2YZHA

Crystal structure of peroxiredoxin-like protein from aquifex aeolicus
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
170
structure length
170
Chain Sequence
GHMARTVNLKGNPVTLVGPELKVGDRAPEAVVVTKDLQEKIVGGAKDVVQVIITVPSLDTPVCETETKKFNEIMAGMEGVDVTVVSMDLPFAQKRFCESFNIQNVTVASDFRYRDMEKYGVLIGEGALKGILARAVFIIDKEGKVAYVQLVPEITEEPNYDEVVNKVKEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Probable thiol peroxidase
publication title Crystal structure of peroxiredoxin-like protein from Aquifex aeolicus
rcsb
source organism Aquifex aeolicus
total genus 47
structure length 170
sequence length 170
chains with identical sequence B, C, D
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2007-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08534 Redoxin Redoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2yzhA00
4HEA2 4YQVA 3FEUA 1Z6MA 3M0FA 3GURA 4IJIA 3EVIA 2NPBA 3O76A 4RUVA 4X43A 4FYCA 2VCQA 3CMIA 3ZLPA 3L9SA 2FWHA 2YJHA 5IIZA 3KXOA 2FWFA 5DQYA 1XPVA 4MF5A 4FIWA 4MZBA 3GKXA 1VF3A 4FYBA 3FKFA 3KJYA 3PINA 3ZYWA 3FK8A 4JE1A 2AV4A 4DEJA 2R37A 3QAVA 2LNSA 5ECPB 4LA1A 3Q18A 1O8WA 3QDNA 1A23A 3GSSA 5ENUA 4IELA 3TOTA 3CTGA 2L5LA 4AF2A 1BYEA 1T4YA 2DJ2A 3F4SA 3CTFA 3HXSA 2ALBA 1TI3A 2H19A 2YP6A 2XBQA 4MP4A 2V41A 2V1MA 4BVYA 2LV3A 2H8LA 2H0IA 1YEPA 2VD0A 1AAZA 3VWXA 3D6IA 2FY6A 2X99A 2DJJA 3PR8A 5F05A 3HZ4A 5DJLA 3Q74A 2GVPA 1X9MB 2ON7A 4JU5A 5DAKA 22GSA 3EC3A 3TJBA 3FYGA 3ZRDA 1TTZA 3IPZA 2BTOT 2DJ0A 3TKSE 1XOAA 3GKMA 2X64A 4GSNA 3DRNA 2JSZA 2FCHA 3LYPA 3VWVA 4MCUA 3ERGA 3ZFLA 2C0DA 4DVCA 4JEDA 1GSSA 3QOUA 2AUVA 3M1GA 4FO5A 1VF1A 1AIUA 5D9WA 3MWHA 4KUNA 1TU7A 3J7Yk 3C1RA 2VCVA 1TOFA 3GKKA 4NXIA 4TR4A 4MZWA 4TR0A 5ECOB 4IP1A 5GSTA 2ZUPA 1YJ6A 2L4CA 1A2JA 3LFLA 1AW9A 2JACA 3GFKA 5IO2A 3P90A 1FG4A 5ECMB 4K0GA 3M8NA 2FGXA 1PQNA 4I5QA 5H5SA 1XW9A 3G7JA 2LEGA 3TJKA 4YAPA 5GSSA 2RUEA 5HFGA 1FO5A 4KX4A 2LJKA 2H71A 4BL7A 2LQQA 4PURA 3UMAA 5IQYA 1R5AA 2FWEA 1KBNA 1M7TA 2Z9SA 1FB0A 5ECKB 5HFIA 1T7PB 1YKCA 3ZVJA 4J56E 2DSAA 4EVMA 1EV9A 1K0CA 5EY6A 1F9MA 4HQSA 4KCEA 1A8YA 2IPAA 2A2RA 5CO3A 4EDZA 3P2AA 1PGTA 2JZSA 18GSA 3BJ5A 4IHUA 1XCCA 2VM1A 3IXRA 3RAZA 4MPFA 2HZFA 2CZ2A 1WJKA 3HVVA 1OE8A 1KEBA 3TDGA 1GH2A 1U87A 2VIMA 4ZBAA 2H75A 3IE3A 1GTBA 3GNJA 5D96A 5IMDA 3GV1A 2KHPA 3VFIA 2FHEA 1WP0A 2CX4A 2F8AA 5GAPD 1QUWA 3I43A 1M2DA 2HRFA 4V1Ag 1G6YA 4TN8A 5A4UA 4G2EA 4ZBDA 1F3AA 1M0UA 2O8VB 3DEXA 1XWBA 2H72A 4WBJA 3TRQA 1GUMA 1B8XA 4J2FA 3BOAA 1BEDA 2O89A 4PQHA 4G10A 4XS1A 1TRSA 4HZ4A 3M9KA 2P5QA 4GWRA 4WXTA 3QD9A 3W6GA 5D9VA 4GLTA 3I9V2 3IBHA 1X9WB 4JRRA 3A5WA 3KH7A 3KM6A 1GULA 5HQPA 1K0BA 4HDEA 3V1WA 2C4JA 5AIXA 1ZL9A 2F3MA 1PKWA 5CP1A 3EYTA 4TW5A 2BMXA 4NHWA 2GT5A 1G0TA 3CRUA 3HA9A 1ZYQB 2KUCA 4DSSB 1YF1A 1S3AA 2C8UA 4G19A 3IDVA 3D21A 3IA1A 4EF0A 5J5NA 1QXHA 2LJRA 3DMLA 1X5EA 2VL2A 3KMNA 3GSTA 1FOVA 5FHIA 3QCPA 4RQXA 1F2EA 2B1KA 2GZPA 4ZILA 1SK2A 1JZDA 1XVQA 5B8AA 1R7HA 3ZIJA 1SJIA 4KNDA 4AJ6A 3LXZA 4EL1A 4Q5FA 1DUGA 1TRUA 4E8HA 4I2TA 4KSOA 4NHZA 2BJXA 1MEKA 2MBSA 5B6NA 1TK0B 4YAVA 1A24A 1WWJA 1YEXA 3ZL5A 2IMKA 2LUSA 4HOJA 4O7HA 5IO0A 2KP2A 1EV4A 2DJKA 1ZOFA 1XWAA 1ZYEA 8GSSA 4ACSA 4MLYA 1WOUA 2MMNA 2XBIA 3NZNA 2AJQB 1SJZA 1PMTA 1UVZA 2HRNA 3VLNA 2WGRA 3H8QA 2CT6A 3LSZA 3TUEA 5D9TA 5JCWA 3RPNA 1THOA 4YH2A 3E3EA 3KMOA 3KP9A 2VL9A 4IVFA 4ULXA 3D4TA 4OO5A 3KCMA 2DLXA 2L6DA 1TK5B 1H75A 3H1NA 4HI7A 1SKSB 5D93A 4ML6A 3HDCA 3E0UA 1FHEA 3QMXA 3RHCA 4IQAA 3KTBA 1M9AA 1Q4JA 1JZWA 2PGTA 5IPGA 2I4AA 4JBBA 4WF5A 1HYUA 3CYNA 2IWTA 1NM3A 3UAPA 5EL8A 3ZMKA 3ZVJD 3GA4A 1TI1A 1XWGA 3IOSA 2AYTA 2I9HA 5AN1A 1BQ7A 1TXXA 3A2WA 1NSWA 4KAEA 4V2LA 2YNXA 2FLSA 5KN3A 3DD3A 3US3A 3QR6A 4OFTA 5CNWA 2PPTA 2V2GA 3F8UA 1EEJA 1EGRA 2L57A 2RM6A 1M99A 1GLQA 5J9BA 2ZCTA 6GSYA 5JWOB 1TDIA 5J41A 3VI7A 3ISOA 4LL4B 1GWCA 4BPYA 3ZTLA 3GYKA 1X9SB 3D0ZA 1MDKA 4IN0A 2E2MA 5CRDA 4ZL7A 4F2IA 1ZGNA 2VCXA 1SYXA 2B1LA 2B7KA 2F51A 1K0AA 2I3YA 3BD2A 4KA0A 5DALA 3VWUA 1MD3A 1JFUA 1ERTA 2N5AA 2YZHA 5D8IA 1YF0A 5IPHA 1ERWA 3HVSA 3SWLA 5D9XA 2MMZA 1B4QA 1BJXA 4JR6A 4KSMA 1VRSD 2PUKC 2JSYA 1SKWB 5B8BA 1DBYA 1C72A 1EEMA 4K1FA 2A4VA 3ZFBA 3F0IA 4WR5A 1O6JA 3FRCA 2HSYA 3M9JA 5ECSA 4XIHA 3A3TA 4KGIA 2KOKA 2PMTA 4XCSA 3O3TA 5IMAA 1CQHA 1FB6A 5KN0A 1ZCPA 4KB3A 3CXGA 4BWQA 2HE3A 3L9VA 3C73A 2DIYA 1HNBA 4OCFA 4POBA 3TOUA 2VCTA 4N0VA 3QAGA 1RW1A 4JR4A 1AXDA 4H86A 4TR3A 2GS3A 2VAFA 1H4OA 3SBCA 1Y6EA 3O6TA 2ZNMA 2LRNA 2YN1A 3KH9A 3UEMA 4BWSA 1SENA 3D4MA 4OD7A 3CRTA 2K8VA 1ZZYA 1XVWA 1F37A 3DVWA 1WE0A 2G0FA 1O85A 4FH8A 2H76A 2RLIA 4IBPA 3J7Yb 2IFQB 3UVHA 1F6MC 3IC4A 2GLRA 4Q5QA 2L5OA 1FW1A 5KEJA 4LMVA 4RI7A 2PVQA 2YOIA 1U3AA 2G2QA 4OWYA 2OE0A 3L78A 3RBTA 1XOBA 3LG6A 3UL3A 2OBIA 3GX8A 4N10A 5G31A 3UBKA 1X5CA 1K3YA 2H1BA 1N2AA 1ZMAA 2OA7A 1S3DA 2REMA 4ILFA 2H6ZA 4OFNA 5IMZA 2H66A 1SD9A 2MMOA 5JCGA 4I2UA 2L4QA 2P0GA 3BCIA 3F3RA 4ZL8A 3HHVA 3HJPA 1Y25A 3IHQA 2WRTA 13GSA 1NW2A 2J9HA 3R2QA 3L4NA 3NIVA 2FA4A 2F8FA 1XBSA 2H1AA 5E59A 5IMFA 2HYXA 5GAND 1GSDA 3ZITA 2EIQA 3TJGA 1EP8A 4PGTA 1GP1A 2H70A 4TVEA 3N5OA 4O5RA 1A0FA 4ZB9A 1V40A 11GSA 3ZIVA 1TP9A 5HR3A 4HQZA 1XWKA 5F06A 2DIZA 1V98A 3VPQA 1X5DA 3PGTA 5DBQA 1XWCA 7GSSA 1VGLA 2LNTA 4ZL9A 2N5FA 3C7MA 4MH3A 3C71A 2WCIA 4ML1A 3MDKA 3TKRA 3CBUA 3QFAC 4K6XA 2C80A 4RI6A 4TOPA 5AIVA 1QQ2A 3IK9A 3KIJA 1M9BA 4L0UA 4ECIA 4PNFA 5EPFA 1EOHA 4MJBA 3IK7A 3VWWA 4XTSA 1AC1A 3D5JA 2MBTA 3LGCA 3H93A 5CRGA 4K7NA 1V2AA 5ECLB 1MD4A 4QL9A 2EC4A 2K18A 1A0RP 3P8WA 1SL2B 1HQOA 4QL7A 3MAKA 4HJ2A 2DJ1A 3TKSA 19GSA 2WDUA 3APQA 1IYHA 1FVJA 1XIYA 1RQMA 4K7OA 4NAXA 4NWYA 5J4UA 2TRXA 2LRTA 1PX6A 3FW2A 5H5QA 4EO3A 4N30A 2E2GA 4CHSA 2OJLA 4CW9A 1PN9A 4K9ZA 2C3QA 2P31A 1SD8A 2CAIA 3UOMA 2CVBA 4I6XA 4FYUA 1WMJA 4MPGA 3VPTA 2AAWA 4MA9A 2X8GA 1QFNA 3BCKA 5C04A 2D2ZA 1SL1B 5HR1A 1K0NA 4F03A 4ISDA 1JHBA 3F6DA 1GSFA 4DSSA 2JU5A 4ZB6A 3G7IA 3EMPA 2H1DA 2O87A 2OKAA 3A2XA 1GTIA 1FAAA 3VURA 4EKZA 2EIOA 1T1VA 6GSVA 1B9YC 2K6VA 1U6TA 5ID2B 1QGVA 4PX1A 5GZZB 4WR4A 2O7KA 4KDUA 3HD5A 5ECRB 3HZ8A 6GSXA 2LRCA 1GSYA 2H6YA 3DKSA 2HZEB 3TRPA 3QFBC 1G7EA 3U5RE 2IJYA 3FHKA 5F0GA 1XW5A 1GSEA 1CQGA 4NMUA 3FZ4A 4MJCA 4LMWA 5KN2A 3QAWA 1GLPA 4G9HA 1THXA 2FA8A 3HKRA 5E4WA 1B48A 5KN1A 2QSIA 2WJUA 1OE7A 1V57A 5LCZA 1PL1A 1VF4A 3DWVA 2YV7A 3APOA 4MH2A 3WD6A 1I5GA 2CX3A 2YWOA 5G1KA 4GQFA 1HNAA 2YV9A 3L9UA 1A2MA 3GIXA 1KTEA 4EE0A 1O7UA 3EWLA 1W89A 4HU9A 1VF2A 2C0EA 3LJRA 2IL3A 2GZZA 1K3LA 2WFCA 1PSQA 1LU4A 3LEFA 2B7JA 2JADA 3F63A 4J57E 2OE3A 4TXVA 5DVBA 4PNGA 2IMEA 3LORA 4K7IA 2C0GA 4GCIA 2MZCA 2B5XA 2YZUA 4KCAA 2VO4A 1OAZA 1JLVA 2OACA 2YANA 1FVKA 3DXBA 4PXOA 2H1GA 1EZKA 2HFDA 1S3CA 2VL3A 5COHA 2VM2A 3I6AA 3RPPA 4XS4B 2GGTA 4RQRA 5ELGA 4N0ZA 5J3RA 4L5OA 1O81A 3IAM2 1AQVA 4GTUA 1ACVA 5C00A 2CZ3A 3DVXA 5G1LA 2ON5A 5AGYA 4WF4A 2YWMA 3L0HA 4ECCA 1JZOA 3UJ1A 3W8JA 4MF6A 5B7CA 6GSTA 1N8JA 4I8BA 2ES7A 4EC0A 3PH9A 1Z7PA 1Z7RA 4HU7A 2KLXA 3HJOA 3KGKA 4GXZA 5G2ZA 4TKYA 3WGEA 2J23A 1G7OA 4XRDA 3WGDA 5IOWA 5ECIB 14GSA 1X0RA 1SL0B 4XRAA 4F9ZA 2RIIA 1YDKA 4V2NA 3FZ9A 3QPMA 2L59A 3AY8A 1E6BA 1EP7A 3LWAA 1EWXA 1ON4A 4GSTA 2AB6A 2PBJA 2VL2C 2DJ3A 4MJAA 3ERFA 2HXKA 1AQWA 3ZMLA 1K0MA 2RM5A 4V2MA 2JL4A 3FZ5A 3UIWA 3GHAA 5JWQB 5CREA 3I69A 1PRXA 3TKQA 3IAS2 5D73A 4D73B 3S9FA 5CRWA 4IGJA 3FR3A 2IMIA 3WT1A 4TRXA 1PKZA 1EGOA 2RUFA 1M2AA 3DYRA 4DSQA 1WIKA 2E0QA 1DE1A 1K0OA 5EVOA 3ME8A 2XPDA 3TCOA 3GRXA 2C0FA 2LSTA 1XFLA 2P5RA 5DJMA 3ME7A 2DBCA 1R4WA 1ABAA 1K3OA 4MZCA 2H30A 2GQMA 4LLRA 5G5EA 1GUKA 2GDRA 2H01A 2HI7A 1MDIA 1TKDB 4TXOA 2VLVA 2LJAA 3EURA 4MABA 4ZBBA 2VLUA 1J0FA 1XW6A 3EMXA 2R6KA 1R5PA 5A5KA 2N5BA 2LQOA 2GSSA 4TXOB 2IFQA 4IQ1A 1ML6A 5LNKe 3P7XA 1UC7A 4OFMA 1QMVA 4CDOA 5FWGA 3JCML 2CAQA 2H0GA 1TRVA 4LL1B 2FWGA 3MNGA 2FD3A 3GL3A 4MMMA 3TKPA 1GL8A 3FY7A 1YY7A 2CVDA 1A2LA 5CAXA 1GTUA 4MDCA 5DCHA 5A4VA 2PN8A 5DQSA 2VUPA 5CRHA 1T3BA 1GNEA 2VCWA 4POMA 4K8MA 4P3YB 4X0XA 2HNLA 2TIRA 4KW6A 1SYRA 1XZOA 5CYYA 1ERVA 1TJDA 3G9BA 4DSRA 5DAKB 1V9WA 5B6MA 1JZRA 3GKNA 1SU9A 3ZREA 2LS5A 1O8XA 1LBKA 2TRCP 3UBLA 1MDJA 4PUAA 3F4RA 3DIEA 2IIYA 3ERWA 1T4ZA 4F0CA 1K0DA 1V58A 5JWRB 4HUAA 5INYA 2K8SA 3CSJA 5G5FA 1GTAA 4E8EA 1BX9A 1KNGA 1AQXA 4F0BA 3ED3A 3Q6OA 5IOXA 4GF0A 1J08A 4X1UA 2GSRA 5J9CA 4AGSA 2WULA 2R4VA 5DDLA 3C8EA 3BBYA 3HJMA 3KP8A 1JLWA 2M72A 5HR0A 2X8HA 2VLTA 2V6KA 4MF7A 3UARA 5HFKA 1HNCA 1E2YA 4KH7A 1WPIA 1SJ6A 2YCDA 4K0NA 2WB9A 2H0HA 3M3MA 2QC7A 4EUYA 2DMLA 1YKAA 1SK0A 2F9SA 3OR5A 1Z3EA 4JZQA 4IW9A 2YJ7A 4WETA 3TGZA 3F9UA 1NHOA 4L8EA 3KZQA 4IS0A 2HSHA 2OBKA 4PQ1A 3IV4A 3EU4A 1TRWA 1PX7A 2V32A 3TJJA 1OC8A 2C3NA 1J9BA 4O32A 1OYJA 9GSSA 4OCEA 3U6VA 4EDYA 4ECJA 10GSA 2IMFA 3EINA 4PQIA 3F6FA 1I9DA 1GSUA 3N9JA 4ZXGA 5F07A 2WZ9A 5H5RA 1Q98A 1MTCA 4ZIJA 3CSHA 1DSBA 4MK3A 1QK8A 2I81A 2GQLA 1ILOA 2PU9C 2X8CA 2R5GA 1PA3A 3KD0A 5ECNB 3GTUA 3TB2A 1GSQA 4Q5NA 3WT2A 4YQMA 3IRAA 5F8BA 4NPBA 2R2JA 1BG5A 2PWJA 2XHFA 4WKWA 5ID2A 2KP1A 3GTUB 4QQ7A 2XC2A 5JCUA 2PVOC 2O85A 2CA8A 4ZB8A 3HYPA 1TU8A 2VOCA 2C1YA 16GSA 1B4PA 3C1SA 3HCZA 3CSIA 2HZEA 4V1Ap 1A8LA 1W4VA 4XHMA 2IMDA 3Q19A 2OE1A 5G30A 1T00A 4KE3A 1YZXA 1URMA 1PL2A 2FNOA 2AHEA 4ECBA 4Z7XA 3EU3A 1BAYA 1PD21 2B5YA 2CQ9A 2VCZA 3GX0A 4OMVA 2GSTA 4OO4A 2HLSA 1DE2A 3EE2A 3RHBA 3LQ7A 3MSZA 4WEYA 2E7PA 1YQ1A 3W8SA 4HS1A 1TK8B 4L5LA 2NTOA 3GH9A 4HZ2A 3KTLA 4KDYA 5ECQB 2B6MA 1USBA 3NOFA 4WBRD 3F3QA 5IM9A 4F82A 2MMAA 3H79A 3DGQA 1U3IA 4L0WA 3UVTA 3VK9A 1U88A 4POLA 4ID0A 4KDXA 2M80A 1O73A 1R26A 4YQUA 1SKRB 3K8NA 2H73A 3FR9A 5FT3A 1OVNA 2K9FA 5LD0A 1XXUA 3LYKA 3LXTA 3GL5A 3FR6A 2FUG2 2GTUA 3IR4A 2DMMA 1Z6NA 3HVXA 1ST9A 1OKTA 3FZAA 3WGXA 1GRXA 1GNWA 4IP6A 2YWIA 5ELAA 4BVXA 2LTKA 2GQKA 3D22A 4AJ7A 4GSSA 3KEBA 3TRXA 1T8EB 2I1UA 3TJFA 2CV4A 20GSA 3VI5A 4XS4A 5ABRA 4GQCA 3G7YA 2OADA 2L6CA 2NBSA 5L71A 2QGVA 3TKSC 2A2SA 2XPEA 4I97A 4NV2A 4POKA 4BA7A 3GH6A 2B3SA 1HD2A 1SK1A 1OC9A 2PERA 2JZRA 3HY2A 2R3XA 5ECHB 2MYGA 4XS6A 4PUFC 5AISA 1OC9B 1LJRA 2CVKA 2HT9A 1OKDA 4AJ8A 5HR2A 2EIRA 4IKHA 4K2DA 2WS2A 3RDWA 2H6XA 2C3TA 1OC3A 1ERUA 2JZTA 4N11A 2VD1A 3GMFA 2DC5A 17GSA 3WYWA 6GSWA 3ZZXA 2NDOA 4GRFA 4TR1A 1B9XC 1G6WA 4MJEA 4O92A 2YWNA 2LKUA 2GSQA 4HJMA 1NHYA 4TR1B 1IYIA 2YPMA 3H4KA 12GSA 1UA5A 6GSSA 2IN3A 1GUHA 3A2VA 1WRYA 2GT6A 1RK4A 2B5EA 2M46A 3GN3A 4Q5RA 2NVLA 1AUCA 4IJ3A 2GZYA 1UN2A 1M2BA 4EXJA 1TW9A 6GSUA 1Z5YE 1EOGA 1F3BA 4D73A 3E9JB 5IMVA 2H74A 4NV5A 2QKEA 3F4TA 5DALB 5A4WA 5IMCA 2V6OA 1Z9HA 5DCGA 3APSA 3GUSA
