3BCIA

Crystal structure of staphylococcus aureus dsba
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
165
structure length
165
Chain Sequence
GKPLVVVYGDYKCPYCKELDEKVMPKLRKNYIDNHKVEYQFVNLAFLGKDSIVGSRASHAVLMYAPKSFLDFQKQLFAAQQDENKEWLTKELLDKHIKQLHLDKETENKIIKDYKTKDSKSWKAAEKDKKIAKDNHIKTTPTAFINGEKVEDPYDYESYEKLLKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Disulfide bond protein A
publication title Staphylococcus aureus DsbA Does Not Have a Destabilizing Disulfide: A NEW PARADIGM FOR BACTERIAL OXIDATIVE FOLDING
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 62
structure length 165
sequence length 165
ec nomenclature
pdb deposition date 2007-11-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3bciA00
4FO5A 2MMNA 3FZAA 4RQXA 5CYYA 2H1GA 4O5RA 3DMLA 3UBKA 2B7JA 3GL5A 2J9HA 4Z7XA 11GSA 2HSHA 2I9HA 13GSA 2MBTA 4TRXA 5D9XA 3VI7A 5JCWA 1G6YA 2YV9A 5ECOB 3BCIA 3TOUA 2K18A 2H73A 2HXKA 1ML6A 3L78A 5KEJA 2TRXA 2GSRA 2L5OA 1XVQA 2LS5A 4MJAA 2FWFA 5IOWA 2HZFA 4IVFA 4NHZA 3KCMA 4XS6A 2FNOA 1GTIA 1K3LA 2F8FA 1B4QA 1F9MA 1SJ6A 2E2MA 1F3BA 12GSA 2IFQA 2IMIA 1DE2A 1I5GA 3VFIA 2A2SA 3IA1A 1MEKA 2P0GA 1GTAA 1U3AA 3TCOA 1O85A 1BQ7A 2WJUA 4WF4A 1O7UA 3FR9A 4KB3A 3WGDA 1GNEA 1A0FA 3NIVA 3CYNA 3FHKA 1JZOA 1V58A 4RQRA 3UMAA 1G6WA 3W8JA 2FA8A 1BEDA 1TRSA 5DVBA 4PNFA 3F6DA 4D73A 4EC0A 4I6XA 2GT5A 2H0IA 2H76A 4JU5A 2VO4A 1W4VA 3L4NA 1GSDA 1WJKA 3LYPA 2QC7A 2LJRA 1FAAA 3WT1A 2CVKA 4G19A 4JZQA 3TRXA 3D22A 1X5DA 4GCIA 2ZUPA 2DC5A 2CQ9A 1PA3A 1CQHA 4YAVA 2VCWA 5CRHA 5DQSA 4K6XA 2H19A 5IQYA 4Q5NA 4DSSB 4HS1A 3KH7A 2IMKA 4FYBA 2VL3A 1R5AA 4YH2A 1SD8A 1QGVA 1GRXA 3GN3A 2CX4A 2MMOA 1AC1A 1M7TA 1SKWB 2MMAA 3IHQA 3UVHA 3SBCA 3G7IA 2FGXA 2F3MA 1KTEA 1B9YC 1QUWA 1EP7A 3U5RE 5JCGA 1NSWA 4XS4A 4YQMA 2C1YA 4E8EA 20GSA 2V1MA 4OFNA 1VF1A 2B7KA 19GSA 1FG4A 2X99A 3KMNA 5G2ZA 2K9FA 2IN3A 3F3QA 1GWCA 1TI1A 1RK4A 4MH3A 5GSTA 1VGLA 4OO5A 1QFNA 1ILOA 1Z5YE 4OFTA 3GKNA 3E3EA 4G2EA 4V2NA 4AGSA 2ES7A 2HT9A 4BVXA 4ECJA 1DE1A 3L9UA 2CVBA 4GTUA 3KIJA 2VD0A 2H75A 5ECIB 1PKWA 4Q5RA 3H1NA 4WEYA 3TJFA 4D73B 3CBUA 1MDKA 2H1DA 2CVDA 1R5PA 3F6FA 2XBQA 9GSSA 2PVOC 3M8NA 4QL9A 3GSSA 2OADA 1K0CA 3GX0A 4TKYA 4XIHA 1TW9A 5D8IA 5IPHA 1GTUA 2TIRA 1PD21 4KA0A 5FWGA 1TTZA 3D5JA 1Z9HA 1M2DA 1OC9A 2YZUA 3A2WA 5ECMB 1ST9A 1TOFA 3CRUA 1SKRB 1OYJA 3F3RA 5JWQB 4NWYA 2BJXA 2ZCTA 4NV5A 4TN8A 1XW6A 3D0ZA 2CZ2A 2HSYA 3H79A 2EC4A 1Z6NA 2GQMA 1EP8A 3CTFA 3QCPA 1U88A 3EC3A 2OA7A 1B9XC 4PURA 5ECKB 4CDOA 4LLRA 3M3MA 4MF6A 4XS4B 2N5FA 2WCIA 1XW9A 2CT6A 2JL4A 1UC7A 3ZLPA 3HA9A 3QAGA 3KZQA 4MMMA 2AHEA 3QFBC 3DRNA 2X8HA 1XVWA 4PQIA 1VF4A 3TJJA 3LQ7A 1NM3A 2HLSA 1YKCA 1X5EA 4FIWA 5E59A 5B7CA 1YF1A 1WWJA 4QQ7A 5E4WA 3UJ1A 4KCEA 2FWEA 4POKA 4I2TA 3HYPA 1OE8A 4CHSA 2V32A 4ZL9A 3D21A 3VPQA 3DD3A 2XPDA 3ZL5A 3US3A 1TXXA 3HHVA 4IP1A 4I5QA 3TKPA 1ZCPA 4IKHA 4OD7A 4TOPA 2WFCA 3HXSA 4CW9A 5IIZA 1B48A 1QMVA 1EWXA 3G9BA 3IXRA 1OC9B 3ERWA 1F2EA 3IRAA 4WBJA 1HNBA 1H4OA 1OC8A 1TK0B 2JADA 2TRCP 3RAZA 3L9VA 3ZREA 2VLUA 1K0BA 3EU3A 3ZMLA 1IYIA 4K0GA 5HR1A 4MLYA 3MNGA 5HR2A 5AIVA 6GSYA 2IJYA 3NOFA 1E2YA 4NXIA 4TR0A 1V98A 2M72A 1SJIA 2VIMA 1EV4A 5JWRB 1FOVA 2GDRA 3LXZA 2E7PA 3TJKA 1B8XA 1EEMA 1XZOA 3QOUA 4HQSA 2WRTA 3F63A 2WULA 4L5OA 2C0FA 1AIUA 4MF5A 4ID0A 4TR4A 4LL1B 5IMCA 1WE0A 1MDIA 2K8VA 3GYKA 3VWXA 4MP4A 4FYUA 2B1KA 1Y6EA 6GSUA 3C8EA 2MBSA 2LNTA 3CSHA 3P8WA 2H66A 3IAS2 1DUGA 3M1GA 4X0XA 2OE3A 3GV1A 3Q18A 5F8BA 1NW2A 5F06A 5J9CA 1AQVA 1EZKA 5EVOA 4POMA 1WPIA 2RM5A 5FHIA 3EE2A 3KP8A 4HU7A 1ERUA 3FR3A 3LEFA 1VF3A 4POBA 2XC2A 5ECSA 1SYRA 2WB9A 3IC4A 2FHEA 3TB2A 3HJMA 3UIWA 3P7XA 3TGZA 5L71A 2CAQA 2YCDA 4KAEA 5D9VA 1YEXA 4HZ2A 5CRDA 3TKRA 2HI7A 4L5LA 2FLSA 5HR0A 4MCUA 5AISA 4HUAA 2REMA 1NHYA 1AAZA 2GZYA 4TR1A 3Q6OA 2VD1A 4HJ2A 5KN0A 1OVNA 1ZGNA 2EIQA 4GSTA 4AJ7A 5B6MA 4MDCA 4EE0A 1U87A 1GNWA 5DJLA 3EINA 1WOUA 1RQMA 3FR6A 3H8QA 2B1LA 3GTUA 2KHPA 1XBSA 2VAFA 4HQZA 1J9BA 1A2JA 8GSSA 17GSA 1B4PA 5KN3A 1Y25A 4O92A 6GSSA 2C8UA 4JRRA 2PUKC 1K0NA 4RI7A 2DLXA 2ON7A 2DJJA 4IGJA 3GURA 2L6CA 1K0AA 2F8AA 3L9SA 3ZVJD 1XOBA 5JCUA 1G7EA 1SKSB 4N0VA 2GGTA 2LQQA 3FRCA 3GA4A 3D4TA 3TUEA 2OBKA 4O32A 2H72A 2C4JA 5G31A 2YWNA 1YJ6A 3VLNA 4RUVA 4MJCA 3WGXA 5CO3A 5CREA 1QK8A 1TKDB 3F4RA 2H6XA 1JHBA 1O8WA 1FVJA 4L8EA 5CAXA 3R2QA 4V2MA 3EMXA 4ECBA 5EL8A 3VURA 1HQOA 2YPMA 3I43A 5B8AA 1GSFA 3W8SA 3P90A 1JZRA 1O6JA 1NHOA 3HY2A 2PGTA 2V6KA 4TR1B 2IWTA 1YF0A 1O73A 3EVIA 5G1LA 2YNXA 4KW6A 3F0IA 3TKQA 4YQUA 3IOSA 3IDVA 3HJPA 2FD3A 5HR3A 2HNLA 3JCML 3KH9A 1AXDA 1FB0A 4IS0A 4O7HA 5D9TA 3GTUB 3UEMA 4NV2A 4MA9A 1RW1A 1GSYA 1USBA 2VM1A 3IBHA 2DJ3A 1BX9A 1YY7A 2EIRA 1U3IA 4N0ZA 2DJ0A 2C80A 3MAKA 3BD2A 2B6MA 4KUNA 1EOHA 2GVPA 2CV4A 3PH9A 1CQGA 2GSTA 3HD5A 4GXZA 4POLA 2V2GA 3MDKA 3IR4A 3F9UA 3ZFBA 2ZNMA 4TVEA 2KP2A 1F37A 3I6AA 1N8JA 1K0DA 2JZTA 3TJGA 3UBLA 4BA7A 4MABA 1C72A 1A2MA 4H86A 3OR5A 4OCEA 3PR8A 2IMEA 1EEJA 1N2AA 1GLQA 1V40A 4Q5FA 2VCZA 5AGYA 1UN2A 5ECQB 2QKEA 5IMVA 4WF5A 2GT6A 2IFQB 3C71A 1J0FA 4IBPA 4ML6A 2YWIA 2LJKA 4XS1A 4AJ8A 5ELAA 5J4UA 2HYXA 3C1SA 2N5AA 3A2XA 1PSQA 1Q98A 2K6VA 2LNSA 1TK8B 3QPMA 2OKAA 4IQAA 2X8GA 3DIEA 1THXA 4OFMA 3GHAA 3QAWA 1M0UA 1PKZA 2H6ZA 2AV4A 2E2GA 3RBTA 1GUMA 4ZBDA 1VRSD 2R5GA 3ZIJA 3UVTA 2CAIA 2QSIA 4TW5A 4KSOA 4G9HA 3HZ4A 3GIXA 4MK3A 5GSSA 4IP6A 1JFUA 4TXOA 10GSA 3QAVA 2X64A 1A24A 2C3NA 2H01A 1WRYA 2IMDA 5DQYA 1FO5A 2NVLA 3EWLA 2LSTA 16GSA 3HVXA 4K1FA 2AUVA 2J23A 4EDZA 1R4WA 3ERFA 1X9SB 3CSIA 2LRNA 3QDNA 3A5WA 3LSZA 4TXVA 4WETA 1ZYQB 5CRGA 3VWUA 1A2LA 1G0TA 4EVMA 3FK8A 4NPBA 3RHCA 1HNCA 4J57E 2VLVA 1Z7RA 3IAM2 1GUKA 3BJ5A 4F9ZA 4I2UA 2B5XA 3MSZA 5IO2A 3KEBA 1WP0A 3EYTA 1X9WB 4MPGA 3LJRA 6GSWA 4KH7A 4DSRA 2L4CA 4GQFA 1Z7PA 4PGTA 5GZZB 2H0HA 5ECNB 5KN2A 4Q5QA 1X0RA 2GSQA 1XWAA 1SENA 5J3RA 1SK2A 4EDYA 2M80A 5COHA 4HEA2 4XRDA 2YWMA 4X43A 2O8VB 3CTGA 2FCHA 4XRAA 1GTBA 2PMTA 2C0EA 3RPNA 2YANA 2R3XA 4LMVA 7GSSA 3H93A 2C3QA 4OCFA 1T4ZA 2NPBA 4AF2A 2JSZA 1KEBA 2GQLA 4OMVA 3EU4A 3BCKA 4TXOB 2DBCA 1LJRA 1BYEA 2C0DA 1OAZA 2ALBA 4GWRA 4XHMA 1MDJA 2JU5A 1HYUA 1JLWA 3IK7A 2WDUA 4EUYA 2VUPA 5J5NA 3UL3A 1XPVA 2C3TA 4MJEA 1GUHA 4MZBA 1OKTA 4F03A 2WS2A 3ZVJA 1UA5A 3VPTA 3L0HA 2I1UA 3ME7A 5EPFA 3ZTLA 4ACSA 1AQWA 1ERVA 2E0QA 5D96A 6GSXA 2MYGA 1TRUA 2RM6A 5B6NA 2N5BA 3E0UA 2A4VA 3W6GA 3KJYA 3HVVA 4N11A 3TKSA 3LWAA 4IHUA 3TRQA 3ZYWA 1T8EB 2YWOA 2KLXA 5IO0A 1YQ1A 2LV3A 4JBBA 4ZBBA 5H5SA 3EMPA 5KN1A 3LFLA 1FW1A 2H1BA 1OC3A 2KOKA 1IYHA 4PXOA 4BVYA 4N30A 2FA4A 2V6OA 1S3CA 3DEXA 5ECHB 4PNGA 5ECRB 2LRTA 1Z3EA 2L57A 1BAYA 3CXGA 1AUCA 4ZBAA 2L59A 3ZMKA 1YZXA 3A2VA 2VCVA 2DMMA 2M46A 2LTKA 5B8BA 4ZILA 4HU9A 3DYRA 3D6IA 2K8SA 2GLRA 1XWKA 3KGKA 1ZOFA 5DBQA 2F9SA 1XIYA 4DVCA 1E6BA 4HOJA 3LG6A 4LMWA 3APQA 2H70A 4MZCA 5D73A 2FY6A 3H4KA 5C00A 5ABRA 2XHFA 1T3BA 2PERA 3G7JA 2A2RA 3KD0A 1XWCA 4WKWA 2H6YA 2YV7A 3I69A 3QMXA 4GF0A 5HFKA 4OO4A 5F05A 1TDIA 1JLVA 5HQPA 4DEJA 2GSSA 3K8NA 1W89A 3APOA 3E9JB 2B5EA 5G30A 1K0MA 5D93A 5D9WA 1X9MB 3VI5A 3TKSC 1WMJA 3HCZA 3HJOA 3UARA 1ZL9A 3KP9A 1FHEA 1O8XA 1J08A 3APSA 2ON5A 5A5KA 3DKSA 1HD2A 4BWQA 3PGTA 1T00A 2B5YA 4HJMA 4NAXA 2P31A 3VWVA 3FY7A 3GMFA 5A4WA 1K0OA 4KNDA 5DAKA 5F07A 2JSYA 3RHBA 2DJKA 4JR6A 14GSA 2DIYA 1SK0A 4K7OA 2AB6A 1JZWA 3ERGA 1XW5A 5DALA 1PN9A 1YKAA 3G7YA 3QR6A 3M9JA 2LRCA 1XOAA 1PX6A 4G10A 4ZXGA 4XCSA 4E8HA 1A8LA 3ZIVA 1KNGA 5DCGA 4ZIJA 1M9AA 2HRNA 4P3YB 4FYCA 2G0FA 1M9BA 2FUG2 2YJHA 4KE3A 4GQCA 4V1Ag 1XWGA 1OE7A 2IMFA 2OE1A 4YAPA 4IJ3A 3M9KA 3SWLA 4ZL8A 2VOCA 2DJ2A 3IK9A 3U6VA 4IW9A 5J41A 2LQOA 4ML1A 3UOMA 1LBKA 3FYGA 2R37A 2WGRA 1FB6A 2MMZA 3DWVA 1SL2B 2PVQA 1GULA 1SL0B 3AY8A 4K9ZA 2VM2A 3DGQA 1G7OA 1I9DA 5A4VA 2R4VA 1YDKA 1LU4A 1QQ2A 5IMDA 4PUAA 1TU7A 2I81A 3A3TA 4ZL7A 1K3YA 2QGVA 3CSJA 1OKDA 4X1UA 3GKMA 1TP9A 4ISDA 2YZHA 3C1RA 3TRPA 4ILFA 1SK1A 1XXUA 2OBIA 3ME8A 1PL2A 1HNAA 1U6TA 1KBNA 5DJMA 4KCAA 2MZCA 5CP1A 5DAKB 3Q19A 2AAWA 5ENUA 2L4QA 4EF0A 1SL1B 2VCXA 1DBYA 3D4MA 2VCTA 3J7Yk 2PN8A 5F0GA 4JEDA 3I9V2 5DALB 1Z6MA 2O7KA 1TRVA 4IELA 1FVKA 4BWSA 4HDEA 5AN1A 2RUEA 3CMIA 1EV9A 3GFKA 5FT3A 4TR3A 1PQNA 4EL1A 6GSVA 4DSQA 3FKFA 4ECCA 2CZ3A 5EY6A 1A0RP 4HI7A 2OE0A 1ZYEA 1AW9A 1Q4JA 5LCZA 2V41A 4YQVA 2I3YA 3DXBA 3GH9A 4BPYA 1SJZA 1EGRA 2BTOT 2FWGA 3VK9A 3BBYA 3F4TA 4GRFA 4GLTA 4ECIA 2IIYA 2H0GA 3GH6A 3IV4A 3GKKA 1MD4A 3EURA 4KDXA 3ZZXA 4QL7A 2FWHA 3KMOA 4PQ1A 2O87A 1ZMAA 3FZ9A 1K3OA 1TRWA 4EO3A 5G5FA 4IN0A 1ACVA 3QFAC 4K0NA 4ZB9A 4ZB6A 3TOTA 4K2DA 1YEPA 2IPAA 22GSA 1GSSA 2HRFA 3N5OA 1DSBA 2GS3A 2X8CA 3V1WA 2H74A 2C0GA 2PU9C 1VF2A 1JZDA 2OJLA 5INYA 1A8YA 5LNKe 4HZ4A 3HZ8A 2KP1A 4FH8A 1PMTA 4ULXA 3RPPA 4JE1A 3ZRDA 4EXJA 5G1KA 2PWJA 4KX4A 1PX7A 1ON4A 5ID2A 2I4AA 3LGCA 3CRTA 4F0CA 4K7NA 4L0UA 4MH2A 2G2QA 3GL3A 1URMA 2JZSA 1TU8A 3ZITA 2EIOA 1SU9A 3FZ5A 1R7HA 3TDGA 2DMLA 5DDLA 1QXHA 2HE3A 3KM6A 2LKUA 3M0FA 2YN1A 1WIKA 2NDOA 4NMUA 2YOIA 3GUSA 2L5LA 1PRXA 1XWBA 4F2IA 1T1VA 3FW2A 1GSQA 4I97A 2H8LA 1V57A 2CX3A 2L6DA 4BL7A 5LD0A 1X5CA 2H1AA 3WYWA 2LUSA 1M2BA 2B3SA 2NBSA 5CRWA 4I8BA 3TKSE 1XFLA 5IMAA 1GL8A 2XPEA 2KUCA 3ISOA 1GSUA 4J2FA 3BOAA 1TJDA 3NZNA 3LXTA 3HVSA 1TI3A 4JR4A 4V1Ap 2YP6A 4IQ1A 1O81A 2WZ9A 3Q74A 4F0BA 5GAND 2O85A 1XCCA 1M2AA 3VWWA 1H75A 1GP1A 5IOXA 3PINA 2GZPA 2IL3A 4LL4B 4KDYA 1V9WA 5IM9A 2R2JA 2RUFA 3LYKA 3J7Yb 4KSMA 3WT2A 1MTCA 1BG5A 3HKRA 1PGTA 2P5QA 2NTOA 1S3DA 4LA1A 2HZEA 1GSEA 4PUFC 2VL2A 2F51A 5ID2B 5DCHA 1UVZA 2BMXA 4RI6A 4V2LA 1TK5B 4K7IA 3KXOA 4J56E 4OWYA 4KDUA 1EGOA 2VCQA 5CNWA 3IE3A 3KTBA 3DVXA 3DVWA 3C73A 5ECLB 4IJIA 4WR4A 2O89A 2VLTA 3C7MA 3TJBA 1GLPA 4KGIA 1AQXA 2H30A 6GSTA 4WR5A 3FEUA 3KTLA 2DIZA 4XTSA 1F3AA 4MZWA 3S9FA 5H5RA 4WXTA 1BJXA 4NHWA 2GQKA 2YJ7A 5H5QA 5G5EA 2DJ1A 2D2ZA 1M99A 2LJAA 3QD9A 5AIXA 5IMZA 1V2AA 5ECPB 3ZFLA 3ED3A 1SD9A 1A23A 1R26A 4AJ6A 3IPZA 4MPFA 2XBIA 3WGEA 1PL1A 4MJBA 1GH2A 5JWOB 2CA8A 2PPTA 3N9JA 4N10A 4EKZA 4PQHA 2P5RA 3FZ4A 2HZEB 3F4SA 5IMFA 5HFIA 2R6KA 5A4UA 5IPGA 2GTUA 4K8MA 1T4YA 2VL2C 2GZZA 3MWHA 4PX1A 1EOGA 4MF7A 2RIIA 3HDCA 4F82A 3GX8A 4ZB8A 2PBJA 2JACA 3LORA 5HFGA 2JZRA 2RLIA 5ELGA 4GSNA 2DSAA 1ERWA 5J9BA 3GSTA 4GSSA 1MD3A 18GSA 1ERTA 1THOA 2OACA 1ABAA 1ZZYA 2H71A 3GRXA 3WD6A 2Z9SA 3F8UA 4WBRD 3UAPA 5C04A 5GAPD 3GNJA 3RDWA 4L0WA 2HFDA 1SYXA 1S3AA 2AJQB 3P2AA 2VL9A 1T7PB 3O3TA 2LEGA 2AYTA 3GKXA 3O76A 4DSSA 1F6MC 3O6TA
