FR3A 4IQ1A 4P3YB 4BVYA 1SK0A 5CYYA 2TIRA 2AHEA 5EY6A 1V98A 2MBTA 1JZOA 2DSAA 2XBIA 5KN1A 5CP1A 4F0CA 5JCWA 4KAEA 1ERVA 3L9SA 3CTGA 1O73A 1IYHA 4ZL7A 2L6CA 1A2JA 4KX4A 2YJHA 3ZFBA 13GSA 2L4CA 4I8BA 5F07A 2B1LA 4XS1A 11GSA 3C8EA 1BX9A 4N10A 1WE0A 1XW9A 4WR4A 1PX6A 1PRXA 3D21A 1SU9A 1RK4A 3FZ9A 2K9FA 2C0FA 4KDYA 1OAZA 1FW1A 5HFGA 4GSSA 5J4UA 4HU7A 5F06A 2MMAA 1XWAA 1BEDA 4ECIA 3DEXA 3LYKA 2CVDA 2HE3A 4EC0A 3QCPA 1VF2A 1A8YA 3C1RA 5E4WA 2ALBA 1X5CA 1SL0B 1OYJA 2H30A 2J23A 4PXOA 4OFTA 1JFUA 1PN9A 1Y25A 4WBRD 1R5PA 3UOMA 1TP9A 3F3RA 2P5RA 4V2NA 3IOSA 5HFKA 2B7JA 5ECIB 3HD5A 1ERUA 4TR1B 2E7PA 4MZWA 3TKSC 3PR8A 4DSSB 2R6KA 1QXHA 2I81A 4JBBA 3LORA 4FYCA 2K6VA 1T00A 4ID0A 3VPTA 5AISA 4NHZA 3WYWA 3EWLA 2C8UA 4NMUA 5H5SA 1AIUA 2MZCA 5F05A 3GYKA 3TRXA 1EP8A 4ZL8A 5F8BA 1URMA 10GSA 1FVJA 1GUHA 2DMLA 2WRTA 3VI7A 2FA8A 3TCOA 3QAVA 5IPHA 2LNSA 3G9BA 3F3QA 4JEDA 3TJKA 2HZFA 1PKZA 2GSRA 2R5GA 3F4SA 3D6IA 1PSQA 3GH6A 4TXOA 2AUVA 2NTOA 4D73A 1Z6MA 3BBYA 4BA7A 2JSYA 1YEXA 4WR5A 3AY8A 3F6DA 3DMLA 3ZTLA 4PNFA 4ZBBA 4O5RA 4F82A 1K0AA 2VL2C 3IK7A 3KM6A 4MDCA 1JZRA 4J56E 4KE3A 2XC2A 1MDKA 1SYXA 3G7JA 1BYEA 2CZ2A 1ACVA 3Q18A 1K0OA 2GZZA 4WXTA 5D9TA 4MP4A 1NHOA 3GTUA 1M9AA 1X0RA 1TK5B 2IMKA 1E2YA 1SJIA 1DBYA 1BAYA 6GSVA 4L5LA 1BG5A 4WETA 5CRHA 4HJ2A 1EOGA 3HHVA 4IBPA 2GQKA 3WGEA 3APSA 4NAXA 1ZCPA 1TRUA 3LXZA 1PGTA 2OACA 1EV9A 2VD1A 5D9WA 2M72A 1GLQA 4Q5FA 2C0DA 2M46A 4NXIA 2H71A 4ZL9A 1EV4A 4FYBA 2C0EA 1DE2A 2PVQA 1HNCA 2AV4A 3ZVJA 1PKWA 1EP7A 2C0GA 3GL3A 2OBKA 3ZYWA 1K0DA 5DVBA 1FB0A 5GZZB 3EINA 4LLRA 1WJKA 3GV1A 5IO2A 1NHYA 1GSSA 1X5EA 2IMFA 4AJ8A 3GKXA 4GQCA 2B7KA 1M2AA 2CZ3A 2GSQA 4GTUA 2VM1A 4FO5A 3ERFA 2FWHA 2NVLA 4CHSA 2D2ZA 5FWGA 1A2LA 1Z7RA 4GCIA 9GSSA 3LYPA 4AGSA 1B9XC 4X43A 2B6MA 3KXOA 1BQ7A 2X8GA 5HR2A 5ECRB 2DJKA 2BMXA 3ZIVA 2EC4A 2HZEB 2A4VA 3LG6A 2P31A 2WGRA 1G6YA 2I9HA 1EGRA 2QC7A 2LQOA 2YZUA 4ZXGA 3M9KA 5G5EA 2VO4A 4TR1A 1TRSA 2RUFA 3IC4A 4IGJA 2L57A 4TW5A 3ZFLA 2OJLA 3WGDA 4EUYA 2IJYA 3HA9A 3KJYA 4WF4A 4DSSA 1EEMA 3GUSA 2CVBA 2H1DA 2H66A 3UMAA 1FG4A 3R2QA 2FWGA 2VUPA 3TGZA 4POKA 3VURA 1F3BA 5HR0A 4I6XA 3L78A 4OMVA 1TKDB 3H79A 5CO3A 1XIYA 5JWQB 4V2MA 3C1SA 1ERWA 4FIWA 4IW9A 1TU8A 1XFLA 1GTAA 3UVTA 4MZBA 1A23A 4HQSA 4TR0A 3GH9A 2VL9A 1XVWA 2A2RA 4OD7A 1K0MA 2Z9SA 4ECCA 5D9VA 5ECQB 3HVSA 2CQ9A 3L9UA 1VGLA 12GSA 2CA8A 1VF3A 3KEBA 4K7IA 2O85A 1R4WA 3VK9A 1TK8B 3CRTA 3W8SA 3H8QA 3O6TA 1R5AA 3RHBA 1PQNA 3D0ZA 1Z9HA 2AJQB 2AYTA 4ZB9A 1GSFA 1XWKA 4K0GA 5B8BA 3E9JB 3DWVA 5HFIA 2G2QA 4IJ3A 4TRXA 4KDUA 3HYPA 3D4TA 3N5OA 3GNJA 5J5NA 3A3TA 2HSYA 5ECOB 2BJXA 3GA4A 2GSTA 4HEA2 3IRAA 19GSA 4N0VA 3TUEA 2H6YA 5HR1A 3HVXA 1RQMA 4JRRA 3KGKA 4EF0A 2JACA 2YWNA 2P0GA 2REMA 2FY6A 2QKEA 1RW1A 5A5KA 5FT3A 3VWXA 2E0QA 5IMZA 1DUGA 3HJPA 4KB3A 3DVXA 3DVWA 2XPEA 3MAKA 4OO5A 3ME8A 2LSTA 3BOAA 1SK2A 2RUEA 4GRFA 5IIZA 4RQRA 3A2XA 3GSSA 3F63A
chains in the Genus database with same CATH superfamily
4ZBDA 4DSQA 5C00A 5DJLA 4H86A 1O7UA 2IN3A 1CQHA 1GUMA 2H0IA 2N5AA 2MYGA 5A4WA 2M80A 1YQ1A 2DJJA 4K6XA 1K3LA 2H73A 4BL7B 2O8VB 18GSA 2FWEA 1GWCA 4GF0A 5ECSA 3LQ7A 2C80A 1B8XA 3ZITA 2FA4A 5BMUA 3ERWA 2E2MA 2E2GA 4PTSA 4LA1A 2H0HA 2JZRA 1J0FA 3ZZXA 2C3NA 1K0NA 2V1MA 5ELAA 3RPNA 1GSEA 5ECHB 1UN2A 2B5XA 2C1YA 3LGCA 1JZWA 4GSTA 1KBNA 5IOXA 2PBJA 6GSXA 2IIYA 1NM3A 2WJUA 4O32A 3M1GA 4MJCA 5IM9A 2XHFA 1PMTA 4GLTA 2FUG2 1Q4JA 3UBLA 16GSA 2DLXA 3FR6A 2HZEA 4IN0A 7GSSA 2ES7A 6GSYA 4BPYA 2YCDA 5J41A 4ACSA 3QPMA 3GRXA 1ILOA 3IBHA 1HYUA 4ZILA 3NOFA 1I9DA 2TRCP 1SL1B 1O81A 3O3TA 3CTFA 1GSQA 3EE2A 5ECLB 1QK8A 3VWUA 2WDUA 1V9WA 3C71A 1AQVA 5FHIA 3TJJA 3A2WA 2PPTA 3MYDA 3FY7A 1X5DA 4IHUA 1Z5YE 1GNWA 3KD0A 4OCEA 2WULA 1GTBA 3HXSA 3VFIA 2YPMA 2R3XA 1O8XA 4V2LA 4PQ1A 4LL4B 3LFLA 2YWOA 2H1GA 2R4VA 3IHQA 1HD2A 4MF6A 3P8WA 1EOHA 4POLA 1YZXA 4OFMA 3E0UA 1M2BA 2C3QA 1ZYEA 2EIQA 4TVEA 1WP0A 3TOTA 3APOA 3QAGA 4G0LA 1O6JA 3Q19A 1ZYPA 2IPAA 3F6FA 4MF7A 4KCAA 1QFNA 1A8LA 2KHPA 5DJMA 3FHKA 17GSA 2AAWA 2VLVA 2LQQA 5A2QI 1FAAA 4TOPA 1SJ6A 3S9FA 3CSHA 3ZREA 2LRNA 5EVOA 4MPFA 1QUWA 4IS0A 2YP6A 3I69A 2RM5A 3FMWA 3EURA 2XBQA 4MJBA 3UIWA 4HSCX 4KF9A 4JZQA 1K3YA 2R0GA 2F8FA 1THOA 4XRDA 4ZBAA 4PX1A 5D96A 5GSTA 2FD3A 3G7IA 2HRNA 4J57E 3CRUA 2K8VA 2LTKA 4ML1A 4E8HA 1M9BA 3D5JA 4K7OA 3IHGA 1F2EA 4XHMA 2B5EA 4NWYA 3KCMA 1YJ6A 2B5YA 3TJFA 1M2DA 2YANA 1R7HA 4BWSA 1F37A 2YWMA 3APQA 3IDVA 1LBKA 3UAPA 3PPUA 4BL7A 4CW9A 1Q98A 2QA2A 1TW9A 3TOUA 4KUNA 1X9SB 1LJRA 4YQVA 4CY6A 5B8AA 2GQMA 2R37A 1DE1A 3NZNA 2HXKA 2F8AA 3M8NA 2CAIA 4HQZA 1OVNA 1T1VA 5AIVA 5DCGA 5IMCA 2PU9C 2VCQA 3UBKA 2X8CA 2DKIA 2F3MA 2YZHA 4Q5QA 5GAPD 3GMFA 2HRKA 2H75A 2A4HA 6GSTA 1JLVA 2V6OA 3KIJA 1FOVA 1YKCA 5LD0A 3F4RA 1G6WA 2DC5A 5DALB 3MSZA 4TKYA 1ZOFA 4XS6A 1C72A 4XRAA 5AIXA 3IC8A 2KP1A 2DJ3A 4ZIJA 3EMPA 2H0GA 5CRGA 3PH9A 2X99A 3KP9A 3R3EA 1N2AA 2H6ZA 4L0WA 1YEPA 3GKNA 3WT2A 1S3AA 4GWRA 1JLWA 5J9CA 4I5QA 1AQWA 3DKSA 1KNGA 3MWHA 3FW2A 4BWQA 2LRTA 3ED3A 4OFNA 1N8JA 3QR6A 3QD9A 2GDRA 1GSUA 1KTEA 1AXDA 1M3JA 4KH7A 3KMNA 1JZDA 2KLXA 1F9MA 1PN0A 4CDOA 3C73A 2PMTA 4F2IA 2K8SA 2MMNA 1MTCA 1GNEA 3N9JA 1OKTA 4KCEA 4HU9A 3ERGA 3CMIA 4HZ4A 1M7TA 1R26A 5JWRB 4PGTA 3FEUA 2H1AA 2YWIA 1WRYA 4XCSA 2QSIA 4XS4B 4HZ2A 5HQPA 1YY7A 2L59A 3P90A 4V1Ag 4L0UA 1YF1A 4EVMA 1GTIA 2JL4A 3GURA 1EWXA 2IWTA 4PNGA 1B48A 3EC3A 4PUFC 2H76A 2JZTA 3OR5A 5DQYA 1MEKA 3QAWA 4BVXB 2C3TA 3DYRA 4ECBA 2PWJA 4QQ7A 1FHEA 5IMVA 1ZZYA 1U3AA 3KZQA 2V2GA 1PX7A 4MJEA 1DSBA 2WCIA 2FLSA 1OKDA 1OE7A 2CVKA 3D22A 5CAXA 3QDNA 4O5QA 3DIEA 4N0ZA 2VCWA 3UARA 2X8HA 2IFQB 2F51A 1GP1A 4G0KA 4RUVA 3RDWA 4N30A 4MCUA 3TKRA 2FNOA 3M3MA 1XXUA 3O76A 4TR4A 2DJ0A 2VLTA 5ID2B 5G31A 5COHA 1TOFA 1M0UA 3TJGA 4OO4A 4MPGA 4ULXA 3H1NA 4O92A 2GQLA 3Q6OA 4K2DA 2VD0A 1PA3A 2I4AA 2L4QA 4ML6A 2TRXA 4MNNA 3ISOA 1VF1A 20GSA 3UJ1A 5E59A 4OWYA 3TDGA 2HNLA 1CQGA 2HI7A 5KN0A 3VLNA 3EU4A 4HOJA 5ECKB 1W4VA 3TKSE 3U5RE 3WT1A 2O7KA 4LL1B 1WWJA 1T7PB 1S3CA 3F4TA 1TRWA 2GSSA 2WZ9A 2VCTA 3CYNA 3TB2A 5KN3A 2IL3A 3FK8A 3TKSA 3IAS2 4FH8A 2JZSA 4KGIA 1QGVA 4JR4A 4K9ZA 3IE3A 3GX0A 3FZAA 3IK9A 2QA1A 2YNXA 3MIXA 5ENUA 4ZB6A 2L6DA 4K7NA 1TDIA 4HS1A 2GLRA 3BD2A 4NV2A 5IMAA 5DDLA 2MBSA 4F0BA 5KN2A 1VF4A 3ZMKA 4MH2A 4K5SA 5B7CA 4IP1A 1T3BA 5LL6V 4WF5A 2H74A 4E8EA 1K3OA 4X4JA 1G7EA 1F6MC 1GH2A 3TKQA 1ST9A 2DIZA 4MF5A 4KSOA 1YKAA 2GVPA 2CAQA 3EVIA 5DALA 4PUAA 2HRFA 3CSIA 5ECNB 1A24A 3EYTA 1J9BA 4Z7XA 1LU4A 5D8IA 4DEJA 2VL3A 4DVCA 2LNTA 4OCFA 3FZ5A 1JHBA 3WD6A 1SKSB 1XVQA 2VL2A 5EPFA 4LMVA 4I97A 1I5GA 4NPBA 3L9VA 3W6GA 1B4QA 3JCML 5L71A 1Z3EA 1KEBA 3HZ8A 3HDCA 1H75A 4I2TA 1B9YC 1Y6EA 3PGTA 4WEYA 2VIMA 1ML6A 1X9MB 2HLSA 3E3EA 3GL5A 2VM2A 2NPBA 2LJRA 1U87A 1TI1A 4MMMA 1PL2A 2HSMA 2RLIA 4ZB8A 5KOXA 1THXA 5ELGA 3U6VA 3NIVA 2DJ1A 1ZL9A 1SD8A 1PL1A 5JCUA 2DIYA 3GX8A 2DBCA 1WPIA 3SWLA 3GFKA 4O7HA 3K8NA 5J9BA 2H8LA 1SYRA 4HUAA 1GRXA 1XW5A 2CX4A 4J2FA 3RPPA 4WBJA 2FHEA 3F8UA 2RM6A 5CREA 2AB6A 3KTBA 2R0CA 4XS4A 3DRNA 2ZNMA 4QL7A 1SKRB 1ZYNA 5ECMB 2V41A 4K5RA 3A2VA 1QQ2A 3QMXA 4RI6A 4YAPA 5D9XA 3IV4A 4XIHA 1EZKA 1UVZA 1GSDA 5IMFA 2YOIA 4BVXA 1V2AA 4IELA 3US3A 3KMOA 1XWGA 3ZVJD 3GIXA 4F03A 1TI3A 1SD9A 3IAM2 2PVOC 3DD3A 3KH7A 2H70A 3FYGA 1M3IA 4YQUA 1HNBA 2ZUPA 4EIPA 1HQOA 4K8MA 2DJ2A 3F9UA 2IMDA 3H93A 4IVFA 1G7OA 3I6AA 3IXRA 2IFQA 5A4VA 4BIKA 3F0IA 1A2MA 2ZCTA 3VI5A 1GL8A 1TXXA 1V57A 5ID2A 1Z7PA 2HYXA 4HI7A 4FYUA 2HT9A 3IPZA 1XPVA 1UA5A 3HCZA 3EPTA 2MMOA 2LS5A 3I43A 5ECPB 4G2EA 4NV5A 2V6KA 3H4KA 2EIRA 3RHCA 5IT9I 1MD4A 4JR6A 3UL3A 4ISDA 3HVVA 1TRVA 1UC7A 2R0PA 3GHAA 3ME7A 1K0BA 1XCCA 1XWBA 2OADA 5JWOB 4KSMA 3HKRA 1TU7A 3KH9A 1ABAA 5IMDA 1NW2A 2HRAA 4RQXA 1SKWB 1M99A 2N5BA 4L5OA 5JCGA 2C4JA 4KW6A 4GXZA 5IQYA 1EGOA 1GLPA 4TN8A 2LJKA 3L0HA 1U6TA 4IQAA 2WFCA 3WGXA 2GZYA 4G9HA 3CXGA 2GGTA 2V32A 2MMZA 2R2JA 5G30A 3LXTA 2OKAA 4Q5RA 5DAKB 3HJOA 2HSHA 3LW9A 4K2XA 1PD21 4YQMA 3P2AA 3TRPA 3G7YA 2GT5A 2PERA 4V1Ap 3I9V2 2LEGA 1SL2B 3CSJA 2LUSA 1B4PA 3Q74A 5B6MA 2YV7A 4LMWA 1NSWA 5H5QA 2NDOA 2YJ7A 4F9ZA 5IO0A 4PURA 4YKFA 2LV3A 5G1LA 4G19A 1T4ZA 3LWAA 2XPDA 6GSWA 4GQFA 2P5QA 4PQHA 2LRCA 4JE1A 4EDYA 4Z2TA 3FRCA 3ZLPA 1OC9B 2GT6A 2FGXA 3L4NA 2B3SA 1X9WB 3FKFA 1O85A 3TKPA 5CRWA 1V40A 1WMJA 1Z6NA 1YDKA 3VWVA 1YF0A 4EDZA 4AF2A 2DMMA 2HFDA 2H19A 3BCIA 3DGQA 4TR3A 1TJDA 3BCKA 1XOBA 3DXBA 2CT6A 2O89A 2B1KA 1VRSD 2H72A 1E6BA 4ICYA 3J7Yb 4G10A 2ON5A 1XZOA 3J80I 4HDEA 4A5PA 3ZRDA 1GSYA 4POBA 5G1KA 2X64A 22GSA 1K0CA 5B6NA 