2ZCTA

Oxidation of archaeal peroxiredoxin involves a hypervalent sulfur intermediate
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
240
structure length
235
Chain Sequence
PLIGERFPEMEVTTDHGVIKLPDHYVSQGKWFVLFSHPADFTPVTTEFVSFARRYEDFQRLGVDLIGLSVDSVFSHIKWKEWIERHIGVRIPFPIIADPQGTVARRLGLLATHTVRGVFIVDARGVIRTMLYYPMELGRLVDEILRIVKALKLGDSLKRAVPADWPNNEIIGEGLIVPPPTTEDQARARMESGQYRSLDWWFCWDTPASRDDVEEARRYLRRAAEKPAKLLYEEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Probable peroxiredoxin
publication title Oxidation of archaeal peroxiredoxin involves a hypervalent sulfur intermediate
pubmed doi rcsb
source organism Aeropyrum pernix
total genus 78
structure length 235
sequence length 240
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2007-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
A PF10417 1-cysPrx_C C-terminal domain of 1-Cys peroxiredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1020.20 Alpha Beta 2-Layer Sandwich Antioxidant, Horf6; Chain A, domain 2 Antioxidant, Horf6; Chain A, domain 2 2zctA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2zctA01
1AW9A 2GS3A 5C04A 4IBPA 4Q5NA 4GF0A 1YDKA 2FWEA 1AAZA 3RPNA 2YZUA 2HRFA 3U6VA 1OC9B 4XCSA 3TB2A 2MBTA 1UN2A 1F3AA 2DLXA 2B1KA 5CREA 4I2UA 4V1Ap 5F06A 2DSAA 3C7MA 5HR0A 3F9UA 4TR0A 5DVBA 2IJYA 5CNWA 2YV7A 2GQKA 3DRNA 3RDWA 3BOAA 2DJKA 1B48A 4K7OA 1X5EA 2X99A 2JZSA 1TDIA 1JLWA 1PGTA 5J9BA 1K0BA 1TU8A 4N30A 3CBUA 2VL2A 3F0IA 4F0CA 5CO3A 3PINA 2NTOA 1SJZA 1SD9A 3O76A 2PWJA 7GSSA 4P3YB 1J08A 3VI7A 4JR4A 2G0FA 2H75A 3BJ5A 4OCEA 2B6MA 2QC7A 4KAEA 3GL5A 5HR3A 3L9SA 3VPQA 1G6WA 2OKAA 4CW9A 3KMOA 2L6DA 1XWBA 1V57A 2OBIA 4IQ1A 1K0DA 1YQ1A 1T4YA 1EOHA 3I9V2 3FEUA 4L5OA 4ZBDA 4TVEA 4TR4A 5D9TA 1F6MC 3NOFA 4IN0A 1GSDA 3VK9A 2O7KA 2RUFA 1XPVA 1SL0B 3Q74A 1WMJA 1B4QA 3GSSA 1IYHA 1E2YA 2F9SA 3LQ7A 3RHBA 1AQXA 4IGJA 3ZRDA 1PKWA 3E9JB 1N8JA 2WZ9A 4XHMA 5D9WA 3ZIJA 3KH7A 1O85A 3LYKA 3IRAA 2OJLA 3KP9A 2H6YA 4ML1A 5DBQA 1PN9A 5ECPB 2JSYA 4KDXA 1I5GA 2YANA 3RAZA 1XOBA 1VF2A 2RM5A 2H1GA 5DALB 4KA0A 2L59A 3GH6A 3VI5A 4TR1A 3D4MA 3EC3A 2LSTA 4J2FA 2B3SA 1RQMA 4DEJA 1EWXA 4I2TA 4Q5QA 2LJRA 2H72A 2IL3A 1GSEA 4MH3A 2A2RA 1RW1A 4PUAA 1GH2A 2NPBA 2WFCA 1X0RA 2KOKA 1T1VA 1A2LA 3KD0A 5IMCA 1YF1A 1THXA 2N5FA 1JLVA 1XVWA 2XC2A 2P5RA 3R2QA 1DE2A 2WRTA 2H01A 2B1LA 1EOGA 1Z5YE 4F0BA 3G7JA 2EIQA 5ID2A 3ED3A 2CVDA 4HJ2A 4G9HA 4WEYA 2VCQA 2PUKC 4TXOA 2BTOT 2V6OA 2LRNA 5AISA 4HS1A 5C00A 1EV9A 1EEMA 2GZYA 1MDKA 4YQMA 3U5RE 4EDYA 3FZ9A 2XPEA 4HJMA 2H1BA 2AAWA 2LQQA 4GSSA 2C1YA 1FG4A 2OACA 2PERA 3HZ8A 4O32A 1GLQA 3UVHA 4BVYA 4E8HA 1B9XC 3SWLA 4F82A 1AQVA 3DWVA 3LXTA 1SK2A 4F9ZA 3GTUA 1XW5A 4MJEA 4TN8A 4ML6A 3UAPA 4ACSA 4WF5A 5DAKB 3TKPA 5J41A 5EY6A 5G30A 3LXZA 2FY6A 1EV4A 4YQVA 3LYPA 2EC4A 1K0NA 2R2JA 3D22A 2I81A 1GULA 2VCXA 4WETA 4KH7A 4L0UA 2IIYA 3BCIA 2CV4A 4LL1B 1U88A 3IAS2 5KN3A 3HJPA 3PGTA 