4AJ6A

Crystallographic structure of thioredoxin from litopenaeus vannamei (reduced form).
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
105
structure length
104
Chain Sequence
MVYQVKDQEDFTKQLNEAGNKLVVIDFYATWCGPCKMIAPKLEELSQSMSDVVFLKVDVDECEDIAQDNQIACPTFLFMKNGQKLDSLSGANYDKLLELVEKNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords THIOREDOXIN
publication title Expression, Purification, Crystallization and X-Ray Crystallographic Studies of Different Redox States of the Active Site of Thioredoxin 1 from the Whiteleg Shrimp Litopenaeus Vannamei
pubmed doi rcsb
source organism Litopenaeus vannamei
total genus 36
structure length 104
sequence length 105
chains with identical sequence B
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 2012-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4aj6A00
3CBUA 3GKMA 4HZ4A 3HJPA 3TJJA 2C4JA 4X1UA 2IFQA 1OC9B 3GH9A 5D9VA 1TRSA 2LNTA 2CZ2A 2C0FA 4Q5NA 5JCGA 5F8BA 1UC7A 4FYBA 1Z5YE 4F2IA 2GS3A 3MWHA 1T00A 4MMMA 3DYRA 2OACA 4ZB9A 4PX1A 2RUFA 2GZYA 5DDLA 4WXTA 3DMLA 2H1GA 3DEXA 5HR3A 2OE0A 1ERTA 2NPBA 4BA7A 4GXZA 2L59A 5FT3A 4ECCA 3EU4A 1HNBA 1ZCPA 4BVXA 3M9JA 3FK8A 4BWQA 4PUAA 2LQOA 1TI1A 4KCAA 3GKNA 4EVMA 17GSA 1OE8A 4LLRA 4N0VA 4X0XA 3AY8A 2GSSA 3LORA 4V1Ap 2EIRA 1OC9A 5E4WA 1AQVA 4BVYA 5LCZA 2M46A 2V2GA 2VM2A 1XVQA 1M2BA 2KUCA 2X8CA 4HUAA 2OA7A 3TJKA 3IV4A 3ZIJA 3H79A 1Z3EA 4ZXGA 3GKKA 3QDNA 4TKYA 1GP1A 1O85A 3CRTA 1BG5A 5B8AA 3O3TA 4N10A 4MH3A 1EEJA 6GSWA 3ED3A 4XCSA 4TXVA 1X0RA 2QKEA 4I6XA 1V40A 4O5RA 3WD6A 4WKWA 2XHFA 4POMA 1QQ2A 1A2LA 1QMVA 1YKCA 4N0ZA 3CRUA 1FVKA 5D93A 2BMXA 2MBSA 4NMUA 1KTEA 4J56E 4LL4B 4EC0A 1HNAA 1M2AA 2H73A 4ECBA 2K6VA 4N11A 5DBQA 3IOSA 4GWRA 5ECIB 1GSUA 2Z9SA 3IR4A 1THXA 3ZRDA 4ML1A 1V98A 6GSVA 5ID2B 3HYPA 5B6MA 1C72A 1ABAA 4ZB6A 3DVWA 3LJRA 4XIHA 2RLIA 4BWSA 3NOFA 1M99A 1PX7A 1AAZA 4NV5A 2GQLA 2O85A 2H6YA 5GAND 18GSA 2CAQA 1K0MA 1O8WA 2B5YA 4IQ1A 1MD3A 4WBRD 3EMPA 3WGXA 1OC3A 2GGTA 4XS4A 2K8SA 5DCHA 4KSOA 3EMXA 4ECIA 2RIIA 3FHKA 1V2AA 2PU9C 1WOUA 2AYTA 4MA9A 4IELA 2IL3A 2C3NA 3QFAC 1G7OA 3A2VA 3I43A 2B7KA 3IA1A 3D4MA 1F37A 3GFKA 2WZ9A 3ZLPA 3GYKA 3VPQA 1TRVA 1YKAA 5CAXA 1XZOA 3KH7A 2LS5A 1AC1A 2YANA 4OCFA 4G19A 4V2NA 1R5PA 1LU4A 1G6YA 3ZYWA 1XOAA 1N2AA 3D21A 1NHYA 3SWLA 5F07A 2ES7A 1V58A 1TKDB 4RI7A 1F3BA 1X5EA 4MK3A 2YJHA 2V41A 2CZ3A 3KTBA 2GQKA 2CA8A 5C04A 4ZL9A 1XWCA 5JCUA 1PX6A 2LV3A 4K0GA 2B5EA 1XW5A 4K6XA 2C0GA 4WETA 2YOIA 1LJRA 4K1FA 1EOHA 3A2WA 1GTIA 2YWIA 3D4TA 5COHA 4EKZA 4MDCA 3CSJA 1YF0A 2GDRA 3I6AA 4ZB8A 1XXUA 4YAVA 3ERGA 3L78A 1TP9A 4L0WA 2HLSA 4AJ6A 4YH2A 1U3IA 3ERWA 4G10A 4HS1A 3KJYA 1ZOFA 3M9KA 4XTSA 2OBIA 3C71A 1GLQA 3HKRA 4MABA 2VOCA 4DVCA 3LEFA 2CX3A 3A3TA 3BCIA 5FHIA 1NSWA 4KDUA 3TRXA 1GRXA 3APQA 3KMOA 4XS1A 3TKSC 5IMCA 4IN0A 1SD8A 3DKSA 3VK9A 4E8HA 5EVOA 3RPPA 5CYYA 3P8WA 4GSTA 4ULXA 3GMFA 2CAIA 4O32A 2MMNA 4Q5RA 2B7JA 2YWMA 1J9BA 1M7TA 1A2MA 1KEBA 4GQCA 1R4WA 4JBBA 4JRRA 5E59A 1TK0B 4PXOA 1F2EA 1TDIA 1A8YA 3H93A 2NDOA 1GUKA 2DJ0A 2FWHA 1OE7A 1YF1A 4RUVA 1SK0A 1T7PB 2H71A 1SKRB 1DE1A 1W89A 2A2SA 3GUSA 5DAKA 2I1UA 1TW9A 3L0HA 2YCDA 5G31A 3KH9A 4JU5A 1GULA 4ZBBA 1O8XA 3TKSA 1YEXA 1X5CA 3LGCA 3ZITA 1VF3A 3CTFA 4IBPA 3BD2A 1RW1A 1ML6A 2I9HA 4JEDA 3GNJA 2PVQA 1TXXA 3KCMA 5JWQB 3FY7A 2WS2A 5CRWA 2N5AA 4ZIJA 2R2JA 1OYJA 2X64A 1XWGA 4ML6A 2MYGA 2BTOT 1YDKA 3PH9A 3M3MA 1FG4A 4KB3A 2VL3A 1SL0B 1VF2A 2FGXA 5A4UA 6GSTA 1X9SB 1R5AA 2H01A 4F9ZA 1UVZA 1TU8A 2LQQA 5DJMA 4XS6A 5GSTA 2ALBA 3GSTA 4ILFA 4MZWA 4TR0A 4DSRA 4PUFC 1AIUA 5KN1A 4MH2A 4IGJA 2IPAA 4HDEA 2R4VA 2PERA 2VCVA 3GSSA 3Q6OA 1KBNA 4ID0A 2EC4A 4I5QA 3PINA 1TJDA 5J9BA 2HXKA 1EOGA 4FIWA 5CRGA 3KD0A 1EGRA 2K18A 1WRYA 8GSSA 3TDGA 4L8EA 1R7HA 5LNKe 6GSUA 5D73A 4G2EA 2P31A 4EDZA 4LA1A 3MAKA 2XBIA 1WMJA 2OKAA 20GSA 3ZZXA 3HJOA 2NTOA 2H66A 3KMNA 5HQPA 1QXHA 1XIYA 4MJEA 4GCIA 2VCZA 3TGZA 2WGRA 5JWOB 2GT5A 1FB6A 4WF4A 2YP6A 16GSA 2AB6A 4OWYA 4AGSA 3WT1A 1YY7A 3WYWA 1YEPA 1ZYEA 5FWGA 3GL5A 3O76A 3J7Yb 3IAS2 1YZXA 4DSQA 5IM9A 4ZBAA 3VI5A 2IJYA 1FO5A 2R5GA 1DSBA 2G0FA 1GSQA 4KDXA 5ABRA 1SJIA 2VIMA 4NV2A 3D0ZA 3FZ5A 2MBTA 1U87A 2FNOA 5CP1A 2F8FA 1SL1B 2DJKA 3D5JA 2VM1A 1DBYA 1TRUA 4XRAA 1XCCA 4ECJA 2MZCA 4IJIA 1Z7PA 3IK7A 1RQMA 1VRSD 4TVEA 1TI3A 5F0GA 4QL7A 3TKPA 5GZZB 2GTUA 2LKUA 2H1AA 1SK2A 2C3QA 4KA0A 4CHSA 3W6GA 2R37A 1K0NA 5H5QA 3W8JA 3A2XA 2V32A 2KHPA 1ERUA 1PGTA 2GSTA 2HNLA 3ZMKA 4HEA2 4XRDA 3M1GA 3R2QA 2I4AA 4TR3A 4NHWA 3D6IA 3ZL5A 1B8XA 3DWVA 4RQRA 2RUEA 3QR6A 2M72A 1F9MA 1GSEA 1M0UA 2ZCTA 1Q4JA 4YAPA 5EPFA 5J3RA 2LRTA 3HZ8A 2WB9A 4POBA 2FCHA 1X9WB 3D22A 3ME8A 1HQOA 3HXSA 1DE2A 3KZQA 3EU3A 1PKWA 3HD5A 3VLNA 5GSSA 4JZQA 2VO4A 2X8GA 1GSSA 1I9DA 1BX9A 1JZWA 4X43A 5KN3A 1O7UA 4IVFA 2H70A 4KX4A 2LJAA 5CRHA 1XWBA 1VGLA 1USBA 5B6NA 5J4UA 1K3OA 4DEJA 3E0UA 3KM6A 3TJBA 3ME7A 3FEUA 4K7IA 5AGYA 2XBQA 4OFTA 3JCML 2L5LA 4OCEA 2YWNA 3VWVA 2WFCA 2REMA 3P2AA 4EDYA 3FR9A 1CQGA 2CVDA 3LFLA 1X5DA 2V6OA 4N30A 2QC7A 2V6KA 2WDUA 5ID2A 1A24A 2H0GA 4KAEA 2LEGA 5HFKA 3FYGA 1B4QA 3VWXA 2NVLA 3O6TA 4ISDA 3ISOA 1ST9A 3FZ9A 4KUNA 3QFBC 3KTLA 3LYKA 5IPGA 2FY6A 2O87A 3TKQA 1E2YA 2L4CA 1NM3A 1OVNA 3EE2A 1Z6NA 4K2DA 4HI7A 3GH6A 3UEMA 4PURA 4F0BA 5A4VA 2DMLA 5C00A 4K8MA 3DVXA 2H0HA 3M0FA 3HY2A 3IC4A 2HZFA 2YZUA 3C1RA 2WCIA 2IMEA 1T4ZA 1JLVA 2GSQA 1URMA 5KN0A 3BBYA 2ON7A 3HHVA 3GURA 1E6BA 3IPZA 1S3DA 4PQIA 3OR5A 5DALB 2I3YA 2HZEB 3L9SA 4V2LA 3ZREA 2O7KA 4KGIA 1SL2B 2H8LA 1J08A 3HCZA 5ECHB 2C0DA 5EY6A 4ZILA 4BPYA 4PNGA 2P0GA 2H19A 2YJ7A 4TXOB 3W8SA 4MP4A 1AQXA 2E2MA 3IHQA 2IWTA 3ZMLA 2C8UA 4IS0A 2GZZA 2YV9A 1AXDA 2JZRA 3K8NA 4HZ2A 1OC8A 3TUEA 10GSA 3FKFA 4L0UA 4OFNA 4EO3A 22GSA 1ZYQB 2FLSA 2L6CA 2H72A 3IK9A 3LYPA 5D9TA 2A2RA 4GF0A 1Q98A 5CO3A 5DALA 3TOUA 3QPMA 1ERVA 2DSAA 5INYA 1GNEA 2AUVA 5ECSA 4POKA 2F8AA 5D8IA 1FVJA 4J57E 1XWAA 4WF5A 3APOA 2VCWA 4HJMA 4LL1B 4YQMA 1KNGA 1JFUA 3GL3A 1PL1A 3UVTA 1ZMAA 1Z6MA 2GT6A 1OKTA 5IMZA 4H86A 3APSA 3KIJA 2XC2A 2VCXA 2DLXA 3MDKA 5ECMB 2HYXA 2PBJA 1HNCA 3TOTA 5B7CA 2FWGA 3F4RA 3IAM2 5G1KA 3UIWA 1F6MC 4XHMA 1WE0A 2O89A 2VD0A 1A2JA 2PMTA 1A0FA 1EWXA 2EIQA 2CVKA 2OJLA 3WGEA 4MCUA 5A5KA 1N8JA 1IYHA 4LMVA 5H5RA 12GSA 2WRTA 2VCTA 4D73B 4WR5A 5G5EA 1ILOA 3EVIA 1GUMA 1FOVA 4HJ2A 2QSIA 1K0CA 4EE0A 3VWWA 1XBSA 5LD0A 4MF7A 2C0EA 3GIXA 5GAPD 1BAYA 5IMVA 5J41A 3F3QA 2H1DA 1K0OA 5D9XA 4TR1B 4TRXA 3C7MA 4IW9A 5D9WA 4KH7A 4OD7A 3HVXA 3TRQA 3RHBA 5CRDA 1AUCA 4NPBA 14GSA 2WJUA 2H75A 5ECKB 5DQYA 2MMAA 1DUGA 2H30A 3EURA 2P5RA 1SKWB 4HU7A 3FRCA 3HZ4A 1EGOA 3US3A 2YN1A 2KLXA 1T4YA 2OE1A 4ACSA 3GTUB 3I9V2 1EEMA 1G0TA 1SENA 5J5NA 3HJMA 2VL2C 1M9AA 4HQZA 1CQHA 4KCEA 3ZVJD 1MD4A 3GX8A 5JCWA 4MPFA 2AAWA 1U88A 3F3RA 1FB0A 4HOJA 2KOKA 4YQUA 3VWUA 2AHEA 3F9UA 1BJXA 1PKZA 3E9JB 5EL8A 3KGKA 1X9MB 4F82A 3QAWA 2E0QA 1PA3A 1OKDA 2B6MA 2J23A 3PGTA 3BJ5A 3VURA 2IFQB 1PQNA 4GSNA 1Y25A 5IO0A 4TW5A 3F8UA 5G30A 3A5WA 3F4SA 3HDCA 3F6FA 2JSZA 1O81A 1HD2A 2OBKA 2JZSA 3SBCA 2R6KA 4K7NA 3C1SA 4AF2A 1GSDA 2DJ3A 2VLUA 2BJXA 4RI6A 5L71A 1XPVA 1UN2A 4K0NA 3GX0A 4TR4A 2VL2A 1GWCA 7GSSA 2LNSA 2IMKA 3V1WA 4IKHA 4O92A 1K3YA 2B3SA 2H1BA 5AISA 3TJGA 3TKRA 1GSYA 5IPHA 3BCKA 1U6TA 3LXTA 5IOXA 1AQWA 4PQ1A 2GLRA 2JL4A 2XPEA 2CV4A 3FW2A 2LUSA 3GKXA 4OFMA 1SKSB 2LRCA 1O73A 1GNWA 1EZKA 1TK8B 2O8VB 3H8QA 3F63A 3G9BA 2RM6A 3EC3A 5HR0A 4MZBA 2KP2A 2PUKC 4AJ7A 1ZGNA 3LQ7A 4PGTA 1O6JA 1LBKA 1GUHA 4E8EA 2DIYA 3Q19A 2DMMA 1FAAA 2HE3A 1EV4A 1GTAA 5DCGA 3G7IA 5B8BA 1IYIA 4OO5A 3U6VA 2L6DA 2DJJA 2C80A 2DIZA 3S9FA 1T3BA 1T1VA 2ZNMA 3TCOA 4POLA 6GSXA 2FA4A 1G7EA 1Z9HA 3I69A 1GSFA 4F0CA 3IRAA 5AIVA 2F3MA 4V1Ag 2HSYA 1THOA 3DD3A 1BEDA 1UA5A 5DJLA 5AIXA 4LMWA 4I8BA 4MF5A 2IMIA 1Z7RA 4NXIA 3NZNA 3MSZA 5IMFA 3NIVA 1B9XC 5DVBA 5A4WA 3TB2A 2HRNA 3UMAA 1B48A 4JR6A 1J0FA 4MZCA 1PD21 1NHOA 2ON5A 4K9ZA 2IMFA 1OAZA 4EL1A 4EUYA 4FO5A 3ZTLA 3RPNA 1F3AA 3F6DA 2JACA 2NBSA 1B4PA 1XWKA 3GN3A 2E7PA 6GSSA 3P7XA 2LTKA 4MPGA 3CMIA 3ZIVA 3KXOA 2YZHA 4KNDA 4PNFA 3TKSE 4FYUA 5KN2A 3RBTA 3LG6A 2B1KA 13GSA 2ZUPA 3LSZA 2OE3A 2P5QA 1QFNA 3PR8A 3RDWA 3QMXA 3UAPA 2VUPA 3E3EA 1QGVA 3CYNA 4XS4B 3UJ1A 5ENUA 1SYXA 1SYRA 1K0AA 1GH2A 3UBKA 5HFIA 1TRWA 4J2FA 1MTCA 2F9SA 2JSYA 3UVHA 5HFGA 2YNXA 4FYCA 2KP1A 2YWOA 4Q5QA 2HT9A 2XPDA 1S3AA 1M9BA 4GRFA 5F06A 5G2ZA 2CVBA 3QOUA 4KDYA 5KEJA 4IP6A 1EP7A 2AV4A 2R3XA 4EXJA 1Y6EA 2GZPA 2CX4A 4Z7XA 5D96A 4NHZA 4YQVA 2TRXA 4L5OA 2FWEA 4GTUA 4GQFA 4MJAA 2C3TA 1VF4A 3EINA 4IHUA 1TTZA 3UARA 3H4KA 3M8NA 3QAGA 1TU7A 3GA4A 3GRXA 5HR2A 3N5OA 4ZL8A 19GSA 2AJQB 2HRFA 3ZVJA 1B9YC 4ZL7A 1M2DA 1RK4A 2QGVA 2VLVA 2F51A 4OMVA 3WT2A 2FUG2 1PN9A 3HVVA 1YJ6A 2VAFA 4JR4A 4I97A 4KW6A 3CSIA 4KE3A 3ERFA 2WULA 1XFLA 3QD9A 5HR1A 3GV1A 3F0IA 2VD1A 1VF1A 2JADA 3VI7A 3Q74A 4O7HA 3DRNA 4F03A 2DBCA 2N5BA 4I2UA 3RAZA 9GSSA 2MMZA 4WBJA 5IOWA 4QQ7A 2LJRA 4Q5FA 1SJ6A 1G6WA 1JLWA 4ZBDA 2GSRA 1WWJA 4PQHA 3L4NA 2HSHA 2H6XA 3C73A 1W4VA 3H1NA 4BL7A 2EIOA 3FZAA 1EV9A 1XW6A 3N9JA 5ELGA 3MNGA 5ECNB 3DGQA 4FH8A 4QL9A 1A8LA 4AJ8A 1GTBA 3BOAA 2G2QA 2GQMA 3L9UA 1ZZYA 2CQ9A 4TN8A 3UL3A 5ELAA 1JHBA 4MLYA 2HZEA 5ECQB 5IQYA 2HFDA 3QAVA 2JZTA 5DQSA 3IE3A 1T8EB 1WIKA 1QUWA 4KSMA 4IJ3A 3ZFLA 3EWLA 2A4VA 3U5RE 4TXOA 4CDOA 1PSQA 4NAXA 2VL9A 5ECRB 3QCPA 3IBHA 3RHCA 4HU9A 5F05A 2DJ2A 3FZ4A 1GLPA 3TRPA 5ECPB 4GSSA 2J9HA 2FWFA 3LWAA 3J7Yk 1GL8A 5ECOB 5CNWA 5DAKB 3WGDA 4IP1A 1PL2A 5JWRB 1MDIA 2DC5A 3DIEA 2VCQA 4V2MA 3UOMA 4G9HA 3KP8A 3KEBA 3FR6A 2RM5A 3GHAA 1AW9A 1GTUA 2K9FA 2H76A 3FR3A 5J9CA 2X99A 2FA8A 5ECLB 1MEKA 1ZL9A 2L5OA 1ACVA 1R26A 2LJKA 1H75A 2K8VA 2H6ZA 4K7OA 3ZFBA 1SD9A 2V1MA 2LSTA 5G1LA 3L9VA 3G7JA 2LRNA 1ON4A 4OO4A 4MF6A 2L4QA 2MMOA 1BYEA 4MJCA 1JZRA 1JZOA 3P90A 1V57A 2JU5A 4DSSB 3CXGA 5IMAA 2N5FA 1ERWA 2C1YA 4L5LA 4JE1A 4WEYA 2FD3A 5CREA 1QK8A 1PMTA 1WP0A 2CT6A 1NW2A 2IN3A 4TOPA 2PGTA 5IO2A 1SJZA 3UBLA 2HI7A 4IQAA 3CTGA 2OADA 2DJ1A 3EYTA 4MJBA 3C8EA 6GSYA 3LXZA 1K0BA 1SU9A 2VLTA 2X8HA 1JZDA 5H5SA 2GVPA 4I2TA 1K0DA 2YPMA 4WR4A 4D73A 2M80A 3IDVA 1U3AA 2TIRA 1SK1A 3CSHA 1V9WA 2FHEA 1EP8A 1XVWA 2B1LA 1K3LA 1FHEA 4DSSA 1FW1A 11GSA 1A23A 4GLTA 1XOBA 5AN1A 4TR1A 4CW9A 3HA9A 1PRXA 5G5FA 1A0RP 2PPTA 3F4TA 2TRCP 5IMDA 4HQSA 2H0IA 2PVOC 2IMDA 2D2ZA 2PN8A 2L57A 5IIZA 1BQ7A 1WPIA 1MDKA 1XW9A 1S3CA 2E2GA 3TJFA 1H4OA 1I5GA 4NWYA 3HVSA 1HYUA 3GTUA 1TK5B 1MDJA 4RQXA 3VPTA 2H74A 3KP9A 3DXBA 1WJKA 4EF0A 2PWJA 3VFIA 4P3YB 2I81A 1YQ1A 1TOFA 2B5XA 3Q18A 3G7YA 2IIYA 3IXRA 2YV7A