3CQFA 4BVYB 1MD3A 2OA7A 2RIIA 3GSTA 5J3RA 2EIOA 2JADA 8GSSA 4GSNA 4MA9A 1W89A 3EMXA 4NHWA 4EE0A 5LNKe 5CRDA 2JU5A 2ON7A 1QMVA 2GS3A 3GN3A 1GULA 3HJMA 4K0NA 2L5OA 3UEMA 1AC1A 5DQSA 4IP6A 5ABRA 1S3DA 4IKHA 4O5UA 6GSSA 1TK0B 4X1UA 3UVHA 1U3IA 1WIKA 2WB9A 1AQXA 2X4AA 3LSZA 2I3YA 3IA1A 4KDXA 2JSZA 1ERTA 1GUKA 4Z2RA 1XBSA 4MABA 2VCXA 1HNAA 4EXJA 2N5FA 3CBUA 3TRQA 5H5RA 3VPQA 3IR4A 5LCZA 5HR3A 3QFBC 4ILFA 4ECJA 3FR9A 2CX3A 3QFAC 4X0XA 5C04A 1V58A 4POMA 5EL8A 5G2ZA 3KP8A 4AJ7A 4EL1A 1T4YA 4MJAA 4JU5A 1XOAA 2CV4A 3C7MA 1FO5A 2YN1A 1SJZA 2GTUA 5F0GA 4KA0A 2OE3A 2PN8A 2J9HA 4EO3A 1WOUA 1AW9A 1SK1A 5GAND 2KOKA 1ZMAA 1ZYQB 4I2UA 4TXVA 3RBTA 2K18A 4PQIA 1OC3A 4EKZA 1GTUA 4Q5NA 3GKMA 3PINA 4L8EA 3LJRA 5D73A 5AGYA 3M0FA 2KUCA 4MK3A 2NBSA 3P7XA 3ZL5A 4QL9A 2LKUA 1A0FA 3HZ4A 3J7Yk 1ZGNA 2PGTA 2FCHA 4K1FA 5IOWA 3MNGA 3D4MA 2OE1A 5KEJA 2GZPA 4XTSA 1AAZA 1F3AA 4YH2A 1T8EB 5DAKA 2O87A 2LJAA 1OE8A 4HJMA 5GSSA 3V1WA 2VAFA 2VCZA 1O8WA 1FVKA 4AJ6A 5AN1A 4N11A 2G0FA 2VOCA 1XWCA 1IYIA 14GSA 3LEFA 4IJIA 5INYA 2VCVA 4TXOB 1U88A 2IMIA 4D73B 2FWFA 2OBIA 1USBA 1MDIA 3A5WA 3VWWA 3QOUA 4FQUA 3EU3A 3ZIJA 3ZMLA 2F9SA 1EEJA 2QGVA 5DBQA 3BJ5A 2A2SA 4WKWA 2YV9A 1A0RP 3FZ4A 2KP2A 1G0TA 5D93A 2OE0A 1FB6A 1OC9A 2UZ8A 1ON4A 5A4UA 5G5FA 2H1BA 2I1UA 4RI7A 1J08A 3GTUB 5DCHA 3TJBA 2WS2A 5IPGA 2IMEA 2BTOT 4MLYA 5CNWA 3RAZA 3W8JA 4Z2UA 1SENA 2H01A 4DSRA 1MDJA 1OC8A 4MH3A 3KTLA 1H4OA 1XW6A 3GKKA 2PUKC 1TTZA 1BJXA 1S3RA 1AUCA 4KNDA 3HY2A 2H6XA 3MDKA 4MZCA 4YAVA 3M9JA 6GSUA 2L5LA 3SBCA 2VLUA 3FR3A 4IQ1A 4P3YB 4BVYA 5FLXI 1SK0A 5CYYA 2TIRA 2AHEA 5EY6A 1V98A 2MBTA 1JZOA 2DSAA 2XBIA 5KN1A 5CP1A 4F0CA 5JCWA 4KAEA 1ERVA 3L9SA 3CTGA 1O73A 1IYHA 4ZL7A 2L6CA 1A2JA 4KX4A 2DKHA 1FOHA 2YJHA 3ZFBA 13GSA 2L4CA 4I8BA 5F07A 2A2PA 2B1LA 4XS1A 11GSA 3C8EA 1BX9A 4N10A 1WE0A 1XW9A 4WR4A 1PX6A 1PRXA 3D21A 4YKGA 1SU9A 1RK4A 3FZ9A 2K9FA 2C0FA 4KDYA 1OAZA 1FW1A 5HFGA 4GSSA 5J4UA 4HU7A 5F06A 2MMAA 1XWAA 1BEDA 1PFOA 4ECIA 3DEXA 3LYKA 2CVDA 2HE3A 4EC0A 3QCPA 1VF2A 1A8YA 3C1RA 5E4WA 2ALBA 1X5CA 1SL0B 1OYJA 2H30A 2J23A 4PXOA 4OFTA 1JFUA 1PN9A 1Y25A 4WBRD 1R5PA 3UOMA 1TP9A 3F3RA 2P5RA 3J81I 4V2NA 3IOSA 5HFKA 2B7JA 5ECIB 3HD5A 1ERUA 4TR1B 2E7PA 4MZWA 3TKSC 3PR8A 4DSSB 2R6KA 1QXHA 2I81A 4JBBA 3LORA 4FYCA 2K6VA 1T00A 4ID0A 3VPTA 5AISA 4NHZA 3WYWA 3EWLA 2C8UA 4NMUA 5H5SA 1AIUA 2MZCA 5F05A 3GYKA 3TRXA 1EP8A 4ZL8A 5F8BA 1URMA 10GSA 1FVJA 1GUHA 2DMLA 2WRTA 3VI7A 2FA8A 3TCOA 3QAVA 5IPHA 3JAMI 2LNSA 3G9BA 3F3QA 4JEDA 3TJKA 2HZFA 1PKZA 2GSRA 2R5GA 3F4SA 3D6IA 1PSQA 3GH6A 4TXOA 2AUVA 2NTOA 4D73A 1Z6MA 3BBYA 3HVNA 4BA7A 2JSYA 1YEXA 4WR5A 3AY8A 3F6DA 3DMLA 3ZTLA 4PNFA 4ZBBA 4O5RA 4F82A 1K0AA 2VL2C 3IK7A 3KM6A 4MDCA 1JZRA 4J56E 4KE3A 2XC2A 1MDKA 4CY8A 1SYXA 3G7JA 1BYEA 2CZ2A 1ACVA 3Q18A 1K0OA 2GZZA 4WXTA 5D9TA 4MP4A 1NHOA 3GTUA 1M9AA 1X0RA 1TK5B 2IMKA 1E2YA 1SJIA 1DBYA 1BAYA 6GSVA 4L5LA 1BG5A 4WETA 5CRHA 4HJ2A 1EOGA 3HHVA 4IBPA 2GQKA 3WGEA 3APSA 4NAXA 1ZCPA 1TRUA 3LXZA 1PGTA 2OACA 1EV9A 2VD1A 5D9WA 2M72A 1GLQA 4Q5FA 2C0DA 2M46A 4G0IA 4NXIA 2H71A 4ZL9A 1EV4A 4FYBA 2C0EA 1DE2A 2PVQA 1HNCA 2AV4A 3ZVJA 1PKWA 1EP7A 2C0GA 3GL3A 2OBKA 3ZYWA 1K0DA 5DVBA 1FB0A 5GZZB 3EINA 4LLRA 1WJKA 3GV1A 5IO2A 1NHYA 1GSSA 1X5EA 2IMFA 4AJ8A 3GKXA 4GQCA 3A5IA 2B7KA 1M2AA 4EIQA 2CZ3A 2GSQA 4GTUA 2VM1A 4FO5A 3ERFA 2FWHA 2NVLA 4CHSA 2D2ZA 5FWGA 1A2LA 1Z7RA 4GCIA 9GSSA 3LYPA 4AGSA 1B9XC 4X43A 2B6MA 3KXOA 1BQ7A 2X8GA 5HR2A 5ECRB 2DJKA 2BMXA 3ZIVA 2EC4A 2HZEB 2A4VA 3LG6A 2P31A 2WGRA 1G6YA 2I9HA 1EGRA 2QC7A 2LQOA 2YZUA 4ZXGA 3M9KA 5G5EA 2VO4A 4TR1A 1TRSA 2RUFA 3IC4A 4IGJA 2L57A 4TW5A 3ZFLA 2OJLA 3WGDA 4EUYA 2IJYA 3HA9A 3KJYA 4WF4A 4DSSA 1EEMA 3GUSA 2CVBA 2H1DA 2H66A 3UMAA 1FG4A 3R2QA 2FWGA 2VUPA 3TGZA 4POKA 3VURA 1F3BA 5HR0A 4I6XA 3L78A 4OMVA 1TKDB 3H79A 5CO3A 1XIYA 5JWQB 4V2MA 3C1SA 1ERWA 4FIWA 4IW9A 1TU8A 1XFLA 1GTAA 3UVTA 4MZBA 1A23A 4HQSA 4TR0A 3GH9A 2VL9A 1XVWA 2A2RA 4OD7A 1K0MA 2Z9SA 4ECCA 4USSA 5D9VA 5ECQB 3HVSA 2CQ9A 3L9UA 1VGLA 12GSA 2CA8A 1XG8A 1VF3A 3KEBA 4K7IA 2O85A 1R4WA 3VK9A 1TK8B 3CRTA 3W8SA 5BRTA 3H8QA 3O6TA 1R5AA 3RHBA 1PQNA 3D0ZA 1Z9HA 2AJQB 2AYTA 4ZB9A 1GSFA 1XWKA 4K0GA 5B8BA 3E9JB 3DWVA 5HFIA 2G2QA 4IJ3A 4TRXA 4KDUA 3HYPA 3D4TA 3N5OA 3GNJA 5J5NA 3A3TA 2X49A 5KOWA 2HSYA 5ECOB 2BJXA 3GA4A 2GSTA 4HEA2 3IRAA 19GSA 4N0VA 3TUEA 2H6YA 5HR1A 3HVXA 1RQMA 4JRRA 3KGKA 4EF0A 2JACA 2YWNA 2P0GA 2REMA 2FY6A 2QKEA 1RW1A 5A5KA 5FT3A 3VWXA 2E0QA 5IMZA 1DUGA 3HJPA 4KB3A 3DVXA 3DVWA 2XPEA 3MAKA 4OO5A 3ME8A 2LSTA 3BOAA 1SK2A 2RUEA 4GRFA 5IIZA 4RQRA 3A2XA 3GSSA 3F63A
chains in the Genus database with same CATH topology
4ZBDA 4DSQA 5C00A 5DJLA 4H86A 1O7UA 2IN3A 1CQHA 1GUMA 2H0IA 2N5AA 2MYGA 5A4WA 2M80A 1YQ1A 2DJJA 4K6XA 1K3LA 2H73A 4BL7B 2O8VB 18GSA 2FWEA 1GWCA 4GF0A 5ECSA 3LQ7A 2C80A 1B8XA 3ZITA 2FA4A 5BMUA 3ERWA 2E2MA 2E2GA 4PTSA 4LA1A 2H0HA 2JZRA 1J0FA 3ZZXA 2C3NA 1K0NA 2V1MA 5ELAA 3RPNA 1GSEA 5ECHB 1UN2A 2B5XA 2C1YA 3LGCA 1JZWA 4GSTA 1KBNA 5IOXA 2PBJA 6GSXA 2IIYA 1NM3A 2WJUA 4O32A 3M1GA 4MJCA 5IM9A 2XHFA 1PMTA 4GLTA 2FUG2 1Q4JA 3UBLA 16GSA 2DLXA 3FR6A 2HZEA 4IN0A 7GSSA 2ES7A 6GSYA 4BPYA 2YCDA 5J41A 4ACSA 3QPMA 3GRXA 1ILOA 3IBHA 1HYUA 4ZILA 3NOFA 1I9DA 2TRCP 1SL1B 1O81A 3O3TA 3CTFA 1GSQA 3EE2A 5ECLB 1QK8A 3VWUA 2WDUA 1V9WA 3C71A 1AQVA 5FHIA 3TJJA 3A2WA 2PPTA 3MYDA 3FY7A 1X5DA 4IHUA 1Z5YE 1GNWA 3KD0A 4OCEA 2WULA 1GTBA 3HXSA 3VFIA 2YPMA 2R3XA 1O8XA 4V2LA 4PQ1A 4LL4B 3LFLA 2YWOA 2H1GA 2R4VA 3IHQA 1HD2A 4MF6A 3P8WA 1EOHA 4POLA 1YZXA 4OFMA 3E0UA 1M2BA 2C3QA 1ZYEA 2EIQA 4TVEA 1WP0A 3TOTA 3APOA 3QAGA 4G0LA 1O6JA 3Q19A 1ZYPA 2IPAA 3F6FA 4MF7A 4KCAA 1QFNA 1A8LA 2KHPA 5DJMA 3FHKA 17GSA 2AAWA 2VLVA 2LQQA 1FAAA 4TOPA 1SJ6A 3S9FA 3CSHA 3ZREA 2LRNA 5EVOA 4MPFA 1QUWA 4IS0A 2YP6A 3I69A 2RM5A 3FMWA 3EURA 2XBQA 4MJBA 3UIWA 4KF9A 4JZQA 1K3YA 2R0GA 2F8FA 1THOA 4XRDA 4ZBAA 4PX1A 5D96A 5GSTA 2FD3A 3G7IA 2HRNA 4J57E 3CRUA 2K8VA 2LTKA 4ML1A 4E8HA 1M9BA 3D5JA 4K7OA 3IHGA 1F2EA 4XHMA 2B5EA 4NWYA 3KCMA 1YJ6A 2B5YA 3TJFA 1M2DA 2YANA 1R7HA 4BWSA 1F37A 2YWMA 3APQA 3IDVA 1LBKA 3UAPA 3PPUA 4BL7A 4CW9A 1Q98A 2QA2A 1TW9A 3TOUA 4KUNA 1X9SB 1LJRA 4YQVA 4CY6A 5B8AA 2GQMA 2R37A 1DE1A 3NZNA 2HXKA 2F8AA 3M8NA 2CAIA 4HQZA 1OVNA 1T1VA 5AIVA 5DCGA 5IMCA 2PU9C 2VCQA 3UBKA 2X8CA 2DKIA 2F3MA 2YZHA 4Q5QA 5GAPD 3GMFA 2HRKA 2H75A 2A4HA 6GSTA 1JLVA 2V6OA 3KIJA 1FOVA 1YKCA 5LD0A 3F4RA 1G6WA 2DC5A 5DALB 3MSZA 4TKYA 1ZOFA 4XS6A 1C72A 4XRAA 5AIXA 3IC8A 2KP1A 2DJ3A 4ZIJA 3EMPA 2H0GA 5CRGA 3PH9A 2X99A 3KP9A 3R3EA 1N2AA 2H6ZA 4L0WA 1YEPA 3GKNA 3WT2A 1S3AA 4GWRA 1JLWA 5J9CA 4I5QA 1AQWA 3DKSA 1KNGA 3MWHA 3FW2A 4BWQA 2LRTA 3ED3A 4OFNA 1N8JA 3QR6A 3QD9A 2GDRA 1GSUA 1KTEA 1AXDA 4KH7A 3KMNA 1JZDA 2KLXA 1F9MA 1PN0A 4CDOA 3C73A 2PMTA 4F2IA 2K8SA 2MMNA 1MTCA 1GNEA 3N9JA 1OKTA 4KCEA 4HU9A 3ERGA 3CMIA 4HZ4A 1M7TA 1R26A 5JWRB 4PGTA 3FEUA 2H1AA 2YWIA 1WRYA 4XCSA 2QSIA 4XS4B 4HZ2A 5HQPA 1YY7A 2L59A 3P90A 4V1Ag 4L0UA 1YF1A 4EVMA 1GTIA 2JL4A 3GURA 1EWXA 2IWTA 4PNGA 1B48A 3EC3A 4PUFC 2H76A 2JZTA 3OR5A 5DQYA 1MEKA 3QAWA 4BVXB 2C3TA 3DYRA 4ECBA 2PWJA 4QQ7A 1FHEA 5IMVA 1ZZYA 1U3AA 3KZQA 2V2GA 1PX7A 4MJEA 1DSBA 2WCIA 2FLSA 1OKDA 1OE7A 2CVKA 3D22A 5CAXA 3QDNA 4O5QA 3DIEA 4N0ZA 2VCWA 3UARA 2X8HA 2IFQB 2F51A 1GP1A 4G0KA 4RUVA 3RDWA 4N30A 4MCUA 3TKRA 2FNOA 3M3MA 1XXUA 3O76A 4TR4A 2DJ0A 2VLTA 5ID2B 5G31A 5COHA 1TOFA 1M0UA 3TJGA 4OO4A 4MPGA 4ULXA 3H1NA 4O92A 2GQLA 3Q6OA 4K2DA 2VD0A 1PA3A 2I4AA 2L4QA 4ML6A 2TRXA 4MNNA 3ISOA 1VF1A 20GSA 3UJ1A 5E59A 4OWYA 3TDGA 2HNLA 1CQGA 2HI7A 5KN0A 3VLNA 3EU4A 4HOJA 5ECKB 1W4VA 3TKSE 3U5RE 3WT1A 2O7KA 4LL1B 1WWJA 1T7PB 1S3CA 3F4TA 1TRWA 2GSSA 2WZ9A 2VCTA 3CYNA 3TB2A 5KN3A 2IL3A 3FK8A 3TKSA 3IAS2 4FH8A 2JZSA 4KGIA 1QGVA 4JR4A 4K9ZA 3IE3A 3GX0A 3FZAA 3IK9A 2QA1A 2YNXA 3MIXA 5ENUA 4ZB6A 2L6DA 4K7NA 1TDIA 4HS1A 2GLRA 3BD2A 4NV2A 5IMAA 5DDLA 2MBSA 4F0BA 5KN2A 1VF4A 3ZMKA 4MH2A 4K5SA 5B7CA 4IP1A 1T3BA 4WF5A 2H74A 4E8EA 1K3OA 4X4JA 1G7EA 1F6MC 1GH2A 3TKQA 1ST9A 2DIZA 4MF5A 4KSOA 1YKAA 2GVPA 2CAQA 3EVIA 5DALA 4PUAA 2HRFA 3CSIA 5ECNB 1A24A 3EYTA 1J9BA 4Z7XA 1LU4A 5D8IA 4DEJA 2VL3A 4DVCA 2LNTA 4OCFA 3FZ5A 1JHBA 3WD6A 1SKSB 1XVQA 2VL2A 5EPFA 4LMVA 4I97A 1I5GA 4NPBA 3L9VA 3W6GA 1B4QA 3JCML 5L71A 1Z3EA 1KEBA 3HZ8A 3HDCA 1H75A 4I2TA 1B9YC 1Y6EA 3PGTA 4WEYA 2VIMA 1ML6A 1X9MB 2HLSA 3E3EA 3GL5A 2VM2A 2NPBA 2LJRA 1U87A 1TI1A 4MMMA 1PL2A 2HSMA 2RLIA 4ZB8A 5KOXA 1THXA 5ELGA 3U6VA 3NIVA 2DJ1A 1ZL9A 1SD8A 1PL1A 5JCUA 2DIYA 3GX8A 2DBCA 1WPIA 