3A2VA

Peroxiredoxin (c207s) from aeropyrum pernix k1 complexed with hydrogen peroxide
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
243
structure length
243
Chain Sequence
PGSIPLIGERFPEMEVTTDHGVIKLPDHYVSQGKWFVLFSHPADFTPVCTTEFVSFARRYEDFQRLGVDLIGLSVDSVFSHIKWKEWIERHIGVRIPFPIIADPQGTVARRLGLLHAESATHTVRGVFIVDARGVIRTMLYYPMELGRLVDEILRIVKALKLGDSLKRAVPADWPNNEIIGEGLIVPPPTTEDQARARMESGQYRSLDWWFCWDTPASRDDVEEARRYLRRAAEKPAKLLYEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Probable peroxiredoxin
publication title Crystal structure of peroxiredoxin from Aeropyrum pernix K1 complexed with its substrate, hydrogen peroxide
pubmed doi rcsb
source organism Aeropyrum pernix
total genus 83
structure length 243
sequence length 243
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2009-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
A PF10417 1-cysPrx_C C-terminal domain of 1-Cys peroxiredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1020.20 Alpha Beta 2-Layer Sandwich Antioxidant, Horf6; Chain A, domain 2 Antioxidant, Horf6; Chain A, domain 2 3a2vA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3a2vA01
2I3YA 3N5OA 4I2UA 3UVTA 3ME8A 1EP8A 1SL1B 2OACA 3EVIA 4BPYA 3P90A 1FO5A 3WT2A 1YEPA 2C0FA 2KP1A 4JR4A 3DRNA 4IGJA 4ML6A 1XIYA 3EU4A 1FOVA 2GS3A 5IMAA 3G7JA 3TUEA 3I9V2 5ABRA 2G2QA 4GQFA 1OE7A 4L5OA 1M9AA 3TRPA 1GLPA 4N0VA 4MK3A 4HUAA 1N2AA 1E6BA 2DJ3A 2X64A 1VGLA 2EC4A 2FY6A 4G9HA 4EXJA 1BYEA 4EKZA 2LQOA 4E8HA 3DXBA 1XW9A 2CX3A 3DEXA 5D9WA 5AIXA 2M72A 1RQMA 1QK8A 2OE3A 4ZBBA 4V2LA 4IP6A 2GT6A 1O85A 2VCXA 1XVWA 1A0RP 3KJYA 5HR0A 1XWCA 2WGRA 2L5OA 3ZITA 2MMOA 4PURA 4TXOA 2TRXA 4L0UA 3SWLA 2R37A 2L5LA 4MA9A 3F6FA 1QMVA 2L4QA 2IJYA 3M3MA 2LJRA 3I43A 4WR5A 1OE8A 1OVNA 3FZ4A 5HFKA 1EP7A 3GSTA 3D5JA 3DGQA 3I6AA 2IL3A 1M2DA 3HCZA 4GSTA 1MDJA 1Z9HA 3KH9A 3KH7A 4KCEA 2XBIA 3F3RA 4FH8A 4MPGA 5KN1A 4ZIJA 3BCKA 3ZLPA 3M1GA 4AF2A 4EE0A 1FB0A 3IHQA 4N10A 5H5SA 3APOA 5G2ZA 19GSA 4ECCA 3KIJA 3TKSA 1PN9A 1USBA 1OC8A 4O32A 4IQAA 3TKRA 4KDYA 1GTUA 1R7HA 3A2VA 4EO3A 4MDCA 1AQVA 1RW1A 4HZ4A 4NMUA 5J4UA 2YWOA 4O5RA 2EIRA 5JWOB 1R5AA 1B4QA 5IPGA 4K7NA 3VWUA 1T3BA 5J41A 3HHVA 3A5WA 2PVOC 2B6MA 1Z6NA 3HVVA 1FVKA 1T1VA 2JSZA 5DALB 2YANA 3CYNA 3EYTA 1U6TA 3CMIA 3NOFA 2LEGA 2F8FA 3FZ5A 1ZOFA 4CHSA 2R3XA 1S3CA 3LWAA 1AIUA 2LNTA 3F0IA 2AJQB 2EIOA 2GZZA 4BVXA 1S3DA 2FWGA 3WGXA 2DJ0A 4TW5A 2PGTA 2ON7A 4I8BA 3Q6OA 16GSA 3US3A 1GWCA 1UVZA 2XBQA 1XPVA 3GKXA 5ENUA 2CQ9A 1GSSA 5F0GA 3DIEA 1EEMA 1K0MA 1GSQA 1VF4A 1WOUA 1THXA 3GX0A 4NV2A 1WRYA 3ED3A 3GNJA 4KNDA 1BEDA 1MD4A 4XIHA 2IWTA 2VM2A 4PQHA 3L9VA 1O8XA 3EINA 4LMVA 3RPNA 3F9UA 4CW9A 5DALA 3LYKA 4QQ7A 1PKWA 3KTBA 2K8SA 3IOSA 1AUCA 4PNFA 4PNGA 2O89A 1A2JA 3R2QA 2YJHA 4TRXA 2L4CA 2C0GA 4OCEA 5HFIA 5B6MA 2CZ2A 2LRTA 4F0CA 2DMLA 2NVLA 1XWKA 2PN8A 1V58A 1GUKA 1SKRB 3VURA 5F05A 5G5EA 1J08A 1V98A 2H72A 2V6OA 4RI6A 4I5QA 3DKSA 3FR9A 2HI7A 2GGTA 3EC3A 4XS4B 3EMXA 1O8WA 3O3TA 5INYA 1R4WA 2I1UA 1K3YA 1SK1A 2PPTA 1QQ2A 3WYWA 1TRVA 4IP1A 1PL1A 3CXGA 3P7XA 3Q74A 2VCTA 2C3QA 3M8NA 1THOA 5GAND 4KGIA 2AYTA 4FYCA 5F06A 1ERUA 3IA1A 1TK8B 2CZ3A 2LJKA 3OR5A 5DCHA 4YQMA 1JFUA 3ZYWA 2JACA 3GKMA 1A24A 2P31A 3CRTA 2OBIA 4JR6A 3IK9A 1MEKA 1C72A 1GTIA 3UL3A 3E9JB 1O6JA 4KH7A 4FIWA 3IRAA 1HNAA 5DAKB 4ID0A 2HRFA 5IO0A 5D96A 5LD0A 4TR1A 4EDZA 1F9MA 2H1BA 5KN3A 2TIRA 3U6VA 3QMXA 4ECIA 2V6KA 4MPFA 1NW2A 4I2TA 2E7PA 3APQA 4POKA 4K0GA 4O92A 3HD5A 2YZHA 4TR0A 4ZXGA 2YCDA 5B7CA 2WS2A 1TP9A 3HKRA 5ECLB 5J9CA 1NHYA 5D93A 3IAS2 1WPIA 1AQWA 1TOFA 5A4UA 4G19A 4N11A 3IBHA 1ERTA 3L78A 2H8LA 5IM9A 4Z7XA 2C1YA 2AUVA 1BX9A 2DMMA 1M99A 3IAM2 5DJMA 5CRGA 3H79A 2VCVA 5HR3A 4K0NA 5EY6A 1ON4A 2OE0A 2HZEA 3TCOA 1ZYEA 4BWQA 2JADA 4MJBA 1EZKA 2M80A 1BQ7A 1SK2A 4GCIA 3GA4A 2DIZA 2QKEA 4MH2A 1MD3A 3M9JA 5DAKA 1TKDB 2E0QA 2VLVA 1SK0A 1UA5A 2L57A 1TW9A 4OWYA 4N30A 2RM6A 1PMTA 4LA1A 2WULA 3DWVA 1A23A 2REMA 3IDVA 1X5DA 2DSAA 3TKPA 2VCQA 4L5LA 2JL4A 4KUNA 2QC7A 1XW6A 10GSA 2ZNMA 3TRXA 2NPBA 2YJ7A 1EWXA 3KM6A 5DQYA 3UVHA 2GQKA 3HVSA 3CBUA 3FHKA 4GSNA 1ACVA 2FHEA 1JLWA 2C0EA 1VF3A 1JZDA 4ZB9A 5CRDA 5IMCA 4TN8A 4DSRA 3C7MA 4XCSA 1WIKA 3QFAC 5EVOA 2F51A 3KMNA 4POBA 4KX4A 1H4OA 1ZGNA 4ISDA 5G1KA 3L0HA 4YAVA 3WD6A 3UOMA 2B3SA 1B9XC 1ZL9A 4HJ2A 1UC7A 1TU7A 4TXOB 2GQLA 4MLYA 2F3MA 3ZZXA 5D9VA 1PSQA 2K8VA 4MP4A 3KXOA 1TJDA 3MSZA 2YPMA 4D73A 5G31A 3DMLA 4HDEA 3UIWA 5E59A 2GSQA 2B1KA 4K7IA 4PGTA 3MAKA 4IN0A 1XXUA 2VL2A 5CYYA 4K8MA 4ECBA 2DJ2A 3LGCA 3O76A 2FCHA 2A2RA 4P3YB 3KMOA 3G9BA 3GHAA 14GSA 1HQOA 5DQSA 3V1WA 5C00A 5ELGA 2PMTA 2CT6A 3GH9A 1MDKA 3VWVA 1DE2A 3A2XA 3HVXA 1T4YA 2MMZA 3F4RA 2DJJA 3LXTA 1YKCA 2H71A 4Q5QA 3FY7A 3FEUA 2I81A 4KSOA 2H75A 2MZCA 2HLSA 4ZB6A 3PR8A 1J0FA 1KBNA 2IMDA 3CRUA 2FGXA 1GNWA 5JCWA 3Q18A 4FYBA 2GSSA 2BJXA 1EOHA 2C8UA 2OKAA 3IPZA 4EF0A 2K6VA 5ECNB 3GX8A 1GSUA 2A2SA 3TJKA 3DVXA 1SYRA 2WZ9A 4L8EA 1N8JA 2CAQA 5F8BA 4BWSA 1TI1A 1H75A 1K3OA 4EVMA 2H6YA 4V1Ap 2O7KA 2DLXA 3GUSA 1JZRA 2R5GA 4OO5A 1M0UA 2BTOT 3TKSC 2ZCTA 3GSSA 1NHOA 3UEMA 1AXDA 8GSSA 1FW1A 5A5KA 2WDUA 4KCAA 1TU8A 4MZCA 5ECPB 1TRUA 1TK5B 2K18A 1PL2A 2WB9A 4LL4B 4WEYA 3A3TA 1Q98A 3TDGA 3GTUB 2DJ1A 1FHEA 2WFCA 1XBSA 5HFGA 1Y25A 5ID2A 3C71A 3QR6A 2V1MA 2B7KA 1OC3A 3UBKA 2LSTA 1EEJA 5D73A 3HJOA 4ACSA 1PQNA 4HOJA 1CQGA 2H1DA 1X0RA 2TRCP 1B4PA 5GZZB 3H93A 1X9WB 5ELAA 3UBLA 1QXHA 3U5RE 1Z7RA 1TRWA 3RPPA 4HU7A 3J7Yb 3MDKA 4WETA 4IJIA 4OMVA 4HEA2 1TK0B 1NSWA 2PWJA 18GSA 2VD0A 3HJMA 2ES7A 1SD9A 2H30A 4GLTA 2HE3A 5ECSA 1Z6MA 4NXIA 2C0DA 2O87A 5GSTA 2RLIA 1A8YA 2MYGA 4JE1A 1WE0A 2O85A 1OKTA 2L6CA 3BJ5A 3TJJA 1SD8A 4X43A 5IMVA 3W8JA 5CP1A 4OFTA 4ZL9A 1YDKA 5LNKe 3H1NA 2B7JA 4HS1A 1VRSD 5H5RA 4Q5RA 4ULXA 2L59A 2HFDA 2JZSA 3GTUA 1GL8A 3P2AA 4FO5A 5J3RA 1V2AA 2HSHA 3IXRA 5ECRB 2M46A 3FZAA 1GLQA 1FB6A 1F3AA 1A2LA 4QL7A 1OC9A 3TJFA 4LMWA 5COHA 3FZ9A 1YEXA 4WF4A 3UMAA 3H4KA 2N5AA 1ZYQB 2I9HA 1R26A 4PUFC 4V1Ag 4WBRD 4HZ2A 2X8CA 1NM3A 2DC5A 3KZQA 2I4AA 2AB6A 2KOKA 4IQ1A 2LQQA 3IR4A 2R4VA 4IBPA 2WCIA 1HNCA 4GTUA 4TXVA 2YP6A 1G7EA 4HQSA 3ZTLA 2RUFA 3GMFA 3EWLA 12GSA 2Z9SA 2PVQA 2LNSA 2H73A 3I69A 4TR1B 1U3IA 3D4TA 2P5RA 5JWQB 1YF1A 2KUCA 3GFKA 1OYJA 2H0HA 1T8EB 13GSA 5IOWA 4IVFA 2HRNA 4IJ3A 5IMFA 2VM1A 1E2YA 3ZIVA 2P0GA 2H76A 1LBKA 5HQPA 1K0OA 1GRXA 3CSIA 2OJLA 2JZRA 2YZUA 3GKKA 2FWHA 5A4VA 4RQRA 5DCGA 1ERVA 2HT9A 3L9SA 1T00A 2FD3A 2J9HA 1T7PB 2GSRA 3QD9A 2E2GA 2AHEA 3E3EA 2YV9A 1GUHA 4GF0A 2BMXA 5AGYA 4ZL7A 4XRDA 4NHZA 3UARA 1Q4JA 1GSDA 1ZZYA 2HZFA 2HZEB 3D21A 2RIIA 3KGKA 2B5YA 1JZWA 2C4JA 5IMDA 1PX7A 4NPBA 2LV3A 4KDXA 4NWYA 1X5CA 2IIYA 4KE3A 6GSTA 5FT3A 3NZNA 2LTKA 3GL5A 2YNXA 3TKSE 1U3AA 5D9TA 3HY2A 4JEDA 3LFLA 3CTFA 2HXKA 5HR1A 1JLVA 3W6GA 3IV4A 3CSHA 1QGVA 2X99A 3M0FA 4KA0A 1FVJA 5FHIA 1X5EA 4J56E 3F3QA 4O7HA 1YKAA 2CV4A 2GVPA 4HI7A 1EV4A 1A8LA 4IKHA 1OKDA 4ECJA 5AISA 2FLSA 3MNGA 3APSA 4WF5A 4G10A 4OO4A 2PBJA 3GKNA 4TOPA 2YN1A 2LJAA 1KNGA 1ABAA 3BBYA 2CVDA 2VOCA 3VWXA 4Q5NA 1DUGA 3ERFA 2O8VB 4KW6A 3BCIA 3QAWA 1X9SB 4D73B 3P8WA 5KN2A 2GT5A 4TVEA 3LQ7A 2VL3A 3ZREA 4RUVA 1DSBA 4GXZA 3M9KA 4WKWA 3H8QA 4BA7A 3IK7A 1F37A 4POMA 4NHWA 3PH9A 3TOTA 4K2DA 2VCWA 1EGRA 2XC2A 5DBQA 2GZPA 1GSEA 4DVCA 4MH3A 2R6KA 2C3TA 2FWFA 3JCML 1QUWA 4K9ZA 5CAXA 5IOXA 4MJEA 1SJZA 1ZCPA 3BD2A 3RHBA 3GV1A 3LSZA 1SU9A 3G7YA 3VLNA 4F82A 3FR6A 1CQHA 1B9YC 2OE1A 3ZFLA 1SYXA 3HZ4A 4X1UA 2H70A 4ZILA 1X9MB 3GIXA 4DEJA 4PQIA 2HYXA 4NV5A 4G2EA 2VL2C 1SKSB 2B5EA 3FKFA 5IPHA 3SBCA 1PKZA 3F4SA 1TTZA 3ZL5A 3ZVJA 1UN2A 7GSSA 2VCZA 3TRQA 2YV7A 3DD3A 3FYGA 6GSWA 3A2WA 11GSA 4IW9A 3UAPA 4EC0A 4PUAA 2ON5A 1GTBA 5ECHB 4MJCA 2FUG2 3HJPA 5H5QA 3QOUA 5IIZA 2H0GA 2PERA 3EURA 1WP0A 2CX4A 3KEBA 2RUEA 3RHCA 1K0CA 4K6XA 5ID2B 3WGDA 2IPAA 2IMEA 1G0TA 4I97A 1O7UA 1ST9A 4MZWA 4YQVA 3CTGA 3ZVJD 4NAXA 1GSFA 3ZMKA 5ECOB 4ML1A 1K0NA 4KAEA 5DVBA 4JRRA 2H74A 2MBSA 3GYKA 4V2MA 1Y6EA 1BAYA 1YY7A 2NTOA 2NBSA 3VFIA 5IMZA 3FR3A 4N0ZA 5CRWA 1YF0A 3CSJA 5CNWA 5IO2A 1VF1A 3HA9A 4TR3A 5E4WA 1MTCA 5ECIB 4ZB8A 1GP1A 4GSSA 4V2NA 1FG4A 1K3LA 2FWEA 3ZFBA 1Z5YE 1V40A 4HJMA 2H6XA 2L6DA 3VPTA 5J5NA 1MDIA 3NIVA 2VIMA 1F2EA 2CA8A 1YQ1A 1ZMAA 3DYRA 1DE1A 1WJKA 2KLXA 3GRXA 1VF2A 5G5FA 2DBCA 1K0AA 2YOIA 4DSSB 1ERWA 2H1AA 3KP8A 1IYHA 4EUYA 1PRXA 1EOGA 3VI7A 3LEFA 2G0FA 1XZOA 2AAWA 2GDRA 1M2AA 5IQYA 1SENA 1WMJA 3F8UA 1OC9B 1GH2A 4IHUA 2B5XA 4J57E 2RM5A 2GLRA 4IELA 2VD1A 4MJAA 4F0BA 2IFQB 3BOAA 3G7IA 2X8GA 4I6XA 4H86A 2OBKA 3VK9A 4CDOA 2LS5A 4DSQA 2R2JA 3EMPA 4GRFA 5GSSA 4LL1B 2V41A 3MWHA 4KB3A 3KD0A 3WGEA 4OFMA 5DJLA 3TKQA 3GURA 2GQMA 1V57A 2EIQA 3TB2A 4MCUA 1FAAA 4OD7A 5C04A 1I9DA 3LYPA 3J7Yk 1GNEA 4MF5A 1SL2B 2DJKA 4EL1A 4DSSA 4TKYA 2KHPA 3GL3A 3O6TA 3VWWA 4WXTA 4JZQA 3KP9A 3Q19A 3QAGA 5J9BA 4FYUA 2PUKC 4PQ1A 3IC4A 3QFBC 1EV9A 1TXXA 5ECMB 4XHMA 4EDYA 2J23A 4OCFA 2OA7A 3DVWA 3FW2A 2N5FA 4ILFA 4BL7A 3K8NA 1IYIA 2FA8A 3QCPA 2IFQA 2XPDA 4TR4A 5JCGA 2JZTA 3D0ZA 2CVBA 1KTEA 2H1GA 3GH6A 4XRAA 5EL8A 4JU5A 4AJ7A 5G30A 4PX1A 3HYPA 1GUMA 2HNLA 1O81A 2JU5A 5CO3A 2XPEA 9GSSA 3QDNA 2QGVA 3FK8A 4Q5FA 3E0UA 1XCCA 5A4WA 1PX6A 1XW5A 5EPFA 4MMMA 3RAZA 3F6DA 1F3BA 1TI3A 1EGOA 17GSA 4ZL8A 1XWGA 2YWMA 5L71A 1K0BA 3ME7A 3HXSA 2LRNA 3TGZA 5JCUA 3QPMA 2LRCA 1AW9A 1AC1A 3ERWA 1U87A 1PA3A 2XHFA 4GWRA 1GTAA 4MZBA 5D8IA 4F03A 1PD21 1V9WA 3S9FA 1XWAA 3TOUA 2H6ZA 1Z7PA 1SKWB 1BG5A 2C3NA 2WJUA 3L9UA 5DDLA 3F63A 2JSYA 4BVYA 2C80A 2MMNA 6GSVA 1XOBA 2VL9A 20GSA 2LKUA 5B8AA 1G6WA 2ZUPA 3EU3A 1SJ6A 1XVQA 2DIYA 3ERGA 6GSXA 1GSYA 3LG6A 1TDIA 2V32A 1DBYA 5FWGA 5ECKB 4MABA 1F6MC 1AQXA 1HYUA 2H19A 3C8EA 2IMFA 4WR4A 5B8BA 2F9SA 4XTSA 3FRCA 1G7OA 2ALBA 1I5GA 2FNOA 4POLA 1ILOA 1K0DA 4KSMA 3LJRA 2YWNA 2OADA 3C1SA 2HSYA 1Z3EA 4RQXA 2MMAA 3KTLA 4QL9A 1B48A 3D22A 5F07A 4JBBA 2WRTA 4KDUA 22GSA 6GSYA 2B1LA 3LXZA 1M9BA 4GQCA 4F9ZA 4YAPA 2F8AA 5AN1A 2N5BA 4RI7A 3D4MA 2CAIA 1QFNA 4J2FA 5AIVA 2VLTA 4XS1A 5JWRB 6GSSA 3TJBA 5KN0A 4ZBAA 1B8XA 3HDCA 1RK4A 3N9JA 1G6YA 1URMA 2H0IA 2P5QA 3L4NA 4LLRA 1A0FA 1J9BA 2X8HA 1S3AA 2NDOA 1XFLA 2MBTA 1LU4A 3VI5A 3W8SA 1YJ6A 4K7OA 3VPQA 3ISOA 4F2IA 4XS4A 2LUSA 1YZXA 1O73A 2PU9C 2H66A 1HNBA 4X0XA 3LORA 2GTUA 1M7TA 3RDWA 4E8EA 5CRHA 1GULA 2A4VA 1T4ZA 3IE3A 2V2GA 2GSTA 2VO4A 4ZBDA 4MF6A 3GN3A 2GZYA 5CREA 3UJ1A 4AJ8A 3ZMLA 4MF7A 1W4VA 1R5PA 5GAPD 2D2ZA 1SL0B 3PINA 5B6NA 5HR2A 2VUPA 1TRSA 1W89A 1PGTA 2VAFA 1LJRA 2AV4A 4OFNA 1KEBA 3C73A 2VLUA 2IMKA 2IN3A 2KP2A 1A2MA 2YWIA 1AAZA 3RBTA 5D9XA 3KCMA 3HZ8A 1XOAA 3EE2A 6GSUA 1BJXA 2IMIA 3WT1A 3AY8A 4YQUA 4AJ6A 2H01A 2E2MA 3C1RA 5ECQB 3D6IA 4HQZA 4IS0A 3PGTA 1OAZA 2FA4A 3TJGA 1HD2A 1U88A 4YH2A 2CVKA 4L0WA 1WWJA 2K9FA 3ZIJA 4PXOA 1ML6A 4WBJA 1SJIA 3QAVA 4HU9A 4K1FA 4AGSA 1JZOA 5LCZA 5G1LA 1M2BA 3ZRDA 1XWBA 2QSIA 1JHBA 3F4TA 4XS6A 5KEJA