chains in the Genus database with same CATH superfamily
3CBUA 3GKMA 4HZ4A 3HJPA 3TJJA 2C4JA 4X1UA 2IFQA 4K5RA 1OC9B 3GH9A 5D9VA 1TRSA 2LNTA 2CZ2A 2C0FA 4Q5NA 5JCGA 5F8BA 1UC7A 4FYBA 1Z5YE 4F2IA 2GS3A 3MWHA 1T00A 4MMMA 3DYRA 2OACA 4ZB9A 4PX1A 2RUFA 2GZYA 5DDLA 4WXTA 3DMLA 2H1GA 3DEXA 5HR3A 2OE0A 1ERTA 2NPBA 4BA7A 4GXZA 2L59A 5FT3A 4ECCA 3EU4A 1HNBA 1ZCPA 4BVXA 3M9JA 3FK8A 4BWQA 2A2PA 2DKIA 4PUAA 2LQOA 1TI1A 4KCAA 3GKNA 4EVMA 17GSA 1OE8A 4LLRA 4N0VA 4X0XA 3AY8A 2GSSA 3LORA 4V1Ap 2EIRA 1OC9A 5E4WA 1AQVA 4BVYA 5LCZA 2M46A 2V2GA 2VM2A 1XVQA 1M2BA 2KUCA 2X8CA 4HUAA 2OA7A 3TJKA 3IV4A 3ZIJA 3H79A 1Z3EA 4ZXGA 3GKKA 3QDNA 4TKYA 1GP1A 1O85A 3CRTA 1BG5A 5B8AA 3O3TA 4N10A 4MH3A 1EEJA 6GSWA 3ED3A 4XCSA 4TXVA 4G0IA 1X0RA 4EIPA 2QKEA 4I6XA 1V40A 4O5RA 3WD6A 4WKWA 2XHFA 4POMA 1QQ2A 1A2LA 1QMVA 1YKCA 4N0ZA 3CRUA 1FVKA 5D93A 2BMXA 2MBSA 4NMUA 1KTEA 4J56E 4LL4B 4EC0A 1HNAA 1M2AA 2H73A 4ECBA 2K6VA 4N11A 5DBQA 3IOSA 4GWRA 5ECIB 1GSUA 2Z9SA 3IR4A 1THXA 3ZRDA 4ML1A 1V98A 6GSVA 5ID2B 3HYPA 4K5SA 5B6MA 1C72A 1ABAA 4ZB6A 3DVWA 3LJRA 4XIHA 1M3JA 2RLIA 4BWSA 3NOFA 1ZYNA 1M99A 1PX7A 1AAZA 4NV5A 2GQLA 2O85A 2H6YA 5GAND 18GSA 2CAQA 1K0MA 1O8WA 2B5YA 4IQ1A 1MD3A 4WBRD 3EMPA 3WGXA 1OC3A 2GGTA 4XS4A 2K8SA 5DCHA 4KSOA 3EMXA 4ECIA 2RIIA 3FHKA 1V2AA 2PU9C 1WOUA 2AYTA 4MA9A 4IELA 2IL3A 2C3NA 3QFAC 1G7OA 3A2VA 3I43A 2B7KA 3IA1A 3D4MA 1F37A 3GFKA 2WZ9A 3ZLPA 3GYKA 3VPQA 1TRVA 1YKAA 5CAXA 1XZOA 3KH7A 2LS5A 1AC1A 2YANA 4OCFA 4G19A 4V2NA 1R5PA 1LU4A 1G6YA 3ZYWA 1XOAA 1N2AA 3D21A 1NHYA 3SWLA 5F07A 2ES7A 1V58A 1TKDB 4RI7A 1F3BA 1X5EA 4MK3A 2YJHA 2V41A 2CZ3A 3KTBA 2GQKA 2CA8A 5C04A 4ZL9A 1XWCA 5JCUA 1PX6A 3LW9A 2LV3A 4K0GA 2B5EA 1XW5A 4K6XA 2C0GA 4WETA 2YOIA 1LJRA 3HVNA 4K1FA 1EOHA 3A2WA 1GTIA 2YWIA 3D4TA 5COHA 4EKZA 4MDCA 3CSJA 1YF0A 2GDRA 3I6AA 4ZB8A 1XXUA 4YAVA 3ERGA 3L78A 1TP9A 3IHGA 4L0WA 2HLSA 4AJ6A 4YH2A 1U3IA 3ERWA 4G10A 4HS1A 3KJYA 1ZOFA 5BRTA 4KF9A 3M9KA 4FQUA 4XTSA 2OBIA 3C71A 1GLQA 3HKRA 4MABA 2VOCA 4DVCA 3LEFA 2CX3A 3A3TA 3BCIA 5FHIA 1NSWA 4KDUA 3TRXA 1GRXA 3APQA 3KMOA 4XS1A 3TKSC 2HRKA 5IMCA 4IN0A 1SD8A 3DKSA 3VK9A 4YKGA 4E8HA 5EVOA 3RPPA 5CYYA 3P8WA 4GSTA 4ULXA 3GMFA 2CAIA 4O32A 2MMNA 4Q5RA 2B7JA 2YWMA 1J9BA 1M7TA 1A2MA 1KEBA 4GQCA 1R4WA 4JBBA 4JRRA 5E59A 4BIKA 1TK0B 4PXOA 1F2EA 1TDIA 1A8YA 3H93A 2NDOA 1GUKA 2DJ0A 2FWHA 1OE7A 1YF1A 4RUVA 1SK0A 1T7PB 2H71A 1SKRB 1DE1A 1W89A 2A2SA 3GUSA 5DAKA 2I1UA 1TW9A 3L0HA 2YCDA 5G31A 3KH9A 4JU5A 1GULA 4ZBBA 2X49A 1O8XA 3TKSA 1YEXA 1X5CA 3LGCA 3ZITA 1VF3A 3CTFA 4IBPA 3BD2A 1RW1A 1ML6A 2I9HA 4JEDA 3GNJA 2PVQA 1TXXA 3KCMA 5JWQB 3FY7A 2R0CA 2WS2A 5CRWA 2N5AA 4ZIJA 2R2JA 1OYJA 2X64A 1XWGA 4ML6A 2MYGA 2BTOT 1YDKA 3PH9A 3M3MA 1FG4A 4KB3A 2VL3A 1SL0B 1VF2A 2FGXA 5A4UA 6GSTA 1X9SB 1R5AA 2H01A 4F9ZA 1UVZA 1TU8A 2LQQA 3R3EA 5DJMA 4XS6A 5GSTA 2ALBA 3GSTA 4ILFA 4MZWA 4TR0A 4DSRA 4PUFC 1AIUA 5KN1A 4ICYA 4MH2A 4IGJA 2IPAA 4HDEA 2R4VA 2PERA 2VCVA 3GSSA 3A5IA 3Q6OA 1KBNA 4ID0A 2EC4A 4I5QA 3PINA 1TJDA 4CY6A 5J9BA 2HXKA 1EOGA 4Z2UA 4FIWA 5CRGA 3KD0A 2X4AA 1EGRA 2K18A 1WRYA 8GSSA 3TDGA 4L8EA 1R7HA 5LNKe 6GSUA 5D73A 4G2EA 2P31A 4EDZA 4LA1A 3MAKA 2XBIA 1WMJA 2OKAA 20GSA 3ZZXA 3HJOA 2NTOA 2H66A 3KMNA 5HQPA 1QXHA 4YKFA 1XIYA 4MJEA 4GCIA 2VCZA 3TGZA 2WGRA 5JWOB 2GT5A 1FB6A 4WF4A 2YP6A 16GSA 2AB6A 4OWYA 4AGSA 3WT1A 1YY7A 3WYWA 1YEPA 1ZYEA 5FWGA 3GL5A 3O76A 3J7Yb 2UZ8A 3IAS2 1YZXA 4DSQA 5IM9A 4ZBAA 3VI5A 2IJYA 1FO5A 2R5GA 1DSBA 2G0FA 1GSQA 4KDXA 5ABRA 1SJIA 2VIMA 4NV2A 3D0ZA 3FZ5A 2MBTA 1U87A 2FNOA 5CP1A 2F8FA 1SL1B 2DJKA 1ZYPA 3D5JA 2VM1A 1DBYA 1TRUA 4XRAA 1XCCA 4ECJA 2MZCA 4IJIA 1Z7PA 3IK7A 1RQMA 1VRSD 4TVEA 1TI3A 5F0GA 4QL7A 3TKPA 5GZZB 2GTUA 2LKUA 2H1AA 1SK2A 2C3QA 4KA0A 4CHSA 3W6GA 2R37A 1K0NA 5H5QA 3W8JA 3A2XA 2V32A 2KHPA 1ERUA 1PGTA 2GSTA 2HNLA 3ZMKA 1S3RA 4HEA2 4XRDA 3M1GA 3R2QA 2I4AA 4TR3A 4NHWA 3D6IA 3ZL5A 1B8XA 3DWVA 4RQRA 2RUEA 3QR6A 2M72A 1F9MA 1GSEA 1M0UA 2ZCTA 4MNNA 1Q4JA 4YAPA 5EPFA 5J3RA 2LRTA 3HZ8A 2R0GA 2WB9A 4POBA 2FCHA 1X9WB 3D22A 3ME8A 1HQOA 3HXSA 1DE2A 3KZQA 3EU3A 1PKWA 3HD5A 3VLNA 5GSSA 4JZQA 2VO4A 2X8GA 1GSSA 1I9DA 1BX9A 1JZWA 4X43A 5KN3A 1O7UA 4IVFA 2H70A 4KX4A 2LJAA 5CRHA 1XWBA 1VGLA 1USBA 5B6NA 5J4UA 1K3OA 4DEJA 3E0UA 3KM6A 3TJBA 3ME7A 3FEUA 4K7IA 5AGYA 2XBQA 4OFTA 3JCML 4USSA 2L5LA 4OCEA 2YWNA 3VWVA 2WFCA 2REMA 3P2AA 4EDYA 3FR9A 1CQGA 2CVDA 3LFLA 2R0PA 1X5DA 2V6OA 4N30A 2QC7A 2V6KA 2WDUA 5ID2A 1A24A 4O5QA 2H0GA 4KAEA 2LEGA 5HFKA 3FYGA 1B4QA 3VWXA 2NVLA 3O6TA 4ISDA 3ISOA 1ST9A 3FZ9A 4KUNA 3QFBC 3KTLA 3LYKA 5IPGA 2FY6A 2O87A 2HSMA 3TKQA 1E2YA 2L4CA 1NM3A 1OVNA 3EE2A 1Z6NA 4K2DA 4BL7B 4HI7A 3GH6A 3UEMA 4PURA 4F0BA 5A4VA 2DMLA 5C00A 4K8MA 3DVXA 2H0HA 3M0FA 3HY2A 3IC4A 2HZFA 2YZUA 3C1RA 4Z2TA 2WCIA 2IMEA 1T4ZA 1JLVA 2GSQA 1URMA 5KN0A 3BBYA 2ON7A 3HHVA 3GURA 1E6BA 3IPZA 1S3DA 4PQIA 3OR5A 5DALB 2I3YA 2HZEB 3L9SA 4V2LA 3ZREA 2O7KA 4KGIA 1SL2B 2H8LA 1J08A 3HCZA 3FMWA 5ECHB 4G0LA 2C0DA 5EY6A 4ZILA 4BPYA 4PNGA 2P0GA 2H19A 2YJ7A 4TXOB 3W8SA 4MP4A 1AQXA 2E2MA 3IHQA 2IWTA 3ZMLA 2C8UA 4IS0A 2GZZA 2YV9A 1AXDA 2JZRA 3K8NA 4HZ2A 1OC8A 3TUEA 10GSA 1FOHA 3FKFA 4L0UA 4OFNA 4EO3A 22GSA 1ZYQB 2FLSA 2L6CA 2H72A 3IK9A 3LYPA 5D9TA 2A2RA 4GF0A 1Q98A 5CO3A 5DALA 3TOUA 3QPMA 1ERVA 2DSAA 5INYA 1GNEA 2AUVA 5ECSA 4POKA 2F8AA 5D8IA 1FVJA 2QA2A 4J57E 1XWAA 4WF5A 3APOA 2VCWA 4HJMA 4LL1B 4YQMA 1KNGA 1JFUA 3GL3A 1PL1A 3UVTA 1ZMAA 1Z6MA 2GT6A 1OKTA 5IMZA 4H86A 3APSA 3KIJA 2XC2A 2VCXA 2DLXA 3MIXA 3MDKA 5ECMB 2HYXA 2PBJA 4PTSA 1HNCA 3TOTA 5B7CA 2FWGA 3F4RA 3IAM2 5G1KA 3UIWA 1F6MC 4XHMA 1WE0A 2O89A 2VD0A 1A2JA 2PMTA 1A0FA 1EWXA 2EIQA 2CVKA 2OJLA 3WGEA 4MCUA 5A5KA 5BMUA 1N8JA 1IYHA 4LMVA 5H5RA 12GSA 2WRTA 2VCTA 4D73B 4WR5A 5G5EA 1ILOA 3EVIA 1GUMA 1FOVA 4HJ2A 2QSIA 1K0CA 4EE0A 3VWWA 1XBSA 5LD0A 4MF7A 2C0EA 3GIXA 5GAPD 1BAYA 5IMVA 5J41A 3F3QA 2H1DA 1K0OA 5D9XA 4TR1B 4TRXA 3C7MA 4IW9A 5D9WA 4KH7A 4OD7A 3HVXA 3TRQA 3RHBA 5CRDA 1AUCA 4NPBA 14GSA 2WJUA 2H75A 5ECKB 5DQYA 2MMAA 1DUGA 2H30A 3EURA 2P5RA 1SKWB 4A5PA 4HU7A 3FRCA 3HZ4A 1EGOA 3US3A 2YN1A 2KLXA 1T4YA 2OE1A 4ACSA 3CQFA 3GTUB 3I9V2 1EEMA 1G0TA 1SENA 5J5NA 4CY8A 3HJMA 2VL2C 1M9AA 4HQZA 1CQHA 4KCEA 3ZVJD 1MD4A 3GX8A 5JCWA 4MPFA 2AAWA 1U88A 3F3RA 1FB0A 4HOJA 2KOKA 4YQUA 3VWUA 2AHEA 3F9UA 1BJXA 1PKZA 3E9JB 5EL8A 3KGKA 1X9MB 4F82A 3QAWA 2E0QA 1PA3A 1OKDA 2B6MA 2J23A 3PGTA 3BJ5A 3VURA 2IFQB 1PQNA 4GSNA 1Y25A 5IO0A 4TW5A 3F8UA 5G30A 1M3IA 3A5WA 3F4SA 3HDCA 3F6FA 2JSZA 1O81A 1HD2A 2OBKA 2JZSA 3SBCA 2R6KA 4K7NA 3C1SA 4AF2A 1GSDA 2DJ3A 2VLUA 2BJXA 4RI6A 5L71A 1XPVA 1UN2A 4K0NA 3GX0A 4TR4A 2VL2A 1GWCA 7GSSA 2LNSA 2IMKA 3V1WA 4IKHA 4O92A 1K3YA 2B3SA 2H1BA 4BVXB 1PFOA 5AISA 3TJGA 3TKRA 1GSYA 5IPHA 3BCKA 1U6TA 3LXTA 5IOXA 1AQWA 4PQ1A 2GLRA 2JL4A 2XPEA 2CV4A 3FW2A 2LUSA 3GKXA 4OFMA 1SKSB 2LRCA 1O73A 1GNWA 1EZKA 1TK8B 2O8VB 3H8QA 4BVYB 3F63A 3G9BA 2RM6A 3EC3A 5HR0A 4MZBA 2KP2A 2PUKC 4AJ7A 5KOXA 1ZGNA 3LQ7A 4PGTA 1O6JA 1LBKA 1GUHA 4E8EA 2DIYA 3Q19A 2DMMA 1FAAA 2HE3A 1EV4A 1GTAA 5DCGA 3G7IA 5B8BA 1IYIA 4OO5A 3U6VA 2L6DA 2DJJA 2C80A 2DIZA 3S9FA 1T3BA 1T1VA 2ZNMA 3TCOA 4POLA 6GSXA 2FA4A 1G7EA 1Z9HA 3I69A 1GSFA 4F0CA 3IRAA 5AIVA 2F3MA 4V1Ag 2HSYA 1THOA 3DD3A 1BEDA 1UA5A 5DJLA 5AIXA 4LMWA 4I8BA 4MF5A 2IMIA 1Z7RA 4NXIA 3NZNA 3MSZA 5IMFA 3NIVA 1B9XC 5DVBA 5A4WA 3TB2A 2HRNA 3UMAA 1B48A 4JR6A 1J0FA 4MZCA 1PD21 1NHOA 2ON5A 4K9ZA 2IMFA 1OAZA 4EL1A 4EUYA 4FO5A 3ZTLA 3RPNA 1F3AA 3F6DA 2JACA 2NBSA 1B4PA 1XWKA 3GN3A 1PN0A 2E7PA 6GSSA 3P7XA 3MYDA 2LTKA 4MPGA 3CMIA 3ZIVA 3IC8A 3KXOA 2YZHA 4KNDA 4PNFA 3TKSE 4FYUA 5KN2A 3RBTA 3PPUA 3LG6A 2B1KA 13GSA 2ZUPA 3LSZA 2OE3A 2P5QA 1QFNA 3PR8A 3RDWA 3QMXA 3UAPA 2VUPA 3E3EA 1QGVA 3CYNA 4XS4B 3UJ1A 5ENUA 1SYXA 1SYRA 1K0AA 1GH2A 3UBKA 5HFIA 1TRWA 4J2FA 1MTCA 2F9SA 2JSYA 3UVHA 5HFGA 2YNXA 4FYCA 2KP1A 2YWOA 4Q5QA 2HT9A 2XPDA 1S3AA 1M9BA 4GRFA 5F06A 5G2ZA 2CVBA 3QOUA 4KDYA 5KEJA 4IP6A 1EP7A 2AV4A 2R3XA 4EXJA 1Y6EA 2GZPA 2CX4A 4Z7XA 5D96A 4NHZA 4YQVA 2TRXA 4L5OA 2FWEA 4GTUA 4GQFA 4MJAA 2C3TA 1VF4A 3EINA 4IHUA 1TTZA 3UARA 3H4KA 4HSCX 3M8NA 3QAGA 1TU7A 3GA4A 3GRXA 5HR2A 3N5OA 4ZL8A 19GSA 2AJQB 2HRFA 3ZVJA 1B9YC 4ZL7A 1M2DA 1RK4A 2QGVA 2VLVA 2F51A 4OMVA 3WT2A 2FUG2 1PN9A 3HVVA 1YJ6A 2VAFA 4JR4A 4I97A 4KW6A 3CSIA 4KE3A 3ERFA 2WULA 1XFLA 3QD9A 5HR1A 3GV1A 3F0IA 2VD1A 1VF1A 2JADA 3VI7A 3Q74A 4O7HA 3DRNA 4F03A 