chains in the Genus database with same CATH superfamily
4HEA2 4YQVA 3FEUA 1Z6MA 3M0FA 3GURA 4IJIA 3EVIA 2NPBA 3O76A 4RUVA 4X43A 4FYCA 2VCQA 3CMIA 3ZLPA 3L9SA 2FWHA 2YJHA 5IIZA 3KXOA 2FWFA 5DQYA 1XPVA 4MF5A 4FIWA 4MZBA 3GKXA 1VF3A 4FYBA 3FKFA 3KJYA 3PINA 3ZYWA 3FK8A 4JE1A 2AV4A 4DEJA 2R37A 3QAVA 2LNSA 5ECPB 4LA1A 3Q18A 1O8WA 3QDNA 1A23A 3GSSA 5ENUA 4IELA 2R0GA 3TOTA 3CTGA 2L5LA 4AF2A 1BYEA 1T4YA 1M3IA 2DJ2A 3F4SA 3CTFA 3HXSA 2ALBA 1TI3A 2H19A 2YP6A 2XBQA 4MP4A 2V41A 2V1MA 4BVYA 2LV3A 2H8LA 2H0IA 1YEPA 2VD0A 1AAZA 3VWXA 3D6IA 2FY6A 2X99A 2DJJA 3PR8A 5F05A 3HZ4A 5DJLA 3Q74A 2GVPA 1X9MB 2ON7A 4JU5A 5DAKA 22GSA 3EC3A 3TJBA 3FYGA 3ZRDA 1TTZA 3IPZA 2BTOT 2DJ0A 3TKSE 1XOAA 3GKMA 2X64A 4EIPA 4GSNA 3DRNA 2JSZA 2FCHA 3LYPA 3VWVA 4MCUA 3ERGA 3ZFLA 2C0DA 4DVCA 4JEDA 1GSSA 3QOUA 2AUVA 3M1GA 4FO5A 1VF1A 1AIUA 5D9WA 3MWHA 4KUNA 1TU7A 3J7Yk 3C1RA 2VCVA 1TOFA 3GKKA 4NXIA 4TR4A 4MZWA 4TR0A 5ECOB 3PPUA 4IP1A 5GSTA 2ZUPA 1YJ6A 2L4CA 1A2JA 3LFLA 1AW9A 2JACA 3GFKA 5IO2A 3P90A 1FG4A 5ECMB 4K0GA 3M8NA 2FGXA 1PQNA 4I5QA 5H5SA 1XW9A 3G7JA 2LEGA 3TJKA 4YAPA 5GSSA 2RUEA 2HSMA 5HFGA 1FO5A 4KX4A 2LJKA 2DKIA 2H71A 4BL7A 2LQQA 4PURA 3UMAA 5IQYA 1R5AA 2FWEA 1KBNA 1M7TA 2Z9SA 1FB0A 4EIQA 5ECKB 5HFIA 1T7PB 1YKCA 3ZVJA 4J56E 2DSAA 4EVMA 1EV9A 1K0CA 5EY6A 1F9MA 4HQSA 4KCEA 1A8YA 2IPAA 2A2RA 5CO3A 4EDZA 3P2AA 1PGTA 2JZSA 18GSA 3BJ5A 4IHUA 1XCCA 2VM1A 3IXRA 3RAZA 4MPFA 2HZFA 2CZ2A 1WJKA 3HVVA 1OE8A 1KEBA 3TDGA 1GH2A 1U87A 2VIMA 4ZBAA 2H75A 3IE3A 1GTBA 3GNJA 5D96A 5IMDA 3GV1A 2KHPA 3VFIA 2FHEA 1WP0A 2CX4A 2F8AA 5GAPD 1QUWA 3I43A 1M2DA 2HRFA 4V1Ag 1G6YA 4TN8A 5A4UA 4G2EA 4ZBDA 1F3AA 1M0UA 2O8VB 3DEXA 1XWBA 2H72A 4WBJA 3TRQA 1GUMA 1B8XA 4J2FA 3BOAA 1BEDA 2O89A 4PQHA 4G10A 4XS1A 1TRSA 4HZ4A 3M9KA 2P5QA 4GWRA 4WXTA 3QD9A 3W6GA 5D9VA 4GLTA 3I9V2 3IBHA 3A5IA 1X9WB 4JRRA 3A5WA 3KH7A 3KM6A 1GULA 5HQPA 1K0BA 4HDEA 3V1WA 2C4JA 5AIXA 1ZL9A 2F3MA 1PKWA 5CP1A 3EYTA 4TW5A 2BMXA 4NHWA 2GT5A 1G0TA 3CRUA 3HA9A 1ZYQB 2KUCA 4DSSB 3EPTA 1YF1A 1S3AA 2C8UA 4G19A 3IDVA 3D21A 3IA1A 4EF0A 5J5NA 1QXHA 2LJRA 3DMLA 1X5EA 2VL2A 3KMNA 3GSTA 1FOVA 1PFOA 5FHIA 3QCPA 4RQXA 1F2EA 2B1KA 2GZPA 4ZILA 1SK2A 1JZDA 1XVQA 5B8AA 1R7HA 3ZIJA 1SJIA 4KNDA 4AJ6A 3LXZA 4EL1A 4Q5FA 1DUGA 1TRUA 4E8HA 4I2TA 4KSOA 4NHZA 2BJXA 1MEKA 2MBSA 5B6NA 1TK0B 4YAVA 1A24A 1WWJA 1YEXA 3ZL5A 2IMKA 2LUSA 4HOJA 4O7HA 5IO0A 2KP2A 1EV4A 2DJKA 1ZOFA 1XWAA 1ZYEA 8GSSA 4ACSA 4MLYA 1WOUA 2MMNA 2XBIA 3NZNA 2AJQB 3LW9A 1SJZA 1PMTA 1UVZA 2HRNA 3VLNA 2WGRA 3H8QA 2CT6A 3LSZA 3TUEA 5D9TA 5JCWA 3RPNA 1THOA 4YH2A 3E3EA 3KMOA 3KP9A 2VL9A 4IVFA 4ULXA 3D4TA 4OO5A 3KCMA 2DLXA 2L6DA 1TK5B 1H75A 3H1NA 4HI7A 1SKSB 5D93A 4ML6A 3HDCA 3E0UA 1FHEA 3QMXA 3RHCA 4IQAA 3KTBA 1M9AA 1Q4JA 1JZWA 2PGTA 5IPGA 2I4AA 4JBBA 4WF5A 1HYUA 3CYNA 2IWTA 1NM3A 3UAPA 5EL8A 3ZMKA 3ZVJD 3GA4A 1TI1A 1XWGA 4A5PA 3IOSA 2AYTA 2I9HA 5AN1A 1BQ7A 1TXXA 3HVNA 3A2WA 1NSWA 4KAEA 4V2LA 2YNXA 2FLSA 5KN3A 3DD3A 3US3A 3QR6A 4OFTA 5CNWA 2PPTA 2V2GA 4K2XA 3F8UA 1EEJA 1EGRA 2L57A 2RM6A 1M99A 1GLQA 5J9BA 4CY8A 2ZCTA 6GSYA 5JWOB 1TDIA 5J41A 3VI7A 3ISOA 4LL4B 1GWCA 4BPYA 3ZTLA 3GYKA 1X9SB 3D0ZA 1MDKA 4IN0A 4CY6A 2E2MA 5CRDA 4ZL7A 2QA1A 4F2IA 1ZGNA 2VCXA 1SYXA 2B1LA 2B7KA 2F51A 1K0AA 2I3YA 3BD2A 4KA0A 5DALA 3VWUA 1MD3A 1JFUA 1ERTA 2N5AA 2YZHA 5D8IA 1YF0A 4K5RA 4O5QA 5IPHA 1ERWA 3HVSA 3SWLA 5D9XA 2MMZA 1B4QA 1BJXA 4JR6A 4KSMA 1VRSD 2PUKC 2JSYA 1SKWB 5B8BA 2A4HA 1DBYA 1C72A 1EEMA 4K1FA 2A4VA 3ZFBA 3F0IA 4WR5A 1O6JA 3FRCA 2HSYA 3M9JA 5ECSA 4XIHA 3A3TA 4KGIA 2KOKA 2PMTA 4XCSA 5KOXA 3O3TA 5IMAA 1CQHA 1FB6A 5KN0A 1ZCPA 4KB3A 3CXGA 4BWQA 2HE3A 3L9VA 3C73A 2DIYA 1HNBA 4OCFA 4POBA 3TOUA 2VCTA 4N0VA 3QAGA 1RW1A 4JR4A 1AXDA 4H86A 4TR3A 2GS3A 2VAFA 1H4OA 3SBCA 1Y6EA 3R3EA 3O6TA 2ZNMA 2LRNA 2YN1A 3KH9A 3UEMA 4BWSA 1SENA 3D4MA 4OD7A 3CRTA 2K8VA 1ZZYA 1XVWA 1F37A 3DVWA 1WE0A 2G0FA 1O85A 4FH8A 2H76A 2RLIA 4IBPA 3J7Yb 2IFQB 3UVHA 1F6MC 3IC4A 2GLRA 4Q5QA 2L5OA 1FW1A 4USSA 5KEJA 4LMVA 4RI7A 2PVQA 2YOIA 1U3AA 2G2QA 4OWYA 2OE0A 3L78A 3RBTA 1XOBA 3LG6A 3UL3A 2OBIA 3GX8A 4N10A 5G31A 3UBKA 1X5CA 1K3YA 2H1BA 1N2AA 1ZMAA 2OA7A 1S3DA 2REMA 4ILFA 2H6ZA 4OFNA 5IMZA 2H66A 1SD9A 2MMOA 5JCGA 4I2UA 2L4QA 2P0GA 3BCIA 3F3RA 4ZL8A 3HHVA 3HJPA 1Y25A 3IHQA 2WRTA 13GSA 1NW2A 2J9HA 3R2QA 3L4NA 3NIVA 2FA4A 2F8FA 1XBSA 2H1AA 5E59A 5IMFA 2HYXA 5GAND 1GSDA 3ZITA 2EIQA 3TJGA 1EP8A 4PGTA 1GP1A 2H70A 4TVEA 3N5OA 4O5RA 1A0FA 4ZB9A 1V40A 11GSA 3ZIVA 1TP9A 1S3RA 5HR3A 4HQZA 1XWKA 5F06A 2DIZA 1V98A 3VPQA 1X5DA 3PGTA 5DBQA 1XWCA 7GSSA 1VGLA 2LNTA 4ZL9A 2N5FA 3C7MA 4MH3A 3C71A 2WCIA 4ML1A 3MDKA 3TKRA 3CBUA 3QFAC 4K6XA 2C80A 4RI6A 4TOPA 5AIVA 1QQ2A 3IK9A 3KIJA 5BRTA 1M9BA 4L0UA 4ECIA 4K5SA 4PNFA 5EPFA 1EOHA 4MJBA 3IK7A 3VWWA 4XTSA 1AC1A 3D5JA 2MBTA 3LGCA 3H93A 5CRGA 4K7NA 1V2AA 2DKHA 5ECLB 1MD4A 4QL9A 2EC4A 2K18A 1A0RP 3P8WA 1SL2B 1HQOA 4QL7A 3MAKA 4HJ2A 2DJ1A 3TKSA 19GSA 2WDUA 3APQA 1IYHA 1FVJA 1XIYA 4BIKA 1RQMA 4K7OA 4NAXA 4NWYA 5J4UA 2TRXA 2LRTA 1PX6A 3FW2A 5H5QA 4EO3A 4N30A 2E2GA 4CHSA 2OJLA 4CW9A 1PN9A 4K9ZA 2C3QA 2P31A 1SD8A 2CAIA 3UOMA 2CVBA 4I6XA 4FYUA 1WMJA 4MPGA 3VPTA 2AAWA 4MA9A 2X8GA 1QFNA 3BCKA 5C04A 2D2ZA 1SL1B 5HR1A 1K0NA 4F03A 4ISDA 1JHBA 3F6DA 1GSFA 4DSSA 2JU5A 4ZB6A 3G7IA 3EMPA 2H1DA 2O87A 2OKAA 3A2XA 1GTIA 1FAAA 3VURA 4EKZA 2EIOA 1T1VA 6GSVA 1B9YC 2K6VA 1U6TA 5ID2B 1QGVA 4PX1A 5GZZB 4WR4A 2O7KA 4KDUA 3HD5A 5ECRB 3HZ8A 6GSXA 2LRCA 1GSYA 2H6YA 3DKSA 2HZEB 3TRPA 2UZ8A 3QFBC 1G7EA 3IHGA 3U5RE 2IJYA 3FHKA 5F0GA 4YKGA 1XW5A 1GSEA 1CQGA 4NMUA 3FZ4A 4MJCA 4LMWA 5KN2A 3QAWA 1GLPA 4G9HA 1THXA 2FA8A 3HKRA 5E4WA 3FMWA 1B48A 5KN1A 2QSIA 2WJUA 4KF9A 1OE7A 4X4JA 1V57A 5LCZA 1PL1A 1VF4A 4MNNA 3DWVA 2YV7A 2X49A 3APOA 4MH2A 3WD6A 1I5GA 2CX3A 2YWOA 5G1KA 4GQFA 1HNAA 2YV9A 3L9UA 1A2MA 3GIXA 1KTEA 4EE0A 1O7UA 3EWLA 1W89A 4HU9A 1VF2A 2C0EA 3LJRA 2IL3A 2GZZA 4HSCX 1K3LA 2WFCA 1PSQA 1LU4A 3LEFA 2B7JA 2JADA 3F63A 4J57E 2OE3A 4TXVA 2R0CA 3MIXA 5DVBA 4PNGA 2IMEA 3LORA 4K7IA 2C0GA 4GCIA 2MZCA 4O5UA 2B5XA 2YZUA 4KCAA 2VO4A 1OAZA 1JLVA 2OACA 2YANA 4BVXB 1FVKA 3DXBA 4PXOA 2H1GA 1EZKA 2HFDA 1S3CA 2VL3A 5COHA 2VM2A 3I6AA 3RPPA 4XS4B 2GGTA 4RQRA 5ELGA 4N0ZA 5J3RA 4L5OA 1O81A 3IAM2 1AQVA 4GTUA 1ACVA 5C00A 2CZ3A 4Z2RA 3DVXA 5G1LA 4ICYA 2ON5A 5AGYA 4WF4A 2YWMA 3L0HA 4ECCA 1JZOA 3UJ1A 3W8JA 4MF6A 5B7CA 6GSTA 1N8JA 4I8BA 2ES7A 4EC0A 3PH9A 1Z7PA 1Z7RA 1ZYPA 4HU7A 2KLXA 3HJOA 3KGKA 4GXZA 5G2ZA 4TKYA 3WGEA 2J23A 1G7OA 4XRDA 3WGDA 5IOWA 5ECIB 14GSA 1X0RA 1SL0B 4G0IA 4XRAA 4F9ZA 2RIIA 1YDKA 4V2NA 3FZ9A 3QPMA 2L59A 3AY8A 1E6BA 1EP7A 3LWAA 1EWXA 1ON4A 4GSTA 2AB6A 2PBJA 2VL2C 2DJ3A 4MJAA 3ERFA 2HXKA 1AQWA 3ZMLA 1K0MA 2RM5A 4V2MA 2JL4A 3FZ5A 3UIWA 3GHAA 5JWQB 4YKFA 5CREA 3I69A 1PRXA 3TKQA 3IAS2 5D73A 4D73B 3S9FA 5CRWA 4IGJA 3FR3A 2IMIA 3WT1A 4TRXA 1PKZA 1EGOA 2RUFA 1M2AA 3DYRA 4DSQA 1WIKA 2E0QA 1DE1A 1K0OA 5EVOA 3ME8A 2XPDA 3TCOA 3GRXA 2C0FA 2LSTA 1XFLA 2P5RA 5DJMA 3ME7A 2DBCA 1R4WA 1ABAA 1K3OA 4MZCA 2H30A 2GQMA 4LLRA 5G5EA 1GUKA 2GDRA 2H01A 2HI7A 1MDIA 1TKDB 4TXOA 2VLVA 2LJAA 3EURA 4MABA 4ZBBA 2VLUA 1J0FA 1XW6A 3EMXA 2R6KA 1R5PA 5A5KA 2N5BA 2LQOA 2GSSA 1ZYNA 4TXOB 2IFQA 4IQ1A 1ML6A 5LNKe 3P7XA 1UC7A 4OFMA 1QMVA 4CDOA 5FWGA 3JCML 2CAQA 2H0GA 1TRVA 4LL1B 2FWGA 3MNGA 2FD3A 3GL3A 4MMMA 3TKPA 1GL8A 2QA2A 3FY7A 1YY7A 2CVDA 1A2LA 5CAXA 1GTUA 4MDCA 5DCHA 5A4VA 2PN8A 5DQSA 2VUPA 5CRHA 4BVYB 1T3BA 1GNEA 2VCWA 5BMUA 4POMA 4K8MA 4P3YB 4X0XA 2HNLA 2TIRA 4KW6A 1SYRA 1XZOA 5CYYA 1ERVA 1TJDA 3G9BA 4DSRA 5DAKB 1V9WA 5B6MA 1JZRA 3GKNA 1SU9A 1PN0A 3ZREA 2LS5A 1O8XA 1LBKA 2TRCP 3UBLA 1MDJA 2HRAA 4PUAA 3F4RA 3DIEA 2IIYA 3ERWA 4G0KA 1T4ZA 4F0CA 1K0DA 1V58A 5JWRB 4HUAA 5INYA 2K8SA 3CSJA 5G5FA 1GTAA 4E8EA 1BX9A 1KNGA 1AQXA 4F0BA 3ED3A 3Q6OA 5IOXA 4GF0A 2X4AA 1J08A 4X1UA 2GSRA 5J9CA 4AGSA 2R0PA 2WULA 2R4VA 5DDLA 3C8EA 3BBYA 3HJMA 3KP8A 1JLWA 2M72A 5HR0A 2X8HA 2VLTA 2V6KA 4MF7A 3UARA 5HFKA 1HNCA 1E2YA 4KH7A 4BL7B 1WPIA 1SJ6A 2YCDA 4K0NA 2WB9A 2H0HA 3M3MA 2QC7A 4EUYA 2DMLA 1YKAA 1SK0A 2F9SA 3OR5A 1Z3EA 4JZQA 4IW9A 2YJ7A 4WETA 3TGZA 3F9UA 1NHOA 4L8EA 3KZQA 4IS0A 2HSHA 2OBKA 4PQ1A 3IV4A 3EU4A 1TRWA 1PX7A 2V32A 3TJJA 1OC8A 2C3NA 1J9BA 4O32A 1OYJA 9GSSA 4OCEA 3U6VA 4EDYA 4ECJA 10GSA 2IMFA 3EINA 4PQIA 3CQFA 3F6FA 1I9DA 4G0LA 1GSUA 3N9JA 4ZXGA 5F07A 2WZ9A 5H5RA 5KOWA 1Q98A 1MTCA 4ZIJA 3CSHA 1DSBA 4MK3A 