chains in the Genus database with same CATH superfamily
2I3YA 3N5OA 4I2UA 3UVTA 3ME8A 1EP8A 1SL1B 2OACA 3EVIA 4BPYA 3P90A 1FO5A 3WT2A 1YEPA 2C0FA 2KP1A 2QA1A 4JR4A 3DRNA 4IGJA 4ML6A 1XIYA 3EU4A 1FOVA 2GS3A 5IMAA 3G7JA 3TUEA 3I9V2 5ABRA 2G2QA 4GQFA 1OE7A 4L5OA 1M9AA 3TRPA 1GLPA 4N0VA 4MK3A 4HUAA 1N2AA 1E6BA 2DJ3A 2X64A 1VGLA 2EC4A 2FY6A 4G9HA 4EXJA 1BYEA 4EKZA 2LQOA 4E8HA 3DXBA 1XW9A 2HRAA 2CX3A 3DEXA 5D9WA 5AIXA 2A2PA 2M72A 1RQMA 1QK8A 2OE3A 4ZBBA 4V2LA 4IP6A 2GT6A 1O85A 2VCXA 1XVWA 1A0RP 3KJYA 5HR0A 1XWCA 2WGRA 2L5OA 3ZITA 2MMOA 4PURA 4TXOA 2TRXA 4L0UA 3SWLA 2R37A 2L5LA 4MA9A 3F6FA 1QMVA 2L4QA 2IJYA 3M3MA 2LJRA 3I43A 4WR5A 1OE8A 1OVNA 3FZ4A 4FQUA 5HFKA 1EP7A 3GSTA 3D5JA 3DGQA 3I6AA 2IL3A 1M2DA 3HCZA 4GSTA 1MDJA 1Z9HA 4BVXB 3KH9A 3IHGA 3KH7A 4KCEA 2XBIA 3F3RA 4FH8A 4MPGA 5KN1A 4ZIJA 3BCKA 3ZLPA 3M1GA 4AF2A 4EE0A 1FB0A 3IHQA 4N10A 5H5SA 3APOA 5G2ZA 19GSA 4ECCA 3KIJA 3TKSA 1PN9A 1USBA 1OC8A 4O32A 4IQAA 3TKRA 4KDYA 1GTUA 1R7HA 3A2VA 4EO3A 4MDCA 1AQVA 1RW1A 4HZ4A 4NMUA 5J4UA 2YWOA 4O5RA 2EIRA 5JWOB 1R5AA 1B4QA 5IPGA 4K7NA 3VWUA 1T3BA 5J41A 3HHVA 3A5WA 4Z2RA 2PVOC 2B6MA 1Z6NA 3HVVA 1FVKA 4O5QA 1T1VA 4Z2TA 2JSZA 5DALB 2YANA 3CYNA 3EYTA 1U6TA 3CMIA 3NOFA 2LEGA 2F8FA 3FZ5A 1ZOFA 4CHSA 2R3XA 1S3CA 3LWAA 1AIUA 2LNTA 3F0IA 2AJQB 2EIOA 2GZZA 4BVXA 1S3DA 2FWGA 3WGXA 2DJ0A 4TW5A 3HVNA 2PGTA 2ON7A 4I8BA 3Q6OA 16GSA 3US3A 1GWCA 1UVZA 2XBQA 1XPVA 3GKXA 5ENUA 2CQ9A 1GSSA 5F0GA 3DIEA 1EEMA 1K0MA 1GSQA 1VF4A 1WOUA 1THXA 3GX0A 4NV2A 1WRYA 3ED3A 3GNJA 4KNDA 1BEDA 1MD4A 4XIHA 2IWTA 2VM2A 1ZYNA 4PQHA 3L9VA 1O8XA 3EINA 4LMVA 3RPNA 3F9UA 4CW9A 5DALA 3LYKA 4QQ7A 1PKWA 3KTBA 2K8SA 3IOSA 1AUCA 4PNFA 4PNGA 2O89A 1A2JA 3R2QA 2YJHA 4TRXA 2L4CA 2C0GA 4OCEA 5HFIA 5B6MA 2CZ2A 2LRTA 4F0CA 2DMLA 2NVLA 1XWKA 2PN8A 1V58A 1GUKA 1SKRB 3VURA 3FMWA 5F05A 5G5EA 1J08A 1V98A 2H72A 2V6OA 4RI6A 4I5QA 3DKSA 3FR9A 2HI7A 2GGTA 3EC3A 4XS4B 3EMXA 1O8WA 4MNNA 3O3TA 5INYA 1ZYPA 1R4WA 2I1UA 1K3YA 1SK1A 2PPTA 1QQ2A 3WYWA 1TRVA 4IP1A 1PL1A 3CXGA 3P7XA 3Q74A 2VCTA 2C3QA 3M8NA 1THOA 5GAND 4KGIA 2AYTA 4FYCA 5F06A 1ERUA 3IA1A 1TK8B 2CZ3A 2UZ8A 2LJKA 3OR5A 5DCHA 4YQMA 1JFUA 3ZYWA 2JACA 3GKMA 1A24A 2P31A 2X49A 3CRTA 2OBIA 4JR6A 1PN0A 3IK9A 1MEKA 1C72A 1GTIA 2HRKA 3UL3A 3E9JB 1O6JA 4KH7A 4FIWA 3IRAA 1HNAA 5DAKB 4ID0A 2HRFA 5IO0A 5D96A 5LD0A 4TR1A 4EDZA 1F9MA 2H1BA 5KN3A 2TIRA 3U6VA 3QMXA 4ECIA 2V6KA 4MPFA 1NW2A 4I2TA 2E7PA 3APQA 4POKA 4K0GA 4O92A 3HD5A 2YZHA 4TR0A 4ZXGA 2YCDA 5B7CA 2WS2A 3MIXA 1TP9A 3HKRA 5ECLB 5J9CA 1NHYA 5D93A 3IAS2 1WPIA 1AQWA 1TOFA 5A4UA 4G19A 2DKIA 4N11A 3IBHA 1ERTA 3L78A 2H8LA 5IM9A 4Z7XA 2C1YA 2AUVA 1BX9A 2DMMA 1M99A 3IAM2 5DJMA 5CRGA 3H79A 2VCVA 5HR3A 4K0NA 5EY6A 1ON4A 2OE0A 2HZEA 3TCOA 1ZYEA 4BWQA 2JADA 4MJBA 1EZKA 2M80A 1BQ7A 2R0GA 1SK2A 4GCIA 3GA4A 2DIZA 2QKEA 4MH2A 1MD3A 3M9JA 5DAKA 1TKDB 2E0QA 2VLVA 1SK0A 1UA5A 3CQFA 2L57A 1TW9A 4OWYA 4N30A 2RM6A 1PMTA 4LA1A 2WULA 3DWVA 1A23A 2REMA 3IDVA 1X5DA 2DSAA 3TKPA 2VCQA 4L5LA 2JL4A 4KUNA 2QC7A 1XW6A 10GSA 2ZNMA 3TRXA 2NPBA 2YJ7A 1EWXA 3KM6A 5DQYA 3UVHA 2GQKA 3HVSA 3CBUA 3FHKA 4USSA 4GSNA 1ACVA 2FHEA 1JLWA 2C0EA 1VF3A 2A4HA 1JZDA 4ZB9A 5CRDA 5IMCA 4TN8A 4DSRA 3C7MA 4XCSA 1WIKA 3QFAC 5EVOA 2F51A 3KMNA 4POBA 4KX4A 1H4OA 1ZGNA 4ISDA 5G1KA 3L0HA 4YAVA 3WD6A 3UOMA 2B3SA 1B9XC 1ZL9A 4HJ2A 1UC7A 1TU7A 4TXOB 2GQLA 4MLYA 2F3MA 3ZZXA 5D9VA 1PSQA 2K8VA 4MP4A 3KXOA 1TJDA 1XG8A 3MSZA 2YPMA 4D73A 5G31A 3DMLA 4HDEA 3UIWA 5E59A 2GSQA 2B1KA 4K7IA 4PGTA 3MAKA 4IN0A 1XXUA 2VL2A 5CYYA 4K8MA 4ECBA 2DJ2A 1M3IA 3LGCA 3O76A 2FCHA 2A2RA 4P3YB 3KMOA 3G9BA 3GHAA 14GSA 1HQOA 5DQSA 3V1WA 5C00A 5ELGA 2PMTA 2CT6A 3GH9A 1MDKA 3VWVA 1DE2A 3A2XA 3HVXA 1T4YA 2MMZA 3F4RA 2DJJA 3LXTA 1YKCA 2H71A 4Q5QA 3FY7A 3FEUA 2I81A 4KSOA 2H75A 2MZCA 4CY8A 2HLSA 4ZB6A 3PR8A 1J0FA 1KBNA 2IMDA 3CRUA 2FGXA 1GNWA 5JCWA 3Q18A 4FYBA 2GSSA 2BJXA 1EOHA 2C8UA 2OKAA 3IPZA 4EF0A 2K6VA 5ECNB 3GX8A 1GSUA 2A2SA 3TJKA 3DVXA 1SYRA 2WZ9A 4L8EA 1N8JA 3R3EA 2CAQA 5F8BA 4BWSA 1TI1A 1H75A 1K3OA 4EVMA 2H6YA 4V1Ap 2O7KA 4A5PA 2DLXA 3GUSA 1JZRA 2R5GA 4OO5A 1M0UA 2BTOT 3TKSC 2ZCTA 3GSSA 1NHOA 3UEMA 1AXDA 8GSSA 1FW1A 5A5KA 2WDUA 4K5RA 4KCAA 1TU8A 4MZCA 5ECPB 1TRUA 1TK5B 2K18A 1PL2A 2WB9A 4LL4B 4WEYA 3A3TA 1Q98A 3TDGA 3GTUB 2DJ1A 1FHEA 2WFCA 1XBSA 5HFGA 1Y25A 5ID2A 3C71A 3QR6A 2V1MA 2B7KA 1OC3A 3UBKA 2LSTA 1EEJA 5D73A 3HJOA 4ACSA 1PQNA 4HOJA 1CQGA 2H1DA 1X0RA 2TRCP 1B4PA 5GZZB 3H93A 1X9WB 5ELAA 3UBLA 1QXHA 3U5RE 1Z7RA 1TRWA 3RPPA 4HU7A 3J7Yb 3MDKA 4WETA 4IJIA 4OMVA 4HEA2 1TK0B 1NSWA 2PWJA 18GSA 2VD0A 3HJMA 2ES7A 1SD9A 2H30A 4GLTA 2HE3A 5ECSA 1Z6MA 4X4JA 4NXIA 2C0DA 2O87A 5GSTA 2RLIA 2X4AA 2R0CA 1A8YA 2MYGA 3EPTA 4JE1A 1WE0A 2O85A 1OKTA 2L6CA 3BJ5A 3TJJA 1SD8A 4X43A 5IMVA 3W8JA 5CP1A 4OFTA 4BIKA 4ZL9A 1YDKA 5LNKe 3H1NA 2B7JA 4HS1A 1VRSD 4EIPA 5H5RA 4Q5RA 4ULXA 2L59A 2HFDA 2JZSA 3GTUA 1GL8A 3P2AA 4FO5A 5BMUA 5J3RA 1V2AA 2HSHA 3IXRA 5ECRB 2M46A 3FZAA 1GLQA 1FB6A 1F3AA 1A2LA 4QL7A 1OC9A 3TJFA 1FOHA 4LMWA 5COHA 3PPUA 3FZ9A 1YEXA 4WF4A 3UMAA 3H4KA 2N5AA 1ZYQB 2I9HA 4YKGA 1R26A 4PUFC 4V1Ag 4WBRD 4HZ2A 2X8CA 1NM3A 2DC5A 3KZQA 2I4AA 2AB6A 2KOKA 4IQ1A 2LQQA 3IR4A 2R4VA 4IBPA 2WCIA 1HNCA 4GTUA 4TXVA 2YP6A 1G7EA 1PFOA 4HQSA 3ZTLA 2RUFA 3GMFA 3EWLA 12GSA 2Z9SA 2PVQA 2LNSA 2H73A 4K2XA 3I69A 4TR1B 1U3IA 3D4TA 2P5RA 5JWQB 1YF1A 2KUCA 3GFKA 1OYJA 2H0HA 1T8EB 13GSA 5IOWA 4IVFA 2HRNA 4IJ3A 5IMFA 2VM1A 1E2YA 3ZIVA 2P0GA 2H76A 1LBKA 5HQPA 1K0OA 1GRXA 3CSIA 2OJLA 2JZRA 2YZUA 3GKKA 2FWHA 5A4VA 1S3RA 4RQRA 5DCGA 1ERVA 2HT9A 3L9SA 1T00A 2FD3A 2J9HA 1T7PB 2GSRA 3QD9A 2E2GA 2AHEA 3E3EA 2YV9A 1GUHA 4GF0A 2BMXA 5AGYA 4ZL7A 4XRDA 4NHZA 3UARA 1Q4JA 1GSDA 1ZZYA 2HZFA 2HZEB 3D21A 4ICYA 2RIIA 3KGKA 2B5YA 1JZWA 2C4JA 5IMDA 1PX7A 4NPBA 2LV3A 4KDXA 4NWYA 1X5CA 2IIYA 4KE3A 6GSTA 5FT3A 3NZNA 2LTKA 3GL5A 2YNXA 3TKSE 1U3AA 4Z2UA 5D9TA 3HY2A 4JEDA 3LFLA 3CTFA 2HXKA 5HR1A 2HSMA 1JLVA 3W6GA 3IV4A 3CSHA 1QGVA 2X99A 3M0FA 4KA0A 1FVJA 5FHIA 1X5EA 4J56E 3F3QA 4O7HA 1YKAA 2CV4A 2GVPA 4HI7A 1EV4A 1A8LA 4IKHA 1OKDA 4ECJA 5AISA 2FLSA 3MNGA 3APSA 4WF5A 4G10A 4OO4A 2PBJA 3GKNA 4TOPA 2YN1A 2LJAA 3A5IA 1KNGA 1ABAA 3BBYA 2CVDA 2VOCA 3VWXA 5KOXA 4Q5NA 1DUGA 3ERFA 2O8VB 4KW6A 3BCIA 3QAWA 1X9SB 4D73B 3P8WA 5KN2A 2GT5A 4TVEA 3LQ7A 2VL3A 3ZREA 4RUVA 1DSBA 4GXZA 3M9KA 4WKWA 3H8QA 4BA7A 3IK7A 1F37A 4POMA 4NHWA 3PH9A 3TOTA 4K2DA 2VCWA 1EGRA 2XC2A 5DBQA 2GZPA 1GSEA 4DVCA 4MH3A 2R6KA 2C3TA 2FWFA 3JCML 1QUWA 4K9ZA 5CAXA 5IOXA 4MJEA 1SJZA 1ZCPA 3BD2A 3RHBA 3GV1A 3LSZA 1SU9A 3G7YA 3VLNA 4F82A 3FR6A 1CQHA 1B9YC 2OE1A 3ZFLA 1SYXA 3HZ4A 4X1UA 2H70A 4ZILA 1X9MB 3GIXA 4DEJA 4PQIA 2HYXA 4NV5A 4G2EA 2VL2C 1SKSB 2B5EA 3FKFA 5IPHA 3SBCA 1PKZA 3F4SA 1TTZA 3ZL5A 3ZVJA 1UN2A 7GSSA 2VCZA 3TRQA 2YV7A 3DD3A 3FYGA 6GSWA 3A2WA 11GSA 4IW9A 3UAPA 4EC0A 4PUAA 2ON5A 1GTBA 5ECHB 4MJCA 2FUG2 3HJPA 5H5QA 3QOUA 5IIZA 2H0GA 2PERA 3EURA 1WP0A 2CX4A 3KEBA 2RUEA 3RHCA 4K5SA 1K0CA 4K6XA 5ID2B 3WGDA 2IPAA 2IMEA 1G0TA 4I97A 1O7UA 1ST9A 4MZWA 4YQVA 3CTGA 3ZVJD 4NAXA 1GSFA 3ZMKA 5ECOB 4ML1A 3IC8A 1K0NA 4KAEA 5DVBA 4JRRA 2H74A 2MBSA 3GYKA 4V2MA 1Y6EA 1BAYA 1YY7A 2R0PA 2NTOA 2NBSA 3VFIA 5IMZA 3FR3A 4N0ZA 5CRWA 1YF0A 3CSJA 5CNWA 5IO2A 1VF1A 3HA9A 4TR3A 5E4WA 1MTCA 5ECIB 4ZB8A 1GP1A 4GSSA 4V2NA 1FG4A 1K3LA 2FWEA 3ZFBA 1Z5YE 1V40A 4HJMA 2H6XA 4HSCX 2L6DA 3VPTA 5J5NA 1MDIA 3NIVA 2VIMA 2QA2A 1F2EA 2CA8A 1YQ1A 1ZMAA 3DYRA 1DE1A 4G0LA 1WJKA 2KLXA 3GRXA 1VF2A 5G5FA 2DBCA 1K0AA 2YOIA 4DSSB 1ERWA 2H1AA 3KP8A 1IYHA 4EIQA 4EUYA 1PRXA 1EOGA 3VI7A 3LEFA 2G0FA 1XZOA 2AAWA 2GDRA 1M2AA 5IQYA 1SENA 1WMJA 3F8UA 1OC9B 1GH2A 4IHUA 2B5XA 4J57E 2RM5A 4BL7B 2GLRA 4IELA 2VD1A 4MJAA 4F0BA 2IFQB 3BOAA 3G7IA 2X8GA 4I6XA 4H86A 2OBKA 3VK9A 4CDOA 2LS5A 4DSQA 2R2JA 3EMPA 4GRFA 5GSSA 4YKFA 4LL1B 2V41A 3MWHA 5KOWA 4KB3A 3KD0A 3WGEA 4OFMA 5DJLA 3TKQA 3MYDA 3GURA 2GQMA 2DKHA 1V57A 2EIQA 3TB2A 4MCUA 1FAAA 4OD7A 5C04A 1I9DA 3LYPA 3J7Yk 1GNEA 1M3JA 4MF5A 1SL2B 2DJKA 4EL1A 4DSSA 4TKYA 2KHPA 3GL3A 3O6TA 3VWWA 4WXTA 4JZQA 3KP9A 3Q19A 3QAGA 5J9BA 4FYUA 2PUKC 4PQ1A 3IC4A 3QFBC 1EV9A 1TXXA 5ECMB 4XHMA 4EDYA 2J23A 