chains in the Genus database with same CATH superfamily
4FO5A 2MMNA 3FZAA 4RQXA 5CYYA 2H1GA 4O5RA 3DMLA 3UBKA 2B7JA 3GL5A 2J9HA 4Z7XA 11GSA 2HSHA 2I9HA 13GSA 2MBTA 4TRXA 5D9XA 3VI7A 5JCWA 1G6YA 2YV9A 5ECOB 3BCIA 3TOUA 2K18A 2H73A 2HXKA 1ML6A 3L78A 5KEJA 2TRXA 2GSRA 2L5OA 1XVQA 2LS5A 4MJAA 2FWFA 5IOWA 2HZFA 4IVFA 4NHZA 3KCMA 4XS6A 2FNOA 1GTIA 1K3LA 2F8FA 1B4QA 1F9MA 1SJ6A 2E2MA 1F3BA 12GSA 2IFQA 2IMIA 4O5QA 1DE2A 1I5GA 3VFIA 2A2SA 3IA1A 1MEKA 2P0GA 1GTAA 1U3AA 3TCOA 1O85A 1BQ7A 2WJUA 4WF4A 1O7UA 3FR9A 5BMUA 4KB3A 3WGDA 1GNEA 1A0FA 3NIVA 3CYNA 3FHKA 1JZOA 1V58A 4RQRA 3UMAA 1G6WA 3W8JA 2FA8A 1BEDA 1TRSA 5DVBA 4PNFA 3F6DA 4D73A 4EC0A 4I6XA 2GT5A 2H0IA 2H76A 4JU5A 2VO4A 1W4VA 3L4NA 2A2PA 1GSDA 1WJKA 3LYPA 2QC7A 2LJRA 1FAAA 3WT1A 2CVKA 4G19A 4JZQA 3TRXA 3D22A 1X5DA 4GCIA 2ZUPA 2DC5A 2CQ9A 1PA3A 1CQHA 4YAVA 2VCWA 5CRHA 5DQSA 4K6XA 2H19A 5IQYA 4Q5NA 4DSSB 4HS1A 3KH7A 2IMKA 4FYBA 2VL3A 1R5AA 4YH2A 3FMWA 1SD8A 1QGVA 1GRXA 3GN3A 2CX4A 2MMOA 1AC1A 1M7TA 1SKWB 2MMAA 3IHQA 3UVHA 3SBCA 3G7IA 2FGXA 2F3MA 1KTEA 1B9YC 1QUWA 1EP7A 3HVNA 3U5RE 5JCGA 1NSWA 4XS4A 4YQMA 2C1YA 4E8EA 20GSA 2V1MA 4OFNA 1VF1A 2B7KA 19GSA 1FG4A 2X99A 3KMNA 5G2ZA 2K9FA 4K5RA 2IN3A 3F3QA 1GWCA 1TI1A 1RK4A 4MH3A 5GSTA 1VGLA 4OO5A 1QFNA 1ILOA 1Z5YE 4OFTA 3GKNA 3E3EA 4G2EA 4V2NA 4AGSA 2ES7A 2HT9A 4BVXA 4ECJA 1DE1A 3L9UA 2CVBA 4GTUA 3KIJA 2VD0A 2H75A 5ECIB 4MNNA 1PKWA 4Q5RA 3H1NA 4WEYA 3TJFA 4D73B 3CBUA 1MDKA 2H1DA 2CVDA 1R5PA 3F6FA 2XBQA 9GSSA 2PVOC 3M8NA 4QL9A 3GSSA 2OADA 1K0CA 1ZYNA 3GX0A 4TKYA 4XIHA 1TW9A 5D8IA 5IPHA 1GTUA 2TIRA 1PD21 4KA0A 5FWGA 1TTZA 3D5JA 1Z9HA 1M2DA 1OC9A 2YZUA 3A2WA 5ECMB 1ST9A 1TOFA 3CRUA 1SKRB 1OYJA 3F3RA 5JWQB 4NWYA 2BJXA 2ZCTA 4NV5A 4TN8A 1XW6A 3D0ZA 2CZ2A 2HSYA 3H79A 2EC4A 1Z6NA 2GQMA 1EP8A 3CTFA 3QCPA 1U88A 3EC3A 2OA7A 1B9XC 4PURA 5ECKB 4CDOA 4LLRA 3M3MA 4MF6A 4XS4B 2N5FA 2WCIA 1XW9A 2CT6A 2JL4A 1UC7A 3ZLPA 3HA9A 3QAGA 3KZQA 4MMMA 2AHEA 3QFBC 3DRNA 2X8HA 1XVWA 4PQIA 1VF4A 3TJJA 3LQ7A 1NM3A 2HLSA 1M3IA 1YKCA 1X5EA 4FIWA 5E59A 5B7CA 1YF1A 4K5SA 1WWJA 4QQ7A 5E4WA 3UJ1A 4KCEA 2FWEA 4POKA 4I2TA 3HYPA 1OE8A 4CHSA 2V32A 4ZL9A 3D21A 3VPQA 3DD3A 2XPDA 3ZL5A 3US3A 1TXXA 3HHVA 4IP1A 4I5QA 3TKPA 1ZCPA 4IKHA 4OD7A 4G0IA 3MYDA 4TOPA 2WFCA 3HXSA 4CW9A 5IIZA 1B48A 1QMVA 1EWXA 3G9BA 3IXRA 1OC9B 3ERWA 1F2EA 3IRAA 4WBJA 1HNBA 1H4OA 1OC8A 1TK0B 2JADA 2TRCP 3RAZA 3L9VA 3ZREA 2VLUA 1K0BA 3EU3A 3ZMLA 1IYIA 4K0GA 5HR1A 4MLYA 2X49A 3MNGA 5HR2A 5AIVA 6GSYA 2IJYA 3NOFA 1E2YA 4NXIA 4TR0A 1V98A 2M72A 1SJIA 2VIMA 1EV4A 5JWRB 1FOVA 2GDRA 3LXZA 2E7PA 3TJKA 1B8XA 1EEMA 1XZOA 3QOUA 4HQSA 2WRTA 3F63A 2WULA 4L5OA 2C0FA 4X4JA 1AIUA 4BL7B 4MF5A 4ID0A 4TR4A 4LL1B 5IMCA 1WE0A 1MDIA 2K8VA 3GYKA 3VWXA 4MP4A 4FYUA 2B1KA 1Y6EA 6GSUA 3C8EA 2MBSA 2LNTA 3CSHA 3P8WA 2H66A 3IAS2 1DUGA 3M1GA 4X0XA 2OE3A 3GV1A 3Q18A 5F8BA 1NW2A 5F06A 4USSA 5J9CA 1AQVA 2A4HA 1EZKA 5EVOA 4POMA 1WPIA 2RM5A 5FHIA 3EE2A 3KP8A 4HU7A 1ERUA 3FR3A 3LEFA 1VF3A 4POBA 2XC2A 5ECSA 1SYRA 2WB9A 3IC4A 2FHEA 3TB2A 3MIXA 3HJMA 3UIWA 3P7XA 3TGZA 5L71A 2CAQA 2YCDA 4KAEA 5D9VA 1YEXA 4HZ2A 5CRDA 3TKRA 2HI7A 4L5LA 2FLSA 5HR0A 4MCUA 5AISA 4HUAA 2REMA 1NHYA 1AAZA 2GZYA 4TR1A 3Q6OA 2VD1A 4HJ2A 5KN0A 1OVNA 1ZGNA 2EIQA 4GSTA 4AJ7A 5B6MA 4MDCA 4EE0A 1U87A 1GNWA 5DJLA 3EINA 1WOUA 1RQMA 3FR6A 3H8QA 2B1LA 3GTUA 4FQUA 2KHPA 1XBSA 2VAFA 4HQZA 1J9BA 1A2JA 8GSSA 17GSA 1B4PA 5KN3A 1Y25A 4O92A 6GSSA 2C8UA 4JRRA 2PUKC 1K0NA 4RI7A 2DLXA 2ON7A 2DJJA 4O5UA 4IGJA 3GURA 2L6CA 1K0AA 2F8AA 3L9SA 3ZVJD 1XOBA 5JCUA 1G7EA 1SKSB 4N0VA 2GGTA 2R0CA 2LQQA 3FRCA 3GA4A 3D4TA 3TUEA 2OBKA 4O32A 2H72A 2C4JA 4Z2TA 5G31A 2YWNA 1YJ6A 3VLNA 4RUVA 4MJCA 3WGXA 5CO3A 5CREA 1QK8A 1TKDB 3F4RA 2H6XA 1JHBA 1O8WA 1FVJA 4L8EA 5CAXA 3R2QA 4V2MA 3EMXA 4ECBA 5EL8A 3VURA 1HQOA 2YPMA 3I43A 5B8AA 1GSFA 3W8SA 2R0GA 3P90A 1JZRA 1O6JA 1NHOA 2UZ8A 3HY2A 2PGTA 2V6KA 4TR1B 2IWTA 1YF0A 1O73A 3EVIA 5G1LA 2YNXA 4KW6A 3F0IA 3TKQA 4YQUA 3IOSA 3IDVA 3HJPA 2FD3A 5HR3A 2HNLA 3JCML 3KH9A 1AXDA 1FB0A 4IS0A 4O7HA 5D9TA 3GTUB 3UEMA 4NV2A 4MA9A 4EIQA 1S3RA 1RW1A 1GSYA 1USBA 5BRTA 2VM1A 3IBHA 2DJ3A 1BX9A 1YY7A 2EIRA 1U3IA 4N0ZA 2DJ0A 2C80A 3MAKA 3BD2A 2B6MA 4KUNA 1EOHA 4YKFA 2GVPA 2CV4A 3PH9A 1CQGA 2GSTA 3HD5A 4GXZA 4POLA 2V2GA 3MDKA 3IR4A 3F9UA 3ZFBA 2ZNMA 4TVEA 2KP2A 1F37A 3I6AA 1N8JA 1K0DA 2JZTA 3TJGA 3UBLA 4BA7A 4MABA 1C72A 1A2MA 4H86A 3OR5A 4OCEA 3PR8A 2IMEA 1EEJA 1N2AA 1GLQA 1V40A 4Q5FA 2VCZA 5AGYA 1UN2A 5ECQB 2QKEA 5IMVA 4WF5A 2GT6A 2IFQB 3C71A 1XG8A 1J0FA 4IBPA 4ML6A 2YWIA 2LJKA 4XS1A 4AJ8A 5ELAA 5J4UA 2HYXA 3C1SA 2N5AA 3A2XA 1PSQA 1Q98A 2K6VA 2LNSA 1TK8B 3QPMA 2OKAA 4IQAA 2X8GA 3DIEA 1THXA 4OFMA 3GHAA 3QAWA 1M0UA 1PKZA 2H6ZA 2AV4A 2E2GA 3RBTA 1GUMA 4ZBDA 1VRSD 4YKGA 2R5GA 3ZIJA 3UVTA 3CQFA 2CAIA 2QSIA 4TW5A 4KSOA 4G9HA 3HZ4A 3GIXA 4MK3A 5GSSA 4IP6A 1JFUA 4TXOA 4A5PA 10GSA 3QAVA 2X64A 1A24A 2C3NA 2H01A 1WRYA 2IMDA 5DQYA 1FO5A 2NVLA 3EWLA 2LSTA 16GSA 3HVXA 4K1FA 2AUVA 2J23A 4EDZA 1R4WA 3ERFA 1X9SB 3CSIA 2LRNA 3QDNA 3A5WA 3LSZA 4TXVA 4WETA 2HRAA 5CRGA 3VWUA 1ZYQB 1A2LA 1G0TA 4EVMA 3FK8A 4NPBA 3RHCA 1HNCA 4J57E 2VLVA 1Z7RA 3IAM2 1GUKA 3BJ5A 4F9ZA 4I2UA 2B5XA 3MSZA 5IO2A 3KEBA 5KOWA 3LW9A 1WP0A 3EYTA 1X9WB 4MPGA 3LJRA 6GSWA 4KH7A 4DSRA 2L4CA 4GQFA 1Z7PA 4PGTA 5GZZB 2H0HA 5ECNB 5KN2A 4Q5QA 1X0RA 2GSQA 1XWAA 1SENA 5J3RA 1SK2A 4EDYA 2M80A 5COHA 4HEA2 4XRDA 2YWMA 4BVXB 4X43A 2O8VB 3CTGA 2FCHA 4XRAA 1GTBA 2PMTA 2C0EA 3RPNA 2HRKA 2YANA 2R3XA 4LMVA 7GSSA 3H93A 2C3QA 4OCFA 1T4ZA 2NPBA 4AF2A 2JSZA 1KEBA 2GQLA 4OMVA 3EU4A 3BCKA 4EIPA 4TXOB 2DBCA 1LJRA 1BYEA 2C0DA 1OAZA 2ALBA 4GWRA 4XHMA 1MDJA 2JU5A 1HYUA 1JLWA 3IK7A 2WDUA 4EUYA 2VUPA 5J5NA 3UL3A 1XPVA 2C3TA 4MJEA 1GUHA 4G0LA 4MZBA 1OKTA 4KF9A 4F03A 2WS2A 3ZVJA 1UA5A 3VPTA 3L0HA 2I1UA 3ME7A 5EPFA 3ZTLA 4ACSA 1AQWA 1ERVA 2E0QA 5D96A 6GSXA 2MYGA 1TRUA 2RM6A 5B6NA 3A5IA 2N5BA 2QA1A 3E0UA 2A4VA 3W6GA 3KJYA 3HVVA 4N11A 3TKSA 3LWAA 4IHUA 3TRQA 3ZYWA 1T8EB 3EPTA 2YWOA 2KLXA 5IO0A 1YQ1A 2LV3A 4JBBA 4ZBBA 5H5SA 3EMPA 5KN1A 3LFLA 1FW1A 2H1BA 1OC3A 2KOKA 1IYHA 4PXOA 4BVYA 4N30A 2FA4A 2V6OA 1S3CA 3DEXA 5ECHB 4PNGA 5ECRB 2LRTA 1Z3EA 2L57A 1BAYA 3CXGA 1AUCA 4ZBAA 2L59A 3ZMKA 1YZXA 3A2VA 2VCVA 2DMMA 2M46A 2LTKA 5B8BA 4ZILA 4HU9A 3DYRA 3D6IA 2K8SA 2GLRA 1XWKA 3KGKA 1ZOFA 5DBQA 2F9SA 1XIYA 4DVCA 1E6BA 4HOJA 1FOHA 3LG6A 4LMWA 3APQA 2H70A 4MZCA 5D73A 2FY6A 3H4KA 5C00A 5ABRA 2XHFA 1T3BA 2PERA 3G7JA 2A2RA 3KD0A 1XWCA 4WKWA 2H6YA 2YV7A 3I69A 3QMXA 4GF0A 5HFKA 4OO4A 2DKHA 1TDIA 5F05A 1JLVA 5HQPA 4DEJA 2GSSA 3K8NA 1W89A 3APOA 3E9JB 2B5EA 5G30A 1K0MA 5D93A 4PTSA 5D9WA 1X9MB 3VI5A 3TKSC 1WMJA 3HCZA 3HJOA 3UARA 1ZL9A 3KP9A 1FHEA 1O8XA 1J08A 3APSA 2ON5A 5A5KA 3DKSA 1HD2A 4BWQA 3PGTA 1T00A 2B5YA 4HJMA 4NAXA 2P31A 3VWVA 3FY7A 3GMFA 5A4WA 1K0OA 4KNDA 5DAKA 5F07A 2JSYA 3RHBA 2DJKA 4JR6A 4BVYB 14GSA 2DIYA 1SK0A 4K7OA 2AB6A 1JZWA 3ERGA 2DKIA 1XW5A 5DALA 1PN9A 1YKAA 3G7YA 3QR6A 3M9JA 2LRCA 1XOAA 1PX6A 4G10A 4ZXGA 4XCSA 4E8HA 1A8LA 3ZIVA 1KNGA 5DCGA 4ZIJA 1M9AA 2HRNA 4P3YB 4FYCA 2G0FA 1M9BA 2FUG2 2YJHA 4KE3A 4GQCA 4V1Ag 1XWGA 1OE7A 2IMFA 2OE1A 4YAPA 4IJ3A 3M9KA 3SWLA 4ZL8A 2VOCA 2DJ2A 3R3EA 3IK9A 3U6VA 4IW9A 4CY8A 5J41A 2LQOA 4ML1A 3UOMA 1LBKA 3FYGA 2R37A 2WGRA 1FB6A 2MMZA 1PN0A 3DWVA 1SL2B 2PVQA 1GULA 1SL0B 4G0KA 4ICYA 3AY8A 4K9ZA 2VM2A 3DGQA 1G7OA 1I9DA 5A4VA 4CY6A 2R4VA 1YDKA 1LU4A 1QQ2A 5IMDA 4PUAA 1TU7A 2I81A 3A3TA 4ZL7A 1K3YA 2QGVA 3CSJA 1OKDA 4X1UA 3GKMA 1TP9A 4ISDA 2YZHA 3C1RA 3TRPA 4ILFA 1SK1A 1XXUA 2OBIA 3ME8A 1PL2A 1HNAA 1U6TA 1KBNA 5DJMA 4KCAA 2MZCA 3PPUA 5CP1A 5DAKB 3Q19A 2AAWA 5ENUA 2L4QA 4EF0A 1SL1B 2VCXA 1DBYA 3D4MA 2VCTA 4BIKA 3J7Yk 2HSMA 2PN8A 5F0GA 4JEDA 3I9V2 5DALB 1Z6MA 2O7KA 1TRVA 4IELA 1M3JA 1FVKA 4BWSA 4HDEA 5AN1A 2RUEA 3CMIA 1EV9A 3GFKA 5FT3A 4TR3A 1PQNA 3IC8A 4EL1A 2QA2A 6GSVA 4DSQA 3FKFA 4ECCA 2CZ3A 5EY6A 1A0RP 4HI7A 2OE0A 4Z2UA 1ZYEA 1AW9A 1Q4JA 5LCZA 2V41A 4YQVA 2I3YA 4HSCX 3DXBA 3GH9A 4BPYA 1SJZA 1EGRA 2BTOT 2FWGA 3VK9A 3BBYA 3F4TA 4GRFA 4GLTA 4ECIA 2IIYA 2H0GA 3GH6A 3IV4A 3GKKA 1MD4A 3EURA 4KDXA 3ZZXA 4QL7A 2FWHA 3KMOA 4PQ1A 2O87A 1ZMAA 3FZ9A 1K3OA 1TRWA 4EO3A 5G5FA 4IN0A 1ACVA 3QFAC 4K0NA 4ZB9A 4ZB6A 3TOTA 4K2DA 1YEPA 2IPAA 22GSA 1GSSA 2HRFA 3N5OA 1DSBA 2GS3A 2X8CA 3V1WA 2H74A 2C0GA 2PU9C 1VF2A 1JZDA 2OJLA 5INYA 1A8YA 5LNKe 4HZ4A 3HZ8A 2KP1A 4FH8A 1PMTA 4ULXA 3RPPA 4JE1A 3ZRDA 4EXJA 5G1KA 2PWJA 4KX4A 1PX7A 1ON4A 5ID2A 2I4AA 3LGCA 