1QK8A 2I81A 2GQLA 1ILOA 2PU9C 2X8CA 2R5GA 1PA3A 3KD0A 5ECNB 3GTUA 3TB2A 1GSQA 4Q5NA 3WT2A 4YQMA 3IRAA 5F8BA 4NPBA 2R2JA 1BG5A 2PWJA 2XHFA 4WKWA 5ID2A 2KP1A 3GTUB 4QQ7A 2XC2A 5JCUA 2PVOC 2O85A 2CA8A 4ZB8A 3HYPA 1TU8A 2VOCA 2C1YA 16GSA 1B4PA 3C1SA 3HCZA 3CSIA 2HZEA 4V1Ap 1A8LA 1W4VA 4XHMA 2IMDA 3Q19A 2OE1A 3IC8A 5G30A 1T00A 4KE3A 1YZXA 1URMA 1PL2A 2FNOA 2AHEA 4ECBA 4Z7XA 3EU3A 1BAYA 1PD21 2B5YA 2CQ9A 4Z2TA 2VCZA 3GX0A 4OMVA 2GSTA 4OO4A 2HLSA 3MYDA 1DE2A 3EE2A 3RHBA 3LQ7A 3MSZA 4WEYA 2E7PA 1YQ1A 3W8SA 4HS1A 1M3JA 1TK8B 4L5LA 2NTOA 3GH9A 4HZ2A 3KTLA 4KDYA 5ECQB 2B6MA 1USBA 3NOFA 4WBRD 3F3QA 5IM9A 4F82A 2MMAA 3H79A 3DGQA 1U3IA 4L0WA 3UVTA 3VK9A 1U88A 4POLA 4ID0A 4KDXA 2M80A 1O73A 1R26A 4YQUA 1SKRB 3K8NA 2H73A 3FR9A 5FT3A 1OVNA 2K9FA 5LD0A 4Z2UA 1XXUA 3LYKA 3LXTA 3GL5A 3FR6A 2FUG2 2GTUA 3IR4A 2DMMA 1Z6NA 3HVXA 1ST9A 1OKTA 3FZAA 3WGXA 1GRXA 1GNWA 4IP6A 2YWIA 5ELAA 4BVXA 2LTKA 2GQKA 3D22A 4AJ7A 4GSSA 3KEBA 3TRXA 1XG8A 1T8EB 2I1UA 3TJFA 2CV4A 20GSA 3VI5A 4XS4A 5ABRA 2A2PA 4GQCA 3G7YA 2OADA 2L6CA 2NBSA 5L71A 2QGVA 3TKSC 2A2SA 2XPEA 4I97A 4NV2A 4POKA 4BA7A 3GH6A 2B3SA 1HD2A 1SK1A 1OC9A 2PERA 2JZRA 3HY2A 2R3XA 5ECHB 2MYGA 4XS6A 4PUFC 4FQUA 1OC9B 5AISA 1LJRA 2CVKA 2HT9A 1OKDA 4AJ8A 5HR2A 2EIRA 4IKHA 4K2DA 2WS2A 3RDWA 2HRKA 2H6XA 2C3TA 1OC3A 1FOHA 1ERUA 2JZTA 4N11A 2VD1A 3GMFA 2DC5A 17GSA 3WYWA 6GSWA 3ZZXA 2NDOA 4GRFA 4TR1A 1B9XC 1G6WA 4MJEA 4O92A 2YWNA 2LKUA 2GSQA 4HJMA 1NHYA 4TR1B 1IYIA 2YPMA 3H4KA 12GSA 1UA5A 6GSSA 2IN3A 1GUHA 3A2VA 1WRYA 2GT6A 1RK4A 2B5EA 2M46A 3GN3A 4Q5RA 2NVLA 1AUCA 4IJ3A 2GZYA 1UN2A 1M2BA 4EXJA 1TW9A 6GSUA 1Z5YE 1EOGA 1F3BA 4D73A 3E9JB 5IMVA 2H74A 4NV5A 2QKEA 3F4TA 5DALB 5A4WA 5IMCA 2V6OA 4PTSA 1Z9HA 5DCGA 3APSA 3GUSA
chains in the Genus database with same CATH topology
4HEA2 4YQVA 3FEUA 1Z6MA 3M0FA 3GURA 4IJIA 3EVIA 2NPBA 3O76A 4RUVA 4X43A 4FYCA 2VCQA 3CMIA 3ZLPA 3L9SA 2FWHA 2YJHA 5IIZA 3KXOA 2FWFA 5DQYA 1XPVA 4MF5A 4FIWA 4MZBA 3GKXA 1VF3A 4FYBA 3FKFA 3KJYA 3PINA 3ZYWA 3FK8A 4JE1A 2AV4A 4DEJA 2R37A 3QAVA 2LNSA 5ECPB 4LA1A 3Q18A 1O8WA 3QDNA 1A23A 3GSSA 5ENUA 4IELA 2R0GA 3TOTA 3CTGA 2L5LA 4AF2A 1BYEA 1T4YA 2DJ2A 3F4SA 3CTFA 3HXSA 2ALBA 1TI3A 2H19A 2YP6A 2XBQA 4MP4A 2V41A 2V1MA 4BVYA 2LV3A 2H8LA 2H0IA 1YEPA 2VD0A 1AAZA 3VWXA 3D6IA 2FY6A 2X99A 2DJJA 3PR8A 5F05A 3HZ4A 5DJLA 3Q74A 2GVPA 1X9MB 2ON7A 4JU5A 5DAKA 22GSA 3EC3A 3TJBA 3FYGA 3ZRDA 1TTZA 3IPZA 2BTOT 2DJ0A 3TKSE 1XOAA 3GKMA 2X64A 4EIPA 4GSNA 3DRNA 2JSZA 2FCHA 3LYPA 3VWVA 4MCUA 3ERGA 3ZFLA 2C0DA 4DVCA 4JEDA 1GSSA 3QOUA 2AUVA 3M1GA 4FO5A 1VF1A 1AIUA 5D9WA 3MWHA 4KUNA 1TU7A 3J7Yk 3C1RA 2VCVA 1TOFA 3GKKA 4NXIA 4TR4A 4MZWA 4TR0A 5ECOB 3PPUA 4IP1A 5GSTA 2ZUPA 1YJ6A 2L4CA 1A2JA 3LFLA 1AW9A 2JACA 3GFKA 5IO2A 3P90A 1FG4A 5ECMB 4K0GA 3M8NA 2FGXA 1PQNA 4I5QA 5H5SA 1XW9A 3G7JA 2LEGA 3TJKA 4YAPA 5GSSA 2RUEA 2HSMA 5HFGA 1FO5A 4KX4A 2LJKA 2DKIA 2H71A 4BL7A 2LQQA 4PURA 3UMAA 5IQYA 1R5AA 2FWEA 1KBNA 1M7TA 2Z9SA 1FB0A 4EIQA 5ECKB 5HFIA 1T7PB 1YKCA 3ZVJA 4J56E 2DSAA 4EVMA 1EV9A 1K0CA 5EY6A 1F9MA 4HQSA 4KCEA 1A8YA 2IPAA 2A2RA 5CO3A 4EDZA 3P2AA 1PGTA 2JZSA 18GSA 3BJ5A 4IHUA 1XCCA 2VM1A 3IXRA 3RAZA 4MPFA 2HZFA 2CZ2A 1WJKA 3HVVA 1OE8A 1KEBA 3TDGA 1GH2A 1U87A 2VIMA 4ZBAA 2H75A 3IE3A 1GTBA 3GNJA 5D96A 5IMDA 3GV1A 2KHPA 3VFIA 2FHEA 1WP0A 2CX4A 2F8AA 5GAPD 1QUWA 3I43A 1M2DA 2HRFA 4V1Ag 1G6YA 4TN8A 5A4UA 4G2EA 4ZBDA 1F3AA 1M0UA 2O8VB 3DEXA 1XWBA 2H72A 4WBJA 3TRQA 1GUMA 1B8XA 4J2FA 3BOAA 1BEDA 2O89A 4PQHA 4G10A 4XS1A 1TRSA 4HZ4A 3M9KA 2P5QA 4GWRA 4WXTA 3QD9A 3W6GA 5D9VA 4GLTA 3I9V2 3IBHA 3A5IA 1X9WB 4JRRA 3A5WA 3KH7A 3KM6A 1GULA 5HQPA 1K0BA 4HDEA 3V1WA 2C4JA 5AIXA 1ZL9A 2F3MA 1PKWA 5CP1A 3EYTA 4TW5A 2BMXA 4NHWA 2GT5A 1G0TA 3CRUA 3HA9A 1ZYQB 2KUCA 4DSSB 3EPTA 1YF1A 1S3AA 2C8UA 4G19A 3IDVA 3D21A 3IA1A 4EF0A 5J5NA 1QXHA 2LJRA 3DMLA 1X5EA 2VL2A 3KMNA 3GSTA 1FOVA 5FHIA 3QCPA 4RQXA 1F2EA 2B1KA 2GZPA 4ZILA 1SK2A 1JZDA 1XVQA 5B8AA 1R7HA 3ZIJA 1SJIA 4KNDA 4AJ6A 3LXZA 4EL1A 4Q5FA 1DUGA 1TRUA 4E8HA 4I2TA 4KSOA 4NHZA 2BJXA 1MEKA 2MBSA 5B6NA 1TK0B 4YAVA 1A24A 1WWJA 1YEXA 3ZL5A 2IMKA 2LUSA 4HOJA 4O7HA 5IO0A 2KP2A 1EV4A 2DJKA 1ZOFA 1XWAA 1ZYEA 8GSSA 4ACSA 4MLYA 1WOUA 2MMNA 2XBIA 3NZNA 2AJQB 3LW9A 1SJZA 1PMTA 1UVZA 2HRNA 3VLNA 2WGRA 3H8QA 2CT6A 3LSZA 3TUEA 5D9TA 5JCWA 3RPNA 1THOA 4YH2A 3E3EA 3KMOA 3KP9A 2VL9A 4IVFA 4ULXA 3D4TA 4OO5A 3KCMA 2DLXA 2L6DA 1TK5B 1H75A 3H1NA 4HI7A 1SKSB 5D93A 4ML6A 3HDCA 3E0UA 1FHEA 3QMXA 3RHCA 4IQAA 3KTBA 1M9AA 1Q4JA 1JZWA 2PGTA 5IPGA 2I4AA 4JBBA 4WF5A 1HYUA 3CYNA 2IWTA 1NM3A 3UAPA 5EL8A 3ZMKA 3ZVJD 3GA4A 1TI1A 1XWGA 4A5PA 3IOSA 2AYTA 2I9HA 5AN1A 1BQ7A 1TXXA 3A2WA 1NSWA 4KAEA 4V2LA 2YNXA 2FLSA 5KN3A 3DD3A 3US3A 3QR6A 4OFTA 5CNWA 2PPTA 2V2GA 4K2XA 3F8UA 1EEJA 1EGRA 2L57A 2RM6A 1M99A 1GLQA 5J9BA 4CY8A 2ZCTA 6GSYA 5JWOB 1TDIA 5J41A 3VI7A 3ISOA 4LL4B 1GWCA 4BPYA 3ZTLA 3GYKA 1X9SB 3D0ZA 1MDKA 4IN0A 4CY6A 2E2MA 5CRDA 4ZL7A 2QA1A 4F2IA 1ZGNA 2VCXA 1SYXA 2B1LA 2B7KA 2F51A 1K0AA 2I3YA 3BD2A 4KA0A 5DALA 3VWUA 1MD3A 1JFUA 1ERTA 2N5AA 2YZHA 5D8IA 1YF0A 4K5RA 4O5QA 5IPHA 1ERWA 3HVSA 3SWLA 5D9XA 2MMZA 1B4QA 1BJXA 4JR6A 4KSMA 1VRSD 2PUKC 2JSYA 1SKWB 5B8BA 2A4HA 1DBYA 1C72A 1EEMA 4K1FA 2A4VA 3ZFBA 3F0IA 4WR5A 1O6JA 3FRCA 2HSYA 3M9JA 5ECSA 4XIHA 3A3TA 4KGIA 2KOKA 2PMTA 4XCSA 5KOXA 3O3TA 5IMAA 1CQHA 1FB6A 5KN0A 1ZCPA 4KB3A 3CXGA 4BWQA 2HE3A 3L9VA 3C73A 2DIYA 1HNBA 4OCFA 4POBA 3TOUA 2VCTA 4N0VA 3QAGA 1RW1A 4JR4A 1AXDA 4H86A 4TR3A 2GS3A 2VAFA 1H4OA 3SBCA 1Y6EA 3R3EA 3O6TA 2ZNMA 2LRNA 2YN1A 3KH9A 3UEMA 4BWSA 1SENA 3D4MA 4OD7A 3CRTA 2K8VA 1ZZYA 1XVWA 1F37A 3DVWA 1WE0A 2G0FA 1O85A 4FH8A 2H76A 2RLIA 4IBPA 3J7Yb 2IFQB 3UVHA 1F6MC 3IC4A 2GLRA 4Q5QA 2L5OA 1FW1A 4USSA 5KEJA 4LMVA 4RI7A 2PVQA 2YOIA 1U3AA 2G2QA 4OWYA 2OE0A 3L78A 3RBTA 1XOBA 3LG6A 3UL3A 2OBIA 3GX8A 4N10A 5G31A 3UBKA 1X5CA 1K3YA 2H1BA 1N2AA 1ZMAA 2OA7A 1S3DA 2REMA 4ILFA 2H6ZA 4OFNA 5IMZA 2H66A 1SD9A 2MMOA 5JCGA 4I2UA 2L4QA 2P0GA 3BCIA 3F3RA 4ZL8A 3HHVA 3HJPA 1Y25A 3IHQA 2WRTA 13GSA 1NW2A 2J9HA 3R2QA 3L4NA 3NIVA 2FA4A 2F8FA 1XBSA 2H1AA 5E59A 5IMFA 2HYXA 5GAND 1GSDA 3ZITA 2EIQA 3TJGA 1EP8A 4PGTA 1GP1A 2H70A 4TVEA 3N5OA 4O5RA 1A0FA 4ZB9A 1V40A 11GSA 3ZIVA 1TP9A 5HR3A 4HQZA 1XWKA 5F06A 2DIZA 1V98A 3VPQA 1X5DA 3PGTA 5DBQA 1XWCA 7GSSA 1VGLA 2LNTA 4ZL9A 2N5FA 3C7MA 4MH3A 3C71A 2WCIA 4ML1A 3MDKA 3TKRA 3CBUA 3QFAC 4K6XA 2C80A 4RI6A 4TOPA 5AIVA 1QQ2A 3IK9A 3KIJA 5BRTA 1M9BA 4L0UA 4ECIA 4K5SA 4PNFA 5EPFA 1EOHA 4MJBA 3IK7A 3VWWA 4XTSA 1AC1A 3D5JA 2MBTA 3LGCA 3H93A 5CRGA 4K7NA 1V2AA 2DKHA 5ECLB 1MD4A 4QL9A 2EC4A 2K18A 1A0RP 3P8WA 1SL2B 1HQOA 4QL7A 3MAKA 4HJ2A 2DJ1A 3TKSA 19GSA 2WDUA 3APQA 1IYHA 1FVJA 1XIYA 1RQMA 4K7OA 4NAXA 4NWYA 5J4UA 2TRXA 2LRTA 1PX6A 3FW2A 5H5QA 4EO3A 4N30A 2E2GA 4CHSA 2OJLA 4CW9A 1PN9A 4K9ZA 2C3QA 2P31A 1SD8A 2CAIA 3UOMA 2CVBA 4I6XA 4FYUA 1WMJA 4MPGA 3VPTA 2AAWA 4MA9A 2X8GA 1QFNA 3BCKA 5C04A 2D2ZA 1SL1B 5HR1A 1K0NA 4F03A 4ISDA 1JHBA 3F6DA 1GSFA 4DSSA 2JU5A 4ZB6A 3G7IA 3EMPA 2H1DA 2O87A 2OKAA 3A2XA 1GTIA 1FAAA 3VURA 4EKZA 2EIOA 1T1VA 6GSVA 1B9YC 2K6VA 1U6TA 5ID2B 1QGVA 4PX1A 5GZZB 4WR4A 2O7KA 4KDUA 3HD5A 5ECRB 3HZ8A 6GSXA 2LRCA 1GSYA 2H6YA 3DKSA 2HZEB 3TRPA 2UZ8A 3QFBC 1G7EA 3IHGA 3U5RE 2IJYA 3FHKA 5F0GA 4YKGA 1XW5A 1GSEA 1CQGA 4NMUA 3FZ4A 4MJCA 4LMWA 5KN2A 3QAWA 1GLPA 4G9HA 1THXA 2FA8A 3HKRA 5E4WA 3FMWA 1B48A 5KN1A 2QSIA 2WJUA 4KF9A 1OE7A 4X4JA 1V57A 5LCZA 1PL1A 1VF4A 4MNNA 3DWVA 2YV7A 2X49A 3APOA 4MH2A 3WD6A 1I5GA 2CX3A 2YWOA 5G1KA 4GQFA 1HNAA 2YV9A 3L9UA 1A2MA 3GIXA 1KTEA 4EE0A 1O7UA 3EWLA 1W89A 4HU9A 1VF2A 2C0EA 3LJRA 2IL3A 2GZZA 1K3LA 2WFCA 1PSQA 1LU4A 3LEFA 2B7JA 2JADA 3F63A 4J57E 2OE3A 4TXVA 2R0CA 3MIXA 5DVBA 4PNGA 2IMEA 3LORA 4K7IA 2C0GA 4GCIA 2MZCA 4O5UA 2B5XA 2YZUA 4KCAA 2VO4A 1OAZA 1JLVA 2OACA 2YANA 4BVXB 1FVKA 3DXBA 4PXOA 2H1GA 1EZKA 2HFDA 1S3CA 2VL3A 5COHA 2VM2A 3I6AA 3RPPA 4XS4B 2GGTA 4RQRA 5ELGA 4N0ZA 5J3RA 4L5OA 1O81A 3IAM2 1AQVA 4GTUA 1ACVA 5C00A 2CZ3A 4Z2RA 3DVXA 5G1LA 4ICYA 2ON5A 5AGYA 4WF4A 2YWMA 3L0HA 4ECCA 1JZOA 3UJ1A 3W8JA 4MF6A 5B7CA 6GSTA 1N8JA 4I8BA 2ES7A 4EC0A 3PH9A 1Z7PA 1Z7RA 1ZYPA 4HU7A 2KLXA 3HJOA 3KGKA 4GXZA 5G2ZA 4TKYA 3WGEA 2J23A 1G7OA 4XRDA 3WGDA 5IOWA 5ECIB 14GSA 1X0RA 1SL0B 4G0IA 4XRAA 4F9ZA 2RIIA 1YDKA 4V2NA 3FZ9A 3QPMA 2L59A 3AY8A 1E6BA 1EP7A 3LWAA 1EWXA 1ON4A 4GSTA 2AB6A 2PBJA 2VL2C 2DJ3A 4MJAA 3ERFA 2HXKA 1AQWA 3ZMLA 1K0MA 2RM5A 4V2MA 2JL4A 3FZ5A 3UIWA 3GHAA 5JWQB 4YKFA 5CREA 3I69A 1PRXA 3TKQA 3IAS2 5D73A 4D73B 3S9FA 5CRWA 4IGJA 3FR3A 2IMIA 3WT1A 4TRXA 1PKZA 1EGOA 2RUFA 1M2AA 3DYRA 4DSQA 1WIKA 2E0QA 1DE1A 1K0OA 5EVOA 3ME8A 2XPDA 3TCOA 3GRXA 2C0FA 2LSTA 1XFLA 2P5RA 5DJMA 3ME7A 2DBCA 1R4WA 1ABAA 1K3OA 4MZCA 2H30A 2GQMA 4LLRA 5G5EA 1GUKA 2GDRA 2H01A 2HI7A 1MDIA 1TKDB 4TXOA 2VLVA 2LJAA 3EURA 4MABA 4ZBBA 2VLUA 1J0FA 1XW6A 3EMXA 2R6KA 1R5PA 5A5KA 2N5BA 2LQOA 2GSSA 1ZYNA 4TXOB 2IFQA 4IQ1A 1ML6A 5LNKe 3P7XA 1UC7A 4OFMA 1QMVA 4CDOA 5FWGA 3JCML 2CAQA 2H0GA 1TRVA 4LL1B 2FWGA 3MNGA 2FD3A 3GL3A 4MMMA 3TKPA 1GL8A 2QA2A 3FY7A 1YY7A 2CVDA 1A2LA 5CAXA 1GTUA 4MDCA 5DCHA 5A4VA 2PN8A 5DQSA 2VUPA 5CRHA 4BVYB 1T3BA 1GNEA 2VCWA 5BMUA 4POMA 4K8MA 4P3YB 4X0XA 2HNLA 2TIRA 4KW6A 1SYRA 1XZOA 5CYYA 1ERVA 1TJDA 3G9BA 4DSRA 5DAKB 1V9WA 5B6MA 1JZRA 3GKNA 1SU9A 1PN0A 3ZREA 2LS5A 1O8XA 1LBKA 2TRCP 3UBLA 1MDJA 2HRAA 4PUAA 3F4RA 3DIEA 2IIYA 3ERWA 4G0KA 1T4ZA 4F0CA 1K0DA 1V58A 5JWRB 4HUAA 5INYA 2K8SA 3CSJA 