3SWLA 3GFKA 4O7HA 3K8NA 5J9BA 2H8LA 1SYRA 4HUAA 1GRXA 1XW5A 2CX4A 4J2FA 3RPPA 4WBJA 2FHEA 3F8UA 2RM6A 5CREA 2AB6A 3KTBA 2R0CA 4XS4A 3DRNA 2ZNMA 4QL7A 1SKRB 1ZYNA 5ECMB 2V41A 4K5RA 3A2VA 1QQ2A 3QMXA 4RI6A 4YAPA 5D9XA 3IV4A 4XIHA 1EZKA 1UVZA 1GSDA 5IMFA 2YOIA 4BVXA 1V2AA 4IELA 3US3A 3KMOA 1XWGA 3ZVJD 3GIXA 4F03A 1TI3A 1SD9A 3IAM2 2PVOC 3DD3A 3KH7A 2H70A 3FYGA 4YQUA 1HNBA 2ZUPA 4EIPA 1HQOA 4K8MA 2DJ2A 3F9UA 2IMDA 3H93A 4IVFA 1G7OA 3I6AA 3IXRA 2IFQA 5A4VA 3F0IA 1A2MA 2ZCTA 3VI5A 1GL8A 1TXXA 1V57A 5ID2A 1Z7PA 2HYXA 4HI7A 4FYUA 2HT9A 3IPZA 1XPVA 1UA5A 3HCZA 3EPTA 2MMOA 2LS5A 3I43A 5ECPB 4G2EA 4NV5A 2V6KA 3H4KA 2EIRA 3RHCA 1MD4A 4JR6A 3UL3A 4ISDA 3HVVA 1TRVA 1UC7A 2R0PA 3GHAA 3ME7A 1K0BA 1XCCA 1XWBA 2OADA 5JWOB 4KSMA 3HKRA 1TU7A 3KH9A 1ABAA 5IMDA 1NW2A 2HRAA 4RQXA 1SKWB 1M99A 2N5BA 4L5OA 5JCGA 2C4JA 4KW6A 4GXZA 5IQYA 1EGOA 1GLPA 4TN8A 2LJKA 3L0HA 1U6TA 4IQAA 2WFCA 3WGXA 2GZYA 4G9HA 3CXGA 2GGTA 2V32A 2MMZA 2R2JA 5G30A 3LXTA 2OKAA 4Q5RA 5DAKB 3HJOA 2HSHA 3LW9A 4K2XA 1PD21 4YQMA 3P2AA 3TRPA 3G7YA 2GT5A 2PERA 4V1Ap 3I9V2 2LEGA 1SL2B 3CSJA 2LUSA 1B4PA 3Q74A 5B6MA 2YV7A 4LMWA 1NSWA 5H5QA 2NDOA 2YJ7A 4F9ZA 5IO0A 4PURA 4YKFA 2LV3A 5G1LA 4G19A 1T4ZA 3LWAA 2XPDA 6GSWA 4GQFA 2P5QA 4PQHA 2LRCA 4JE1A 4EDYA 4Z2TA 3FRCA 3ZLPA 1OC9B 2GT6A 2FGXA 3L4NA 2B3SA 1X9WB 3FKFA 1O85A 3TKPA 5CRWA 1V40A 1WMJA 1Z6NA 1YDKA 3VWVA 1YF0A 4EDZA 4AF2A 2DMMA 2HFDA 2H19A 3BCIA 3DGQA 4TR3A 1TJDA 3BCKA 1XOBA 3DXBA 2CT6A 2O89A 2B1KA 1VRSD 2H72A 1E6BA 4ICYA 3J7Yb 4G10A 2ON5A 1XZOA 4HDEA 4A5PA 3ZRDA 1GSYA 4POBA 5G1KA 2X64A 22GSA 1K0CA 5B6NA 4BVYB 1MD3A 2OA7A 2RIIA 3GSTA 5J3RA 2EIOA 2JADA 8GSSA 4GSNA 4MA9A 1W89A 3EMXA 4NHWA 4EE0A 5LNKe 5CRDA 2JU5A 2ON7A 1QMVA 2GS3A 3GN3A 1GULA 3HJMA 4K0NA 2L5OA 3UEMA 1AC1A 5DQSA 4IP6A 5ABRA 1S3DA 4IKHA 4O5UA 6GSSA 1TK0B 4X1UA 3UVHA 1U3IA 1WIKA 2WB9A 1AQXA 2X4AA 3LSZA 2I3YA 3IA1A 4KDXA 2JSZA 1ERTA 1GUKA 4Z2RA 1XBSA 4MABA 2VCXA 1HNAA 4EXJA 2N5FA 3CBUA 3TRQA 5H5RA 3VPQA 3IR4A 5LCZA 5HR3A 3QFBC 4ILFA 4ECJA 3FR9A 2CX3A 3QFAC 4X0XA 5C04A 1V58A 4POMA 5EL8A 5G2ZA 3KP8A 4AJ7A 4EL1A 1T4YA 4MJAA 4JU5A 1XOAA 2CV4A 3C7MA 1FO5A 2YN1A 1SJZA 2GTUA 5F0GA 4KA0A 2OE3A 2PN8A 2J9HA 4EO3A 1WOUA 1AW9A 1SK1A 5GAND 2KOKA 1ZMAA 1ZYQB 4I2UA 4TXVA 3RBTA 2K18A 4PQIA 1OC3A 4EKZA 1GTUA 4Q5NA 3GKMA 3PINA 4L8EA 3LJRA 5D73A 5AGYA 3M0FA 2KUCA 4MK3A 2NBSA 3P7XA 3ZL5A 4QL9A 2LKUA 1A0FA 3HZ4A 3J7Yk 1ZGNA 2PGTA 2FCHA 4K1FA 5IOWA 3MNGA 3D4MA 2OE1A 5KEJA 2GZPA 4XTSA 1AAZA 1F3AA 4YH2A 1T8EB 5DAKA 2O87A 2LJAA 1OE8A 4HJMA 5GSSA 3V1WA 2VAFA 2VCZA 1O8WA 1FVKA 4AJ6A 5AN1A 4N11A 2G0FA 2VOCA 1XWCA 1IYIA 14GSA 3LEFA 4IJIA 5INYA 2VCVA 4TXOB 1U88A 2IMIA 4D73B 2FWFA 2OBIA 1USBA 1MDIA 3A5WA 3VWWA 3QOUA 4FQUA 3EU3A 3ZIJA 3ZMLA 2F9SA 1EEJA 2QGVA 5DBQA 3BJ5A 2A2SA 4WKWA 2YV9A 1A0RP 3FZ4A 2KP2A 1G0TA 5D93A 2OE0A 1FB6A 1OC9A 2UZ8A 1ON4A 5A4UA 5G5FA 2H1BA 2I1UA 4RI7A 1J08A 3GTUB 5DCHA 3TJBA 2WS2A 5IPGA 2IMEA 2BTOT 4MLYA 5CNWA 3RAZA 3W8JA 4Z2UA 1SENA 2H01A 4DSRA 1MDJA 1OC8A 4MH3A 3KTLA 1H4OA 1XW6A 3GKKA 2PUKC 1TTZA 1BJXA 1AUCA 4KNDA 3HY2A 2H6XA 3MDKA 4MZCA 4YAVA 3M9JA 6GSUA 2L5LA 3SBCA 2VLUA 3FR3A 4IQ1A 4P3YB 4BVYA 1SK0A 5CYYA 2TIRA 2AHEA 5EY6A 1V98A 2MBTA 1JZOA 2DSAA 2XBIA 5KN1A 5CP1A 4F0CA 5JCWA 4KAEA 1ERVA 3L9SA 3CTGA 1O73A 1IYHA 4ZL7A 2L6CA 1A2JA 4KX4A 2DKHA 1FOHA 2YJHA 3ZFBA 13GSA 2L4CA 4I8BA 5F07A 2A2PA 2B1LA 4XS1A 11GSA 3C8EA 1BX9A 4N10A 1WE0A 1XW9A 4WR4A 1PX6A 1PRXA 3D21A 4YKGA 1SU9A 1RK4A 3FZ9A 2K9FA 2C0FA 4KDYA 1OAZA 1FW1A 5HFGA 4GSSA 5J4UA 4HU7A 5F06A 2MMAA 1XWAA 1BEDA 4ECIA 3DEXA 3LYKA 2CVDA 2HE3A 4EC0A 3QCPA 1VF2A 1A8YA 3C1RA 5E4WA 2ALBA 1X5CA 1SL0B 1OYJA 2H30A 2J23A 4PXOA 4OFTA 1JFUA 1PN9A 1Y25A 4WBRD 1R5PA 3UOMA 1TP9A 3F3RA 2P5RA 4V2NA 3IOSA 5HFKA 2B7JA 5ECIB 3HD5A 1ERUA 4TR1B 2E7PA 4MZWA 3TKSC 3PR8A 4DSSB 2R6KA 1QXHA 2I81A 4JBBA 3LORA 4FYCA 2K6VA 1T00A 4ID0A 3VPTA 5AISA 4NHZA 3WYWA 3EWLA 2C8UA 4NMUA 5H5SA 1AIUA 2MZCA 5F05A 3GYKA 3TRXA 1EP8A 4ZL8A 5F8BA 1URMA 10GSA 1FVJA 1GUHA 2DMLA 2WRTA 3VI7A 2FA8A 3TCOA 3QAVA 5IPHA 2LNSA 3G9BA 3F3QA 4JEDA 3TJKA 2HZFA 1PKZA 2GSRA 2R5GA 3F4SA 3D6IA 1PSQA 3GH6A 4TXOA 2AUVA 2NTOA 4D73A 1Z6MA 3BBYA 4BA7A 2JSYA 1YEXA 4WR5A 3AY8A 3F6DA 3DMLA 3ZTLA 4PNFA 4ZBBA 4O5RA 4F82A 1K0AA 2VL2C 3IK7A 3KM6A 4MDCA 1JZRA 4J56E 4KE3A 2XC2A 1MDKA 4CY8A 1SYXA 3G7JA 1BYEA 2CZ2A 1ACVA 3Q18A 1K0OA 2GZZA 4WXTA 5D9TA 4MP4A 1NHOA 3GTUA 1M9AA 1X0RA 1TK5B 2IMKA 1E2YA 1SJIA 1DBYA 1BAYA 6GSVA 4L5LA 1BG5A 4WETA 5CRHA 4HJ2A 1EOGA 3HHVA 4IBPA 2GQKA 3WGEA 3APSA 4NAXA 1ZCPA 1TRUA 3LXZA 1PGTA 2OACA 1EV9A 2VD1A 5D9WA 2M72A 1GLQA 4Q5FA 2C0DA 2M46A 4G0IA 4NXIA 2H71A 4ZL9A 1EV4A 4FYBA 2C0EA 1DE2A 2PVQA 1HNCA 2AV4A 3ZVJA 1PKWA 1EP7A 2C0GA 3GL3A 2OBKA 3ZYWA 1K0DA 5DVBA 1FB0A 5GZZB 3EINA 4LLRA 1WJKA 3GV1A 5IO2A 1NHYA 1GSSA 1X5EA 2IMFA 4AJ8A 3GKXA 4GQCA 3A5IA 2B7KA 1M2AA 4EIQA 2CZ3A 2GSQA 4GTUA 2VM1A 4FO5A 3ERFA 2FWHA 2NVLA 4CHSA 2D2ZA 5FWGA 1A2LA 1Z7RA 4GCIA 9GSSA 3LYPA 4AGSA 1B9XC 4X43A 2B6MA 3KXOA 1BQ7A 2X8GA 5HR2A 5ECRB 2DJKA 2BMXA 3ZIVA 2EC4A 2HZEB 2A4VA 3LG6A 2P31A 2WGRA 1G6YA 2I9HA 1EGRA 2QC7A 2LQOA 2YZUA 4ZXGA 3M9KA 5G5EA 2VO4A 4TR1A 1TRSA 2RUFA 3IC4A 4IGJA 2L57A 4TW5A 3ZFLA 2OJLA 3WGDA 4EUYA 2IJYA 3HA9A 3KJYA 4WF4A 4DSSA 1EEMA 3GUSA 2CVBA 2H1DA 2H66A 3UMAA 1FG4A 3R2QA 2FWGA 2VUPA 3TGZA 4POKA 3VURA 1F3BA 5HR0A 4I6XA 3L78A 4OMVA 1TKDB 3H79A 5CO3A 1XIYA 5JWQB 4V2MA 3C1SA 1ERWA 4FIWA 4IW9A 1TU8A 1XFLA 1GTAA 3UVTA 4MZBA 1A23A 4HQSA 4TR0A 3GH9A 2VL9A 1XVWA 2A2RA 4OD7A 1K0MA 2Z9SA 4ECCA 4USSA 5D9VA 5ECQB 3HVSA 2CQ9A 3L9UA 1VGLA 12GSA 2CA8A 1VF3A 3KEBA 4K7IA 2O85A 1R4WA 3VK9A 1TK8B 3CRTA 3W8SA 5BRTA 3H8QA 3O6TA 1R5AA 3RHBA 1PQNA 3D0ZA 1Z9HA 2AJQB 2AYTA 4ZB9A 1GSFA 1XWKA 4K0GA 5B8BA 3E9JB 3DWVA 5HFIA 2G2QA 4IJ3A 4TRXA 4KDUA 3HYPA 3D4TA 3N5OA 3GNJA 5J5NA 3A3TA 2X49A 5KOWA 2HSYA 5ECOB 2BJXA 3GA4A 2GSTA 4HEA2 3IRAA 19GSA 4N0VA 3TUEA 2H6YA 5HR1A 3HVXA 1RQMA 4JRRA 3KGKA 4EF0A 2JACA 2YWNA 2P0GA 2REMA 2FY6A 2QKEA 1RW1A 5A5KA 5FT3A 3VWXA 2E0QA 5IMZA 1DUGA 3HJPA 4KB3A 3DVXA 3DVWA 2XPEA 3MAKA 4OO5A 3ME8A 2LSTA 3BOAA 1SK2A 2RUEA 4GRFA 5IIZA 4RQRA 3A2XA 3GSSA 3F63A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZBD A;  4DSQ A;  5C00 A;  5DJL A;  4H86 A;  1O7U A;  2IN3 A;  1CQH A;  1GUM A;  2H0I A;  2N5A A;  2MYG A;  5A4W A;  2M80 A;  1YQ1 A;  2DJJ A;  4K6X A;  1K3L A;  2H73 A;  2O8V B;  18GS A;  2FWE A;  1GWC A;  4GF0 A;  5ECS A;  3LQ7 A;  2C80 A;  1B8X A;  3ZIT A;  2FA4 A;  3ERW A;  2E2M A;  2E2G A;  4LA1 A;  2H0H A;  2JZR A;  1J0F A;  3ZZX A;  2C3N A;  1K0N A;  2V1M A;  5ELA A;  3RPN A;  1GSE A;  5ECH B;  1UN2 A;  2B5X A;  2C1Y A;  3LGC A;  1JZW A;  4GST A;  1KBN A;  5IOX A;  2PBJ A;  6GSX A;  2IIY A;  1NM3 A;  2WJU A;  4O32 A;  3M1G A;  4MJC A;  5IM9 A;  2XHF A;  1PMT A;  4GLT A;  2FUG 2;  1Q4J A;  3UBL A;  16GS A;  2DLX A;  3FR6 A;  2HZE A;  4IN0 A;  7GSS A;  2ES7 A;  6GSY A;  4BPY A;  2YCD A;  5J41 A;  4ACS A;  3QPM A;  3GRX A;  1ILO A;  3IBH A;  1HYU A;  4ZIL A;  3NOF A;  1I9D A;  2TRC P;  1SL1 B;  1O81 A;  3O3T A;  3CTF A;  1GSQ A;  3EE2 A;  5ECL B;  1QK8 A;  3VWU A;  2WDU A;  1V9W A;  3C71 A;  1AQV A;  5FHI A;  3TJJ A;  3A2W A;  2PPT A;  3FY7 A;  1X5D A;  4IHU A;  1Z5Y E;  1GNW A;  3KD0 A;  4OCE A;  2WUL A;  1GTB A;  3HXS A;  3VFI A;  2YPM A;  2R3X A;  1O8X A;  4V2L A;  4PQ1 A;  4LL4 B;  3LFL A;  2YWO A;  2H1G A;  2R4V A;  3IHQ A;  1HD2 A;  4MF6 A;  3P8W A;  1EOH A;  4POL A;  1YZX A;  4OFM A;  3E0U A;  1M2B A;  2C3Q A;  1ZYE A;  2EIQ A;  4TVE A;  1WP0 A;  3TOT A;  3APO A;  3QAG A;  1O6J A;  3Q19 A;  2IPA A;  3F6F A;  4MF7 A;  4KCA A;  1QFN A;  1A8L A;  2KHP A;  5DJM A;  3FHK A;  17GS A;  2AAW A;  2VLV A;  2LQQ A;  1FAA A;  4TOP A;  1SJ6 A;  3S9F A;  3CSH A;  3ZRE A;  2LRN A;  5EVO A;  4MPF A;  1QUW A;  4IS0 A;  2YP6 A;  3I69 A;  2RM5 A;  3EUR A;  2XBQ A;  4MJB A;  3UIW A;  4JZQ A;  1K3Y A;  2F8F A;  1THO A;  4XRD A;  4ZBA A;  4PX1 A;  5D96 A;  5GST A;  2FD3 A;  3G7I A;  2HRN A;  4J57 E;  3CRU A;  2K8V A;  2LTK A;  4ML1 A;  4E8H A;  1M9B A;  3D5J A;  4K7O A;  1F2E A;  4XHM A;  2B5E A;  4NWY A;  3KCM A;  1YJ6 A;  2B5Y A;  3TJF A;  1M2D A;  2YAN A;  1R7H A;  4BWS A;  1F37 A;  2YWM A;  3APQ A;  3IDV A;  1LBK A;  3UAP A;  4BL7 A;  4CW9 A;  1Q98 A;  1TW9 A;  3TOU A;  4KUN A;  1X9S B;  1LJR A;  4YQV A;  5B8A A;  2GQM A;  2R37 A;  1DE1 A;  3NZN A;  2HXK A;  2F8A A;  3M8N A;  2CAI A;  4HQZ A;  1OVN A;  1T1V A;  5AIV A;  