3CRTA 4F0CA 4K7NA 4L0UA 4MH2A 2G2QA 3GL3A 1URMA 2JZSA 1TU8A 3ZITA 2EIOA 1SU9A 3FZ5A 1R7HA 3TDGA 2DMLA 5DDLA 1QXHA 2HE3A 3KM6A 2LKUA 3M0FA 2YN1A 1WIKA 2NDOA 4NMUA 2YOIA 3GUSA 2L5LA 1PRXA 1XWBA 4F2IA 1T1VA 3FW2A 4K2XA 1GSQA 4I97A 2H8LA 1PFOA 1V57A 2CX3A 2L6DA 4BL7A 5LD0A 1X5CA 2H1AA 3WYWA 2LUSA 1M2BA 2B3SA 2NBSA 5CRWA 4I8BA 3TKSE 1XFLA 5IMAA 1GL8A 2XPEA 2KUCA 3ISOA 1GSUA 4J2FA 3BOAA 1TJDA 3NZNA 3LXTA 3HVSA 1TI3A 4JR4A 4V1Ap 2YP6A 4IQ1A 1O81A 2WZ9A 3Q74A 4F0BA 5GAND 2O85A 1XCCA 1M2AA 3VWWA 1H75A 1GP1A 5IOXA 3PINA 2GZPA 2IL3A 4LL4B 4KDYA 1V9WA 5IM9A 2R2JA 2RUFA 3LYKA 3J7Yb 4KSMA 3WT2A 1MTCA 1BG5A 3HKRA 1PGTA 2P5QA 2NTOA 1S3DA 4LA1A 2HZEA 1GSEA 4PUFC 2VL2A 2F51A 5ID2B 5DCHA 1UVZA 2BMXA 4RI6A 4V2LA 1TK5B 4K7IA 3KXOA 4J56E 4OWYA 4KDUA 1EGOA 2VCQA 5CNWA 3IE3A 3KTBA 3DVXA 3DVWA 3C73A 5ECLB 4IJIA 4WR4A 2O89A 2VLTA 3C7MA 3TJBA 1GLPA 4KGIA 1AQXA 2H30A 6GSTA 4WR5A 3FEUA 3KTLA 2X4AA 2DIZA 4XTSA 1F3AA 4MZWA 3S9FA 5H5RA 4WXTA 1BJXA 4NHWA 2GQKA 2YJ7A 5H5QA 2R0PA 5G5EA 2DJ1A 2D2ZA 3IHGA 1M99A 2LJAA 3QD9A 5AIXA 5IMZA 1V2AA 5ECPB 3ZFLA 1ZYPA 3ED3A 1SD9A 1A23A 1R26A 4AJ6A 3IPZA 4MPFA 2XBIA 3WGEA 1PL1A 4MJBA 1GH2A 5JWOB 2CA8A 2PPTA 3N9JA 4N10A 4EKZA 4PQHA 2P5RA 3FZ4A 2HZEB 3F4SA 5IMFA 5HFIA 2R6KA 5A4UA 5IPGA 2GTUA 4K8MA 1T4YA 2VL2C 2GZZA 3MWHA 4PX1A 1EOGA 4MF7A 2RIIA 3HDCA 4F82A 3GX8A 4ZB8A 2PBJA 2JACA 3LORA 5HFGA 2JZRA 2RLIA 5ELGA 4GSNA 2DSAA 1ERWA 5J9BA 3GSTA 4GSSA 1MD3A 18GSA 1ERTA 1THOA 2OACA 1ABAA 1ZZYA 2H71A 3GRXA 3WD6A 2Z9SA 3F8UA 4WBRD 3UAPA 5C04A 5GAPD 3GNJA 3RDWA 4L0WA 5KOXA 2HFDA 1SYXA 1S3AA 2AJQB 4Z2RA 3P2AA 2VL9A 1T7PB 3O3TA 2LEGA 2AYTA 3GKXA 3O76A 4DSSA 1F6MC 3O6TA
chains in the Genus database with same CATH topology
4FO5A 2MMNA 3FZAA 4RQXA 5CYYA 2H1GA 4O5RA 3DMLA 3UBKA 2B7JA 3GL5A 2J9HA 4Z7XA 11GSA 2HSHA 2I9HA 13GSA 2MBTA 4TRXA 5D9XA 3VI7A 5JCWA 1G6YA 2YV9A 5ECOB 3BCIA 3TOUA 2K18A 2H73A 2HXKA 1ML6A 3L78A 5KEJA 2TRXA 2GSRA 2L5OA 1XVQA 2LS5A 4MJAA 2FWFA 5IOWA 2HZFA 4IVFA 4NHZA 3KCMA 4XS6A 2FNOA 1GTIA 1K3LA 2F8FA 1B4QA 1F9MA 1SJ6A 2E2MA 1F3BA 12GSA 2IFQA 2IMIA 4O5QA 1DE2A 1I5GA 3VFIA 2A2SA 3IA1A 1MEKA 2P0GA 1GTAA 1U3AA 3TCOA 1O85A 1BQ7A 2WJUA 4WF4A 1O7UA 3FR9A 5BMUA 4KB3A 3WGDA 1GNEA 1A0FA 3NIVA 3CYNA 3FHKA 1JZOA 1V58A 4RQRA 3UMAA 1G6WA 3W8JA 2FA8A 1BEDA 1TRSA 5DVBA 4PNFA 3F6DA 4D73A 4EC0A 4I6XA 2GT5A 2H0IA 2H76A 4JU5A 2VO4A 1W4VA 3L4NA 2A2PA 1GSDA 1WJKA 3LYPA 2QC7A 2LJRA 1FAAA 3WT1A 2CVKA 4G19A 4JZQA 3TRXA 3D22A 1X5DA 4GCIA 2ZUPA 2DC5A 2CQ9A 1PA3A 1CQHA 4YAVA 2VCWA 5CRHA 5DQSA 4K6XA 2H19A 5IQYA 4Q5NA 4DSSB 4HS1A 3KH7A 2IMKA 4FYBA 2VL3A 1R5AA 4YH2A 3FMWA 1SD8A 1QGVA 1GRXA 3GN3A 2CX4A 2MMOA 1AC1A 1M7TA 1SKWB 2MMAA 3IHQA 3UVHA 3SBCA 3G7IA 2FGXA 2F3MA 1KTEA 1B9YC 1QUWA 1EP7A 3U5RE 5JCGA 1NSWA 4XS4A 4YQMA 2C1YA 4E8EA 20GSA 2V1MA 4OFNA 1VF1A 2B7KA 19GSA 1FG4A 2X99A 3KMNA 5G2ZA 2K9FA 4K5RA 2IN3A 3F3QA 1GWCA 1TI1A 1RK4A 4MH3A 5GSTA 1VGLA 4OO5A 1QFNA 1ILOA 1Z5YE 4OFTA 3GKNA 3E3EA 4G2EA 4V2NA 4AGSA 2ES7A 2HT9A 4BVXA 4ECJA 1DE1A 3L9UA 2CVBA 4GTUA 3KIJA 2VD0A 2H75A 5ECIB 4MNNA 1PKWA 4Q5RA 3H1NA 4WEYA 3TJFA 4D73B 3CBUA 1MDKA 2H1DA 2CVDA 1R5PA 3F6FA 2XBQA 9GSSA 2PVOC 3M8NA 4QL9A 3GSSA 2OADA 1K0CA 1ZYNA 3GX0A 4TKYA 4XIHA 1TW9A 5D8IA 5IPHA 1GTUA 2TIRA 1PD21 4KA0A 5FWGA 1TTZA 3D5JA 1Z9HA 1M2DA 1OC9A 2YZUA 3A2WA 5ECMB 1ST9A 1TOFA 3CRUA 1SKRB 1OYJA 3F3RA 5JWQB 4NWYA 2BJXA 2ZCTA 4NV5A 4TN8A 1XW6A 3D0ZA 2CZ2A 2HSYA 3H79A 2EC4A 1Z6NA 2GQMA 1EP8A 3CTFA 3QCPA 1U88A 3EC3A 2OA7A 1B9XC 4PURA 5ECKB 4CDOA 4LLRA 3M3MA 4MF6A 4XS4B 2N5FA 2WCIA 1XW9A 2CT6A 2JL4A 1UC7A 3ZLPA 3HA9A 3QAGA 3KZQA 4MMMA 2AHEA 3QFBC 3DRNA 2X8HA 1XVWA 4PQIA 1VF4A 3TJJA 3LQ7A 1NM3A 2HLSA 1YKCA 1X5EA 4FIWA 5E59A 5B7CA 1YF1A 4K5SA 1WWJA 4QQ7A 5E4WA 3UJ1A 4KCEA 2FWEA 4POKA 4I2TA 3HYPA 1OE8A 4CHSA 2V32A 4ZL9A 3D21A 3VPQA 3DD3A 2XPDA 3ZL5A 3US3A 1TXXA 3HHVA 4IP1A 4I5QA 3TKPA 1ZCPA 4IKHA 4OD7A 4G0IA 3MYDA 4TOPA 2WFCA 3HXSA 4CW9A 5IIZA 1B48A 1QMVA 1EWXA 3G9BA 3IXRA 1OC9B 3ERWA 1F2EA 3IRAA 4WBJA 1HNBA 1H4OA 1OC8A 1TK0B 2JADA 2TRCP 3RAZA 3L9VA 3ZREA 2VLUA 1K0BA 3EU3A 3ZMLA 1IYIA 4K0GA 5HR1A 4MLYA 2X49A 3MNGA 5HR2A 5AIVA 6GSYA 2IJYA 3NOFA 1E2YA 4NXIA 4TR0A 1V98A 2M72A 1SJIA 2VIMA 1EV4A 5JWRB 1FOVA 2GDRA 3LXZA 2E7PA 3TJKA 1B8XA 1EEMA 1XZOA 3QOUA 4HQSA 2WRTA 3F63A 2WULA 4L5OA 2C0FA 4X4JA 1AIUA 4BL7B 4MF5A 4ID0A 4TR4A 4LL1B 5IMCA 1WE0A 1MDIA 2K8VA 3GYKA 3VWXA 4MP4A 4FYUA 2B1KA 1Y6EA 6GSUA 3C8EA 2MBSA 2LNTA 3CSHA 3P8WA 2H66A 3IAS2 1DUGA 3M1GA 4X0XA 2OE3A 3GV1A 3Q18A 5F8BA 1NW2A 5F06A 4USSA 5J9CA 1AQVA 2A4HA 1EZKA 5EVOA 4POMA 1WPIA 2RM5A 5FHIA 3EE2A 3KP8A 4HU7A 1ERUA 3FR3A 3LEFA 1VF3A 4POBA 2XC2A 5ECSA 1SYRA 2WB9A 3IC4A 2FHEA 3TB2A 3MIXA 3HJMA 3UIWA 3P7XA 3TGZA 5L71A 2CAQA 2YCDA 4KAEA 5D9VA 1YEXA 4HZ2A 5CRDA 3TKRA 2HI7A 4L5LA 2FLSA 5HR0A 4MCUA 5AISA 4HUAA 2REMA 1NHYA 1AAZA 2GZYA 4TR1A 3Q6OA 2VD1A 4HJ2A 5KN0A 1OVNA 1ZGNA 2EIQA 4GSTA 4AJ7A 5B6MA 4MDCA 4EE0A 1U87A 1GNWA 5DJLA 3EINA 1WOUA 1RQMA 3FR6A 3H8QA 2B1LA 3GTUA 4FQUA 2KHPA 1XBSA 2VAFA 4HQZA 1J9BA 1A2JA 8GSSA 17GSA 1B4PA 5KN3A 1Y25A 4O92A 6GSSA 2C8UA 4JRRA 2PUKC 1K0NA 4RI7A 2DLXA 2ON7A 2DJJA 4O5UA 4IGJA 3GURA 2L6CA 1K0AA 2F8AA 3L9SA 3ZVJD 1XOBA 5JCUA 1G7EA 1SKSB 4N0VA 2GGTA 2R0CA 2LQQA 3FRCA 3GA4A 3D4TA 3TUEA 2OBKA 4O32A 2H72A 2C4JA 4Z2TA 5G31A 2YWNA 1YJ6A 3VLNA 4RUVA 4MJCA 3WGXA 5CO3A 5CREA 1QK8A 1TKDB 3F4RA 2H6XA 1JHBA 1O8WA 1FVJA 4L8EA 5CAXA 3R2QA 4V2MA 3EMXA 4ECBA 5EL8A 3VURA 1HQOA 2YPMA 3I43A 5B8AA 1GSFA 3W8SA 2R0GA 3P90A 1JZRA 1O6JA 1NHOA 2UZ8A 3HY2A 2PGTA 2V6KA 4TR1B 2IWTA 1YF0A 1O73A 3EVIA 5G1LA 2YNXA 4KW6A 3F0IA 3TKQA 4YQUA 3IOSA 3IDVA 3HJPA 2FD3A 5HR3A 2HNLA 3JCML 3KH9A 1AXDA 1FB0A 4IS0A 4O7HA 5D9TA 3GTUB 3UEMA 4NV2A 4MA9A 4EIQA 1RW1A 1GSYA 1USBA 5BRTA 2VM1A 3IBHA 2DJ3A 1BX9A 1YY7A 2EIRA 1U3IA 4N0ZA 2DJ0A 2C80A 3MAKA 3BD2A 2B6MA 4KUNA 1EOHA 4YKFA 2GVPA 2CV4A 3PH9A 1CQGA 2GSTA 3HD5A 4GXZA 4POLA 2V2GA 3MDKA 3IR4A 3F9UA 3ZFBA 2ZNMA 4TVEA 2KP2A 1F37A 3I6AA 1N8JA 1K0DA 2JZTA 3TJGA 3UBLA 4BA7A 4MABA 1C72A 1A2MA 4H86A 3OR5A 4OCEA 3PR8A 2IMEA 1EEJA 1N2AA 1GLQA 1V40A 4Q5FA 2VCZA 5AGYA 1UN2A 5ECQB 2QKEA 5IMVA 4WF5A 2GT6A 2IFQB 3C71A 1J0FA 4IBPA 4ML6A 2YWIA 2LJKA 4XS1A 4AJ8A 5ELAA 5J4UA 2HYXA 3C1SA 2N5AA 3A2XA 1PSQA 1Q98A 2K6VA 2LNSA 1TK8B 3QPMA 2OKAA 4IQAA 2X8GA 3DIEA 1THXA 4OFMA 3GHAA 3QAWA 1M0UA 1PKZA 2H6ZA 2AV4A 2E2GA 3RBTA 1GUMA 4ZBDA 1VRSD 4YKGA 2R5GA 3ZIJA 3UVTA 2CAIA 2QSIA 4TW5A 4KSOA 4G9HA 3HZ4A 3GIXA 4MK3A 5GSSA 4IP6A 1JFUA 4TXOA 4A5PA 10GSA 3QAVA 2X64A 1A24A 2C3NA 2H01A 1WRYA 2IMDA 5DQYA 1FO5A 2NVLA 3EWLA 2LSTA 16GSA 3HVXA 4K1FA 2AUVA 2J23A 4EDZA 1R4WA 3ERFA 1X9SB 3CSIA 2LRNA 3QDNA 3A5WA 3LSZA 4TXVA 4WETA 2HRAA 5CRGA 3VWUA 1ZYQB 1A2LA 1G0TA 4EVMA 3FK8A 4NPBA 3RHCA 1HNCA 4J57E 2VLVA 1Z7RA 3IAM2 1GUKA 3BJ5A 4F9ZA 4I2UA 2B5XA 3MSZA 5IO2A 3KEBA 5KOWA 3LW9A 1WP0A 3EYTA 1X9WB 4MPGA 3LJRA 6GSWA 4KH7A 4DSRA 2L4CA 4GQFA 1Z7PA 4PGTA 5GZZB 2H0HA 5ECNB 5KN2A 4Q5QA 1X0RA 2GSQA 1XWAA 1SENA 5J3RA 1SK2A 4EDYA 2M80A 5COHA 4HEA2 4XRDA 2YWMA 4BVXB 4X43A 2O8VB 3CTGA 2FCHA 4XRAA 1GTBA 2PMTA 2C0EA 3RPNA 2HRKA 2YANA 2R3XA 4LMVA 7GSSA 3H93A 2C3QA 4OCFA 1T4ZA 2NPBA 4AF2A 2JSZA 1KEBA 2GQLA 4OMVA 3EU4A 3BCKA 4EIPA 4TXOB 2DBCA 1LJRA 1BYEA 2C0DA 1OAZA 2ALBA 4GWRA 4XHMA 1MDJA 2JU5A 1HYUA 1JLWA 3IK7A 2WDUA 4EUYA 2VUPA 5J5NA 3UL3A 1XPVA 2C3TA 4MJEA 1GUHA 4G0LA 4MZBA 1OKTA 4KF9A 4F03A 2WS2A 3ZVJA 1UA5A 3VPTA 3L0HA 2I1UA 3ME7A 5EPFA 3ZTLA 4ACSA 1AQWA 1ERVA 2E0QA 5D96A 6GSXA 2MYGA 1TRUA 2RM6A 5B6NA 3A5IA 2N5BA 2QA1A 3E0UA 2A4VA 3W6GA 3KJYA 3HVVA 4N11A 3TKSA 3LWAA 4IHUA 3TRQA 3ZYWA 1T8EB 3EPTA 2YWOA 2KLXA 5IO0A 1YQ1A 2LV3A 4JBBA 4ZBBA 5H5SA 3EMPA 5KN1A 3LFLA 1FW1A 2H1BA 1OC3A 2KOKA 1IYHA 4PXOA 4BVYA 4N30A 2FA4A 2V6OA 1S3CA 3DEXA 5ECHB 4PNGA 5ECRB 2LRTA 1Z3EA 2L57A 1BAYA 3CXGA 1AUCA 4ZBAA 2L59A 3ZMKA 1YZXA 3A2VA 2VCVA 2DMMA 2M46A 2LTKA 5B8BA 4ZILA 4HU9A 3DYRA 3D6IA 2K8SA 2GLRA 1XWKA 3KGKA 1ZOFA 5DBQA 2F9SA 1XIYA 4DVCA 1E6BA 4HOJA 1FOHA 3LG6A 4LMWA 3APQA 2H70A 4MZCA 5D73A 2FY6A 3H4KA 5C00A 5ABRA 2XHFA 1T3BA 2PERA 3G7JA 2A2RA 3KD0A 1XWCA 4WKWA 2H6YA 2YV7A 3I69A 3QMXA 4GF0A 5HFKA 4OO4A 2DKHA 1TDIA 5F05A 1JLVA 5HQPA 4DEJA 2GSSA 3K8NA 1W89A 3APOA 3E9JB 2B5EA 5G30A 1K0MA 5D93A 4PTSA 5D9WA 1X9MB 3VI5A 3TKSC 1WMJA 3HCZA 3HJOA 3UARA 1ZL9A 3KP9A 1FHEA 1O8XA 1J08A 3APSA 2ON5A 5A5KA 3DKSA 1HD2A 4BWQA 3PGTA 1T00A 2B5YA 4HJMA 4NAXA 2P31A 3VWVA 3FY7A 3GMFA 5A4WA 1K0OA 4KNDA 5DAKA 5F07A 2JSYA 3RHBA 2DJKA 4JR6A 4BVYB 14GSA 2DIYA 1SK0A 4K7OA 2AB6A 1JZWA 3ERGA 2DKIA 1XW5A 5DALA 1PN9A 1YKAA 3G7YA 3QR6A 3M9JA 2LRCA 1XOAA 1PX6A 4G10A 4ZXGA 4XCSA 4E8HA 1A8LA 3ZIVA 1KNGA 5DCGA 4ZIJA 1M9AA 2HRNA 4P3YB 4FYCA 2G0FA 1M9BA 2FUG2 2YJHA 4KE3A 4GQCA 4V1Ag 1XWGA 1OE7A 2IMFA 2OE1A 4YAPA 4IJ3A 3M9KA 3SWLA 4ZL8A 2VOCA 2DJ2A 3R3EA 3IK9A 3U6VA 4IW9A 4CY8A 5J41A 2LQOA 4ML1A 3UOMA 1LBKA 3FYGA 2R37A 2WGRA 1FB6A 2MMZA 1PN0A 3DWVA 1SL2B 2PVQA 1GULA 1SL0B 4G0KA 4ICYA 3AY8A 4K9ZA 2VM2A 3DGQA 1G7OA 1I9DA 5A4VA 4CY6A 2R4VA 1YDKA 1LU4A 1QQ2A 5IMDA 4PUAA 1TU7A 2I81A 3A3TA 4ZL7A 1K3YA 2QGVA 3CSJA 1OKDA 4X1UA 3GKMA 1TP9A 4ISDA 2YZHA 3C1RA 3TRPA 4ILFA 1SK1A 1XXUA 2OBIA 3ME8A 1PL2A 1HNAA 1U6TA 1KBNA 5DJMA 4KCAA 2MZCA 3PPUA 5CP1A 5DAKB 3Q19A 2AAWA 5ENUA 2L4QA 4EF0A 1SL1B 2VCXA 1DBYA 3D4MA 2VCTA 3J7Yk 2HSMA 2PN8A 5F0GA 4JEDA 3I9V2 5DALB 1Z6MA 2O7KA 1TRVA 4IELA 1FVKA 4BWSA 4HDEA 5AN1A 2RUEA 3CMIA 1EV9A 