2DBCA 2N5BA 4I2UA 3RAZA 9GSSA 2MMZA 4WBJA 5IOWA 4QQ7A 2LJRA 4Q5FA 1SJ6A 1G6WA 1JLWA 4ZBDA 2GSRA 1WWJA 4PQHA 3L4NA 2HSHA 2H6XA 3C73A 1W4VA 3H1NA 4BL7A 2EIOA 3FZAA 1EV9A 1XW6A 3N9JA 5ELGA 3MNGA 5ECNB 3DGQA 4FH8A 4QL9A 1A8LA 4AJ8A 1GTBA 3BOAA 2G2QA 2GQMA 3L9UA 1ZZYA 2CQ9A 4TN8A 3UL3A 5ELAA 1JHBA 4MLYA 2HZEA 5ECQB 5IQYA 2HFDA 3QAVA 2JZTA 5DQSA 3IE3A 1T8EB 1WIKA 1QUWA 4KSMA 4K2XA 4IJ3A 3ZFLA 3EWLA 2A4VA 3U5RE 4TXOA 4CDOA 1PSQA 4NAXA 2VL9A 5ECRB 3QCPA 3IBHA 3RHCA 4HU9A 5F05A 2DJ2A 3FZ4A 1GLPA 3TRPA 5ECPB 4GSSA 2J9HA 2FWFA 3LWAA 3J7Yk 1GL8A 5ECOB 5CNWA 5DAKB 3WGDA 4IP1A 1PL2A 5JWRB 1MDIA 2DC5A 3DIEA 2VCQA 4EIQA 4V2MA 3UOMA 4G9HA 3KP8A 3KEBA 4X4JA 3FR6A 2RM5A 3GHAA 1AW9A 1GTUA 2K9FA 2H76A 3FR3A 2DKHA 5J9CA 2X99A 2FA8A 5ECLB 1MEKA 1ZL9A 5KOWA 2L5OA 1ACVA 2HRAA 1R26A 2LJKA 1H75A 2K8VA 2H6ZA 4K7OA 3ZFBA 1SD9A 2V1MA 2LSTA 5G1LA 3L9VA 3G7JA 2LRNA 1ON4A 4OO4A 4MF6A 2L4QA 2MMOA 1BYEA 4MJCA 1JZRA 1JZOA 3P90A 1V57A 2JU5A 4DSSB 3CXGA 5IMAA 2N5FA 1ERWA 2C1YA 4L5LA 4JE1A 4WEYA 2FD3A 5CREA 1QK8A 1PMTA 4Z2RA 1WP0A 2CT6A 1NW2A 2IN3A 4TOPA 2PGTA 5IO2A 1SJZA 2QA1A 3UBLA 2HI7A 4IQAA 3CTGA 2OADA 2DJ1A 3EYTA 4MJBA 3C8EA 6GSYA 3LXZA 1K0BA 1SU9A 2VLTA 2X8HA 1JZDA 5H5SA 2GVPA 4I2TA 1K0DA 2YPMA 4WR4A 4D73A 2M80A 2A4HA 3IDVA 1U3AA 2TIRA 1SK1A 3CSHA 1V9WA 2FHEA 1EP8A 1XVWA 2B1LA 1K3LA 1FHEA 4DSSA 1FW1A 11GSA 1A23A 4GLTA 1XOBA 5AN1A 4TR1A 4G0KA 4CW9A 3HA9A 1PRXA 5G5FA 1A0RP 2PPTA 3F4TA 2TRCP 5IMDA 4HQSA 2H0IA 2PVOC 2IMDA 2D2ZA 2PN8A 2L57A 5IIZA 1BQ7A 1WPIA 1MDKA 1XW9A 1S3CA 2E2GA 4O5UA 3TJFA 1H4OA 1I5GA 4NWYA 3HVSA 3EPTA 1HYUA 3GTUA 1TK5B 1XG8A 1MDJA 4RQXA 3VPTA 2H74A 3KP9A 3DXBA 1WJKA 4EF0A 2PWJA 3VFIA 4P3YB 2I81A 1YQ1A 1TOFA 2B5XA 3Q18A 3G7YA 2IIYA 3IXRA 2YV7A
chains in the Genus database with same CATH topology
3CBUA 3GKMA 4HZ4A 3HJPA 3TJJA 2C4JA 4X1UA 2IFQA 4K5RA 1OC9B 3GH9A 5D9VA 1TRSA 2LNTA 2CZ2A 2C0FA 4Q5NA 5JCGA 5F8BA 1UC7A 4FYBA 1Z5YE 4F2IA 2GS3A 3MWHA 1T00A 4MMMA 3DYRA 2OACA 4ZB9A 4PX1A 2RUFA 2GZYA 5DDLA 4WXTA 3DMLA 2H1GA 3DEXA 5HR3A 2OE0A 1ERTA 2NPBA 4BA7A 4GXZA 2L59A 5FT3A 4ECCA 3EU4A 1HNBA 1ZCPA 4BVXA 3M9JA 3FK8A 4BWQA 2A2PA 2DKIA 4PUAA 2LQOA 1TI1A 4KCAA 3GKNA 4EVMA 17GSA 1OE8A 4LLRA 4N0VA 4X0XA 3AY8A 2GSSA 3LORA 4V1Ap 2EIRA 1OC9A 5E4WA 1AQVA 4BVYA 5LCZA 2M46A 2V2GA 2VM2A 1XVQA 1M2BA 2KUCA 2X8CA 4HUAA 2OA7A 3TJKA 3IV4A 3ZIJA 3H79A 1Z3EA 4ZXGA 3GKKA 3QDNA 4TKYA 1GP1A 1O85A 3CRTA 1BG5A 5B8AA 3O3TA 4N10A 4MH3A 1EEJA 6GSWA 3ED3A 4XCSA 4TXVA 4G0IA 1X0RA 4EIPA 2QKEA 4I6XA 1V40A 4O5RA 3WD6A 4WKWA 2XHFA 4POMA 1QQ2A 1A2LA 1QMVA 1YKCA 4N0ZA 3CRUA 1FVKA 5D93A 2BMXA 2MBSA 4NMUA 1KTEA 4J56E 4LL4B 4EC0A 1HNAA 1M2AA 2H73A 4ECBA 2K6VA 4N11A 5DBQA 3IOSA 4GWRA 5ECIB 1GSUA 2Z9SA 3IR4A 1THXA 3ZRDA 4ML1A 1V98A 6GSVA 5ID2B 3HYPA 4K5SA 5B6MA 1C72A 1ABAA 4ZB6A 3DVWA 3LJRA 4XIHA 2RLIA 4BWSA 3NOFA 1ZYNA 1M99A 1PX7A 1AAZA 4NV5A 2GQLA 2O85A 2H6YA 5GAND 18GSA 2CAQA 1K0MA 1O8WA 2B5YA 4IQ1A 1MD3A 4WBRD 3EMPA 3WGXA 1OC3A 2GGTA 4XS4A 2K8SA 5DCHA 4KSOA 3EMXA 4ECIA 2RIIA 3FHKA 1V2AA 2PU9C 1WOUA 2AYTA 4MA9A 4IELA 2IL3A 2C3NA 3QFAC 1G7OA 3A2VA 3I43A 2B7KA 3IA1A 3D4MA 1F37A 3GFKA 2WZ9A 3ZLPA 3GYKA 3VPQA 1TRVA 1YKAA 5CAXA 1XZOA 3KH7A 2LS5A 1AC1A 2YANA 4OCFA 4G19A 4V2NA 1R5PA 1LU4A 1G6YA 3ZYWA 1XOAA 1N2AA 3D21A 1NHYA 3SWLA 5F07A 2ES7A 1V58A 1TKDB 4RI7A 1F3BA 1X5EA 4MK3A 2YJHA 2V41A 2CZ3A 3KTBA 2GQKA 2CA8A 5C04A 4ZL9A 1XWCA 5JCUA 1PX6A 3LW9A 2LV3A 4K0GA 2B5EA 1XW5A 4K6XA 2C0GA 4WETA 2YOIA 1LJRA 4K1FA 1EOHA 3A2WA 1GTIA 2YWIA 3D4TA 5COHA 4EKZA 4MDCA 3CSJA 1YF0A 2GDRA 3I6AA 4ZB8A 1XXUA 4YAVA 3ERGA 3L78A 1TP9A 3IHGA 4L0WA 2HLSA 4AJ6A 4YH2A 1U3IA 3ERWA 4G10A 4HS1A 3KJYA 1ZOFA 5BRTA 4KF9A 3M9KA 4FQUA 4XTSA 2OBIA 3C71A 1GLQA 3HKRA 4MABA 2VOCA 4DVCA 3LEFA 2CX3A 3A3TA 3BCIA 5FHIA 1NSWA 4KDUA 3TRXA 1GRXA 3APQA 3KMOA 4XS1A 3TKSC 2HRKA 5IMCA 4IN0A 1SD8A 3DKSA 3VK9A 4YKGA 4E8HA 5EVOA 3RPPA 5CYYA 3P8WA 4GSTA 4ULXA 3GMFA 2CAIA 4O32A 2MMNA 4Q5RA 2B7JA 2YWMA 1J9BA 1M7TA 1A2MA 1KEBA 4GQCA 1R4WA 4JBBA 4JRRA 5E59A 1TK0B 4PXOA 1F2EA 1TDIA 1A8YA 3H93A 2NDOA 1GUKA 2DJ0A 2FWHA 1OE7A 1YF1A 4RUVA 1SK0A 1T7PB 2H71A 1SKRB 1DE1A 1W89A 2A2SA 3GUSA 5DAKA 2I1UA 1TW9A 3L0HA 2YCDA 5G31A 3KH9A 4JU5A 1GULA 4ZBBA 2X49A 1O8XA 3TKSA 1YEXA 1X5CA 3LGCA 3ZITA 1VF3A 3CTFA 4IBPA 3BD2A 1RW1A 1ML6A 2I9HA 4JEDA 3GNJA 2PVQA 1TXXA 3KCMA 5JWQB 3FY7A 2R0CA 2WS2A 5CRWA 2N5AA 4ZIJA 2R2JA 1OYJA 2X64A 1XWGA 4ML6A 2MYGA 2BTOT 1YDKA 3PH9A 3M3MA 1FG4A 4KB3A 2VL3A 1SL0B 1VF2A 2FGXA 5A4UA 6GSTA 1X9SB 1R5AA 2H01A 4F9ZA 1UVZA 1TU8A 2LQQA 3R3EA 5DJMA 4XS6A 5GSTA 2ALBA 3GSTA 4ILFA 4MZWA 4TR0A 4DSRA 4PUFC 1AIUA 5KN1A 4ICYA 4MH2A 4IGJA 2IPAA 4HDEA 2R4VA 2PERA 2VCVA 3GSSA 3A5IA 3Q6OA 1KBNA 4ID0A 2EC4A 4I5QA 3PINA 1TJDA 4CY6A 5J9BA 2HXKA 1EOGA 4Z2UA 4FIWA 5CRGA 3KD0A 2X4AA 1EGRA 2K18A 1WRYA 8GSSA 3TDGA 4L8EA 1R7HA 5LNKe 6GSUA 5D73A 4G2EA 2P31A 4EDZA 4LA1A 3MAKA 2XBIA 1WMJA 2OKAA 20GSA 3ZZXA 3HJOA 2NTOA 2H66A 3KMNA 5HQPA 1QXHA 4YKFA 1XIYA 4MJEA 4GCIA 2VCZA 3TGZA 2WGRA 5JWOB 2GT5A 1FB6A 4WF4A 2YP6A 16GSA 2AB6A 4OWYA 4AGSA 3WT1A 1YY7A 3WYWA 1YEPA 1ZYEA 5FWGA 3GL5A 3O76A 3J7Yb 2UZ8A 3IAS2 1YZXA 4DSQA 5IM9A 4ZBAA 3VI5A 2IJYA 1FO5A 2R5GA 1DSBA 2G0FA 1GSQA 4KDXA 5ABRA 1SJIA 2VIMA 4NV2A 3D0ZA 3FZ5A 2MBTA 1U87A 2FNOA 5CP1A 2F8FA 1SL1B 2DJKA 1ZYPA 3D5JA 2VM1A 1DBYA 1TRUA 4XRAA 1XCCA 4ECJA 2MZCA 4IJIA 1Z7PA 3IK7A 1RQMA 1VRSD 4TVEA 1TI3A 5F0GA 4QL7A 3TKPA 5GZZB 2GTUA 2LKUA 2H1AA 1SK2A 2C3QA 4KA0A 4CHSA 3W6GA 2R37A 1K0NA 5H5QA 3W8JA 3A2XA 2V32A 2KHPA 1ERUA 1PGTA 2GSTA 2HNLA 3ZMKA 4HEA2 4XRDA 3M1GA 3R2QA 2I4AA 4TR3A 4NHWA 3D6IA 3ZL5A 1B8XA 3DWVA 4RQRA 2RUEA 3QR6A 2M72A 1F9MA 1GSEA 1M0UA 2ZCTA 4MNNA 1Q4JA 4YAPA 5EPFA 5J3RA 2LRTA 3HZ8A 2R0GA 2WB9A 4POBA 2FCHA 1X9WB 3D22A 3ME8A 1HQOA 3HXSA 1DE2A 3KZQA 3EU3A 1PKWA 3HD5A 3VLNA 5GSSA 4JZQA 2VO4A 2X8GA 1GSSA 1I9DA 1BX9A 1JZWA 4X43A 5KN3A 1O7UA 4IVFA 2H70A 4KX4A 2LJAA 5CRHA 1XWBA 1VGLA 1USBA 5B6NA 5J4UA 1K3OA 4DEJA 3E0UA 3KM6A 3TJBA 3ME7A 3FEUA 4K7IA 5AGYA 2XBQA 4OFTA 3JCML 4USSA 2L5LA 4OCEA 2YWNA 3VWVA 2WFCA 2REMA 3P2AA 4EDYA 3FR9A 1CQGA 2CVDA 3LFLA 2R0PA 1X5DA 2V6OA 4N30A 2QC7A 2V6KA 2WDUA 5ID2A 1A24A 4O5QA 2H0GA 4KAEA 2LEGA 5HFKA 3FYGA 1B4QA 3VWXA 2NVLA 3O6TA 4ISDA 3ISOA 1ST9A 3FZ9A 4KUNA 3QFBC 3KTLA 3LYKA 5IPGA 2FY6A 2O87A 2HSMA 3TKQA 1E2YA 2L4CA 1NM3A 1OVNA 3EE2A 1Z6NA 4K2DA 4BL7B 4HI7A 3GH6A 3UEMA 4PURA 4F0BA 5A4VA 2DMLA 5C00A 4K8MA 3DVXA 2H0HA 3M0FA 3HY2A 3IC4A 2HZFA 2YZUA 3C1RA 4Z2TA 2WCIA 2IMEA 1T4ZA 1JLVA 2GSQA 1URMA 5KN0A 3BBYA 2ON7A 3HHVA 3GURA 1E6BA 3IPZA 1S3DA 4PQIA 3OR5A 5DALB 2I3YA 2HZEB 3L9SA 4V2LA 3ZREA 2O7KA 4KGIA 1SL2B 2H8LA 1J08A 3HCZA 3FMWA 5ECHB 4G0LA 2C0DA 5EY6A 4ZILA 4BPYA 4PNGA 2P0GA 2H19A 2YJ7A 4TXOB 3W8SA 4MP4A 1AQXA 2E2MA 3IHQA 2IWTA 3ZMLA 2C8UA 4IS0A 2GZZA 2YV9A 1AXDA 2JZRA 3K8NA 4HZ2A 1OC8A 3TUEA 10GSA 1FOHA 3FKFA 4L0UA 4OFNA 4EO3A 22GSA 1ZYQB 2FLSA 2L6CA 2H72A 3IK9A 3LYPA 5D9TA 2A2RA 4GF0A 1Q98A 5CO3A 5DALA 3TOUA 3QPMA 1ERVA 2DSAA 5INYA 1GNEA 2AUVA 5ECSA 4POKA 2F8AA 5D8IA 1FVJA 2QA2A 4J57E 1XWAA 4WF5A 3APOA 2VCWA 4HJMA 4LL1B 4YQMA 1KNGA 1JFUA 3GL3A 1PL1A 3UVTA 1ZMAA 1Z6MA 2GT6A 1OKTA 5IMZA 4H86A 3APSA 3KIJA 2XC2A 2VCXA 2DLXA 3MIXA 3MDKA 5ECMB 2HYXA 2PBJA 4PTSA 1HNCA 3TOTA 5B7CA 2FWGA 3F4RA 3IAM2 5G1KA 3UIWA 1F6MC 4XHMA 1WE0A 2O89A 2VD0A 1A2JA 2PMTA 1A0FA 1EWXA 2EIQA 2CVKA 2OJLA 3WGEA 4MCUA 5A5KA 5BMUA 1N8JA 1IYHA 4LMVA 5H5RA 12GSA 2WRTA 2VCTA 4D73B 4WR5A 5G5EA 1ILOA 3EVIA 1GUMA 1FOVA 4HJ2A 2QSIA 1K0CA 4EE0A 3VWWA 1XBSA 5LD0A 4MF7A 2C0EA 3GIXA 5GAPD 1BAYA 5IMVA 5J41A 3F3QA 2H1DA 1K0OA 5D9XA 4TR1B 4TRXA 3C7MA 4IW9A 5D9WA 4KH7A 4OD7A 3HVXA 3TRQA 3RHBA 5CRDA 1AUCA 4NPBA 14GSA 2WJUA 2H75A 5ECKB 5DQYA 2MMAA 1DUGA 2H30A 3EURA 2P5RA 1SKWB 4A5PA 4HU7A 3FRCA 3HZ4A 1EGOA 3US3A 2YN1A 2KLXA 1T4YA 2OE1A 4ACSA 3GTUB 3I9V2 1EEMA 1G0TA 1SENA 5J5NA 4CY8A 3HJMA 2VL2C 1M9AA 4HQZA 1CQHA 4KCEA 3ZVJD 1MD4A 3GX8A 5JCWA 4MPFA 2AAWA 1U88A 3F3RA 1FB0A 4HOJA 2KOKA 4YQUA 3VWUA 2AHEA 3F9UA 1BJXA 1PKZA 3E9JB 5EL8A 3KGKA 1X9MB 4F82A 3QAWA 2E0QA 1PA3A 1OKDA 2B6MA 2J23A 3PGTA 3BJ5A 3VURA 2IFQB 1PQNA 4GSNA 1Y25A 5IO0A 4TW5A 3F8UA 5G30A 3A5WA 3F4SA 3HDCA 3F6FA 2JSZA 1O81A 1HD2A 2OBKA 2JZSA 3SBCA 2R6KA 4K7NA 3C1SA 4AF2A 1GSDA 2DJ3A 2VLUA 2BJXA 4RI6A 5L71A 1XPVA 1UN2A 4K0NA 3GX0A 4TR4A 2VL2A 1GWCA 7GSSA 2LNSA 2IMKA 3V1WA 4IKHA 4O92A 1K3YA 2B3SA 2H1BA 4BVXB 5AISA 3TJGA 3TKRA 1GSYA 5IPHA 3BCKA 1U6TA 3LXTA 5IOXA 1AQWA 4PQ1A 2GLRA 2JL4A 2XPEA 2CV4A 3FW2A 2LUSA 3GKXA 4OFMA 1SKSB 2LRCA 1O73A 1GNWA 1EZKA 1TK8B 2O8VB 3H8QA 4BVYB 3F63A 3G9BA 2RM6A 3EC3A 5HR0A 4MZBA 2KP2A 2PUKC 4AJ7A 5KOXA 1ZGNA 3LQ7A 4PGTA 1O6JA 1LBKA 1GUHA 4E8EA 2DIYA 3Q19A 2DMMA 1FAAA 2HE3A 1EV4A 1GTAA 5DCGA 3G7IA 5B8BA 1IYIA 4OO5A 3U6VA 2L6DA 2DJJA 2C80A 2DIZA 3S9FA 1T3BA 1T1VA 2ZNMA 3TCOA 4POLA 6GSXA 2FA4A 1G7EA 1Z9HA 3I69A 1GSFA 4F0CA 3IRAA 5AIVA 2F3MA 4V1Ag 2HSYA 1THOA 3DD3A 1BEDA 1UA5A 5DJLA 5AIXA 4LMWA 4I8BA 4MF5A 2IMIA 1Z7RA 4NXIA 3NZNA 3MSZA 5IMFA 3NIVA 1B9XC 5DVBA 5A4WA 3TB2A 2HRNA 3UMAA 1B48A 4JR6A 1J0FA 4MZCA 1PD21 1NHOA 2ON5A 4K9ZA 2IMFA 1OAZA 4EL1A 4EUYA 4FO5A 3ZTLA 3RPNA 1F3AA 3F6DA 2JACA 2NBSA 1B4PA 1XWKA 3GN3A 1PN0A 2E7PA 6GSSA 3P7XA 3MYDA 2LTKA 4MPGA 3CMIA 3ZIVA 3IC8A 3KXOA 2YZHA 4KNDA 4PNFA 3TKSE 4FYUA 5KN2A 3RBTA 3PPUA 3LG6A 2B1KA 13GSA 2ZUPA 3LSZA 2OE3A 2P5QA 1QFNA 3PR8A 3RDWA 3QMXA 3UAPA 2VUPA 3E3EA 1QGVA 3CYNA 4XS4B 3UJ1A 5ENUA 