5DCG A;  5IMC A;  2PU9 C;  2VCQ A;  3UBK A;  2X8C A;  2F3M A;  2YZH A;  4Q5Q A;  5GAP D;  3GMF A;  2H75 A;  6GST A;  1JLV A;  2V6O A;  3KIJ A;  1FOV A;  1YKC A;  5LD0 A;  3F4R A;  1G6W A;  2DC5 A;  5DAL B;  3MSZ A;  4TKY A;  1ZOF A;  4XS6 A;  1C72 A;  4XRA A;  5AIX A;  2KP1 A;  2DJ3 A;  4ZIJ A;  3EMP A;  2H0G A;  5CRG A;  3PH9 A;  2X99 A;  3KP9 A;  1N2A A;  2H6Z A;  4L0W A;  1YEP A;  3GKN A;  3WT2 A;  1S3A A;  4GWR A;  1JLW A;  5J9C A;  4I5Q A;  1AQW A;  3DKS A;  1KNG A;  3MWH A;  3FW2 A;  4BWQ A;  2LRT A;  3ED3 A;  4OFN A;  1N8J A;  3QR6 A;  3QD9 A;  2GDR A;  1GSU A;  1KTE A;  1AXD A;  4KH7 A;  3KMN A;  1JZD A;  2KLX A;  1F9M A;  4CDO A;  3C73 A;  2PMT A;  4F2I A;  2K8S A;  2MMN A;  1MTC A;  1GNE A;  3N9J A;  1OKT A;  4KCE A;  4HU9 A;  3ERG A;  3CMI A;  4HZ4 A;  1M7T A;  1R26 A;  5JWR B;  4PGT A;  3FEU A;  2H1A A;  2YWI A;  1WRY A;  4XCS A;  2QSI A;  4XS4 B;  4HZ2 A;  5HQP A;  1YY7 A;  2L59 A;  3P90 A;  4V1A g;  4L0U A;  1YF1 A;  4EVM A;  1GTI A;  2JL4 A;  3GUR A;  1EWX A;  2IWT A;  4PNG A;  1B48 A;  3EC3 A;  4PUF C;  2H76 A;  2JZT A;  3OR5 A;  5DQY A;  1MEK A;  3QAW A;  2C3T A;  3DYR A;  4ECB A;  2PWJ A;  4QQ7 A;  1FHE A;  5IMV A;  1ZZY A;  1U3A A;  3KZQ A;  2V2G A;  1PX7 A;  4MJE A;  1DSB A;  2WCI A;  2FLS A;  1OKD A;  1OE7 A;  2CVK A;  3D22 A;  5CAX A;  3QDN A;  3DIE A;  4N0Z A;  2VCW A;  3UAR A;  2X8H A;  2IFQ B;  2F51 A;  1GP1 A;  4RUV A;  3RDW A;  4N30 A;  4MCU A;  3TKR A;  2FNO A;  3M3M A;  1XXU A;  3O76 A;  4TR4 A;  2DJ0 A;  2VLT A;  5ID2 B;  5G31 A;  5COH A;  1TOF A;  1M0U A;  3TJG A;  4OO4 A;  4MPG A;  4ULX A;  3H1N A;  4O92 A;  2GQL A;  3Q6O A;  4K2D A;  2VD0 A;  1PA3 A;  2I4A A;  2L4Q A;  4ML6 A;  2TRX A;  3ISO A;  1VF1 A;  20GS A;  3UJ1 A;  5E59 A;  4OWY A;  3TDG A;  2HNL A;  1CQG A;  2HI7 A;  5KN0 A;  3VLN A;  3EU4 A;  4HOJ A;  5ECK B;  1W4V A;  3TKS E;  3U5R E;  3WT1 A;  2O7K A;  4LL1 B;  1WWJ A;  1T7P B;  1S3C A;  3F4T A;  1TRW A;  2GSS A;  2WZ9 A;  2VCT A;  3CYN A;  3TB2 A;  5KN3 A;  2IL3 A;  3FK8 A;  3TKS A;  3IAS 2;  4FH8 A;  2JZS A;  4KGI A;  1QGV A;  4JR4 A;  4K9Z A;  3IE3 A;  3GX0 A;  3FZA A;  3IK9 A;  2YNX A;  5ENU A;  4ZB6 A;  2L6D A;  4K7N A;  1TDI A;  4HS1 A;  2GLR A;  3BD2 A;  4NV2 A;  5IMA A;  5DDL A;  2MBS A;  4F0B A;  5KN2 A;  1VF4 A;  3ZMK A;  4MH2 A;  5B7C A;  4IP1 A;  1T3B A;  4WF5 A;  2H74 A;  4E8E A;  1K3O A;  1G7E A;  1F6M C;  1GH2 A;  3TKQ A;  1ST9 A;  2DIZ A;  4MF5 A;  4KSO A;  1YKA A;  2GVP A;  2CAQ A;  3EVI A;  5DAL A;  4PUA A;  2HRF A;  3CSI A;  5ECN B;  1A24 A;  3EYT A;  1J9B A;  4Z7X A;  1LU4 A;  5D8I A;  4DEJ A;  2VL3 A;  4DVC A;  2LNT A;  4OCF A;  3FZ5 A;  1JHB A;  3WD6 A;  1SKS B;  1XVQ A;  2VL2 A;  5EPF A;  4LMV A;  4I97 A;  1I5G A;  4NPB A;  3L9V A;  3W6G A;  1B4Q A;  3JCM L;  5L71 A;  1Z3E A;  1KEB A;  3HZ8 A;  3HDC A;  1H75 A;  4I2T A;  1B9Y C;  1Y6E A;  3PGT A;  4WEY A;  2VIM A;  1ML6 A;  1X9M B;  2HLS A;  3E3E A;  3GL5 A;  2VM2 A;  2NPB A;  2LJR A;  1U87 A;  1TI1 A;  4MMM A;  1PL2 A;  2RLI A;  4ZB8 A;  1THX A;  5ELG A;  3U6V A;  3NIV A;  2DJ1 A;  1ZL9 A;  1SD8 A;  1PL1 A;  5JCU A;  2DIY A;  3GX8 A;  2DBC A;  1WPI A;  3SWL A;  3GFK A;  4O7H A;  3K8N A;  5J9B A;  2H8L A;  1SYR A;  4HUA A;  1GRX A;  1XW5 A;  2CX4 A;  4J2F A;  3RPP A;  4WBJ A;  2FHE A;  3F8U A;  2RM6 A;  5CRE A;  2AB6 A;  3KTB A;  4XS4 A;  3DRN A;  2ZNM A;  4QL7 A;  1SKR B;  5ECM B;  2V41 A;  3A2V A;  1QQ2 A;  3QMX A;  4RI6 A;  4YAP A;  5D9X A;  3IV4 A;  4XIH A;  1EZK A;  1UVZ A;  1GSD A;  5IMF A;  2YOI A;  4BVX A;  1V2A A;  4IEL A;  3US3 A;  3KMO A;  1XWG A;  3ZVJ D;  3GIX A;  4F03 A;  1TI3 A;  1SD9 A;  3IAM 2;  2PVO C;  3DD3 A;  3KH7 A;  2H70 A;  3FYG A;  4YQU A;  1HNB A;  2ZUP A;  1HQO A;  4K8M A;  2DJ2 A;  3F9U A;  2IMD A;  3H93 A;  4IVF A;  1G7O A;  3I6A A;  3IXR A;  2IFQ A;  5A4V A;  3F0I A;  1A2M A;  2ZCT A;  3VI5 A;  1GL8 A;  1TXX A;  1V57 A;  5ID2 A;  1Z7P A;  2HYX A;  4HI7 A;  4FYU A;  2HT9 A;  3IPZ A;  1XPV A;  1UA5 A;  3HCZ A;  2MMO A;  2LS5 A;  3I43 A;  5ECP B;  4G2E A;  4NV5 A;  2V6K A;  3H4K A;  2EIR A;  3RHC A;  1MD4 A;  4JR6 A;  3UL3 A;  4ISD A;  3HVV A;  1TRV A;  1UC7 A;  3GHA A;  3ME7 A;  1K0B A;  1XCC A;  1XWB A;  2OAD A;  5JWO B;  4KSM A;  3HKR A;  1TU7 A;  3KH9 A;  1ABA A;  5IMD A;  1NW2 A;  4RQX A;  1SKW B;  1M99 A;  2N5B A;  4L5O A;  5JCG A;  2C4J A;  4KW6 A;  4GXZ A;  5IQY A;  1EGO A;  1GLP A;  4TN8 A;  2LJK A;  3L0H A;  1U6T A;  4IQA A;  2WFC A;  3WGX A;  2GZY A;  4G9H A;  3CXG A;  2GGT A;  2V32 A;  2MMZ A;  2R2J A;  5G30 A;  3LXT A;  2OKA A;  4Q5R A;  5DAK B;  3HJO A;  2HSH A;  1PD2 1;  4YQM A;  3P2A A;  3TRP A;  3G7Y A;  2GT5 A;  2PER A;  4V1A p;  3I9V 2;  2LEG A;  1SL2 B;  3CSJ A;  2LUS A;  1B4P A;  3Q74 A;  5B6M A;  2YV7 A;  4LMW A;  1NSW A;  5H5Q A;  2NDO A;  2YJ7 A;  4F9Z A;  5IO0 A;  4PUR A;  2LV3 A;  5G1L A;  4G19 A;  1T4Z A;  3LWA A;  2XPD A;  6GSW A;  4GQF A;  2P5Q A;  4PQH A;  2LRC A;  4JE1 A;  4EDY A;  3FRC A;  3ZLP A;  1OC9 B;  2GT6 A;  2FGX A;  3L4N A;  2B3S A;  1X9W B;  3FKF A;  1O85 A;  3TKP A;  5CRW A;  1V40 A;  1WMJ A;  1Z6N A;  1YDK A;  3VWV A;  1YF0 A;  4EDZ A;  4AF2 A;  2DMM A;  2HFD A;  2H19 A;  3BCI A;  3DGQ A;  4TR3 A;  1TJD A;  3BCK A;  1XOB A;  3DXB A;  2CT6 A;  2O89 A;  2B1K A;  1VRS D;  2H72 A;  1E6B A;  3J7Y b;  4G10 A;  2ON5 A;  1XZO A;  4HDE A;  3ZRD A;  1GSY A;  4POB A;  5G1K A;  2X64 A;  22GS A;  1K0C A;  5B6N A;  1MD3 A;  2OA7 A;  2RII A;  3GST A;  5J3R A;  2EIO A;  2JAD A;  8GSS A;  4GSN A;  4MA9 A;  1W89 A;  3EMX A;  4NHW A;  4EE0 A;  5LNK e;  5CRD A;  2JU5 A;  2ON7 A;  1QMV A;  2GS3 A;  3GN3 A;  1GUL A;  3HJM A;  4K0N A;  2L5O A;  3UEM A;  1AC1 A;  5DQS A;  4IP6 A;  5ABR A;  1S3D A;  4IKH A;  6GSS A;  1TK0 B;  4X1U A;  3UVH A;  1U3I A;  1WIK A;  2WB9 A;  1AQX A;  3LSZ A;  2I3Y A;  3IA1 A;  4KDX A;  2JSZ A;  1ERT A;  1GUK A;  1XBS A;  4MAB A;  2VCX A;  1HNA A;  4EXJ A;  2N5F A;  3CBU A;  3TRQ A;  5H5R A;  3VPQ A;  3IR4 A;  5LCZ A;  5HR3 A;  3QFB C;  4ILF A;  4ECJ A;  3FR9 A;  2CX3 A;  3QFA C;  4X0X A;  5C04 A;  1V58 A;  4POM A;  5EL8 A;  5G2Z A;  3KP8 A;  4AJ7 A;  4EL1 A;  1T4Y A;  4MJA A;  4JU5 A;  1XOA A;  2CV4 A;  3C7M A;  1FO5 A;  2YN1 A;  1SJZ A;  2GTU A;  5F0G A;  4KA0 A;  2OE3 A;  2PN8 A;  2J9H A;  4EO3 A;  1WOU A;  1AW9 A;  1SK1 A;  5GAN D;  2KOK A;  1ZMA A;  1ZYQ B;  4I2U A;  4TXV A;  3RBT A;  2K18 A;  4PQI A;  1OC3 A;  4EKZ A;  1GTU A;  4Q5N A;  3GKM A;  3PIN A;  4L8E A;  3LJR A;  5D73 A;  5AGY A;  3M0F A;  2KUC A;  4MK3 A;  2NBS A;  3P7X A;  3ZL5 A;  4QL9 A;  2LKU A;  1A0F A;  3HZ4 A;  3J7Y k;  1ZGN A;  2PGT A;  2FCH A;  4K1F A;  5IOW A;  3MNG A;  3D4M A;  2OE1 A;  5KEJ A;  2GZP A;  4XTS A;  1AAZ A;  1F3A A;  4YH2 A;  1T8E B;  5DAK A;  2O87 A;  2LJA A;  1OE8 A;  4HJM A;  5GSS A;  3V1W A;  2VAF A;  2VCZ A;  1O8W A;  1FVK A;  4AJ6 A;  5AN1 A;  4N11 A;  2G0F A;  2VOC A;  1XWC A;  1IYI A;  14GS A;  3LEF A;  4IJI A;  5INY A;  2VCV A;  4TXO B;  1U88 A;  2IMI A;  4D73 B;  2FWF A;  2OBI A;  1USB A;  1MDI A;  3A5W A;  3VWW A;  3QOU A;  3EU3 A;  3ZIJ A;  3ZML A;  2F9S A;  1EEJ A;  2QGV A;  5DBQ A;  3BJ5 A;  2A2S A;  4WKW A;  2YV9 A;  1A0R P;  3FZ4 A;  2KP2 A;  1G0T A;  5D93 A;  2OE0 A;  1FB6 A;  1OC9 A;  1ON4 A;  5A4U A;  5G5F A;  2H1B A;  2I1U A;  4RI7 A;  1J08 A;  3GTU B;  5DCH A;  3TJB A;  2WS2 A;  5IPG A;  2IME A;  2BTO T;  4MLY A;  5CNW A;  3RAZ A;  3W8J A;  1SEN A;  2H01 A;  4DSR A;  1MDJ A;  1OC8 A;  4MH3 A;  3KTL A;  1H4O A;  1XW6 A;  3GKK A;  2PUK C;  1TTZ A;  1BJX A;  1AUC A;  4KND A;  3HY2 A;  2H6X A;  3MDK A;  4MZC A;  4YAV A;  3M9J A;  6GSU A;  2L5L A;  3SBC A;  2VLU A;  3FR3 A;  4IQ1 A;  4P3Y B;  4BVY A;  1SK0 A;  5CYY A;  2TIR A;  2AHE A;  5EY6 A;  1V98 A;  2MBT A;  1JZO A;  2DSA A;  2XBI A;  5KN1 A;  5CP1 A;  4F0C A;  5JCW A;  4KAE A;  1ERV A;  3L9S A;  3CTG A;  1O73 A;  1IYH A;  4ZL7 A;  2L6C A;  1A2J A;  4KX4 A;  2YJH A;  3ZFB A;  13GS A;  2L4C A;  4I8B A;  5F07 A;  2B1L A;  4XS1 A;  11GS A;  3C8E A;  1BX9 A;  4N10 A;  1WE0 A;  1XW9 A;  4WR4 A;  1PX6 A;  1PRX A;  3D21 A;  1SU9 A;  1RK4 A;  3FZ9 A;  2K9F A;  2C0F A;  4KDY A;  1OAZ A;  1FW1 A;  5HFG A;  4GSS A;  5J4U A;  4HU7 A;  5F06 A;  2MMA A;  1XWA A;  1BED A;  4ECI A;  3DEX A;  3LYK A;  2CVD A;  2HE3 A;  4EC0 A;  3QCP A;  1VF2 A;  1A8Y A;  3C1R A;  5E4W A;  2ALB A;  1X5C A;  1SL0 B;  1OYJ A;  