3GFKA 5FT3A 4TR3A 1PQNA 3IC8A 4EL1A 2QA2A 6GSVA 4DSQA 3FKFA 4ECCA 2CZ3A 5EY6A 1A0RP 4HI7A 2OE0A 4Z2UA 1ZYEA 1AW9A 1Q4JA 5LCZA 2V41A 4YQVA 2I3YA 3DXBA 3GH9A 4BPYA 1SJZA 1EGRA 2BTOT 2FWGA 3VK9A 3BBYA 3F4TA 4GRFA 4GLTA 4ECIA 2IIYA 2H0GA 3GH6A 3IV4A 3GKKA 1MD4A 3EURA 4KDXA 3ZZXA 4QL7A 2FWHA 3KMOA 4PQ1A 2O87A 1ZMAA 3FZ9A 1K3OA 1TRWA 4EO3A 5G5FA 4IN0A 1ACVA 3QFAC 4K0NA 4ZB9A 4ZB6A 3TOTA 4K2DA 1YEPA 2IPAA 22GSA 1GSSA 2HRFA 3N5OA 1DSBA 2GS3A 2X8CA 3V1WA 2H74A 2C0GA 2PU9C 1VF2A 1JZDA 2OJLA 5INYA 1A8YA 5LNKe 4HZ4A 3HZ8A 2KP1A 4FH8A 1PMTA 4ULXA 3RPPA 4JE1A 3ZRDA 4EXJA 5G1KA 2PWJA 4KX4A 1PX7A 1ON4A 5ID2A 2I4AA 3LGCA 3CRTA 4F0CA 4K7NA 4L0UA 4MH2A 2G2QA 3GL3A 1URMA 2JZSA 1TU8A 3ZITA 2EIOA 1SU9A 3FZ5A 1R7HA 3TDGA 2DMLA 5DDLA 1QXHA 2HE3A 3KM6A 2LKUA 3M0FA 2YN1A 1WIKA 2NDOA 4NMUA 2YOIA 3GUSA 2L5LA 1PRXA 1XWBA 4F2IA 1T1VA 3FW2A 4K2XA 1GSQA 4I97A 2H8LA 1V57A 2CX3A 2L6DA 4BL7A 5LD0A 1X5CA 2H1AA 3WYWA 2LUSA 1M2BA 2B3SA 2NBSA 5CRWA 4I8BA 3TKSE 1XFLA 5IMAA 1GL8A 2XPEA 2KUCA 3ISOA 1GSUA 4J2FA 3BOAA 1TJDA 3NZNA 3LXTA 3HVSA 1TI3A 4JR4A 4V1Ap 2YP6A 4IQ1A 1O81A 2WZ9A 3Q74A 4F0BA 5GAND 2O85A 1XCCA 1M2AA 3VWWA 1H75A 1GP1A 5IOXA 3PINA 2GZPA 2IL3A 4LL4B 4KDYA 1V9WA 5IM9A 2R2JA 2RUFA 3LYKA 3J7Yb 4KSMA 3WT2A 1MTCA 1BG5A 3HKRA 1PGTA 2P5QA 2NTOA 1S3DA 4LA1A 2HZEA 1GSEA 4PUFC 2VL2A 2F51A 5ID2B 5DCHA 1UVZA 2BMXA 4RI6A 4V2LA 1TK5B 4K7IA 3KXOA 4J56E 4OWYA 4KDUA 1EGOA 2VCQA 5CNWA 3IE3A 3KTBA 3DVXA 3DVWA 3C73A 5ECLB 4IJIA 4WR4A 2O89A 2VLTA 3C7MA 3TJBA 1GLPA 4KGIA 1AQXA 2H30A 6GSTA 4WR5A 3FEUA 3KTLA 2X4AA 2DIZA 4XTSA 1F3AA 4MZWA 3S9FA 5H5RA 4WXTA 1BJXA 4NHWA 2GQKA 2YJ7A 5H5QA 2R0PA 5G5EA 2DJ1A 2D2ZA 3IHGA 1M99A 2LJAA 3QD9A 5AIXA 5IMZA 1V2AA 5ECPB 3ZFLA 1ZYPA 3ED3A 1SD9A 1A23A 1R26A 4AJ6A 3IPZA 4MPFA 2XBIA 3WGEA 1PL1A 4MJBA 1GH2A 5JWOB 2CA8A 2PPTA 3N9JA 4N10A 4EKZA 4PQHA 2P5RA 3FZ4A 2HZEB 3F4SA 5IMFA 5HFIA 2R6KA 5A4UA 5IPGA 2GTUA 4K8MA 1T4YA 2VL2C 2GZZA 3MWHA 4PX1A 1EOGA 4MF7A 2RIIA 3HDCA 4F82A 3GX8A 4ZB8A 2PBJA 2JACA 3LORA 5HFGA 2JZRA 2RLIA 5ELGA 4GSNA 2DSAA 1ERWA 5J9BA 3GSTA 4GSSA 1MD3A 18GSA 1ERTA 1THOA 2OACA 1ABAA 1ZZYA 2H71A 3GRXA 3WD6A 2Z9SA 3F8UA 4WBRD 3UAPA 5C04A 5GAPD 3GNJA 3RDWA 4L0WA 5KOXA 2HFDA 1SYXA 1S3AA 2AJQB 4Z2RA 3P2AA 2VL9A 1T7PB 3O3TA 2LEGA 2AYTA 3GKXA 3O76A 4DSSA 1F6MC 3O6TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FO5 A;  2MMN A;  3FZA A;  4RQX A;  5CYY A;  2H1G A;  4O5R A;  3DML A;  3UBK A;  2B7J A;  3GL5 A;  2J9H A;  4Z7X A;  11GS A;  2HSH A;  2I9H A;  13GS A;  2MBT A;  4TRX A;  5D9X A;  3VI7 A;  5JCW A;  1G6Y A;  2YV9 A;  5ECO B;  3BCI A;  3TOU A;  2K18 A;  2H73 A;  2HXK A;  1ML6 A;  3L78 A;  5KEJ A;  2TRX A;  2GSR A;  2L5O A;  1XVQ A;  2LS5 A;  4MJA A;  2FWF A;  5IOW A;  2HZF A;  4IVF A;  4NHZ A;  3KCM A;  4XS6 A;  2FNO A;  1GTI A;  1K3L A;  2F8F A;  1B4Q A;  1F9M A;  1SJ6 A;  2E2M A;  1F3B A;  12GS A;  2IFQ A;  2IMI A;  1DE2 A;  1I5G A;  3VFI A;  2A2S A;  3IA1 A;  1MEK A;  2P0G A;  1GTA A;  1U3A A;  3TCO A;  1O85 A;  1BQ7 A;  2WJU A;  4WF4 A;  1O7U A;  3FR9 A;  4KB3 A;  3WGD A;  1GNE A;  1A0F A;  3NIV A;  3CYN A;  3FHK A;  1JZO A;  1V58 A;  4RQR A;  3UMA A;  1G6W A;  3W8J A;  2FA8 A;  1BED A;  1TRS A;  5DVB A;  4PNF A;  3F6D A;  4D73 A;  4EC0 A;  4I6X A;  2GT5 A;  2H0I A;  2H76 A;  4JU5 A;  2VO4 A;  1W4V A;  3L4N A;  1GSD A;  1WJK A;  3LYP A;  2QC7 A;  2LJR A;  1FAA A;  3WT1 A;  2CVK A;  4G19 A;  4JZQ A;  3TRX A;  3D22 A;  1X5D A;  4GCI A;  2ZUP A;  2DC5 A;  2CQ9 A;  1PA3 A;  1CQH A;  4YAV A;  2VCW A;  5CRH A;  5DQS A;  4K6X A;  2H19 A;  5IQY A;  4Q5N A;  4DSS B;  4HS1 A;  3KH7 A;  2IMK A;  4FYB A;  2VL3 A;  1R5A A;  4YH2 A;  1SD8 A;  1QGV A;  1GRX A;  3GN3 A;  2CX4 A;  2MMO A;  1AC1 A;  1M7T A;  1SKW B;  2MMA A;  3IHQ A;  3UVH A;  3SBC A;  3G7I A;  2FGX A;  2F3M A;  1KTE A;  1B9Y C;  1QUW A;  1EP7 A;  3U5R E;  5JCG A;  1NSW A;  4XS4 A;  4YQM A;  2C1Y A;  4E8E A;  20GS A;  2V1M A;  4OFN A;  1VF1 A;  2B7K A;  19GS A;  1FG4 A;  2X99 A;  3KMN A;  5G2Z A;  2K9F A;  2IN3 A;  3F3Q A;  1GWC A;  1TI1 A;  1RK4 A;  4MH3 A;  5GST A;  1VGL A;  4OO5 A;  1QFN A;  1ILO A;  1Z5Y E;  4OFT A;  3GKN A;  3E3E A;  4G2E A;  4V2N A;  4AGS A;  2ES7 A;  2HT9 A;  4BVX A;  4ECJ A;  1DE1 A;  3L9U A;  2CVB A;  4GTU A;  3KIJ A;  2VD0 A;  2H75 A;  5ECI B;  1PKW A;  4Q5R A;  3H1N A;  4WEY A;  3TJF A;  4D73 B;  3CBU A;  1MDK A;  2H1D A;  2CVD A;  1R5P A;  3F6F A;  2XBQ A;  9GSS A;  2PVO C;  3M8N A;  4QL9 A;  3GSS A;  2OAD A;  1K0C A;  3GX0 A;  4TKY A;  4XIH A;  1TW9 A;  5D8I A;  5IPH A;  1GTU A;  2TIR A;  1PD2 1;  4KA0 A;  5FWG A;  1TTZ A;  3D5J A;  1Z9H A;  1M2D A;  1OC9 A;  2YZU A;  3A2W A;  5ECM B;  1ST9 A;  1TOF A;  3CRU A;  1SKR B;  1OYJ A;  3F3R A;  5JWQ B;  4NWY A;  2BJX A;  2ZCT A;  4NV5 A;  4TN8 A;  1XW6 A;  3D0Z A;  2CZ2 A;  2HSY A;  3H79 A;  2EC4 A;  1Z6N A;  2GQM A;  1EP8 A;  3CTF A;  3QCP A;  1U88 A;  3EC3 A;  2OA7 A;  1B9X C;  4PUR A;  5ECK B;  4CDO A;  4LLR A;  3M3M A;  4MF6 A;  4XS4 B;  2N5F A;  2WCI A;  1XW9 A;  2CT6 A;  2JL4 A;  1UC7 A;  3ZLP A;  3HA9 A;  3QAG A;  3KZQ A;  4MMM A;  2AHE A;  3QFB C;  3DRN A;  2X8H A;  1XVW A;  4PQI A;  1VF4 A;  3TJJ A;  3LQ7 A;  1NM3 A;  2HLS A;  1YKC A;  1X5E A;  4FIW A;  5E59 A;  5B7C A;  1YF1 A;  1WWJ A;  4QQ7 A;  5E4W A;  3UJ1 A;  4KCE A;  2FWE A;  4POK A;  4I2T A;  3HYP A;  1OE8 A;  4CHS A;  2V32 A;  4ZL9 A;  3D21 A;  3VPQ A;  3DD3 A;  2XPD A;  3ZL5 A;  3US3 A;  1TXX A;  3HHV A;  4IP1 A;  4I5Q A;  3TKP A;  1ZCP A;  4IKH A;  4OD7 A;  4TOP A;  2WFC A;  3HXS A;  4CW9 A;  5IIZ A;  1B48 A;  1QMV A;  1EWX A;  3G9B A;  3IXR A;  1OC9 B;  3ERW A;  1F2E A;  3IRA A;  4WBJ A;  1HNB A;  1H4O A;  1OC8 A;  1TK0 B;  2JAD A;  2TRC P;  3RAZ A;  3L9V A;  3ZRE A;  2VLU A;  1K0B A;  3EU3 A;  3ZML A;  1IYI A;  4K0G A;  5HR1 A;  4MLY A;  3MNG A;  5HR2 A;  5AIV A;  6GSY A;  2IJY A;  3NOF A;  1E2Y A;  4NXI A;  4TR0 A;  1V98 A;  2M72 A;  1SJI A;  2VIM A;  1EV4 A;  5JWR B;  1FOV A;  2GDR A;  3LXZ A;  2E7P A;  3TJK A;  1B8X A;  1EEM A;  1XZO A;  3QOU A;  4HQS A;  2WRT A;  3F63 A;  2WUL A;  4L5O A;  2C0F A;  1AIU A;  4MF5 A;  4ID0 A;  4TR4 A;  4LL1 B;  5IMC A;  1WE0 A;  1MDI A;  2K8V A;  3GYK A;  3VWX A;  4MP4 A;  4FYU A;  2B1K A;  1Y6E A;  6GSU A;  3C8E A;  2MBS A;  2LNT A;  3CSH A;  3P8W A;  2H66 A;  3IAS 2;  1DUG A;  3M1G A;  4X0X A;  2OE3 A;  3GV1 A;  3Q18 A;  5F8B A;  1NW2 A;  5F06 A;  5J9C A;  1AQV A;  1EZK A;  5EVO A;  4POM A;  1WPI A;  2RM5 A;  5FHI A;  3EE2 A;  3KP8 A;  4HU7 A;  1ERU A;  3FR3 A;  3LEF A;  1VF3 A;  4POB A;  2XC2 A;  5ECS A;  1SYR A;  2WB9 A;  3IC4 A;  2FHE A;  3TB2 A;  3HJM A;  3UIW A;  3P7X A;  3TGZ A;  5L71 A;  2CAQ A;  2YCD A;  4KAE A;  5D9V A;  1YEX A;  4HZ2 A;  5CRD A;  3TKR A;  2HI7 A;  4L5L A;  2FLS A;  5HR0 A;  4MCU A;  5AIS A;  4HUA A;  2REM A;  1NHY A;  1AAZ A;  2GZY A;  4TR1 A;  3Q6O A;  2VD1 A;  4HJ2 A;  5KN0 A;  1OVN A;  1ZGN A;  2EIQ A;  4GST A;  4AJ7 A;  5B6M A;  4MDC A;  4EE0 A;  1U87 A;  1GNW A;  5DJL A;  3EIN A;  1WOU A;  1RQM A;  3FR6 A;  3H8Q A;  2B1L A;  3GTU A;  2KHP A;  1XBS A;  2VAF A;  4HQZ A;  1J9B A;  1A2J A;  8GSS A;  17GS A;  1B4P A;  5KN3 A;  1Y25 A;  4O92 A;  6GSS A;  2C8U A;  4JRR A;  2PUK C;  1K0N A;  4RI7 A;  2DLX A;  2ON7 A;  2DJJ A;  4IGJ A;  3GUR A;  2L6C A;  1K0A A;  2F8A A;  3L9S A;  3ZVJ D;  1XOB A;  5JCU A;  1G7E A;  1SKS B;  4N0V A;  2GGT A;  2LQQ A;  3FRC A;  3GA4 A;  3D4T A;  3TUE A;  2OBK A;  4O32 A;  2H72 A;  2C4J A;  5G31 A;  2YWN A;  1YJ6 A;  3VLN A;  4RUV A;  4MJC A;  3WGX A;  5CO3 A;  5CRE A;  1QK8 A;  1TKD B;  3F4R A;  2H6X A;  1JHB A;  1O8W A;  1FVJ A;  4L8E A;  5CAX A;  3R2Q A;  4V2M A;  3EMX A;  4ECB A;  5EL8 A;  3VUR A;  1HQO A;  2YPM A;  3I43 A;  5B8A A;  1GSF A;  3W8S A;  3P90 A;  1JZR A;  1O6J A;  1NHO A;  3HY2 A;  2PGT A;  2V6K A;  4TR1 B;  2IWT A;  1YF0 A;  1O73 A;  3EVI A;  5G1L A;  2YNX A;  4KW6 A;  3F0I A;  3TKQ A;  4YQU A;  3IOS A;  3IDV A;  3HJP A;  2FD3 A;  5HR3 A;  2HNL A;  3JCM L;  3KH9 A;  1AXD A;  1FB0 A;  4IS0 A;  4O7H A;  5D9T A;  3GTU B;  3UEM A;  4NV2 A;  4MA9 A;  1RW1 A;  1GSY A;  1USB A;  2VM1 A;  3IBH A;  2DJ3 A;  1BX9 A;  1YY7 A;  2EIR A;  1U3I A;  4N0Z A;  2DJ0 A;  2C80 A;  3MAK A;  3BD2 A;  2B6M A;  4KUN A;  1EOH A;  2GVP A;  2CV4 A;  3PH9 A;  1CQG A;  2GST A;  3HD5 A;  4GXZ A;  4POL A;  2V2G A;  3MDK A;  3IR4 A;  3F9U A;  3ZFB A;  2ZNM A;  4TVE A;  2KP2 A;  1F37 A;  3I6A A;  1N8J A;  1K0D A;  2JZT A;  3TJG A;  3UBL A;  4BA7 A;  4MAB A;  1C72 A;  1A2M A;  4H86 A;  3OR5 A;  4OCE A;  3PR8 A;  2IME A;  1EEJ A;  1N2A A;  1GLQ A;  1V40 A;  4Q5F A;  2VCZ A;  5AGY A;  1UN2 A;  5ECQ B;  2QKE A;  5IMV A;  4WF5 A;  2GT6 A;  2IFQ B;  3C71 A;  1J0F A;  4IBP A;  4ML6 A;  2YWI A;  2LJK A;  4XS1 A;  4AJ8 A;  5ELA A;  5J4U A;  2HYX A;  3C1S A;  2N5A A;  3A2X A;  1PSQ A;  1Q98 A;  2K6V A;  2LNS A;  1TK8 B;  3QPM A;  2OKA A;  4IQA A;  2X8G A;  3DIE A;  1THX A;  4OFM A;  3GHA A;  3QAW A;  1M0U A;  1PKZ A;  2H6Z A;  2AV4 A;  2E2G A;  3RBT A;  1GUM A;  4ZBD A;  1VRS D;  2R5G A;  3ZIJ A;  3UVT A;  2CAI A;  2QSI A;  4TW5 A;  4KSO A;  4G9H A;  3HZ4 A;  3GIX A;  4MK3 A;  5GSS A;  4IP6 A;  1JFU A;  4TXO A;  10GS A;  3QAV A;  2X64 A;  1A24 A;  2C3N A;  2H01 A;  1WRY A;  2IMD A;  5DQY A;  1FO5 A;  2NVL A;  3EWL A;  2LST A;  16GS