4OCFA 2OA7A 3DVWA 3FW2A 2N5FA 4ILFA 4BVYB 4BL7A 3K8NA 1IYIA 2FA8A 3QCPA 2IFQA 4O5UA 2XPDA 4TR4A 5JCGA 2JZTA 3D0ZA 2CVBA 1KTEA 2H1GA 3GH6A 4XRAA 5EL8A 4JU5A 4AJ7A 5G30A 4PX1A 3HYPA 1GUMA 2HNLA 1O81A 2JU5A 5CO3A 2XPEA 9GSSA 3QDNA 2QGVA 3FK8A 4Q5FA 3E0UA 1XCCA 5A4WA 1PX6A 1XW5A 5EPFA 4MMMA 3RAZA 3F6DA 1F3BA 1TI3A 1EGOA 17GSA 4ZL8A 1XWGA 2YWMA 4PTSA 5L71A 1K0BA 3ME7A 3HXSA 2LRNA 3TGZA 5JCUA 3QPMA 2LRCA 1AW9A 1AC1A 3ERWA 1U87A 1PA3A 2XHFA 4GWRA 1GTAA 4MZBA 5D8IA 4F03A 1PD21 1V9WA 3S9FA 1XWAA 3TOUA 2H6ZA 1Z7PA 1SKWB 1BG5A 2C3NA 2WJUA 3L9UA 5DDLA 3F63A 2JSYA 4BVYA 2C80A 2MMNA 6GSVA 1XOBA 2VL9A 20GSA 2LKUA 5B8AA 1G6WA 2ZUPA 3EU3A 1SJ6A 1XVQA 2DIYA 3ERGA 6GSXA 1GSYA 3LG6A 1TDIA 2V32A 1DBYA 5FWGA 5ECKB 4MABA 1F6MC 1AQXA 1HYUA 2H19A 3C8EA 2IMFA 4WR4A 5B8BA 2F9SA 4XTSA 3FRCA 1G7OA 2ALBA 1I5GA 2FNOA 4POLA 1ILOA 1K0DA 4KSMA 3LJRA 2YWNA 2OADA 3C1SA 2HSYA 1Z3EA 4RQXA 2MMAA 3KTLA 4QL9A 1B48A 3D22A 5F07A 4JBBA 2WRTA 4KDUA 22GSA 6GSYA 2B1LA 3LXZA 1M9BA 4GQCA 4F9ZA 4YAPA 4CY6A 2F8AA 5AN1A 2N5BA 4RI7A 3D4MA 2CAIA 1QFNA 3LW9A 4J2FA 5AIVA 2VLTA 4XS1A 5JWRB 6GSSA 3TJBA 5KN0A 4ZBAA 1B8XA 3HDCA 1RK4A 3N9JA 1G6YA 4G0KA 1URMA 2H0IA 2P5QA 3L4NA 4LLRA 1A0FA 1J9BA 2X8HA 1S3AA 2NDOA 1XFLA 2MBTA 1LU4A 3VI5A 3W8SA 1YJ6A 4K7OA 3VPQA 3ISOA 4F2IA 4XS4A 2LUSA 1YZXA 1O73A 2PU9C 2H66A 1HNBA 4X0XA 3LORA 2GTUA 1M7TA 3RDWA 4E8EA 5CRHA 1GULA 2A4VA 1T4ZA 3IE3A 2V2GA 2GSTA 2VO4A 4ZBDA 4MF6A 3GN3A 2GZYA 5CREA 3UJ1A 4AJ8A 3ZMLA 4MF7A 1W4VA 5BRTA 1R5PA 5GAPD 2D2ZA 1SL0B 5B6NA 3PINA 5HR2A 2VUPA 1TRSA 1W89A 1PGTA 2VAFA 1LJRA 2AV4A 4OFNA 1KEBA 3C73A 2VLUA 2IMKA 2IN3A 4G0IA 2KP2A 1A2MA 2YWIA 1AAZA 3RBTA 5D9XA 3KCMA 3HZ8A 1XOAA 3EE2A 6GSUA 1BJXA 2IMIA 3WT1A 3AY8A 4YQUA 4AJ6A 2H01A 2E2MA 3C1RA 5ECQB 3D6IA 4HQZA 4IS0A 3PGTA 1OAZA 2FA4A 3TJGA 1HD2A 1U88A 4YH2A 2CVKA 4L0WA 1WWJA 2K9FA 3ZIJA 4PXOA 1ML6A 4WBJA 1SJIA 3QAVA 4HU9A 4K1FA 4AGSA 1JZOA 5LCZA 4KF9A 5G1LA 1M2BA 3ZRDA 1XWBA 2QSIA 1JHBA 3F4TA 4XS6A 5KEJA
chains in the Genus database with same CATH topology
2I3YA 3N5OA 4I2UA 3UVTA 3ME8A 1EP8A 1SL1B 2OACA 3EVIA 4BPYA 3P90A 1FO5A 3WT2A 1YEPA 2C0FA 2KP1A 2QA1A 4JR4A 3DRNA 4IGJA 4ML6A 1XIYA 3EU4A 1FOVA 2GS3A 5IMAA 3G7JA 3TUEA 3I9V2 5ABRA 2G2QA 4GQFA 1OE7A 4L5OA 1M9AA 3TRPA 1GLPA 4N0VA 4MK3A 4HUAA 1N2AA 1E6BA 2DJ3A 2X64A 1VGLA 2EC4A 2FY6A 4G9HA 4EXJA 1BYEA 4EKZA 2LQOA 4E8HA 3DXBA 1XW9A 2HRAA 2CX3A 3DEXA 5D9WA 5AIXA 2A2PA 2M72A 1RQMA 1QK8A 2OE3A 4ZBBA 4V2LA 4IP6A 2GT6A 1O85A 2VCXA 1XVWA 1A0RP 3KJYA 5HR0A 1XWCA 2WGRA 2L5OA 3ZITA 2MMOA 4PURA 4TXOA 2TRXA 4L0UA 3SWLA 2R37A 2L5LA 4MA9A 3F6FA 1QMVA 2L4QA 2IJYA 3M3MA 2LJRA 3I43A 4WR5A 1OE8A 1OVNA 3FZ4A 4FQUA 5HFKA 1EP7A 3GSTA 3D5JA 3DGQA 3I6AA 2IL3A 1M2DA 3HCZA 4GSTA 1MDJA 1Z9HA 4BVXB 3KH9A 3IHGA 3KH7A 4KCEA 2XBIA 3F3RA 4FH8A 4MPGA 5KN1A 4ZIJA 3BCKA 3ZLPA 3M1GA 4AF2A 4EE0A 1FB0A 3IHQA 4N10A 5H5SA 3APOA 5G2ZA 19GSA 4ECCA 3KIJA 3TKSA 1PN9A 1USBA 1OC8A 4O32A 4IQAA 3TKRA 4KDYA 1GTUA 1R7HA 3A2VA 4EO3A 4MDCA 1AQVA 1RW1A 4HZ4A 4NMUA 5J4UA 2YWOA 4O5RA 2EIRA 5JWOB 1R5AA 1B4QA 5IPGA 4K7NA 3VWUA 1T3BA 5J41A 3HHVA 3A5WA 4Z2RA 2PVOC 2B6MA 1Z6NA 3HVVA 1FVKA 4O5QA 1T1VA 4Z2TA 2JSZA 5DALB 2YANA 3CYNA 3EYTA 1U6TA 3CMIA 3NOFA 2LEGA 2F8FA 3FZ5A 1ZOFA 4CHSA 2R3XA 1S3CA 3LWAA 1AIUA 2LNTA 3F0IA 2AJQB 2EIOA 2GZZA 4BVXA 1S3DA 2FWGA 3WGXA 2DJ0A 4TW5A 2PGTA 2ON7A 4I8BA 3Q6OA 16GSA 3US3A 1GWCA 1UVZA 2XBQA 1XPVA 3GKXA 5ENUA 2CQ9A 1GSSA 5F0GA 3DIEA 1EEMA 1K0MA 1GSQA 1VF4A 1WOUA 1THXA 3GX0A 4NV2A 1WRYA 3ED3A 3GNJA 4KNDA 1BEDA 1MD4A 4XIHA 2IWTA 2VM2A 1ZYNA 4PQHA 3L9VA 1O8XA 3EINA 4LMVA 3RPNA 3F9UA 4CW9A 5DALA 3LYKA 4QQ7A 1PKWA 3KTBA 2K8SA 3IOSA 1AUCA 4PNFA 4PNGA 2O89A 1A2JA 3R2QA 2YJHA 4TRXA 2L4CA 2C0GA 4OCEA 5HFIA 5B6MA 2CZ2A 2LRTA 4F0CA 2DMLA 2NVLA 1XWKA 2PN8A 1V58A 1GUKA 1SKRB 3VURA 3FMWA 5F05A 5G5EA 1J08A 1V98A 2H72A 2V6OA 4RI6A 4I5QA 3DKSA 3FR9A 2HI7A 2GGTA 3EC3A 4XS4B 3EMXA 1O8WA 4MNNA 3O3TA 5INYA 1ZYPA 1R4WA 2I1UA 1K3YA 1SK1A 2PPTA 1QQ2A 3WYWA 1TRVA 4IP1A 1PL1A 3CXGA 3P7XA 3Q74A 2VCTA 2C3QA 3M8NA 1THOA 5GAND 4KGIA 2AYTA 4FYCA 5F06A 1ERUA 3IA1A 1TK8B 2CZ3A 2UZ8A 2LJKA 3OR5A 5DCHA 4YQMA 1JFUA 3ZYWA 2JACA 3GKMA 1A24A 2P31A 2X49A 3CRTA 2OBIA 4JR6A 1PN0A 3IK9A 1MEKA 1C72A 1GTIA 2HRKA 3UL3A 3E9JB 1O6JA 4KH7A 4FIWA 3IRAA 1HNAA 5DAKB 4ID0A 2HRFA 5IO0A 5D96A 5LD0A 4TR1A 4EDZA 1F9MA 2H1BA 5KN3A 2TIRA 3U6VA 3QMXA 4ECIA 2V6KA 4MPFA 1NW2A 4I2TA 2E7PA 3APQA 4POKA 4K0GA 4O92A 3HD5A 2YZHA 4TR0A 4ZXGA 2YCDA 5B7CA 2WS2A 3MIXA 1TP9A 3HKRA 5ECLB 5J9CA 1NHYA 5D93A 3IAS2 1WPIA 1AQWA 1TOFA 5A4UA 4G19A 2DKIA 4N11A 3IBHA 1ERTA 3L78A 2H8LA 5IM9A 4Z7XA 2C1YA 2AUVA 1BX9A 2DMMA 1M99A 3IAM2 5DJMA 5CRGA 3H79A 2VCVA 5HR3A 4K0NA 5EY6A 1ON4A 2OE0A 2HZEA 3TCOA 1ZYEA 4BWQA 2JADA 4MJBA 1EZKA 2M80A 1BQ7A 2R0GA 1SK2A 4GCIA 3GA4A 2DIZA 2QKEA 4MH2A 1MD3A 3M9JA 5DAKA 1TKDB 2E0QA 2VLVA 1SK0A 1UA5A 2L57A 1TW9A 4OWYA 4N30A 2RM6A 1PMTA 4LA1A 2WULA 3DWVA 1A23A 2REMA 3IDVA 1X5DA 2DSAA 3TKPA 2VCQA 4L5LA 2JL4A 4KUNA 2QC7A 1XW6A 10GSA 2ZNMA 3TRXA 2NPBA 2YJ7A 1EWXA 3KM6A 5DQYA 3UVHA 2GQKA 3HVSA 3CBUA 3FHKA 4USSA 4GSNA 1ACVA 2FHEA 1JLWA 2C0EA 1VF3A 2A4HA 1JZDA 4ZB9A 5CRDA 5IMCA 4TN8A 4DSRA 3C7MA 4XCSA 1WIKA 3QFAC 5EVOA 2F51A 3KMNA 4POBA 4KX4A 1H4OA 1ZGNA 4ISDA 5G1KA 3L0HA 4YAVA 3WD6A 3UOMA 2B3SA 1B9XC 1ZL9A 4HJ2A 1UC7A 1TU7A 4TXOB 2GQLA 4MLYA 2F3MA 3ZZXA 5D9VA 1PSQA 2K8VA 4MP4A 3KXOA 1TJDA 3MSZA 2YPMA 4D73A 5G31A 3DMLA 4HDEA 3UIWA 5E59A 2GSQA 2B1KA 4K7IA 4PGTA 3MAKA 4IN0A 1XXUA 2VL2A 5CYYA 4K8MA 4ECBA 2DJ2A 3LGCA 3O76A 2FCHA 2A2RA 4P3YB 3KMOA 3G9BA 3GHAA 14GSA 1HQOA 5DQSA 3V1WA 5C00A 5ELGA 2PMTA 2CT6A 3GH9A 1MDKA 3VWVA 1DE2A 3A2XA 3HVXA 1T4YA 2MMZA 3F4RA 2DJJA 3LXTA 1YKCA 2H71A 4Q5QA 3FY7A 3FEUA 2I81A 4KSOA 2H75A 2MZCA 4CY8A 2HLSA 4ZB6A 3PR8A 1J0FA 1KBNA 2IMDA 3CRUA 2FGXA 1GNWA 5JCWA 3Q18A 4FYBA 2GSSA 2BJXA 1EOHA 2C8UA 2OKAA 3IPZA 4EF0A 2K6VA 5ECNB 3GX8A 1GSUA 2A2SA 3TJKA 3DVXA 1SYRA 2WZ9A 4L8EA 1N8JA 3R3EA 2CAQA 5F8BA 4BWSA 1TI1A 1H75A 1K3OA 4EVMA 2H6YA 4V1Ap 2O7KA 4A5PA 2DLXA 3GUSA 1JZRA 2R5GA 4OO5A 1M0UA 2BTOT 3TKSC 2ZCTA 3GSSA 1NHOA 3UEMA 1AXDA 8GSSA 1FW1A 5A5KA 2WDUA 4K5RA 4KCAA 1TU8A 4MZCA 5ECPB 1TRUA 1TK5B 2K18A 1PL2A 2WB9A 4LL4B 4WEYA 3A3TA 1Q98A 3TDGA 3GTUB 2DJ1A 1FHEA 2WFCA 1XBSA 5HFGA 1Y25A 5ID2A 3C71A 3QR6A 2V1MA 2B7KA 1OC3A 3UBKA 2LSTA 1EEJA 5D73A 3HJOA 4ACSA 1PQNA 4HOJA 1CQGA 2H1DA 1X0RA 2TRCP 1B4PA 5GZZB 3H93A 1X9WB 5ELAA 3UBLA 1QXHA 3U5RE 1Z7RA 1TRWA 3RPPA 4HU7A 3J7Yb 3MDKA 4WETA 4IJIA 4OMVA 4HEA2 1TK0B 1NSWA 2PWJA 18GSA 2VD0A 3HJMA 2ES7A 1SD9A 2H30A 4GLTA 2HE3A 5ECSA 1Z6MA 4X4JA 4NXIA 2C0DA 2O87A 5GSTA 2RLIA 2X4AA 2R0CA 1A8YA 2MYGA 3EPTA 4JE1A 1WE0A 2O85A 1OKTA 2L6CA 3BJ5A 3TJJA 1SD8A 4X43A 5IMVA 3W8JA 5CP1A 4OFTA 4ZL9A 1YDKA 5LNKe 3H1NA 2B7JA 4HS1A 1VRSD 4EIPA 5H5RA 4Q5RA 4ULXA 2L59A 2HFDA 2JZSA 3GTUA 1GL8A 3P2AA 4FO5A 5BMUA 5J3RA 1V2AA 2HSHA 3IXRA 5ECRB 2M46A 3FZAA 1GLQA 1FB6A 1F3AA 1A2LA 4QL7A 1OC9A 3TJFA 1FOHA 4LMWA 5COHA 3PPUA 3FZ9A 1YEXA 4WF4A 3UMAA 3H4KA 2N5AA 1ZYQB 2I9HA 4YKGA 1R26A 4PUFC 4V1Ag 4WBRD 4HZ2A 2X8CA 1NM3A 2DC5A 3KZQA 2I4AA 2AB6A 2KOKA 4IQ1A 2LQQA 3IR4A 2R4VA 4IBPA 2WCIA 1HNCA 4GTUA 4TXVA 2YP6A 1G7EA 4HQSA 3ZTLA 2RUFA 3GMFA 3EWLA 12GSA 2Z9SA 2PVQA 2LNSA 2H73A 4K2XA 3I69A 4TR1B 1U3IA 3D4TA 2P5RA 5JWQB 1YF1A 2KUCA 3GFKA 1OYJA 2H0HA 1T8EB 13GSA 5IOWA 4IVFA 2HRNA 4IJ3A 5IMFA 2VM1A 1E2YA 3ZIVA 2P0GA 2H76A 1LBKA 5HQPA 1K0OA 1GRXA 3CSIA 2OJLA 2JZRA 2YZUA 3GKKA 2FWHA 5A4VA 4RQRA 5DCGA 1ERVA 2HT9A 3L9SA 1T00A 2FD3A 2J9HA 1T7PB 2GSRA 3QD9A 2E2GA 2AHEA 3E3EA 2YV9A 1GUHA 4GF0A 2BMXA 5AGYA 4ZL7A 4XRDA 4NHZA 3UARA 1Q4JA 1GSDA 1ZZYA 2HZFA 2HZEB 3D21A 4ICYA 2RIIA 3KGKA 2B5YA 1JZWA 2C4JA 5IMDA 1PX7A 4NPBA 2LV3A 4KDXA 4NWYA 1X5CA 2IIYA 4KE3A 6GSTA 5FT3A 3NZNA 2LTKA 3GL5A 2YNXA 3TKSE 1U3AA 4Z2UA 5D9TA 3HY2A 4JEDA 3LFLA 3CTFA 2HXKA 5HR1A 2HSMA 1JLVA 3W6GA 3IV4A 3CSHA 1QGVA 2X99A 3M0FA 4KA0A 1FVJA 5FHIA 1X5EA 4J56E 3F3QA 4O7HA 1YKAA 2CV4A 2GVPA 4HI7A 1EV4A 1A8LA 4IKHA 1OKDA 4ECJA 5AISA 2FLSA 3MNGA 3APSA 4WF5A 4G10A 4OO4A 2PBJA 3GKNA 4TOPA 2YN1A 2LJAA 3A5IA 1KNGA 1ABAA 3BBYA 2CVDA 2VOCA 3VWXA 5KOXA 4Q5NA 1DUGA 3ERFA 2O8VB 4KW6A 3BCIA 3QAWA 1X9SB 4D73B 3P8WA 5KN2A 2GT5A 4TVEA 3LQ7A 2VL3A 3ZREA 4RUVA 1DSBA 4GXZA 3M9KA 4WKWA 3H8QA 4BA7A 3IK7A 1F37A 4POMA 4NHWA 3PH9A 3TOTA 4K2DA 2VCWA 1EGRA 2XC2A 5DBQA 2GZPA 1GSEA 4DVCA 4MH3A 2R6KA 2C3TA 2FWFA 3JCML 1QUWA 4K9ZA 5CAXA 5IOXA 4MJEA 1SJZA 1ZCPA 3BD2A 3RHBA 3GV1A 3LSZA 1SU9A 3G7YA 3VLNA 4F82A 3FR6A 1CQHA 1B9YC 2OE1A 3ZFLA 1SYXA 3HZ4A 4X1UA 2H70A 4ZILA 1X9MB 3GIXA 4DEJA 4PQIA 2HYXA 4NV5A 4G2EA 2VL2C 1SKSB 2B5EA 3FKFA 5IPHA 3SBCA 1PKZA 3F4SA 1TTZA 3ZL5A 3ZVJA 1UN2A 7GSSA 2VCZA 3TRQA 2YV7A 3DD3A 3FYGA 6GSWA 3A2WA 11GSA 4IW9A 3UAPA 4EC0A 4PUAA 2ON5A 1GTBA 5ECHB 4MJCA 2FUG2 3HJPA 5H5QA 3QOUA 5IIZA 2H0GA 2PERA 3EURA 1WP0A 2CX4A 3KEBA 2RUEA 3RHCA 4K5SA 1K0CA 4K6XA 5ID2B 3WGDA 2IPAA 2IMEA 1G0TA 4I97A 1O7UA 1ST9A 4MZWA 4YQVA 3CTGA 3ZVJD 4NAXA 1GSFA 3ZMKA 5ECOB 4ML1A 3IC8A 1K0NA 4KAEA 5DVBA 4JRRA 2H74A 2MBSA 3GYKA 4V2MA 1Y6EA 1BAYA 1YY7A 2R0PA 2NTOA 2NBSA 3VFIA 5IMZA 3FR3A 4N0ZA 5CRWA 1YF0A 3CSJA 5CNWA 5IO2A 1VF1A 3HA9A 4TR3A 5E4WA 1MTCA 5ECIB 4ZB8A 1GP1A 4GSSA 4V2NA 1FG4A 1K3LA 2FWEA 3ZFBA 1Z5YE 1V40A 4HJMA 2H6XA 2L6DA 3VPTA 5J5NA 1MDIA 3NIVA 2VIMA 2QA2A 1F2EA 2CA8A 1YQ1A 1ZMAA 3DYRA 1DE1A 4G0LA 1WJKA 2KLXA 3GRXA 1VF2A 5G5FA 2DBCA 1K0AA 2YOIA 4DSSB 1ERWA 2H1AA 3KP8A 1IYHA 4EIQA 4EUYA 