2H30 A;  2J23 A;  4PXO A;  4OFT A;  1JFU A;  1PN9 A;  1Y25 A;  4WBR D;  1R5P A;  3UOM A;  1TP9 A;  3F3R A;  2P5R A;  4V2N A;  3IOS A;  5HFK A;  2B7J A;  5ECI B;  3HD5 A;  1ERU A;  4TR1 B;  2E7P A;  4MZW A;  3TKS C;  3PR8 A;  4DSS B;  2R6K A;  1QXH A;  2I81 A;  4JBB A;  3LOR A;  4FYC A;  2K6V A;  1T00 A;  4ID0 A;  3VPT A;  5AIS A;  4NHZ A;  3WYW A;  3EWL A;  2C8U A;  4NMU A;  5H5S A;  1AIU A;  2MZC A;  5F05 A;  3GYK A;  3TRX A;  1EP8 A;  4ZL8 A;  5F8B A;  1URM A;  10GS A;  1FVJ A;  1GUH A;  2DML A;  2WRT A;  3VI7 A;  2FA8 A;  3TCO A;  3QAV A;  5IPH A;  2LNS A;  3G9B A;  3F3Q A;  4JED A;  3TJK A;  2HZF A;  1PKZ A;  2GSR A;  2R5G A;  3F4S A;  3D6I A;  1PSQ A;  3GH6 A;  4TXO A;  2AUV A;  2NTO A;  4D73 A;  1Z6M A;  3BBY A;  4BA7 A;  2JSY A;  1YEX A;  4WR5 A;  3AY8 A;  3F6D A;  3DML A;  3ZTL A;  4PNF A;  4ZBB A;  4O5R A;  4F82 A;  1K0A A;  2VL2 C;  3IK7 A;  3KM6 A;  4MDC A;  1JZR A;  4J56 E;  4KE3 A;  2XC2 A;  1MDK A;  1SYX A;  3G7J A;  1BYE A;  2CZ2 A;  1ACV A;  3Q18 A;  1K0O A;  2GZZ A;  4WXT A;  5D9T A;  4MP4 A;  1NHO A;  3GTU A;  1M9A A;  1X0R A;  1TK5 B;  2IMK A;  1E2Y A;  1SJI A;  1DBY A;  1BAY A;  6GSV A;  4L5L A;  1BG5 A;  4WET A;  5CRH A;  4HJ2 A;  1EOG A;  3HHV A;  4IBP A;  2GQK A;  3WGE A;  3APS A;  4NAX A;  1ZCP A;  1TRU A;  3LXZ A;  1PGT A;  2OAC A;  1EV9 A;  2VD1 A;  5D9W A;  2M72 A;  1GLQ A;  4Q5F A;  2C0D A;  2M46 A;  4NXI A;  2H71 A;  4ZL9 A;  1EV4 A;  4FYB A;  2C0E A;  1DE2 A;  2PVQ A;  1HNC A;  2AV4 A;  3ZVJ A;  1PKW A;  1EP7 A;  2C0G A;  3GL3 A;  2OBK A;  3ZYW A;  1K0D A;  5DVB A;  1FB0 A;  5GZZ B;  3EIN A;  4LLR A;  1WJK A;  3GV1 A;  5IO2 A;  1NHY A;  1GSS A;  1X5E A;  2IMF A;  4AJ8 A;  3GKX A;  4GQC A;  2B7K A;  1M2A A;  2CZ3 A;  2GSQ A;  4GTU A;  2VM1 A;  4FO5 A;  3ERF A;  2FWH A;  2NVL A;  4CHS A;  2D2Z A;  5FWG A;  1A2L A;  1Z7R A;  4GCI A;  9GSS A;  3LYP A;  4AGS A;  1B9X C;  4X43 A;  2B6M A;  3KXO A;  1BQ7 A;  2X8G A;  5HR2 A;  5ECR B;  2DJK A;  2BMX A;  3ZIV A;  2EC4 A;  2HZE B;  2A4V A;  3LG6 A;  2P31 A;  2WGR A;  1G6Y A;  2I9H A;  1EGR A;  2QC7 A;  2LQO A;  2YZU A;  4ZXG A;  3M9K A;  5G5E A;  2VO4 A;  4TR1 A;  1TRS A;  2RUF A;  3IC4 A;  4IGJ A;  2L57 A;  4TW5 A;  3ZFL A;  2OJL A;  3WGD A;  4EUY A;  2IJY A;  3HA9 A;  3KJY A;  4WF4 A;  4DSS A;  1EEM A;  3GUS A;  2CVB A;  2H1D A;  2H66 A;  3UMA A;  1FG4 A;  3R2Q A;  2FWG A;  2VUP A;  3TGZ A;  4POK A;  3VUR A;  1F3B A;  5HR0 A;  4I6X A;  3L78 A;  4OMV A;  1TKD B;  3H79 A;  5CO3 A;  1XIY A;  5JWQ B;  4V2M A;  3C1S A;  1ERW A;  4FIW A;  4IW9 A;  1TU8 A;  1XFL A;  1GTA A;  3UVT A;  4MZB A;  1A23 A;  4HQS A;  4TR0 A;  3GH9 A;  2VL9 A;  1XVW A;  2A2R A;  4OD7 A;  1K0M A;  2Z9S A;  4ECC A;  5D9V A;  5ECQ B;  3HVS A;  2CQ9 A;  3L9U A;  1VGL A;  12GS A;  2CA8 A;  1VF3 A;  3KEB A;  4K7I A;  2O85 A;  1R4W A;  3VK9 A;  1TK8 B;  3CRT A;  3W8S A;  3H8Q A;  3O6T A;  1R5A A;  3RHB A;  1PQN A;  3D0Z A;  1Z9H A;  2AJQ B;  2AYT A;  4ZB9 A;  1GSF A;  1XWK A;  4K0G A;  5B8B A;  3E9J B;  3DWV A;  5HFI A;  2G2Q A;  4IJ3 A;  4TRX A;  4KDU A;  3HYP A;  3D4T A;  3N5O A;  3GNJ A;  5J5N A;  3A3T A;  2HSY A;  5ECO B;  2BJX A;  3GA4 A;  2GST A;  4HEA 2;  3IRA A;  19GS A;  4N0V A;  3TUE A;  2H6Y A;  5HR1 A;  3HVX A;  1RQM A;  4JRR A;  3KGK A;  4EF0 A;  2JAC A;  2YWN A;  2P0G A;  2REM A;  2FY6 A;  2QKE A;  1RW1 A;  5A5K A;  5FT3 A;  3VWX A;  2E0Q A;  5IMZ A;  1DUG A;  3HJP A;  4KB3 A;  3DVX A;  3DVW A;  2XPE A;  3MAK A;  4OO5 A;  3ME8 A;  2LST A;  3BOA A;  1SK2 A;  2RUE A;  4GRF A;  5IIZ A;  4RQR A;  3A2X A;  3GSS A;  3F63 A; 
#chains in the Genus database with same CATH topology
 4ZBD A;  4DSQ A;  5C00 A;  5DJL A;  4H86 A;  1O7U A;  2IN3 A;  1CQH A;  1GUM A;  2H0I A;  2N5A A;  2MYG A;  5A4W A;  2M80 A;  1YQ1 A;  2DJJ A;  4K6X A;  1K3L A;  2H73 A;  4BL7 B;  2O8V B;  18GS A;  2FWE A;  1GWC A;  4GF0 A;  5ECS A;  3LQ7 A;  2C80 A;  1B8X A;  3ZIT A;  2FA4 A;  5BMU A;  3ERW A;  2E2M A;  2E2G A;  4PTS A;  4LA1 A;  2H0H A;  2JZR A;  1J0F A;  3ZZX A;  2C3N A;  1K0N A;  2V1M A;  5ELA A;  3RPN A;  1GSE A;  5ECH B;  1UN2 A;  2B5X A;  2C1Y A;  3LGC A;  1JZW A;  4GST A;  1KBN A;  5IOX A;  2PBJ A;  6GSX A;  2IIY A;  1NM3 A;  2WJU A;  4O32 A;  3M1G A;  4MJC A;  5IM9 A;  2XHF A;  1PMT A;  4GLT A;  2FUG 2;  1Q4J A;  3UBL A;  16GS A;  2DLX A;  3FR6 A;  2HZE A;  4IN0 A;  7GSS A;  2ES7 A;  6GSY A;  4BPY A;  2YCD A;  5J41 A;  4ACS A;  3QPM A;  3GRX A;  1ILO A;  3IBH A;  1HYU A;  4ZIL A;  3NOF A;  1I9D A;  2TRC P;  1SL1 B;  1O81 A;  3O3T A;  3CTF A;  1GSQ A;  3EE2 A;  5ECL B;  1QK8 A;  3VWU A;  2WDU A;  1V9W A;  3C71 A;  1AQV A;  5FHI A;  3TJJ A;  3A2W A;  2PPT A;  3MYD A;  3FY7 A;  1X5D A;  4IHU A;  1Z5Y E;  1GNW A;  3KD0 A;  4OCE A;  2WUL A;  1GTB A;  3HXS A;  3VFI A;  2YPM A;  2R3X A;  1O8X A;  4V2L A;  4PQ1 A;  4LL4 B;  3LFL A;  2YWO A;  2H1G A;  2R4V A;  3IHQ A;  1HD2 A;  4MF6 A;  3P8W A;  1EOH A;  4POL A;  1YZX A;  4OFM A;  3E0U A;  1M2B A;  2C3Q A;  1ZYE A;  2EIQ A;  4TVE A;  1WP0 A;  3TOT A;  3APO A;  3QAG A;  4G0L A;  1O6J A;  3Q19 A;  1ZYP A;  2IPA A;  3F6F A;  4MF7 A;  4KCA A;  1QFN A;  1A8L A;  2KHP A;  5DJM A;  3FHK A;  17GS A;  2AAW A;  2VLV A;  2LQQ A;  5A2Q I;  1FAA A;  4TOP A;  1SJ6 A;  3S9F A;  3CSH A;  3ZRE A;  2LRN A;  5EVO A;  4MPF A;  1QUW A;  4IS0 A;  2YP6 A;  3I69 A;  2RM5 A;  3FMW A;  3EUR A;  2XBQ A;  4MJB A;  3UIW A;  4HSC X;  4KF9 A;  4JZQ A;  1K3Y A;  2R0G A;  2F8F A;  1THO A;  4XRD A;  4ZBA A;  4PX1 A;  5D96 A;  5GST A;  2FD3 A;  3G7I A;  2HRN A;  4J57 E;  3CRU A;  2K8V A;  2LTK A;  4ML1 A;  4E8H A;  1M9B A;  3D5J A;  4K7O A;  3IHG A;  1F2E A;  4XHM A;  2B5E A;  4NWY A;  3KCM A;  1YJ6 A;  2B5Y A;  3TJF A;  1M2D A;  2YAN A;  1R7H A;  4BWS A;  1F37 A;  2YWM A;  3APQ A;  3IDV A;  1LBK A;  3UAP A;  3PPU A;  4BL7 A;  4CW9 A;  1Q98 A;  2QA2 A;  1TW9 A;  3TOU A;  4KUN A;  1X9S B;  1LJR A;  4YQV A;  4CY6 A;  5B8A A;  2GQM A;  2R37 A;  1DE1 A;  3NZN A;  2HXK A;  2F8A A;  3M8N A;  2CAI A;  4HQZ A;  1OVN A;  1T1V A;  5AIV A;  5DCG A;  5IMC A;  2PU9 C;  2VCQ A;  3UBK A;  2X8C A;  2DKI A;  2F3M A;  2YZH A;  4Q5Q A;  5GAP D;  3GMF A;  2HRK A;  2H75 A;  2A4H A;  6GST A;  1JLV A;  2V6O A;  3KIJ A;  1FOV A;  1YKC A;  5LD0 A;  3F4R A;  1G6W A;  2DC5 A;  5DAL B;  3MSZ A;  4TKY A;  1ZOF A;  4XS6 A;  1C72 A;  4XRA A;  5AIX A;  3IC8 A;  2KP1 A;  2DJ3 A;  4ZIJ A;  3EMP A;  2H0G A;  5CRG A;  3PH9 A;  2X99 A;  3KP9 A;  3R3E A;  1N2A A;  2H6Z A;  4L0W A;  1YEP A;  3GKN A;  3WT2 A;  1S3A A;  4GWR A;  1JLW A;  5J9C A;  4I5Q A;  1AQW A;  3DKS A;  1KNG A;  3MWH A;  3FW2 A;  4BWQ A;  2LRT A;  3ED3 A;  4OFN A;  1N8J A;  3QR6 A;  3QD9 A;  2GDR A;  1GSU A;  1KTE A;  1AXD A;  1M3J A;  4KH7 A;  3KMN A;  1JZD A;  2KLX A;  1F9M A;  1PN0 A;  4CDO A;  3C73 A;  2PMT A;  4F2I A;  2K8S A;  2MMN A;  1MTC A;  1GNE A;  3N9J A;  1OKT A;  4KCE A;  4HU9 A;  3ERG A;  3CMI A;  4HZ4 A;  1M7T A;  1R26 A;  5JWR B;  4PGT A;  3FEU A;  2H1A A;  2YWI A;  1WRY A;  4XCS A;  2QSI A;  4XS4 B;  4HZ2 A;  5HQP A;  1YY7 A;  2L59 A;  3P90 A;  4V1A g;  4L0U A;  1YF1 A;  4EVM A;  1GTI A;  2JL4 A;  3GUR A;  1EWX A;  2IWT A;  4PNG A;  1B48 A;  3EC3 A;  4PUF C;  2H76 A;  2JZT A;  3OR5 A;  5DQY A;  1MEK A;  3QAW A;  4BVX B;  2C3T A;  3DYR A;  4ECB A;  2PWJ A;  4QQ7 A;  1FHE A;  5IMV A;  1ZZY A;  1U3A A;  3KZQ A;  2V2G A;  1PX7 A;  4MJE A;  1DSB A;  2WCI A;  2FLS A;  1OKD A;  1OE7 A;  2CVK A;  3D22 A;  5CAX A;  3QDN A;  4O5Q A;  3DIE A;  4N0Z A;  2VCW A;  3UAR A;  2X8H A;  2IFQ B;  2F51 A;  1GP1 A;  4G0K A;  4RUV A;  3RDW A;  4N30 A;  4MCU A;  3TKR A;  2FNO A;  3M3M A;  1XXU A;  3O76 A;  4TR4 A;  2DJ0 A;  2VLT A;  5ID2 B;  5G31 A;  5COH A;  1TOF A;  1M0U A;  3TJG A;  4OO4 A;  4MPG A;  4ULX A;  3H1N A;  4O92 A;  2GQL A;  3Q6O A;  4K2D A;  2VD0 A;  1PA3 A;  2I4A A;  2L4Q A;  4ML6 A;  2TRX A;  4MNN A;  3ISO A;  1VF1 A;  20GS A;  3UJ1 A;  5E59 A;  4OWY A;  3TDG A;  2HNL A;  1CQG A;  2HI7 A;  5KN0 A;  3VLN A;  3EU4 A;  4HOJ A;  5ECK B;  1W4V A;  3TKS E;  3U5R E;  3WT1 A;  2O7K A;  4LL1 B;  1WWJ A;  1T7P B;  1S3C A;  3F4T A;  1TRW A;  2GSS A;  2WZ9 A;  2VCT A;  3CYN A;  3TB2 A;  5KN3 A;  2IL3 A;  3FK8 A;  3TKS A;  3IAS 2;  4FH8 A;  2JZS A;  4KGI A;  1QGV A;  4JR4 A;  4K9Z A;  3IE3 A;  3GX0 A;  3FZA A;  3IK9 A;  2QA1 A;  2YNX A;  3MIX A;  5ENU A;  4ZB6 A;  2L6D A;  4K7N A;  