5G5FA 1GTAA 4E8EA 1BX9A 1KNGA 1AQXA 4F0BA 3ED3A 3Q6OA 5IOXA 4GF0A 2X4AA 1J08A 4X1UA 2GSRA 5J9CA 4AGSA 2R0PA 2WULA 2R4VA 5DDLA 3C8EA 3BBYA 3HJMA 3KP8A 1JLWA 2M72A 5HR0A 2X8HA 2VLTA 2V6KA 4MF7A 3UARA 5HFKA 1HNCA 1E2YA 4KH7A 4BL7B 1WPIA 1SJ6A 2YCDA 4K0NA 2WB9A 2H0HA 3M3MA 2QC7A 4EUYA 2DMLA 1YKAA 1SK0A 2F9SA 3OR5A 1Z3EA 4JZQA 4IW9A 2YJ7A 4WETA 3TGZA 3F9UA 1NHOA 4L8EA 3KZQA 4IS0A 2HSHA 2OBKA 4PQ1A 3IV4A 3EU4A 1TRWA 1PX7A 2V32A 3TJJA 1OC8A 2C3NA 1J9BA 4O32A 1OYJA 9GSSA 4OCEA 3U6VA 4EDYA 4ECJA 10GSA 2IMFA 3EINA 4PQIA 3F6FA 1I9DA 4G0LA 1GSUA 3N9JA 4ZXGA 5F07A 2WZ9A 5H5RA 5KOWA 1Q98A 1MTCA 4ZIJA 3CSHA 1DSBA 4MK3A 1QK8A 2I81A 2GQLA 1ILOA 2PU9C 2X8CA 2R5GA 1PA3A 3KD0A 5ECNB 3GTUA 3TB2A 1GSQA 4Q5NA 3WT2A 4YQMA 3IRAA 5F8BA 4NPBA 2R2JA 1BG5A 2PWJA 2XHFA 4WKWA 5ID2A 2KP1A 3GTUB 4QQ7A 2XC2A 5JCUA 2PVOC 2O85A 2CA8A 4ZB8A 3HYPA 1TU8A 2VOCA 2C1YA 16GSA 1B4PA 3C1SA 3HCZA 3CSIA 2HZEA 4V1Ap 1A8LA 1W4VA 4XHMA 2IMDA 3Q19A 2OE1A 3IC8A 5G30A 1T00A 4KE3A 1YZXA 1URMA 1PL2A 2FNOA 2AHEA 4ECBA 4Z7XA 3EU3A 1BAYA 1PD21 2B5YA 2CQ9A 4Z2TA 2VCZA 3GX0A 4OMVA 2GSTA 4OO4A 2HLSA 3MYDA 1DE2A 3EE2A 3RHBA 3LQ7A 3MSZA 4WEYA 2E7PA 1YQ1A 3W8SA 4HS1A 1TK8B 4L5LA 2NTOA 3GH9A 4HZ2A 3KTLA 4KDYA 5ECQB 2B6MA 1USBA 3NOFA 4WBRD 3F3QA 5IM9A 4F82A 2MMAA 3H79A 3DGQA 1U3IA 4L0WA 3UVTA 3VK9A 1U88A 4POLA 4ID0A 4KDXA 2M80A 1O73A 1R26A 4YQUA 1SKRB 3K8NA 2H73A 3FR9A 5FT3A 1OVNA 2K9FA 5LD0A 4Z2UA 1XXUA 3LYKA 3LXTA 3GL5A 3FR6A 2FUG2 2GTUA 3IR4A 2DMMA 1Z6NA 3HVXA 1ST9A 1OKTA 3FZAA 3WGXA 1GRXA 1GNWA 4IP6A 2YWIA 5ELAA 4BVXA 2LTKA 2GQKA 3D22A 4AJ7A 4GSSA 3KEBA 3TRXA 1T8EB 2I1UA 3TJFA 2CV4A 20GSA 3VI5A 4XS4A 5ABRA 2A2PA 4GQCA 3G7YA 2OADA 2L6CA 2NBSA 5L71A 2QGVA 3TKSC 2A2SA 2XPEA 4I97A 4NV2A 4POKA 4BA7A 3GH6A 2B3SA 1HD2A 1SK1A 1OC9A 2PERA 2JZRA 3HY2A 2R3XA 5ECHB 2MYGA 4XS6A 4PUFC 4FQUA 5AISA 1OC9B 1LJRA 2CVKA 2HT9A 1OKDA 4AJ8A 5HR2A 2EIRA 4IKHA 4K2DA 2WS2A 3RDWA 2HRKA 2H6XA 2C3TA 1OC3A 1FOHA 1ERUA 2JZTA 4N11A 2VD1A 3GMFA 2DC5A 17GSA 3WYWA 6GSWA 3ZZXA 2NDOA 4GRFA 4TR1A 1B9XC 1G6WA 4MJEA 4O92A 2YWNA 2LKUA 2GSQA 4HJMA 1NHYA 4TR1B 1IYIA 2YPMA 3H4KA 12GSA 1UA5A 6GSSA 2IN3A 1GUHA 3A2VA 1WRYA 2GT6A 1RK4A 2B5EA 2M46A 3GN3A 4Q5RA 2NVLA 1AUCA 4IJ3A 2GZYA 1UN2A 1M2BA 4EXJA 1TW9A 6GSUA 1Z5YE 1EOGA 1F3BA 4D73A 3E9JB 5IMVA 2H74A 4NV5A 2QKEA 3F4TA 5DALB 5A4WA 5IMCA 2V6OA 4PTSA 1Z9HA 5DCGA 3APSA 3GUSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HEA 2;  4YQV A;  3FEU A;  1Z6M A;  3M0F A;  3GUR A;  4IJI A;  3EVI A;  2NPB A;  3O76 A;  4RUV A;  4X43 A;  4FYC A;  2VCQ A;  3CMI A;  3ZLP A;  3L9S A;  2FWH A;  2YJH A;  5IIZ A;  3KXO A;  2FWF A;  5DQY A;  1XPV A;  4MF5 A;  4FIW A;  4MZB A;  3GKX A;  1VF3 A;  4FYB A;  3FKF A;  3KJY A;  3PIN A;  3ZYW A;  3FK8 A;  4JE1 A;  2AV4 A;  4DEJ A;  2R37 A;  3QAV A;  2LNS A;  5ECP B;  4LA1 A;  3Q18 A;  1O8W A;  3QDN A;  1A23 A;  3GSS A;  5ENU A;  4IEL A;  3TOT A;  3CTG A;  2L5L A;  4AF2 A;  1BYE A;  1T4Y A;  2DJ2 A;  3F4S A;  3CTF A;  3HXS A;  2ALB A;  1TI3 A;  2H19 A;  2YP6 A;  2XBQ A;  4MP4 A;  2V41 A;  2V1M A;  4BVY A;  2LV3 A;  2H8L A;  2H0I A;  1YEP A;  2VD0 A;  1AAZ A;  3VWX A;  3D6I A;  2FY6 A;  2X99 A;  2DJJ A;  3PR8 A;  5F05 A;  3HZ4 A;  5DJL A;  3Q74 A;  2GVP A;  1X9M B;  2ON7 A;  4JU5 A;  5DAK A;  22GS A;  3EC3 A;  3TJB A;  3FYG A;  3ZRD A;  1TTZ A;  3IPZ A;  2BTO T;  2DJ0 A;  3TKS E;  1XOA A;  3GKM A;  2X64 A;  4GSN A;  3DRN A;  2JSZ A;  2FCH A;  3LYP A;  3VWV A;  4MCU A;  3ERG A;  3ZFL A;  2C0D A;  4DVC A;  4JED A;  1GSS A;  3QOU A;  2AUV A;  3M1G A;  4FO5 A;  1VF1 A;  1AIU A;  5D9W A;  3MWH A;  4KUN A;  1TU7 A;  3J7Y k;  3C1R A;  2VCV A;  1TOF A;  3GKK A;  4NXI A;  4TR4 A;  4MZW A;  4TR0 A;  5ECO B;  4IP1 A;  5GST A;  2ZUP A;  1YJ6 A;  2L4C A;  1A2J A;  3LFL A;  1AW9 A;  2JAC A;  3GFK A;  5IO2 A;  3P90 A;  1FG4 A;  5ECM B;  4K0G A;  3M8N A;  2FGX A;  1PQN A;  4I5Q A;  5H5S A;  1XW9 A;  3G7J A;  2LEG A;  3TJK A;  4YAP A;  5GSS A;  2RUE A;  5HFG A;  1FO5 A;  4KX4 A;  2LJK A;  2H71 A;  4BL7 A;  2LQQ A;  4PUR A;  3UMA A;  5IQY A;  1R5A A;  2FWE A;  1KBN A;  1M7T A;  2Z9S A;  1FB0 A;  5ECK B;  5HFI A;  1T7P B;  1YKC A;  3ZVJ A;  4J56 E;  2DSA A;  4EVM A;  1EV9 A;  1K0C A;  5EY6 A;  1F9M A;  4HQS A;  4KCE A;  1A8Y A;  2IPA A;  2A2R A;  5CO3 A;  4EDZ A;  3P2A A;  1PGT A;  2JZS A;  18GS A;  3BJ5 A;  4IHU A;  1XCC A;  2VM1 A;  3IXR A;  3RAZ A;  4MPF A;  2HZF A;  2CZ2 A;  1WJK A;  3HVV A;  1OE8 A;  1KEB A;  3TDG A;  1GH2 A;  1U87 A;  2VIM A;  4ZBA A;  2H75 A;  3IE3 A;  1GTB A;  3GNJ A;  5D96 A;  5IMD A;  3GV1 A;  2KHP A;  3VFI A;  2FHE A;  1WP0 A;  2CX4 A;  2F8A A;  5GAP D;  1QUW A;  3I43 A;  1M2D A;  2HRF A;  4V1A g;  1G6Y A;  4TN8 A;  5A4U A;  4G2E A;  4ZBD A;  1F3A A;  1M0U A;  2O8V B;  3DEX A;  1XWB A;  2H72 A;  4WBJ A;  3TRQ A;  1GUM A;  1B8X A;  4J2F A;  3BOA A;  1BED A;  2O89 A;  4PQH A;  4G10 A;  4XS1 A;  1TRS A;  4HZ4 A;  3M9K A;  2P5Q A;  4GWR A;  4WXT A;  3QD9 A;  3W6G A;  5D9V A;  4GLT A;  3I9V 2;  3IBH A;  1X9W B;  4JRR A;  3A5W A;  3KH7 A;  3KM6 A;  1GUL A;  5HQP A;  1K0B A;  4HDE A;  3V1W A;  2C4J A;  5AIX A;  1ZL9 A;  2F3M A;  1PKW A;  5CP1 A;  3EYT A;  4TW5 A;  2BMX A;  4NHW A;  2GT5 A;  1G0T A;  3CRU A;  3HA9 A;  1ZYQ B;  2KUC A;  4DSS B;  1YF1 A;  1S3A A;  2C8U A;  4G19 A;  3IDV A;  3D21 A;  3IA1 A;  4EF0 A;  5J5N A;  1QXH A;  2LJR A;  3DML A;  1X5E A;  2VL2 A;  3KMN A;  3GST A;  1FOV A;  5FHI A;  3QCP A;  4RQX A;  1F2E A;  2B1K A;  2GZP A;  4ZIL A;  1SK2 A;  1JZD A;  1XVQ A;  5B8A A;  1R7H A;  3ZIJ A;  1SJI A;  4KND A;  4AJ6 A;  3LXZ A;  4EL1 A;  4Q5F A;  1DUG A;  1TRU A;  4E8H A;  4I2T A;  4KSO A;  4NHZ A;  2BJX A;  1MEK A;  2MBS A;  5B6N A;  1TK0 B;  4YAV A;  1A24 A;  1WWJ A;  1YEX A;  3ZL5 A;  2IMK A;  2LUS A;  4HOJ A;  4O7H A;  5IO0 A;  2KP2 A;  1EV4 A;  2DJK A;  1ZOF A;  1XWA A;  1ZYE A;  8GSS A;  4ACS A;  4MLY A;  1WOU A;  2MMN A;  2XBI A;  3NZN A;  2AJQ B;  1SJZ A;  1PMT A;  1UVZ A;  2HRN A;  3VLN A;  2WGR A;  3H8Q A;  2CT6 A;  3LSZ A;  3TUE A;  5D9T A;  5JCW A;  3RPN A;  1THO A;  4YH2 A;  3E3E A;  3KMO A;  3KP9 A;  2VL9 A;  4IVF A;  4ULX A;  3D4T A;  4OO5 A;  3KCM A;  2DLX A;  2L6D A;  1TK5 B;  1H75 A;  3H1N A;  4HI7 A;  1SKS B;  5D93 A;  4ML6 A;  3HDC A;  3E0U A;  1FHE A;  3QMX A;  3RHC A;  4IQA A;  3KTB A;  1M9A A;  1Q4J A;  1JZW A;  2PGT A;  5IPG A;  2I4A A;  4JBB A;  4WF5 A;  1HYU A;  3CYN A;  2IWT A;  1NM3 A;  3UAP A;  5EL8 A;  3ZMK A;  3ZVJ D;  3GA4 A;  1TI1 A;  1XWG A;  3IOS A;  2AYT A;  2I9H A;  5AN1 A;  1BQ7 A;  1TXX A;  3A2W A;  1NSW A;  4KAE A;  4V2L A;  2YNX A;  2FLS A;  5KN3 A;  3DD3 A;  3US3 A;  3QR6 A;  4OFT A;  5CNW A;  2PPT A;  2V2G A;  3F8U A;  1EEJ A;  1EGR A;  2L57 A;  2RM6 A;  1M99 A;  1GLQ A;  5J9B A;  2ZCT A;  6GSY A;  5JWO B;  1TDI A;  5J41 A;  3VI7 A;  3ISO A;  4LL4 B;  1GWC A;  4BPY A;  3ZTL A;  3GYK A;  1X9S B;  3D0Z A;  1MDK A;  4IN0 A;  2E2M A;  5CRD A;  4ZL7 A;  4F2I A;  1ZGN A;  2VCX A;  1SYX A;  2B1L A;  2B7K A;  2F51 A;  1K0A A;  2I3Y A;  3BD2 A;  4KA0 A;  5DAL A;  3VWU A;  1MD3 A;  1JFU A;  1ERT A;  2N5A A;  2YZH A;  5D8I A;  1YF0 A;  5IPH A;  1ERW A;  3HVS A;  3SWL A;  5D9X A;  2MMZ A;  1B4Q A;  1BJX A;  4JR6 A;  4KSM A;  1VRS D;  2PUK C;  2JSY A;  1SKW B;  5B8B A;  1DBY A;  1C72 A;  1EEM A;  4K1F A;  2A4V A;  3ZFB A;  3F0I A;  4WR5 A;  1O6J A;  3FRC A;  2HSY A;  3M9J A;  5ECS A;  4XIH A;  3A3T A;  4KGI A;  2KOK A;  2PMT A;  4XCS A;  3O3T A;  5IMA A;  1CQH A;  1FB6 A;  5KN0 A;  1ZCP A;  4KB3 A;  3CXG A;  4BWQ A;  2HE3 A;  3L9V A;  3C73 A;  2DIY A;  1HNB A;  4OCF A;  4POB A;  3TOU A;  2VCT A;  4N0V A;  3QAG A;  1RW1 A;  4JR4 A;  1AXD A;  4H86 A;  4TR3 A;  2GS3 A;  2VAF A;  1H4O A;  3SBC A;  1Y6E A;  3O6T A;  2ZNM A;  2LRN A;  2YN1 A;  3KH9 A;  3UEM A;  4BWS A;  1SEN A;  3D4M A;  4OD7 A;  3CRT A;  2K8V A;  1ZZY A;  1XVW A;  1F37 A;  3DVW A;  1WE0 A;  2G0F A;  1O85 A;  4FH8 A;  2H76 A;  2RLI A;  4IBP A;  3J7Y b;  2IFQ B;  3UVH A;  1F6M C;  3IC4 A;  2GLR A;  4Q5Q A;  2L5O A;  1FW1 A;  5KEJ A;  4LMV A;  4RI7 A;  2PVQ A;  2YOI A;  1U3A A;  2G2Q A;  4OWY A;  2OE0 A;  3L78 A;  3RBT A;  1XOB A;  3LG6 A;  3UL3 A;  2OBI A;  3GX8 A;  4N10 A;  5G31 A;  3UBK A;  1X5C A;  1K3Y A;  2H1B A;  1N2A A;  1ZMA A;  2OA7 A;  1S3D A;  2REM A;  4ILF A;  2H6Z A;  4OFN A;  5IMZ A;  2H66 A;  1SD9 A;  2MMO A;  5JCG A;  4I2U A;  2L4Q A;  2P0G A;  3BCI A;  3F3R A;  4ZL8 A;  3HHV A;  3HJP A;  1Y25 A;  3IHQ A;  2WRT A;  13GS A;  1NW2 A;  2J9H A;  3R2Q A;  3L4N A;  3NIV A;  2FA4 A;  2F8F A;  1XBS A;  2H1A A;  5E59 A;  5IMF A;  2HYX A;  5GAN D;  1GSD A;  3ZIT A;  2EIQ A;  3TJG A;  1EP8 A;  4PGT A;  1GP1 A;  2H70 A;  4TVE A;  3N5O A;  4O5R A;  1A0F A;  4ZB9 A;  1V40 A;  11GS A;  3ZIV A;  1TP9 A;  5HR3 A;  4HQZ A;  1XWK A;  5F06 A;  2DIZ A;  1V98 A;  3VPQ A;  1X5D A;  3PGT A;  5DBQ A;  1XWC A;  7GSS A;  1VGL A;  2LNT A;  4ZL9 A;  2N5F A;  3C7M A;  4MH3 A;  3C71 A;  2WCI A;  4ML1 A;  3MDK A;  3TKR A;  3CBU A;  3QFA C;  4K6X A;  2C80 A;  4RI6 A;  4TOP A;  5AIV A;  1QQ2 A;  3IK9 A;  3KIJ A;  1M9B A;  4L0U A;  4ECI A;  4PNF A;  5EPF A;  1EOH A;  4MJB A;  3IK7 A;  3VWW A;  4XTS A;  1AC1 A;  3D5J A;  2MBT A;  3LGC A;  3H93 A;  5CRG A;  4K7N A;  1V2A A;  5ECL B;  1MD4 A;  4QL9 A;  2EC4 A;  2K18 A;  1A0R P;  3P8W A;  1SL2 B;  1HQO A;  