1PRXA 1EOGA 3VI7A 3LEFA 2G0FA 1XZOA 2AAWA 2GDRA 1M2AA 5IQYA 1SENA 1WMJA 3F8UA 1OC9B 1GH2A 4IHUA 2B5XA 4J57E 2RM5A 4BL7B 2GLRA 4IELA 2VD1A 4MJAA 4F0BA 2IFQB 3BOAA 3G7IA 2X8GA 4I6XA 4H86A 2OBKA 3VK9A 4CDOA 2LS5A 4DSQA 2R2JA 3EMPA 4GRFA 5GSSA 4YKFA 4LL1B 2V41A 3MWHA 5KOWA 4KB3A 3KD0A 3WGEA 4OFMA 5DJLA 3TKQA 3MYDA 3GURA 2GQMA 2DKHA 1V57A 2EIQA 3TB2A 4MCUA 1FAAA 4OD7A 5C04A 1I9DA 3LYPA 3J7Yk 1GNEA 4MF5A 1SL2B 2DJKA 4EL1A 4DSSA 4TKYA 2KHPA 3GL3A 3O6TA 3VWWA 4WXTA 4JZQA 3KP9A 3Q19A 3QAGA 5J9BA 4FYUA 2PUKC 4PQ1A 3IC4A 3QFBC 1EV9A 1TXXA 5ECMB 4XHMA 4EDYA 2J23A 4OCFA 2OA7A 3DVWA 3FW2A 2N5FA 4ILFA 4BVYB 4BL7A 3K8NA 1IYIA 2FA8A 3QCPA 2IFQA 4O5UA 2XPDA 4TR4A 5JCGA 2JZTA 3D0ZA 2CVBA 1KTEA 2H1GA 3GH6A 4XRAA 5EL8A 4JU5A 4AJ7A 5G30A 4PX1A 3HYPA 1GUMA 2HNLA 1O81A 2JU5A 5CO3A 2XPEA 9GSSA 3QDNA 2QGVA 3FK8A 4Q5FA 3E0UA 1XCCA 5A4WA 1PX6A 1XW5A 5EPFA 4MMMA 3RAZA 3F6DA 1F3BA 1TI3A 1EGOA 17GSA 4ZL8A 1XWGA 2YWMA 4PTSA 5L71A 1K0BA 3ME7A 3HXSA 2LRNA 3TGZA 5JCUA 3QPMA 2LRCA 1AW9A 1AC1A 3ERWA 1U87A 1PA3A 2XHFA 4GWRA 1GTAA 4MZBA 5D8IA 4F03A 1PD21 1V9WA 3S9FA 1XWAA 3TOUA 2H6ZA 1Z7PA 1SKWB 1BG5A 2C3NA 2WJUA 3L9UA 5DDLA 3F63A 2JSYA 4BVYA 2C80A 2MMNA 6GSVA 1XOBA 2VL9A 20GSA 2LKUA 5B8AA 1G6WA 2ZUPA 3EU3A 1SJ6A 1XVQA 2DIYA 3ERGA 6GSXA 1GSYA 3LG6A 1TDIA 2V32A 1DBYA 5FWGA 5ECKB 4MABA 1F6MC 1AQXA 1HYUA 2H19A 3C8EA 2IMFA 4WR4A 5B8BA 2F9SA 4XTSA 3FRCA 1G7OA 2ALBA 1I5GA 2FNOA 4POLA 1ILOA 1K0DA 4KSMA 3LJRA 2YWNA 2OADA 3C1SA 2HSYA 1Z3EA 4RQXA 2MMAA 3KTLA 4QL9A 1B48A 3D22A 5F07A 4JBBA 2WRTA 4KDUA 22GSA 6GSYA 2B1LA 3LXZA 1M9BA 4GQCA 4F9ZA 4YAPA 4CY6A 2F8AA 5AN1A 2N5BA 4RI7A 3D4MA 2CAIA 1QFNA 3LW9A 4J2FA 5AIVA 2VLTA 4XS1A 5JWRB 6GSSA 3TJBA 5KN0A 4ZBAA 1B8XA 3HDCA 1RK4A 3N9JA 1G6YA 4G0KA 1URMA 2H0IA 2P5QA 3L4NA 4LLRA 1A0FA 1J9BA 2X8HA 1S3AA 2NDOA 1XFLA 2MBTA 1LU4A 3VI5A 3W8SA 1YJ6A 4K7OA 3VPQA 3ISOA 4F2IA 4XS4A 2LUSA 1YZXA 1O73A 2PU9C 2H66A 1HNBA 4X0XA 3LORA 2GTUA 1M7TA 3RDWA 4E8EA 5CRHA 1GULA 2A4VA 1T4ZA 3IE3A 2V2GA 2GSTA 2VO4A 4ZBDA 4MF6A 3GN3A 2GZYA 5CREA 3UJ1A 4AJ8A 3ZMLA 4MF7A 1W4VA 5BRTA 1R5PA 5GAPD 2D2ZA 1SL0B 3PINA 5B6NA 5HR2A 2VUPA 1TRSA 1W89A 1PGTA 2VAFA 1LJRA 2AV4A 4OFNA 1KEBA 3C73A 2VLUA 2IMKA 2IN3A 4G0IA 2KP2A 1A2MA 2YWIA 1AAZA 3RBTA 5D9XA 3KCMA 3HZ8A 1XOAA 3EE2A 6GSUA 1BJXA 2IMIA 3WT1A 3AY8A 4YQUA 4AJ6A 2H01A 2E2MA 3C1RA 5ECQB 3D6IA 4HQZA 4IS0A 3PGTA 1OAZA 2FA4A 3TJGA 1HD2A 1U88A 4YH2A 2CVKA 4L0WA 1WWJA 2K9FA 3ZIJA 4PXOA 1ML6A 4WBJA 1SJIA 3QAVA 4HU9A 4K1FA 4AGSA 1JZOA 5LCZA 4KF9A 5G1LA 1M2BA 3ZRDA 1XWBA 2QSIA 1JHBA 3F4TA 4XS6A 5KEJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I3Y A;  3N5O A;  4I2U A;  3UVT A;  3ME8 A;  1EP8 A;  1SL1 B;  2OAC A;  3EVI A;  4BPY A;  3P90 A;  1FO5 A;  3WT2 A;  1YEP A;  2C0F A;  2KP1 A;  4JR4 A;  3DRN A;  4IGJ A;  4ML6 A;  1XIY A;  3EU4 A;  1FOV A;  2GS3 A;  5IMA A;  3G7J A;  3TUE A;  3I9V 2;  5ABR A;  2G2Q A;  4GQF A;  1OE7 A;  4L5O A;  1M9A A;  3TRP A;  1GLP A;  4N0V A;  4MK3 A;  4HUA A;  1N2A A;  1E6B A;  2DJ3 A;  2X64 A;  1VGL A;  2EC4 A;  2FY6 A;  4G9H A;  4EXJ A;  1BYE A;  4EKZ A;  2LQO A;  4E8H A;  3DXB A;  1XW9 A;  2CX3 A;  3DEX A;  5D9W A;  5AIX A;  2M72 A;  1RQM A;  1QK8 A;  2OE3 A;  4ZBB A;  4V2L A;  4IP6 A;  2GT6 A;  1O85 A;  2VCX A;  1XVW A;  1A0R P;  3KJY A;  5HR0 A;  1XWC A;  2WGR A;  2L5O A;  3ZIT A;  2MMO A;  4PUR A;  4TXO A;  2TRX A;  4L0U A;  3SWL A;  2R37 A;  2L5L A;  4MA9 A;  3F6F A;  1QMV A;  2L4Q A;  2IJY A;  3M3M A;  2LJR A;  3I43 A;  4WR5 A;  1OE8 A;  1OVN A;  3FZ4 A;  5HFK A;  1EP7 A;  3GST A;  3D5J A;  3DGQ A;  3I6A A;  2IL3 A;  1M2D A;  3HCZ A;  4GST A;  1MDJ A;  1Z9H A;  3KH9 A;  3KH7 A;  4KCE A;  2XBI A;  3F3R A;  4FH8 A;  4MPG A;  5KN1 A;  4ZIJ A;  3BCK A;  3ZLP A;  3M1G A;  4AF2 A;  4EE0 A;  1FB0 A;  3IHQ A;  4N10 A;  5H5S A;  3APO A;  5G2Z A;  19GS A;  4ECC A;  3KIJ A;  3TKS A;  1PN9 A;  1USB A;  1OC8 A;  4O32 A;  4IQA A;  3TKR A;  4KDY A;  1GTU A;  1R7H A;  3A2V A;  4EO3 A;  4MDC A;  1AQV A;  1RW1 A;  4HZ4 A;  4NMU A;  5J4U A;  2YWO A;  4O5R A;  2EIR A;  5JWO B;  1R5A A;  1B4Q A;  5IPG A;  4K7N A;  3VWU A;  1T3B A;  5J41 A;  3HHV A;  3A5W A;  2PVO C;  2B6M A;  1Z6N A;  3HVV A;  1FVK A;  1T1V A;  2JSZ A;  5DAL B;  2YAN A;  3CYN A;  3EYT A;  1U6T A;  3CMI A;  3NOF A;  2LEG A;  2F8F A;  3FZ5 A;  1ZOF A;  4CHS A;  2R3X A;  1S3C A;  3LWA A;  1AIU A;  2LNT A;  3F0I A;  2AJQ B;  2EIO A;  2GZZ A;  4BVX A;  1S3D A;  2FWG A;  3WGX A;  2DJ0 A;  4TW5 A;  2PGT A;  2ON7 A;  4I8B A;  3Q6O A;  16GS A;  3US3 A;  1GWC A;  1UVZ A;  2XBQ A;  1XPV A;  3GKX A;  5ENU A;  2CQ9 A;  1GSS A;  5F0G A;  3DIE A;  1EEM A;  1K0M A;  1GSQ A;  1VF4 A;  1WOU A;  1THX A;  3GX0 A;  4NV2 A;  1WRY A;  3ED3 A;  3GNJ A;  4KND A;  1BED A;  1MD4 A;  4XIH A;  2IWT A;  2VM2 A;  4PQH A;  3L9V A;  1O8X A;  3EIN A;  4LMV A;  3RPN A;  3F9U A;  4CW9 A;  5DAL A;  3LYK A;  4QQ7 A;  1PKW A;  3KTB A;  2K8S A;  3IOS A;  1AUC A;  4PNF A;  4PNG A;  2O89 A;  1A2J A;  3R2Q A;  2YJH A;  4TRX A;  2L4C A;  2C0G A;  4OCE A;  5HFI A;  5B6M A;  2CZ2 A;  2LRT A;  4F0C A;  2DML A;  2NVL A;  1XWK A;  2PN8 A;  1V58 A;  1GUK A;  1SKR B;  3VUR A;  5F05 A;  5G5E A;  1J08 A;  1V98 A;  2H72 A;  2V6O A;  4RI6 A;  4I5Q A;  3DKS A;  3FR9 A;  2HI7 A;  2GGT A;  3EC3 A;  4XS4 B;  3EMX A;  1O8W A;  3O3T A;  5INY A;  1R4W A;  2I1U A;  1K3Y A;  1SK1 A;  2PPT A;  1QQ2 A;  3WYW A;  1TRV A;  4IP1 A;  1PL1 A;  3CXG A;  3P7X A;  3Q74 A;  2VCT A;  2C3Q A;  3M8N A;  1THO A;  5GAN D;  4KGI A;  2AYT A;  4FYC A;  5F06 A;  1ERU A;  3IA1 A;  1TK8 B;  2CZ3 A;  2LJK A;  3OR5 A;  5DCH A;  4YQM A;  1JFU A;  3ZYW A;  2JAC A;  3GKM A;  1A24 A;  2P31 A;  3CRT A;  2OBI A;  4JR6 A;  3IK9 A;  1MEK A;  1C72 A;  1GTI A;  3UL3 A;  3E9J B;  1O6J A;  4KH7 A;  4FIW A;  3IRA A;  1HNA A;  5DAK B;  4ID0 A;  2HRF A;  5IO0 A;  5D96 A;  5LD0 A;  4TR1 A;  4EDZ A;  1F9M A;  2H1B A;  5KN3 A;  2TIR A;  3U6V A;  3QMX A;  4ECI A;  2V6K A;  4MPF A;  1NW2 A;  4I2T A;  2E7P A;  3APQ A;  4POK A;  4K0G A;  4O92 A;  3HD5 A;  2YZH A;  4TR0 A;  4ZXG A;  2YCD A;  5B7C A;  2WS2 A;  1TP9 A;  3HKR A;  5ECL B;  5J9C A;  1NHY A;  5D93 A;  3IAS 2;  1WPI A;  1AQW A;  1TOF A;  5A4U A;  4G19 A;  4N11 A;  3IBH A;  1ERT A;  3L78 A;  2H8L A;  5IM9 A;  4Z7X A;  2C1Y A;  2AUV A;  1BX9 A;  2DMM A;  1M99 A;  3IAM 2;  5DJM A;  5CRG A;  3H79 A;  2VCV A;  5HR3 A;  4K0N A;  5EY6 A;  1ON4 A;  2OE0 A;  2HZE A;  3TCO A;  1ZYE A;  4BWQ A;  2JAD A;  4MJB A;  1EZK A;  2M80 A;  1BQ7 A;  1SK2 A;  4GCI A;  3GA4 A;  2DIZ A;  2QKE A;  4MH2 A;  1MD3 A;  3M9J A;  5DAK A;  1TKD B;  2E0Q A;  2VLV A;  1SK0 A;  1UA5 A;  2L57 A;  1TW9 A;  4OWY A;  4N30 A;  2RM6 A;  1PMT A;  4LA1 A;  2WUL A;  3DWV A;  1A23 A;  2REM A;  3IDV A;  1X5D A;  2DSA A;  3TKP A;  2VCQ A;  4L5L A;  2JL4 A;  4KUN A;  2QC7 A;  1XW6 A;  10GS A;  2ZNM A;  3TRX A;  2NPB A;  2YJ7 A;  1EWX A;  3KM6 A;  5DQY A;  3UVH A;  2GQK A;  3HVS A;  3CBU A;  3FHK A;  4GSN A;  1ACV A;  2FHE A;  1JLW A;  2C0E A;  1VF3 A;  1JZD A;  4ZB9 A;  5CRD A;  5IMC A;  4TN8 A;  4DSR A;  3C7M A;  4XCS A;  1WIK A;  3QFA C;  5EVO A;  2F51 A;  3KMN A;  4POB A;  4KX4 A;  1H4O A;  1ZGN A;  4ISD A;  5G1K A;  3L0H A;  4YAV A;  3WD6 A;  3UOM A;  2B3S A;  1B9X C;  1ZL9 A;  4HJ2 A;  1UC7 A;  1TU7 A;  4TXO B;  2GQL A;  4MLY A;  2F3M A;  3ZZX A;  5D9V A;  1PSQ A;  2K8V A;  4MP4 A;  3KXO A;  1TJD A;  3MSZ A;  2YPM A;  4D73 A;  5G31 A;  3DML A;  4HDE A;  3UIW A;  5E59 A;  2GSQ A;  2B1K A;  4K7I A;  4PGT A;  3MAK A;  4IN0 A;  1XXU A;  2VL2 A;  5CYY A;  4K8M A;  4ECB A;  2DJ2 A;  3LGC A;  3O76 A;  2FCH A;  2A2R A;  4P3Y B;  3KMO A;  3G9B A;  3GHA A;  14GS A;  1HQO A;  5DQS A;  3V1W A;  5C00 A;  5ELG A;  2PMT A;  2CT6 A;  3GH9 A;  1MDK A;  3VWV A;  1DE2 A;  3A2X A;  3HVX A;  1T4Y A;  2MMZ A;  3F4R A;  2DJJ A;  3LXT A;  1YKC A;  2H71 A;  4Q5Q A;  3FY7 A;  3FEU A;  2I81 A;  4KSO A;  2H75 A;  2MZC A;  2HLS A;  4ZB6 A;  3PR8 A;  1J0F A;  1KBN A;  2IMD A;  3CRU A;  2FGX A;  1GNW A;  5JCW A;  3Q18 A;  4FYB A;  2GSS A;  2BJX A;  1EOH A;  2C8U A;  2OKA A;  3IPZ A;  4EF0 A;  2K6V A;  5ECN B;  3GX8 A;  1GSU A;  2A2S A;  3TJK A;  3DVX A;  1SYR A;  2WZ9 A;  4L8E A;  1N8J A;  2CAQ A;  5F8B A;  4BWS A;  1TI1 A;  1H75 A;  1K3O A;  4EVM A;  2H6Y A;  4V1A p;  2O7K A;  2DLX A;  3GUS A;  1JZR A;  2R5G A;  4OO5 A;  1M0U A;  2BTO T;  3TKS C;  2ZCT A;  3GSS A;  1NHO A;  3UEM A;  1AXD A;  8GSS A;  1FW1 A;  5A5K A;  2WDU A;  4KCA A;  1TU8 A;  4MZC A;  5ECP B;  1TRU A;  1TK5 B;  2K18 A;  1PL2 A;  2WB9 A;  4LL4 B;  4WEY A;  3A3T A;  1Q98 A;  3TDG A;  3GTU B;  2DJ1 A;  1FHE A;  2WFC A;  1XBS A;  5HFG A;  1Y25 A;  5ID2 A;  3C71 A;  3QR6 A;  2V1M A;  2B7K A;  1OC3 A;  3UBK A;  2LST A;  1EEJ A;  5D73 A;  3HJO A;  4ACS A;  1PQN A;  4HOJ A;  1CQG A;  2H1D A;  1X0R A;  2TRC P;  1B4P A;  5GZZ B;  3H93 A;  1X9W B;  5ELA A;  3UBL A;  1QXH A;  3U5R E;  1Z7R A;  1TRW A;  3RPP A;  4HU7 A;  3J7Y b;  3MDK A;  4WET A;  4IJI A;  4OMV A;  4HEA 2;  1TK0 B;  1NSW A;  2PWJ A;  18GS A;  2VD0 A;  3HJM A;  2ES7 A;  1SD9 A;  2H30 A;  4GLT A;  2HE3 A;  5ECS A;  1Z6M A;  4NXI A;  2C0D A;  2O87 A;  5GST A;  2RLI A;  1A8Y A;  2MYG A;  4JE1 A;  1WE0 A;  2O85 A;  1OKT A;  2L6C A;  3BJ5 A;  3TJJ A;  1SD8 A;  4X43 A;  5IMV A;  3W8J A;  5CP1 A;  4OFT A;  4ZL9 A;  1YDK A;  5LNK e;  3H1N A;  2B7J A;  4HS1 A;  