2GSQA 2F51A 2FA8A 3IHQA 4LMVA 3J7Yk 1TK8B 2KUCA 1GTIA 6GSVA 3S9FA 3VWWA 4PNGA 19GSA 2AB6A 1JZOA 5ENUA 3F4TA 4RQRA 1A23A 3PH9A 1K0AA 2VIMA 4GCIA 4PNFA 1XXUA 3GYKA 1Y25A 1QFNA 2GZZA 4JR6A 1W4VA 1JZDA 4OMVA 1K3LA 2CX4A 2B7JA 2VLVA 4ID0A 4EC0A 1MD3A 5ECNB 3UIWA 1WE0A 4IHUA 1GUHA 1ERTA 4EKZA 1U6TA 2L5LA 1OC8A 4F2IA 4K1FA 1X5CA 3BCKA 4KB3A 4TR3A 6GSTA 2X8HA 4PX1A 2IN3A 3HA9A 3UVTA 3DGQA 3F6DA 1PD21 2EIRA 2JADA 4JU5A 4BWSA 1GSUA 1MDIA 3GNJA 2B5EA 2E7PA 3ERFA 3IV4A 4YH2A 1Z7RA 2MZCA 3HXSA 3O6TA 3FR3A 4GWRA 3G7IA 1GNEA 5IMDA 3KZQA 3EMPA 3SBCA 2R4VA 1K3YA 3F3RA 3IK9A 3WD6A 3ZVJA 4OCFA 4DSSA 3QOUA 3GIXA 3TKRA 4MJAA 4HUAA 2C80A 1O7UA 1T7PB 1VF1A 2CAIA 1FO5A 1TRSA 4FH8A 4OFMA 5AN1A 3FW2A 4K0NA 4O92A 5D9VA 2GZPA 4K9ZA 4TR1B 1Z6MA 1JHBA 2LJKA 2YWOA 1DSBA 4ZL8A 5JCWA 3WGEA 1G7EA 4GQFA 4MK3A 5G1KA 4CHSA 4EDZA 1SD8A 2REMA 3EVIA 2C0GA 3DXBA 1ERUA 2B5YA 2H0HA 1HD2A 3FHKA 2FD3A 3WGXA 4BA7A 4L8EA 4L5LA 1TK0B 1OKDA 3D5JA 3DYRA 3WYWA 2RM6A 3I69A 4WF4A 1YKAA 4O7HA 4AJ7A 3Q6OA 2C3TA 1OYJA 4IS0A 2CZ3A 1X5DA 4KUNA 1XVQA 1Q98A 1HNCA 2HRNA 2VUPA 2H0GA 4MCUA 3L4NA 2TRXA 3TJBA 4ILFA 4KX4A 5F0GA 4E8EA 2M80A 1M2DA 3UL3A 2H30A 1GUKA 4GLTA 1GTBA 3EU4A 4TXOB 4IKHA 5IO2A 1MD4A 2V32A 3ZITA 4EF0A 3F63A 3TKSA 3F4RA 5F8BA 4QL9A 5CRGA 5D8IA 1ZOFA 5IPHA 2LJAA 3QD9A 1HNBA 3FRCA 3KH9A 4MF7A 4IVFA 1NM3A 3EINA 3L9UA 3QFBC 2KP2A 5HR1A 3ME8A 1ST9A 2D2ZA 2TIRA 1XW6A 1I9DA 4K0GA 5KEJA 3VLNA 4MZCA 1CQGA 3HKRA 1FHEA 1G7OA 5ECRB 4Z7XA 2C3NA 3ZMKA 1GL8A 2HZEA 1LJRA 1EP7A 1F2EA 1B8XA 2LTKA 1Z6NA 2HFDA 3UMAA 2M72A 3HJMA 1QGVA 4LLRA 2VM2A 2L6CA 2H1AA 5IM9A 1SENA 1WOUA 4F03A 4XS1A 3IR4A 1TJDA 2FWFA 3GSTA 4NXIA 1ABAA 3ERWA 3LSZA 3L9VA 5KN1A 2WGRA 5GAPD 4OFTA 2DMLA 3A2XA 4HZ4A 4OO5A 5A4VA 5ECKB 2C4JA 5ECHB 5GSTA 8GSSA 3CSHA 4IELA 2A2SA 3MDKA 1B4PA 2P0GA 4RI7A 2QGVA 5FT3A 3H93A 4WKWA 2GQMA 6GSWA 4ZXGA 4TW5A 2H8LA 1QK8A 1E6BA 1FVKA 3ZVJD 4BVXA 2OA7A 3APOA 3IBHA 1X9SB 1K0CA 2R3XA 4NV5A 2JL4A 2IWTA 2CZ2A 1ZYQB 1X9MB 2E2GA 2JSZA 3NZNA 5B7CA 2K18A 5AIXA 2IMDA 4FYCA 2R6KA 1MDJA 5AIVA 4I8BA 3N9JA 2NVLA 1SKRB 3PR8A 5D96A 5DQYA 2CT6A 1J0FA 2TRCP 5E4WA 4BWQA 3UBKA 1U3IA 1J9BA 1VRSD 4ECIA 2O89A 2B5XA 4HEA2 1PKZA 2ON5A 4NWYA 3CYNA 1YZXA 2H76A 1TI1A 1OE8A 2H74A 4TXVA 4JEDA 1R7HA 3GX8A 1V98A 1SYXA 2XBQA 4J56E 1SKSB 3CSIA 2IMEA 2VD1A 2WULA 3M9KA 4KW6A 4POKA 2QKEA 1A24A 3UARA 1PA3A 2IFQA 1TKDB 3C1RA 4D73A 1WP0A 4I5QA 4MP4A 5GAND 1O73A 1T8EB 5DJMA 3FZAA 2P5QA 4KCEA 3TKSE 3F6FA 1TU7A 3Q19A 1WWJA 1ILOA 1SK0A 1F3BA 3HVXA 4RI6A 2GSRA 3CTFA 1XWAA 2YOIA 3QR6A 4K6XA 2YP6A 1AUCA 4DSQA 2J9HA 5ECOB 4XRAA 4K7NA 1F37A 1PQNA 1SK1A 2B7KA 2DJ3A 2MMAA 4GTUA 3ZIVA 4ZBAA 3A2VA 5B6MA 1QXHA 2HE3A 3IXRA 4GXZA 3H8QA 1BEDA 1V9WA 1ZL9A 5LD0A 20GSA 1O6JA 1PSQA 5IIZA 1A2JA 3HVSA 3GV1A 3ZZXA 3G9BA 2LNTA 4ISDA 4N11A 3P8WA 3CRTA 4ECJA 2FHEA 5CRDA 2X64A 4IJ3A 2ALBA 3TOUA 1GWCA 3W8SA 5KN2A 3CTGA 3KEBA 5IOXA 4X43A 3RHCA 3TJJA 3FR6A 