4QL7 A;  3MAK A;  4HJ2 A;  2DJ1 A;  3TKS A;  19GS A;  2WDU A;  3APQ A;  1IYH A;  1FVJ A;  1XIY A;  1RQM A;  4K7O A;  4NAX A;  4NWY A;  5J4U A;  2TRX A;  2LRT A;  1PX6 A;  3FW2 A;  5H5Q A;  4EO3 A;  4N30 A;  2E2G A;  4CHS A;  2OJL A;  4CW9 A;  1PN9 A;  4K9Z A;  2C3Q A;  2P31 A;  1SD8 A;  2CAI A;  3UOM A;  2CVB A;  4I6X A;  4FYU A;  1WMJ A;  4MPG A;  3VPT A;  2AAW A;  4MA9 A;  2X8G A;  1QFN A;  3BCK A;  5C04 A;  2D2Z A;  1SL1 B;  5HR1 A;  1K0N A;  4F03 A;  4ISD A;  1JHB A;  3F6D A;  1GSF A;  4DSS A;  2JU5 A;  4ZB6 A;  3G7I A;  3EMP A;  2H1D A;  2O87 A;  2OKA A;  3A2X A;  1GTI A;  1FAA A;  3VUR A;  4EKZ A;  2EIO A;  1T1V A;  6GSV A;  1B9Y C;  2K6V A;  1U6T A;  5ID2 B;  1QGV A;  4PX1 A;  5GZZ B;  4WR4 A;  2O7K A;  4KDU A;  3HD5 A;  5ECR B;  3HZ8 A;  6GSX A;  2LRC A;  1GSY A;  2H6Y A;  3DKS A;  2HZE B;  3TRP A;  3QFB C;  1G7E A;  3U5R E;  2IJY A;  3FHK A;  5F0G A;  1XW5 A;  1GSE A;  1CQG A;  4NMU A;  3FZ4 A;  4MJC A;  4LMW A;  5KN2 A;  3QAW A;  1GLP A;  4G9H A;  1THX A;  2FA8 A;  3HKR A;  5E4W A;  1B48 A;  5KN1 A;  2QSI A;  2WJU A;  1OE7 A;  1V57 A;  5LCZ A;  1PL1 A;  1VF4 A;  3DWV A;  2YV7 A;  3APO A;  4MH2 A;  3WD6 A;  1I5G A;  2CX3 A;  2YWO A;  5G1K A;  4GQF A;  1HNA A;  2YV9 A;  3L9U A;  1A2M A;  3GIX A;  1KTE A;  4EE0 A;  1O7U A;  3EWL A;  1W89 A;  4HU9 A;  1VF2 A;  2C0E A;  3LJR A;  2IL3 A;  2GZZ A;  1K3L A;  2WFC A;  1PSQ A;  1LU4 A;  3LEF A;  2B7J A;  2JAD A;  3F63 A;  4J57 E;  2OE3 A;  4TXV A;  5DVB A;  4PNG A;  2IME A;  3LOR A;  4K7I A;  2C0G A;  4GCI A;  2MZC A;  2B5X A;  2YZU A;  4KCA A;  2VO4 A;  1OAZ A;  1JLV A;  2OAC A;  2YAN A;  1FVK A;  3DXB A;  4PXO A;  2H1G A;  1EZK A;  2HFD A;  1S3C A;  2VL3 A;  5COH A;  2VM2 A;  3I6A A;  3RPP A;  4XS4 B;  2GGT A;  4RQR A;  5ELG A;  4N0Z A;  5J3R A;  4L5O A;  1O81 A;  3IAM 2;  1AQV A;  4GTU A;  1ACV A;  5C00 A;  2CZ3 A;  3DVX A;  5G1L A;  2ON5 A;  5AGY A;  4WF4 A;  2YWM A;  3L0H A;  4ECC A;  1JZO A;  3UJ1 A;  3W8J A;  4MF6 A;  5B7C A;  6GST A;  1N8J A;  4I8B A;  2ES7 A;  4EC0 A;  3PH9 A;  1Z7P A;  1Z7R A;  4HU7 A;  2KLX A;  3HJO A;  3KGK A;  4GXZ A;  5G2Z A;  4TKY A;  3WGE A;  2J23 A;  1G7O A;  4XRD A;  3WGD A;  5IOW A;  5ECI B;  14GS A;  1X0R A;  1SL0 B;  4XRA A;  4F9Z A;  2RII A;  1YDK A;  4V2N A;  3FZ9 A;  3QPM A;  2L59 A;  3AY8 A;  1E6B A;  1EP7 A;  3LWA A;  1EWX A;  1ON4 A;  4GST A;  2AB6 A;  2PBJ A;  2VL2 C;  2DJ3 A;  4MJA A;  3ERF A;  2HXK A;  1AQW A;  3ZML A;  1K0M A;  2RM5 A;  4V2M A;  2JL4 A;  3FZ5 A;  3UIW A;  3GHA A;  5JWQ B;  5CRE A;  3I69 A;  1PRX A;  3TKQ A;  3IAS 2;  5D73 A;  4D73 B;  3S9F A;  5CRW A;  4IGJ A;  3FR3 A;  2IMI A;  3WT1 A;  4TRX A;  1PKZ A;  1EGO A;  2RUF A;  1M2A A;  3DYR A;  4DSQ A;  1WIK A;  2E0Q A;  1DE1 A;  1K0O A;  5EVO A;  3ME8 A;  2XPD A;  3TCO A;  3GRX A;  2C0F A;  2LST A;  1XFL A;  2P5R A;  5DJM A;  3ME7 A;  2DBC A;  1R4W A;  1ABA A;  1K3O A;  4MZC A;  2H30 A;  2GQM A;  4LLR A;  5G5E A;  1GUK A;  2GDR A;  2H01 A;  2HI7 A;  1MDI A;  1TKD B;  4TXO A;  2VLV A;  2LJA A;  3EUR A;  4MAB A;  4ZBB A;  2VLU A;  1J0F A;  1XW6 A;  3EMX A;  2R6K A;  1R5P A;  5A5K A;  2N5B A;  2LQO A;  2GSS A;  4TXO B;  2IFQ A;  4IQ1 A;  1ML6 A;  5LNK e;  3P7X A;  1UC7 A;  4OFM A;  1QMV A;  4CDO A;  5FWG A;  3JCM L;  2CAQ A;  2H0G A;  1TRV A;  4LL1 B;  2FWG A;  3MNG A;  2FD3 A;  3GL3 A;  4MMM A;  3TKP A;  1GL8 A;  3FY7 A;  1YY7 A;  2CVD A;  1A2L A;  5CAX A;  1GTU A;  4MDC A;  5DCH A;  5A4V A;  2PN8 A;  5DQS A;  2VUP A;  5CRH A;  1T3B A;  1GNE A;  2VCW A;  4POM A;  4K8M A;  4P3Y B;  4X0X A;  2HNL A;  2TIR A;  4KW6 A;  1SYR A;  1XZO A;  5CYY A;  1ERV A;  1TJD A;  3G9B A;  4DSR A;  5DAK B;  1V9W A;  5B6M A;  1JZR A;  3GKN A;  1SU9 A;  3ZRE A;  2LS5 A;  1O8X A;  1LBK A;  2TRC P;  3UBL A;  1MDJ A;  4PUA A;  3F4R A;  3DIE A;  2IIY A;  3ERW A;  1T4Z A;  4F0C A;  1K0D A;  1V58 A;  5JWR B;  4HUA A;  5INY A;  2K8S A;  3CSJ A;  5G5F A;  1GTA A;  4E8E A;  1BX9 A;  1KNG A;  1AQX A;  4F0B A;  3ED3 A;  3Q6O A;  5IOX A;  4GF0 A;  1J08 A;  4X1U A;  2GSR A;  5J9C A;  4AGS A;  2WUL A;  2R4V A;  5DDL A;  3C8E A;  3BBY A;  3HJM A;  3KP8 A;  1JLW A;  2M72 A;  5HR0 A;  2X8H A;  2VLT A;  2V6K A;  4MF7 A;  3UAR A;  5HFK A;  1HNC A;  1E2Y A;  4KH7 A;  1WPI A;  1SJ6 A;  2YCD A;  4K0N A;  2WB9 A;  2H0H A;  3M3M A;  2QC7 A;  4EUY A;  2DML A;  1YKA A;  1SK0 A;  2F9S A;  3OR5 A;  1Z3E A;  4JZQ A;  4IW9 A;  2YJ7 A;  4WET A;  3TGZ A;  3F9U A;  1NHO A;  4L8E A;  3KZQ A;  4IS0 A;  2HSH A;  2OBK A;  4PQ1 A;  3IV4 A;  3EU4 A;  1TRW A;  1PX7 A;  2V32 A;  3TJJ A;  1OC8 A;  2C3N A;  1J9B A;  4O32 A;  1OYJ A;  9GSS A;  4OCE A;  3U6V A;  4EDY A;  4ECJ A;  10GS A;  2IMF A;  3EIN A;  4PQI A;  3F6F A;  1I9D A;  1GSU A;  3N9J A;  4ZXG A;  5F07 A;  2WZ9 A;  5H5R A;  1Q98 A;  1MTC A;  4ZIJ A;  3CSH A;  1DSB A;  4MK3 A;  1QK8 A;  2I81 A;  2GQL A;  1ILO A;  2PU9 C;  2X8C A;  2R5G A;  1PA3 A;  3KD0 A;  5ECN B;  3GTU A;  3TB2 A;  1GSQ A;  4Q5N A;  3WT2 A;  4YQM A;  3IRA A;  5F8B A;  4NPB A;  2R2J A;  1BG5 A;  2PWJ A;  2XHF A;  4WKW A;  5ID2 A;  2KP1 A;  3GTU B;  4QQ7 A;  2XC2 A;  5JCU A;  2PVO C;  2O85 A;  2CA8 A;  4ZB8 A;  3HYP A;  1TU8 A;  2VOC A;  2C1Y A;  16GS A;  1B4P A;  3C1S A;  3HCZ A;  3CSI A;  2HZE A;  4V1A p;  1A8L A;  1W4V A;  4XHM A;  2IMD A;  3Q19 A;  2OE1 A;  5G30 A;  1T00 A;  4KE3 A;  1YZX A;  1URM A;  1PL2 A;  2FNO A;  2AHE A;  4ECB A;  4Z7X A;  3EU3 A;  1BAY A;  1PD2 1;  2B5Y A;  2CQ9 A;  2VCZ A;  3GX0 A;  4OMV A;  2GST A;  4OO4 A;  2HLS A;  1DE2 A;  3EE2 A;  3RHB A;  3LQ7 A;  3MSZ A;  4WEY A;  2E7P A;  1YQ1 A;  3W8S A;  4HS1 A;  1TK8 B;  4L5L A;  2NTO A;  3GH9 A;  4HZ2 A;  3KTL A;  4KDY A;  5ECQ B;  2B6M A;  1USB A;  3NOF A;  4WBR D;  3F3Q A;  5IM9 A;  4F82 A;  2MMA A;  3H79 A;  3DGQ A;  1U3I A;  4L0W A;  3UVT A;  3VK9 A;  1U88 A;  4POL A;  4ID0 A;  4KDX A;  2M80 A;  1O73 A;  1R26 A;  4YQU A;  1SKR B;  3K8N A;  2H73 A;  3FR9 A;  5FT3 A;  1OVN A;  2K9F A;  5LD0 A;  1XXU A;  3LYK A;  3LXT A;  3GL5 A;  3FR6 A;  2FUG 2;  2GTU A;  3IR4 A;  2DMM A;  1Z6N A;  3HVX A;  1ST9 A;  1OKT A;  3FZA A;  3WGX A;  1GRX A;  1GNW A;  4IP6 A;  2YWI A;  5ELA A;  4BVX A;  2LTK A;  2GQK A;  3D22 A;  4AJ7 A;  4GSS A;  3KEB A;  3TRX A;  1T8E B;  2I1U A;  3TJF A;  2CV4 A;  20GS A;  3VI5 A;  4XS4 A;  5ABR A;  4GQC A;  3G7Y A;  2OAD A;  2L6C A;  2NBS A;  5L71 A;  2QGV A;  3TKS C;  2A2S A;  2XPE A;  4I97 A;  4NV2 A;  4POK A;  4BA7 A;  3GH6 A;  2B3S A;  1HD2 A;  1SK1 A;  1OC9 A;  2PER A;  2JZR A;  3HY2 A;  2R3X A;  5ECH B;  2MYG A;  4XS6 A;  4PUF C;  5AIS A;  1OC9 B;  1LJR A;  2CVK A;  2HT9 A;  1OKD A;  4AJ8 A;  5HR2 A;  2EIR A;  4IKH A;  4K2D A;  2WS2 A;  3RDW A;  2H6X A;  2C3T A;  1OC3 A;  1ERU A;  2JZT A;  4N11 A;  2VD1 A;  3GMF A;  2DC5 A;  17GS A;  3WYW A;  6GSW A;  3ZZX A;  2NDO A;  4GRF A;  4TR1 A;  1B9X C;  1G6W A;  4MJE A;  4O92 A;  2YWN A;  2LKU A;  2GSQ A;  4HJM A;  1NHY A;  4TR1 B;  1IYI A;  2YPM A;  3H4K A;  12GS A;  1UA5 A;  6GSS A;  2IN3 A;  1GUH A;  3A2V A;  1WRY A;  2GT6 A;  1RK4 A;  2B5E A;  2M46 A;  3GN3 A;  4Q5R A;  2NVL A;  1AUC A;  4IJ3 A;  2GZY A;  1UN2 A;  1M2B A;  4EXJ A;  1TW9 A;  6GSU A;  1Z5Y E;  1EOG A;  1F3B A;  4D73 A;  3E9J B;  5IMV A;  2H74 A;  4NV5 A;  2QKE A;  3F4T A;  5DAL B;  5A4W A;  5IMC A;  2V6O A;  1Z9H A;  5DCG A;  3APS A;  3GUS A; 
#chains in the Genus database with same CATH topology
 4HEA 2;  4YQV A;  3FEU A;  1Z6M A;  3M0F A;  3GUR A;  4IJI A;  3EVI A;  2NPB A;  3O76 A;  4RUV A;  4X43 A;  4FYC A;  2VCQ A;  3CMI A;  3ZLP A;  3L9S A;  2FWH A;  2YJH A;  5IIZ A;  3KXO A;  2FWF A;  5DQY A;  1XPV A;  4MF5 A;  4FIW A;  4MZB A;  3GKX A;  1VF3 A;  4FYB A;  3FKF A;  3KJY A;  3PIN A;  3ZYW A;  3FK8 A;  4JE1 A;  2AV4 A;  4DEJ A;  2R37 A;  3QAV A;  2LNS A;  5ECP B;  4LA1 A;  3Q18 A;  1O8W A;  3QDN A;  1A23 A;  3GSS A;  5ENU A;  4IEL A;  2R0G A;  3TOT A;  3CTG A;  2L5L A;  4AF2 A;  1BYE A;  1T4Y A;  1M3I A;  2DJ2 A;  3F4S A;  3CTF A;  3HXS A;  2ALB A;  1TI3 A;  2H19 A;  2YP6 A;  2XBQ A;  4MP4 A;  2V41 A;  2V1M A;  4BVY A;  2LV3 A;  2H8L A;  2H0I A;  1YEP A;  2VD0 A;  1AAZ A;  3VWX A;  3D6I A;  2FY6 A;  2X99 A;  2DJJ A;  3PR8 A;  5F05 A;  3HZ4 A;  5DJL A;  3Q74 A;  2GVP A;  1X9M B;  2ON7 A;  4JU5 A;  5DAK A;  22GS A;  3EC3 A;  3TJB A;  3FYG A;  3ZRD A;  1TTZ A;  3IPZ A;  2BTO T;  2DJ0 A;  3TKS E;  1XOA A;  3GKM A;  2X64 A;  4EIP A;  4GSN A;  3DRN A;  2JSZ A;  2FCH A;  3LYP A;  3VWV A;  4MCU A;  3ERG A;  3ZFL A;  2C0D A;  4DVC A;  4JED A;  1GSS A;  3QOU A;  2AUV A;  3M1G A;  4FO5 A;  1VF1 A;  1AIU A;  5D9W A;  3MWH A;  4KUN A;  1TU7 A;  3J7Y k;  3C1R A;  2VCV A;  1TOF A;  3GKK A;  4NXI A;  4TR4 A;  4MZW A;  4TR0 A;  5ECO B;  3PPU A;  4IP1 A;  5GST A;  2ZUP A;  1YJ6 A;  2L4C A;  1A2J A;  3LFL A;  1AW9 A;  2JAC A;  3GFK A;  5IO2 A;  3P90 A;  1FG4 A;  5ECM B;  4K0G A;  3M8N A;  2FGX A;  1PQN A;  4I5Q A;  5H5S A;  1XW9 A;  3G7J A;  2LEG A;  3TJK A;  4YAP A;  5GSS A;  2RUE A;  2HSM A;  5HFG A;  1FO5 A;  4KX4 A;  2LJK A;  2DKI A;  2H71 A;  4BL7 A;  2LQQ A;  4PUR A;  3UMA A;  5IQY A;  1R5A A;  2FWE A;  1KBN A;  1M7T A;  2Z9S A;  1FB0 A;  4EIQ A;  5ECK B;  5HFI A;  1T7P B;  1YKC A;  3ZVJ A;  4J56 E;  2DSA A;  4EVM A;  1EV9 A;  1K0C A;  5EY6 A;  1F9M A;  4HQS A;  4KCE A;  1A8Y A;  2IPA