1VRS D;  5H5R A;  4Q5R A;  4ULX A;  2L59 A;  2HFD A;  2JZS A;  3GTU A;  1GL8 A;  3P2A A;  4FO5 A;  5J3R A;  1V2A A;  2HSH A;  3IXR A;  5ECR B;  2M46 A;  3FZA A;  1GLQ A;  1FB6 A;  1F3A A;  1A2L A;  4QL7 A;  1OC9 A;  3TJF A;  4LMW A;  5COH A;  3FZ9 A;  1YEX A;  4WF4 A;  3UMA A;  3H4K A;  2N5A A;  1ZYQ B;  2I9H A;  1R26 A;  4PUF C;  4V1A g;  4WBR D;  4HZ2 A;  2X8C A;  1NM3 A;  2DC5 A;  3KZQ A;  2I4A A;  2AB6 A;  2KOK A;  4IQ1 A;  2LQQ A;  3IR4 A;  2R4V A;  4IBP A;  2WCI A;  1HNC A;  4GTU A;  4TXV A;  2YP6 A;  1G7E A;  4HQS A;  3ZTL A;  2RUF A;  3GMF A;  3EWL A;  12GS A;  2Z9S A;  2PVQ A;  2LNS A;  2H73 A;  3I69 A;  4TR1 B;  1U3I A;  3D4T A;  2P5R A;  5JWQ B;  1YF1 A;  2KUC A;  3GFK A;  1OYJ A;  2H0H A;  1T8E B;  13GS A;  5IOW A;  4IVF A;  2HRN A;  4IJ3 A;  5IMF A;  2VM1 A;  1E2Y A;  3ZIV A;  2P0G A;  2H76 A;  1LBK A;  5HQP A;  1K0O A;  1GRX A;  3CSI A;  2OJL A;  2JZR A;  2YZU A;  3GKK A;  2FWH A;  5A4V A;  4RQR A;  5DCG A;  1ERV A;  2HT9 A;  3L9S A;  1T00 A;  2FD3 A;  2J9H A;  1T7P B;  2GSR A;  3QD9 A;  2E2G A;  2AHE A;  3E3E A;  2YV9 A;  1GUH A;  4GF0 A;  2BMX A;  5AGY A;  4ZL7 A;  4XRD A;  4NHZ A;  3UAR A;  1Q4J A;  1GSD A;  1ZZY A;  2HZF A;  2HZE B;  3D21 A;  2RII A;  3KGK A;  2B5Y A;  1JZW A;  2C4J A;  5IMD A;  1PX7 A;  4NPB A;  2LV3 A;  4KDX A;  4NWY A;  1X5C A;  2IIY A;  4KE3 A;  6GST A;  5FT3 A;  3NZN A;  2LTK A;  3GL5 A;  2YNX A;  3TKS E;  1U3A A;  5D9T A;  3HY2 A;  4JED A;  3LFL A;  3CTF A;  2HXK A;  5HR1 A;  1JLV A;  3W6G A;  3IV4 A;  3CSH A;  1QGV A;  2X99 A;  3M0F A;  4KA0 A;  1FVJ A;  5FHI A;  1X5E A;  4J56 E;  3F3Q A;  4O7H A;  1YKA A;  2CV4 A;  2GVP A;  4HI7 A;  1EV4 A;  1A8L A;  4IKH A;  1OKD A;  4ECJ A;  5AIS A;  2FLS A;  3MNG A;  3APS A;  4WF5 A;  4G10 A;  4OO4 A;  2PBJ A;  3GKN A;  4TOP A;  2YN1 A;  2LJA A;  1KNG A;  1ABA A;  3BBY A;  2CVD A;  2VOC A;  3VWX A;  4Q5N A;  1DUG A;  3ERF A;  2O8V B;  4KW6 A;  3BCI A;  3QAW A;  1X9S B;  4D73 B;  3P8W A;  5KN2 A;  2GT5 A;  4TVE A;  3LQ7 A;  2VL3 A;  3ZRE A;  4RUV A;  1DSB A;  4GXZ A;  3M9K A;  4WKW A;  3H8Q A;  4BA7 A;  3IK7 A;  1F37 A;  4POM A;  4NHW A;  3PH9 A;  3TOT A;  4K2D A;  2VCW A;  1EGR A;  2XC2 A;  5DBQ A;  2GZP A;  1GSE A;  4DVC A;  4MH3 A;  2R6K A;  2C3T A;  2FWF A;  3JCM L;  1QUW A;  4K9Z A;  5CAX A;  5IOX A;  4MJE A;  1SJZ A;  1ZCP A;  3BD2 A;  3RHB A;  3GV1 A;  3LSZ A;  1SU9 A;  3G7Y A;  3VLN A;  4F82 A;  3FR6 A;  1CQH A;  1B9Y C;  2OE1 A;  3ZFL A;  1SYX A;  3HZ4 A;  4X1U A;  2H70 A;  4ZIL A;  1X9M B;  3GIX A;  4DEJ A;  4PQI A;  2HYX A;  4NV5 A;  4G2E A;  2VL2 C;  1SKS B;  2B5E A;  3FKF A;  5IPH A;  3SBC A;  1PKZ A;  3F4S A;  1TTZ A;  3ZL5 A;  3ZVJ A;  1UN2 A;  7GSS A;  2VCZ A;  3TRQ A;  2YV7 A;  3DD3 A;  3FYG A;  6GSW A;  3A2W A;  11GS A;  4IW9 A;  3UAP A;  4EC0 A;  4PUA A;  2ON5 A;  1GTB A;  5ECH B;  4MJC A;  2FUG 2;  3HJP A;  5H5Q A;  3QOU A;  5IIZ A;  2H0G A;  2PER A;  3EUR A;  1WP0 A;  2CX4 A;  3KEB A;  2RUE A;  3RHC A;  1K0C A;  4K6X A;  5ID2 B;  3WGD A;  2IPA A;  2IME A;  1G0T A;  4I97 A;  1O7U A;  1ST9 A;  4MZW A;  4YQV A;  3CTG A;  3ZVJ D;  4NAX A;  1GSF A;  3ZMK A;  5ECO B;  4ML1 A;  1K0N A;  4KAE A;  5DVB A;  4JRR A;  2H74 A;  2MBS A;  3GYK A;  4V2M A;  1Y6E A;  1BAY A;  1YY7 A;  2NTO A;  2NBS A;  3VFI A;  5IMZ A;  3FR3 A;  4N0Z A;  5CRW A;  1YF0 A;  3CSJ A;  5CNW A;  5IO2 A;  1VF1 A;  3HA9 A;  4TR3 A;  5E4W A;  1MTC A;  5ECI B;  4ZB8 A;  1GP1 A;  4GSS A;  4V2N A;  1FG4 A;  1K3L A;  2FWE A;  3ZFB A;  1Z5Y E;  1V40 A;  4HJM A;  2H6X A;  2L6D A;  3VPT A;  5J5N A;  1MDI A;  3NIV A;  2VIM A;  1F2E A;  2CA8 A;  1YQ1 A;  1ZMA A;  3DYR A;  1DE1 A;  1WJK A;  2KLX A;  3GRX A;  1VF2 A;  5G5F A;  2DBC A;  1K0A A;  2YOI A;  4DSS B;  1ERW A;  2H1A A;  3KP8 A;  1IYH A;  4EUY A;  1PRX A;  1EOG A;  3VI7 A;  3LEF A;  2G0F A;  1XZO A;  2AAW A;  2GDR A;  1M2A A;  5IQY A;  1SEN A;  1WMJ A;  3F8U A;  1OC9 B;  1GH2 A;  4IHU A;  2B5X A;  4J57 E;  2RM5 A;  2GLR A;  4IEL A;  2VD1 A;  4MJA A;  4F0B A;  2IFQ B;  3BOA A;  3G7I A;  2X8G A;  4I6X A;  4H86 A;  2OBK A;  3VK9 A;  4CDO A;  2LS5 A;  4DSQ A;  2R2J A;  3EMP A;  4GRF A;  5GSS A;  4LL1 B;  2V41 A;  3MWH A;  4KB3 A;  3KD0 A;  3WGE A;  4OFM A;  5DJL A;  3TKQ A;  3GUR A;  2GQM A;  1V57 A;  2EIQ A;  3TB2 A;  4MCU A;  1FAA A;  4OD7 A;  5C04 A;  1I9D A;  3LYP A;  3J7Y k;  1GNE A;  4MF5 A;  1SL2 B;  2DJK A;  4EL1 A;  4DSS A;  4TKY A;  2KHP A;  3GL3 A;  3O6T A;  3VWW A;  4WXT A;  4JZQ A;  3KP9 A;  3Q19 A;  3QAG A;  5J9B A;  4FYU A;  2PUK C;  4PQ1 A;  3IC4 A;  3QFB C;  1EV9 A;  1TXX A;  5ECM B;  4XHM A;  4EDY A;  2J23 A;  4OCF A;  2OA7 A;  3DVW A;  3FW2 A;  2N5F A;  4ILF A;  4BL7 A;  3K8N A;  1IYI A;  2FA8 A;  3QCP A;  2IFQ A;  2XPD A;  4TR4 A;  5JCG A;  2JZT A;  3D0Z A;  2CVB A;  1KTE A;  2H1G A;  3GH6 A;  4XRA A;  5EL8 A;  4JU5 A;  4AJ7 A;  5G30 A;  4PX1 A;  3HYP A;  1GUM A;  2HNL A;  1O81 A;  2JU5 A;  5CO3 A;  2XPE A;  9GSS A;  3QDN A;  2QGV A;  3FK8 A;  4Q5F A;  3E0U A;  1XCC A;  5A4W A;  1PX6 A;  1XW5 A;  5EPF A;  4MMM A;  3RAZ A;  3F6D A;  1F3B A;  1TI3 A;  1EGO A;  17GS A;  4ZL8 A;  1XWG A;  2YWM A;  5L71 A;  1K0B A;  3ME7 A;  3HXS A;  2LRN A;  3TGZ A;  5JCU A;  3QPM A;  2LRC A;  1AW9 A;  1AC1 A;  3ERW A;  1U87 A;  1PA3 A;  2XHF A;  4GWR A;  1GTA A;  4MZB A;  5D8I A;  4F03 A;  1PD2 1;  1V9W A;  3S9F A;  1XWA A;  3TOU A;  2H6Z A;  1Z7P A;  1SKW B;  1BG5 A;  2C3N A;  2WJU A;  3L9U A;  5DDL A;  3F63 A;  2JSY A;  4BVY A;  2C80 A;  2MMN A;  6GSV A;  1XOB A;  2VL9 A;  20GS A;  2LKU A;  5B8A A;  1G6W A;  2ZUP A;  3EU3 A;  1SJ6 A;  1XVQ A;  2DIY A;  3ERG A;  6GSX A;  1GSY A;  3LG6 A;  1TDI A;  2V32 A;  1DBY A;  5FWG A;  5ECK B;  4MAB A;  1F6M C;  1AQX A;  1HYU A;  2H19 A;  3C8E A;  2IMF A;  4WR4 A;  5B8B A;  2F9S A;  4XTS A;  3FRC A;  1G7O A;  2ALB A;  1I5G A;  2FNO A;  4POL A;  1ILO A;  1K0D A;  4KSM A;  3LJR A;  2YWN A;  2OAD A;  3C1S A;  2HSY A;  1Z3E A;  4RQX A;  2MMA A;  3KTL A;  4QL9 A;  1B48 A;  3D22 A;  5F07 A;  4JBB A;  2WRT A;  4KDU A;  22GS A;  6GSY A;  2B1L A;  3LXZ A;  1M9B A;  4GQC A;  4F9Z A;  4YAP A;  2F8A A;  5AN1 A;  2N5B A;  4RI7 A;  3D4M A;  2CAI A;  1QFN A;  4J2F A;  5AIV A;  2VLT A;  4XS1 A;  5JWR B;  6GSS A;  3TJB A;  5KN0 A;  4ZBA A;  1B8X A;  3HDC A;  1RK4 A;  3N9J A;  1G6Y A;  1URM A;  2H0I A;  2P5Q A;  3L4N A;  4LLR A;  1A0F A;  1J9B A;  2X8H A;  1S3A A;  2NDO A;  1XFL A;  2MBT A;  1LU4 A;  3VI5 A;  3W8S A;  1YJ6 A;  4K7O A;  3VPQ A;  3ISO A;  4F2I A;  4XS4 A;  2LUS A;  1YZX A;  1O73 A;  2PU9 C;  2H66 A;  1HNB A;  4X0X A;  3LOR A;  2GTU A;  1M7T A;  3RDW A;  4E8E A;  5CRH A;  1GUL A;  2A4V A;  1T4Z A;  3IE3 A;  2V2G A;  2GST A;  2VO4 A;  4ZBD A;  4MF6 A;  3GN3 A;  2GZY A;  5CRE A;  3UJ1 A;  4AJ8 A;  3ZML A;  4MF7 A;  1W4V A;  1R5P A;  5GAP D;  2D2Z A;  1SL0 B;  3PIN A;  5B6N A;  5HR2 A;  2VUP A;  1TRS A;  1W89 A;  1PGT A;  2VAF A;  1LJR A;  2AV4 A;  4OFN A;  1KEB A;  3C73 A;  2VLU A;  2IMK A;  2IN3 A;  2KP2 A;  1A2M A;  2YWI A;  1AAZ A;  3RBT A;  5D9X A;  3KCM A;  3HZ8 A;  1XOA A;  3EE2 A;  6GSU A;  1BJX A;  2IMI A;  3WT1 A;  3AY8 A;  4YQU A;  4AJ6 A;  2H01 A;  2E2M A;  3C1R A;  5ECQ B;  3D6I A;  4HQZ A;  4IS0 A;  3PGT A;  1OAZ A;  2FA4 A;  3TJG A;  1HD2 A;  1U88 A;  4YH2 A;  2CVK A;  4L0W A;  1WWJ A;  2K9F A;  3ZIJ A;  4PXO A;  1ML6 A;  4WBJ A;  1SJI A;  3QAV A;  4HU9 A;  4K1F A;  4AGS A;  1JZO A;  5LCZ A;  5G1L A;  1M2B A;  3ZRD A;  1XWB A;  2QSI A;  1JHB A;  3F4T A;  4XS6 A;  5KEJ A; 
#chains in the Genus database with same CATH topology
 2I3Y A;  3N5O A;  4I2U A;  3UVT A;  3ME8 A;  1EP8 A;  1SL1 B;  2OAC A;  3EVI A;  4BPY A;  3P90 A;  1FO5 A;  3WT2 A;  1YEP A;  2C0F A;  2KP1 A;  2QA1 A;  4JR4 A;  3DRN A;  4IGJ A;  4ML6 A;  1XIY A;  3EU4 A;  1FOV A;  2GS3 A;  5IMA A;  3G7J A;  3TUE A;  3I9V 2;  5ABR A;  2G2Q A;  4GQF A;  1OE7 A;  4L5O A;  1M9A A;  3TRP A;  1GLP A;  4N0V A;  4MK3 A;  4HUA A;  1N2A A;  1E6B A;  2DJ3 A;  2X64 A;  1VGL A;  2EC4 A;  2FY6 A;  4G9H A;  4EXJ A;  1BYE A;  4EKZ A;  2LQO A;  4E8H A;  3DXB A;  1XW9 A;  2HRA A;  2CX3 A;  3DEX A;  5D9W A;  5AIX A;  2A2P A;  2M72 A;  1RQM A;  1QK8 A;  2OE3 A;  4ZBB A;  4V2L A;  4IP6 A;  2GT6 A;  1O85 A;  2VCX A;  1XVW A;  1A0R P;  3KJY A;  5HR0 A;  1XWC A;  2WGR A;  2L5O A;  3ZIT A;  2MMO A;  4PUR A;  4TXO A;  2TRX A;  4L0U A;  3SWL A;  2R37 A;  2L5L A;  4MA9 A;  3F6F A;  1QMV A;  2L4Q A;  2IJY A;  3M3M A;  2LJR A;  3I43 A;  4WR5 A;  1OE8 A;  1OVN A;  3FZ4 A;  4FQU A;  5HFK A;  1EP7 A;  3GST A;  3D5J A;  3DGQ A;  3I6A A;  2IL3 A;  1M2D A;  3HCZ A;  4GST A;  1MDJ A;  1Z9H A;  4BVX B;  3KH9 A;  3IHG A;  3KH7 A;  4KCE A;  2XBI A;  3F3R A;  4FH8 A;  4MPG A;  5KN1 A;  4ZIJ A;  3BCK A;  3ZLP A;  3M1G A;  4AF2 A;  4EE0 A;  1FB0 A;  3IHQ A;  4N10 A;  5H5S A;  3APO A;  5G2Z A;  19GS A;  4ECC A;  3KIJ A;  3TKS A;  1PN9 A;  1USB A;  1OC8 A;  4O32 A;  4IQA A;  3TKR A;  4KDY A;  1GTU A;  1R7H A;  3A2V A;  4EO3 A;  4MDC A;  1AQV A;  1RW1 A;  4HZ4 A;  4NMU A;  5J4U A;  2YWO A;  4O5R A;  2EIR A;  5JWO B;  1R5A A;  1B4Q A;  5IPG A;  4K7N A;  3VWU A;  1T3B A;  5J41 A;  3HHV A;  3A5W A;  4Z2R A;  2PVO C;  2B6M A;  1Z6N A;  3HVV A;  1FVK A;  4O5Q A;  1T1V A;  4Z2T A;  2JSZ A;  5DAL B;  2YAN A;  3CYN A;  3EYT A;  1U6T A;  3CMI A;  3NOF A;  2LEG A;  2F8F A;  3FZ5 A;  1ZOF A;  