1TDI A;  4HS1 A;  2GLR A;  3BD2 A;  4NV2 A;  5IMA A;  5DDL A;  2MBS A;  4F0B A;  5KN2 A;  1VF4 A;  3ZMK A;  4MH2 A;  4K5S A;  5B7C A;  4IP1 A;  1T3B A;  5LL6 V;  4WF5 A;  2H74 A;  4E8E A;  1K3O A;  4X4J A;  1G7E A;  1F6M C;  1GH2 A;  3TKQ A;  1ST9 A;  2DIZ A;  4MF5 A;  4KSO A;  1YKA A;  2GVP A;  2CAQ A;  3EVI A;  5DAL A;  4PUA A;  2HRF A;  3CSI A;  5ECN B;  1A24 A;  3EYT A;  1J9B A;  4Z7X A;  1LU4 A;  5D8I A;  4DEJ A;  2VL3 A;  4DVC A;  2LNT A;  4OCF A;  3FZ5 A;  1JHB A;  3WD6 A;  1SKS B;  1XVQ A;  2VL2 A;  5EPF A;  4LMV A;  4I97 A;  1I5G A;  4NPB A;  3L9V A;  3W6G A;  1B4Q A;  3JCM L;  5L71 A;  1Z3E A;  1KEB A;  3HZ8 A;  3HDC A;  1H75 A;  4I2T A;  1B9Y C;  1Y6E A;  3PGT A;  4WEY A;  2VIM A;  1ML6 A;  1X9M B;  2HLS A;  3E3E A;  3GL5 A;  2VM2 A;  2NPB A;  2LJR A;  1U87 A;  1TI1 A;  4MMM A;  1PL2 A;  2HSM A;  2RLI A;  4ZB8 A;  5KOX A;  1THX A;  5ELG A;  3U6V A;  3NIV A;  2DJ1 A;  1ZL9 A;  1SD8 A;  1PL1 A;  5JCU A;  2DIY A;  3GX8 A;  2DBC A;  1WPI A;  3SWL A;  3GFK A;  4O7H A;  3K8N A;  5J9B A;  2H8L A;  1SYR A;  4HUA A;  1GRX A;  1XW5 A;  2CX4 A;  4J2F A;  3RPP A;  4WBJ A;  2FHE A;  3F8U A;  2RM6 A;  5CRE A;  2AB6 A;  3KTB A;  2R0C A;  4XS4 A;  3DRN A;  2ZNM A;  4QL7 A;  1SKR B;  1ZYN A;  5ECM B;  2V41 A;  4K5R A;  3A2V A;  1QQ2 A;  3QMX A;  4RI6 A;  4YAP A;  5D9X A;  3IV4 A;  4XIH A;  1EZK A;  1UVZ A;  1GSD A;  5IMF A;  2YOI A;  4BVX A;  1V2A A;  4IEL A;  3US3 A;  3KMO A;  1XWG A;  3ZVJ D;  3GIX A;  4F03 A;  1TI3 A;  1SD9 A;  3IAM 2;  2PVO C;  3DD3 A;  3KH7 A;  2H70 A;  3FYG A;  1M3I A;  4YQU A;  1HNB A;  2ZUP A;  4EIP A;  1HQO A;  4K8M A;  2DJ2 A;  3F9U A;  2IMD A;  3H93 A;  4IVF A;  1G7O A;  3I6A A;  3IXR A;  2IFQ A;  5A4V A;  4BIK A;  3F0I A;  1A2M A;  2ZCT A;  3VI5 A;  1GL8 A;  1TXX A;  1V57 A;  5ID2 A;  1Z7P A;  2HYX A;  4HI7 A;  4FYU A;  2HT9 A;  3IPZ A;  1XPV A;  1UA5 A;  3HCZ A;  3EPT A;  2MMO A;  2LS5 A;  3I43 A;  5ECP B;  4G2E A;  4NV5 A;  2V6K A;  3H4K A;  2EIR A;  3RHC A;  5IT9 I;  1MD4 A;  4JR6 A;  3UL3 A;  4ISD A;  3HVV A;  1TRV A;  1UC7 A;  2R0P A;  3GHA A;  3ME7 A;  1K0B A;  1XCC A;  1XWB A;  2OAD A;  5JWO B;  4KSM A;  3HKR A;  1TU7 A;  3KH9 A;  1ABA A;  5IMD A;  1NW2 A;  2HRA A;  4RQX A;  1SKW B;  1M99 A;  2N5B A;  4L5O A;  5JCG A;  2C4J A;  4KW6 A;  4GXZ A;  5IQY A;  1EGO A;  1GLP A;  4TN8 A;  2LJK A;  3L0H A;  1U6T A;  4IQA A;  2WFC A;  3WGX A;  2GZY A;  4G9H A;  3CXG A;  2GGT A;  2V32 A;  2MMZ A;  2R2J A;  5G30 A;  3LXT A;  2OKA A;  4Q5R A;  5DAK B;  3HJO A;  2HSH A;  3LW9 A;  4K2X A;  1PD2 1;  4YQM A;  3P2A A;  3TRP A;  3G7Y A;  2GT5 A;  2PER A;  4V1A p;  3I9V 2;  2LEG A;  1SL2 B;  3CSJ A;  2LUS A;  1B4P A;  3Q74 A;  5B6M A;  2YV7 A;  4LMW A;  1NSW A;  5H5Q A;  2NDO A;  2YJ7 A;  4F9Z A;  5IO0 A;  4PUR A;  4YKF A;  2LV3 A;  5G1L A;  4G19 A;  1T4Z A;  3LWA A;  2XPD A;  6GSW A;  4GQF A;  2P5Q A;  4PQH A;  2LRC A;  4JE1 A;  4EDY A;  4Z2T A;  3FRC A;  3ZLP A;  1OC9 B;  2GT6 A;  2FGX A;  3L4N A;  2B3S A;  1X9W B;  3FKF A;  1O85 A;  3TKP A;  5CRW A;  1V40 A;  1WMJ A;  1Z6N A;  1YDK A;  3VWV A;  1YF0 A;  4EDZ A;  4AF2 A;  2DMM A;  2HFD A;  2H19 A;  3BCI A;  3DGQ A;  4TR3 A;  1TJD A;  3BCK A;  1XOB A;  3DXB A;  2CT6 A;  2O89 A;  2B1K A;  1VRS D;  2H72 A;  1E6B A;  4ICY A;  3J7Y b;  4G10 A;  2ON5 A;  1XZO A;  3J80 I;  4HDE A;  4A5P A;  3ZRD A;  1GSY A;  4POB A;  5G1K A;  2X64 A;  22GS A;  1K0C A;  5B6N A;  3CQF A;  4BVY B;  1MD3 A;  2OA7 A;  2RII A;  3GST A;  5J3R A;  2EIO A;  2JAD A;  8GSS A;  4GSN A;  4MA9 A;  1W89 A;  3EMX A;  4NHW A;  4EE0 A;  5LNK e;  5CRD A;  2JU5 A;  2ON7 A;  1QMV A;  2GS3 A;  3GN3 A;  1GUL A;  3HJM A;  4K0N A;  2L5O A;  3UEM A;  1AC1 A;  5DQS A;  4IP6 A;  5ABR A;  1S3D A;  4IKH A;  4O5U A;  6GSS A;  1TK0 B;  4X1U A;  3UVH A;  1U3I A;  1WIK A;  2WB9 A;  1AQX A;  2X4A A;  3LSZ A;  2I3Y A;  3IA1 A;  4KDX A;  2JSZ A;  1ERT A;  1GUK A;  4Z2R A;  1XBS A;  4MAB A;  2VCX A;  1HNA A;  4EXJ A;  2N5F A;  3CBU A;  3TRQ A;  5H5R A;  3VPQ A;  3IR4 A;  5LCZ A;  5HR3 A;  3QFB C;  4ILF A;  4ECJ A;  3FR9 A;  2CX3 A;  3QFA C;  4X0X A;  5C04 A;  1V58 A;  4POM A;  5EL8 A;  5G2Z A;  3KP8 A;  4AJ7 A;  4EL1 A;  1T4Y A;  4MJA A;  4JU5 A;  1XOA A;  2CV4 A;  3C7M A;  1FO5 A;  2YN1 A;  1SJZ A;  2GTU A;  5F0G A;  4KA0 A;  2OE3 A;  2PN8 A;  2J9H A;  4EO3 A;  1WOU A;  1AW9 A;  1SK1 A;  5GAN D;  2KOK A;  1ZMA A;  1ZYQ B;  4I2U A;  4TXV A;  3RBT A;  2K18 A;  4PQI A;  1OC3 A;  4EKZ A;  1GTU A;  4Q5N A;  3GKM A;  3PIN A;  4L8E A;  3LJR A;  5D73 A;  5AGY A;  3M0F A;  2KUC A;  4MK3 A;  2NBS A;  3P7X A;  3ZL5 A;  4QL9 A;  2LKU A;  1A0F A;  3HZ4 A;  3J7Y k;  1ZGN A;  2PGT A;  2FCH A;  4K1F A;  5IOW A;  3MNG A;  3D4M A;  2OE1 A;  5KEJ A;  2GZP A;  4XTS A;  1AAZ A;  1F3A A;  4YH2 A;  1T8E B;  5DAK A;  2O87 A;  2LJA A;  1OE8 A;  4HJM A;  5GSS A;  3V1W A;  2VAF A;  2VCZ A;  1O8W A;  1FVK A;  4AJ6 A;  5AN1 A;  4N11 A;  2G0F A;  2VOC A;  1XWC A;  1IYI A;  14GS A;  3LEF A;  4IJI A;  5INY A;  2VCV A;  4TXO B;  1U88 A;  2IMI A;  4D73 B;  2FWF A;  2OBI A;  1USB A;  1MDI A;  3A5W A;  3VWW A;  3QOU A;  4FQU A;  3EU3 A;  3ZIJ A;  3ZML A;  2F9S A;  1EEJ A;  2QGV A;  5DBQ A;  3BJ5 A;  2A2S A;  4WKW A;  2YV9 A;  1A0R P;  3FZ4 A;  2KP2 A;  1G0T A;  5D93 A;  2OE0 A;  1FB6 A;  1OC9 A;  2UZ8 A;  1ON4 A;  5A4U A;  5G5F A;  2H1B A;  2I1U A;  4RI7 A;  1J08 A;  3GTU B;  5DCH A;  3TJB A;  2WS2 A;  5IPG A;  2IME A;  2BTO T;  4MLY A;  5CNW A;  3RAZ A;  3W8J A;  4Z2U A;  1SEN A;  2H01 A;  4DSR A;  1MDJ A;  1OC8 A;  4MH3 A;  3KTL A;  1H4O A;  1XW6 A;  3GKK A;  2PUK C;  1TTZ A;  1BJX A;  1S3R A;  1AUC A;  4KND A;  3HY2 A;  2H6X A;  3MDK A;  4MZC A;  4YAV A;  3M9J A;  6GSU A;  2L5L A;  3SBC A;  2VLU A;  3FR3 A;  4IQ1 A;  4P3Y B;  4BVY A;  5FLX I;  1SK0 A;  5CYY A;  2TIR A;  2AHE A;  5EY6 A;  1V98 A;  2MBT A;  1JZO A;  2DSA A;  2XBI A;  5KN1 A;  5CP1 A;  4F0C A;  5JCW A;  4KAE A;  1ERV A;  3L9S A;  3CTG A;  1O73 A;  1IYH A;  4ZL7 A;  2L6C A;  1A2J A;  4KX4 A;  2DKH A;  1FOH A;  2YJH A;  3ZFB A;  13GS A;  2L4C A;  4I8B A;  5F07 A;  2A2P A;  2B1L A;  4XS1 A;  11GS A;  3C8E A;  1BX9 A;  4N10 A;  1WE0 A;  1XW9 A;  4WR4 A;  1PX6 A;  1PRX A;  3D21 A;  4YKG A;  1SU9 A;  1RK4 A;  3FZ9 A;  2K9F A;  2C0F A;  4KDY A;  1OAZ A;  1FW1 A;  5HFG A;  4GSS A;  5J4U A;  4HU7 A;  5F06 A;  2MMA A;  1XWA A;  1BED A;  1PFO A;  4ECI A;  3DEX A;  3LYK A;  2CVD A;  2HE3 A;  4EC0 A;  3QCP A;  1VF2 A;  1A8Y A;  3C1R A;  5E4W A;  2ALB A;  1X5C A;  1SL0 B;  1OYJ A;  2H30 A;  2J23 A;  4PXO A;  4OFT A;  1JFU A;  1PN9 A;  1Y25 A;  4WBR D;  1R5P A;  3UOM A;  1TP9 A;  3F3R A;  2P5R A;  3J81 I;  4V2N A;  3IOS A;  5HFK A;  2B7J A;  5ECI B;  3HD5 A;  1ERU A;  4TR1 B;  2E7P A;  4MZW A;  3TKS C;  3PR8 A;  4DSS B;  2R6K A;  1QXH A;  2I81 A;  4JBB A;  3LOR A;  4FYC A;  2K6V A;  1T00 A;  4ID0 A;  3VPT A;  5AIS A;  4NHZ A;  3WYW A;  3EWL A;  2C8U A;  4NMU A;  5H5S A;  1AIU A;  2MZC A;  5F05 A;  3GYK A;  3TRX A;  1EP8 A;  4ZL8 A;  5F8B A;  1URM A;  10GS A;  1FVJ A;  1GUH A;  2DML A;  2WRT A;  3VI7 A;  2FA8 A;  3TCO A;  3QAV A;  5IPH A;  3JAM I;  2LNS A;  3G9B A;  3F3Q A;  4JED A;  3TJK A;  2HZF A;  1PKZ A;  2GSR A;  2R5G A;  3F4S A;  3D6I A;  1PSQ A;  3GH6 A;  4TXO A;  2AUV A;  2NTO A;  4D73 A;  1Z6M A;  3BBY A;  3HVN A;  4BA7 A;  2JSY A;  1YEX A;  4WR5 A;  3AY8 A;  3F6D A;  3DML A;  3ZTL A;  4PNF A;  4ZBB A;  4O5R A;  4F82 A;  1K0A A;  2VL2 C;  3IK7 A;  3KM6 A;  4MDC A;  1JZR A;  4J56 E;  4KE3 A;  2XC2 A;  1MDK A;  4CY8 A;  1SYX A;  3G7J A;  1BYE A;  2CZ2 A;  1ACV A;  3Q18 A;  1K0O A;  2GZZ A;  4WXT A;  5D9T A;  4MP4 A;  1NHO A;  3GTU A;  1M9A A;  1X0R A;  1TK5 B;  2IMK A;  1E2Y A;  1SJI A;  1DBY A;  1BAY A;  6GSV A;  4L5L A;  1BG5 A;  4WET A;  5CRH A;  4HJ2 A;  1EOG A;  3HHV A;  4IBP A;  2GQK A;  3WGE A;  3APS A;  4NAX A;  1ZCP A;  1TRU A;  3LXZ A;  1PGT A;  2OAC A;  1EV9 A;  2VD1 A;  5D9W A;  2M72 A;  1GLQ A;  4Q5F A;  2C0D A;  2M46 A;  4G0I A;  4NXI A;  2H71 A;  4ZL9 A;  1EV4 A;  4FYB A;  2C0E A;  1DE2 A;  2PVQ A;  1HNC A;  2AV4 A;  3ZVJ A;  1PKW A;  1EP7 A;  2C0G A;  3GL3 A;  2OBK A;  3ZYW A;  1K0D A;  5DVB A;  1FB0 A;  5GZZ B;  3EIN A;  4LLR A;  1WJK A;  3GV1 A;  5IO2 A;  1NHY A;  1GSS A;  1X5E A;  2IMF A;  4AJ8 A;  3GKX A;  4GQC A;  3A5I A;  2B7K A;  1M2A A;  4EIQ A;  2CZ3 A;  2GSQ A;  4GTU A;  2VM1 A;  4FO5 A;  3ERF