A;  3HVX A;  4K1F A;  2AUV A;  2J23 A;  4EDZ A;  1R4W A;  3ERF A;  1X9S B;  3CSI A;  2LRN A;  3QDN A;  3A5W A;  3LSZ A;  4TXV A;  4WET A;  1ZYQ B;  5CRG A;  3VWU A;  1A2L A;  1G0T A;  4EVM A;  3FK8 A;  4NPB A;  3RHC A;  1HNC A;  4J57 E;  2VLV A;  1Z7R A;  3IAM 2;  1GUK A;  3BJ5 A;  4F9Z A;  4I2U A;  2B5X A;  3MSZ A;  5IO2 A;  3KEB A;  1WP0 A;  3EYT A;  1X9W B;  4MPG A;  3LJR A;  6GSW A;  4KH7 A;  4DSR A;  2L4C A;  4GQF A;  1Z7P A;  4PGT A;  5GZZ B;  2H0H A;  5ECN B;  5KN2 A;  4Q5Q A;  1X0R A;  2GSQ A;  1XWA A;  1SEN A;  5J3R A;  1SK2 A;  4EDY A;  2M80 A;  5COH A;  4HEA 2;  4XRD A;  2YWM A;  4X43 A;  2O8V B;  3CTG A;  2FCH A;  4XRA A;  1GTB A;  2PMT A;  2C0E A;  3RPN A;  2YAN A;  2R3X A;  4LMV A;  7GSS A;  3H93 A;  2C3Q A;  4OCF A;  1T4Z A;  2NPB A;  4AF2 A;  2JSZ A;  1KEB A;  2GQL A;  4OMV A;  3EU4 A;  3BCK A;  4TXO B;  2DBC A;  1LJR A;  1BYE A;  2C0D A;  1OAZ A;  2ALB A;  4GWR A;  4XHM A;  1MDJ A;  2JU5 A;  1HYU A;  1JLW A;  3IK7 A;  2WDU A;  4EUY A;  2VUP A;  5J5N A;  3UL3 A;  1XPV A;  2C3T A;  4MJE A;  1GUH A;  4MZB A;  1OKT A;  4F03 A;  2WS2 A;  3ZVJ A;  1UA5 A;  3VPT A;  3L0H A;  2I1U A;  3ME7 A;  5EPF A;  3ZTL A;  4ACS A;  1AQW A;  1ERV A;  2E0Q A;  5D96 A;  6GSX A;  2MYG A;  1TRU A;  2RM6 A;  5B6N A;  2N5B A;  3E0U A;  2A4V A;  3W6G A;  3KJY A;  3HVV A;  4N11 A;  3TKS A;  3LWA A;  4IHU A;  3TRQ A;  3ZYW A;  1T8E B;  2YWO A;  2KLX A;  5IO0 A;  1YQ1 A;  2LV3 A;  4JBB A;  4ZBB A;  5H5S A;  3EMP A;  5KN1 A;  3LFL A;  1FW1 A;  2H1B A;  1OC3 A;  2KOK A;  1IYH A;  4PXO A;  4BVY A;  4N30 A;  2FA4 A;  2V6O A;  1S3C A;  3DEX A;  5ECH B;  4PNG A;  5ECR B;  2LRT A;  1Z3E A;  2L57 A;  1BAY A;  3CXG A;  1AUC A;  4ZBA A;  2L59 A;  3ZMK A;  1YZX A;  3A2V A;  2VCV A;  2DMM A;  2M46 A;  2LTK A;  5B8B A;  4ZIL A;  4HU9 A;  3DYR A;  3D6I A;  2K8S A;  2GLR A;  1XWK A;  3KGK A;  1ZOF A;  5DBQ A;  2F9S A;  1XIY A;  4DVC A;  1E6B A;  4HOJ A;  3LG6 A;  4LMW A;  3APQ A;  2H70 A;  4MZC A;  5D73 A;  2FY6 A;  3H4K A;  5C00 A;  5ABR A;  2XHF A;  1T3B A;  2PER A;  3G7J A;  2A2R A;  3KD0 A;  1XWC A;  4WKW A;  2H6Y A;  2YV7 A;  3I69 A;  3QMX A;  4GF0 A;  5HFK A;  4OO4 A;  5F05 A;  1TDI A;  1JLV A;  5HQP A;  4DEJ A;  2GSS A;  3K8N A;  1W89 A;  3APO A;  3E9J B;  2B5E A;  5G30 A;  1K0M A;  5D93 A;  5D9W A;  1X9M B;  3VI5 A;  3TKS C;  1WMJ A;  3HCZ A;  3HJO A;  3UAR A;  1ZL9 A;  3KP9 A;  1FHE A;  1O8X A;  1J08 A;  3APS A;  2ON5 A;  5A5K A;  3DKS A;  1HD2 A;  4BWQ A;  3PGT A;  1T00 A;  2B5Y A;  4HJM A;  4NAX A;  2P31 A;  3VWV A;  3FY7 A;  3GMF A;  5A4W A;  1K0O A;  4KND A;  5DAK A;  5F07 A;  2JSY A;  3RHB A;  2DJK A;  4JR6 A;  14GS A;  2DIY A;  1SK0 A;  4K7O A;  2AB6 A;  1JZW A;  3ERG A;  1XW5 A;  5DAL A;  1PN9 A;  1YKA A;  3G7Y A;  3QR6 A;  3M9J A;  2LRC A;  1XOA A;  1PX6 A;  4G10 A;  4ZXG A;  4XCS A;  4E8H A;  1A8L A;  3ZIV A;  1KNG A;  5DCG A;  4ZIJ A;  1M9A A;  2HRN A;  4P3Y B;  4FYC A;  2G0F A;  1M9B A;  2FUG 2;  2YJH A;  4KE3 A;  4GQC A;  4V1A g;  1XWG A;  1OE7 A;  2IMF A;  2OE1 A;  4YAP A;  4IJ3 A;  3M9K A;  3SWL A;  4ZL8 A;  2VOC A;  2DJ2 A;  3IK9 A;  3U6V A;  4IW9 A;  5J41 A;  2LQO A;  4ML1 A;  3UOM A;  1LBK A;  3FYG A;  2R37 A;  2WGR A;  1FB6 A;  2MMZ A;  3DWV A;  1SL2 B;  2PVQ A;  1GUL A;  1SL0 B;  3AY8 A;  4K9Z A;  2VM2 A;  3DGQ A;  1G7O A;  1I9D A;  5A4V A;  2R4V A;  1YDK A;  1LU4 A;  1QQ2 A;  5IMD A;  4PUA A;  1TU7 A;  2I81 A;  3A3T A;  4ZL7 A;  1K3Y A;  2QGV A;  3CSJ A;  1OKD A;  4X1U A;  3GKM A;  1TP9 A;  4ISD A;  2YZH A;  3C1R A;  3TRP A;  4ILF A;  1SK1 A;  1XXU A;  2OBI A;  3ME8 A;  1PL2 A;  1HNA A;  1U6T A;  1KBN A;  5DJM A;  4KCA A;  2MZC A;  5CP1 A;  5DAK B;  3Q19 A;  2AAW A;  5ENU A;  2L4Q A;  4EF0 A;  1SL1 B;  2VCX A;  1DBY A;  3D4M A;  2VCT A;  3J7Y k;  2PN8 A;  5F0G A;  4JED A;  3I9V 2;  5DAL B;  1Z6M A;  2O7K A;  1TRV A;  4IEL A;  1FVK A;  4BWS A;  4HDE A;  5AN1 A;  2RUE A;  3CMI A;  1EV9 A;  3GFK A;  5FT3 A;  4TR3 A;  1PQN A;  4EL1 A;  6GSV A;  4DSQ A;  3FKF A;  4ECC A;  2CZ3 A;  5EY6 A;  1A0R P;  4HI7 A;  2OE0 A;  1ZYE A;  1AW9 A;  1Q4J A;  5LCZ A;  2V41 A;  4YQV A;  2I3Y A;  3DXB A;  3GH9 A;  4BPY A;  1SJZ A;  1EGR A;  2BTO T;  2FWG A;  3VK9 A;  3BBY A;  3F4T A;  4GRF A;  4GLT A;  4ECI A;  2IIY A;  2H0G A;  3GH6 A;  3IV4 A;  3GKK A;  1MD4 A;  3EUR A;  4KDX A;  3ZZX A;  4QL7 A;  2FWH A;  3KMO A;  4PQ1 A;  2O87 A;  1ZMA A;  3FZ9 A;  1K3O A;  1TRW A;  4EO3 A;  5G5F A;  4IN0 A;  1ACV A;  3QFA C;  4K0N A;  4ZB9 A;  4ZB6 A;  3TOT A;  4K2D A;  1YEP A;  2IPA A;  22GS A;  1GSS A;  2HRF A;  3N5O A;  1DSB A;  2GS3 A;  2X8C A;  3V1W A;  2H74 A;  2C0G A;  2PU9 C;  1VF2 A;  1JZD A;  2OJL A;  5INY A;  1A8Y A;  5LNK e;  4HZ4 A;  3HZ8 A;  2KP1 A;  4FH8 A;  1PMT A;  4ULX A;  3RPP A;  4JE1 A;  3ZRD A;  4EXJ A;  5G1K A;  2PWJ A;  4KX4 A;  1PX7 A;  1ON4 A;  5ID2 A;  2I4A A;  3LGC A;  3CRT A;  4F0C A;  4K7N A;  4L0U A;  4MH2 A;  2G2Q A;  3GL3 A;  1URM A;  2JZS A;  1TU8 A;  3ZIT A;  2EIO A;  1SU9 A;  3FZ5 A;  1R7H A;  3TDG A;  2DML A;  5DDL A;  1QXH A;  2HE3 A;  3KM6 A;  2LKU A;  3M0F A;  2YN1 A;  1WIK A;  2NDO A;  4NMU A;  2YOI A;  3GUS A;  2L5L A;  1PRX A;  1XWB A;  4F2I A;  1T1V A;  3FW2 A;  1GSQ A;  4I97 A;  2H8L A;  1V57 A;  2CX3 A;  2L6D A;  4BL7 A;  5LD0 A;  1X5C A;  2H1A A;  3WYW A;  2LUS A;  1M2B A;  2B3S A;  2NBS A;  5CRW A;  4I8B A;  3TKS E;  1XFL A;  5IMA A;  1GL8 A;  2XPE A;  2KUC A;  3ISO A;  1GSU A;  4J2F A;  3BOA A;  1TJD A;  3NZN A;  3LXT A;  3HVS A;  1TI3 A;  4JR4 A;  4V1A p;  2YP6 A;  4IQ1 A;  1O81 A;  2WZ9 A;  3Q74 A;  4F0B A;  5GAN D;  2O85 A;  1XCC A;  1M2A A;  3VWW A;  1H75 A;  1GP1 A;  5IOX A;  3PIN A;  2GZP A;  2IL3 A;  4LL4 B;  4KDY A;  1V9W A;  5IM9 A;  2R2J A;  2RUF A;  3LYK A;  3J7Y b;  4KSM A;  3WT2 A;  1MTC A;  1BG5 A;  3HKR A;  1PGT A;  2P5Q A;  2NTO A;  1S3D A;  4LA1 A;  2HZE A;  1GSE A;  4PUF C;  2VL2 A;  2F51 A;  5ID2 B;  5DCH A;  1UVZ A;  2BMX A;  4RI6 A;  4V2L A;  1TK5 B;  4K7I A;  3KXO A;  4J56 E;  4OWY A;  4KDU A;  1EGO A;  2VCQ A;  5CNW A;  3IE3 A;  3KTB A;  3DVX A;  3DVW A;  3C73 A;  5ECL B;  4IJI A;  4WR4 A;  2O89 A;  2VLT A;  3C7M A;  3TJB A;  1GLP A;  4KGI A;  1AQX A;  2H30 A;  6GST A;  4WR5 A;  3FEU A;  3KTL A;  2DIZ A;  4XTS A;  1F3A A;  4MZW A;  3S9F A;  5H5R A;  4WXT A;  1BJX A;  4NHW A;  2GQK A;  2YJ7 A;  5H5Q A;  5G5E A;  2DJ1 A;  2D2Z A;  1M99 A;  2LJA A;  3QD9 A;  5AIX A;  5IMZ A;  1V2A A;  5ECP B;  3ZFL A;  3ED3 A;  1SD9 A;  1A23 A;  1R26 A;  4AJ6 A;  3IPZ A;  4MPF A;  2XBI A;  3WGE A;  1PL1 A;  4MJB A;  1GH2 A;  5JWO B;  2CA8 A;  2PPT A;  3N9J A;  4N10 A;  4EKZ A;  4PQH A;  2P5R A;  3FZ4 A;  2HZE B;  3F4S A;  5IMF A;  5HFI A;  2R6K A;  5A4U A;  5IPG A;  2GTU A;  4K8M A;  1T4Y A;  2VL2 C;  2GZZ A;  3MWH A;  4PX1 A;  1EOG A;  4MF7 A;  2RII A;  3HDC A;  4F82 A;  3GX8 A;  4ZB8 A;  2PBJ A;  2JAC A;  3LOR A;  5HFG A;  2JZR A;  2RLI A;  5ELG A;  4GSN A;  2DSA A;  1ERW A;  5J9B A;  3GST A;  4GSS A;  1MD3 A;  18GS A;  1ERT A;  1THO A;  2OAC A;  1ABA A;  1ZZY A;  2H71 A;  3GRX A;  3WD6 A;  2Z9S A;  3F8U A;  4WBR D;  3UAP A;  5C04 A;  5GAP D;  3GNJ A;  3RDW A;  4L0W A;  2HFD A;  1SYX A;  1S3A A;  2AJQ B;  3P2A A;  2VL9 A;  1T7P B;  3O3T A;  2LEG A;  2AYT A;  3GKX A;  3O76 A;  4DSS A;  1F6M C;  3O6T A; 
#chains in the Genus database with same CATH topology
 4FO5 A;  2MMN A;  3FZA A;  4RQX A;  5CYY A;  2H1G A;  4O5R A;  3DML A;  3UBK A;  2B7J A;  3GL5 A;  2J9H A;  4Z7X A;  11GS A;  2HSH A;  2I9H A;  13GS A;  2MBT A;  4TRX A;  5D9X A;  3VI7 A;  5JCW A;  1G6Y A;  2YV9 A;  5ECO B;  3BCI A;  3TOU A;  2K18 A;  2H73 A;  2HXK A;  1ML6 A;  3L78 A;  5KEJ A;  2TRX A;  2GSR A;  2L5O A;  1XVQ A;  2LS5 A;  4MJA A;  2FWF A;  5IOW A;  2HZF A;  4IVF A;  4NHZ A;  3KCM A;  4XS6 A;  2FNO A;  1GTI A;  1K3L A;  2F8F A;  1B4Q A;  1F9M A;  1SJ6 A;  2E2M A;  1F3B A;  12GS A;  2IFQ A;  2IMI A;  4O5Q A;  1DE2 A;  1I5G A;  3VFI A;  2A2S A;  3IA1 A;  1MEK A;  2P0G A;  1GTA A;  1U3A A;  3TCO A;  1O85 A;  1BQ7 A;  2WJU A;  4WF4 A;  1O7U A;  3FR9 A;  5BMU A;  4KB3 A;  3WGD A;  1GNE A;  1A0F A;  3NIV A;  3CYN A;  3FHK A;  1JZO A;  1V58 A;  4RQR A;  3UMA A;  1G6W A;  3W8J A;  2FA8 A;  1BED A;  1TRS A;  5DVB A;  4PNF A;  3F6D A;  4D73 A;  4EC0 A;  4I6X A;  2GT5 A;  2H0I A;  2H76 A;  4JU5 A;  2VO4 A;  1W4V A;  3L4N A;  2A2P A;  1GSD A;  1WJK A;  3LYP A;  2QC7 A;  2LJR A;  1FAA A;  3WT1 A;  2CVK A;  4G19 A;  4JZQ A;  3TRX A;  3D22 A;  1X5D A;  4GCI A;  2ZUP A;  2DC5 A;  2CQ9 A;  1PA3 A;  1CQH A;  4YAV A;  2VCW A;  5CRH A;  5DQS A;  4K6X A;  2H19 A;  5IQY A;  4Q5N A;  4DSS B;  4HS1 A;  3KH7 A;  2IMK A;  4FYB A;  2VL3 A;  1R5A A;  4YH2 A;  3FMW A;  1SD8 A;  1QGV A;  1GRX A;  3GN3 A;  2CX4 A;  2MMO A;  1AC1 A;  1M7T A;  1SKW B;  2MMA A;  3IHQ A;  3UVH A;  3SBC A;  3G7I A;  2FGX A;  2F3M A;  1KTE A;  1B9Y C;  1QUW A;  1EP7 A;  3HVN A;  3U5R E;  5JCG A;  1NSW A;  4XS4 A;  4YQM A;  2C1Y A;  4E8E A;  20GS A;  2V1M A;  4OFN A;  1VF1 A;  2B7K A;  19GS A;  1FG4 A;  2X99 A;  3KMN A;  5G2Z A;  2K9F A;  4K5R A;  2IN3 A;  3F3Q A;  1GWC A;  1TI1 A;  1RK4 A;  4MH3 A;  5GST A;  1VGL A;  4OO5 A;  1QFN A;  1ILO A;  1Z5Y E;  4OFT A;  3GKN A;  3E3E A;  4G2E A;  4V2N A;  4AGS A;  2ES7 A;  2HT9 A;  4BVX A;  4ECJ A;  1DE1 A;  3L9U