4CHS A;  2R3X A;  1S3C A;  3LWA A;  1AIU A;  2LNT A;  3F0I A;  2AJQ B;  2EIO A;  2GZZ A;  4BVX A;  1S3D A;  2FWG A;  3WGX A;  2DJ0 A;  4TW5 A;  3HVN A;  2PGT A;  2ON7 A;  4I8B A;  3Q6O A;  16GS A;  3US3 A;  1GWC A;  1UVZ A;  2XBQ A;  1XPV A;  3GKX A;  5ENU A;  2CQ9 A;  1GSS A;  5F0G A;  3DIE A;  1EEM A;  1K0M A;  1GSQ A;  1VF4 A;  1WOU A;  1THX A;  3GX0 A;  4NV2 A;  1WRY A;  3ED3 A;  3GNJ A;  4KND A;  1BED A;  1MD4 A;  4XIH A;  2IWT A;  2VM2 A;  1ZYN A;  4PQH A;  3L9V A;  1O8X A;  3EIN A;  4LMV A;  3RPN A;  3F9U A;  4CW9 A;  5DAL A;  3LYK A;  4QQ7 A;  1PKW A;  3KTB A;  2K8S A;  3IOS A;  1AUC A;  4PNF A;  4PNG A;  2O89 A;  1A2J A;  3R2Q A;  2YJH A;  4TRX A;  2L4C A;  2C0G A;  4OCE A;  5HFI A;  5B6M A;  2CZ2 A;  2LRT A;  4F0C A;  2DML A;  2NVL A;  1XWK A;  2PN8 A;  1V58 A;  1GUK A;  1SKR B;  3VUR A;  3FMW A;  5F05 A;  5G5E A;  1J08 A;  1V98 A;  2H72 A;  2V6O A;  4RI6 A;  4I5Q A;  3DKS A;  3FR9 A;  2HI7 A;  2GGT A;  3EC3 A;  4XS4 B;  3EMX A;  1O8W A;  4MNN A;  3O3T A;  5INY A;  1ZYP A;  1R4W A;  2I1U A;  1K3Y A;  1SK1 A;  2PPT A;  1QQ2 A;  3WYW A;  1TRV A;  4IP1 A;  1PL1 A;  3CXG A;  3P7X A;  3Q74 A;  2VCT A;  2C3Q A;  3M8N A;  1THO A;  5GAN D;  4KGI A;  2AYT A;  4FYC A;  5F06 A;  1ERU A;  3IA1 A;  1TK8 B;  2CZ3 A;  2UZ8 A;  2LJK A;  3OR5 A;  5DCH A;  4YQM A;  1JFU A;  3ZYW A;  2JAC A;  3GKM A;  1A24 A;  2P31 A;  2X49 A;  3CRT A;  2OBI A;  4JR6 A;  1PN0 A;  3IK9 A;  1MEK A;  1C72 A;  1GTI A;  2HRK A;  3UL3 A;  3E9J B;  1O6J A;  4KH7 A;  4FIW A;  3IRA A;  1HNA A;  5DAK B;  4ID0 A;  2HRF A;  5IO0 A;  5D96 A;  5LD0 A;  4TR1 A;  4EDZ A;  1F9M A;  2H1B A;  5KN3 A;  2TIR A;  3U6V A;  3QMX A;  4ECI A;  2V6K A;  4MPF A;  1NW2 A;  4I2T A;  2E7P A;  3APQ A;  4POK A;  4K0G A;  4O92 A;  3HD5 A;  2YZH A;  4TR0 A;  4ZXG A;  2YCD A;  5B7C A;  2WS2 A;  3MIX A;  1TP9 A;  3HKR A;  5ECL B;  5J9C A;  1NHY A;  5D93 A;  3IAS 2;  1WPI A;  1AQW A;  1TOF A;  5A4U A;  4G19 A;  2DKI A;  4N11 A;  3IBH A;  1ERT A;  3L78 A;  2H8L A;  5IM9 A;  4Z7X A;  2C1Y A;  2AUV A;  1BX9 A;  2DMM A;  1M99 A;  3IAM 2;  5DJM A;  5CRG A;  3H79 A;  2VCV A;  5HR3 A;  4K0N A;  5EY6 A;  1ON4 A;  2OE0 A;  2HZE A;  3TCO A;  1ZYE A;  4BWQ A;  2JAD A;  4MJB A;  1EZK A;  2M80 A;  1BQ7 A;  2R0G A;  1SK2 A;  4GCI A;  3GA4 A;  2DIZ A;  2QKE A;  4MH2 A;  1MD3 A;  3M9J A;  5DAK A;  1TKD B;  2E0Q A;  2VLV A;  1SK0 A;  1UA5 A;  3CQF A;  2L57 A;  1TW9 A;  4OWY A;  4N30 A;  2RM6 A;  1PMT A;  4LA1 A;  2WUL A;  3DWV A;  1A23 A;  2REM A;  3IDV A;  1X5D A;  2DSA A;  3TKP A;  2VCQ A;  4L5L A;  2JL4 A;  4KUN A;  2QC7 A;  1XW6 A;  10GS A;  2ZNM A;  3TRX A;  2NPB A;  2YJ7 A;  1EWX A;  3KM6 A;  5DQY A;  3UVH A;  2GQK A;  3HVS A;  3CBU A;  3FHK A;  4USS A;  4GSN A;  1ACV A;  2FHE A;  1JLW A;  2C0E A;  1VF3 A;  2A4H A;  1JZD A;  4ZB9 A;  5CRD A;  5IMC A;  4TN8 A;  4DSR A;  3C7M A;  4XCS A;  1WIK A;  3QFA C;  5EVO A;  2F51 A;  3KMN A;  4POB A;  4KX4 A;  1H4O A;  1ZGN A;  4ISD A;  5G1K A;  3L0H A;  4YAV A;  3WD6 A;  3UOM A;  2B3S A;  1B9X C;  1ZL9 A;  4HJ2 A;  1UC7 A;  1TU7 A;  4TXO B;  2GQL A;  4MLY A;  2F3M A;  3ZZX A;  5D9V A;  1PSQ A;  2K8V A;  4MP4 A;  3KXO A;  1TJD A;  1XG8 A;  3MSZ A;  2YPM A;  4D73 A;  5G31 A;  3DML A;  4HDE A;  3UIW A;  5E59 A;  2GSQ A;  2B1K A;  4K7I A;  4PGT A;  3MAK A;  4IN0 A;  1XXU A;  2VL2 A;  5CYY A;  4K8M A;  4ECB A;  2DJ2 A;  1M3I A;  3LGC A;  3O76 A;  2FCH A;  2A2R A;  4P3Y B;  3KMO A;  3G9B A;  3GHA A;  14GS A;  1HQO A;  5DQS A;  3V1W A;  5C00 A;  5ELG A;  2PMT A;  2CT6 A;  3GH9 A;  1MDK A;  3VWV A;  1DE2 A;  3A2X A;  3HVX A;  1T4Y A;  2MMZ A;  3F4R A;  2DJJ A;  3LXT A;  1YKC A;  2H71 A;  4Q5Q A;  3FY7 A;  3FEU A;  2I81 A;  4KSO A;  2H75 A;  2MZC A;  4CY8 A;  2HLS A;  4ZB6 A;  3PR8 A;  1J0F A;  1KBN A;  2IMD A;  3CRU A;  2FGX A;  1GNW A;  5JCW A;  3Q18 A;  4FYB A;  2GSS A;  2BJX A;  1EOH A;  2C8U A;  2OKA A;  3IPZ A;  4EF0 A;  2K6V A;  5ECN B;  3GX8 A;  1GSU A;  2A2S A;  3TJK A;  3DVX A;  1SYR A;  2WZ9 A;  4L8E A;  1N8J A;  3R3E A;  2CAQ A;  5F8B A;  4BWS A;  1TI1 A;  1H75 A;  1K3O A;  4EVM A;  2H6Y A;  4V1A p;  2O7K A;  4A5P A;  2DLX A;  3GUS A;  1JZR A;  2R5G A;  4OO5 A;  1M0U A;  2BTO T;  3TKS C;  2ZCT A;  3GSS A;  1NHO A;  3UEM A;  1AXD A;  8GSS A;  1FW1 A;  5A5K A;  2WDU A;  4K5R A;  4KCA A;  1TU8 A;  4MZC A;  5ECP B;  1TRU A;  1TK5 B;  2K18 A;  1PL2 A;  2WB9 A;  4LL4 B;  4WEY A;  3A3T A;  1Q98 A;  3TDG A;  3GTU B;  2DJ1 A;  1FHE A;  2WFC A;  1XBS A;  5HFG A;  1Y25 A;  5ID2 A;  3C71 A;  3QR6 A;  2V1M A;  2B7K A;  1OC3 A;  3UBK A;  2LST A;  1EEJ A;  5D73 A;  3HJO A;  4ACS A;  1PQN A;  4HOJ A;  1CQG A;  2H1D A;  1X0R A;  2TRC P;  1B4P A;  5GZZ B;  3H93 A;  1X9W B;  5ELA A;  3UBL A;  1QXH A;  3U5R E;  1Z7R A;  1TRW A;  3RPP A;  4HU7 A;  3J7Y b;  3MDK A;  4WET A;  4IJI A;  4OMV A;  4HEA 2;  1TK0 B;  1NSW A;  2PWJ A;  18GS A;  2VD0 A;  3HJM A;  2ES7 A;  1SD9 A;  2H30 A;  4GLT A;  2HE3 A;  5ECS A;  1Z6M A;  4X4J A;  4NXI A;  2C0D A;  2O87 A;  5GST A;  2RLI A;  2X4A A;  2R0C A;  1A8Y A;  2MYG A;  3EPT A;  4JE1 A;  1WE0 A;  2O85 A;  1OKT A;  2L6C A;  3BJ5 A;  3TJJ A;  1SD8 A;  4X43 A;  5IMV A;  3W8J A;  5CP1 A;  4OFT A;  4BIK A;  4ZL9 A;  1YDK A;  5LNK e;  3H1N A;  2B7J A;  4HS1 A;  1VRS D;  4EIP A;  5H5R A;  4Q5R A;  4ULX A;  2L59 A;  2HFD A;  2JZS A;  3GTU A;  1GL8 A;  3P2A A;  4FO5 A;  5BMU A;  5J3R A;  1V2A A;  2HSH A;  3IXR A;  5ECR B;  2M46 A;  3FZA A;  1GLQ A;  1FB6 A;  1F3A A;  1A2L A;  4QL7 A;  1OC9 A;  3TJF A;  1FOH A;  4LMW A;  5COH A;  3PPU A;  3FZ9 A;  1YEX A;  4WF4 A;  3UMA A;  3H4K A;  2N5A A;  1ZYQ B;  2I9H A;  4YKG A;  1R26 A;  4PUF C;  4V1A g;  4WBR D;  4HZ2 A;  2X8C A;  1NM3 A;  2DC5 A;  3KZQ A;  2I4A A;  2AB6 A;  2KOK A;  4IQ1 A;  2LQQ A;  3IR4 A;  2R4V A;  4IBP A;  2WCI A;  1HNC A;  4GTU A;  4TXV A;  2YP6 A;  1G7E A;  1PFO A;  4HQS A;  3ZTL A;  2RUF A;  3GMF A;  3EWL A;  12GS A;  2Z9S A;  2PVQ A;  2LNS A;  2H73 A;  4K2X A;  3I69 A;  4TR1 B;  1U3I A;  3D4T A;  2P5R A;  5JWQ B;  1YF1 A;  2KUC A;  3GFK A;  1OYJ A;  2H0H A;  1T8E B;  13GS A;  5IOW A;  4IVF A;  2HRN A;  4IJ3 A;  5IMF A;  2VM1 A;  1E2Y A;  3ZIV A;  2P0G A;  2H76 A;  1LBK A;  5HQP A;  1K0O A;  1GRX A;  3CSI A;  2OJL A;  2JZR A;  2YZU A;  3GKK A;  2FWH A;  5A4V A;  1S3R A;  4RQR A;  5DCG A;  1ERV A;  2HT9 A;  3L9S A;  1T00 A;  2FD3 A;  2J9H A;  1T7P B;  2GSR A;  3QD9 A;  2E2G A;  2AHE A;  3E3E A;  2YV9 A;  1GUH A;  4GF0 A;  2BMX A;  5AGY A;  4ZL7 A;  4XRD A;  4NHZ A;  3UAR A;  1Q4J A;  1GSD A;  1ZZY A;  2HZF A;  2HZE B;  3D21 A;  4ICY A;  2RII A;  3KGK A;  2B5Y A;  1JZW A;  2C4J A;  5IMD A;  1PX7 A;  4NPB A;  2LV3 A;  4KDX A;  4NWY A;  1X5C A;  2IIY A;  4KE3 A;  6GST A;  5FT3 A;  3NZN A;  2LTK A;  3GL5 A;  2YNX A;  3TKS E;  1U3A A;  4Z2U A;  5D9T A;  3HY2 A;  4JED A;  3LFL A;  3CTF A;  2HXK A;  5HR1 A;  2HSM A;  1JLV A;  3W6G A;  3IV4 A;  3CSH A;  1QGV A;  2X99 A;  3M0F A;  4KA0 A;  1FVJ A;  5FHI A;  1X5E A;  4J56 E;  3F3Q A;  4O7H A;  1YKA A;  2CV4 A;  2GVP A;  4HI7 A;  1EV4 A;  1A8L A;  4IKH A;  1OKD A;  4ECJ A;  5AIS A;  2FLS A;  3MNG A;  3APS A;  4WF5 A;  4G10 A;  4OO4 A;  2PBJ A;  3GKN A;  4TOP A;  2YN1 A;  2LJA A;  3A5I A;  1KNG A;  1ABA A;  3BBY A;  2CVD A;  2VOC A;  3VWX A;  5KOX A;  4Q5N A;  1DUG A;  3ERF A;  2O8V B;  4KW6 A;  3BCI A;  3QAW A;  1X9S B;  4D73 B;  3P8W A;  5KN2 A;  2GT5 A;  4TVE A;  3LQ7 A;  2VL3 A;  3ZRE A;  4RUV A;  1DSB A;  4GXZ A;  3M9K A;  4WKW A;  3H8Q A;  4BA7 A;  3IK7 A;  1F37 A;  4POM A;  4NHW A;  3PH9 A;  3TOT A;  4K2D A;  2VCW A;  1EGR A;  2XC2 A;  5DBQ A;  2GZP A;  1GSE A;  4DVC A;  4MH3 A;  2R6K A;  2C3T A;  2FWF A;  3JCM L;  1QUW A;  4K9Z A;  5CAX A;  5IOX A;  4MJE A;  1SJZ A;  1ZCP A;  3BD2 A;  3RHB A;  3GV1 A;  3LSZ A;  1SU9 A;  3G7Y A;  3VLN A;  4F82 A;  3FR6 A;  1CQH A;  1B9Y C;  2OE1 A;  3ZFL A;  1SYX A;  3HZ4 A;  4X1U A;  2H70 A;  4ZIL A;  1X9M B;  3GIX A;  4DEJ A;  4PQI A;  2HYX A;  4NV5 A;  4G2E A;  2VL2 C;  1SKS B;  2B5E A;  3FKF A;  5IPH A;  3SBC A;  1PKZ A;  3F4S A;  1TTZ A;  3ZL5 A;  3ZVJ A;  1UN2 A;  7GSS A;  2VCZ A;  3TRQ A;  2YV7 A;  3DD3 A;  3FYG A;  6GSW A;  3A2W A;  11GS A;  4IW9 A;  3UAP A;  4EC0 A;  4PUA A;  2ON5 A;  1GTB A;  5ECH B;  4MJC A;  2FUG 2;  3HJP A;  5H5Q A;  3QOU A;  5IIZ A;  2H0G A;  2PER A;  3EUR A;  1WP0 A;  2CX4 A;  3KEB A;  2RUE A;  3RHC A;  4K5S A;  1K0C A;  4K6X A;  5ID2 B;  3WGD A;  2IPA A;  2IME A;  1G0T A;  4I97 A;  1O7U A;  1ST9 A;  4MZW A;  4YQV A;  3CTG A;  3ZVJ D;  4NAX A;  1GSF A;  3ZMK A;  5ECO B;  4ML1 A;  3IC8 A;  1K0N A;  4KAE A;  5DVB A;  4JRR A;  2H74 A;  2MBS A;  3GYK A;  4V2M A;  1Y6E A;  1BAY A;  1YY7 A;  2R0P A;  2NTO A;  2NBS A;  3VFI A;  5IMZ A;  3FR3 A;  4N0Z A;  5CRW A;  1YF0 A;  3CSJ A;  5CNW A;  5IO2 A;  1VF1 A;  3HA9 A;  4TR3 A;  5E4W A;  1MTC A;  5ECI B;  4ZB8 A;  1GP1 A;  4GSS A;  4V2N A;  1FG4 A;  1K3L A;  2FWE A;  3ZFB A;  1Z5Y E;  1V40 A;  4HJM A;  2H6X A;  4HSC X;  2L6D A;  3VPT A;  5J5N A;  1MDI A;  3NIV A;  2VIM A;  2QA2 A;  1F2E A;  2CA8 A;  1YQ1 A;  1ZMA A;  3DYR A;  1DE1 A;  4G0L A;  1WJK A;  2KLX A;  3GRX A;  1VF2 A;  5G5F A;  2DBC A;  1K0A A;  2YOI A;  4DSS B;  1ERW A;  2H1A A;  3KP8 A;  1IYH A;  4EIQ A;  4EUY A;  1PRX A;  1EOG A;  3VI7 A;  3LEF A;  2G0F A;  1XZO A;  2AAW A;  2GDR A;  1M2A A;  