2NDOA 4HOJA 1XW9A 1KBNA 3HVVA 2OBKA 5EPFA 4GSTA 2RLIA 4AGSA 3DMLA 2YWNA 2PBJA 1TK5B 3UOMA 1GLPA 5JWRB 2CVBA 4KE3A 2V6KA 4KNDA 5INYA 5G5EA 2GVPA 1R26A 5A4WA 3V1WA 2H6ZA 1ZZYA 4KGIA 3TRPA 2BMXA 2L4CA 4TRXA 5JWOB 2YNXA 2DBCA 1QQ2A 2L4QA 1OC9A 1MEKA 4MJBA 1SKWB 1GNWA 3P7XA 3ZFBA 2C0DA 3QAWA 3GURA 2GTUA 5HFGA 4POMA 2JZRA 3LJRA 4N10A 3F8UA 2YPMA 2LQOA 2GQLA 2Z9SA 4Q5FA 1TRUA 1TXXA 1GUMA 1WPIA 3EE2A 4NV2A 3KXOA 3TDGA 4KSMA 2FA4A 2PVQA 3QPMA 4H86A 1BX9A 3J7Yb 1FB0A 2LRCA 3TJGA 4ZL9A 5A5KA 5H5QA 4IW9A 4WBJA 1ZYEA 2N5AA 3QFAC 1N2AA 4N0ZA 1USBA 2DJ2A 3TUEA 2VD0A 2FNOA 4OFNA 3F4SA 5HQPA 2AJQB 1Q4JA 5IQYA 2R37A 1S3CA 2K6VA 4MJCA 5F07A 4EXJA 1THOA 5B8BA 1SL2B 14GSA 3P90A 1SYRA 2V1MA 2KLXA 4K8MA 1GTUA 3HD5A 4PURA 4PXOA 4X1UA 3QCPA 1WRYA 2PN8A 3H1NA 3LORA 3IA1A 2CVKA 3MNGA 3WT2A 5J3RA 1JZWA 1JZRA 4GQCA 2WCIA 4QQ7A 3I43A 3ISOA 1GSFA 2JU5A 1XOAA 6GSXA 4V2NA 1FB6A 5B8AA 1JFUA 2K8SA 1AC1A 4JRRA 1F9MA 1GSSA 3BD2A 4V2LA 5CRHA 5ABRA 3EYTA 1T00A 4WXTA 4G2EA 3CSJA 3ERGA 4D73B 4ULXA 6GSYA 22GSA 3DKSA 2FCHA 5ECMB 3TKQA 1QMVA 4O5RA 5CAXA 2HI7A 3LG6A 2XBIA 3A5WA 2KP1A 4IJIA 5FHIA 5DALA 3ZMLA 1RK4A 2O8VB 3QAGA 1TW9A 2YCDA 2I3YA 2ON7A 3DIEA 1CQHA 1LU4A 2MYGA 5F05A 4PQ1A 4DSRA 5IPGA 3IC4A 2V41A 5J4UA 1DBYA 3KM6A 2VL2C 4ZBBA 1ACVA 5ID2B 5ECQB 1R4WA 2LV3A 1IYIA 1Z3EA 4KSOA 1NHOA 2PGTA 4V2MA 2HZFA 1GRXA 3HJOA 4HDEA 1G6YA 3GX0A 1A8YA 1TRVA 3ZYWA 3KTBA 1ON4A 2BJXA 2O87A 1BQ7A 2DJ1A 3H4KA 3QAVA 1PMTA 1DUGA 3M8NA 4IQAA 2WJUA 5H5RA 2ZNMA 4FO5A 4LL4B 4XIHA 1ZCPA 2FWHA 3APQA 3QDNA 3M0FA 3IOSA 1U3AA 1O8WA 5G2ZA 3VWXA 1B9YC 3K8NA 3FYGA 3D4TA 2VO4A 1V40A 4FYUA 1BG5A 5D9XA 4X0XA 4CDOA 1O8XA 1GSQA 1YJ6A 5COHA 4MF6A 5HFIA 3GTUB 2OE3A 2H71A 3FZ4A 3ME7A 3IK7A 4PGTA 3IPZA 2DIZA 3M9JA 5GZZB 2F8AA 2OE0A 5ECIB 2LNSA 3E0UA 2P31A 2H6XA 5DAKA 3EURA 3APSA 3KJYA 2YV9A 1YEXA 4KDYA 3VFIA 1TI3A 3ZLPA 4HI7A 3GKKA 5ELAA 3HY2A 3KGKA 5HFKA 2MMZA 1K3OA 1ZMAA 1VF4A 2YJHA 3IE3A 1XFLA 4EVMA 4ECBA 1X9WB 2YWMA 1EGRA 1AQWA 1FOVA 4Q5RA 4MABA 4PQIA 3TGZA 3H79A 5LCZA 3I6AA 1EP8A 3FY7A 4OO4A 1AXDA 1PL1A 1T4ZA 2RUEA 4TOPA 2HLSA 2CX3A 3KTLA 3VPTA 5KN0A 3GA4A 2RIIA 2ES7A 2C3QA 1R5AA 2DJ0A 2K8VA 9GSSA 3GRXA 1KTEA 4V1Ag 4GSNA 1K0OA 5IMVA 4IP6A 2VCWA 5ECSA 1GP1A 3HCZA 4EE0A 2DC5A 1A0RP 3MAKA 1PRXA 4HU9A 5G31A 2L5OA 5G1LA 1V58A 1XWKA 2H70A 1XIYA 2CQ9A 1PX6A 5IOWA 1M2AA 2FWGA 2VLUA 3DVWA 4ZL7A 1HNAA 2F3MA 1HYUA 4OD7A 5EL8A 5IMZA 4JE1A 3IAM2 4XRDA 2LKUA 2DMMA 1C72A 4G10A 4POLA 3HHVA 4DSSB 3TRQA 1M0UA 2HT9A 2MMNA 5IMAA 5DCHA 2DIYA 3CMIA 5H5SA 4HQZA 3W6GA 5GSSA 3HZ4A 3GHAA 4PQHA 4ZILA 3TRXA 1SJIA 1FVJA 4YAVA 1LBKA 4DVCA 2I4AA 4JBBA 3WGDA 4POBA 3ZFLA 1S3DA 2IMIA 5AGYA 1VGLA 2YN1A 1XWGA 5G5FA 3LEFA 1BYEA 4MZBA 2G2QA 3GL3A 2ZCTA 2HNLA 2N5BA 1ERVA 4MMMA 1FW1A 2YZHA 1TRWA 1HQOA 3C1SA 3AY8A 3C71A 1O81A 3F3QA 2I1UA 4IP1A 4K7IA 2GT6A 4MPFA 5CP1A 2YJ7A 2H1DA 4WR5A 5E59A 2H66A 3ZL5A 3MSZA 4EO3A 4KCAA 4XS4A 4I97A 2GSSA 