A;  2CVB A;  4GTU A;  3KIJ A;  2VD0 A;  2H75 A;  5ECI B;  4MNN A;  1PKW A;  4Q5R A;  3H1N A;  4WEY A;  3TJF A;  4D73 B;  3CBU A;  1MDK A;  2H1D A;  2CVD A;  1R5P A;  3F6F A;  2XBQ A;  9GSS A;  2PVO C;  3M8N A;  4QL9 A;  3GSS A;  2OAD A;  1K0C A;  1ZYN A;  3GX0 A;  4TKY A;  4XIH A;  1TW9 A;  5D8I A;  5IPH A;  1GTU A;  2TIR A;  1PD2 1;  4KA0 A;  5FWG A;  1TTZ A;  3D5J A;  1Z9H A;  1M2D A;  1OC9 A;  2YZU A;  3A2W A;  5ECM B;  1ST9 A;  1TOF A;  3CRU A;  1SKR B;  1OYJ A;  3F3R A;  5JWQ B;  4NWY A;  2BJX A;  2ZCT A;  4NV5 A;  4TN8 A;  1XW6 A;  3D0Z A;  2CZ2 A;  2HSY A;  3H79 A;  2EC4 A;  1Z6N A;  2GQM A;  1EP8 A;  3CTF A;  3QCP A;  1U88 A;  3EC3 A;  2OA7 A;  1B9X C;  4PUR A;  5ECK B;  4CDO A;  4LLR A;  3M3M A;  4MF6 A;  4XS4 B;  2N5F A;  2WCI A;  1XW9 A;  2CT6 A;  2JL4 A;  1UC7 A;  3ZLP A;  3HA9 A;  3QAG A;  3KZQ A;  4MMM A;  2AHE A;  3QFB C;  3DRN A;  2X8H A;  1XVW A;  4PQI A;  1VF4 A;  3TJJ A;  3LQ7 A;  1NM3 A;  2HLS A;  1M3I A;  1YKC A;  1X5E A;  4FIW A;  5E59 A;  5B7C A;  1YF1 A;  4K5S A;  1WWJ A;  4QQ7 A;  5E4W A;  3UJ1 A;  4KCE A;  2FWE A;  4POK A;  4I2T A;  3HYP A;  1OE8 A;  4CHS A;  2V32 A;  4ZL9 A;  3D21 A;  3VPQ A;  3DD3 A;  2XPD A;  3ZL5 A;  3US3 A;  1TXX A;  3HHV A;  4IP1 A;  4I5Q A;  3TKP A;  1ZCP A;  4IKH A;  4OD7 A;  4G0I A;  3MYD A;  4TOP A;  2WFC A;  3HXS A;  4CW9 A;  5IIZ A;  1B48 A;  1QMV A;  1EWX A;  3G9B A;  3IXR A;  1OC9 B;  3ERW A;  1F2E A;  3IRA A;  4WBJ A;  1HNB A;  1H4O A;  1OC8 A;  1TK0 B;  2JAD A;  2TRC P;  3RAZ A;  3L9V A;  3ZRE A;  2VLU A;  1K0B A;  3EU3 A;  3ZML A;  1IYI A;  4K0G A;  5HR1 A;  4MLY A;  2X49 A;  3MNG A;  5HR2 A;  5AIV A;  6GSY A;  2IJY A;  3NOF A;  1E2Y A;  4NXI A;  4TR0 A;  1V98 A;  2M72 A;  1SJI A;  2VIM A;  1EV4 A;  5JWR B;  1FOV A;  2GDR A;  3LXZ A;  2E7P A;  3TJK A;  1B8X A;  1EEM A;  1XZO A;  3QOU A;  4HQS A;  2WRT A;  3F63 A;  2WUL A;  4L5O A;  2C0F A;  4X4J A;  1AIU A;  4BL7 B;  4MF5 A;  4ID0 A;  4TR4 A;  4LL1 B;  5IMC A;  1WE0 A;  1MDI A;  2K8V A;  3GYK A;  3VWX A;  4MP4 A;  4FYU A;  2B1K A;  1Y6E A;  6GSU A;  3C8E A;  2MBS A;  2LNT A;  3CSH A;  3P8W A;  2H66 A;  3IAS 2;  1DUG A;  3M1G A;  4X0X A;  2OE3 A;  3GV1 A;  3Q18 A;  5F8B A;  1NW2 A;  5F06 A;  4USS A;  5J9C A;  1AQV A;  2A4H A;  1EZK A;  5EVO A;  4POM A;  1WPI A;  2RM5 A;  5FHI A;  3EE2 A;  3KP8 A;  4HU7 A;  1ERU A;  3FR3 A;  3LEF A;  1VF3 A;  4POB A;  2XC2 A;  5ECS A;  1SYR A;  2WB9 A;  3IC4 A;  2FHE A;  3TB2 A;  3MIX A;  3HJM A;  3UIW A;  3P7X A;  3TGZ A;  5L71 A;  2CAQ A;  2YCD A;  4KAE A;  5D9V A;  1YEX A;  4HZ2 A;  5CRD A;  3TKR A;  2HI7 A;  4L5L A;  2FLS A;  5HR0 A;  4MCU A;  5AIS A;  4HUA A;  2REM A;  1NHY A;  1AAZ A;  2GZY A;  4TR1 A;  3Q6O A;  2VD1 A;  4HJ2 A;  5KN0 A;  1OVN A;  1ZGN A;  2EIQ A;  4GST A;  4AJ7 A;  5B6M A;  4MDC A;  4EE0 A;  1U87 A;  1GNW A;  5DJL A;  3EIN A;  1WOU A;  1RQM A;  3FR6 A;  3H8Q A;  2B1L A;  3GTU A;  4FQU A;  2KHP A;  1XBS A;  2VAF A;  4HQZ A;  1J9B A;  1A2J A;  8GSS A;  17GS A;  1B4P A;  5KN3 A;  1Y25 A;  4O92 A;  6GSS A;  2C8U A;  4JRR A;  2PUK C;  1K0N A;  4RI7 A;  2DLX A;  2ON7 A;  2DJJ A;  4O5U A;  4IGJ A;  3GUR A;  2L6C A;  1K0A A;  2F8A A;  3L9S A;  3ZVJ D;  1XOB A;  5JCU A;  1G7E A;  1SKS B;  4N0V A;  2GGT A;  2R0C A;  2LQQ A;  3FRC A;  3GA4 A;  3D4T A;  3TUE A;  2OBK A;  4O32 A;  2H72 A;  2C4J A;  4Z2T A;  5G31 A;  2YWN A;  1YJ6 A;  3VLN A;  4RUV A;  4MJC A;  3WGX A;  5CO3 A;  5CRE A;  1QK8 A;  1TKD B;  3F4R A;  2H6X A;  1JHB A;  1O8W A;  1FVJ A;  4L8E A;  5CAX A;  3R2Q A;  4V2M A;  3EMX A;  4ECB A;  5EL8 A;  3VUR A;  1HQO A;  2YPM A;  3I43 A;  5B8A A;  1GSF A;  3W8S A;  2R0G A;  3P90 A;  1JZR A;  1O6J A;  1NHO A;  2UZ8 A;  3HY2 A;  2PGT A;  2V6K A;  4TR1 B;  2IWT A;  1YF0 A;  1O73 A;  3EVI A;  5G1L A;  2YNX A;  4KW6 A;  3F0I A;  3TKQ A;  4YQU A;  3IOS A;  3IDV A;  3HJP A;  2FD3 A;  5HR3 A;  2HNL A;  3JCM L;  3KH9 A;  1AXD A;  1FB0 A;  4IS0 A;  4O7H A;  5D9T A;  3GTU B;  3UEM A;  4NV2 A;  4MA9 A;  4EIQ A;  1S3R A;  1RW1 A;  1GSY A;  1USB A;  5BRT A;  2VM1 A;  3IBH A;  2DJ3 A;  1BX9 A;  1YY7 A;  2EIR A;  1U3I A;  4N0Z A;  2DJ0 A;  2C80 A;  3MAK A;  3BD2 A;  2B6M A;  4KUN A;  1EOH A;  4YKF A;  2GVP A;  2CV4 A;  3PH9 A;  1CQG A;  2GST A;  3HD5 A;  4GXZ A;  4POL A;  2V2G A;  3MDK A;  3IR4 A;  3F9U A;  3ZFB A;  2ZNM A;  4TVE A;  2KP2 A;  1F37 A;  3I6A A;  1N8J A;  1K0D A;  2JZT A;  3TJG A;  3UBL A;  4BA7 A;  4MAB A;  1C72 A;  1A2M A;  4H86 A;  3OR5 A;  4OCE A;  3PR8 A;  2IME A;  1EEJ A;  1N2A A;  1GLQ A;  1V40 A;  4Q5F A;  2VCZ A;  5AGY A;  1UN2 A;  5ECQ B;  2QKE A;  5IMV A;  4WF5 A;  2GT6 A;  2IFQ B;  3C71 A;  1XG8 A;  1J0F A;  4IBP A;  4ML6 A;  2YWI A;  2LJK A;  4XS1 A;  4AJ8 A;  5ELA A;  5J4U A;  2HYX A;  3C1S A;  2N5A A;  3A2X A;  1PSQ A;  1Q98 A;  2K6V A;  2LNS A;  1TK8 B;  3QPM A;  2OKA A;  4IQA A;  2X8G A;  3DIE A;  1THX A;  4OFM A;  3GHA A;  3QAW A;  1M0U A;  1PKZ A;  2H6Z A;  2AV4 A;  2E2G A;  3RBT A;  1GUM A;  4ZBD A;  1VRS D;  4YKG A;  2R5G A;  3ZIJ A;  3UVT A;  3CQF A;  2CAI A;  2QSI A;  4TW5 A;  4KSO A;  4G9H A;  3HZ4 A;  3GIX A;  4MK3 A;  5GSS A;  4IP6 A;  1JFU A;  4TXO A;  4A5P A;  10GS A;  3QAV A;  2X64 A;  1A24 A;  2C3N A;  2H01 A;  1WRY A;  2IMD A;  5DQY A;  1FO5 A;  2NVL A;  3EWL A;  2LST A;  16GS A;  3HVX A;  4K1F A;  2AUV A;  2J23 A;  4EDZ A;  1R4W A;  3ERF A;  1X9S B;  3CSI A;  2LRN A;  3QDN A;  3A5W A;  3LSZ A;  4TXV A;  4WET A;  2HRA A;  5CRG A;  3VWU A;  1ZYQ B;  1A2L A;  1G0T A;  4EVM A;  3FK8 A;  4NPB A;  3RHC A;  1HNC A;  4J57 E;  2VLV A;  1Z7R A;  3IAM 2;  1GUK A;  3BJ5 A;  4F9Z A;  4I2U A;  2B5X A;  3MSZ A;  5IO2 A;  3KEB A;  5KOW A;  3LW9 A;  1WP0 A;  3EYT A;  1X9W B;  4MPG A;  3LJR A;  6GSW A;  4KH7 A;  4DSR A;  2L4C A;  4GQF A;  1Z7P A;  4PGT A;  5GZZ B;  2H0H A;  5ECN B;  5KN2 A;  4Q5Q A;  1X0R A;  2GSQ A;  1XWA A;  1SEN A;  5J3R A;  1SK2 A;  4EDY A;  2M80 A;  5COH A;  4HEA 2;  4XRD A;  2YWM A;  4BVX B;  4X43 A;  2O8V B;  3CTG A;  2FCH A;  4XRA A;  1GTB A;  2PMT A;  2C0E A;  3RPN A;  2HRK A;  2YAN A;  2R3X A;  4LMV A;  7GSS A;  3H93 A;  2C3Q A;  4OCF A;  1T4Z A;  2NPB A;  4AF2 A;  2JSZ A;  1KEB A;  2GQL A;  4OMV A;  3EU4 A;  3BCK A;  4EIP A;  4TXO B;  2DBC A;  1LJR A;  1BYE A;  2C0D A;  1OAZ A;  2ALB A;  4GWR A;  4XHM A;  1MDJ A;  2JU5 A;  1HYU A;  1JLW A;  3IK7 A;  2WDU A;  4EUY A;  2VUP A;  5J5N A;  3UL3 A;  1XPV A;  2C3T A;  4MJE A;  1GUH A;  4G0L A;  4MZB A;  1OKT A;  4KF9 A;  4F03 A;  2WS2 A;  3ZVJ A;  1UA5 A;  3VPT A;  3L0H A;  2I1U A;  3ME7 A;  5EPF A;  3ZTL A;  4ACS A;  1AQW A;  1ERV A;  2E0Q A;  5D96 A;  6GSX A;  2MYG A;  1TRU A;  2RM6 A;  5B6N A;  3A5I A;  2N5B A;  2QA1 A;  3E0U A;  2A4V A;  3W6G A;  3KJY A;  3HVV A;  4N11 A;  3TKS A;  3LWA A;  4IHU A;  3TRQ A;  3ZYW A;  1T8E B;  3EPT A;  2YWO A;  2KLX A;  5IO0 A;  1YQ1 A;  2LV3 A;  4JBB A;  4ZBB A;  5H5S A;  3EMP A;  5KN1 A;  3LFL A;  1FW1 A;  2H1B A;  1OC3 A;  2KOK A;  1IYH A;  4PXO A;  4BVY A;  4N30 A;  2FA4 A;  2V6O A;  1S3C A;  3DEX A;  5ECH B;  4PNG A;  5ECR B;  2LRT A;  1Z3E A;  2L57 A;  1BAY A;  3CXG A;  1AUC A;  4ZBA A;  2L59 A;  3ZMK A;  1YZX A;  3A2V A;  2VCV A;  2DMM A;  2M46 A;  2LTK A;  5B8B A;  4ZIL A;  4HU9 A;  3DYR A;  3D6I A;  2K8S A;  2GLR A;  1XWK A;  3KGK A;  1ZOF A;  5DBQ A;  2F9S A;  1XIY A;  4DVC A;  1E6B A;  4HOJ A;  1FOH A;  3LG6 A;  4LMW A;  3APQ A;  2H70 A;  4MZC A;  5D73 A;  2FY6 A;  3H4K A;  5C00 A;  5ABR A;  2XHF A;  1T3B A;  2PER A;  3G7J A;  2A2R A;  3KD0 A;  1XWC A;  4WKW A;  2H6Y A;  2YV7 A;  3I69 A;  3QMX A;  4GF0 A;  5HFK A;  4OO4 A;  2DKH A;  1TDI A;  5F05 A;  1JLV A;  5HQP A;  4DEJ A;  2GSS A;  3K8N A;  1W89 A;  3APO A;  3E9J B;  2B5E A;  5G30 A;  1K0M A;  5D93 A;  4PTS A;  5D9W A;  1X9M B;  3VI5 A;  3TKS C;  1WMJ A;  3HCZ A;  3HJO A;  3UAR A;  1ZL9 A;  3KP9 A;  1FHE A;  1O8X A;  1J08 A;  3APS A;  2ON5 A;  5A5K A;  3DKS A;  1HD2 A;  4BWQ A;  3PGT A;  1T00 A;  2B5Y A;  4HJM A;  4NAX A;  2P31 A;  3VWV A;  3FY7 A;  3GMF A;  5A4W A;  1K0O A;  4KND A;  5DAK A;  5F07 A;  2JSY A;  3RHB A;  2DJK A;  4JR6 A;  4BVY B;  14GS A;  2DIY A;  1SK0 A;  4K7O A;  2AB6 A;  1JZW A;  3ERG A;  2DKI A;  1XW5 A;  5DAL A;  1PN9 A;  1YKA A;  3G7Y A;  3QR6 A;  3M9J A;  2LRC A;  1XOA A;  1PX6 A;  4G10 A;  4ZXG A;  4XCS A;  4E8H A;  1A8L A;  3ZIV A;  1KNG A;  5DCG A;  4ZIJ A;  1M9A A;  2HRN A;  4P3Y B;  4FYC A;  2G0F A;  1M9B A;  2FUG 2;  2YJH A;  4KE3 A;  4GQC A;  4V1A g;  1XWG A;  1OE7 A;  2IMF A;  2OE1 A;  4YAP A;  4IJ3 A;  3M9K A;  3SWL A;  4ZL8 A;  2VOC A;  2DJ2 A;  3R3E A;  3IK9 A;  3U6V A;  4IW9 A;  4CY8 A;  5J41 A;  2LQO A;  4ML1 A;  3UOM A;  1LBK A;  3FYG A;  2R37 A;  2WGR A;  1FB6 A;  2MMZ A;  1PN0 A;  3DWV A;  1SL2 B;  2PVQ A;  1GUL A;  1SL0 B;  4G0K A;  4ICY A;  3AY8 A;  4K9Z A;  2VM2 A;  3DGQ A;  1G7O A;  1I9D A;  5A4V A;  4CY6 A;  2R4V A;  1YDK A;  1LU4 A;  1QQ2 A;  5IMD A;  4PUA A;  1TU7 A;  2I81 A;  3A3T A;  4ZL7 A;  1K3Y A;  2QGV A;  3CSJ A;  1OKD A;  4X1U A;  3GKM A;  1TP9 A;  4ISD A;  2YZH A;  3C1R A;  3TRP A;  4ILF A;  1SK1 A;  1XXU A;  2OBI A;  3ME8 A;  1PL2 A;  1HNA A;  1U6T A;  1KBN A;  5DJM A;  4KCA A;  2MZC A;  3PPU A;  5CP1 A;  5DAK B;  3Q19 A;  2AAW A;  5ENU A;  2L4Q A;  4EF0 A;  1SL1 B;  2VCX A;  1DBY A;  3D4M A;  