5IQY A;  1SEN A;  1WMJ A;  3F8U A;  1OC9 B;  1GH2 A;  4IHU A;  2B5X A;  4J57 E;  2RM5 A;  4BL7 B;  2GLR A;  4IEL A;  2VD1 A;  4MJA A;  4F0B A;  2IFQ B;  3BOA A;  3G7I A;  2X8G A;  4I6X A;  4H86 A;  2OBK A;  3VK9 A;  4CDO A;  2LS5 A;  4DSQ A;  2R2J A;  3EMP A;  4GRF A;  5GSS A;  4YKF A;  4LL1 B;  2V41 A;  3MWH A;  5KOW A;  4KB3 A;  3KD0 A;  3WGE A;  4OFM A;  5DJL A;  3TKQ A;  3MYD A;  3GUR A;  2GQM A;  2DKH A;  1V57 A;  2EIQ A;  3TB2 A;  4MCU A;  1FAA A;  4OD7 A;  5C04 A;  1I9D A;  3LYP A;  3J7Y k;  1GNE A;  1M3J A;  4MF5 A;  1SL2 B;  2DJK A;  4EL1 A;  4DSS A;  4TKY A;  2KHP A;  3GL3 A;  3O6T A;  3VWW A;  4WXT A;  4JZQ A;  3KP9 A;  3Q19 A;  3QAG A;  5J9B A;  4FYU A;  2PUK C;  4PQ1 A;  3IC4 A;  3QFB C;  1EV9 A;  1TXX A;  5ECM B;  4XHM A;  4EDY A;  2J23 A;  4OCF A;  2OA7 A;  3DVW A;  3FW2 A;  2N5F A;  4ILF A;  4BVY B;  4BL7 A;  3K8N A;  1IYI A;  2FA8 A;  3QCP A;  2IFQ A;  4O5U A;  2XPD A;  4TR4 A;  5JCG A;  2JZT A;  3D0Z A;  2CVB A;  1KTE A;  2H1G A;  3GH6 A;  4XRA A;  5EL8 A;  4JU5 A;  4AJ7 A;  5G30 A;  4PX1 A;  3HYP A;  1GUM A;  2HNL A;  1O81 A;  2JU5 A;  5CO3 A;  2XPE A;  9GSS A;  3QDN A;  2QGV A;  3FK8 A;  4Q5F A;  3E0U A;  1XCC A;  5A4W A;  1PX6 A;  1XW5 A;  5EPF A;  4MMM A;  3RAZ A;  3F6D A;  1F3B A;  1TI3 A;  1EGO A;  17GS A;  4ZL8 A;  1XWG A;  2YWM A;  4PTS A;  5L71 A;  1K0B A;  3ME7 A;  3HXS A;  2LRN A;  3TGZ A;  5JCU A;  3QPM A;  2LRC A;  1AW9 A;  1AC1 A;  3ERW A;  1U87 A;  1PA3 A;  2XHF A;  4GWR A;  1GTA A;  4MZB A;  5D8I A;  4F03 A;  1PD2 1;  1V9W A;  3S9F A;  1XWA A;  3TOU A;  2H6Z A;  1Z7P A;  1SKW B;  1BG5 A;  2C3N A;  2WJU A;  3L9U A;  5DDL A;  3F63 A;  2JSY A;  4BVY A;  2C80 A;  2MMN A;  6GSV A;  1XOB A;  2VL9 A;  20GS A;  2LKU A;  5B8A A;  1G6W A;  2ZUP A;  3EU3 A;  1SJ6 A;  1XVQ A;  2DIY A;  3ERG A;  6GSX A;  1GSY A;  3LG6 A;  1TDI A;  2V32 A;  1DBY A;  5FWG A;  5ECK B;  4MAB A;  1F6M C;  1AQX A;  1HYU A;  2H19 A;  3C8E A;  2IMF A;  4WR4 A;  5B8B A;  2F9S A;  4XTS A;  3FRC A;  1G7O A;  2ALB A;  1I5G A;  2FNO A;  4POL A;  1ILO A;  1K0D A;  4KSM A;  3LJR A;  2YWN A;  2OAD A;  3C1S A;  2HSY A;  1Z3E A;  4RQX A;  2MMA A;  3KTL A;  4QL9 A;  1B48 A;  3D22 A;  5F07 A;  4JBB A;  2WRT A;  4KDU A;  22GS A;  6GSY A;  2B1L A;  3LXZ A;  1M9B A;  4GQC A;  4F9Z A;  4YAP A;  4CY6 A;  2F8A A;  5AN1 A;  2N5B A;  4RI7 A;  3D4M A;  2CAI A;  1QFN A;  3LW9 A;  4J2F A;  5AIV A;  2VLT A;  4XS1 A;  5JWR B;  6GSS A;  3TJB A;  5KN0 A;  4ZBA A;  1B8X A;  3HDC A;  1RK4 A;  3N9J A;  1G6Y A;  4G0K A;  1URM A;  2H0I A;  2P5Q A;  3L4N A;  4LLR A;  1A0F A;  1J9B A;  2X8H A;  1S3A A;  2NDO A;  1XFL A;  2MBT A;  1LU4 A;  3VI5 A;  3W8S A;  1YJ6 A;  4K7O A;  3VPQ A;  3ISO A;  4F2I A;  4XS4 A;  2LUS A;  1YZX A;  1O73 A;  2PU9 C;  2H66 A;  1HNB A;  4X0X A;  3LOR A;  2GTU A;  1M7T A;  3RDW A;  4E8E A;  5CRH A;  1GUL A;  2A4V A;  1T4Z A;  3IE3 A;  2V2G A;  2GST A;  2VO4 A;  4ZBD A;  4MF6 A;  3GN3 A;  2GZY A;  5CRE A;  3UJ1 A;  4AJ8 A;  3ZML A;  4MF7 A;  1W4V A;  5BRT A;  1R5P A;  5GAP D;  2D2Z A;  1SL0 B;  5B6N A;  3PIN A;  5HR2 A;  2VUP A;  1TRS A;  1W89 A;  1PGT A;  2VAF A;  1LJR A;  2AV4 A;  4OFN A;  1KEB A;  3C73 A;  2VLU A;  2IMK A;  2IN3 A;  4G0I A;  2KP2 A;  1A2M A;  2YWI A;  1AAZ A;  3RBT A;  5D9X A;  3KCM A;  3HZ8 A;  1XOA A;  3EE2 A;  6GSU A;  1BJX A;  2IMI A;  3WT1 A;  3AY8 A;  4YQU A;  4AJ6 A;  2H01 A;  2E2M A;  3C1R A;  5ECQ B;  3D6I A;  4HQZ A;  4IS0 A;  3PGT A;  1OAZ A;  2FA4 A;  3TJG A;  1HD2 A;  1U88 A;  4YH2 A;  2CVK A;  4L0W A;  1WWJ A;  2K9F A;  3ZIJ A;  4PXO A;  1ML6 A;  4WBJ A;  1SJI A;  3QAV A;  4HU9 A;  4K1F A;  4AGS A;  1JZO A;  5LCZ A;  4KF9 A;  5G1L A;  1M2B A;  3ZRD A;  1XWB A;  2QSI A;  1JHB A;  3F4T A;  4XS6 A;  5KEJ A; 
#chains in the Genus database with same CATH homology
 2I3Y A;  3N5O A;  4I2U A;  3UVT A;  3ME8 A;  1EP8 A;  1SL1 B;  2OAC A;  3EVI A;  4BPY A;  3P90 A;  1FO5 A;  3WT2 A;  1YEP A;  2C0F A;  2KP1 A;  2QA1 A;  4JR4 A;  3DRN A;  4IGJ A;  4ML6 A;  1XIY A;  3EU4 A;  1FOV A;  2GS3 A;  5IMA A;  3G7J A;  3TUE A;  3I9V 2;  5ABR A;  2G2Q A;  4GQF A;  1OE7 A;  4L5O A;  1M9A A;  3TRP A;  1GLP A;  4N0V A;  4MK3 A;  4HUA A;  1N2A A;  1E6B A;  2DJ3 A;  2X64 A;  1VGL A;  2EC4 A;  2FY6 A;  4G9H A;  4EXJ A;  1BYE A;  4EKZ A;  2LQO A;  4E8H A;  3DXB A;  1XW9 A;  2HRA A;  2CX3 A;  3DEX A;  5D9W A;  5AIX A;  2A2P A;  2M72 A;  1RQM A;  1QK8 A;  2OE3 A;  4ZBB A;  4V2L A;  4IP6 A;  2GT6 A;  1O85 A;  2VCX A;  1XVW A;  1A0R P;  3KJY A;  5HR0 A;  1XWC A;  2WGR A;  2L5O A;  3ZIT A;  2MMO A;  4PUR A;  4TXO A;  2TRX A;  4L0U A;  3SWL A;  2R37 A;  2L5L A;  4MA9 A;  3F6F A;  1QMV A;  2L4Q A;  2IJY A;  3M3M A;  2LJR A;  3I43 A;  4WR5 A;  1OE8 A;  1OVN A;  3FZ4 A;  4FQU A;  5HFK A;  1EP7 A;  3GST A;  3D5J A;  3DGQ A;  3I6A A;  2IL3 A;  1M2D A;  3HCZ A;  4GST A;  1MDJ A;  1Z9H A;  4BVX B;  3KH9 A;  3IHG A;  3KH7 A;  4KCE A;  2XBI A;  3F3R A;  4FH8 A;  4MPG A;  5KN1 A;  4ZIJ A;  3BCK A;  3ZLP A;  3M1G A;  4AF2 A;  4EE0 A;  1FB0 A;  3IHQ A;  4N10 A;  5H5S A;  3APO A;  5G2Z A;  19GS A;  4ECC A;  3KIJ A;  3TKS A;  1PN9 A;  1USB A;  1OC8 A;  4O32 A;  4IQA A;  3TKR A;  4KDY A;  1GTU A;  1R7H A;  3A2V A;  4EO3 A;  4MDC A;  1AQV A;  1RW1 A;  4HZ4 A;  4NMU A;  5J4U A;  2YWO A;  4O5R A;  2EIR A;  5JWO B;  1R5A A;  1B4Q A;  5IPG A;  4K7N A;  3VWU A;  1T3B A;  5J41 A;  3HHV A;  3A5W A;  4Z2R A;  2PVO C;  2B6M A;  1Z6N A;  3HVV A;  1FVK A;  4O5Q A;  1T1V A;  4Z2T A;  2JSZ A;  5DAL B;  2YAN A;  3CYN A;  3EYT A;  1U6T A;  3CMI A;  3NOF A;  2LEG A;  2F8F A;  3FZ5 A;  1ZOF A;  4CHS A;  2R3X A;  1S3C A;  3LWA A;  1AIU A;  2LNT A;  3F0I A;  2AJQ B;  2EIO A;  2GZZ A;  4BVX A;  1S3D A;  2FWG A;  3WGX A;  2DJ0 A;  4TW5 A;  2PGT A;  2ON7 A;  4I8B A;  3Q6O A;  16GS A;  3US3 A;  1GWC A;  1UVZ A;  2XBQ A;  1XPV A;  3GKX A;  5ENU A;  2CQ9 A;  1GSS A;  5F0G A;  3DIE A;  1EEM A;  1K0M A;  1GSQ A;  1VF4 A;  1WOU A;  1THX A;  3GX0 A;  4NV2 A;  1WRY A;  3ED3 A;  3GNJ A;  4KND A;  1BED A;  1MD4 A;  4XIH A;  2IWT A;  2VM2 A;  1ZYN A;  4PQH A;  3L9V A;  1O8X A;  3EIN A;  4LMV A;  3RPN A;  3F9U A;  4CW9 A;  5DAL A;  3LYK A;  4QQ7 A;  1PKW A;  3KTB A;  2K8S A;  3IOS A;  1AUC A;  4PNF A;  4PNG A;  2O89 A;  1A2J A;  3R2Q A;  2YJH A;  4TRX A;  2L4C A;  2C0G A;  4OCE A;  5HFI A;  5B6M A;  2CZ2 A;  2LRT A;  4F0C A;  2DML A;  2NVL A;  1XWK A;  2PN8 A;  1V58 A;  1GUK A;  1SKR B;  3VUR A;  3FMW A;  5F05 A;  5G5E A;  1J08 A;  1V98 A;  2H72 A;  2V6O A;  4RI6 A;  4I5Q A;  3DKS A;  3FR9 A;  2HI7 A;  2GGT A;  3EC3 A;  4XS4 B;  3EMX A;  1O8W A;  4MNN A;  3O3T A;  5INY A;  1ZYP A;  1R4W A;  2I1U A;  1K3Y A;  1SK1 A;  2PPT A;  1QQ2 A;  3WYW A;  1TRV A;  4IP1 A;  1PL1 A;  3CXG A;  3P7X A;  3Q74 A;  2VCT A;  2C3Q A;  3M8N A;  1THO A;  5GAN D;  4KGI A;  2AYT A;  4FYC A;  5F06 A;  1ERU A;  3IA1 A;  1TK8 B;  2CZ3 A;  2UZ8 A;  2LJK A;  3OR5 A;  5DCH A;  4YQM A;  1JFU A;  3ZYW A;  2JAC A;  3GKM A;  1A24 A;  2P31 A;  2X49 A;  3CRT A;  2OBI A;  4JR6 A;  1PN0 A;  3IK9 A;  1MEK A;  1C72 A;  1GTI A;  2HRK A;  3UL3 A;  3E9J B;  1O6J A;  4KH7 A;  4FIW A;  3IRA A;  1HNA A;  5DAK B;  4ID0 A;  2HRF A;  5IO0 A;  5D96 A;  5LD0 A;  4TR1 A;  4EDZ A;  1F9M A;  2H1B A;  5KN3 A;  2TIR A;  3U6V A;  3QMX A;  4ECI A;  2V6K A;  4MPF A;  1NW2 A;  4I2T A;  2E7P A;  3APQ A;  4POK A;  4K0G A;  4O92 A;  3HD5 A;  2YZH A;  4TR0 A;  4ZXG A;  2YCD A;  5B7C A;  2WS2 A;  3MIX A;  1TP9 A;  3HKR A;  5ECL B;  5J9C A;  1NHY A;  5D93 A;  3IAS 2;  1WPI A;  1AQW A;  1TOF A;  5A4U A;  4G19 A;  2DKI A;  4N11 A;  3IBH A;  1ERT A;  3L78 A;  2H8L A;  5IM9 A;  4Z7X A;  2C1Y A;  2AUV A;  1BX9 A;  2DMM A;  1M99 A;  3IAM 2;  5DJM A;  5CRG A;  3H79 A;  2VCV A;  5HR3 A;  4K0N A;  5EY6 A;  1ON4 A;  2OE0 A;  2HZE A;  3TCO A;  1ZYE A;  4BWQ A;  2JAD A;  4MJB A;  1EZK A;  2M80 A;  1BQ7 A;  2R0G A;  1SK2 A;  4GCI A;  3GA4 A;  2DIZ A;  2QKE A;  4MH2 A;  1MD3 A;  3M9J A;  5DAK A;  1TKD B;  2E0Q A;  2VLV A;  1SK0 A;  1UA5 A;  2L57 A;  1TW9 A;  4OWY A;  4N30 A;  2RM6 A;  1PMT A;  4LA1 A;  2WUL A;  3DWV A;  1A23 A;  2REM A;  3IDV A;  1X5D A;  2DSA A;  3TKP A;  2VCQ A;  4L5L A;  2JL4 A;  4KUN A;  2QC7 A;  1XW6 A;  10GS A;  2ZNM A;  3TRX A;  2NPB A;  2YJ7 A;  1EWX A;  3KM6 A;  5DQY A;  3UVH A;  2GQK A;  3HVS A;  3CBU A;  3FHK A;  4USS A;  4GSN A;  1ACV A;  2FHE A;  1JLW A;  2C0E A;  1VF3 A;  2A4H A;  1JZD A;  4ZB9 A;  5CRD A;  5IMC A;  4TN8 A;  4DSR A;  3C7M A;  4XCS A;  1WIK A;  3QFA C;  5EVO A;  2F51 A;  3KMN A;  4POB A;  4KX4 A;  1H4O A;  1ZGN A;  4ISD A;  5G1K A;  3L0H A;  4YAV A;  3WD6 A;  3UOM A;  2B3S A;  1B9X C;  1ZL9 A;  4HJ2 A;  1UC7 A;  1TU7 A;  4TXO B;  2GQL A;  4MLY A;  2F3M A;  3ZZX A;  5D9V A;  1PSQ A;  2K8V A;  4MP4 A;  3KXO A;  1TJD A;  3MSZ A;  2YPM A;  4D73 A;  5G31 A;  3DML A;  4HDE A;  3UIW A;  5E59 A;  2GSQ A;  2B1K A;  4K7I A;  4PGT A;  3MAK A;  4IN0 A;  1XXU A;  2VL2 A;  5CYY A;  4K8M A;  4ECB A;  2DJ2 A;  3LGC A;  3O76 A;  2FCH A;  2A2R A;  4P3Y B;  3KMO A;  3G9B A;  3GHA A;  14GS A;  1HQO A;  5DQS A;  3V1W A;  5C00 A;  5ELG A;  2PMT A;  2CT6 A;  3GH9 A;  1MDK A;  3VWV A;  1DE2 A;  3A2X A;  3HVX A;  1T4Y A;  2MMZ A;  3F4R A;  2DJJ A;  3LXT A;  1YKC A;  2H71 A;  4Q5Q A;  3FY7 A;  3FEU A;  2I81 A;  4KSO A;  2H75 A;  2MZC A;  4CY8 A;  2HLS A;  4ZB6 