1SYXA 1SYRA 1K0AA 1GH2A 3UBKA 5HFIA 1TRWA 4J2FA 1MTCA 2F9SA 2JSYA 3UVHA 5HFGA 2YNXA 4FYCA 2KP1A 2YWOA 4Q5QA 2HT9A 2XPDA 1S3AA 1M9BA 4GRFA 5F06A 5G2ZA 2CVBA 3QOUA 4KDYA 5KEJA 4IP6A 1EP7A 2AV4A 2R3XA 4EXJA 1Y6EA 2GZPA 2CX4A 4Z7XA 5D96A 4NHZA 4YQVA 2TRXA 4L5OA 2FWEA 4GTUA 4GQFA 4MJAA 2C3TA 1VF4A 3EINA 4IHUA 1TTZA 3UARA 3H4KA 3M8NA 3QAGA 1TU7A 3GA4A 3GRXA 5HR2A 3N5OA 4ZL8A 19GSA 2AJQB 2HRFA 3ZVJA 1B9YC 4ZL7A 1M2DA 1RK4A 2QGVA 2VLVA 2F51A 4OMVA 3WT2A 2FUG2 1PN9A 3HVVA 1YJ6A 2VAFA 4JR4A 4I97A 4KW6A 3CSIA 4KE3A 3ERFA 2WULA 1XFLA 3QD9A 5HR1A 3GV1A 3F0IA 2VD1A 1VF1A 2JADA 3VI7A 3Q74A 4O7HA 3DRNA 4F03A 2DBCA 2N5BA 4I2UA 3RAZA 9GSSA 2MMZA 4WBJA 5IOWA 4QQ7A 2LJRA 4Q5FA 1SJ6A 1G6WA 1JLWA 4ZBDA 2GSRA 1WWJA 4PQHA 3L4NA 2HSHA 2H6XA 3C73A 1W4VA 3H1NA 4BL7A 2EIOA 3FZAA 1EV9A 1XW6A 3N9JA 5ELGA 3MNGA 5ECNB 3DGQA 4FH8A 4QL9A 1A8LA 4AJ8A 1GTBA 3BOAA 2G2QA 2GQMA 3L9UA 1ZZYA 2CQ9A 4TN8A 3UL3A 5ELAA 1JHBA 4MLYA 2HZEA 5ECQB 5IQYA 2HFDA 3QAVA 2JZTA 5DQSA 3IE3A 1T8EB 1WIKA 1QUWA 4KSMA 4K2XA 4IJ3A 3ZFLA 3EWLA 2A4VA 3U5RE 4TXOA 4CDOA 1PSQA 4NAXA 2VL9A 5ECRB 3QCPA 3IBHA 3RHCA 4HU9A 5F05A 2DJ2A 3FZ4A 1GLPA 3TRPA 5ECPB 4GSSA 2J9HA 2FWFA 3LWAA 3J7Yk 1GL8A 5ECOB 5CNWA 5DAKB 3WGDA 4IP1A 1PL2A 5JWRB 1MDIA 2DC5A 3DIEA 2VCQA 4EIQA 4V2MA 3UOMA 4G9HA 3KP8A 3KEBA 4X4JA 3FR6A 2RM5A 3GHAA 1AW9A 1GTUA 2K9FA 2H76A 3FR3A 2DKHA 5J9CA 2X99A 2FA8A 5ECLB 1MEKA 1ZL9A 5KOWA 2L5OA 1ACVA 2HRAA 1R26A 2LJKA 1H75A 2K8VA 2H6ZA 4K7OA 3ZFBA 1SD9A 2V1MA 2LSTA 5G1LA 3L9VA 3G7JA 2LRNA 1ON4A 4OO4A 4MF6A 2L4QA 2MMOA 1BYEA 4MJCA 1JZRA 1JZOA 3P90A 1V57A 2JU5A 4DSSB 3CXGA 5IMAA 2N5FA 1ERWA 2C1YA 4L5LA 4JE1A 4WEYA 2FD3A 5CREA 1QK8A 1PMTA 4Z2RA 1WP0A 2CT6A 1NW2A 2IN3A 4TOPA 2PGTA 5IO2A 1SJZA 2QA1A 3UBLA 2HI7A 4IQAA 3CTGA 2OADA 2DJ1A 3EYTA 4MJBA 3C8EA 6GSYA 3LXZA 1K0BA 1SU9A 2VLTA 2X8HA 1JZDA 5H5SA 2GVPA 4I2TA 1K0DA 2YPMA 4WR4A 4D73A 2M80A 2A4HA 3IDVA 1U3AA 2TIRA 1SK1A 3CSHA 1V9WA 2FHEA 1EP8A 1XVWA 2B1LA 1K3LA 1FHEA 4DSSA 1FW1A 11GSA 1A23A 4GLTA 1XOBA 5AN1A 4TR1A 4G0KA 4CW9A 3HA9A 1PRXA 5G5FA 1A0RP 2PPTA 3F4TA 2TRCP 5IMDA 4HQSA 2H0IA 2PVOC 2IMDA 2D2ZA 2PN8A 2L57A 5IIZA 1BQ7A 1WPIA 1MDKA 1XW9A 1S3CA 2E2GA 4O5UA 3TJFA 1H4OA 1I5GA 4NWYA 3HVSA 3EPTA 1HYUA 3GTUA 1TK5B 1MDJA 4RQXA 3VPTA 2H74A 3KP9A 3DXBA 1WJKA 4EF0A 2PWJA 3VFIA 4P3YB 2I81A 1YQ1A 1TOFA 2B5XA 3Q18A 3G7YA 2IIYA 3IXRA 2YV7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CBU A;  3GKM A;  4HZ4 A;  3HJP A;  3TJJ A;  2C4J A;  4X1U A;  2IFQ A;  1OC9 B;  3GH9 A;  5D9V A;  1TRS A;  2LNT A;  2CZ2 A;  2C0F A;  4Q5N A;  5JCG A;  5F8B A;  1UC7 A;  4FYB A;  1Z5Y E;  4F2I A;  2GS3 A;  3MWH A;  1T00 A;  4MMM A;  3DYR A;  2OAC A;  4ZB9 A;  4PX1 A;  2RUF A;  2GZY A;  5DDL A;  4WXT A;  3DML A;  2H1G A;  3DEX A;  5HR3 A;  2OE0 A;  1ERT A;  2NPB A;  4BA7 A;  4GXZ A;  2L59 A;  5FT3 A;  4ECC A;  3EU4 A;  1HNB A;  1ZCP A;  4BVX A;  3M9J A;  3FK8 A;  4BWQ A;  4PUA A;  2LQO A;  1TI1 A;  4KCA A;  3GKN A;  4EVM A;  17GS A;  1OE8 A;  4LLR A;  4N0V A;  4X0X A;  3AY8 A;  2GSS A;  3LOR A;  4V1A p;  2EIR A;  1OC9 A;  5E4W A;  1AQV A;  4BVY A;  5LCZ A;  2M46 A;  2V2G A;  2VM2 A;  1XVQ A;  1M2B A;  2KUC A;  2X8C A;  4HUA A;  2OA7 A;  3TJK A;  3IV4 A;  3ZIJ A;  3H79 A;  1Z3E A;  4ZXG A;  3GKK A;  3QDN A;  4TKY A;  1GP1 A;  1O85 A;  3CRT A;  1BG5 A;  5B8A A;  3O3T A;  4N10 A;  4MH3 A;  1EEJ A;  6GSW A;  3ED3 A;  4XCS A;  4TXV A;  1X0R A;  2QKE A;  4I6X A;  1V40 A;  4O5R A;  3WD6 A;  4WKW A;  2XHF A;  4POM A;  1QQ2 A;  1A2L A;  1QMV A;  1YKC A;  4N0Z A;  3CRU A;  1FVK A;  5D93 A;  2BMX A;  2MBS A;  4NMU A;  1KTE A;  4J56 E;  4LL4 B;  4EC0 A;  1HNA A;  1M2A A;  2H73 A;  4ECB A;  2K6V A;  4N11 A;  5DBQ A;  3IOS A;  4GWR A;  5ECI B;  1GSU A;  2Z9S A;  3IR4 A;  1THX A;  3ZRD A;  4ML1 A;  1V98 A;  6GSV A;  5ID2 B;  3HYP A;  5B6M A;  1C72 A;  1ABA A;  4ZB6 A;  3DVW A;  3LJR A;  4XIH A;  2RLI A;  4BWS A;  3NOF A;  1M99 A;  1PX7 A;  1AAZ A;  4NV5 A;  2GQL A;  2O85 A;  2H6Y A;  5GAN D;  18GS A;  2CAQ A;  1K0M A;  1O8W A;  2B5Y A;  4IQ1 A;  1MD3 A;  4WBR D;  3EMP A;  3WGX A;  1OC3 A;  2GGT A;  4XS4 A;  2K8S A;  5DCH A;  4KSO A;  3EMX A;  4ECI A;  2RII A;  3FHK A;  1V2A A;  2PU9 C;  1WOU A;  2AYT A;  4MA9 A;  4IEL A;  2IL3 A;  2C3N A;  3QFA C;  1G7O A;  3A2V A;  3I43 A;  2B7K A;  3IA1 A;  3D4M A;  1F37 A;  3GFK A;  2WZ9 A;  3ZLP A;  3GYK A;  3VPQ A;  1TRV A;  1YKA A;  5CAX A;  1XZO A;  3KH7 A;  2LS5 A;  1AC1 A;  2YAN A;  4OCF A;  4G19 A;  4V2N A;  1R5P A;  1LU4 A;  1G6Y A;  3ZYW A;  1XOA A;  1N2A A;  3D21 A;  1NHY A;  3SWL A;  5F07 A;  2ES7 A;  1V58 A;  1TKD B;  4RI7 A;  1F3B A;  1X5E A;  4MK3 A;  2YJH A;  2V41 A;  2CZ3 A;  3KTB A;  2GQK A;  2CA8 A;  5C04 A;  4ZL9 A;  1XWC A;  5JCU A;  1PX6 A;  2LV3 A;  4K0G A;  2B5E A;  1XW5 A;  4K6X A;  2C0G A;  4WET A;  2YOI A;  1LJR A;  4K1F A;  1EOH A;  3A2W A;  1GTI A;  2YWI A;  3D4T A;  5COH A;  4EKZ A;  4MDC A;  3CSJ A;  1YF0 A;  2GDR A;  3I6A A;  4ZB8 A;  1XXU A;  4YAV A;  3ERG A;  3L78 A;  1TP9 A;  4L0W A;  2HLS A;  4AJ6 A;  4YH2 A;  1U3I A;  3ERW A;  4G10 A;  4HS1 A;  3KJY A;  1ZOF A;  3M9K A;  4XTS A;  2OBI A;  3C71 A;  1GLQ A;  3HKR A;  4MAB A;  2VOC A;  4DVC A;  3LEF A;  2CX3 A;  3A3T A;  3BCI A;  5FHI A;  1NSW A;  4KDU A;  3TRX A;  1GRX A;  3APQ A;  3KMO A;  4XS1 A;  3TKS C;  5IMC A;  4IN0 A;  1SD8 A;  3DKS A;  3VK9 A;  4E8H A;  5EVO A;  3RPP A;  5CYY A;  3P8W A;  4GST A;  4ULX A;  3GMF A;  2CAI A;  4O32 A;  2MMN A;  4Q5R A;  2B7J A;  2YWM A;  1J9B A;  1M7T A;  1A2M A;  1KEB A;  4GQC A;  1R4W A;  4JBB A;  4JRR A;  5E59 A;  1TK0 B;  4PXO A;  1F2E A;  1TDI A;  1A8Y A;  3H93 A;  2NDO A;  1GUK A;  2DJ0 A;  2FWH A;  1OE7 A;  1YF1 A;  4RUV A;  1SK0 A;  1T7P B;  2H71 A;  1SKR B;  1DE1 A;  1W89 A;  2A2S A;  3GUS A;  5DAK A;  2I1U A;  1TW9 A;  3L0H A;  2YCD A;  5G31 A;  3KH9 A;  4JU5 A;  1GUL A;  4ZBB A;  1O8X A;  3TKS A;  1YEX A;  1X5C A;  3LGC A;  3ZIT A;  1VF3 A;  3CTF A;  4IBP A;  3BD2 A;  1RW1 A;  1ML6 A;  2I9H A;  4JED A;  3GNJ A;  2PVQ A;  1TXX A;  3KCM A;  5JWQ B;  3FY7 A;  2WS2 A;  5CRW A;  2N5A A;  4ZIJ A;  2R2J A;  1OYJ A;  2X64 A;  1XWG A;  4ML6 A;  2MYG A;  2BTO T;  1YDK A;  3PH9 A;  3M3M A;  1FG4 A;  4KB3 A;  2VL3 A;  1SL0 B;  1VF2 A;  2FGX A;  5A4U A;  6GST A;  1X9S B;  1R5A A;  2H01 A;  4F9Z A;  1UVZ A;  1TU8 A;  2LQQ A;  5DJM A;  4XS6 A;  5GST A;  2ALB A;  3GST A;  4ILF A;  4MZW A;  4TR0 A;  4DSR A;  4PUF C;  1AIU A;  5KN1 A;  4MH2 A;  4IGJ A;  2IPA A;  4HDE A;  2R4V A;  2PER A;  2VCV A;  3GSS A;  3Q6O A;  1KBN A;  4ID0 A;  2EC4 A;  4I5Q A;  3PIN A;  1TJD A;  5J9B A;  2HXK A;  1EOG A;  4FIW A;  5CRG A;  3KD0 A;  1EGR A;  2K18 A;  1WRY A;  8GSS A;  3TDG A;  4L8E A;  1R7H A;  5LNK e;  6GSU A;  5D73 A;  4G2E A;  2P31 A;  4EDZ A;  4LA1 A;  3MAK A;  2XBI A;  1WMJ A;  2OKA A;  20GS A;  3ZZX A;  3HJO A;  2NTO A;  2H66 A;  3KMN A;  5HQP A;  1QXH A;  1XIY A;  4MJE A;  4GCI A;  2VCZ A;  3TGZ A;  2WGR A;  5JWO B;  2GT5 A;  1FB6 A;  4WF4 A;  2YP6 A;  16GS A;  2AB6 A;  4OWY A;  4AGS A;  3WT1 A;  1YY7 A;  3WYW A;  1YEP A;  1ZYE A;  5FWG A;  3GL5 A;  3O76 A;  3J7Y b;  3IAS 2;  1YZX A;  4DSQ A;  5IM9 A;  4ZBA A;  3VI5 A;  2IJY A;  1FO5 A;  2R5G A;  1DSB A;  2G0F A;  1GSQ A;  4KDX A;  5ABR A;  1SJI A;  2VIM A;  4NV2 A;  3D0Z A;  3FZ5 A;  2MBT A;  1U87 A;  2FNO A;  5CP1 A;  2F8F A;  1SL1 B;  2DJK A;  3D5J A;  2VM1 A;  1DBY A;  1TRU A;  4XRA A;  1XCC A;  4ECJ A;  2MZC A;  4IJI A;  1Z7P A;  3IK7 A;  1RQM A;  1VRS D;  4TVE A;  1TI3 A;  5F0G A;  4QL7 A;  3TKP A;  5GZZ B;  2GTU A;  2LKU A;  2H1A A;  1SK2 A;  2C3Q A;  4KA0 A;  4CHS A;  3W6G A;  2R37 A;  1K0N A;  5H5Q A;  3W8J A;  3A2X A;  2V32 A;  2KHP A;  1ERU A;  1PGT A;  2GST A;  2HNL A;  3ZMK A;  4HEA 2;  4XRD A;  3M1G A;  3R2Q A;  2I4A A;  4TR3 A;  4NHW A;  3D6I A;  3ZL5 A;  1B8X A;  3DWV A;  4RQR A;  2RUE A;  3QR6 A;  2M72 A;  1F9M A;  1GSE A;  1M0U A;  2ZCT A;  1Q4J A;  4YAP A;  5EPF A;  5J3R A;  2LRT A;  3HZ8 A;  2WB9 A;  4POB A;  2FCH A;  1X9W B;  3D22 A;  3ME8 A;  1HQO A;  3HXS A;  1DE2 A;  3KZQ A;  3EU3 A;  1PKW A;  3HD5 A;  3VLN A;  5GSS A;  4JZQ A;  2VO4 A;  2X8G A;  1GSS A;  1I9D A;  1BX9 A;  1JZW A;  4X43 A;  5KN3 A;  1O7U A;  4IVF A;  2H70 A;  4KX4 A;  2LJA A;  5CRH A;  1XWB A;  1VGL A;  1USB A;  5B6N A;  5J4U A;  1K3O A;  4DEJ A;  3E0U A;  3KM6 A;  3TJB A;  3ME7 A;  3FEU A;  4K7I A;  5AGY A;  2XBQ A;  4OFT A;  3JCM L;  2L5L A;  4OCE A;  2YWN A;  3VWV A;  2WFC A;  2REM A;  3P2A A;  4EDY A;  3FR9 A;  1CQG A;  2CVD A;  3LFL A;  1X5D A;  2V6O A;  4N30 A;  2QC7 A;  2V6K A;  2WDU A;  5ID2 A;  1A24 A;  2H0G A;  4KAE A;  2LEG A;  5HFK A;  3FYG A;  1B4Q A;  3VWX A;  2NVL A;  3O6T A;  4ISD A;  3ISO A;  1ST9 A;  3FZ9 A;  4KUN A;  3QFB C;  3KTL A;  3LYK A;  5IPG A;  2FY6 A;  2O87 A;  3TKQ A;  1E2Y A;  2L4C A;  1NM3 A;  1OVN A;  3EE2 A;  1Z6N A;  4K2D A;  4HI7 A;  3GH6 A;  3UEM A;  4PUR A;  4F0B A;  5A4V A;  2DML A;  5C00 A;  4K8M A;  3DVX A;  2H0H A;  3M0F A;  3HY2 A;  3IC4 A;  2HZF A;  2YZU A;  3C1R A;  2WCI A;  2IME A;  1T4Z A;  1JLV A;  2GSQ A;  1URM A;  5KN0 A;  3BBY A;  2ON7 A;  3HHV A;  3GUR A;  1E6B A;  3IPZ A;  1S3D A;  4PQI A;  3OR5 A;  5DAL B;  2I3Y A;  2HZE B;  3L9S A;  4V2L A;  3ZRE A;  2O7K A;  4KGI A;  1SL2 B;  2H8L A;  1J08 A;  3HCZ A;  5ECH B;  2C0D A;  