2VCT A;  4BIK A;  3J7Y k;  2HSM A;  2PN8 A;  5F0G A;  4JED A;  3I9V 2;  5DAL B;  1Z6M A;  2O7K A;  1TRV A;  4IEL A;  1M3J A;  1FVK A;  4BWS A;  4HDE A;  5AN1 A;  2RUE A;  3CMI A;  1EV9 A;  3GFK A;  5FT3 A;  4TR3 A;  1PQN A;  3IC8 A;  4EL1 A;  2QA2 A;  6GSV A;  4DSQ A;  3FKF A;  4ECC A;  2CZ3 A;  5EY6 A;  1A0R P;  4HI7 A;  2OE0 A;  4Z2U A;  1ZYE A;  1AW9 A;  1Q4J A;  5LCZ A;  2V41 A;  4YQV A;  2I3Y A;  4HSC X;  3DXB A;  3GH9 A;  4BPY A;  1SJZ A;  1EGR A;  2BTO T;  2FWG A;  3VK9 A;  3BBY A;  3F4T A;  4GRF A;  4GLT A;  4ECI A;  2IIY A;  2H0G A;  3GH6 A;  3IV4 A;  3GKK A;  1MD4 A;  3EUR A;  4KDX A;  3ZZX A;  4QL7 A;  2FWH A;  3KMO A;  4PQ1 A;  2O87 A;  1ZMA A;  3FZ9 A;  1K3O A;  1TRW A;  4EO3 A;  5G5F A;  4IN0 A;  1ACV A;  3QFA C;  4K0N A;  4ZB9 A;  4ZB6 A;  3TOT A;  4K2D A;  1YEP A;  2IPA A;  22GS A;  1GSS A;  2HRF A;  3N5O A;  1DSB A;  2GS3 A;  2X8C A;  3V1W A;  2H74 A;  2C0G A;  2PU9 C;  1VF2 A;  1JZD A;  2OJL A;  5INY A;  1A8Y A;  5LNK e;  4HZ4 A;  3HZ8 A;  2KP1 A;  4FH8 A;  1PMT A;  4ULX A;  3RPP A;  4JE1 A;  3ZRD A;  4EXJ A;  5G1K A;  2PWJ A;  4KX4 A;  1PX7 A;  1ON4 A;  5ID2 A;  2I4A A;  3LGC A;  3CRT A;  4F0C A;  4K7N A;  4L0U A;  4MH2 A;  2G2Q A;  3GL3 A;  1URM A;  2JZS A;  1TU8 A;  3ZIT A;  2EIO A;  1SU9 A;  3FZ5 A;  1R7H A;  3TDG A;  2DML A;  5DDL A;  1QXH A;  2HE3 A;  3KM6 A;  2LKU A;  3M0F A;  2YN1 A;  1WIK A;  2NDO A;  4NMU A;  2YOI A;  3GUS A;  2L5L A;  1PRX A;  1XWB A;  4F2I A;  1T1V A;  3FW2 A;  4K2X A;  1GSQ A;  4I97 A;  2H8L A;  1PFO A;  1V57 A;  2CX3 A;  2L6D A;  4BL7 A;  5LD0 A;  1X5C A;  2H1A A;  3WYW A;  2LUS A;  1M2B A;  2B3S A;  2NBS A;  5CRW A;  4I8B A;  3TKS E;  1XFL A;  5IMA A;  1GL8 A;  2XPE A;  2KUC A;  3ISO A;  1GSU A;  4J2F A;  3BOA A;  1TJD A;  3NZN A;  3LXT A;  3HVS A;  1TI3 A;  4JR4 A;  4V1A p;  2YP6 A;  4IQ1 A;  1O81 A;  2WZ9 A;  3Q74 A;  4F0B A;  5GAN D;  2O85 A;  1XCC A;  1M2A A;  3VWW A;  1H75 A;  1GP1 A;  5IOX A;  3PIN A;  2GZP A;  2IL3 A;  4LL4 B;  4KDY A;  1V9W A;  5IM9 A;  2R2J A;  2RUF A;  3LYK A;  3J7Y b;  4KSM A;  3WT2 A;  1MTC A;  1BG5 A;  3HKR A;  1PGT A;  2P5Q A;  2NTO A;  1S3D A;  4LA1 A;  2HZE A;  1GSE A;  4PUF C;  2VL2 A;  2F51 A;  5ID2 B;  5DCH A;  1UVZ A;  2BMX A;  4RI6 A;  4V2L A;  1TK5 B;  4K7I A;  3KXO A;  4J56 E;  4OWY A;  4KDU A;  1EGO A;  2VCQ A;  5CNW A;  3IE3 A;  3KTB A;  3DVX A;  3DVW A;  3C73 A;  5ECL B;  4IJI A;  4WR4 A;  2O89 A;  2VLT A;  3C7M A;  3TJB A;  1GLP A;  4KGI A;  1AQX A;  2H30 A;  6GST A;  4WR5 A;  3FEU A;  3KTL A;  2X4A A;  2DIZ A;  4XTS A;  1F3A A;  4MZW A;  3S9F A;  5H5R A;  4WXT A;  1BJX A;  4NHW A;  2GQK A;  2YJ7 A;  5H5Q A;  2R0P A;  5G5E A;  2DJ1 A;  2D2Z A;  3IHG A;  1M99 A;  2LJA A;  3QD9 A;  5AIX A;  5IMZ A;  1V2A A;  5ECP B;  3ZFL A;  1ZYP A;  3ED3 A;  1SD9 A;  1A23 A;  1R26 A;  4AJ6 A;  3IPZ A;  4MPF A;  2XBI A;  3WGE A;  1PL1 A;  4MJB A;  1GH2 A;  5JWO B;  2CA8 A;  2PPT A;  3N9J A;  4N10 A;  4EKZ A;  4PQH A;  2P5R A;  3FZ4 A;  2HZE B;  3F4S A;  5IMF A;  5HFI A;  2R6K A;  5A4U A;  5IPG A;  2GTU A;  4K8M A;  1T4Y A;  2VL2 C;  2GZZ A;  3MWH A;  4PX1 A;  1EOG A;  4MF7 A;  2RII A;  3HDC A;  4F82 A;  3GX8 A;  4ZB8 A;  2PBJ A;  2JAC A;  3LOR A;  5HFG A;  2JZR A;  2RLI A;  5ELG A;  4GSN A;  2DSA A;  1ERW A;  5J9B A;  3GST A;  4GSS A;  1MD3 A;  18GS A;  1ERT A;  1THO A;  2OAC A;  1ABA A;  1ZZY A;  2H71 A;  3GRX A;  3WD6 A;  2Z9S A;  3F8U A;  4WBR D;  3UAP A;  5C04 A;  5GAP D;  3GNJ A;  3RDW A;  4L0W A;  5KOX A;  2HFD A;  1SYX A;  1S3A A;  2AJQ B;  4Z2R A;  3P2A A;  2VL9 A;  1T7P B;  3O3T A;  2LEG A;  2AYT A;  3GKX A;  3O76 A;  4DSS A;  1F6M C;  3O6T A; 
#chains in the Genus database with same CATH homology
 4FO5 A;  2MMN A;  3FZA A;  4RQX A;  5CYY A;  2H1G A;  4O5R A;  3DML A;  3UBK A;  2B7J A;  3GL5 A;  2J9H A;  4Z7X A;  11GS A;  2HSH A;  2I9H A;  13GS A;  2MBT A;  4TRX A;  5D9X A;  3VI7 A;  5JCW A;  1G6Y A;  2YV9 A;  5ECO B;  3BCI A;  3TOU A;  2K18 A;  2H73 A;  2HXK A;  1ML6 A;  3L78 A;  5KEJ A;  2TRX A;  2GSR A;  2L5O A;  1XVQ A;  2LS5 A;  4MJA A;  2FWF A;  5IOW A;  2HZF A;  4IVF A;  4NHZ A;  3KCM A;  4XS6 A;  2FNO A;  1GTI A;  1K3L A;  2F8F A;  1B4Q A;  1F9M A;  1SJ6 A;  2E2M A;  1F3B A;  12GS A;  2IFQ A;  2IMI A;  4O5Q A;  1DE2 A;  1I5G A;  3VFI A;  2A2S A;  3IA1 A;  1MEK A;  2P0G A;  1GTA A;  1U3A A;  3TCO A;  1O85 A;  1BQ7 A;  2WJU A;  4WF4 A;  1O7U A;  3FR9 A;  5BMU A;  4KB3 A;  3WGD A;  1GNE A;  1A0F A;  3NIV A;  3CYN A;  3FHK A;  1JZO A;  1V58 A;  4RQR A;  3UMA A;  1G6W A;  3W8J A;  2FA8 A;  1BED A;  1TRS A;  5DVB A;  4PNF A;  3F6D A;  4D73 A;  4EC0 A;  4I6X A;  2GT5 A;  2H0I A;  2H76 A;  4JU5 A;  2VO4 A;  1W4V A;  3L4N A;  2A2P A;  1GSD A;  1WJK A;  3LYP A;  2QC7 A;  2LJR A;  1FAA A;  3WT1 A;  2CVK A;  4G19 A;  4JZQ A;  3TRX A;  3D22 A;  1X5D A;  4GCI A;  2ZUP A;  2DC5 A;  2CQ9 A;  1PA3 A;  1CQH A;  4YAV A;  2VCW A;  5CRH A;  5DQS A;  4K6X A;  2H19 A;  5IQY A;  4Q5N A;  4DSS B;  4HS1 A;  3KH7 A;  2IMK A;  4FYB A;  2VL3 A;  1R5A A;  4YH2 A;  3FMW A;  1SD8 A;  1QGV A;  1GRX A;  3GN3 A;  2CX4 A;  2MMO A;  1AC1 A;  1M7T A;  1SKW B;  2MMA A;  3IHQ A;  3UVH A;  3SBC A;  3G7I A;  2FGX A;  2F3M A;  1KTE A;  1B9Y C;  1QUW A;  1EP7 A;  3U5R E;  5JCG A;  1NSW A;  4XS4 A;  4YQM A;  2C1Y A;  4E8E A;  20GS A;  2V1M A;  4OFN A;  1VF1 A;  2B7K A;  19GS A;  1FG4 A;  2X99 A;  3KMN A;  5G2Z A;  2K9F A;  4K5R A;  2IN3 A;  3F3Q A;  1GWC A;  1TI1 A;  1RK4 A;  4MH3 A;  5GST A;  1VGL A;  4OO5 A;  1QFN A;  1ILO A;  1Z5Y E;  4OFT A;  3GKN A;  3E3E A;  4G2E A;  4V2N A;  4AGS A;  2ES7 A;  2HT9 A;  4BVX A;  4ECJ A;  1DE1 A;  3L9U A;  2CVB A;  4GTU A;  3KIJ A;  2VD0 A;  2H75 A;  5ECI B;  4MNN A;  1PKW A;  4Q5R A;  3H1N A;  4WEY A;  3TJF A;  4D73 B;  3CBU A;  1MDK A;  2H1D A;  2CVD A;  1R5P A;  3F6F A;  2XBQ A;  9GSS A;  2PVO C;  3M8N A;  4QL9 A;  3GSS A;  2OAD A;  1K0C A;  1ZYN A;  3GX0 A;  4TKY A;  4XIH A;  1TW9 A;  5D8I A;  5IPH A;  1GTU A;  2TIR A;  1PD2 1;  4KA0 A;  5FWG A;  1TTZ A;  3D5J A;  1Z9H A;  1M2D A;  1OC9 A;  2YZU A;  3A2W A;  5ECM B;  1ST9 A;  1TOF A;  3CRU A;  1SKR B;  1OYJ A;  3F3R A;  5JWQ B;  4NWY A;  2BJX A;  2ZCT A;  4NV5 A;  4TN8 A;  1XW6 A;  3D0Z A;  2CZ2 A;  2HSY A;  3H79 A;  2EC4 A;  1Z6N A;  2GQM A;  1EP8 A;  3CTF A;  3QCP A;  1U88 A;  3EC3 A;  2OA7 A;  1B9X C;  4PUR A;  5ECK B;  4CDO A;  4LLR A;  3M3M A;  4MF6 A;  4XS4 B;  2N5F A;  2WCI A;  1XW9 A;  2CT6 A;  2JL4 A;  1UC7 A;  3ZLP A;  3HA9 A;  3QAG A;  3KZQ A;  4MMM A;  2AHE A;  3QFB C;  3DRN A;  2X8H A;  1XVW A;  4PQI A;  1VF4 A;  3TJJ A;  3LQ7 A;  1NM3 A;  2HLS A;  1YKC A;  1X5E A;  4FIW A;  5E59 A;  5B7C A;  1YF1 A;  4K5S A;  1WWJ A;  4QQ7 A;  5E4W A;  3UJ1 A;  4KCE A;  2FWE A;  4POK A;  4I2T A;  3HYP A;  1OE8 A;  4CHS A;  2V32 A;  4ZL9 A;  3D21 A;  3VPQ A;  3DD3 A;  2XPD A;  3ZL5 A;  3US3 A;  1TXX A;  3HHV A;  4IP1 A;  4I5Q A;  3TKP A;  1ZCP A;  4IKH A;  4OD7 A;  4G0I A;  3MYD A;  4TOP A;  2WFC A;  3HXS A;  4CW9 A;  5IIZ A;  1B48 A;  1QMV A;  1EWX A;  3G9B A;  3IXR A;  1OC9 B;  3ERW A;  1F2E A;  3IRA A;  4WBJ A;  1HNB A;  1H4O A;  1OC8 A;  1TK0 B;  2JAD A;  2TRC P;  3RAZ A;  3L9V A;  3ZRE A;  2VLU A;  1K0B A;  3EU3 A;  3ZML A;  1IYI A;  4K0G A;  5HR1 A;  4MLY A;  2X49 A;  3MNG A;  5HR2 A;  5AIV A;  6GSY A;  2IJY A;  3NOF A;  1E2Y A;  4NXI A;  4TR0 A;  1V98 A;  2M72 A;  1SJI A;  2VIM A;  1EV4 A;  5JWR B;  1FOV A;  2GDR A;  3LXZ A;  2E7P A;  3TJK A;  1B8X A;  1EEM A;  1XZO A;  3QOU A;  4HQS A;  2WRT A;  3F63 A;  2WUL A;  4L5O A;  2C0F A;  4X4J A;  1AIU A;  4BL7 B;  4MF5 A;  4ID0 A;  4TR4 A;  4LL1 B;  5IMC A;  1WE0 A;  1MDI A;  2K8V A;  3GYK A;  3VWX A;  4MP4 A;  4FYU A;  2B1K A;  1Y6E A;  6GSU A;  3C8E A;  2MBS A;  2LNT A;  3CSH A;  3P8W A;  2H66 A;  3IAS 2;  1DUG A;  3M1G A;  4X0X A;  2OE3 A;  3GV1 A;  3Q18 A;  5F8B A;  1NW2 A;  5F06 A;  4USS A;  5J9C A;  1AQV A;  2A4H A;  1EZK A;  5EVO A;  4POM A;  1WPI A;  2RM5 A;  5FHI A;  3EE2 A;  3KP8 A;  4HU7 A;  1ERU A;  3FR3 A;  3LEF A;  1VF3 A;  4POB A;  2XC2 A;  5ECS A;  1SYR A;  2WB9 A;  3IC4 A;  2FHE A;  3TB2 A;  3MIX A;  3HJM A;  3UIW A;  3P7X A;  3TGZ A;  5L71 A;  2CAQ A;  2YCD A;  4KAE A;  5D9V A;  1YEX A;  4HZ2 A;  5CRD A;  3TKR A;  2HI7 A;  4L5L A;  2FLS A;  5HR0 A;  4MCU A;  5AIS A;  4HUA A;  2REM A;  1NHY A;  1AAZ A;  2GZY A;  4TR1 A;  3Q6O A;  2VD1 A;  4HJ2 A;  5KN0 A;  1OVN A;  1ZGN A;  2EIQ A;  4GST A;  4AJ7 A;  5B6M A;  4MDC A;  4EE0 A;  1U87 A;  1GNW A;  5DJL A;  3EIN A;  1WOU A;  1RQM A;  3FR6 A;  3H8Q A;  2B1L A;  3GTU A;  4FQU A;  2KHP A;  1XBS A;  2VAF A;  4HQZ A;  1J9B A;  1A2J A;  8GSS A;  17GS A;  1B4P A;  5KN3 A;  1Y25 A;  4O92 A;  6GSS A;  2C8U A;  4JRR A;  2PUK C;  1K0N A;  4RI7 A;  2DLX A;  2ON7 A;  2DJJ A;  4O5U A;  4IGJ A;  3GUR A;  2L6C A;  1K0A A;  2F8A A;  3L9S A;  3ZVJ D;  1XOB A;  5JCU A;  1G7E A;  1SKS B;  4N0V A;  2GGT A;  2R0C A;  2LQQ A;  3FRC A;  3GA4 A;  3D4T A;  3TUE A;  2OBK A;  4O32 A;  2H72 A;  2C4J A;  4Z2T A;  5G31 A;  2YWN A;  1YJ6 A;  3VLN A;  4RUV A;  4MJC A;  3WGX A;  5CO3 A;  5CRE A;  1QK8 A;  1TKD B;  3F4R A;  2H6X A;  1JHB A;  1O8W A;  1FVJ A;  4L8E A;  5CAX A;  3R2Q A;  4V2M A;  3EMX A;  4ECB A;  5EL8 A;  3VUR A;  1HQO A;  2YPM A;  3I43 A;  5B8A A;  1GSF A;  3W8S