3N5OA 4NAXA 1H75A 1S3AA 3EU3A 1BAYA 4MZWA 4AF2A 3TCOA 2PU9C 5J9CA 3ZTLA 2VL3A 1A2MA 1WJKA 5ELGA 4HU7A 1A8LA 2CA8A 3RBTA 4JZQA 1BJXA 2IMFA 1Z9HA 1FAAA 5D73A 1Y6EA 4K2DA 3VURA 1YEPA 5D93A 2JZTA 1OE7A 1SU9A 1XCCA 4NMUA 2AYTA 4YQUA 4BPYA 1OC3A 5DJLA 3C73A 1TP9A 1R5PA 5JCUA 4EUYA 1U87A 3D6IA 1ZGNA 3QMXA 1QUWA 3GKMA 1OKTA 5ECLB 5A4UA 1GSYA 4MPGA 5CRWA 3M1GA 2GDRA 3DD3A 2VLTA 4MF5A 1W89A 2HZEB 4ZB9A 3G7YA 3TJFA 5IO0A 3JCML 3WT1A 1EEJA 3P2AA 2HXKA 2CAQA 4RQXA 2C0EA 1T3BA 3ZREA 4ZIJA 1M7TA 2FLSA 1XZOA 1M9BA 4MDCA 4AJ8A 3L78A 2H73A 1ERWA 2J23A 5EVOA 3DVXA 4NHZA 2OADA 1UVZA 6GSUA 1H4OA 2C8UA 4AJ6A 1NSWA 2FGXA 1TOFA 2MBSA 3EMXA 2PPTA 6GSSA 2LRTA 3KCMA 2HSYA 2GSTA 4XS6A 5L71A 2MMOA 2QSIA 10GSA 4QL7A 4PUFC 2AHEA 2WB9A 3GKNA 2VAFA 2HSHA 1OAZA 3BBYA 3KIJA 3W8JA 5DCGA 1ML6A 2FUG2 5DDLA 4LA1A 3HYPA 4J57E 5HR2A 3FKFA 2I9HA 1KEBA 3DEXA 2PMTA 4MA9A 1M2BA 4N0VA 3C8EA 3OR5A 3VWUA 2DJJA 3A2WA 1PL2A 1DE1A 2VCZA 2LUSA 1WIKA 4HQSA 2M46A 5B6NA 1EZKA 4FIWA 3US3A 1EGOA 1M99A 2WDUA 5IMFA 3L0HA 2E2MA 1UA5A 2O85A 2JACA 5J5NA 3VWVA 3TKSC 1M9AA 4NPBA 2YWIA 4MH2A 4FYBA 3UBLA 2IFQB 5CYYA 2C0FA 2XHFA 11GSA 18GSA 3D0ZA 4OWYA 3GFKA 5JWQB 1Z7PA 1V2AA 3GKXA 5DQSA 3GMFA 2R5GA 3FK8A 4TKYA 2V2GA 3E3EA 4KDUA 1SL1B 2VL9A 4WR4A 3UEMA 1AIUA 2OE1A 2H19A 2EIOA 3EWLA 1SJ6A 3TJKA 2E0QA 1NW2A 2GGTA 1URMA 3M3MA 2K9FA 16GSA 2VOCA 1OVNA 2X8GA 2IMKA 3UJ1A 2AUVA 2LS5A 3LFLA 2IPAA 3Q18A 3TOTA 3LWAA 13GSA 4GRFA 3FR9A 1UC7A 4XS4B 3O3TA 2VM1A 1KNGA 2XPDA 2X8CA 2LEGA 3CRUA 3GH9A 2ZUPA 3KP8A 2PVOC 3GN3A 1YKCA 4ZB8A 4I6XA 4MLYA 3FZ5A 1VF3A 1A0FA 4HZ2A 1MTCA 2F8FA 4NHWA 2H0IA 4XTSA 4ECCA 1TTZA 4RUVA 3CXGA 4YAPA 2L57A 1G0TA 5LNKe 4ZB6A 2VCVA 1XWCA 12GSA 2A4VA 3IDVA 4LMWA 2GT5A 1K0MA 3D21A 4WBRD 5FWGA 3A3TA 3MWHA 1NHYA 1YY7A 4BL7A 3GUSA 2KHPA 4G19A 3RPPA 5JCGA 3LGCA 2GLRA 3NIVA 4L0WA 1XBSA 4EL1A 2VCTA 17GSA 2AV4A 2WS2A 3KMNA 1YF0A 1PX7A 2HYXA 2NBSA 1GTAA 3HDCA
chains in the Genus database with same CATH superfamily
1AW9A 2GS3A 5C04A 4IBPA 4Q5NA 4GF0A 1YDKA 2FWEA 1AAZA 3RPNA 2YZUA 2HRFA 3U6VA 1OC9B 4XCSA 3TB2A 2MBTA 1UN2A 1F3AA 2DLXA 2B1KA 5CREA 4I2UA 4V1Ap 5F06A 2DSAA 3C7MA 5HR0A 3F9UA 4TR0A 5DVBA 2IJYA 5CNWA 2YV7A 2GQKA 3DRNA 3RDWA 3BOAA 2DJKA 1B48A 4K7OA 1X5EA 2X99A 2JZSA 1TDIA 1JLWA 1PGTA 5J9BA 1K0BA 1TU8A 4N30A 3CBUA 2VL2A 3F0IA 4F0CA 5CO3A 3PINA 2NTOA 1SJZA 1SD9A 3O76A 2PWJA 7GSSA 4P3YB 1J08A 3VI7A 4JR4A 2G0FA 2H75A 3BJ5A 4ICYA 4OCEA 2B6MA 2QC7A 4KAEA 3GL5A 5HR3A 3L9SA 3VPQA 1G6WA 2OKAA 4CW9A 3KMOA 2L6DA 1XWBA 1V57A 2OBIA 4IQ1A 1K0DA 1YQ1A 1T4YA 1EOHA 3I9V2 3FEUA 4L5OA 4ZBDA 1PFOA 4TVEA 4TR4A 5D9TA 1F6MC 3NOFA 4IN0A 1GSDA 3VK9A 2O7KA 2RUFA 1XPVA 1SL0B 3Q74A 1WMJA 1B4QA 3GSSA 1IYHA 1E2YA 2F9SA 3LQ7A 4EIPA 4Z2TA 3RHBA 1AQXA 4IGJA 3ZRDA 1FOHA 1PKWA 4X4JA 3E9JB 1N8JA 2WZ9A 2QA1A 4XHMA 5D9WA 3ZIJA 3KH7A 1O85A 3LYKA 3IRAA 2OJLA 3KP9A 2H6YA 4EIQA 4ML1A 5DBQA 1PN9A 2JSYA 5ECPB 4KDXA 1I5GA 2YANA 