5EY6 A;  4ZIL A;  4BPY A;  4PNG A;  2P0G A;  2H19 A;  2YJ7 A;  4TXO B;  3W8S A;  4MP4 A;  1AQX A;  2E2M A;  3IHQ A;  2IWT A;  3ZML A;  2C8U A;  4IS0 A;  2GZZ A;  2YV9 A;  1AXD A;  2JZR A;  3K8N A;  4HZ2 A;  1OC8 A;  3TUE A;  10GS A;  3FKF A;  4L0U A;  4OFN A;  4EO3 A;  22GS A;  1ZYQ B;  2FLS A;  2L6C A;  2H72 A;  3IK9 A;  3LYP A;  5D9T A;  2A2R A;  4GF0 A;  1Q98 A;  5CO3 A;  5DAL A;  3TOU A;  3QPM A;  1ERV A;  2DSA A;  5INY A;  1GNE A;  2AUV A;  5ECS A;  4POK A;  2F8A A;  5D8I A;  1FVJ A;  4J57 E;  1XWA A;  4WF5 A;  3APO A;  2VCW A;  4HJM A;  4LL1 B;  4YQM A;  1KNG A;  1JFU A;  3GL3 A;  1PL1 A;  3UVT A;  1ZMA A;  1Z6M A;  2GT6 A;  1OKT A;  5IMZ A;  4H86 A;  3APS A;  3KIJ A;  2XC2 A;  2VCX A;  2DLX A;  3MDK A;  5ECM B;  2HYX A;  2PBJ A;  1HNC A;  3TOT A;  5B7C A;  2FWG A;  3F4R A;  3IAM 2;  5G1K A;  3UIW A;  1F6M C;  4XHM A;  1WE0 A;  2O89 A;  2VD0 A;  1A2J A;  2PMT A;  1A0F A;  1EWX A;  2EIQ A;  2CVK A;  2OJL A;  3WGE A;  4MCU A;  5A5K A;  1N8J A;  1IYH A;  4LMV A;  5H5R A;  12GS A;  2WRT A;  2VCT A;  4D73 B;  4WR5 A;  5G5E A;  1ILO A;  3EVI A;  1GUM A;  1FOV A;  4HJ2 A;  2QSI A;  1K0C A;  4EE0 A;  3VWW A;  1XBS A;  5LD0 A;  4MF7 A;  2C0E A;  3GIX A;  5GAP D;  1BAY A;  5IMV A;  5J41 A;  3F3Q A;  2H1D A;  1K0O A;  5D9X A;  4TR1 B;  4TRX A;  3C7M A;  4IW9 A;  5D9W A;  4KH7 A;  4OD7 A;  3HVX A;  3TRQ A;  3RHB A;  5CRD A;  1AUC A;  4NPB A;  14GS A;  2WJU A;  2H75 A;  5ECK B;  5DQY A;  2MMA A;  1DUG A;  2H30 A;  3EUR A;  2P5R A;  1SKW B;  4HU7 A;  3FRC A;  3HZ4 A;  1EGO A;  3US3 A;  2YN1 A;  2KLX A;  1T4Y A;  2OE1 A;  4ACS A;  3GTU B;  3I9V 2;  1EEM A;  1G0T A;  1SEN A;  5J5N A;  3HJM A;  2VL2 C;  1M9A A;  4HQZ A;  1CQH A;  4KCE A;  3ZVJ D;  1MD4 A;  3GX8 A;  5JCW A;  4MPF A;  2AAW A;  1U88 A;  3F3R A;  1FB0 A;  4HOJ A;  2KOK A;  4YQU A;  3VWU A;  2AHE A;  3F9U A;  1BJX A;  1PKZ A;  3E9J B;  5EL8 A;  3KGK A;  1X9M B;  4F82 A;  3QAW A;  2E0Q A;  1PA3 A;  1OKD A;  2B6M A;  2J23 A;  3PGT A;  3BJ5 A;  3VUR A;  2IFQ B;  1PQN A;  4GSN A;  1Y25 A;  5IO0 A;  4TW5 A;  3F8U A;  5G30 A;  3A5W A;  3F4S A;  3HDC A;  3F6F A;  2JSZ A;  1O81 A;  1HD2 A;  2OBK A;  2JZS A;  3SBC A;  2R6K A;  4K7N A;  3C1S A;  4AF2 A;  1GSD A;  2DJ3 A;  2VLU A;  2BJX A;  4RI6 A;  5L71 A;  1XPV A;  1UN2 A;  4K0N A;  3GX0 A;  4TR4 A;  2VL2 A;  1GWC A;  7GSS A;  2LNS A;  2IMK A;  3V1W A;  4IKH A;  4O92 A;  1K3Y A;  2B3S A;  2H1B A;  5AIS A;  3TJG A;  3TKR A;  1GSY A;  5IPH A;  3BCK A;  1U6T A;  3LXT A;  5IOX A;  1AQW A;  4PQ1 A;  2GLR A;  2JL4 A;  2XPE A;  2CV4 A;  3FW2 A;  2LUS A;  3GKX A;  4OFM A;  1SKS B;  2LRC A;  1O73 A;  1GNW A;  1EZK A;  1TK8 B;  2O8V B;  3H8Q A;  3F63 A;  3G9B A;  2RM6 A;  3EC3 A;  5HR0 A;  4MZB A;  2KP2 A;  2PUK C;  4AJ7 A;  1ZGN A;  3LQ7 A;  4PGT A;  1O6J A;  1LBK A;  1GUH A;  4E8E A;  2DIY A;  3Q19 A;  2DMM A;  1FAA A;  2HE3 A;  1EV4 A;  1GTA A;  5DCG A;  3G7I A;  5B8B A;  1IYI A;  4OO5 A;  3U6V A;  2L6D A;  2DJJ A;  2C80 A;  2DIZ A;  3S9F A;  1T3B A;  1T1V A;  2ZNM A;  3TCO A;  4POL A;  6GSX A;  2FA4 A;  1G7E A;  1Z9H A;  3I69 A;  1GSF A;  4F0C A;  3IRA A;  5AIV A;  2F3M A;  4V1A g;  2HSY A;  1THO A;  3DD3 A;  1BED A;  1UA5 A;  5DJL A;  5AIX A;  4LMW A;  4I8B A;  4MF5 A;  2IMI A;  1Z7R A;  4NXI A;  3NZN A;  3MSZ A;  5IMF A;  3NIV A;  1B9X C;  5DVB A;  5A4W A;  3TB2 A;  2HRN A;  3UMA A;  1B48 A;  4JR6 A;  1J0F A;  4MZC A;  1PD2 1;  1NHO A;  2ON5 A;  4K9Z A;  2IMF A;  1OAZ A;  4EL1 A;  4EUY A;  4FO5 A;  3ZTL A;  3RPN A;  1F3A A;  3F6D A;  2JAC A;  2NBS A;  1B4P A;  1XWK A;  3GN3 A;  2E7P A;  6GSS A;  3P7X A;  2LTK A;  4MPG A;  3CMI A;  3ZIV A;  3KXO A;  2YZH A;  4KND A;  4PNF A;  3TKS E;  4FYU A;  5KN2 A;  3RBT A;  3LG6 A;  2B1K A;  13GS A;  2ZUP A;  3LSZ A;  2OE3 A;  2P5Q A;  1QFN A;  3PR8 A;  3RDW A;  3QMX A;  3UAP A;  2VUP A;  3E3E A;  1QGV A;  3CYN A;  4XS4 B;  3UJ1 A;  5ENU A;  1SYX A;  1SYR A;  1K0A A;  1GH2 A;  3UBK A;  5HFI A;  1TRW A;  4J2F A;  1MTC A;  2F9S A;  2JSY A;  3UVH A;  5HFG A;  2YNX A;  4FYC A;  2KP1 A;  2YWO A;  4Q5Q A;  2HT9 A;  2XPD A;  1S3A A;  1M9B A;  4GRF A;  5F06 A;  5G2Z A;  2CVB A;  3QOU A;  4KDY A;  5KEJ A;  4IP6 A;  1EP7 A;  2AV4 A;  2R3X A;  4EXJ A;  1Y6E A;  2GZP A;  2CX4 A;  4Z7X A;  5D96 A;  4NHZ A;  4YQV A;  2TRX A;  4L5O A;  2FWE A;  4GTU A;  4GQF A;  4MJA A;  2C3T A;  1VF4 A;  3EIN A;  4IHU A;  1TTZ A;  3UAR A;  3H4K A;  3M8N A;  3QAG A;  1TU7 A;  3GA4 A;  3GRX A;  5HR2 A;  3N5O A;  4ZL8 A;  19GS A;  2AJQ B;  2HRF A;  3ZVJ A;  1B9Y C;  4ZL7 A;  1M2D A;  1RK4 A;  2QGV A;  2VLV A;  2F51 A;  4OMV A;  3WT2 A;  2FUG 2;  1PN9 A;  3HVV A;  1YJ6 A;  2VAF A;  4JR4 A;  4I97 A;  4KW6 A;  3CSI A;  4KE3 A;  3ERF A;  2WUL A;  1XFL A;  3QD9 A;  5HR1 A;  3GV1 A;  3F0I A;  2VD1 A;  1VF1 A;  2JAD A;  3VI7 A;  3Q74 A;  4O7H A;  3DRN A;  4F03 A;  2DBC A;  2N5B A;  4I2U A;  3RAZ A;  9GSS A;  2MMZ A;  4WBJ A;  5IOW A;  4QQ7 A;  2LJR A;  4Q5F A;  1SJ6 A;  1G6W A;  1JLW A;  4ZBD A;  2GSR A;  1WWJ A;  4PQH A;  3L4N A;  2HSH A;  2H6X A;  3C73 A;  1W4V A;  3H1N A;  4BL7 A;  2EIO A;  3FZA A;  1EV9 A;  1XW6 A;  3N9J A;  5ELG A;  3MNG A;  5ECN B;  3DGQ A;  4FH8 A;  4QL9 A;  1A8L A;  4AJ8 A;  1GTB A;  3BOA A;  2G2Q A;  2GQM A;  3L9U A;  1ZZY A;  2CQ9 A;  4TN8 A;  3UL3 A;  5ELA A;  1JHB A;  4MLY A;  2HZE A;  5ECQ B;  5IQY A;  2HFD A;  3QAV A;  2JZT A;  5DQS A;  3IE3 A;  1T8E B;  1WIK A;  1QUW A;  4KSM A;  4IJ3 A;  3ZFL A;  3EWL A;  2A4V A;  3U5R E;  4TXO A;  4CDO A;  1PSQ A;  4NAX A;  2VL9 A;  5ECR B;  3QCP A;  3IBH A;  3RHC A;  4HU9 A;  5F05 A;  2DJ2 A;  3FZ4 A;  1GLP A;  3TRP A;  5ECP B;  4GSS A;  2J9H A;  2FWF A;  3LWA A;  3J7Y k;  1GL8 A;  5ECO B;  5CNW A;  5DAK B;  3WGD A;  4IP1 A;  1PL2 A;  5JWR B;  1MDI A;  2DC5 A;  3DIE A;  2VCQ A;  4V2M A;  3UOM A;  4G9H A;  3KP8 A;  3KEB A;  3FR6 A;  2RM5 A;  3GHA A;  1AW9 A;  1GTU A;  2K9F A;  2H76 A;  3FR3 A;  5J9C A;  2X99 A;  2FA8 A;  5ECL B;  1MEK A;  1ZL9 A;  2L5O A;  1ACV A;  1R26 A;  2LJK A;  1H75 A;  2K8V A;  2H6Z A;  4K7O A;  3ZFB A;  1SD9 A;  2V1M A;  2LST A;  5G1L A;  3L9V A;  3G7J A;  2LRN A;  1ON4 A;  4OO4 A;  4MF6 A;  2L4Q A;  2MMO A;  1BYE A;  4MJC A;  1JZR A;  1JZO A;  3P90 A;  1V57 A;  2JU5 A;  4DSS B;  3CXG A;  5IMA A;  2N5F A;  1ERW A;  2C1Y A;  4L5L A;  4JE1 A;  4WEY A;  2FD3 A;  5CRE A;  1QK8 A;  1PMT A;  1WP0 A;  2CT6 A;  1NW2 A;  2IN3 A;  4TOP A;  2PGT A;  5IO2 A;  1SJZ A;  3UBL A;  2HI7 A;  4IQA A;  3CTG A;  2OAD A;  2DJ1 A;  3EYT A;  4MJB A;  3C8E A;  6GSY A;  3LXZ A;  1K0B A;  1SU9 A;  2VLT A;  2X8H A;  1JZD A;  5H5S A;  2GVP A;  4I2T A;  1K0D A;  2YPM A;  4WR4 A;  4D73 A;  2M80 A;  3IDV A;  1U3A A;  2TIR A;  1SK1 A;  3CSH A;  1V9W A;  2FHE A;  1EP8 A;  1XVW A;  2B1L A;  1K3L A;  1FHE A;  4DSS A;  1FW1 A;  11GS A;  1A23 A;  4GLT A;  1XOB A;  5AN1 A;  4TR1 A;  4CW9 A;  3HA9 A;  1PRX A;  5G5F A;  1A0R P;  2PPT A;  3F4T A;  2TRC P;  5IMD A;  4HQS A;  2H0I A;  2PVO C;  2IMD A;  2D2Z A;  2PN8 A;  2L57 A;  5IIZ A;  1BQ7 A;  1WPI A;  1MDK A;  1XW9 A;  1S3C A;  2E2G A;  3TJF A;  1H4O A;  1I5G A;  4NWY A;  3HVS A;  1HYU A;  3GTU A;  1TK5 B;  1MDJ A;  4RQX A;  3VPT A;  2H74 A;  3KP9 A;  3DXB A;  1WJK A;  4EF0 A;  2PWJ A;  3VFI A;  4P3Y B;  2I81 A;  1YQ1 A;  1TOF A;  2B5X A;  3Q18 A;  3G7Y A;  2IIY A;  3IXR A;  2YV7 A; 
#chains in the Genus database with same CATH topology
 3CBU A;  3GKM A;  4HZ4 A;  3HJP A;  3TJJ A;  2C4J A;  4X1U A;  2IFQ A;  4K5R A;  1OC9 B;  3GH9 A;  5D9V A;  1TRS A;  2LNT A;  2CZ2 A;  2C0F A;  4Q5N A;  5JCG A;  5F8B A;  1UC7 A;  4FYB A;  1Z5Y E;  4F2I A;  2GS3 A;  3MWH A;  1T00 A;  4MMM A;  3DYR A;  2OAC A;  4ZB9 A;  4PX1 A;  2RUF A;  2GZY A;  5DDL A;  4WXT A;  3DML A;  2H1G A;  3DEX A;  5HR3 A;  2OE0 A;  1ERT A;  2NPB A;  4BA7 A;  4GXZ A;  2L59 A;  5FT3 A;  4ECC A;  3EU4 A;  1HNB A;  1ZCP A;  4BVX A;  3M9J A;  3FK8 A;  4BWQ A;  2A2P A;  2DKI A;  4PUA A;  2LQO A;  1TI1 A;  4KCA A;  3GKN A;  4EVM A;  17GS A;  1OE8 A;  4LLR A;  4N0V A;  4X0X A;  3AY8 A;  2GSS A;  3LOR A;  4V1A p;  2EIR A;  1OC9 A;  5E4W A;  1AQV A;  4BVY A;  5LCZ A;  2M46 A;  2V2G A;  2VM2 A;  1XVQ A;  1M2B A;  2KUC A;  2X8C A;  4HUA A;  2OA7 A;  3TJK A;  3IV4 A;  3ZIJ A;  3H79 A;  1Z3E A;  4ZXG A;  3GKK A;  3QDN A;  4TKY A;  1GP1 A;  1O85 A;  3CRT A;  1BG5 A;  5B8A A;  3O3T A;  4N10 A;  4MH3 A;  1EEJ A;  6GSW A;  3ED3 A;  4XCS A;  4TXV A;  4G0I A;  1X0R A;  4EIP A;  2QKE A;  4I6X A;  1V40 A;  4O5R A;  3WD6 A;  4WKW A;  2XHF A;  4POM A;  1QQ2 A;  1A2L A;  1QMV A;  1YKC A;  4N0Z A;  3CRU A;  1FVK A;  5D93 A;  2BMX A;  2MBS A;  4NMU A;  1KTE A;  4J56 E;  4LL4 B;  4EC0 A;  1HNA A;  1M2A A;  2H73 A;  4ECB A;  2K6V A;  4N11 A;  5DBQ A;  3IOS A;  4GWR A;  5ECI B;  1GSU A;  2Z9S A;  3IR4 A;  1THX A;  3ZRD A;  4ML1 A;  1V98 A;  6GSV A;  5ID2 B;  3HYP A;  4K5S A;  5B6M A;  1C72 A;  1ABA A;  4ZB6 A;  3DVW A;  3LJR A;  4XIH A;  1M3J A;  2RLI A;  4BWS A;  3NOF A;  1ZYN A;  1M99 A;  1PX7 A;  1AAZ A;  4NV5 A;  2GQL A;  2O85 A;  2H6Y A;  5GAN D;  18GS A;  2CAQ A;  1K0M A;  1O8W A;  2B5Y A;  4IQ1 A;  1MD3 A;  4WBR D;  3EMP A;  3WGX A;  1OC3 A;  2GGT A;  4XS4 A;  2K8S A;  5DCH A;  4KSO A;  3EMX A;  4ECI A;  2RII A;  3FHK A;  1V2A A;  2PU9 C;  1WOU A;  2AYT A;  4MA9 A;  4IEL A;  2IL3 