A;  2A2R A;  5CO3 A;  4EDZ A;  3P2A A;  1PGT A;  2JZS A;  18GS A;  3BJ5 A;  4IHU A;  1XCC A;  2VM1 A;  3IXR A;  3RAZ A;  4MPF A;  2HZF A;  2CZ2 A;  1WJK A;  3HVV A;  1OE8 A;  1KEB A;  3TDG A;  1GH2 A;  1U87 A;  2VIM A;  4ZBA A;  2H75 A;  3IE3 A;  1GTB A;  3GNJ A;  5D96 A;  5IMD A;  3GV1 A;  2KHP A;  3VFI A;  2FHE A;  1WP0 A;  2CX4 A;  2F8A A;  5GAP D;  1QUW A;  3I43 A;  1M2D A;  2HRF A;  4V1A g;  1G6Y A;  4TN8 A;  5A4U A;  4G2E A;  4ZBD A;  1F3A A;  1M0U A;  2O8V B;  3DEX A;  1XWB A;  2H72 A;  4WBJ A;  3TRQ A;  1GUM A;  1B8X A;  4J2F A;  3BOA A;  1BED A;  2O89 A;  4PQH A;  4G10 A;  4XS1 A;  1TRS A;  4HZ4 A;  3M9K A;  2P5Q A;  4GWR A;  4WXT A;  3QD9 A;  3W6G A;  5D9V A;  4GLT A;  3I9V 2;  3IBH A;  3A5I A;  1X9W B;  4JRR A;  3A5W A;  3KH7 A;  3KM6 A;  1GUL A;  5HQP A;  1K0B A;  4HDE A;  3V1W A;  2C4J A;  5AIX A;  1ZL9 A;  2F3M A;  1PKW A;  5CP1 A;  3EYT A;  4TW5 A;  2BMX A;  4NHW A;  2GT5 A;  1G0T A;  3CRU A;  3HA9 A;  1ZYQ B;  2KUC A;  4DSS B;  3EPT A;  1YF1 A;  1S3A A;  2C8U A;  4G19 A;  3IDV A;  3D21 A;  3IA1 A;  4EF0 A;  5J5N A;  1QXH A;  2LJR A;  3DML A;  1X5E A;  2VL2 A;  3KMN A;  3GST A;  1FOV A;  1PFO A;  5FHI A;  3QCP A;  4RQX A;  1F2E A;  2B1K A;  2GZP A;  4ZIL A;  1SK2 A;  1JZD A;  1XVQ A;  5B8A A;  1R7H A;  3ZIJ A;  1SJI A;  4KND A;  4AJ6 A;  3LXZ A;  4EL1 A;  4Q5F A;  1DUG A;  1TRU A;  4E8H A;  4I2T A;  4KSO A;  4NHZ A;  2BJX A;  1MEK A;  2MBS A;  5B6N A;  1TK0 B;  4YAV A;  1A24 A;  1WWJ A;  1YEX A;  3ZL5 A;  2IMK A;  2LUS A;  4HOJ A;  4O7H A;  5IO0 A;  2KP2 A;  1EV4 A;  2DJK A;  1ZOF A;  1XWA A;  1ZYE A;  8GSS A;  4ACS A;  4MLY A;  1WOU A;  2MMN A;  2XBI A;  3NZN A;  2AJQ B;  3LW9 A;  1SJZ A;  1PMT A;  1UVZ A;  2HRN A;  3VLN A;  2WGR A;  3H8Q A;  2CT6 A;  3LSZ A;  3TUE A;  5D9T A;  5JCW A;  3RPN A;  1THO A;  4YH2 A;  3E3E A;  3KMO A;  3KP9 A;  2VL9 A;  4IVF A;  4ULX A;  3D4T A;  4OO5 A;  3KCM A;  2DLX A;  2L6D A;  1TK5 B;  1H75 A;  3H1N A;  4HI7 A;  1SKS B;  5D93 A;  4ML6 A;  3HDC A;  3E0U A;  1FHE A;  3QMX A;  3RHC A;  4IQA A;  3KTB A;  1M9A A;  1Q4J A;  1JZW A;  2PGT A;  5IPG A;  2I4A A;  4JBB A;  4WF5 A;  1HYU A;  3CYN A;  2IWT A;  1NM3 A;  3UAP A;  5EL8 A;  3ZMK A;  3ZVJ D;  3GA4 A;  1TI1 A;  1XWG A;  4A5P A;  3IOS A;  2AYT A;  2I9H A;  5AN1 A;  1BQ7 A;  1TXX A;  3HVN A;  3A2W A;  1NSW A;  4KAE A;  4V2L A;  2YNX A;  2FLS A;  5KN3 A;  3DD3 A;  3US3 A;  3QR6 A;  4OFT A;  5CNW A;  2PPT A;  2V2G A;  4K2X A;  3F8U A;  1EEJ A;  1EGR A;  2L57 A;  2RM6 A;  1M99 A;  1GLQ A;  5J9B A;  4CY8 A;  2ZCT A;  6GSY A;  5JWO B;  1TDI A;  5J41 A;  3VI7 A;  3ISO A;  4LL4 B;  1GWC A;  4BPY A;  3ZTL A;  3GYK A;  1X9S B;  3D0Z A;  1MDK A;  4IN0 A;  4CY6 A;  2E2M A;  5CRD A;  4ZL7 A;  2QA1 A;  4F2I A;  1ZGN A;  2VCX A;  1SYX A;  2B1L A;  2B7K A;  2F51 A;  1K0A A;  2I3Y A;  3BD2 A;  4KA0 A;  5DAL A;  3VWU A;  1MD3 A;  1JFU A;  1ERT A;  2N5A A;  2YZH A;  5D8I A;  1YF0 A;  4K5R A;  4O5Q A;  5IPH A;  1ERW A;  3HVS A;  3SWL A;  5D9X A;  2MMZ A;  1B4Q A;  1BJX A;  4JR6 A;  4KSM A;  1VRS D;  2PUK C;  2JSY A;  1SKW B;  5B8B A;  2A4H A;  1DBY A;  1C72 A;  1EEM A;  4K1F A;  2A4V A;  3ZFB A;  3F0I A;  4WR5 A;  1O6J A;  3FRC A;  2HSY A;  3M9J A;  5ECS A;  4XIH A;  3A3T A;  4KGI A;  2KOK A;  2PMT A;  4XCS A;  5KOX A;  3O3T A;  5IMA A;  1CQH A;  1FB6 A;  5KN0 A;  1ZCP A;  4KB3 A;  3CXG A;  4BWQ A;  2HE3 A;  3L9V A;  3C73 A;  2DIY A;  1HNB A;  4OCF A;  4POB A;  3TOU A;  2VCT A;  4N0V A;  3QAG A;  1RW1 A;  4JR4 A;  1AXD A;  4H86 A;  4TR3 A;  2GS3 A;  2VAF A;  1H4O A;  3SBC A;  1Y6E A;  3R3E A;  3O6T A;  2ZNM A;  2LRN A;  2YN1 A;  3KH9 A;  3UEM A;  4BWS A;  1SEN A;  3D4M A;  4OD7 A;  3CRT A;  2K8V A;  1ZZY A;  1XVW A;  1F37 A;  3DVW A;  1WE0 A;  2G0F A;  1O85 A;  4FH8 A;  2H76 A;  2RLI A;  4IBP A;  3J7Y b;  2IFQ B;  3UVH A;  1F6M C;  3IC4 A;  2GLR A;  4Q5Q A;  2L5O A;  1FW1 A;  4USS A;  5KEJ A;  4LMV A;  4RI7 A;  2PVQ A;  2YOI A;  1U3A A;  2G2Q A;  4OWY A;  2OE0 A;  3L78 A;  3RBT A;  1XOB A;  3LG6 A;  3UL3 A;  2OBI A;  3GX8 A;  4N10 A;  5G31 A;  3UBK A;  1X5C A;  1K3Y A;  2H1B A;  1N2A A;  1ZMA A;  2OA7 A;  1S3D A;  2REM A;  4ILF A;  2H6Z A;  4OFN A;  5IMZ A;  2H66 A;  1SD9 A;  2MMO A;  5JCG A;  4I2U A;  2L4Q A;  2P0G A;  3BCI A;  3F3R A;  4ZL8 A;  3HHV A;  3HJP A;  1Y25 A;  3IHQ A;  2WRT A;  13GS A;  1NW2 A;  2J9H A;  3R2Q A;  3L4N A;  3NIV A;  2FA4 A;  2F8F A;  1XBS A;  2H1A A;  5E59 A;  5IMF A;  2HYX A;  5GAN D;  1GSD A;  3ZIT A;  2EIQ A;  3TJG A;  1EP8 A;  4PGT A;  1GP1 A;  2H70 A;  4TVE A;  3N5O A;  4O5R A;  1A0F A;  4ZB9 A;  1V40 A;  11GS A;  3ZIV A;  1TP9 A;  1S3R A;  5HR3 A;  4HQZ A;  1XWK A;  5F06 A;  2DIZ A;  1V98 A;  3VPQ A;  1X5D A;  3PGT A;  5DBQ A;  1XWC A;  7GSS A;  1VGL A;  2LNT A;  4ZL9 A;  2N5F A;  3C7M A;  4MH3 A;  3C71 A;  2WCI A;  4ML1 A;  3MDK A;  3TKR A;  3CBU A;  3QFA C;  4K6X A;  2C80 A;  4RI6 A;  4TOP A;  5AIV A;  1QQ2 A;  3IK9 A;  3KIJ A;  5BRT A;  1M9B A;  4L0U A;  4ECI A;  4K5S A;  4PNF A;  5EPF A;  1EOH A;  4MJB A;  3IK7 A;  3VWW A;  4XTS A;  1AC1 A;  3D5J A;  2MBT A;  3LGC A;  3H93 A;  5CRG A;  4K7N A;  1V2A A;  2DKH A;  5ECL B;  1MD4 A;  4QL9 A;  2EC4 A;  2K18 A;  1A0R P;  3P8W A;  1SL2 B;  1HQO A;  4QL7 A;  3MAK A;  4HJ2 A;  2DJ1 A;  3TKS A;  19GS A;  2WDU A;  3APQ A;  1IYH A;  1FVJ A;  1XIY A;  4BIK A;  1RQM A;  4K7O A;  4NAX A;  4NWY A;  5J4U A;  2TRX A;  2LRT A;  1PX6 A;  3FW2 A;  5H5Q A;  4EO3 A;  4N30 A;  2E2G A;  4CHS A;  2OJL A;  4CW9 A;  1PN9 A;  4K9Z A;  2C3Q A;  2P31 A;  1SD8 A;  2CAI A;  3UOM A;  2CVB A;  4I6X A;  4FYU A;  1WMJ A;  4MPG A;  3VPT A;  2AAW A;  4MA9 A;  2X8G A;  1QFN A;  3BCK A;  5C04 A;  2D2Z A;  1SL1 B;  5HR1 A;  1K0N A;  4F03 A;  4ISD A;  1JHB A;  3F6D A;  1GSF A;  4DSS A;  2JU5 A;  4ZB6 A;  3G7I A;  3EMP A;  2H1D A;  2O87 A;  2OKA A;  3A2X A;  1GTI A;  1FAA A;  3VUR A;  4EKZ A;  2EIO A;  1T1V A;  6GSV A;  1B9Y C;  2K6V A;  1U6T A;  5ID2 B;  1QGV A;  4PX1 A;  5GZZ B;  4WR4 A;  2O7K A;  4KDU A;  3HD5 A;  5ECR B;  3HZ8 A;  6GSX A;  2LRC A;  1GSY A;  2H6Y A;  3DKS A;  2HZE B;  3TRP A;  2UZ8 A;  3QFB C;  1G7E A;  3IHG A;  3U5R E;  2IJY A;  3FHK A;  5F0G A;  4YKG A;  1XW5 A;  1GSE A;  1CQG A;  4NMU A;  3FZ4 A;  4MJC A;  4LMW A;  5KN2 A;  3QAW A;  1GLP A;  4G9H A;  1THX A;  2FA8 A;  3HKR A;  5E4W A;  3FMW A;  1B48 A;  5KN1 A;  2QSI A;  2WJU A;  4KF9 A;  1OE7 A;  4X4J A;  1V57 A;  5LCZ A;  1PL1 A;  1VF4 A;  4MNN A;  3DWV A;  2YV7 A;  2X49 A;  3APO A;  4MH2 A;  3WD6 A;  1I5G A;  2CX3 A;  2YWO A;  5G1K A;  4GQF A;  1HNA A;  2YV9 A;  3L9U A;  1A2M A;  3GIX A;  1KTE A;  4EE0 A;  1O7U A;  3EWL A;  1W89 A;  4HU9 A;  1VF2 A;  2C0E A;  3LJR A;  2IL3 A;  2GZZ A;  4HSC X;  1K3L A;  2WFC A;  1PSQ A;  1LU4 A;  3LEF A;  2B7J A;  2JAD A;  3F63 A;  4J57 E;  2OE3 A;  4TXV A;  2R0C A;  3MIX A;  5DVB A;  4PNG A;  2IME A;  3LOR A;  4K7I A;  2C0G A;  4GCI A;  2MZC A;  4O5U A;  2B5X A;  2YZU A;  4KCA A;  2VO4 A;  1OAZ A;  1JLV A;  2OAC A;  2YAN A;  4BVX B;  1FVK A;  3DXB A;  4PXO A;  2H1G A;  1EZK A;  2HFD A;  1S3C A;  2VL3 A;  5COH A;  2VM2 A;  3I6A A;  3RPP A;  4XS4 B;  2GGT A;  4RQR A;  5ELG A;  4N0Z A;  5J3R A;  4L5O A;  1O81 A;  3IAM 2;  1AQV A;  4GTU A;  1ACV A;  5C00 A;  2CZ3 A;  4Z2R A;  3DVX A;  5G1L A;  4ICY A;  2ON5 A;  5AGY A;  4WF4 A;  2YWM A;  3L0H A;  4ECC A;  1JZO A;  3UJ1 A;  3W8J A;  4MF6 A;  5B7C A;  6GST A;  1N8J A;  4I8B A;  2ES7 A;  4EC0 A;  3PH9 A;  1Z7P A;  1Z7R A;  1ZYP A;  4HU7 A;  2KLX A;  3HJO A;  3KGK A;  4GXZ A;  5G2Z A;  4TKY A;  3WGE A;  2J23 A;  1G7O A;  4XRD A;  3WGD A;  5IOW A;  5ECI B;  14GS A;  1X0R A;  1SL0 B;  4G0I A;  4XRA A;  4F9Z A;  2RII A;  1YDK A;  4V2N A;  3FZ9 A;  3QPM A;  2L59 A;  3AY8 A;  1E6B A;  1EP7 A;  3LWA A;  1EWX A;  1ON4 A;  4GST A;  2AB6 A;  2PBJ A;  2VL2 C;  2DJ3 A;  4MJA A;  3ERF A;  2HXK A;  1AQW A;  3ZML A;  1K0M A;  2RM5 A;  4V2M A;  2JL4 A;  3FZ5 A;  3UIW A;  3GHA A;  5JWQ B;  4YKF A;  5CRE A;  3I69 A;  1PRX A;  3TKQ A;  3IAS 2;  5D73 A;  4D73 B;  3S9F A;  5CRW A;  4IGJ A;  3FR3 A;  2IMI A;  3WT1 A;  4TRX A;  1PKZ A;  1EGO A;  2RUF A;  1M2A A;  3DYR A;  4DSQ A;  1WIK A;  2E0Q A;  1DE1 A;  1K0O A;  5EVO A;  3ME8 A;  2XPD A;  3TCO A;  3GRX A;  2C0F A;  2LST A;  1XFL A;  2P5R A;  5DJM A;  3ME7 A;  2DBC A;  1R4W A;  1ABA A;  1K3O A;  4MZC A;  2H30 A;  2GQM A;  4LLR A;  5G5E A;  1GUK A;  2GDR A;  2H01 A;  2HI7 A;  1MDI A;  1TKD B;  4TXO A;  2VLV A;  2LJA A;  3EUR A;  4MAB A;  4ZBB A;  2VLU A;  1J0F A;  1XW6 A;  3EMX A;  2R6K A;  1R5P A;  5A5K A;  2N5B A;  2LQO A;  2GSS A;  1ZYN A;  4TXO B;  2IFQ A;  4IQ1 A;  1ML6 A;  5LNK e;  3P7X A;  1UC7 A;  4OFM A;  1QMV A;  4CDO A;  5FWG A;  3JCM L;  2CAQ A;  2H0G A;  1TRV A;  4LL1 B;  2FWG A;  3MNG A;  2FD3 A;  3GL3 A;  4MMM A;  3TKP A;  1GL8 A;  2QA2 A;  3FY7 A;  1YY7 A;  2CVD A;  1A2L A;  5CAX A;  1GTU A;  4MDC A;  5DCH A;  5A4V A;  2PN8 A;  5DQS A;  2VUP A;  5CRH A;  4BVY B;  1T3B A;  1GNE A;  2VCW A;  5BMU A;  4POM A;  4K8M A;  4P3Y B;  4X0X A;  2HNL A;  2TIR A;  4KW6 A;  1SYR A;  1XZO A;  5CYY A;  1ERV A;  1TJD A;  3G9B A;  4DSR A;  5DAK B;  1V9W A;  5B6M A;  1JZR A;  3GKN A;  1SU9 A;  1PN0 A;  3ZRE A;  2LS5 A;  1O8X A;  1LBK A;  2TRC P;  3UBL A;  1MDJ A;  2HRA A;  4PUA A;  3F4R A;  3DIE A;  