3RAZA 1XOBA 1VF2A 2RM5A 2H1GA 5KOWA 5DALB 4KA0A 2L59A 3GH6A 3VI5A 4TR1A 3D4MA 3EC3A 2LSTA 4J2FA 2B3SA 1RQMA 4DEJA 1EWXA 4I2TA 4Q5QA 2LJRA 2H72A 2IL3A 1GSEA 4MH3A 2A2RA 1RW1A 4PUAA 1GH2A 2NPBA 2WFCA 1X0RA 2KOKA 1T1VA 1A2LA 3KD0A 5IMCA 1YF1A 1THXA 2N5FA 5BMUA 1JLVA 1XVWA 2XC2A 2P5RA 3R2QA 1DE2A 2WRTA 3LW9A 2H01A 2B1LA 1EOGA 1Z5YE 4F0BA 3G7JA 2EIQA 5ID2A 3ED3A 2CVDA 4HJ2A 4G9HA 4WEYA 2VCQA 2PUKC 4TXOA 2BTOT 2V6OA 2LRNA 5AISA 4BL7B 4HS1A 5C00A 1EV9A 1EEMA 2GZYA 1MDKA 4YQMA 3U5RE 4EDYA 3FZ9A 2XPEA 4HJMA 2H1BA 2AAWA 2LQQA 4GSSA 2C1YA 1FG4A 2OACA 2PERA 3HZ8A 4O32A 1GLQA 3UVHA 4BVYA 4E8HA 1B9XC 3SWLA 4F82A 1AQVA 3DWVA 3LXTA 1SK2A 4FQUA 4F9ZA 3GTUA 1XW5A 4MJEA 4TN8A 4ML6A 3UAPA 4ACSA 4WF5A 5DAKB 1ZYNA 3TKPA 5EY6A 5J41A 5G30A 2DKHA 3LXZA 2FY6A 1EV4A 4YQVA 3LYPA 2EC4A 1K0NA 2R2JA 3D22A 2I81A 1GULA 2VCXA 4WETA 2UZ8A 4KH7A 4L0UA 2IIYA 3BCIA 2CV4A 4LL1B 1U88A 3IAS2 5KN3A 3HJPA 3PGTA 2GSQA 2F51A 2FA8A 3IHQA 4LMVA 3J7Yk 1TK8B 2KUCA 1GTIA 6GSVA 3S9FA 3VWWA 4PNGA 19GSA 2AB6A 1JZOA 5ENUA 3F4TA 4RQRA 1A23A 3PH9A 1K0AA 2VIMA 4GCIA 4PNFA 1XXUA 3GYKA 1Y25A 1QFNA 2GZZA 4JR6A 1W4VA 1JZDA 4OMVA 1K3LA 2CX4A 2B7JA 3EPTA 2VLVA 4ID0A 4EC0A 1MD3A 2HSMA 5ECNB 3UIWA 1WE0A 4IHUA 1GUHA 1ERTA 4EKZA 1U6TA 2L5LA 1OC8A 4F2IA 4K1FA 1X5CA 3BCKA 4KB3A 4TR3A 6GSTA 2X8HA 4PX1A 2IN3A 3HA9A 3UVTA 3DGQA 3F6DA 1PD21 2EIRA 2JADA 4JU5A 4BWSA 1GSUA 1MDIA 3GNJA 2B5EA 2E7PA 3ERFA 3IV4A 1Z7RA 4YH2A 2MZCA 3HXSA 4PTSA 2X49A 3O6TA 3FR3A 4GWRA 3G7IA 1GNEA 5IMDA 3KZQA 3EMPA 3SBCA 2R4VA 1K3YA 3F3RA 3IK9A 3WD6A 3ZVJA 4OCFA 4DSSA 3QOUA 3GIXA 4USSA 3TKRA 4MJAA 4HUAA 2C80A 1O7UA 1T7PB 1VF1A 2CAIA 1FO5A 1TRSA 4FH8A 4OFMA 5AN1A 3FW2A 4K0NA 4O92A 5D9VA 2GZPA 4K9ZA 4TR1B 1Z6MA 1JHBA 2LJKA 2YWOA 1DSBA 4ZL8A 5JCWA 3WGEA 1G7EA 4GQFA 4MK3A 5G1KA 3HVNA 4CHSA 4EDZA 1SD8A 2REMA 3EVIA 2DKIA 2C0GA 3DXBA 1ERUA 2B5YA 2H0HA 1HD2A 3FHKA 2FD3A 3WGXA 4BA7A 4L8EA 4L5LA 1TK0B 1OKDA 3D5JA 3DYRA 3WYWA 2RM6A 3I69A 4WF4A 1YKAA 4O7HA 4AJ7A 3Q6OA 2C3TA 1OYJA 4IS0A 2R0GA 2CZ3A 1X5DA 4KUNA 1XVQA 1Q98A 1HNCA 2HRNA 2VUPA 2H0GA 4MCUA 3L4NA 2TRXA 3TJBA 4ILFA 2HRAA 4KX4A 5F0GA 4E8EA 1XG8A 2M80A 1M2DA 3UL3A 2H30A 4Z2UA 1GUKA 4GLTA 1GTBA 3EU4A 4TXOB 4IKHA 5IO2A 1MD4A 2V32A 3ZITA 4EF0A 3F63A 3TKSA 3F4RA 5F8BA 4QL9A 5CRGA 5D8IA 1ZOFA 5IPHA 2LJAA 3QD9A 1HNBA 2X4AA 3FRCA 3KH9A 4MF7A 4IVFA 1NM3A 3EINA 3L9UA 3QFBC 2KP2A 5HR1A 3ME8A 1ST9A 2D2ZA 2TIRA 1XW6A 1I9DA 4K0GA 5KEJA 3VLNA 4MZCA 1CQGA 3HKRA 1FHEA 1G7OA 5ECRB 4Z7XA 2C3NA 3ZMKA 1GL8A 2HZEA 1LJRA 1EP7A 1F2EA 1B8XA 3A5IA 2LTKA 1Z6NA 2HFDA 3UMAA 2M72A 3HJMA 1QGVA 4LLRA 2VM2A 2L6CA 2H1AA 5IM9A 1SENA 1WOUA 4F03A 4XS1A 3IR4A 1TJDA 2R0CA 2FWFA 3GSTA 4NXIA 1ABAA 3ERWA 3LSZA 3L9VA 5KN1A 2WGRA 5GAPD 4OFTA 2DMLA 3A2XA 4HZ4A 4OO5A 5A4VA 5ECKB 2C4JA 5ECHB 5GSTA 8GSSA 3CSHA 4IELA 2A2SA 3MDKA 1B4PA 2P0GA 4RI7A 2QGVA 5FT3A 3H93A 4WKWA 2GQMA 4K5RA 6GSWA 4ZXGA 4TW5A 2H8LA 1QK8A 1E6BA 1FVKA 