A;  2C3N A;  3QFA C;  1G7O A;  3A2V A;  3I43 A;  2B7K A;  3IA1 A;  3D4M A;  1F37 A;  3GFK A;  2WZ9 A;  3ZLP A;  3GYK A;  3VPQ A;  1TRV A;  1YKA A;  5CAX A;  1XZO A;  3KH7 A;  2LS5 A;  1AC1 A;  2YAN A;  4OCF A;  4G19 A;  4V2N A;  1R5P A;  1LU4 A;  1G6Y A;  3ZYW A;  1XOA A;  1N2A A;  3D21 A;  1NHY A;  3SWL A;  5F07 A;  2ES7 A;  1V58 A;  1TKD B;  4RI7 A;  1F3B A;  1X5E A;  4MK3 A;  2YJH A;  2V41 A;  2CZ3 A;  3KTB A;  2GQK A;  2CA8 A;  5C04 A;  4ZL9 A;  1XWC A;  5JCU A;  1PX6 A;  3LW9 A;  2LV3 A;  4K0G A;  2B5E A;  1XW5 A;  4K6X A;  2C0G A;  4WET A;  2YOI A;  1LJR A;  3HVN A;  4K1F A;  1EOH A;  3A2W A;  1GTI A;  2YWI A;  3D4T A;  5COH A;  4EKZ A;  4MDC A;  3CSJ A;  1YF0 A;  2GDR A;  3I6A A;  4ZB8 A;  1XXU A;  4YAV A;  3ERG A;  3L78 A;  1TP9 A;  3IHG A;  4L0W A;  2HLS A;  4AJ6 A;  4YH2 A;  1U3I A;  3ERW A;  4G10 A;  4HS1 A;  3KJY A;  1ZOF A;  5BRT A;  4KF9 A;  3M9K A;  4FQU A;  4XTS A;  2OBI A;  3C71 A;  1GLQ A;  3HKR A;  4MAB A;  2VOC A;  4DVC A;  3LEF A;  2CX3 A;  3A3T A;  3BCI A;  5FHI A;  1NSW A;  4KDU A;  3TRX A;  1GRX A;  3APQ A;  3KMO A;  4XS1 A;  3TKS C;  2HRK A;  5IMC A;  4IN0 A;  1SD8 A;  3DKS A;  3VK9 A;  4YKG A;  4E8H A;  5EVO A;  3RPP A;  5CYY A;  3P8W A;  4GST A;  4ULX A;  3GMF A;  2CAI A;  4O32 A;  2MMN A;  4Q5R A;  2B7J A;  2YWM A;  1J9B A;  1M7T A;  1A2M A;  1KEB A;  4GQC A;  1R4W A;  4JBB A;  4JRR A;  5E59 A;  4BIK A;  1TK0 B;  4PXO A;  1F2E A;  1TDI A;  1A8Y A;  3H93 A;  2NDO A;  1GUK A;  2DJ0 A;  2FWH A;  1OE7 A;  1YF1 A;  4RUV A;  1SK0 A;  1T7P B;  2H71 A;  1SKR B;  1DE1 A;  1W89 A;  2A2S A;  3GUS A;  5DAK A;  2I1U A;  1TW9 A;  3L0H A;  2YCD A;  5G31 A;  3KH9 A;  4JU5 A;  1GUL A;  4ZBB A;  2X49 A;  1O8X A;  3TKS A;  1YEX A;  1X5C A;  3LGC A;  3ZIT A;  1VF3 A;  3CTF A;  4IBP A;  3BD2 A;  1RW1 A;  1ML6 A;  2I9H A;  4JED A;  3GNJ A;  2PVQ A;  1TXX A;  3KCM A;  5JWQ B;  3FY7 A;  2R0C A;  2WS2 A;  5CRW A;  2N5A A;  4ZIJ A;  2R2J A;  1OYJ A;  2X64 A;  1XWG A;  4ML6 A;  2MYG A;  2BTO T;  1YDK A;  3PH9 A;  3M3M A;  1FG4 A;  4KB3 A;  2VL3 A;  1SL0 B;  1VF2 A;  2FGX A;  5A4U A;  6GST A;  1X9S B;  1R5A A;  2H01 A;  4F9Z A;  1UVZ A;  1TU8 A;  2LQQ A;  3R3E A;  5DJM A;  4XS6 A;  5GST A;  2ALB A;  3GST A;  4ILF A;  4MZW A;  4TR0 A;  4DSR A;  4PUF C;  1AIU A;  5KN1 A;  4ICY A;  4MH2 A;  4IGJ A;  2IPA A;  4HDE A;  2R4V A;  2PER A;  2VCV A;  3GSS A;  3A5I A;  3Q6O A;  1KBN A;  4ID0 A;  2EC4 A;  4I5Q A;  3PIN A;  1TJD A;  4CY6 A;  5J9B A;  2HXK A;  1EOG A;  4Z2U A;  4FIW A;  5CRG A;  3KD0 A;  2X4A A;  1EGR A;  2K18 A;  1WRY A;  8GSS A;  3TDG A;  4L8E A;  1R7H A;  5LNK e;  6GSU A;  5D73 A;  4G2E A;  2P31 A;  4EDZ A;  4LA1 A;  3MAK A;  2XBI A;  1WMJ A;  2OKA A;  20GS A;  3ZZX A;  3HJO A;  2NTO A;  2H66 A;  3KMN A;  5HQP A;  1QXH A;  4YKF A;  1XIY A;  4MJE A;  4GCI A;  2VCZ A;  3TGZ A;  2WGR A;  5JWO B;  2GT5 A;  1FB6 A;  4WF4 A;  2YP6 A;  16GS A;  2AB6 A;  4OWY A;  4AGS A;  3WT1 A;  1YY7 A;  3WYW A;  1YEP A;  1ZYE A;  5FWG A;  3GL5 A;  3O76 A;  3J7Y b;  2UZ8 A;  3IAS 2;  1YZX A;  4DSQ A;  5IM9 A;  4ZBA A;  3VI5 A;  2IJY A;  1FO5 A;  2R5G A;  1DSB A;  2G0F A;  1GSQ A;  4KDX A;  5ABR A;  1SJI A;  2VIM A;  4NV2 A;  3D0Z A;  3FZ5 A;  2MBT A;  1U87 A;  2FNO A;  5CP1 A;  2F8F A;  1SL1 B;  2DJK A;  1ZYP A;  3D5J A;  2VM1 A;  1DBY A;  1TRU A;  4XRA A;  1XCC A;  4ECJ A;  2MZC A;  4IJI A;  1Z7P A;  3IK7 A;  1RQM A;  1VRS D;  4TVE A;  1TI3 A;  5F0G A;  4QL7 A;  3TKP A;  5GZZ B;  2GTU A;  2LKU A;  2H1A A;  1SK2 A;  2C3Q A;  4KA0 A;  4CHS A;  3W6G A;  2R37 A;  1K0N A;  5H5Q A;  3W8J A;  3A2X A;  2V32 A;  2KHP A;  1ERU A;  1PGT A;  2GST A;  2HNL A;  3ZMK A;  1S3R A;  4HEA 2;  4XRD A;  3M1G A;  3R2Q A;  2I4A A;  4TR3 A;  4NHW A;  3D6I A;  3ZL5 A;  1B8X A;  3DWV A;  4RQR A;  2RUE A;  3QR6 A;  2M72 A;  1F9M A;  1GSE A;  1M0U A;  2ZCT A;  4MNN A;  1Q4J A;  4YAP A;  5EPF A;  5J3R A;  2LRT A;  3HZ8 A;  2R0G A;  2WB9 A;  4POB A;  2FCH A;  1X9W B;  3D22 A;  3ME8 A;  1HQO A;  3HXS A;  1DE2 A;  3KZQ A;  3EU3 A;  1PKW A;  3HD5 A;  3VLN A;  5GSS A;  4JZQ A;  2VO4 A;  2X8G A;  1GSS A;  1I9D A;  1BX9 A;  1JZW A;  4X43 A;  5KN3 A;  1O7U A;  4IVF A;  2H70 A;  4KX4 A;  2LJA A;  5CRH A;  1XWB A;  1VGL A;  1USB A;  5B6N A;  5J4U A;  1K3O A;  4DEJ A;  3E0U A;  3KM6 A;  3TJB A;  3ME7 A;  3FEU A;  4K7I A;  5AGY A;  2XBQ A;  4OFT A;  3JCM L;  4USS A;  2L5L A;  4OCE A;  2YWN A;  3VWV A;  2WFC A;  2REM A;  3P2A A;  4EDY A;  3FR9 A;  1CQG A;  2CVD A;  3LFL A;  2R0P A;  1X5D A;  2V6O A;  4N30 A;  2QC7 A;  2V6K A;  2WDU A;  5ID2 A;  1A24 A;  4O5Q A;  2H0G A;  4KAE A;  2LEG A;  5HFK A;  3FYG A;  1B4Q A;  3VWX A;  2NVL A;  3O6T A;  4ISD A;  3ISO A;  1ST9 A;  3FZ9 A;  4KUN A;  3QFB C;  3KTL A;  3LYK A;  5IPG A;  2FY6 A;  2O87 A;  2HSM A;  3TKQ A;  1E2Y A;  2L4C A;  1NM3 A;  1OVN A;  3EE2 A;  1Z6N A;  4K2D A;  4BL7 B;  4HI7 A;  3GH6 A;  3UEM A;  4PUR A;  4F0B A;  5A4V A;  2DML A;  5C00 A;  4K8M A;  3DVX A;  2H0H A;  3M0F A;  3HY2 A;  3IC4 A;  2HZF A;  2YZU A;  3C1R A;  4Z2T A;  2WCI A;  2IME A;  1T4Z A;  1JLV A;  2GSQ A;  1URM A;  5KN0 A;  3BBY A;  2ON7 A;  3HHV A;  3GUR A;  1E6B A;  3IPZ A;  1S3D A;  4PQI A;  3OR5 A;  5DAL B;  2I3Y A;  2HZE B;  3L9S A;  4V2L A;  3ZRE A;  2O7K A;  4KGI A;  1SL2 B;  2H8L A;  1J08 A;  3HCZ A;  3FMW A;  5ECH B;  4G0L A;  2C0D A;  5EY6 A;  4ZIL A;  4BPY A;  4PNG A;  2P0G A;  2H19 A;  2YJ7 A;  4TXO B;  3W8S A;  4MP4 A;  1AQX A;  2E2M A;  3IHQ A;  2IWT A;  3ZML A;  2C8U A;  4IS0 A;  2GZZ A;  2YV9 A;  1AXD A;  2JZR A;  3K8N A;  4HZ2 A;  1OC8 A;  3TUE A;  10GS A;  1FOH A;  3FKF A;  4L0U A;  4OFN A;  4EO3 A;  22GS A;  1ZYQ B;  2FLS A;  2L6C A;  2H72 A;  3IK9 A;  3LYP A;  5D9T A;  2A2R A;  4GF0 A;  1Q98 A;  5CO3 A;  5DAL A;  3TOU A;  3QPM A;  1ERV A;  2DSA A;  5INY A;  1GNE A;  2AUV A;  5ECS A;  4POK A;  2F8A A;  5D8I A;  1FVJ A;  2QA2 A;  4J57 E;  1XWA A;  4WF5 A;  3APO A;  2VCW A;  4HJM A;  4LL1 B;  4YQM A;  1KNG A;  1JFU A;  3GL3 A;  1PL1 A;  3UVT A;  1ZMA A;  1Z6M A;  2GT6 A;  1OKT A;  5IMZ A;  4H86 A;  3APS A;  3KIJ A;  2XC2 A;  2VCX A;  2DLX A;  3MIX A;  3MDK A;  5ECM B;  2HYX A;  2PBJ A;  4PTS A;  1HNC A;  3TOT A;  5B7C A;  2FWG A;  3F4R A;  3IAM 2;  5G1K A;  3UIW A;  1F6M C;  4XHM A;  1WE0 A;  2O89 A;  2VD0 A;  1A2J A;  2PMT A;  1A0F A;  1EWX A;  2EIQ A;  2CVK A;  2OJL A;  3WGE A;  4MCU A;  5A5K A;  5BMU A;  1N8J A;  1IYH A;  4LMV A;  5H5R A;  12GS A;  2WRT A;  2VCT A;  4D73 B;  4WR5 A;  5G5E A;  1ILO A;  3EVI A;  1GUM A;  1FOV A;  4HJ2 A;  2QSI A;  1K0C A;  4EE0 A;  3VWW A;  1XBS A;  5LD0 A;  4MF7 A;  2C0E A;  3GIX A;  5GAP D;  1BAY A;  5IMV A;  5J41 A;  3F3Q A;  2H1D A;  1K0O A;  5D9X A;  4TR1 B;  4TRX A;  3C7M A;  4IW9 A;  5D9W A;  4KH7 A;  4OD7 A;  3HVX A;  3TRQ A;  3RHB A;  5CRD A;  1AUC A;  4NPB A;  14GS A;  2WJU A;  2H75 A;  5ECK B;  5DQY A;  2MMA A;  1DUG A;  2H30 A;  3EUR A;  2P5R A;  1SKW B;  4A5P A;  4HU7 A;  3FRC A;  3HZ4 A;  1EGO A;  3US3 A;  2YN1 A;  2KLX A;  1T4Y A;  2OE1 A;  4ACS A;  3CQF A;  3GTU B;  3I9V 2;  1EEM A;  1G0T A;  1SEN A;  5J5N A;  4CY8 A;  3HJM A;  2VL2 C;  1M9A A;  4HQZ A;  1CQH A;  4KCE A;  3ZVJ D;  1MD4 A;  3GX8 A;  5JCW A;  4MPF A;  2AAW A;  1U88 A;  3F3R A;  1FB0 A;  4HOJ A;  2KOK A;  4YQU A;  3VWU A;  2AHE A;  3F9U A;  1BJX A;  1PKZ A;  3E9J B;  5EL8 A;  3KGK A;  1X9M B;  4F82 A;  3QAW A;  2E0Q A;  1PA3 A;  1OKD A;  2B6M A;  2J23 A;  3PGT A;  3BJ5 A;  3VUR A;  2IFQ B;  1PQN A;  4GSN A;  1Y25 A;  5IO0 A;  4TW5 A;  3F8U A;  5G30 A;  1M3I A;  3A5W A;  3F4S A;  3HDC A;  3F6F A;  2JSZ A;  1O81 A;  1HD2 A;  2OBK A;  2JZS A;  3SBC A;  2R6K A;  4K7N A;  3C1S A;  4AF2 A;  1GSD A;  2DJ3 A;  2VLU A;  2BJX A;  4RI6 A;  5L71 A;  1XPV A;  1UN2 A;  4K0N A;  3GX0 A;  4TR4 A;  2VL2 A;  1GWC A;  7GSS A;  2LNS A;  2IMK A;  3V1W A;  4IKH A;  4O92 A;  1K3Y A;  2B3S A;  2H1B A;  4BVX B;  1PFO A;  5AIS A;  3TJG A;  3TKR A;  1GSY A;  5IPH A;  3BCK A;  1U6T A;  3LXT A;  5IOX A;  1AQW A;  4PQ1 A;  2GLR A;  2JL4 A;  2XPE A;  2CV4 A;  3FW2 A;  2LUS A;  3GKX A;  4OFM A;  1SKS B;  2LRC A;  1O73 A;  1GNW A;  1EZK A;  1TK8 B;  2O8V B;  3H8Q A;  4BVY B;  3F63 A;  3G9B A;  2RM6 A;  3EC3 A;  5HR0 A;  4MZB A;  2KP2 A;  2PUK C;  4AJ7 A;  5KOX A;  1ZGN A;  3LQ7 A;  4PGT A;  1O6J A;  1LBK A;  1GUH A;  4E8E A;  2DIY A;  3Q19 A;  2DMM A;  1FAA A;  2HE3 A;  1EV4 A;  1GTA A;  5DCG A;  3G7I A;  5B8B A;  1IYI A;  4OO5 A;  3U6V A;  2L6D A;  2DJJ A;  2C80 A;  2DIZ A;  3S9F A;  1T3B A;  1T1V A;  2ZNM A;  3TCO A;  4POL A;  6GSX A;  2FA4 A;  1G7E A;  1Z9H A;  3I69 A;  1GSF A;  4F0C A;  3IRA A;  5AIV A;  2F3M A;  4V1A g;  2HSY A;  1THO A;  3DD3 A;  1BED A;  1UA5 A;  5DJL A;  5AIX A;  4LMW A;  4I8B A;  4MF5 A;  2IMI A;  1Z7R A;  4NXI A;  3NZN A;  3MSZ A;  5IMF A;  3NIV A;  1B9X C;  5DVB A;  5A4W A;  3TB2 A;  2HRN A;  3UMA A;  1B48 A;  4JR6 A;  1J0F A;  4MZC A;  1PD2 1;  1NHO A;  2ON5 A;  4K9Z A;  2IMF A;  1OAZ A;  4EL1 A;  4EUY A;  4FO5 A;  3ZTL A;  3RPN A;  1F3A A;  3F6D A;  2JAC A;  2NBS A;  1B4P A;  1XWK A;  3GN3 A;  1PN0 A;  2E7P A;  6GSS A;  3P7X A;  3MYD A;  2LTK A;  4MPG A;  3CMI A;  3ZIV A;  3IC8 A;  3KXO A;  2YZH A;  4KND A;  4PNF A;  3TKS E;  4FYU A;  5KN2 A;  3RBT A;  3PPU A;  3LG6 A;  2B1K A;  13GS A;  2ZUP A;  3LSZ A;  2OE3 