2IIY A;  3ERW A;  4G0K A;  1T4Z A;  4F0C A;  1K0D A;  1V58 A;  5JWR B;  4HUA A;  5INY A;  2K8S A;  3CSJ A;  5G5F A;  1GTA A;  4E8E A;  1BX9 A;  1KNG A;  1AQX A;  4F0B A;  3ED3 A;  3Q6O A;  5IOX A;  4GF0 A;  2X4A A;  1J08 A;  4X1U A;  2GSR A;  5J9C A;  4AGS A;  2R0P A;  2WUL A;  2R4V A;  5DDL A;  3C8E A;  3BBY A;  3HJM A;  3KP8 A;  1JLW A;  2M72 A;  5HR0 A;  2X8H A;  2VLT A;  2V6K A;  4MF7 A;  3UAR A;  5HFK A;  1HNC A;  1E2Y A;  4KH7 A;  4BL7 B;  1WPI A;  1SJ6 A;  2YCD A;  4K0N A;  2WB9 A;  2H0H A;  3M3M A;  2QC7 A;  4EUY A;  2DML A;  1YKA A;  1SK0 A;  2F9S A;  3OR5 A;  1Z3E A;  4JZQ A;  4IW9 A;  2YJ7 A;  4WET A;  3TGZ A;  3F9U A;  1NHO A;  4L8E A;  3KZQ A;  4IS0 A;  2HSH A;  2OBK A;  4PQ1 A;  3IV4 A;  3EU4 A;  1TRW A;  1PX7 A;  2V32 A;  3TJJ A;  1OC8 A;  2C3N A;  1J9B A;  4O32 A;  1OYJ A;  9GSS A;  4OCE A;  3U6V A;  4EDY A;  4ECJ A;  10GS A;  2IMF A;  3EIN A;  4PQI A;  3CQF A;  3F6F A;  1I9D A;  4G0L A;  1GSU A;  3N9J A;  4ZXG A;  5F07 A;  2WZ9 A;  5H5R A;  5KOW A;  1Q98 A;  1MTC A;  4ZIJ A;  3CSH A;  1DSB A;  4MK3 A;  1QK8 A;  2I81 A;  2GQL A;  1ILO A;  2PU9 C;  2X8C A;  2R5G A;  1PA3 A;  3KD0 A;  5ECN B;  3GTU A;  3TB2 A;  1GSQ A;  4Q5N A;  3WT2 A;  4YQM A;  3IRA A;  5F8B A;  4NPB A;  2R2J A;  1BG5 A;  2PWJ A;  2XHF A;  4WKW A;  5ID2 A;  2KP1 A;  3GTU B;  4QQ7 A;  2XC2 A;  5JCU A;  2PVO C;  2O85 A;  2CA8 A;  4ZB8 A;  3HYP A;  1TU8 A;  2VOC A;  2C1Y A;  16GS A;  1B4P A;  3C1S A;  3HCZ A;  3CSI A;  2HZE A;  4V1A p;  1A8L A;  1W4V A;  4XHM A;  2IMD A;  3Q19 A;  2OE1 A;  3IC8 A;  5G30 A;  1T00 A;  4KE3 A;  1YZX A;  1URM A;  1PL2 A;  2FNO A;  2AHE A;  4ECB A;  4Z7X A;  3EU3 A;  1BAY A;  1PD2 1;  2B5Y A;  2CQ9 A;  4Z2T A;  2VCZ A;  3GX0 A;  4OMV A;  2GST A;  4OO4 A;  2HLS A;  3MYD A;  1DE2 A;  3EE2 A;  3RHB A;  3LQ7 A;  3MSZ A;  4WEY A;  2E7P A;  1YQ1 A;  3W8S A;  4HS1 A;  1M3J A;  1TK8 B;  4L5L A;  2NTO A;  3GH9 A;  4HZ2 A;  3KTL A;  4KDY A;  5ECQ B;  2B6M A;  1USB A;  3NOF A;  4WBR D;  3F3Q A;  5IM9 A;  4F82 A;  2MMA A;  3H79 A;  3DGQ A;  1U3I A;  4L0W A;  3UVT A;  3VK9 A;  1U88 A;  4POL A;  4ID0 A;  4KDX A;  2M80 A;  1O73 A;  1R26 A;  4YQU A;  1SKR B;  3K8N A;  2H73 A;  3FR9 A;  5FT3 A;  1OVN A;  2K9F A;  5LD0 A;  4Z2U A;  1XXU A;  3LYK A;  3LXT A;  3GL5 A;  3FR6 A;  2FUG 2;  2GTU A;  3IR4 A;  2DMM A;  1Z6N A;  3HVX A;  1ST9 A;  1OKT A;  3FZA A;  3WGX A;  1GRX A;  1GNW A;  4IP6 A;  2YWI A;  5ELA A;  4BVX A;  2LTK A;  2GQK A;  3D22 A;  4AJ7 A;  4GSS A;  3KEB A;  3TRX A;  1XG8 A;  1T8E B;  2I1U A;  3TJF A;  2CV4 A;  20GS A;  3VI5 A;  4XS4 A;  5ABR A;  2A2P A;  4GQC A;  3G7Y A;  2OAD A;  2L6C A;  2NBS A;  5L71 A;  2QGV A;  3TKS C;  2A2S A;  2XPE A;  4I97 A;  4NV2 A;  4POK A;  4BA7 A;  3GH6 A;  2B3S A;  1HD2 A;  1SK1 A;  1OC9 A;  2PER A;  2JZR A;  3HY2 A;  2R3X A;  5ECH B;  2MYG A;  4XS6 A;  4PUF C;  4FQU A;  1OC9 B;  5AIS A;  1LJR A;  2CVK A;  2HT9 A;  1OKD A;  4AJ8 A;  5HR2 A;  2EIR A;  4IKH A;  4K2D A;  2WS2 A;  3RDW A;  2HRK A;  2H6X A;  2C3T A;  1OC3 A;  1FOH A;  1ERU A;  2JZT A;  4N11 A;  2VD1 A;  3GMF A;  2DC5 A;  17GS A;  3WYW A;  6GSW A;  3ZZX A;  2NDO A;  4GRF A;  4TR1 A;  1B9X C;  1G6W A;  4MJE A;  4O92 A;  2YWN A;  2LKU A;  2GSQ A;  4HJM A;  1NHY A;  4TR1 B;  1IYI A;  2YPM A;  3H4K A;  12GS A;  1UA5 A;  6GSS A;  2IN3 A;  1GUH A;  3A2V A;  1WRY A;  2GT6 A;  1RK4 A;  2B5E A;  2M46 A;  3GN3 A;  4Q5R A;  2NVL A;  1AUC A;  4IJ3 A;  2GZY A;  1UN2 A;  1M2B A;  4EXJ A;  1TW9 A;  6GSU A;  1Z5Y E;  1EOG A;  1F3B A;  4D73 A;  3E9J B;  5IMV A;  2H74 A;  4NV5 A;  2QKE A;  3F4T A;  5DAL B;  5A4W A;  5IMC A;  2V6O A;  4PTS A;  1Z9H A;  5DCG A;  3APS A;  3GUS A; 
#chains in the Genus database with same CATH homology
 4HEA 2;  4YQV A;  3FEU A;  1Z6M A;  3M0F A;  3GUR A;  4IJI A;  3EVI A;  2NPB A;  3O76 A;  4RUV A;  4X43 A;  4FYC A;  2VCQ A;  3CMI A;  3ZLP A;  3L9S A;  2FWH A;  2YJH A;  5IIZ A;  3KXO A;  2FWF A;  5DQY A;  1XPV A;  4MF5 A;  4FIW A;  4MZB A;  3GKX A;  1VF3 A;  4FYB A;  3FKF A;  3KJY A;  3PIN A;  3ZYW A;  3FK8 A;  4JE1 A;  2AV4 A;  4DEJ A;  2R37 A;  3QAV A;  2LNS A;  5ECP B;  4LA1 A;  3Q18 A;  1O8W A;  3QDN A;  1A23 A;  3GSS A;  5ENU A;  4IEL A;  2R0G A;  3TOT A;  3CTG A;  2L5L A;  4AF2 A;  1BYE A;  1T4Y A;  2DJ2 A;  3F4S A;  3CTF A;  3HXS A;  2ALB A;  1TI3 A;  2H19 A;  2YP6 A;  2XBQ A;  4MP4 A;  2V41 A;  2V1M A;  4BVY A;  2LV3 A;  2H8L A;  2H0I A;  1YEP A;  2VD0 A;  1AAZ A;  3VWX A;  3D6I A;  2FY6 A;  2X99 A;  2DJJ A;  3PR8 A;  5F05 A;  3HZ4 A;  5DJL A;  3Q74 A;  2GVP A;  1X9M B;  2ON7 A;  4JU5 A;  5DAK A;  22GS A;  3EC3 A;  3TJB A;  3FYG A;  3ZRD A;  1TTZ A;  3IPZ A;  2BTO T;  2DJ0 A;  3TKS E;  1XOA A;  3GKM A;  2X64 A;  4EIP A;  4GSN A;  3DRN A;  2JSZ A;  2FCH A;  3LYP A;  3VWV A;  4MCU A;  3ERG A;  3ZFL A;  2C0D A;  4DVC A;  4JED A;  1GSS A;  3QOU A;  2AUV A;  3M1G A;  4FO5 A;  1VF1 A;  1AIU A;  5D9W A;  3MWH A;  4KUN A;  1TU7 A;  3J7Y k;  3C1R A;  2VCV A;  1TOF A;  3GKK A;  4NXI A;  4TR4 A;  4MZW A;  4TR0 A;  5ECO B;  3PPU A;  4IP1 A;  5GST A;  2ZUP A;  1YJ6 A;  2L4C A;  1A2J A;  3LFL A;  1AW9 A;  2JAC A;  3GFK A;  5IO2 A;  3P90 A;  1FG4 A;  5ECM B;  4K0G A;  3M8N A;  2FGX A;  1PQN A;  4I5Q A;  5H5S A;  1XW9 A;  3G7J A;  2LEG A;  3TJK A;  4YAP A;  5GSS A;  2RUE A;  2HSM A;  5HFG A;  1FO5 A;  4KX4 A;  2LJK A;  2DKI A;  2H71 A;  4BL7 A;  2LQQ A;  4PUR A;  3UMA A;  5IQY A;  1R5A A;  2FWE A;  1KBN A;  1M7T A;  2Z9S A;  1FB0 A;  4EIQ A;  5ECK B;  5HFI A;  1T7P B;  1YKC A;  3ZVJ A;  4J56 E;  2DSA A;  4EVM A;  1EV9 A;  1K0C A;  5EY6 A;  1F9M A;  4HQS A;  4KCE A;  1A8Y A;  2IPA A;  2A2R A;  5CO3 A;  4EDZ A;  3P2A A;  1PGT A;  2JZS A;  18GS A;  3BJ5 A;  4IHU A;  1XCC A;  2VM1 A;  3IXR A;  3RAZ A;  4MPF A;  2HZF A;  2CZ2 A;  1WJK A;  3HVV A;  1OE8 A;  1KEB A;  3TDG A;  1GH2 A;  1U87 A;  2VIM A;  4ZBA A;  2H75 A;  3IE3 A;  1GTB A;  3GNJ A;  5D96 A;  5IMD A;  3GV1 A;  2KHP A;  3VFI A;  2FHE A;  1WP0 A;  2CX4 A;  2F8A A;  5GAP D;  1QUW A;  3I43 A;  1M2D A;  2HRF A;  4V1A g;  1G6Y A;  4TN8 A;  5A4U A;  4G2E A;  4ZBD A;  1F3A A;  1M0U A;  2O8V B;  3DEX A;  1XWB A;  2H72 A;  4WBJ A;  3TRQ A;  1GUM A;  1B8X A;  4J2F A;  3BOA A;  1BED A;  2O89 A;  4PQH A;  4G10 A;  4XS1 A;  1TRS A;  4HZ4 A;  3M9K A;  2P5Q A;  4GWR A;  4WXT A;  3QD9 A;  3W6G A;  5D9V A;  4GLT A;  3I9V 2;  3IBH A;  3A5I A;  1X9W B;  4JRR A;  3A5W A;  3KH7 A;  3KM6 A;  1GUL A;  5HQP A;  1K0B A;  4HDE A;  3V1W A;  2C4J A;  5AIX A;  1ZL9 A;  2F3M A;  1PKW A;  5CP1 A;  3EYT A;  4TW5 A;  2BMX A;  4NHW A;  2GT5 A;  1G0T A;  3CRU A;  3HA9 A;  1ZYQ B;  2KUC A;  4DSS B;  3EPT A;  1YF1 A;  1S3A A;  2C8U A;  4G19 A;  3IDV A;  3D21 A;  3IA1 A;  4EF0 A;  5J5N A;  1QXH A;  2LJR A;  3DML A;  1X5E A;  2VL2 A;  3KMN A;  3GST A;  1FOV A;  5FHI A;  3QCP A;  4RQX A;  1F2E A;  2B1K A;  2GZP A;  4ZIL A;  1SK2 A;  1JZD A;  1XVQ A;  5B8A A;  1R7H A;  3ZIJ A;  1SJI A;  4KND A;  4AJ6 A;  3LXZ A;  4EL1 A;  4Q5F A;  1DUG A;  1TRU A;  4E8H A;  4I2T A;  4KSO A;  4NHZ A;  2BJX A;  1MEK A;  2MBS A;  5B6N A;  1TK0 B;  4YAV A;  1A24 A;  1WWJ A;  1YEX A;  3ZL5 A;  2IMK A;  2LUS A;  4HOJ A;  4O7H A;  5IO0 A;  2KP2 A;  1EV4 A;  2DJK A;  1ZOF A;  1XWA A;  1ZYE A;  8GSS A;  4ACS A;  4MLY A;  1WOU A;  2MMN A;  2XBI A;  3NZN A;  2AJQ B;  3LW9 A;  1SJZ A;  1PMT A;  1UVZ A;  2HRN A;  3VLN A;  2WGR A;  3H8Q A;  2CT6 A;  3LSZ A;  3TUE A;  5D9T A;  5JCW A;  3RPN A;  1THO A;  4YH2 A;  3E3E A;  3KMO A;  3KP9 A;  2VL9 A;  4IVF A;  4ULX A;  3D4T A;  4OO5 A;  3KCM A;  2DLX A;  2L6D A;  1TK5 B;  1H75 A;  3H1N A;  4HI7 A;  1SKS B;  5D93 A;  4ML6 A;  3HDC A;  3E0U A;  1FHE A;  3QMX A;  3RHC A;  4IQA A;  3KTB A;  1M9A A;  1Q4J A;  1JZW A;  2PGT A;  5IPG A;  2I4A A;  4JBB A;  4WF5 A;  1HYU A;  3CYN A;  2IWT A;  1NM3 A;  3UAP A;  5EL8 A;  3ZMK A;  3ZVJ D;  3GA4 A;  1TI1 A;  1XWG A;  4A5P A;  3IOS A;  2AYT A;  2I9H A;  5AN1 A;  1BQ7 A;  1TXX A;  3A2W A;  1NSW A;  4KAE A;  4V2L A;  2YNX A;  2FLS A;  5KN3 A;  3DD3 A;  3US3 A;  3QR6 A;  4OFT A;  5CNW A;  2PPT A;  2V2G A;  4K2X A;  3F8U A;  1EEJ A;  1EGR A;  2L57 A;  2RM6 A;  1M99 A;  1GLQ A;  5J9B A;  4CY8 A;  2ZCT A;  6GSY A;  5JWO B;  1TDI A;  5J41 A;  3VI7 A;  3ISO A;  4LL4 B;  1GWC A;  4BPY A;  3ZTL A;  3GYK A;  1X9S B;  3D0Z A;  1MDK A;  4IN0 A;  4CY6 A;  2E2M A;  5CRD A;  4ZL7 A;  2QA1 A;  4F2I A;  1ZGN A;  2VCX A;  1SYX A;  2B1L A;  2B7K A;  2F51 A;  1K0A A;  2I3Y A;  3BD2 A;  4KA0 A;  5DAL A;  3VWU A;  1MD3 A;  1JFU A;  1ERT A;  2N5A A;  2YZH A;  5D8I A;  1YF0 A;  4K5R A;  4O5Q A;  5IPH A;  1ERW A;  3HVS A;  3SWL A;  5D9X A;  2MMZ A;  1B4Q A;  1BJX A;  4JR6 A;  4KSM A;  1VRS D;  2PUK C;  2JSY A;  1SKW B;  5B8B A;  2A4H A;  1DBY A;  1C72 A;  1EEM A;  4K1F A;  2A4V A;  3ZFB A;  3F0I A;  4WR5 A;  1O6J A;  3FRC A;  2HSY A;  3M9J A;  5ECS A;  4XIH A;  3A3T A;  4KGI A;  2KOK A;  2PMT A;  4XCS A;  5KOX A;  3O3T A;  5IMA A;  1CQH A;  1FB6 A;  5KN0 A;  1ZCP A;  4KB3 A;  3CXG A;  4BWQ A;  2HE3 A;  3L9V A;  3C73 A;  2DIY A;  1HNB A;  4OCF A;  4POB A;  3TOU A;  2VCT A;  4N0V A;  3QAG A;  1RW1 A;  4JR4 A;  1AXD A;  4H86 A;  4TR3 A;  2GS3 A;  2VAF A;  1H4O A;  3SBC A;  1Y6E A;  3R3E A;  3O6T A;  2ZNM A;  2LRN A;  2YN1 A;  3KH9 A;  3UEM A;  4BWS A;  1SEN A;  3D4M A;  