A;  2FWH A;  2NVL A;  4CHS A;  2D2Z A;  5FWG A;  1A2L A;  1Z7R A;  4GCI A;  9GSS A;  3LYP A;  4AGS A;  1B9X C;  4X43 A;  2B6M A;  3KXO A;  1BQ7 A;  2X8G A;  5HR2 A;  5ECR B;  2DJK A;  2BMX A;  3ZIV A;  2EC4 A;  2HZE B;  2A4V A;  3LG6 A;  2P31 A;  2WGR A;  1G6Y A;  2I9H A;  1EGR A;  2QC7 A;  2LQO A;  2YZU A;  4ZXG A;  3M9K A;  5G5E A;  2VO4 A;  4TR1 A;  1TRS A;  2RUF A;  3IC4 A;  4IGJ A;  2L57 A;  4TW5 A;  3ZFL A;  2OJL A;  3WGD A;  4EUY A;  2IJY A;  3HA9 A;  3KJY A;  4WF4 A;  4DSS A;  1EEM A;  3GUS A;  2CVB A;  2H1D A;  2H66 A;  3UMA A;  1FG4 A;  3R2Q A;  2FWG A;  2VUP A;  3TGZ A;  4POK A;  3VUR A;  1F3B A;  5HR0 A;  4I6X A;  3L78 A;  4OMV A;  1TKD B;  3H79 A;  5CO3 A;  1XIY A;  5JWQ B;  4V2M A;  3C1S A;  1ERW A;  4FIW A;  4IW9 A;  1TU8 A;  1XFL A;  1GTA A;  3UVT A;  4MZB A;  1A23 A;  4HQS A;  4TR0 A;  3GH9 A;  2VL9 A;  1XVW A;  2A2R A;  4OD7 A;  1K0M A;  2Z9S A;  4ECC A;  4USS A;  5D9V A;  5ECQ B;  3HVS A;  2CQ9 A;  3L9U A;  1VGL A;  12GS A;  2CA8 A;  1XG8 A;  1VF3 A;  3KEB A;  4K7I A;  2O85 A;  1R4W A;  3VK9 A;  1TK8 B;  3CRT A;  3W8S A;  5BRT A;  3H8Q A;  3O6T A;  1R5A A;  3RHB A;  1PQN A;  3D0Z A;  1Z9H A;  2AJQ B;  2AYT A;  4ZB9 A;  1GSF A;  1XWK A;  4K0G A;  5B8B A;  3E9J B;  3DWV A;  5HFI A;  2G2Q A;  4IJ3 A;  4TRX A;  4KDU A;  3HYP A;  3D4T A;  3N5O A;  3GNJ A;  5J5N A;  3A3T A;  2X49 A;  5KOW A;  2HSY A;  5ECO B;  2BJX A;  3GA4 A;  2GST A;  4HEA 2;  3IRA A;  19GS A;  4N0V A;  3TUE A;  2H6Y A;  5HR1 A;  3HVX A;  1RQM A;  4JRR A;  3KGK A;  4EF0 A;  2JAC A;  2YWN A;  2P0G A;  2REM A;  2FY6 A;  2QKE A;  1RW1 A;  5A5K A;  5FT3 A;  3VWX A;  2E0Q A;  5IMZ A;  1DUG A;  3HJP A;  4KB3 A;  3DVX A;  3DVW A;  2XPE A;  3MAK A;  4OO5 A;  3ME8 A;  2LST A;  3BOA A;  1SK2 A;  2RUE A;  4GRF A;  5IIZ A;  4RQR A;  3A2X A;  3GSS A;  3F63 A; 
#chains in the Genus database with same CATH homology
 4ZBD A;  4DSQ A;  5C00 A;  5DJL A;  4H86 A;  1O7U A;  2IN3 A;  1CQH A;  1GUM A;  2H0I A;  2N5A A;  2MYG A;  5A4W A;  2M80 A;  1YQ1 A;  2DJJ A;  4K6X A;  1K3L A;  2H73 A;  4BL7 B;  2O8V B;  18GS A;  2FWE A;  1GWC A;  4GF0 A;  5ECS A;  3LQ7 A;  2C80 A;  1B8X A;  3ZIT A;  2FA4 A;  5BMU A;  3ERW A;  2E2M A;  2E2G A;  4PTS A;  4LA1 A;  2H0H A;  2JZR A;  1J0F A;  3ZZX A;  2C3N A;  1K0N A;  2V1M A;  5ELA A;  3RPN A;  1GSE A;  5ECH B;  1UN2 A;  2B5X A;  2C1Y A;  3LGC A;  1JZW A;  4GST A;  1KBN A;  5IOX A;  2PBJ A;  6GSX A;  2IIY A;  1NM3 A;  2WJU A;  4O32 A;  3M1G A;  4MJC A;  5IM9 A;  2XHF A;  1PMT A;  4GLT A;  2FUG 2;  1Q4J A;  3UBL A;  16GS A;  2DLX A;  3FR6 A;  2HZE A;  4IN0 A;  7GSS A;  2ES7 A;  6GSY A;  4BPY A;  2YCD A;  5J41 A;  4ACS A;  3QPM A;  3GRX A;  1ILO A;  3IBH A;  1HYU A;  4ZIL A;  3NOF A;  1I9D A;  2TRC P;  1SL1 B;  1O81 A;  3O3T A;  3CTF A;  1GSQ A;  3EE2 A;  5ECL B;  1QK8 A;  3VWU A;  2WDU A;  1V9W A;  3C71 A;  1AQV A;  5FHI A;  3TJJ A;  3A2W A;  2PPT A;  3MYD A;  3FY7 A;  1X5D A;  4IHU A;  1Z5Y E;  1GNW A;  3KD0 A;  4OCE A;  2WUL A;  1GTB A;  3HXS A;  3VFI A;  2YPM A;  2R3X A;  1O8X A;  4V2L A;  4PQ1 A;  4LL4 B;  3LFL A;  2YWO A;  2H1G A;  2R4V A;  3IHQ A;  1HD2 A;  4MF6 A;  3P8W A;  1EOH A;  4POL A;  1YZX A;  4OFM A;  3E0U A;  1M2B A;  2C3Q A;  1ZYE A;  2EIQ A;  4TVE A;  1WP0 A;  3TOT A;  3APO A;  3QAG A;  4G0L A;  1O6J A;  3Q19 A;  1ZYP A;  2IPA A;  3F6F A;  4MF7 A;  4KCA A;  1QFN A;  1A8L A;  2KHP A;  5DJM A;  3FHK A;  17GS A;  2AAW A;  2VLV A;  2LQQ A;  1FAA A;  4TOP A;  1SJ6 A;  3S9F A;  3CSH A;  3ZRE A;  2LRN A;  5EVO A;  4MPF A;  1QUW A;  4IS0 A;  2YP6 A;  3I69 A;  2RM5 A;  3FMW A;  3EUR A;  2XBQ A;  4MJB A;  3UIW A;  4KF9 A;  4JZQ A;  1K3Y A;  2R0G A;  2F8F A;  1THO A;  4XRD A;  4ZBA A;  4PX1 A;  5D96 A;  5GST A;  2FD3 A;  3G7I A;  2HRN A;  4J57 E;  3CRU A;  2K8V A;  2LTK A;  4ML1 A;  4E8H A;  1M9B A;  3D5J A;  4K7O A;  3IHG A;  1F2E A;  4XHM A;  2B5E A;  4NWY A;  3KCM A;  1YJ6 A;  2B5Y A;  3TJF A;  1M2D A;  2YAN A;  1R7H A;  4BWS A;  1F37 A;  2YWM A;  3APQ A;  3IDV A;  1LBK A;  3UAP A;  3PPU A;  4BL7 A;  4CW9 A;  1Q98 A;  2QA2 A;  1TW9 A;  3TOU A;  4KUN A;  1X9S B;  1LJR A;  4YQV A;  4CY6 A;  5B8A A;  2GQM A;  2R37 A;  1DE1 A;  3NZN A;  2HXK A;  2F8A A;  3M8N A;  2CAI A;  4HQZ A;  1OVN A;  1T1V A;  5AIV A;  5DCG A;  5IMC A;  2PU9 C;  2VCQ A;  3UBK A;  2X8C A;  2DKI A;  2F3M A;  2YZH A;  4Q5Q A;  5GAP D;  3GMF A;  2HRK A;  2H75 A;  2A4H A;  6GST A;  1JLV A;  2V6O A;  3KIJ A;  1FOV A;  1YKC A;  5LD0 A;  3F4R A;  1G6W A;  2DC5 A;  5DAL B;  3MSZ A;  4TKY A;  1ZOF A;  4XS6 A;  1C72 A;  4XRA A;  5AIX A;  3IC8 A;  2KP1 A;  2DJ3 A;  4ZIJ A;  3EMP A;  2H0G A;  5CRG A;  3PH9 A;  2X99 A;  3KP9 A;  3R3E A;  1N2A A;  2H6Z A;  4L0W A;  1YEP A;  3GKN A;  3WT2 A;  1S3A A;  4GWR A;  1JLW A;  5J9C A;  4I5Q A;  1AQW A;  3DKS A;  1KNG A;  3MWH A;  3FW2 A;  4BWQ A;  2LRT A;  3ED3 A;  4OFN A;  1N8J A;  3QR6 A;  3QD9 A;  2GDR A;  1GSU A;  1KTE A;  1AXD A;  4KH7 A;  3KMN A;  1JZD A;  2KLX A;  1F9M A;  1PN0 A;  4CDO A;  3C73 A;  2PMT A;  4F2I A;  2K8S A;  2MMN A;  1MTC A;  1GNE A;  3N9J A;  1OKT A;  4KCE A;  4HU9 A;  3ERG A;  3CMI A;  4HZ4 A;  1M7T A;  1R26 A;  5JWR B;  4PGT A;  3FEU A;  2H1A A;  2YWI A;  1WRY A;  4XCS A;  2QSI A;  4XS4 B;  4HZ2 A;  5HQP A;  1YY7 A;  2L59 A;  3P90 A;  4V1A g;  4L0U A;  1YF1 A;  4EVM A;  1GTI A;  2JL4 A;  3GUR A;  1EWX A;  2IWT A;  4PNG A;  1B48 A;  3EC3 A;  4PUF C;  2H76 A;  2JZT A;  3OR5 A;  5DQY A;  1MEK A;  3QAW A;  4BVX B;  2C3T A;  3DYR A;  4ECB A;  2PWJ A;  4QQ7 A;  1FHE A;  5IMV A;  1ZZY A;  1U3A A;  3KZQ A;  2V2G A;  1PX7 A;  4MJE A;  1DSB A;  2WCI A;  2FLS A;  1OKD A;  1OE7 A;  2CVK A;  3D22 A;  5CAX A;  3QDN A;  4O5Q A;  3DIE A;  4N0Z A;  2VCW A;  3UAR A;  2X8H A;  2IFQ B;  2F51 A;  1GP1 A;  4G0K A;  4RUV A;  3RDW A;  4N30 A;  4MCU A;  3TKR A;  2FNO A;  3M3M A;  1XXU A;  3O76 A;  4TR4 A;  2DJ0 A;  2VLT A;  5ID2 B;  5G31 A;  5COH A;  1TOF A;  1M0U A;  3TJG A;  4OO4 A;  4MPG A;  4ULX A;  3H1N A;  4O92 A;  2GQL A;  3Q6O A;  4K2D A;  2VD0 A;  1PA3 A;  2I4A A;  2L4Q A;  4ML6 A;  2TRX A;  4MNN A;  3ISO A;  1VF1 A;  20GS A;  3UJ1 A;  5E59 A;  4OWY A;  3TDG A;  2HNL A;  1CQG A;  2HI7 A;  5KN0 A;  3VLN A;  3EU4 A;  4HOJ A;  5ECK B;  1W4V A;  3TKS E;  3U5R E;  3WT1 A;  2O7K A;  4LL1 B;  1WWJ A;  1T7P B;  1S3C A;  3F4T A;  1TRW A;  2GSS A;  2WZ9 A;  2VCT A;  3CYN A;  3TB2 A;  5KN3 A;  2IL3 A;  3FK8 A;  3TKS A;  3IAS 2;  4FH8 A;  2JZS A;  4KGI A;  1QGV A;  4JR4 A;  4K9Z A;  3IE3 A;  3GX0 A;  3FZA A;  3IK9 A;  2QA1 A;  2YNX A;  3MIX A;  5ENU A;  4ZB6 A;  2L6D A;  4K7N A;  1TDI A;  4HS1 A;  2GLR A;  3BD2 A;  4NV2 A;  5IMA A;  5DDL A;  2MBS A;  4F0B A;  5KN2 A;  1VF4 A;  3ZMK A;  4MH2 A;  4K5S A;  5B7C A;  4IP1 A;  1T3B A;  4WF5 A;  2H74 A;  4E8E A;  1K3O A;  4X4J A;  1G7E A;  1F6M C;  1GH2 A;  3TKQ A;  1ST9 A;  2DIZ A;  4MF5 A;  4KSO A;  1YKA A;  2GVP A;  2CAQ A;  3EVI A;  5DAL A;  4PUA A;  2HRF A;  3CSI A;  5ECN B;  1A24 A;  3EYT A;  1J9B A;  4Z7X A;  1LU4 A;  5D8I A;  4DEJ A;  2VL3 A;  4DVC A;  2LNT A;  4OCF A;  3FZ5 A;  1JHB A;  3WD6 A;  1SKS B;  1XVQ A;  2VL2 A;  5EPF A;  4LMV A;  4I97 A;  1I5G A;  4NPB A;  3L9V A;  3W6G A;  1B4Q A;  3JCM L;  5L71 A;  1Z3E A;  1KEB A;  3HZ8 A;  3HDC A;  1H75 A;  4I2T A;  1B9Y C;  1Y6E A;  3PGT A;  4WEY A;  2VIM A;  1ML6 A;  1X9M B;  2HLS A;  3E3E A;  3GL5 A;  2VM2 A;  2NPB A;  2LJR A;  1U87 A;  1TI1 A;  4MMM A;  1PL2 A;  2HSM A;  2RLI A;  4ZB8 A;  5KOX A;  1THX A;  5ELG A;  3U6V A;  3NIV A;  2DJ1 A;  1ZL9 A;  1SD8 A;  1PL1 A;  5JCU A;  2DIY A;  3GX8 A;  2DBC A;  1WPI A;  3SWL A;  3GFK A;  4O7H A;  3K8N A;  5J9B A;  2H8L A;  1SYR A;  4HUA A;  1GRX A;  1XW5 A;  2CX4 A;  4J2F A;  3RPP A;  4WBJ A;  2FHE A;  3F8U A;  2RM6 A;  5CRE A;  2AB6 A;  3KTB A;  2R0C A;  4XS4 A;  3DRN A;  2ZNM A;  4QL7 A;  1SKR B;  1ZYN A;  5ECM B;  2V41 A;  4K5R A;  3A2V A;  1QQ2 A;  3QMX A;  4RI6 A;  4YAP A;  5D9X A;  3IV4 A;  4XIH A;  1EZK A;  1UVZ A;  1GSD A;  5IMF A;  2YOI A;  4BVX A;  1V2A A;  4IEL A;  3US3 A;  3KMO A;  1XWG A;  3ZVJ D;  3GIX A;  4F03 A;  1TI3 A;  1SD9 A;  3IAM 2;  2PVO C;  3DD3 A;  3KH7 A;  2H70 A;  3FYG A;  4YQU A;  1HNB A;  2ZUP A;  4EIP A;  1HQO A;  4K8M A;  2DJ2 A;  3F9U A;  2IMD A;  3H93 A;  4IVF A;  1G7O A;  3I6A A;  3IXR A;  2IFQ A;  5A4V A;  3F0I A;  1A2M A;  2ZCT A;  3VI5 A;  1GL8 A;  1TXX A;  1V57 