A;  2P5Q A;  1QFN A;  3PR8 A;  3RDW A;  3QMX A;  3UAP A;  2VUP A;  3E3E A;  1QGV A;  3CYN A;  4XS4 B;  3UJ1 A;  5ENU A;  1SYX A;  1SYR A;  1K0A A;  1GH2 A;  3UBK A;  5HFI A;  1TRW A;  4J2F A;  1MTC A;  2F9S A;  2JSY A;  3UVH A;  5HFG A;  2YNX A;  4FYC A;  2KP1 A;  2YWO A;  4Q5Q A;  2HT9 A;  2XPD A;  1S3A A;  1M9B A;  4GRF A;  5F06 A;  5G2Z A;  2CVB A;  3QOU A;  4KDY A;  5KEJ A;  4IP6 A;  1EP7 A;  2AV4 A;  2R3X A;  4EXJ A;  1Y6E A;  2GZP A;  2CX4 A;  4Z7X A;  5D96 A;  4NHZ A;  4YQV A;  2TRX A;  4L5O A;  2FWE A;  4GTU A;  4GQF A;  4MJA A;  2C3T A;  1VF4 A;  3EIN A;  4IHU A;  1TTZ A;  3UAR A;  3H4K A;  4HSC X;  3M8N A;  3QAG A;  1TU7 A;  3GA4 A;  3GRX A;  5HR2 A;  3N5O A;  4ZL8 A;  19GS A;  2AJQ B;  2HRF A;  3ZVJ A;  1B9Y C;  4ZL7 A;  1M2D A;  1RK4 A;  2QGV A;  2VLV A;  2F51 A;  4OMV A;  3WT2 A;  2FUG 2;  1PN9 A;  3HVV A;  1YJ6 A;  2VAF A;  4JR4 A;  4I97 A;  4KW6 A;  3CSI A;  4KE3 A;  3ERF A;  2WUL A;  1XFL A;  3QD9 A;  5HR1 A;  3GV1 A;  3F0I A;  2VD1 A;  1VF1 A;  2JAD A;  3VI7 A;  3Q74 A;  4O7H A;  3DRN A;  4F03 A;  2DBC A;  2N5B A;  4I2U A;  3RAZ A;  9GSS A;  2MMZ A;  4WBJ A;  5IOW A;  4QQ7 A;  2LJR A;  4Q5F A;  1SJ6 A;  1G6W A;  1JLW A;  4ZBD A;  2GSR A;  1WWJ A;  4PQH A;  3L4N A;  2HSH A;  2H6X A;  3C73 A;  1W4V A;  3H1N A;  4BL7 A;  2EIO A;  3FZA A;  1EV9 A;  1XW6 A;  3N9J A;  5ELG A;  3MNG A;  5ECN B;  3DGQ A;  4FH8 A;  4QL9 A;  1A8L A;  4AJ8 A;  1GTB A;  3BOA A;  2G2Q A;  2GQM A;  3L9U A;  1ZZY A;  2CQ9 A;  4TN8 A;  3UL3 A;  5ELA A;  1JHB A;  4MLY A;  2HZE A;  5ECQ B;  5IQY A;  2HFD A;  3QAV A;  2JZT A;  5DQS A;  3IE3 A;  1T8E B;  1WIK A;  1QUW A;  4KSM A;  4K2X A;  4IJ3 A;  3ZFL A;  3EWL A;  2A4V A;  3U5R E;  4TXO A;  4CDO A;  1PSQ A;  4NAX A;  2VL9 A;  5ECR B;  3QCP A;  3IBH A;  3RHC A;  4HU9 A;  5F05 A;  2DJ2 A;  3FZ4 A;  1GLP A;  3TRP A;  5ECP B;  4GSS A;  2J9H A;  2FWF A;  3LWA A;  3J7Y k;  1GL8 A;  5ECO B;  5CNW A;  5DAK B;  3WGD A;  4IP1 A;  1PL2 A;  5JWR B;  1MDI A;  2DC5 A;  3DIE A;  2VCQ A;  4EIQ A;  4V2M A;  3UOM A;  4G9H A;  3KP8 A;  3KEB A;  4X4J A;  3FR6 A;  2RM5 A;  3GHA A;  1AW9 A;  1GTU A;  2K9F A;  2H76 A;  3FR3 A;  2DKH A;  5J9C A;  2X99 A;  2FA8 A;  5ECL B;  1MEK A;  1ZL9 A;  5KOW A;  2L5O A;  1ACV A;  2HRA A;  1R26 A;  2LJK A;  1H75 A;  2K8V A;  2H6Z A;  4K7O A;  3ZFB A;  1SD9 A;  2V1M A;  2LST A;  5G1L A;  3L9V A;  3G7J A;  2LRN A;  1ON4 A;  4OO4 A;  4MF6 A;  2L4Q A;  2MMO A;  1BYE A;  4MJC A;  1JZR A;  1JZO A;  3P90 A;  1V57 A;  2JU5 A;  4DSS B;  3CXG A;  5IMA A;  2N5F A;  1ERW A;  2C1Y A;  4L5L A;  4JE1 A;  4WEY A;  2FD3 A;  5CRE A;  1QK8 A;  1PMT A;  4Z2R A;  1WP0 A;  2CT6 A;  1NW2 A;  2IN3 A;  4TOP A;  2PGT A;  5IO2 A;  1SJZ A;  2QA1 A;  3UBL A;  2HI7 A;  4IQA A;  3CTG A;  2OAD A;  2DJ1 A;  3EYT A;  4MJB A;  3C8E A;  6GSY A;  3LXZ A;  1K0B A;  1SU9 A;  2VLT A;  2X8H A;  1JZD A;  5H5S A;  2GVP A;  4I2T A;  1K0D A;  2YPM A;  4WR4 A;  4D73 A;  2M80 A;  2A4H A;  3IDV A;  1U3A A;  2TIR A;  1SK1 A;  3CSH A;  1V9W A;  2FHE A;  1EP8 A;  1XVW A;  2B1L A;  1K3L A;  1FHE A;  4DSS A;  1FW1 A;  11GS A;  1A23 A;  4GLT A;  1XOB A;  5AN1 A;  4TR1 A;  4G0K A;  4CW9 A;  3HA9 A;  1PRX A;  5G5F A;  1A0R P;  2PPT A;  3F4T A;  2TRC P;  5IMD A;  4HQS A;  2H0I A;  2PVO C;  2IMD A;  2D2Z A;  2PN8 A;  2L57 A;  5IIZ A;  1BQ7 A;  1WPI A;  1MDK A;  1XW9 A;  1S3C A;  2E2G A;  4O5U A;  3TJF A;  1H4O A;  1I5G A;  4NWY A;  3HVS A;  3EPT A;  1HYU A;  3GTU A;  1TK5 B;  1XG8 A;  1MDJ A;  4RQX A;  3VPT A;  2H74 A;  3KP9 A;  3DXB A;  1WJK A;  4EF0 A;  2PWJ A;  3VFI A;  4P3Y B;  2I81 A;  1YQ1 A;  1TOF A;  2B5X A;  3Q18 A;  3G7Y A;  2IIY A;  3IXR A;  2YV7 A; 
#chains in the Genus database with same CATH homology
 3CBU A;  3GKM A;  4HZ4 A;  3HJP A;  3TJJ A;  2C4J A;  4X1U A;  2IFQ A;  4K5R A;  1OC9 B;  3GH9 A;  5D9V A;  1TRS A;  2LNT A;  2CZ2 A;  2C0F A;  4Q5N A;  5JCG A;  5F8B A;  1UC7 A;  4FYB A;  1Z5Y E;  4F2I A;  2GS3 A;  3MWH A;  1T00 A;  4MMM A;  3DYR A;  2OAC A;  4ZB9 A;  4PX1 A;  2RUF A;  2GZY A;  5DDL A;  4WXT A;  3DML A;  2H1G A;  3DEX A;  5HR3 A;  2OE0 A;  1ERT A;  2NPB A;  4BA7 A;  4GXZ A;  2L59 A;  5FT3 A;  4ECC A;  3EU4 A;  1HNB A;  1ZCP A;  4BVX A;  3M9J A;  3FK8 A;  4BWQ A;  2A2P A;  2DKI A;  4PUA A;  2LQO A;  1TI1 A;  4KCA A;  3GKN A;  4EVM A;  17GS A;  1OE8 A;  4LLR A;  4N0V A;  4X0X A;  3AY8 A;  2GSS A;  3LOR A;  4V1A p;  2EIR A;  1OC9 A;  5E4W A;  1AQV A;  4BVY A;  5LCZ A;  2M46 A;  2V2G A;  2VM2 A;  1XVQ A;  1M2B A;  2KUC A;  2X8C A;  4HUA A;  2OA7 A;  3TJK A;  3IV4 A;  3ZIJ A;  3H79 A;  1Z3E A;  4ZXG A;  3GKK A;  3QDN A;  4TKY A;  1GP1 A;  1O85 A;  3CRT A;  1BG5 A;  5B8A A;  3O3T A;  4N10 A;  4MH3 A;  1EEJ A;  6GSW A;  3ED3 A;  4XCS A;  4TXV A;  4G0I A;  1X0R A;  4EIP A;  2QKE A;  4I6X A;  1V40 A;  4O5R A;  3WD6 A;  4WKW A;  2XHF A;  4POM A;  1QQ2 A;  1A2L A;  1QMV A;  1YKC A;  4N0Z A;  3CRU A;  1FVK A;  5D93 A;  2BMX A;  2MBS A;  4NMU A;  1KTE A;  4J56 E;  4LL4 B;  4EC0 A;  1HNA A;  1M2A A;  2H73 A;  4ECB A;  2K6V A;  4N11 A;  5DBQ A;  3IOS A;  4GWR A;  5ECI B;  1GSU A;  2Z9S A;  3IR4 A;  1THX A;  3ZRD A;  4ML1 A;  1V98 A;  6GSV A;  5ID2 B;  3HYP A;  4K5S A;  5B6M A;  1C72 A;  1ABA A;  4ZB6 A;  3DVW A;  3LJR A;  4XIH A;  2RLI A;  4BWS A;  3NOF A;  1ZYN A;  1M99 A;  1PX7 A;  1AAZ A;  4NV5 A;  2GQL A;  2O85 A;  2H6Y A;  5GAN D;  18GS A;  2CAQ A;  1K0M A;  1O8W A;  2B5Y A;  4IQ1 A;  1MD3 A;  4WBR D;  3EMP A;  3WGX A;  1OC3 A;  2GGT A;  4XS4 A;  2K8S A;  5DCH A;  4KSO A;  3EMX A;  4ECI A;  2RII A;  3FHK A;  1V2A A;  2PU9 C;  1WOU A;  2AYT A;  4MA9 A;  4IEL A;  2IL3 A;  2C3N A;  3QFA C;  1G7O A;  3A2V A;  3I43 A;  2B7K A;  3IA1 A;  3D4M A;  1F37 A;  3GFK A;  2WZ9 A;  3ZLP A;  3GYK A;  3VPQ A;  1TRV A;  1YKA A;  5CAX A;  1XZO A;  3KH7 A;  2LS5 A;  1AC1 A;  2YAN A;  4OCF A;  4G19 A;  4V2N A;  1R5P A;  1LU4 A;  1G6Y A;  3ZYW A;  1XOA A;  1N2A A;  3D21 A;  1NHY A;  3SWL A;  5F07 A;  2ES7 A;  1V58 A;  1TKD B;  4RI7 A;  1F3B A;  1X5E A;  4MK3 A;  2YJH A;  2V41 A;  2CZ3 A;  3KTB A;  2GQK A;  2CA8 A;  5C04 A;  4ZL9 A;  1XWC A;  5JCU A;  1PX6 A;  3LW9 A;  2LV3 A;  4K0G A;  2B5E A;  1XW5 A;  4K6X A;  2C0G A;  4WET A;  2YOI A;  1LJR A;  4K1F A;  1EOH A;  3A2W A;  1GTI A;  2YWI A;  3D4T A;  5COH A;  4EKZ A;  4MDC A;  3CSJ A;  1YF0 A;  2GDR A;  3I6A A;  4ZB8 A;  1XXU A;  4YAV A;  3ERG A;  3L78 A;  1TP9 A;  3IHG A;  4L0W A;  2HLS A;  4AJ6 A;  4YH2 A;  1U3I A;  3ERW A;  4G10 A;  4HS1 A;  3KJY A;  1ZOF A;  5BRT A;  4KF9 A;  3M9K A;  4FQU A;  4XTS A;  2OBI A;  3C71 A;  1GLQ A;  3HKR A;  4MAB A;  2VOC A;  4DVC A;  3LEF A;  2CX3 A;  3A3T A;  3BCI A;  5FHI A;  1NSW A;  4KDU A;  3TRX A;  1GRX A;  3APQ A;  3KMO A;  4XS1 A;  3TKS C;  2HRK A;  5IMC A;  4IN0 A;  1SD8 A;  3DKS A;  3VK9 A;  4YKG A;  4E8H A;  5EVO A;  3RPP A;  5CYY A;  3P8W A;  4GST A;  4ULX A;  3GMF A;  2CAI A;  4O32 A;  2MMN A;  4Q5R A;  2B7J A;  2YWM A;  1J9B A;  1M7T A;  1A2M A;  1KEB A;  4GQC A;  1R4W A;  4JBB A;  4JRR A;  5E59 A;  1TK0 B;  4PXO A;  1F2E A;  1TDI A;  1A8Y A;  3H93 A;  2NDO A;  1GUK A;  2DJ0 A;  2FWH A;  1OE7 A;  1YF1 A;  4RUV A;  1SK0 A;  1T7P B;  2H71 A;  1SKR B;  1DE1 A;  1W89 A;  2A2S A;  3GUS A;  5DAK A;  2I1U A;  1TW9 A;  3L0H A;  2YCD A;  5G31 A;  3KH9 A;  4JU5 A;  1GUL A;  4ZBB A;  2X49 A;  1O8X A;  3TKS A;  1YEX A;  1X5C A;  3LGC A;  3ZIT A;  1VF3 A;  3CTF A;  4IBP A;  3BD2 A;  1RW1 A;  1ML6 A;  2I9H A;  4JED A;  3GNJ A;  2PVQ A;  1TXX A;  3KCM A;  5JWQ B;  3FY7 A;  2R0C A;  2WS2 A;  5CRW A;  2N5A A;  4ZIJ A;  2R2J A;  1OYJ A;  2X64 A;  1XWG A;  4ML6 A;  2MYG A;  2BTO T;  1YDK A;  3PH9 A;  3M3M A;  1FG4 A;  4KB3 A;  2VL3 A;  1SL0 B;  1VF2 A;  2FGX A;  5A4U A;  6GST A;  1X9S B;  1R5A A;  2H01 A;  4F9Z A;  1UVZ A;  1TU8 A;  2LQQ A;  3R3E A;  5DJM A;  4XS6 A;  5GST A;  2ALB A;  3GST A;  4ILF A;  4MZW A;  4TR0 A;  4DSR A;  4PUF C;  1AIU A;  5KN1 A;  4ICY A;  4MH2 A;  4IGJ A;  2IPA A;  4HDE A;  2R4V A;  2PER A;  2VCV A;  3GSS A;  3A5I A;  3Q6O A;  1KBN A;  4ID0 A;  2EC4 A;  4I5Q A;  3PIN A;  1TJD A;  4CY6 A;  5J9B A;  2HXK A;  1EOG A;  4Z2U A;  4FIW A;  5CRG A;  3KD0 A;  2X4A A;  1EGR A;  2K18 A;  1WRY A;  8GSS A;  3TDG A;  4L8E A;  1R7H A;  5LNK e;  6GSU A;  5D73 A;  4G2E A;  2P31 A;  4EDZ A;  4LA1 A;  3MAK A;  2XBI A;  1WMJ A;  2OKA A;  20GS A;  3ZZX A;  3HJO A;  2NTO A;  2H66 A;  3KMN A;  5HQP A;  1QXH A;  4YKF A;  1XIY A;  4MJE A;  4GCI A;  2VCZ A;  3TGZ A;  2WGR A;  5JWO B;  2GT5 A;  1FB6 A;  4WF4 A;  2YP6 A;  16GS A;  2AB6 A;  4OWY A;  4AGS A;  3WT1 A;  1YY7 A;  3WYW A;  1YEP A;  1ZYE A;  5FWG A;  3GL5 A;  3O76 A;  3J7Y b;  2UZ8 A;  3IAS 2;  1YZX A;  4DSQ A;  5IM9 A;  4ZBA A;  3VI5 A;  2IJY A;  1FO5 A;  2R5G A;  1DSB A;  2G0F A;  1GSQ A;  4KDX A;  5ABR A;  1SJI A;  2VIM A;  4NV2 A;  3D0Z A;  3FZ5 A;  2MBT A;  1U87 A;  2FNO A;  5CP1 A;  2F8F A;  1SL1 B;  2DJK A;  1ZYP A;  3D5J A;  2VM1 A;  1DBY A;  1TRU A;  4XRA A;  1XCC A;  4ECJ A;  2MZC A;  4IJI A;  1Z7P A;  3IK7 A;  1RQM A;  1VRS D;  4TVE A;  1TI3 A;  5F0G A;  4QL7 A;  3TKP A;  5GZZ B;  2GTU A;  2LKU A;  2H1A A;  1SK2 A;  2C3Q A;  4KA0 A;  4CHS A;  3W6G A;  2R37 A;  1K0N A;  5H5Q A;  3W8J A;  3A2X A;  2V32 A;  2KHP A;  1ERU A;  1PGT A;  2GST A;  2HNL A;  3ZMK A;  4HEA 2;  