3ZVJD 4BVXA 2OA7A 3APOA 3IBHA 1X9SB 1K0CA 2R3XA 4NV5A 2JL4A 2IWTA 2CZ2A 1ZYQB 1X9MB 2E2GA 2JSZA 3NZNA 5B7CA 2K18A 5AIXA 2IMDA 4FYCA 2R6KA 1MDJA 5AIVA 4I8BA 5KOXA 3N9JA 2NVLA 1SKRB 3PR8A 5D96A 5DQYA 2CT6A 1J0FA 2TRCP 5E4WA 4BWQA 3UBKA 1U3IA 1J9BA 4G0LA 1VRSD 4ECIA 2O89A 2B5XA 4HEA2 1PKZA 2ON5A 4NWYA 3CYNA 1YZXA 2H76A 1TI1A 1OE8A 2H74A 4TXVA 4O5QA 4JEDA 1R7HA 3GX8A 1V98A 1SYXA 2XBQA 4J56E 1SKSB 3CSIA 2IMEA 2VD1A 2WULA 3M9KA 4KW6A 4POKA 2QKEA 1A24A 3UARA 1PA3A 2IFQA 1TKDB 3C1RA 4D73A 1WP0A 4I5QA 4MP4A 5GAND 1O73A 1T8EB 5DJMA 3FZAA 2P5QA 4KCEA 3TKSE 3F6FA 1TU7A 3Q19A 1WWJA 1ILOA 2QA2A 1SK0A 1F3BA 3HVXA 4RI6A 2GSRA 3CTFA 1XWAA 2YOIA 3QR6A 4K6XA 2YP6A 1AUCA 4DSQA 2J9HA 5ECOB 4XRAA 4K7NA 1F37A 1PQNA 1SK1A 2B7KA 2DJ3A 2MMAA 4GTUA 3ZIVA 4ZBAA 3A2VA 5B6MA 1QXHA 2HE3A 3IXRA 4GXZA 3H8QA 1BEDA 1V9WA 1ZL9A 5LD0A 20GSA 1O6JA 1PSQA 5IIZA 1A2JA 3HVSA 3GV1A 5BRTA 3ZZXA 3G9BA 2LNTA 4ISDA 4N11A 3P8WA 3CRTA 4ECJA 2FHEA 5CRDA 2X64A 4IJ3A 2ALBA 3TOUA 1GWCA 3W8SA 5KN2A 3CTGA 3KEBA 5IOXA 4X43A 3RHCA 3TJJA 3FR6A 2NDOA 4HOJA 1XW9A 1KBNA 3HVVA 2OBKA 5EPFA 4GSTA 2RLIA 4AGSA 3DMLA 2YWNA 2PBJA 1TK5B 3UOMA 1GLPA 5JWRB 2CVBA 4KE3A 2V6KA 4KNDA 5INYA 5G5EA 2GVPA 1R26A 5A4WA 4O5UA 3V1WA 2H6ZA 1ZZYA 4MNNA 4KGIA 3TRPA 2BMXA 2L4CA 4TRXA 5JWOB 2YNXA 2DBCA 1QQ2A 2HRKA 2L4QA 1OC9A 1MEKA 4MJBA 1SKWB 2A4HA 1GNWA 3P7XA 3ZFBA 2C0DA 3QAWA 3GURA 2GTUA 5HFGA 4CY8A 4POMA 2JZRA 3LJRA 4N10A 3F8UA 2YPMA 2LQOA 2GQLA 2Z9SA 4Q5FA 1TRUA 1TXXA 1GUMA 1WPIA 3EE2A 4NV2A 3KXOA 3TDGA 4KSMA 2FA4A 2PVQA 3QPMA 4H86A 1BX9A 3J7Yb 1FB0A 2LRCA 3CQFA 3TJGA 4ZL9A 5A5KA 5H5QA 4IW9A 4WBJA 1ZYEA 2N5AA 3QFAC 1N2AA 4N0ZA 1USBA 2DJ2A 3TUEA 2VD0A 4BVXB 2FNOA 4OFNA 3F4SA 5HQPA 2AJQB 1Q4JA 5IQYA 1PN0A 2R37A 1S3CA 2K6VA 4MJCA 5F07A 4EXJA 1THOA 5B8BA 1SL2B 14GSA 3P90A 1SYRA 4K2XA 2V1MA 2KLXA 4K8MA 1GTUA 3HD5A 4PURA 4PXOA 4X1UA 3QCPA 1WRYA 2PN8A 3H1NA 3LORA 3IA1A 2CVKA 3MNGA 4G0KA 3WT2A 5J3RA 1JZWA 1JZRA 4GQCA 2WCIA 4QQ7A 3PPUA 3I43A 3ISOA 1GSFA 2JU5A 1XOAA 6GSXA 4V2NA 1FB6A 5B8AA 1JFUA 2K8SA 1AC1A 4JRRA 1F9MA 1GSSA 3BD2A 3IC8A 4V2LA 5CRHA 5ABRA 3EYTA 1T00A 4WXTA 4G2EA 3CSJA 3ERGA 4D73B 4ULXA 6GSYA 22GSA 3DKSA 2FCHA 5ECMB 3TKQA 1QMVA 4O5RA 5CAXA 2HI7A 3LG6A 2XBIA 3A5WA 2KP1A 4IJIA 5FHIA 5DALA 3ZMLA 1RK4A 2O8VB 3QAGA 4BIKA 1TW9A 2YCDA 2I3YA 2ON7A 3DIEA 1CQHA 1LU4A 2MYGA 5F05A 4PQ1A 4DSRA 5IPGA 3IC4A 2V41A 5J4UA 1ZYPA 1DBYA 3KM6A 2VL2C 4ZBBA 1ACVA 5ID2B 5ECQB 1R4WA 2LV3A 1IYIA 1Z3EA 4KSOA 1NHOA 2PGTA 4V2MA 2HZFA 1GRXA 3HJOA 4HDEA 1G6YA 3GX0A 3MYDA 1A8YA 1TRVA 3ZYWA 3KTBA 1ON4A 2BJXA 4G0IA 2O87A 1BQ7A 2DJ1A 3H4KA 3IHGA 3QAVA 1PMTA 1DUGA 3M8NA 4IQAA 2WJUA 5H5RA 2ZNMA 4FO5A 4LL4B 4XIHA 1ZCPA 2FWHA 3APQA 3QDNA 3M0FA 3IOSA 1U3AA 1O8WA 5G2ZA 3VWXA 1B9YC 3K8NA 3FYGA 3D4TA 2VO4A 1V40A 4FYUA 1BG5A 5D9XA 4X0XA 4BVYB 1O8XA 4CDOA 1GSQA 1YJ6A 5COHA 4MF6A 5HFIA 3GTUB 1S3RA 2OE3A 2H71A 3FZ4A 3ME7A 1M3JA 3IK7A 4PGTA 3IPZA 