A;  3PR8 A;  1J0F A;  1KBN A;  2IMD A;  3CRU A;  2FGX A;  1GNW A;  5JCW A;  3Q18 A;  4FYB A;  2GSS A;  2BJX A;  1EOH A;  2C8U A;  2OKA A;  3IPZ A;  4EF0 A;  2K6V A;  5ECN B;  3GX8 A;  1GSU A;  2A2S A;  3TJK A;  3DVX A;  1SYR A;  2WZ9 A;  4L8E A;  1N8J A;  3R3E A;  2CAQ A;  5F8B A;  4BWS A;  1TI1 A;  1H75 A;  1K3O A;  4EVM A;  2H6Y A;  4V1A p;  2O7K A;  4A5P A;  2DLX A;  3GUS A;  1JZR A;  2R5G A;  4OO5 A;  1M0U A;  2BTO T;  3TKS C;  2ZCT A;  3GSS A;  1NHO A;  3UEM A;  1AXD A;  8GSS A;  1FW1 A;  5A5K A;  2WDU A;  4K5R A;  4KCA A;  1TU8 A;  4MZC A;  5ECP B;  1TRU A;  1TK5 B;  2K18 A;  1PL2 A;  2WB9 A;  4LL4 B;  4WEY A;  3A3T A;  1Q98 A;  3TDG A;  3GTU B;  2DJ1 A;  1FHE A;  2WFC A;  1XBS A;  5HFG A;  1Y25 A;  5ID2 A;  3C71 A;  3QR6 A;  2V1M A;  2B7K A;  1OC3 A;  3UBK A;  2LST A;  1EEJ A;  5D73 A;  3HJO A;  4ACS A;  1PQN A;  4HOJ A;  1CQG A;  2H1D A;  1X0R A;  2TRC P;  1B4P A;  5GZZ B;  3H93 A;  1X9W B;  5ELA A;  3UBL A;  1QXH A;  3U5R E;  1Z7R A;  1TRW A;  3RPP A;  4HU7 A;  3J7Y b;  3MDK A;  4WET A;  4IJI A;  4OMV A;  4HEA 2;  1TK0 B;  1NSW A;  2PWJ A;  18GS A;  2VD0 A;  3HJM A;  2ES7 A;  1SD9 A;  2H30 A;  4GLT A;  2HE3 A;  5ECS A;  1Z6M A;  4X4J A;  4NXI A;  2C0D A;  2O87 A;  5GST A;  2RLI A;  2X4A A;  2R0C A;  1A8Y A;  2MYG A;  3EPT A;  4JE1 A;  1WE0 A;  2O85 A;  1OKT A;  2L6C A;  3BJ5 A;  3TJJ A;  1SD8 A;  4X43 A;  5IMV A;  3W8J A;  5CP1 A;  4OFT A;  4ZL9 A;  1YDK A;  5LNK e;  3H1N A;  2B7J A;  4HS1 A;  1VRS D;  4EIP A;  5H5R A;  4Q5R A;  4ULX A;  2L59 A;  2HFD A;  2JZS A;  3GTU A;  1GL8 A;  3P2A A;  4FO5 A;  5BMU A;  5J3R A;  1V2A A;  2HSH A;  3IXR A;  5ECR B;  2M46 A;  3FZA A;  1GLQ A;  1FB6 A;  1F3A A;  1A2L A;  4QL7 A;  1OC9 A;  3TJF A;  1FOH A;  4LMW A;  5COH A;  3PPU A;  3FZ9 A;  1YEX A;  4WF4 A;  3UMA A;  3H4K A;  2N5A A;  1ZYQ B;  2I9H A;  4YKG A;  1R26 A;  4PUF C;  4V1A g;  4WBR D;  4HZ2 A;  2X8C A;  1NM3 A;  2DC5 A;  3KZQ A;  2I4A A;  2AB6 A;  2KOK A;  4IQ1 A;  2LQQ A;  3IR4 A;  2R4V A;  4IBP A;  2WCI A;  1HNC A;  4GTU A;  4TXV A;  2YP6 A;  1G7E A;  4HQS A;  3ZTL A;  2RUF A;  3GMF A;  3EWL A;  12GS A;  2Z9S A;  2PVQ A;  2LNS A;  2H73 A;  4K2X A;  3I69 A;  4TR1 B;  1U3I A;  3D4T A;  2P5R A;  5JWQ B;  1YF1 A;  2KUC A;  3GFK A;  1OYJ A;  2H0H A;  1T8E B;  13GS A;  5IOW A;  4IVF A;  2HRN A;  4IJ3 A;  5IMF A;  2VM1 A;  1E2Y A;  3ZIV A;  2P0G A;  2H76 A;  1LBK A;  5HQP A;  1K0O A;  1GRX A;  3CSI A;  2OJL A;  2JZR A;  2YZU A;  3GKK A;  2FWH A;  5A4V A;  4RQR A;  5DCG A;  1ERV A;  2HT9 A;  3L9S A;  1T00 A;  2FD3 A;  2J9H A;  1T7P B;  2GSR A;  3QD9 A;  2E2G A;  2AHE A;  3E3E A;  2YV9 A;  1GUH A;  4GF0 A;  2BMX A;  5AGY A;  4ZL7 A;  4XRD A;  4NHZ A;  3UAR A;  1Q4J A;  1GSD A;  1ZZY A;  2HZF A;  2HZE B;  3D21 A;  4ICY A;  2RII A;  3KGK A;  2B5Y A;  1JZW A;  2C4J A;  5IMD A;  1PX7 A;  4NPB A;  2LV3 A;  4KDX A;  4NWY A;  1X5C A;  2IIY A;  4KE3 A;  6GST A;  5FT3 A;  3NZN A;  2LTK A;  3GL5 A;  2YNX A;  3TKS E;  1U3A A;  4Z2U A;  5D9T A;  3HY2 A;  4JED A;  3LFL A;  3CTF A;  2HXK A;  5HR1 A;  2HSM A;  1JLV A;  3W6G A;  3IV4 A;  3CSH A;  1QGV A;  2X99 A;  3M0F A;  4KA0 A;  1FVJ A;  5FHI A;  1X5E A;  4J56 E;  3F3Q A;  4O7H A;  1YKA A;  2CV4 A;  2GVP A;  4HI7 A;  1EV4 A;  1A8L A;  4IKH A;  1OKD A;  4ECJ A;  5AIS A;  2FLS A;  3MNG A;  3APS A;  4WF5 A;  4G10 A;  4OO4 A;  2PBJ A;  3GKN A;  4TOP A;  2YN1 A;  2LJA A;  3A5I A;  1KNG A;  1ABA A;  3BBY A;  2CVD A;  2VOC A;  3VWX A;  5KOX A;  4Q5N A;  1DUG A;  3ERF A;  2O8V B;  4KW6 A;  3BCI A;  3QAW A;  1X9S B;  4D73 B;  3P8W A;  5KN2 A;  2GT5 A;  4TVE A;  3LQ7 A;  2VL3 A;  3ZRE A;  4RUV A;  1DSB A;  4GXZ A;  3M9K A;  4WKW A;  3H8Q A;  4BA7 A;  3IK7 A;  1F37 A;  4POM A;  4NHW A;  3PH9 A;  3TOT A;  4K2D A;  2VCW A;  1EGR A;  2XC2 A;  5DBQ A;  2GZP A;  1GSE A;  4DVC A;  4MH3 A;  2R6K A;  2C3T A;  2FWF A;  3JCM L;  1QUW A;  4K9Z A;  5CAX A;  5IOX A;  4MJE A;  1SJZ A;  1ZCP A;  3BD2 A;  3RHB A;  3GV1 A;  3LSZ A;  1SU9 A;  3G7Y A;  3VLN A;  4F82 A;  3FR6 A;  1CQH A;  1B9Y C;  2OE1 A;  3ZFL A;  1SYX A;  3HZ4 A;  4X1U A;  2H70 A;  4ZIL A;  1X9M B;  3GIX A;  4DEJ A;  4PQI A;  2HYX A;  4NV5 A;  4G2E A;  2VL2 C;  1SKS B;  2B5E A;  3FKF A;  5IPH A;  3SBC A;  1PKZ A;  3F4S A;  1TTZ A;  3ZL5 A;  3ZVJ A;  1UN2 A;  7GSS A;  2VCZ A;  3TRQ A;  2YV7 A;  3DD3 A;  3FYG A;  6GSW A;  3A2W A;  11GS A;  4IW9 A;  3UAP A;  4EC0 A;  4PUA A;  2ON5 A;  1GTB A;  5ECH B;  4MJC A;  2FUG 2;  3HJP A;  5H5Q A;  3QOU A;  5IIZ A;  2H0G A;  2PER A;  3EUR A;  1WP0 A;  2CX4 A;  3KEB A;  2RUE A;  3RHC A;  4K5S A;  1K0C A;  4K6X A;  5ID2 B;  3WGD A;  2IPA A;  2IME A;  1G0T A;  4I97 A;  1O7U A;  1ST9 A;  4MZW A;  4YQV A;  3CTG A;  3ZVJ D;  4NAX A;  1GSF A;  3ZMK A;  5ECO B;  4ML1 A;  3IC8 A;  1K0N A;  4KAE A;  5DVB A;  4JRR A;  2H74 A;  2MBS A;  3GYK A;  4V2M A;  1Y6E A;  1BAY A;  1YY7 A;  2R0P A;  2NTO A;  2NBS A;  3VFI A;  5IMZ A;  3FR3 A;  4N0Z A;  5CRW A;  1YF0 A;  3CSJ A;  5CNW A;  5IO2 A;  1VF1 A;  3HA9 A;  4TR3 A;  5E4W A;  1MTC A;  5ECI B;  4ZB8 A;  1GP1 A;  4GSS A;  4V2N A;  1FG4 A;  1K3L A;  2FWE A;  3ZFB A;  1Z5Y E;  1V40 A;  4HJM A;  2H6X A;  2L6D A;  3VPT A;  5J5N A;  1MDI A;  3NIV A;  2VIM A;  2QA2 A;  1F2E A;  2CA8 A;  1YQ1 A;  1ZMA A;  3DYR A;  1DE1 A;  4G0L A;  1WJK A;  2KLX A;  3GRX A;  1VF2 A;  5G5F A;  2DBC A;  1K0A A;  2YOI A;  4DSS B;  1ERW A;  2H1A A;  3KP8 A;  1IYH A;  4EIQ A;  4EUY A;  1PRX A;  1EOG A;  3VI7 A;  3LEF A;  2G0F A;  1XZO A;  2AAW A;  2GDR A;  1M2A A;  5IQY A;  1SEN A;  1WMJ A;  3F8U A;  1OC9 B;  1GH2 A;  4IHU A;  2B5X A;  4J57 E;  2RM5 A;  4BL7 B;  2GLR A;  4IEL A;  2VD1 A;  4MJA A;  4F0B A;  2IFQ B;  3BOA A;  3G7I A;  2X8G A;  4I6X A;  4H86 A;  2OBK A;  3VK9 A;  4CDO A;  2LS5 A;  4DSQ A;  2R2J A;  3EMP A;  4GRF A;  5GSS A;  4YKF A;  4LL1 B;  2V41 A;  3MWH A;  5KOW A;  4KB3 A;  3KD0 A;  3WGE A;  4OFM A;  5DJL A;  3TKQ A;  3MYD A;  3GUR A;  2GQM A;  2DKH A;  1V57 A;  2EIQ A;  3TB2 A;  4MCU A;  1FAA A;  4OD7 A;  5C04 A;  1I9D A;  3LYP A;  3J7Y k;  1GNE A;  4MF5 A;  1SL2 B;  2DJK A;  4EL1 A;  4DSS A;  4TKY A;  2KHP A;  3GL3 A;  3O6T A;  3VWW A;  4WXT A;  4JZQ A;  3KP9 A;  3Q19 A;  3QAG A;  5J9B A;  4FYU A;  2PUK C;  4PQ1 A;  3IC4 A;  3QFB C;  1EV9 A;  1TXX A;  5ECM B;  4XHM A;  4EDY A;  2J23 A;  4OCF A;  2OA7 A;  3DVW A;  3FW2 A;  2N5F A;  4ILF A;  4BVY B;  4BL7 A;  3K8N A;  1IYI A;  2FA8 A;  3QCP A;  2IFQ A;  4O5U A;  2XPD A;  4TR4 A;  5JCG A;  2JZT A;  3D0Z A;  2CVB A;  1KTE A;  2H1G A;  3GH6 A;  4XRA A;  5EL8 A;  4JU5 A;  4AJ7 A;  5G30 A;  4PX1 A;  3HYP A;  1GUM A;  2HNL A;  1O81 A;  2JU5 A;  5CO3 A;  2XPE A;  9GSS A;  3QDN A;  2QGV A;  3FK8 A;  4Q5F A;  3E0U A;  1XCC A;  5A4W A;  1PX6 A;  1XW5 A;  5EPF A;  4MMM A;  3RAZ A;  3F6D A;  1F3B A;  1TI3 A;  1EGO A;  17GS A;  4ZL8 A;  1XWG A;  2YWM A;  4PTS A;  5L71 A;  1K0B A;  3ME7 A;  3HXS A;  2LRN A;  3TGZ A;  5JCU A;  3QPM A;  2LRC A;  1AW9 A;  1AC1 A;  3ERW A;  1U87 A;  1PA3 A;  2XHF A;  4GWR A;  1GTA A;  4MZB A;  5D8I A;  4F03 A;  1PD2 1;  1V9W A;  3S9F A;  1XWA A;  3TOU A;  2H6Z A;  1Z7P A;  1SKW B;  1BG5 A;  2C3N A;  2WJU A;  3L9U A;  5DDL A;  3F63 A;  2JSY A;  4BVY A;  2C80 A;  2MMN A;  6GSV A;  1XOB A;  2VL9 A;  20GS A;  2LKU A;  5B8A A;  1G6W A;  2ZUP A;  3EU3 A;  1SJ6 A;  1XVQ A;  2DIY A;  3ERG A;  6GSX A;  1GSY A;  3LG6 A;  1TDI A;  2V32 A;  1DBY A;  5FWG A;  5ECK B;  4MAB A;  1F6M C;  1AQX A;  1HYU A;  2H19 A;  3C8E A;  2IMF A;  4WR4 A;  5B8B A;  2F9S A;  4XTS A;  3FRC A;  1G7O A;  2ALB A;  1I5G A;  2FNO A;  4POL A;  1ILO A;  1K0D A;  4KSM A;  3LJR A;  2YWN A;  2OAD A;  3C1S A;  2HSY A;  1Z3E A;  4RQX A;  2MMA A;  3KTL A;  4QL9 A;  1B48 A;  3D22 A;  5F07 A;  4JBB A;  2WRT A;  4KDU A;  22GS A;  6GSY A;  2B1L A;  3LXZ A;  1M9B A;  4GQC A;  4F9Z A;  4YAP A;  4CY6 A;  2F8A A;  5AN1 A;  2N5B A;  4RI7 A;  3D4M A;  2CAI A;  1QFN A;  3LW9 A;  4J2F A;  5AIV A;  2VLT A;  4XS1 A;  5JWR B;  6GSS A;  3TJB A;  5KN0 A;  4ZBA A;  1B8X A;  3HDC A;  1RK4 A;  3N9J A;  1G6Y A;  4G0K A;  1URM A;  2H0I A;  2P5Q A;  3L4N A;  4LLR A;  1A0F A;  1J9B A;  2X8H A;  1S3A A;  2NDO A;  1XFL A;  2MBT A;  1LU4 A;  3VI5 A;  3W8S A;  1YJ6 A;  4K7O A;  3VPQ A;  3ISO A;  4F2I A;  4XS4 A;  2LUS A;  1YZX A;  1O73 A;  2PU9 C;  2H66 A;  1HNB A;  4X0X A;  3LOR A;  2GTU A;  1M7T A;  3RDW A;  4E8E A;  5CRH A;  1GUL A;  2A4V A;  1T4Z A;  3IE3 A;  2V2G A;  2GST A;  2VO4 A;  4ZBD A;  4MF6 A;  3GN3 A;  2GZY A;  5CRE A;  3UJ1 A;  4AJ8 A;  3ZML A;  4MF7 A;  1W4V A;  5BRT A;  1R5P A;  5GAP D;  2D2Z A;  1SL0 B;  3PIN A;  5B6N A;  5HR2 A;  2VUP A;  1TRS A;  1W89 A;  1PGT A;  2VAF A;  1LJR A;  2AV4 A;  4OFN A;  1KEB A;  3C73 A;  2VLU A;  2IMK A;  2IN3 A;  4G0I A;  2KP2 A;  1A2M A;  2YWI A;  1AAZ A;  3RBT A;  5D9X A;  3KCM A;  3HZ8 A;  1XOA A;  3EE2 A;  6GSU A;  1BJX A;  2IMI A;  3WT1 A;  3AY8 A;  4YQU A;  4AJ6 A;  2H01 A;  2E2M A;  3C1R A;  5ECQ B;  3D6I A;  4HQZ A;  4IS0 A;  3PGT A;  1OAZ A;  2FA4 A;  3TJG A;  1HD2 A;  1U88 A;  4YH2 A;  2CVK A;  4L0W A;  1WWJ A;  2K9F A;  3ZIJ A;  4PXO A;  1ML6 A;  4WBJ A;  1SJI A;  3QAV A;  4HU9 A;  4K1F A;  4AGS A;  1JZO A;  5LCZ A;  4KF9 A;  5G1L A;  1M2B A;  3ZRD A;  1XWB A;  2QSI A;  1JHB A;  3F4T A;  4XS6 A;  5KEJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...