4XRD A;  3M1G A;  3R2Q A;  2I4A A;  4TR3 A;  4NHW A;  3D6I A;  3ZL5 A;  1B8X A;  3DWV A;  4RQR A;  2RUE A;  3QR6 A;  2M72 A;  1F9M A;  1GSE A;  1M0U A;  2ZCT A;  4MNN A;  1Q4J A;  4YAP A;  5EPF A;  5J3R A;  2LRT A;  3HZ8 A;  2R0G A;  2WB9 A;  4POB A;  2FCH A;  1X9W B;  3D22 A;  3ME8 A;  1HQO A;  3HXS A;  1DE2 A;  3KZQ A;  3EU3 A;  1PKW A;  3HD5 A;  3VLN A;  5GSS A;  4JZQ A;  2VO4 A;  2X8G A;  1GSS A;  1I9D A;  1BX9 A;  1JZW A;  4X43 A;  5KN3 A;  1O7U A;  4IVF A;  2H70 A;  4KX4 A;  2LJA A;  5CRH A;  1XWB A;  1VGL A;  1USB A;  5B6N A;  5J4U A;  1K3O A;  4DEJ A;  3E0U A;  3KM6 A;  3TJB A;  3ME7 A;  3FEU A;  4K7I A;  5AGY A;  2XBQ A;  4OFT A;  3JCM L;  4USS A;  2L5L A;  4OCE A;  2YWN A;  3VWV A;  2WFC A;  2REM A;  3P2A A;  4EDY A;  3FR9 A;  1CQG A;  2CVD A;  3LFL A;  2R0P A;  1X5D A;  2V6O A;  4N30 A;  2QC7 A;  2V6K A;  2WDU A;  5ID2 A;  1A24 A;  4O5Q A;  2H0G A;  4KAE A;  2LEG A;  5HFK A;  3FYG A;  1B4Q A;  3VWX A;  2NVL A;  3O6T A;  4ISD A;  3ISO A;  1ST9 A;  3FZ9 A;  4KUN A;  3QFB C;  3KTL A;  3LYK A;  5IPG A;  2FY6 A;  2O87 A;  2HSM A;  3TKQ A;  1E2Y A;  2L4C A;  1NM3 A;  1OVN A;  3EE2 A;  1Z6N A;  4K2D A;  4BL7 B;  4HI7 A;  3GH6 A;  3UEM A;  4PUR A;  4F0B A;  5A4V A;  2DML A;  5C00 A;  4K8M A;  3DVX A;  2H0H A;  3M0F A;  3HY2 A;  3IC4 A;  2HZF A;  2YZU A;  3C1R A;  4Z2T A;  2WCI A;  2IME A;  1T4Z A;  1JLV A;  2GSQ A;  1URM A;  5KN0 A;  3BBY A;  2ON7 A;  3HHV A;  3GUR A;  1E6B A;  3IPZ A;  1S3D A;  4PQI A;  3OR5 A;  5DAL B;  2I3Y A;  2HZE B;  3L9S A;  4V2L A;  3ZRE A;  2O7K A;  4KGI A;  1SL2 B;  2H8L A;  1J08 A;  3HCZ A;  3FMW A;  5ECH B;  4G0L A;  2C0D A;  5EY6 A;  4ZIL A;  4BPY A;  4PNG A;  2P0G A;  2H19 A;  2YJ7 A;  4TXO B;  3W8S A;  4MP4 A;  1AQX A;  2E2M A;  3IHQ A;  2IWT A;  3ZML A;  2C8U A;  4IS0 A;  2GZZ A;  2YV9 A;  1AXD A;  2JZR A;  3K8N A;  4HZ2 A;  1OC8 A;  3TUE A;  10GS A;  1FOH A;  3FKF A;  4L0U A;  4OFN A;  4EO3 A;  22GS A;  1ZYQ B;  2FLS A;  2L6C A;  2H72 A;  3IK9 A;  3LYP A;  5D9T A;  2A2R A;  4GF0 A;  1Q98 A;  5CO3 A;  5DAL A;  3TOU A;  3QPM A;  1ERV A;  2DSA A;  5INY A;  1GNE A;  2AUV A;  5ECS A;  4POK A;  2F8A A;  5D8I A;  1FVJ A;  2QA2 A;  4J57 E;  1XWA A;  4WF5 A;  3APO A;  2VCW A;  4HJM A;  4LL1 B;  4YQM A;  1KNG A;  1JFU A;  3GL3 A;  1PL1 A;  3UVT A;  1ZMA A;  1Z6M A;  2GT6 A;  1OKT A;  5IMZ A;  4H86 A;  3APS A;  3KIJ A;  2XC2 A;  2VCX A;  2DLX A;  3MIX A;  3MDK A;  5ECM B;  2HYX A;  2PBJ A;  4PTS A;  1HNC A;  3TOT A;  5B7C A;  2FWG A;  3F4R A;  3IAM 2;  5G1K A;  3UIW A;  1F6M C;  4XHM A;  1WE0 A;  2O89 A;  2VD0 A;  1A2J A;  2PMT A;  1A0F A;  1EWX A;  2EIQ A;  2CVK A;  2OJL A;  3WGE A;  4MCU A;  5A5K A;  5BMU A;  1N8J A;  1IYH A;  4LMV A;  5H5R A;  12GS A;  2WRT A;  2VCT A;  4D73 B;  4WR5 A;  5G5E A;  1ILO A;  3EVI A;  1GUM A;  1FOV A;  4HJ2 A;  2QSI A;  1K0C A;  4EE0 A;  3VWW A;  1XBS A;  5LD0 A;  4MF7 A;  2C0E A;  3GIX A;  5GAP D;  1BAY A;  5IMV A;  5J41 A;  3F3Q A;  2H1D A;  1K0O A;  5D9X A;  4TR1 B;  4TRX A;  3C7M A;  4IW9 A;  5D9W A;  4KH7 A;  4OD7 A;  3HVX A;  3TRQ A;  3RHB A;  5CRD A;  1AUC A;  4NPB A;  14GS A;  2WJU A;  2H75 A;  5ECK B;  5DQY A;  2MMA A;  1DUG A;  2H30 A;  3EUR A;  2P5R A;  1SKW B;  4A5P A;  4HU7 A;  3FRC A;  3HZ4 A;  1EGO A;  3US3 A;  2YN1 A;  2KLX A;  1T4Y A;  2OE1 A;  4ACS A;  3GTU B;  3I9V 2;  1EEM A;  1G0T A;  1SEN A;  5J5N A;  4CY8 A;  3HJM A;  2VL2 C;  1M9A A;  4HQZ A;  1CQH A;  4KCE A;  3ZVJ D;  1MD4 A;  3GX8 A;  5JCW A;  4MPF A;  2AAW A;  1U88 A;  3F3R A;  1FB0 A;  4HOJ A;  2KOK A;  4YQU A;  3VWU A;  2AHE A;  3F9U A;  1BJX A;  1PKZ A;  3E9J B;  5EL8 A;  3KGK A;  1X9M B;  4F82 A;  3QAW A;  2E0Q A;  1PA3 A;  1OKD A;  2B6M A;  2J23 A;  3PGT A;  3BJ5 A;  3VUR A;  2IFQ B;  1PQN A;  4GSN A;  1Y25 A;  5IO0 A;  4TW5 A;  3F8U A;  5G30 A;  3A5W A;  3F4S A;  3HDC A;  3F6F A;  2JSZ A;  1O81 A;  1HD2 A;  2OBK A;  2JZS A;  3SBC A;  2R6K A;  4K7N A;  3C1S A;  4AF2 A;  1GSD A;  2DJ3 A;  2VLU A;  2BJX A;  4RI6 A;  5L71 A;  1XPV A;  1UN2 A;  4K0N A;  3GX0 A;  4TR4 A;  2VL2 A;  1GWC A;  7GSS A;  2LNS A;  2IMK A;  3V1W A;  4IKH A;  4O92 A;  1K3Y A;  2B3S A;  2H1B A;  4BVX B;  5AIS A;  3TJG A;  3TKR A;  1GSY A;  5IPH A;  3BCK A;  1U6T A;  3LXT A;  5IOX A;  1AQW A;  4PQ1 A;  2GLR A;  2JL4 A;  2XPE A;  2CV4 A;  3FW2 A;  2LUS A;  3GKX A;  4OFM A;  1SKS B;  2LRC A;  1O73 A;  1GNW A;  1EZK A;  1TK8 B;  2O8V B;  3H8Q A;  4BVY B;  3F63 A;  3G9B A;  2RM6 A;  3EC3 A;  5HR0 A;  4MZB A;  2KP2 A;  2PUK C;  4AJ7 A;  5KOX A;  1ZGN A;  3LQ7 A;  4PGT A;  1O6J A;  1LBK A;  1GUH A;  4E8E A;  2DIY A;  3Q19 A;  2DMM A;  1FAA A;  2HE3 A;  1EV4 A;  1GTA A;  5DCG A;  3G7I A;  5B8B A;  1IYI A;  4OO5 A;  3U6V A;  2L6D A;  2DJJ A;  2C80 A;  2DIZ A;  3S9F A;  1T3B A;  1T1V A;  2ZNM A;  3TCO A;  4POL A;  6GSX A;  2FA4 A;  1G7E A;  1Z9H A;  3I69 A;  1GSF A;  4F0C A;  3IRA A;  5AIV A;  2F3M A;  4V1A g;  2HSY A;  1THO A;  3DD3 A;  1BED A;  1UA5 A;  5DJL A;  5AIX A;  4LMW A;  4I8B A;  4MF5 A;  2IMI A;  1Z7R A;  4NXI A;  3NZN A;  3MSZ A;  5IMF A;  3NIV A;  1B9X C;  5DVB A;  5A4W A;  3TB2 A;  2HRN A;  3UMA A;  1B48 A;  4JR6 A;  1J0F A;  4MZC A;  1PD2 1;  1NHO A;  2ON5 A;  4K9Z A;  2IMF A;  1OAZ A;  4EL1 A;  4EUY A;  4FO5 A;  3ZTL A;  3RPN A;  1F3A A;  3F6D A;  2JAC A;  2NBS A;  1B4P A;  1XWK A;  3GN3 A;  1PN0 A;  2E7P A;  6GSS A;  3P7X A;  3MYD A;  2LTK A;  4MPG A;  3CMI A;  3ZIV A;  3IC8 A;  3KXO A;  2YZH A;  4KND A;  4PNF A;  3TKS E;  4FYU A;  5KN2 A;  3RBT A;  3PPU A;  3LG6 A;  2B1K A;  13GS A;  2ZUP A;  3LSZ A;  2OE3 A;  2P5Q A;  1QFN A;  3PR8 A;  3RDW A;  3QMX A;  3UAP A;  2VUP A;  3E3E A;  1QGV A;  3CYN A;  4XS4 B;  3UJ1 A;  5ENU A;  1SYX A;  1SYR A;  1K0A A;  1GH2 A;  3UBK A;  5HFI A;  1TRW A;  4J2F A;  1MTC A;  2F9S A;  2JSY A;  3UVH A;  5HFG A;  2YNX A;  4FYC A;  2KP1 A;  2YWO A;  4Q5Q A;  2HT9 A;  2XPD A;  1S3A A;  1M9B A;  4GRF A;  5F06 A;  5G2Z A;  2CVB A;  3QOU A;  4KDY A;  5KEJ A;  4IP6 A;  1EP7 A;  2AV4 A;  2R3X A;  4EXJ A;  1Y6E A;  2GZP A;  2CX4 A;  4Z7X A;  5D96 A;  4NHZ A;  4YQV A;  2TRX A;  4L5O A;  2FWE A;  4GTU A;  4GQF A;  4MJA A;  2C3T A;  1VF4 A;  3EIN A;  4IHU A;  1TTZ A;  3UAR A;  3H4K A;  3M8N A;  3QAG A;  1TU7 A;  3GA4 A;  3GRX A;  5HR2 A;  3N5O A;  4ZL8 A;  19GS A;  2AJQ B;  2HRF A;  3ZVJ A;  1B9Y C;  4ZL7 A;  1M2D A;  1RK4 A;  2QGV A;  2VLV A;  2F51 A;  4OMV A;  3WT2 A;  2FUG 2;  1PN9 A;  3HVV A;  1YJ6 A;  2VAF A;  4JR4 A;  4I97 A;  4KW6 A;  3CSI A;  4KE3 A;  3ERF A;  2WUL A;  1XFL A;  3QD9 A;  5HR1 A;  3GV1 A;  3F0I A;  2VD1 A;  1VF1 A;  2JAD A;  3VI7 A;  3Q74 A;  4O7H A;  3DRN A;  4F03 A;  2DBC A;  2N5B A;  4I2U A;  3RAZ A;  9GSS A;  2MMZ A;  4WBJ A;  5IOW A;  4QQ7 A;  2LJR A;  4Q5F A;  1SJ6 A;  1G6W A;  1JLW A;  4ZBD A;  2GSR A;  1WWJ A;  4PQH A;  3L4N A;  2HSH A;  2H6X A;  3C73 A;  1W4V A;  3H1N A;  4BL7 A;  2EIO A;  3FZA A;  1EV9 A;  1XW6 A;  3N9J A;  5ELG A;  3MNG A;  5ECN B;  3DGQ A;  4FH8 A;  4QL9 A;  1A8L A;  4AJ8 A;  1GTB A;  3BOA A;  2G2Q A;  2GQM A;  3L9U A;  1ZZY A;  2CQ9 A;  4TN8 A;  3UL3 A;  5ELA A;  1JHB A;  4MLY A;  2HZE A;  5ECQ B;  5IQY A;  2HFD A;  3QAV A;  2JZT A;  5DQS A;  3IE3 A;  1T8E B;  1WIK A;  1QUW A;  4KSM A;  4K2X A;  4IJ3 A;  3ZFL A;  3EWL A;  2A4V A;  3U5R E;  4TXO A;  4CDO A;  1PSQ A;  4NAX A;  2VL9 A;  5ECR B;  3QCP A;  3IBH A;  3RHC A;  4HU9 A;  5F05 A;  2DJ2 A;  3FZ4 A;  1GLP A;  3TRP A;  5ECP B;  4GSS A;  2J9H A;  2FWF A;  3LWA A;  3J7Y k;  1GL8 A;  5ECO B;  5CNW A;  5DAK B;  3WGD A;  4IP1 A;  1PL2 A;  5JWR B;  1MDI A;  2DC5 A;  3DIE A;  2VCQ A;  4EIQ A;  4V2M A;  3UOM A;  4G9H A;  3KP8 A;  3KEB A;  4X4J A;  3FR6 A;  2RM5 A;  3GHA A;  1AW9 A;  1GTU A;  2K9F A;  2H76 A;  3FR3 A;  2DKH A;  5J9C A;  2X99 A;  2FA8 A;  5ECL B;  1MEK A;  1ZL9 A;  5KOW A;  2L5O A;  1ACV A;  2HRA A;  1R26 A;  2LJK A;  1H75 A;  2K8V A;  2H6Z A;  4K7O A;  3ZFB A;  1SD9 A;  2V1M A;  2LST A;  5G1L A;  3L9V A;  3G7J A;  2LRN A;  1ON4 A;  4OO4 A;  4MF6 A;  2L4Q A;  2MMO A;  1BYE A;  4MJC A;  1JZR A;  1JZO A;  3P90 A;  1V57 A;  2JU5 A;  4DSS B;  3CXG A;  5IMA A;  2N5F A;  1ERW A;  2C1Y A;  4L5L A;  4JE1 A;  4WEY A;  2FD3 A;  5CRE A;  1QK8 A;  1PMT A;  4Z2R A;  1WP0 A;  2CT6 A;  1NW2 A;  2IN3 A;  4TOP A;  2PGT A;  5IO2 A;  1SJZ A;  2QA1 A;  3UBL A;  2HI7 A;  4IQA A;  3CTG A;  2OAD A;  2DJ1 A;  3EYT A;  4MJB A;  3C8E A;  6GSY A;  3LXZ A;  1K0B A;  1SU9 A;  2VLT A;  2X8H A;  1JZD A;  5H5S A;  2GVP A;  4I2T A;  1K0D A;  2YPM A;  4WR4 A;  4D73 A;  2M80 A;  2A4H A;  3IDV A;  1U3A A;  2TIR A;  1SK1 A;  3CSH A;  1V9W A;  2FHE A;  1EP8 A;  1XVW A;  2B1L A;  1K3L A;  1FHE A;  4DSS A;  1FW1 A;  11GS A;  1A23 A;  4GLT A;  1XOB A;  5AN1 A;  4TR1 A;  4G0K A;  4CW9 A;  3HA9 A;  1PRX A;  5G5F A;  1A0R P;  2PPT A;  3F4T A;  2TRC P;  5IMD A;  4HQS A;  2H0I A;  2PVO C;  2IMD A;  2D2Z A;  2PN8 A;  2L57 A;  5IIZ A;  1BQ7 A;  1WPI A;  1MDK A;  1XW9 A;  1S3C A;  2E2G A;  4O5U A;  3TJF A;  1H4O A;  1I5G A;  4NWY A;  3HVS A;  3EPT A;  1HYU A;  3GTU A;  1TK5 B;  1MDJ A;  4RQX A;  3VPT A;  2H74 A;  3KP9 A;  3DXB A;  1WJK A;  4EF0 A;  2PWJ A;  3VFI A;  4P3Y B;  2I81 A;  1YQ1 A;  1TOF A;  2B5X A;  3Q18 A;  3G7Y A;  2IIY A;  3IXR A;  2YV7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...