A;  2R0G A;  3P90 A;  1JZR A;  1O6J A;  1NHO A;  2UZ8 A;  3HY2 A;  2PGT A;  2V6K A;  4TR1 B;  2IWT A;  1YF0 A;  1O73 A;  3EVI A;  5G1L A;  2YNX A;  4KW6 A;  3F0I A;  3TKQ A;  4YQU A;  3IOS A;  3IDV A;  3HJP A;  2FD3 A;  5HR3 A;  2HNL A;  3JCM L;  3KH9 A;  1AXD A;  1FB0 A;  4IS0 A;  4O7H A;  5D9T A;  3GTU B;  3UEM A;  4NV2 A;  4MA9 A;  4EIQ A;  1RW1 A;  1GSY A;  1USB A;  5BRT A;  2VM1 A;  3IBH A;  2DJ3 A;  1BX9 A;  1YY7 A;  2EIR A;  1U3I A;  4N0Z A;  2DJ0 A;  2C80 A;  3MAK A;  3BD2 A;  2B6M A;  4KUN A;  1EOH A;  4YKF A;  2GVP A;  2CV4 A;  3PH9 A;  1CQG A;  2GST A;  3HD5 A;  4GXZ A;  4POL A;  2V2G A;  3MDK A;  3IR4 A;  3F9U A;  3ZFB A;  2ZNM A;  4TVE A;  2KP2 A;  1F37 A;  3I6A A;  1N8J A;  1K0D A;  2JZT A;  3TJG A;  3UBL A;  4BA7 A;  4MAB A;  1C72 A;  1A2M A;  4H86 A;  3OR5 A;  4OCE A;  3PR8 A;  2IME A;  1EEJ A;  1N2A A;  1GLQ A;  1V40 A;  4Q5F A;  2VCZ A;  5AGY A;  1UN2 A;  5ECQ B;  2QKE A;  5IMV A;  4WF5 A;  2GT6 A;  2IFQ B;  3C71 A;  1J0F A;  4IBP A;  4ML6 A;  2YWI A;  2LJK A;  4XS1 A;  4AJ8 A;  5ELA A;  5J4U A;  2HYX A;  3C1S A;  2N5A A;  3A2X A;  1PSQ A;  1Q98 A;  2K6V A;  2LNS A;  1TK8 B;  3QPM A;  2OKA A;  4IQA A;  2X8G A;  3DIE A;  1THX A;  4OFM A;  3GHA A;  3QAW A;  1M0U A;  1PKZ A;  2H6Z A;  2AV4 A;  2E2G A;  3RBT A;  1GUM A;  4ZBD A;  1VRS D;  4YKG A;  2R5G A;  3ZIJ A;  3UVT A;  2CAI A;  2QSI A;  4TW5 A;  4KSO A;  4G9H A;  3HZ4 A;  3GIX A;  4MK3 A;  5GSS A;  4IP6 A;  1JFU A;  4TXO A;  4A5P A;  10GS A;  3QAV A;  2X64 A;  1A24 A;  2C3N A;  2H01 A;  1WRY A;  2IMD A;  5DQY A;  1FO5 A;  2NVL A;  3EWL A;  2LST A;  16GS A;  3HVX A;  4K1F A;  2AUV A;  2J23 A;  4EDZ A;  1R4W A;  3ERF A;  1X9S B;  3CSI A;  2LRN A;  3QDN A;  3A5W A;  3LSZ A;  4TXV A;  4WET A;  2HRA A;  5CRG A;  3VWU A;  1ZYQ B;  1A2L A;  1G0T A;  4EVM A;  3FK8 A;  4NPB A;  3RHC A;  1HNC A;  4J57 E;  2VLV A;  1Z7R A;  3IAM 2;  1GUK A;  3BJ5 A;  4F9Z A;  4I2U A;  2B5X A;  3MSZ A;  5IO2 A;  3KEB A;  5KOW A;  3LW9 A;  1WP0 A;  3EYT A;  1X9W B;  4MPG A;  3LJR A;  6GSW A;  4KH7 A;  4DSR A;  2L4C A;  4GQF A;  1Z7P A;  4PGT A;  5GZZ B;  2H0H A;  5ECN B;  5KN2 A;  4Q5Q A;  1X0R A;  2GSQ A;  1XWA A;  1SEN A;  5J3R A;  1SK2 A;  4EDY A;  2M80 A;  5COH A;  4HEA 2;  4XRD A;  2YWM A;  4BVX B;  4X43 A;  2O8V B;  3CTG A;  2FCH A;  4XRA A;  1GTB A;  2PMT A;  2C0E A;  3RPN A;  2HRK A;  2YAN A;  2R3X A;  4LMV A;  7GSS A;  3H93 A;  2C3Q A;  4OCF A;  1T4Z A;  2NPB A;  4AF2 A;  2JSZ A;  1KEB A;  2GQL A;  4OMV A;  3EU4 A;  3BCK A;  4EIP A;  4TXO B;  2DBC A;  1LJR A;  1BYE A;  2C0D A;  1OAZ A;  2ALB A;  4GWR A;  4XHM A;  1MDJ A;  2JU5 A;  1HYU A;  1JLW A;  3IK7 A;  2WDU A;  4EUY A;  2VUP A;  5J5N A;  3UL3 A;  1XPV A;  2C3T A;  4MJE A;  1GUH A;  4G0L A;  4MZB A;  1OKT A;  4KF9 A;  4F03 A;  2WS2 A;  3ZVJ A;  1UA5 A;  3VPT A;  3L0H A;  2I1U A;  3ME7 A;  5EPF A;  3ZTL A;  4ACS A;  1AQW A;  1ERV A;  2E0Q A;  5D96 A;  6GSX A;  2MYG A;  1TRU A;  2RM6 A;  5B6N A;  3A5I A;  2N5B A;  2QA1 A;  3E0U A;  2A4V A;  3W6G A;  3KJY A;  3HVV A;  4N11 A;  3TKS A;  3LWA A;  4IHU A;  3TRQ A;  3ZYW A;  1T8E B;  3EPT A;  2YWO A;  2KLX A;  5IO0 A;  1YQ1 A;  2LV3 A;  4JBB A;  4ZBB A;  5H5S A;  3EMP A;  5KN1 A;  3LFL A;  1FW1 A;  2H1B A;  1OC3 A;  2KOK A;  1IYH A;  4PXO A;  4BVY A;  4N30 A;  2FA4 A;  2V6O A;  1S3C A;  3DEX A;  5ECH B;  4PNG A;  5ECR B;  2LRT A;  1Z3E A;  2L57 A;  1BAY A;  3CXG A;  1AUC A;  4ZBA A;  2L59 A;  3ZMK A;  1YZX A;  3A2V A;  2VCV A;  2DMM A;  2M46 A;  2LTK A;  5B8B A;  4ZIL A;  4HU9 A;  3DYR A;  3D6I A;  2K8S A;  2GLR A;  1XWK A;  3KGK A;  1ZOF A;  5DBQ A;  2F9S A;  1XIY A;  4DVC A;  1E6B A;  4HOJ A;  1FOH A;  3LG6 A;  4LMW A;  3APQ A;  2H70 A;  4MZC A;  5D73 A;  2FY6 A;  3H4K A;  5C00 A;  5ABR A;  2XHF A;  1T3B A;  2PER A;  3G7J A;  2A2R A;  3KD0 A;  1XWC A;  4WKW A;  2H6Y A;  2YV7 A;  3I69 A;  3QMX A;  4GF0 A;  5HFK A;  4OO4 A;  2DKH A;  1TDI A;  5F05 A;  1JLV A;  5HQP A;  4DEJ A;  2GSS A;  3K8N A;  1W89 A;  3APO A;  3E9J B;  2B5E A;  5G30 A;  1K0M A;  5D93 A;  4PTS A;  5D9W A;  1X9M B;  3VI5 A;  3TKS C;  1WMJ A;  3HCZ A;  3HJO A;  3UAR A;  1ZL9 A;  3KP9 A;  1FHE A;  1O8X A;  1J08 A;  3APS A;  2ON5 A;  5A5K A;  3DKS A;  1HD2 A;  4BWQ A;  3PGT A;  1T00 A;  2B5Y A;  4HJM A;  4NAX A;  2P31 A;  3VWV A;  3FY7 A;  3GMF A;  5A4W A;  1K0O A;  4KND A;  5DAK A;  5F07 A;  2JSY A;  3RHB A;  2DJK A;  4JR6 A;  4BVY B;  14GS A;  2DIY A;  1SK0 A;  4K7O A;  2AB6 A;  1JZW A;  3ERG A;  2DKI A;  1XW5 A;  5DAL A;  1PN9 A;  1YKA A;  3G7Y A;  3QR6 A;  3M9J A;  2LRC A;  1XOA A;  1PX6 A;  4G10 A;  4ZXG A;  4XCS A;  4E8H A;  1A8L A;  3ZIV A;  1KNG A;  5DCG A;  4ZIJ A;  1M9A A;  2HRN A;  4P3Y B;  4FYC A;  2G0F A;  1M9B A;  2FUG 2;  2YJH A;  4KE3 A;  4GQC A;  4V1A g;  1XWG A;  1OE7 A;  2IMF A;  2OE1 A;  4YAP A;  4IJ3 A;  3M9K A;  3SWL A;  4ZL8 A;  2VOC A;  2DJ2 A;  3R3E A;  3IK9 A;  3U6V A;  4IW9 A;  4CY8 A;  5J41 A;  2LQO A;  4ML1 A;  3UOM A;  1LBK A;  3FYG A;  2R37 A;  2WGR A;  1FB6 A;  2MMZ A;  1PN0 A;  3DWV A;  1SL2 B;  2PVQ A;  1GUL A;  1SL0 B;  4G0K A;  4ICY A;  3AY8 A;  4K9Z A;  2VM2 A;  3DGQ A;  1G7O A;  1I9D A;  5A4V A;  4CY6 A;  2R4V A;  1YDK A;  1LU4 A;  1QQ2 A;  5IMD A;  4PUA A;  1TU7 A;  2I81 A;  3A3T A;  4ZL7 A;  1K3Y A;  2QGV A;  3CSJ A;  1OKD A;  4X1U A;  3GKM A;  1TP9 A;  4ISD A;  2YZH A;  3C1R A;  3TRP A;  4ILF A;  1SK1 A;  1XXU A;  2OBI A;  3ME8 A;  1PL2 A;  1HNA A;  1U6T A;  1KBN A;  5DJM A;  4KCA A;  2MZC A;  3PPU A;  5CP1 A;  5DAK B;  3Q19 A;  2AAW A;  5ENU A;  2L4Q A;  4EF0 A;  1SL1 B;  2VCX A;  1DBY A;  3D4M A;  2VCT A;  3J7Y k;  2HSM A;  2PN8 A;  5F0G A;  4JED A;  3I9V 2;  5DAL B;  1Z6M A;  2O7K A;  1TRV A;  4IEL A;  1FVK A;  4BWS A;  4HDE A;  5AN1 A;  2RUE A;  3CMI A;  1EV9 A;  3GFK A;  5FT3 A;  4TR3 A;  1PQN A;  3IC8 A;  4EL1 A;  2QA2 A;  6GSV A;  4DSQ A;  3FKF A;  4ECC A;  2CZ3 A;  5EY6 A;  1A0R P;  4HI7 A;  2OE0 A;  4Z2U A;  1ZYE A;  1AW9 A;  1Q4J A;  5LCZ A;  2V41 A;  4YQV A;  2I3Y A;  3DXB A;  3GH9 A;  4BPY A;  1SJZ A;  1EGR A;  2BTO T;  2FWG A;  3VK9 A;  3BBY A;  3F4T A;  4GRF A;  4GLT A;  4ECI A;  2IIY A;  2H0G A;  3GH6 A;  3IV4 A;  3GKK A;  1MD4 A;  3EUR A;  4KDX A;  3ZZX A;  4QL7 A;  2FWH A;  3KMO A;  4PQ1 A;  2O87 A;  1ZMA A;  3FZ9 A;  1K3O A;  1TRW A;  4EO3 A;  5G5F A;  4IN0 A;  1ACV A;  3QFA C;  4K0N A;  4ZB9 A;  4ZB6 A;  3TOT A;  4K2D A;  1YEP A;  2IPA A;  22GS A;  1GSS A;  2HRF A;  3N5O A;  1DSB A;  2GS3 A;  2X8C A;  3V1W A;  2H74 A;  2C0G A;  2PU9 C;  1VF2 A;  1JZD A;  2OJL A;  5INY A;  1A8Y A;  5LNK e;  4HZ4 A;  3HZ8 A;  2KP1 A;  4FH8 A;  1PMT A;  4ULX A;  3RPP A;  4JE1 A;  3ZRD A;  4EXJ A;  5G1K A;  2PWJ A;  4KX4 A;  1PX7 A;  1ON4 A;  5ID2 A;  2I4A A;  3LGC A;  3CRT A;  4F0C A;  4K7N A;  4L0U A;  4MH2 A;  2G2Q A;  3GL3 A;  1URM A;  2JZS A;  1TU8 A;  3ZIT A;  2EIO A;  1SU9 A;  3FZ5 A;  1R7H A;  3TDG A;  2DML A;  5DDL A;  1QXH A;  2HE3 A;  3KM6 A;  2LKU A;  3M0F A;  2YN1 A;  1WIK A;  2NDO A;  4NMU A;  2YOI A;  3GUS A;  2L5L A;  1PRX A;  1XWB A;  4F2I A;  1T1V A;  3FW2 A;  4K2X A;  1GSQ A;  4I97 A;  2H8L A;  1V57 A;  2CX3 A;  2L6D A;  4BL7 A;  5LD0 A;  1X5C A;  2H1A A;  3WYW A;  2LUS A;  1M2B A;  2B3S A;  2NBS A;  5CRW A;  4I8B A;  3TKS E;  1XFL A;  5IMA A;  1GL8 A;  2XPE A;  2KUC A;  3ISO A;  1GSU A;  4J2F A;  3BOA A;  1TJD A;  3NZN A;  3LXT A;  3HVS A;  1TI3 A;  4JR4 A;  4V1A p;  2YP6 A;  4IQ1 A;  1O81 A;  2WZ9 A;  3Q74 A;  4F0B A;  5GAN D;  2O85 A;  1XCC A;  1M2A A;  3VWW A;  1H75 A;  1GP1 A;  5IOX A;  3PIN A;  2GZP A;  2IL3 A;  4LL4 B;  4KDY A;  1V9W A;  5IM9 A;  2R2J A;  2RUF A;  3LYK A;  3J7Y b;  4KSM A;  3WT2 A;  1MTC A;  1BG5 A;  3HKR A;  1PGT A;  2P5Q A;  2NTO A;  1S3D A;  4LA1 A;  2HZE A;  1GSE A;  4PUF C;  2VL2 A;  2F51 A;  5ID2 B;  5DCH A;  1UVZ A;  2BMX A;  4RI6 A;  4V2L A;  1TK5 B;  4K7I A;  3KXO A;  4J56 E;  4OWY A;  4KDU A;  1EGO A;  2VCQ A;  5CNW A;  3IE3 A;  3KTB A;  3DVX A;  3DVW A;  3C73 A;  5ECL B;  4IJI A;  4WR4 A;  2O89 A;  2VLT A;  3C7M A;  3TJB A;  1GLP A;  4KGI A;  1AQX A;  2H30 A;  6GST A;  4WR5 A;  3FEU A;  3KTL A;  2X4A A;  2DIZ A;  4XTS A;  1F3A A;  4MZW A;  3S9F A;  5H5R A;  4WXT A;  1BJX A;  4NHW A;  2GQK A;  2YJ7 A;  5H5Q A;  2R0P A;  5G5E A;  2DJ1 A;  2D2Z A;  3IHG A;  1M99 A;  2LJA A;  3QD9 A;  5AIX A;  5IMZ A;  1V2A A;  5ECP B;  3ZFL A;  1ZYP A;  3ED3 A;  1SD9 A;  1A23 A;  1R26 A;  4AJ6 A;  3IPZ A;  4MPF A;  2XBI A;  3WGE A;  1PL1 A;  4MJB A;  1GH2 A;  5JWO B;  2CA8 A;  2PPT A;  3N9J A;  4N10 A;  4EKZ A;  4PQH A;  2P5R A;  3FZ4 A;  2HZE B;  3F4S A;  5IMF A;  5HFI A;  2R6K A;  5A4U A;  5IPG A;  2GTU A;  4K8M A;  1T4Y A;  2VL2 C;  2GZZ A;  3MWH A;  4PX1 A;  1EOG A;  4MF7 A;  2RII A;  3HDC A;  4F82 A;  3GX8 A;  4ZB8 A;  2PBJ A;  2JAC A;  3LOR A;  5HFG A;  2JZR A;  2RLI A;  5ELG A;  4GSN A;  2DSA A;  1ERW A;  5J9B A;  3GST A;  4GSS A;  1MD3 A;  18GS A;  1ERT A;  1THO A;  2OAC A;  1ABA A;  1ZZY A;  2H71 A;  3GRX A;  3WD6 A;  2Z9S A;  3F8U A;  4WBR D;  3UAP A;  5C04 A;  5GAP D;  3GNJ A;  3RDW A;  4L0W A;  5KOX A;  2HFD A;  1SYX A;  1S3A A;  2AJQ B;  4Z2R A;  3P2A A;  2VL9 A;  1T7P B;  3O3T A;  2LEG A;  2AYT A;  3GKX A;  3O76 A;  4DSS A;  1F6M C;  3O6T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...