2DIZA 3M9JA 5GZZB 2F8AA 2OE0A 5ECIB 2LNSA 3E0UA 2P31A 2H6XA 5DAKA 3EURA 3APSA 3KJYA 2YV9A 1YEXA 4KDYA 3VFIA 1TI3A 3ZLPA 4HI7A 3GKKA 5ELAA 3HY2A 3KGKA 5HFKA 2MMZA 1K3OA 1ZMAA 4HSCX 1VF4A 2YJHA 3IE3A 1XFLA 4EVMA 4ECBA 1X9WB 2YWMA 1EGRA 1AQWA 1FOVA 4Q5RA 4MABA 4PQIA 3TGZA 3H79A 5LCZA 3I6AA 1EP8A 3FY7A 4OO4A 1AXDA 1PL1A 1T4ZA 2RUEA 4TOPA 2HLSA 2CX3A 3KTLA 3VPTA 5KN0A 3GA4A 2RIIA 2ES7A 2C3QA 1R5AA 2DJ0A 2K8VA 9GSSA 3GRXA 1KTEA 4V1Ag 4KF9A 4GSNA 1K0OA 5IMVA 4IP6A 2VCWA 5ECSA 1GP1A 3HCZA 4EE0A 2DC5A 1A0RP 3MAKA 1PRXA 4HU9A 5G31A 2L5OA 5G1LA 1V58A 1XWKA 2H70A 1XIYA 2CQ9A 1PX6A 5IOWA 1M2AA 4CY6A 2FWGA 2VLUA 3DVWA 4ZL7A 1HNAA 2F3MA 1HYUA 4OD7A 5EL8A 5IMZA 4JE1A 3IAM2 4XRDA 2LKUA 2DMMA 1C72A 4G10A 4POLA 3HHVA 4DSSB 3TRQA 1M0UA 2HT9A 2MMNA 5IMAA 5DCHA 2DIYA 3CMIA 5H5SA 4HQZA 4K5SA 3W6GA 5GSSA 3HZ4A 3GHAA 4PQHA 4ZILA 3TRXA 1SJIA 1FVJA 4YAVA 1LBKA 4DVCA 2I4AA 4JBBA 3WGDA 4POBA 3ZFLA 1S3DA 2IMIA 5AGYA 1VGLA 2YN1A 1XWGA 5G5FA 4A5PA 3LEFA 1BYEA 4MZBA 2G2QA 3GL3A 2ZCTA 2HNLA 2N5BA 1ERVA 4MMMA 1FW1A 2YZHA 1TRWA 1HQOA 3C1SA 3AY8A 3C71A 1O81A 3F3QA 2I1UA 4IP1A 4K7IA 2GT6A 4MPFA 5CP1A 2YJ7A 2H1DA 3R3EA 4WR5A 5E59A 2H66A 3ZL5A 3MSZA 4EO3A 4KCAA 4XS4A 4I97A 2GSSA 3N5OA 4NAXA 1H75A 1S3AA 3EU3A 1BAYA 4MZWA 4AF2A 3TCOA 2PU9C 5J9CA 3ZTLA 2VL3A 1A2MA 1WJKA 5ELGA 4HU7A 1A8LA 2R0PA 2CA8A 3RBTA 4JZQA 1BJXA 2IMFA 1Z9HA 1FAAA 5D73A 1Y6EA 4K2DA 3VURA 1YEPA 5D93A 2JZTA 1OE7A 1XCCA 1SU9A 4NMUA 2AYTA 4YQUA 4BPYA 1OC3A 5DJLA 3C73A 1TP9A 1R5PA 5JCUA 4EUYA 1U87A 3D6IA 1ZGNA 3QMXA 1QUWA 3GKMA 1OKTA 5ECLB 5A4UA 1GSYA 4MPGA 5CRWA 3M1GA 2GDRA 3DD3A 2VLTA 4MF5A 1W89A 2HZEB 4ZB9A 3G7YA 3TJFA 5IO0A 3JCML 3WT1A 1EEJA 3P2AA 2HXKA 2CAQA 4RQXA 2C0EA 1T3BA 3ZREA 4ZIJA 1M7TA 2FLSA 1XZOA 1M9BA 4MDCA 4AJ8A 3L78A 2H73A 1ERWA 2J23A 3FMWA 5EVOA 3DVXA 4NHZA 2OADA 1UVZA 6GSUA 1H4OA 2C8UA 4AJ6A 1NSWA 2A2PA 2FGXA 1TOFA 4YKFA 2MBSA 3EMXA 2PPTA 6GSSA 2LRTA 3KCMA 2HSYA 2GSTA 4XS6A 5L71A 2MMOA 2QSIA 10GSA 4QL7A 4PUFC 2AHEA 2WB9A 3GKNA 2VAFA 2HSHA 1OAZA 3BBYA 3KIJA 4Z2RA 3W8JA 5DCGA 1ML6A 2FUG2 5DDLA 4LA1A 3HYPA 4J57E 5HR2A 3FKFA 2I9HA 1KEBA 3DEXA 2PMTA 4MA9A 1M2BA 4N0VA 3C8EA 3OR5A 3VWUA 2DJJA 3A2WA 1PL2A 1DE1A 2VCZA 2LUSA 1WIKA 4HQSA 2M46A 5B6NA 1EZKA 4FIWA 3US3A 1EGOA 1M99A 2WDUA 4YKGA 5IMFA 3L0HA 2E2MA 1UA5A 2O85A 2JACA 5J5NA 3VWVA 3TKSC 1M9AA 4NPBA 2YWIA 4MH2A 4FYBA 3UBLA 2IFQB 5CYYA 2C0FA 2XHFA 11GSA 18GSA 3D0ZA 4OWYA 3GFKA 5JWQB 1Z7PA 1V2AA 3GKXA 5DQSA 3GMFA 2R5GA 3FK8A 4TKYA 2V2GA 3E3EA 4KDUA 1SL1B 2VL9A 4WR4A 3UEMA 1AIUA 2OE1A 2H19A 2EIOA 3EWLA 1SJ6A 3TJKA 2E0QA 1NW2A 2GGTA 1URMA 3M3MA 2K9FA 16GSA 2VOCA 1OVNA 2X8GA 2IMKA 3UJ1A 2AUVA 2LS5A 3LFLA 2IPAA 3Q18A 3TOTA 3LWAA 13GSA 4GRFA 3FR9A 1UC7A 4XS4B 3O3TA 2VM1A 1KNGA 2XPDA 2X8CA 2LEGA 3CRUA 3GH9A 2ZUPA 3KP8A 2PVOC 3GN3A 1YKCA 4ZB8A 4I6XA 4MLYA 1M3IA 3FZ5A 1VF3A 1A0FA 4HZ2A 1MTCA 2F8FA 4NHWA 2H0IA 4XTSA 4ECCA 1TTZA 4RUVA 3CXGA 4YAPA 2L57A 1G0TA 3MIXA 5LNKe 4ZB6A 2VCVA 1XWCA 12GSA 2A4VA 3IDVA 4LMWA 2GT5A 1K0MA 3D21A 4WBRD 5FWGA 3A3TA 3MWHA 1NHYA 1YY7A 4BL7A 3GUSA 2KHPA 4G19A 3RPPA 5JCGA 3LGCA 2GLRA 3NIVA 4L0WA 1XBSA 4EL1A 2VCTA 17GSA 2AV4A 2WS2A 3KMNA 1YF0A 1PX7A 2HYXA 2NBSA 1GTAA 3HDCA