A;  5ID2 A;  1Z7P A;  2HYX A;  4HI7 A;  4FYU A;  2HT9 A;  3IPZ A;  1XPV A;  1UA5 A;  3HCZ A;  3EPT A;  2MMO A;  2LS5 A;  3I43 A;  5ECP B;  4G2E A;  4NV5 A;  2V6K A;  3H4K A;  2EIR A;  3RHC A;  1MD4 A;  4JR6 A;  3UL3 A;  4ISD A;  3HVV A;  1TRV A;  1UC7 A;  2R0P A;  3GHA A;  3ME7 A;  1K0B A;  1XCC A;  1XWB A;  2OAD A;  5JWO B;  4KSM A;  3HKR A;  1TU7 A;  3KH9 A;  1ABA A;  5IMD A;  1NW2 A;  2HRA A;  4RQX A;  1SKW B;  1M99 A;  2N5B A;  4L5O A;  5JCG A;  2C4J A;  4KW6 A;  4GXZ A;  5IQY A;  1EGO A;  1GLP A;  4TN8 A;  2LJK A;  3L0H A;  1U6T A;  4IQA A;  2WFC A;  3WGX A;  2GZY A;  4G9H A;  3CXG A;  2GGT A;  2V32 A;  2MMZ A;  2R2J A;  5G30 A;  3LXT A;  2OKA A;  4Q5R A;  5DAK B;  3HJO A;  2HSH A;  3LW9 A;  4K2X A;  1PD2 1;  4YQM A;  3P2A A;  3TRP A;  3G7Y A;  2GT5 A;  2PER A;  4V1A p;  3I9V 2;  2LEG A;  1SL2 B;  3CSJ A;  2LUS A;  1B4P A;  3Q74 A;  5B6M A;  2YV7 A;  4LMW A;  1NSW A;  5H5Q A;  2NDO A;  2YJ7 A;  4F9Z A;  5IO0 A;  4PUR A;  4YKF A;  2LV3 A;  5G1L A;  4G19 A;  1T4Z A;  3LWA A;  2XPD A;  6GSW A;  4GQF A;  2P5Q A;  4PQH A;  2LRC A;  4JE1 A;  4EDY A;  4Z2T A;  3FRC A;  3ZLP A;  1OC9 B;  2GT6 A;  2FGX A;  3L4N A;  2B3S A;  1X9W B;  3FKF A;  1O85 A;  3TKP A;  5CRW A;  1V40 A;  1WMJ A;  1Z6N A;  1YDK A;  3VWV A;  1YF0 A;  4EDZ A;  4AF2 A;  2DMM A;  2HFD A;  2H19 A;  3BCI A;  3DGQ A;  4TR3 A;  1TJD A;  3BCK A;  1XOB A;  3DXB A;  2CT6 A;  2O89 A;  2B1K A;  1VRS D;  2H72 A;  1E6B A;  4ICY A;  3J7Y b;  4G10 A;  2ON5 A;  1XZO A;  4HDE A;  4A5P A;  3ZRD A;  1GSY A;  4POB A;  5G1K A;  2X64 A;  22GS A;  1K0C A;  5B6N A;  4BVY B;  1MD3 A;  2OA7 A;  2RII A;  3GST A;  5J3R A;  2EIO A;  2JAD A;  8GSS A;  4GSN A;  4MA9 A;  1W89 A;  3EMX A;  4NHW A;  4EE0 A;  5LNK e;  5CRD A;  2JU5 A;  2ON7 A;  1QMV A;  2GS3 A;  3GN3 A;  1GUL A;  3HJM A;  4K0N A;  2L5O A;  3UEM A;  1AC1 A;  5DQS A;  4IP6 A;  5ABR A;  1S3D A;  4IKH A;  4O5U A;  6GSS A;  1TK0 B;  4X1U A;  3UVH A;  1U3I A;  1WIK A;  2WB9 A;  1AQX A;  2X4A A;  3LSZ A;  2I3Y A;  3IA1 A;  4KDX A;  2JSZ A;  1ERT A;  1GUK A;  4Z2R A;  1XBS A;  4MAB A;  2VCX A;  1HNA A;  4EXJ A;  2N5F A;  3CBU A;  3TRQ A;  5H5R A;  3VPQ A;  3IR4 A;  5LCZ A;  5HR3 A;  3QFB C;  4ILF A;  4ECJ A;  3FR9 A;  2CX3 A;  3QFA C;  4X0X A;  5C04 A;  1V58 A;  4POM A;  5EL8 A;  5G2Z A;  3KP8 A;  4AJ7 A;  4EL1 A;  1T4Y A;  4MJA A;  4JU5 A;  1XOA A;  2CV4 A;  3C7M A;  1FO5 A;  2YN1 A;  1SJZ A;  2GTU A;  5F0G A;  4KA0 A;  2OE3 A;  2PN8 A;  2J9H A;  4EO3 A;  1WOU A;  1AW9 A;  1SK1 A;  5GAN D;  2KOK A;  1ZMA A;  1ZYQ B;  4I2U A;  4TXV A;  3RBT A;  2K18 A;  4PQI A;  1OC3 A;  4EKZ A;  1GTU A;  4Q5N A;  3GKM A;  3PIN A;  4L8E A;  3LJR A;  5D73 A;  5AGY A;  3M0F A;  2KUC A;  4MK3 A;  2NBS A;  3P7X A;  3ZL5 A;  4QL9 A;  2LKU A;  1A0F A;  3HZ4 A;  3J7Y k;  1ZGN A;  2PGT A;  2FCH A;  4K1F A;  5IOW A;  3MNG A;  3D4M A;  2OE1 A;  5KEJ A;  2GZP A;  4XTS A;  1AAZ A;  1F3A A;  4YH2 A;  1T8E B;  5DAK A;  2O87 A;  2LJA A;  1OE8 A;  4HJM A;  5GSS A;  3V1W A;  2VAF A;  2VCZ A;  1O8W A;  1FVK A;  4AJ6 A;  5AN1 A;  4N11 A;  2G0F A;  2VOC A;  1XWC A;  1IYI A;  14GS A;  3LEF A;  4IJI A;  5INY A;  2VCV A;  4TXO B;  1U88 A;  2IMI A;  4D73 B;  2FWF A;  2OBI A;  1USB A;  1MDI A;  3A5W A;  3VWW A;  3QOU A;  4FQU A;  3EU3 A;  3ZIJ A;  3ZML A;  2F9S A;  1EEJ A;  2QGV A;  5DBQ A;  3BJ5 A;  2A2S A;  4WKW A;  2YV9 A;  1A0R P;  3FZ4 A;  2KP2 A;  1G0T A;  5D93 A;  2OE0 A;  1FB6 A;  1OC9 A;  2UZ8 A;  1ON4 A;  5A4U A;  5G5F A;  2H1B A;  2I1U A;  4RI7 A;  1J08 A;  3GTU B;  5DCH A;  3TJB A;  2WS2 A;  5IPG A;  2IME A;  2BTO T;  4MLY A;  5CNW A;  3RAZ A;  3W8J A;  4Z2U A;  1SEN A;  2H01 A;  4DSR A;  1MDJ A;  1OC8 A;  4MH3 A;  3KTL A;  1H4O A;  1XW6 A;  3GKK A;  2PUK C;  1TTZ A;  1BJX A;  1AUC A;  4KND A;  3HY2 A;  2H6X A;  3MDK A;  4MZC A;  4YAV A;  3M9J A;  6GSU A;  2L5L A;  3SBC A;  2VLU A;  3FR3 A;  4IQ1 A;  4P3Y B;  4BVY A;  1SK0 A;  5CYY A;  2TIR A;  2AHE A;  5EY6 A;  1V98 A;  2MBT A;  1JZO A;  2DSA A;  2XBI A;  5KN1 A;  5CP1 A;  4F0C A;  5JCW A;  4KAE A;  1ERV A;  3L9S A;  3CTG A;  1O73 A;  1IYH A;  4ZL7 A;  2L6C A;  1A2J A;  4KX4 A;  2DKH A;  1FOH A;  2YJH A;  3ZFB A;  13GS A;  2L4C A;  4I8B A;  5F07 A;  2A2P A;  2B1L A;  4XS1 A;  11GS A;  3C8E A;  1BX9 A;  4N10 A;  1WE0 A;  1XW9 A;  4WR4 A;  1PX6 A;  1PRX A;  3D21 A;  4YKG A;  1SU9 A;  1RK4 A;  3FZ9 A;  2K9F A;  2C0F A;  4KDY A;  1OAZ A;  1FW1 A;  5HFG A;  4GSS A;  5J4U A;  4HU7 A;  5F06 A;  2MMA A;  1XWA A;  1BED A;  4ECI A;  3DEX A;  3LYK A;  2CVD A;  2HE3 A;  4EC0 A;  3QCP A;  1VF2 A;  1A8Y A;  3C1R A;  5E4W A;  2ALB A;  1X5C A;  1SL0 B;  1OYJ A;  2H30 A;  2J23 A;  4PXO A;  4OFT A;  1JFU A;  1PN9 A;  1Y25 A;  4WBR D;  1R5P A;  3UOM A;  1TP9 A;  3F3R A;  2P5R A;  4V2N A;  3IOS A;  5HFK A;  2B7J A;  5ECI B;  3HD5 A;  1ERU A;  4TR1 B;  2E7P A;  4MZW A;  3TKS C;  3PR8 A;  4DSS B;  2R6K A;  1QXH A;  2I81 A;  4JBB A;  3LOR A;  4FYC A;  2K6V A;  1T00 A;  4ID0 A;  3VPT A;  5AIS A;  4NHZ A;  3WYW A;  3EWL A;  2C8U A;  4NMU A;  5H5S A;  1AIU A;  2MZC A;  5F05 A;  3GYK A;  3TRX A;  1EP8 A;  4ZL8 A;  5F8B A;  1URM A;  10GS A;  1FVJ A;  1GUH A;  2DML A;  2WRT A;  3VI7 A;  2FA8 A;  3TCO A;  3QAV A;  5IPH A;  2LNS A;  3G9B A;  3F3Q A;  4JED A;  3TJK A;  2HZF A;  1PKZ A;  2GSR A;  2R5G A;  3F4S A;  3D6I A;  1PSQ A;  3GH6 A;  4TXO A;  2AUV A;  2NTO A;  4D73 A;  1Z6M A;  3BBY A;  4BA7 A;  2JSY A;  1YEX A;  4WR5 A;  3AY8 A;  3F6D A;  3DML A;  3ZTL A;  4PNF A;  4ZBB A;  4O5R A;  4F82 A;  1K0A A;  2VL2 C;  3IK7 A;  3KM6 A;  4MDC A;  1JZR A;  4J56 E;  4KE3 A;  2XC2 A;  1MDK A;  4CY8 A;  1SYX A;  3G7J A;  1BYE A;  2CZ2 A;  1ACV A;  3Q18 A;  1K0O A;  2GZZ A;  4WXT A;  5D9T A;  4MP4 A;  1NHO A;  3GTU A;  1M9A A;  1X0R A;  1TK5 B;  2IMK A;  1E2Y A;  1SJI A;  1DBY A;  1BAY A;  6GSV A;  4L5L A;  1BG5 A;  4WET A;  5CRH A;  4HJ2 A;  1EOG A;  3HHV A;  4IBP A;  2GQK A;  3WGE A;  3APS A;  4NAX A;  1ZCP A;  1TRU A;  3LXZ A;  1PGT A;  2OAC A;  1EV9 A;  2VD1 A;  5D9W A;  2M72 A;  1GLQ A;  4Q5F A;  2C0D A;  2M46 A;  4G0I A;  4NXI A;  2H71 A;  4ZL9 A;  1EV4 A;  4FYB A;  2C0E A;  1DE2 A;  2PVQ A;  1HNC A;  2AV4 A;  3ZVJ A;  1PKW A;  1EP7 A;  2C0G A;  3GL3 A;  2OBK A;  3ZYW A;  1K0D A;  5DVB A;  1FB0 A;  5GZZ B;  3EIN A;  4LLR A;  1WJK A;  3GV1 A;  5IO2 A;  1NHY A;  1GSS A;  1X5E A;  2IMF A;  4AJ8 A;  3GKX A;  4GQC A;  3A5I A;  2B7K A;  1M2A A;  4EIQ A;  2CZ3 A;  2GSQ A;  4GTU A;  2VM1 A;  4FO5 A;  3ERF A;  2FWH A;  2NVL A;  4CHS A;  2D2Z A;  5FWG A;  1A2L A;  1Z7R A;  4GCI A;  9GSS A;  3LYP A;  4AGS A;  1B9X C;  4X43 A;  2B6M A;  3KXO A;  1BQ7 A;  2X8G A;  5HR2 A;  5ECR B;  2DJK A;  2BMX A;  3ZIV A;  2EC4 A;  2HZE B;  2A4V A;  3LG6 A;  2P31 A;  2WGR A;  1G6Y A;  2I9H A;  1EGR A;  2QC7 A;  2LQO A;  2YZU A;  4ZXG A;  3M9K A;  5G5E A;  2VO4 A;  4TR1 A;  1TRS A;  2RUF A;  3IC4 A;  4IGJ A;  2L57 A;  4TW5 A;  3ZFL A;  2OJL A;  3WGD A;  4EUY A;  2IJY A;  3HA9 A;  3KJY A;  4WF4 A;  4DSS A;  1EEM A;  3GUS A;  2CVB A;  2H1D A;  2H66 A;  3UMA A;  1FG4 A;  3R2Q A;  2FWG A;  2VUP A;  3TGZ A;  4POK A;  3VUR A;  1F3B A;  5HR0 A;  4I6X A;  3L78 A;  4OMV A;  1TKD B;  3H79 A;  5CO3 A;  1XIY A;  5JWQ B;  4V2M A;  3C1S A;  1ERW A;  4FIW A;  4IW9 A;  1TU8 A;  1XFL A;  1GTA A;  3UVT A;  4MZB A;  1A23 A;  4HQS A;  4TR0 A;  3GH9 A;  2VL9 A;  1XVW A;  2A2R A;  4OD7 A;  1K0M A;  2Z9S A;  4ECC A;  4USS A;  5D9V A;  5ECQ B;  3HVS A;  2CQ9 A;  3L9U A;  1VGL A;  12GS A;  2CA8 A;  1VF3 A;  3KEB A;  4K7I A;  2O85 A;  1R4W A;  3VK9 A;  1TK8 B;  3CRT A;  3W8S A;  5BRT A;  3H8Q A;  3O6T A;  1R5A A;  3RHB A;  1PQN A;  3D0Z A;  1Z9H A;  2AJQ B;  2AYT A;  4ZB9 A;  1GSF A;  1XWK A;  4K0G A;  5B8B A;  3E9J B;  3DWV A;  5HFI A;  2G2Q A;  4IJ3 A;  4TRX A;  4KDU A;  3HYP A;  3D4T A;  3N5O A;  3GNJ A;  5J5N A;  3A3T A;  2X49 A;  5KOW A;  2HSY A;  5ECO B;  2BJX A;  3GA4 A;  2GST A;  4HEA 2;  3IRA A;  19GS A;  4N0V A;  3TUE A;  2H6Y A;  5HR1 A;  3HVX A;  1RQM A;  4JRR A;  3KGK A;  4EF0 A;  2JAC A;  2YWN A;  2P0G A;  2REM A;  2FY6 A;  2QKE A;  1RW1 A;  5A5K A;  5FT3 A;  3VWX A;  2E0Q A;  5IMZ A;  1DUG A;  3HJP A;  4KB3 A;  3DVX A;  3DVW A;  2XPE A;  3MAK A;  4OO5 A;  3ME8 A;  2LST A;  3BOA A;  1SK2 A;  2RUE A;  4GRF A;  5IIZ A;  4RQR A;  3A2X A;  3GSS A;  3F63 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...