4OD7 A;  3CRT A;  2K8V A;  1ZZY A;  1XVW A;  1F37 A;  3DVW A;  1WE0 A;  2G0F A;  1O85 A;  4FH8 A;  2H76 A;  2RLI A;  4IBP A;  3J7Y b;  2IFQ B;  3UVH A;  1F6M C;  3IC4 A;  2GLR A;  4Q5Q A;  2L5O A;  1FW1 A;  4USS A;  5KEJ A;  4LMV A;  4RI7 A;  2PVQ A;  2YOI A;  1U3A A;  2G2Q A;  4OWY A;  2OE0 A;  3L78 A;  3RBT A;  1XOB A;  3LG6 A;  3UL3 A;  2OBI A;  3GX8 A;  4N10 A;  5G31 A;  3UBK A;  1X5C A;  1K3Y A;  2H1B A;  1N2A A;  1ZMA A;  2OA7 A;  1S3D A;  2REM A;  4ILF A;  2H6Z A;  4OFN A;  5IMZ A;  2H66 A;  1SD9 A;  2MMO A;  5JCG A;  4I2U A;  2L4Q A;  2P0G A;  3BCI A;  3F3R A;  4ZL8 A;  3HHV A;  3HJP A;  1Y25 A;  3IHQ A;  2WRT A;  13GS A;  1NW2 A;  2J9H A;  3R2Q A;  3L4N A;  3NIV A;  2FA4 A;  2F8F A;  1XBS A;  2H1A A;  5E59 A;  5IMF A;  2HYX A;  5GAN D;  1GSD A;  3ZIT A;  2EIQ A;  3TJG A;  1EP8 A;  4PGT A;  1GP1 A;  2H70 A;  4TVE A;  3N5O A;  4O5R A;  1A0F A;  4ZB9 A;  1V40 A;  11GS A;  3ZIV A;  1TP9 A;  5HR3 A;  4HQZ A;  1XWK A;  5F06 A;  2DIZ A;  1V98 A;  3VPQ A;  1X5D A;  3PGT A;  5DBQ A;  1XWC A;  7GSS A;  1VGL A;  2LNT A;  4ZL9 A;  2N5F A;  3C7M A;  4MH3 A;  3C71 A;  2WCI A;  4ML1 A;  3MDK A;  3TKR A;  3CBU A;  3QFA C;  4K6X A;  2C80 A;  4RI6 A;  4TOP A;  5AIV A;  1QQ2 A;  3IK9 A;  3KIJ A;  5BRT A;  1M9B A;  4L0U A;  4ECI A;  4K5S A;  4PNF A;  5EPF A;  1EOH A;  4MJB A;  3IK7 A;  3VWW A;  4XTS A;  1AC1 A;  3D5J A;  2MBT A;  3LGC A;  3H93 A;  5CRG A;  4K7N A;  1V2A A;  2DKH A;  5ECL B;  1MD4 A;  4QL9 A;  2EC4 A;  2K18 A;  1A0R P;  3P8W A;  1SL2 B;  1HQO A;  4QL7 A;  3MAK A;  4HJ2 A;  2DJ1 A;  3TKS A;  19GS A;  2WDU A;  3APQ A;  1IYH A;  1FVJ A;  1XIY A;  1RQM A;  4K7O A;  4NAX A;  4NWY A;  5J4U A;  2TRX A;  2LRT A;  1PX6 A;  3FW2 A;  5H5Q A;  4EO3 A;  4N30 A;  2E2G A;  4CHS A;  2OJL A;  4CW9 A;  1PN9 A;  4K9Z A;  2C3Q A;  2P31 A;  1SD8 A;  2CAI A;  3UOM A;  2CVB A;  4I6X A;  4FYU A;  1WMJ A;  4MPG A;  3VPT A;  2AAW A;  4MA9 A;  2X8G A;  1QFN A;  3BCK A;  5C04 A;  2D2Z A;  1SL1 B;  5HR1 A;  1K0N A;  4F03 A;  4ISD A;  1JHB A;  3F6D A;  1GSF A;  4DSS A;  2JU5 A;  4ZB6 A;  3G7I A;  3EMP A;  2H1D A;  2O87 A;  2OKA A;  3A2X A;  1GTI A;  1FAA A;  3VUR A;  4EKZ A;  2EIO A;  1T1V A;  6GSV A;  1B9Y C;  2K6V A;  1U6T A;  5ID2 B;  1QGV A;  4PX1 A;  5GZZ B;  4WR4 A;  2O7K A;  4KDU A;  3HD5 A;  5ECR B;  3HZ8 A;  6GSX A;  2LRC A;  1GSY A;  2H6Y A;  3DKS A;  2HZE B;  3TRP A;  2UZ8 A;  3QFB C;  1G7E A;  3IHG A;  3U5R E;  2IJY A;  3FHK A;  5F0G A;  4YKG A;  1XW5 A;  1GSE A;  1CQG A;  4NMU A;  3FZ4 A;  4MJC A;  4LMW A;  5KN2 A;  3QAW A;  1GLP A;  4G9H A;  1THX A;  2FA8 A;  3HKR A;  5E4W A;  3FMW A;  1B48 A;  5KN1 A;  2QSI A;  2WJU A;  4KF9 A;  1OE7 A;  4X4J A;  1V57 A;  5LCZ A;  1PL1 A;  1VF4 A;  4MNN A;  3DWV A;  2YV7 A;  2X49 A;  3APO A;  4MH2 A;  3WD6 A;  1I5G A;  2CX3 A;  2YWO A;  5G1K A;  4GQF A;  1HNA A;  2YV9 A;  3L9U A;  1A2M A;  3GIX A;  1KTE A;  4EE0 A;  1O7U A;  3EWL A;  1W89 A;  4HU9 A;  1VF2 A;  2C0E A;  3LJR A;  2IL3 A;  2GZZ A;  1K3L A;  2WFC A;  1PSQ A;  1LU4 A;  3LEF A;  2B7J A;  2JAD A;  3F63 A;  4J57 E;  2OE3 A;  4TXV A;  2R0C A;  3MIX A;  5DVB A;  4PNG A;  2IME A;  3LOR A;  4K7I A;  2C0G A;  4GCI A;  2MZC A;  4O5U A;  2B5X A;  2YZU A;  4KCA A;  2VO4 A;  1OAZ A;  1JLV A;  2OAC A;  2YAN A;  4BVX B;  1FVK A;  3DXB A;  4PXO A;  2H1G A;  1EZK A;  2HFD A;  1S3C A;  2VL3 A;  5COH A;  2VM2 A;  3I6A A;  3RPP A;  4XS4 B;  2GGT A;  4RQR A;  5ELG A;  4N0Z A;  5J3R A;  4L5O A;  1O81 A;  3IAM 2;  1AQV A;  4GTU A;  1ACV A;  5C00 A;  2CZ3 A;  4Z2R A;  3DVX A;  5G1L A;  4ICY A;  2ON5 A;  5AGY A;  4WF4 A;  2YWM A;  3L0H A;  4ECC A;  1JZO A;  3UJ1 A;  3W8J A;  4MF6 A;  5B7C A;  6GST A;  1N8J A;  4I8B A;  2ES7 A;  4EC0 A;  3PH9 A;  1Z7P A;  1Z7R A;  1ZYP A;  4HU7 A;  2KLX A;  3HJO A;  3KGK A;  4GXZ A;  5G2Z A;  4TKY A;  3WGE A;  2J23 A;  1G7O A;  4XRD A;  3WGD A;  5IOW A;  5ECI B;  14GS A;  1X0R A;  1SL0 B;  4G0I A;  4XRA A;  4F9Z A;  2RII A;  1YDK A;  4V2N A;  3FZ9 A;  3QPM A;  2L59 A;  3AY8 A;  1E6B A;  1EP7 A;  3LWA A;  1EWX A;  1ON4 A;  4GST A;  2AB6 A;  2PBJ A;  2VL2 C;  2DJ3 A;  4MJA A;  3ERF A;  2HXK A;  1AQW A;  3ZML A;  1K0M A;  2RM5 A;  4V2M A;  2JL4 A;  3FZ5 A;  3UIW A;  3GHA A;  5JWQ B;  4YKF A;  5CRE A;  3I69 A;  1PRX A;  3TKQ A;  3IAS 2;  5D73 A;  4D73 B;  3S9F A;  5CRW A;  4IGJ A;  3FR3 A;  2IMI A;  3WT1 A;  4TRX A;  1PKZ A;  1EGO A;  2RUF A;  1M2A A;  3DYR A;  4DSQ A;  1WIK A;  2E0Q A;  1DE1 A;  1K0O A;  5EVO A;  3ME8 A;  2XPD A;  3TCO A;  3GRX A;  2C0F A;  2LST A;  1XFL A;  2P5R A;  5DJM A;  3ME7 A;  2DBC A;  1R4W A;  1ABA A;  1K3O A;  4MZC A;  2H30 A;  2GQM A;  4LLR A;  5G5E A;  1GUK A;  2GDR A;  2H01 A;  2HI7 A;  1MDI A;  1TKD B;  4TXO A;  2VLV A;  2LJA A;  3EUR A;  4MAB A;  4ZBB A;  2VLU A;  1J0F A;  1XW6 A;  3EMX A;  2R6K A;  1R5P A;  5A5K A;  2N5B A;  2LQO A;  2GSS A;  1ZYN A;  4TXO B;  2IFQ A;  4IQ1 A;  1ML6 A;  5LNK e;  3P7X A;  1UC7 A;  4OFM A;  1QMV A;  4CDO A;  5FWG A;  3JCM L;  2CAQ A;  2H0G A;  1TRV A;  4LL1 B;  2FWG A;  3MNG A;  2FD3 A;  3GL3 A;  4MMM A;  3TKP A;  1GL8 A;  2QA2 A;  3FY7 A;  1YY7 A;  2CVD A;  1A2L A;  5CAX A;  1GTU A;  4MDC A;  5DCH A;  5A4V A;  2PN8 A;  5DQS A;  2VUP A;  5CRH A;  4BVY B;  1T3B A;  1GNE A;  2VCW A;  5BMU A;  4POM A;  4K8M A;  4P3Y B;  4X0X A;  2HNL A;  2TIR A;  4KW6 A;  1SYR A;  1XZO A;  5CYY A;  1ERV A;  1TJD A;  3G9B A;  4DSR A;  5DAK B;  1V9W A;  5B6M A;  1JZR A;  3GKN A;  1SU9 A;  1PN0 A;  3ZRE A;  2LS5 A;  1O8X A;  1LBK A;  2TRC P;  3UBL A;  1MDJ A;  2HRA A;  4PUA A;  3F4R A;  3DIE A;  2IIY A;  3ERW A;  4G0K A;  1T4Z A;  4F0C A;  1K0D A;  1V58 A;  5JWR B;  4HUA A;  5INY A;  2K8S A;  3CSJ A;  5G5F A;  1GTA A;  4E8E A;  1BX9 A;  1KNG A;  1AQX A;  4F0B A;  3ED3 A;  3Q6O A;  5IOX A;  4GF0 A;  2X4A A;  1J08 A;  4X1U A;  2GSR A;  5J9C A;  4AGS A;  2R0P A;  2WUL A;  2R4V A;  5DDL A;  3C8E A;  3BBY A;  3HJM A;  3KP8 A;  1JLW A;  2M72 A;  5HR0 A;  2X8H A;  2VLT A;  2V6K A;  4MF7 A;  3UAR A;  5HFK A;  1HNC A;  1E2Y A;  4KH7 A;  4BL7 B;  1WPI A;  1SJ6 A;  2YCD A;  4K0N A;  2WB9 A;  2H0H A;  3M3M A;  2QC7 A;  4EUY A;  2DML A;  1YKA A;  1SK0 A;  2F9S A;  3OR5 A;  1Z3E A;  4JZQ A;  4IW9 A;  2YJ7 A;  4WET A;  3TGZ A;  3F9U A;  1NHO A;  4L8E A;  3KZQ A;  4IS0 A;  2HSH A;  2OBK A;  4PQ1 A;  3IV4 A;  3EU4 A;  1TRW A;  1PX7 A;  2V32 A;  3TJJ A;  1OC8 A;  2C3N A;  1J9B A;  4O32 A;  1OYJ A;  9GSS A;  4OCE A;  3U6V A;  4EDY A;  4ECJ A;  10GS A;  2IMF A;  3EIN A;  4PQI A;  3F6F A;  1I9D A;  4G0L A;  1GSU A;  3N9J A;  4ZXG A;  5F07 A;  2WZ9 A;  5H5R A;  5KOW A;  1Q98 A;  1MTC A;  4ZIJ A;  3CSH A;  1DSB A;  4MK3 A;  1QK8 A;  2I81 A;  2GQL A;  1ILO A;  2PU9 C;  2X8C A;  2R5G A;  1PA3 A;  3KD0 A;  5ECN B;  3GTU A;  3TB2 A;  1GSQ A;  4Q5N A;  3WT2 A;  4YQM A;  3IRA A;  5F8B A;  4NPB A;  2R2J A;  1BG5 A;  2PWJ A;  2XHF A;  4WKW A;  5ID2 A;  2KP1 A;  3GTU B;  4QQ7 A;  2XC2 A;  5JCU A;  2PVO C;  2O85 A;  2CA8 A;  4ZB8 A;  3HYP A;  1TU8 A;  2VOC A;  2C1Y A;  16GS A;  1B4P A;  3C1S A;  3HCZ A;  3CSI A;  2HZE A;  4V1A p;  1A8L A;  1W4V A;  4XHM A;  2IMD A;  3Q19 A;  2OE1 A;  3IC8 A;  5G30 A;  1T00 A;  4KE3 A;  1YZX A;  1URM A;  1PL2 A;  2FNO A;  2AHE A;  4ECB A;  4Z7X A;  3EU3 A;  1BAY A;  1PD2 1;  2B5Y A;  2CQ9 A;  4Z2T A;  2VCZ A;  3GX0 A;  4OMV A;  2GST A;  4OO4 A;  2HLS A;  3MYD A;  1DE2 A;  3EE2 A;  3RHB A;  3LQ7 A;  3MSZ A;  4WEY A;  2E7P A;  1YQ1 A;  3W8S A;  4HS1 A;  1TK8 B;  4L5L A;  2NTO A;  3GH9 A;  4HZ2 A;  3KTL A;  4KDY A;  5ECQ B;  2B6M A;  1USB A;  3NOF A;  4WBR D;  3F3Q A;  5IM9 A;  4F82 A;  2MMA A;  3H79 A;  3DGQ A;  1U3I A;  4L0W A;  3UVT A;  3VK9 A;  1U88 A;  4POL A;  4ID0 A;  4KDX A;  2M80 A;  1O73 A;  1R26 A;  4YQU A;  1SKR B;  3K8N A;  2H73 A;  3FR9 A;  5FT3 A;  1OVN A;  2K9F A;  5LD0 A;  4Z2U A;  1XXU A;  3LYK A;  3LXT A;  3GL5 A;  3FR6 A;  2FUG 2;  2GTU A;  3IR4 A;  2DMM A;  1Z6N A;  3HVX A;  1ST9 A;  1OKT A;  3FZA A;  3WGX A;  1GRX A;  1GNW A;  4IP6 A;  2YWI A;  5ELA A;  4BVX A;  2LTK A;  2GQK A;  3D22 A;  4AJ7 A;  4GSS A;  3KEB A;  3TRX A;  1T8E B;  2I1U A;  3TJF A;  2CV4 A;  20GS A;  3VI5 A;  4XS4 A;  5ABR A;  2A2P A;  4GQC A;  3G7Y A;  2OAD A;  2L6C A;  2NBS A;  5L71 A;  2QGV A;  3TKS C;  2A2S A;  2XPE A;  4I97 A;  4NV2 A;  4POK A;  4BA7 A;  3GH6 A;  2B3S A;  1HD2 A;  1SK1 A;  1OC9 A;  2PER A;  2JZR A;  3HY2 A;  2R3X A;  5ECH B;  2MYG A;  4XS6 A;  4PUF C;  4FQU A;  5AIS A;  1OC9 B;  1LJR A;  2CVK A;  2HT9 A;  1OKD A;  4AJ8 A;  5HR2 A;  2EIR A;  4IKH A;  4K2D A;  2WS2 A;  3RDW A;  2HRK A;  2H6X A;  2C3T A;  1OC3 A;  1FOH A;  1ERU A;  2JZT A;  4N11 A;  2VD1 A;  3GMF A;  2DC5 A;  17GS A;  3WYW A;  6GSW A;  3ZZX A;  2NDO A;  4GRF A;  4TR1 A;  1B9X C;  1G6W A;  4MJE A;  4O92 A;  2YWN A;  2LKU A;  2GSQ A;  4HJM A;  1NHY A;  4TR1 B;  1IYI A;  2YPM A;  3H4K A;  12GS A;  1UA5 A;  6GSS A;  2IN3 A;  1GUH A;  3A2V A;  1WRY A;  2GT6 A;  1RK4 A;  2B5E A;  2M46 A;  3GN3 A;  4Q5R A;  2NVL A;  1AUC A;  4IJ3 A;  2GZY A;  1UN2 A;  1M2B A;  4EXJ A;  1TW9 A;  6GSU A;  1Z5Y E;  1EOG A;  1F3B A;  4D73 A;  3E9J B;  5IMV A;  2H74 A;  4NV5 A;  2QKE A;  3F4T A;  5DAL B;  5A4W A;  5IMC A;  2V6O A;  4PTS A;  1Z9H A;  5DCG A;  3APS A;  3GUS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...