chains in the Genus database with same CATH topology
1AW9A 2GS3A 5C04A 4IBPA 4Q5NA 4GF0A 1YDKA 2FWEA 1AAZA 3RPNA 2YZUA 2HRFA 3U6VA 1OC9B 4XCSA 3TB2A 2MBTA 1UN2A 1F3AA 2DLXA 2B1KA 5CREA 4I2UA 4V1Ap 5F06A 2DSAA 3C7MA 5HR0A 3F9UA 4TR0A 5DVBA 2IJYA 5CNWA 2YV7A 2GQKA 3DRNA 3RDWA 3BOAA 2DJKA 1B48A 4K7OA 1X5EA 2X99A 2JZSA 1TDIA 1JLWA 1PGTA 5J9BA 1K0BA 1TU8A 4N30A 3CBUA 2VL2A 3F0IA 4F0CA 5CO3A 3PINA 2NTOA 1SJZA 1SD9A 3O76A 2PWJA 7GSSA 4P3YB 1J08A 3VI7A 4JR4A 2G0FA 2H75A 3BJ5A 4ICYA 4OCEA 2B6MA 2QC7A 4KAEA 3GL5A 5HR3A 3L9SA 3VPQA 1G6WA 2OKAA 4CW9A 3KMOA 2L6DA 1XWBA 1V57A 2OBIA 4IQ1A 1K0DA 1YQ1A 1T4YA 1EOHA 3I9V2 3FEUA 4L5OA 4ZBDA 4TVEA 4TR4A 5D9TA 1F6MC 3NOFA 4IN0A 1GSDA 3VK9A 2O7KA 2RUFA 1XPVA 1SL0B 3Q74A 1WMJA 1B4QA 3GSSA 1IYHA 1E2YA 2F9SA 3LQ7A 4EIPA 4Z2TA 3RHBA 1AQXA 4IGJA 3ZRDA 1FOHA 1PKWA 4X4JA 3E9JB 1N8JA 2WZ9A 2QA1A 4XHMA 5D9WA 3ZIJA 3KH7A 1O85A 3LYKA 3IRAA 2OJLA 3KP9A 2H6YA 4EIQA 4ML1A 5DBQA 1PN9A 2JSYA 5ECPB 4KDXA 1I5GA 2YANA 3RAZA 1XOBA 1VF2A 2RM5A 2H1GA 5KOWA 5DALB 4KA0A 2L59A 3GH6A 3VI5A 4TR1A 3D4MA 3EC3A 2LSTA 4J2FA 2B3SA 1RQMA 4DEJA 1EWXA 4I2TA 4Q5QA 2LJRA 2H72A 2IL3A 1GSEA 4MH3A 2A2RA 1RW1A 4PUAA 1GH2A 2NPBA 2WFCA 1X0RA 2KOKA 1T1VA 1A2LA 3KD0A 5IMCA 1YF1A 1THXA 2N5FA 5BMUA 1JLVA 1XVWA 2XC2A 2P5RA 3R2QA 1DE2A 2WRTA 3LW9A 2H01A 2B1LA 1EOGA 1Z5YE 4F0BA 3G7JA 2EIQA 5ID2A 3ED3A 2CVDA 4HJ2A 4G9HA 4WEYA 2VCQA 2PUKC 4TXOA 2BTOT 2V6OA 2LRNA 5AISA 4BL7B 4HS1A 5C00A 1EV9A 1EEMA 2GZYA 1MDKA 4YQMA 3U5RE 4EDYA 3FZ9A 2XPEA 4HJMA 2H1BA 2AAWA 2LQQA 4GSSA 2C1YA 1FG4A 2OACA 2PERA 3HZ8A 4O32A 1GLQA 3UVHA 4BVYA 4E8HA 1B9XC 3SWLA 4F82A 1AQVA 3DWVA 3LXTA 1SK2A 4FQUA 4F9ZA 3GTUA 1XW5A 4MJEA 4TN8A 4ML6A 3UAPA 4ACSA 4WF5A 5DAKB 1ZYNA 3TKPA 5EY6A 5J41A 5G30A 2DKHA 3LXZA 2FY6A 1EV4A 4YQVA 3LYPA 2EC4A 1K0NA 2R2JA 3D22A 2I81A 1GULA 2VCXA 4WETA 2UZ8A 4KH7A 4L0UA 2IIYA 3BCIA 2CV4A 4LL1B 1U88A 3IAS2 5KN3A 3HJPA 3PGTA 2GSQA 2F51A 2FA8A 3IHQA 4LMVA 3J7Yk 1TK8B 2KUCA 1GTIA 6GSVA 3S9FA 3VWWA 4PNGA 19GSA 2AB6A 1JZOA 5ENUA 3F4TA 4RQRA 1A23A 3PH9A 1K0AA 2VIMA 4GCIA 4PNFA 1XXUA 3GYKA 1Y25A 1QFNA 2GZZA 4JR6A 1W4VA 1JZDA 4OMVA 1K3LA 2CX4A 2B7JA 3EPTA 2VLVA 4ID0A 4EC0A 1MD3A 2HSMA 5ECNB 3UIWA 1WE0A 4IHUA 1GUHA 1ERTA 4EKZA 1U6TA 2L5LA 1OC8A 4F2IA 4K1FA 1X5CA 3BCKA 4KB3A 4TR3A 6GSTA 2X8HA 4PX1A 2IN3A 3HA9A 3UVTA 3DGQA 3F6DA 1PD21 2EIRA 2JADA 4JU5A 4BWSA 1GSUA 1MDIA 3GNJA 2B5EA 2E7PA 3ERFA 3IV4A 4YH2A 1Z7RA 2MZCA 3HXSA 4PTSA 2X49A 3O6TA 3FR3A 4GWRA 3G7IA 1GNEA 5IMDA 3KZQA 3EMPA 3SBCA 2R4VA 1K3YA 3F3RA 3IK9A 3WD6A 3ZVJA 4OCFA 4DSSA 3QOUA 3GIXA 4USSA 3TKRA 4MJAA 4HUAA 2C80A 1O7UA 1T7PB 1VF1A 2CAIA 1FO5A 1TRSA 4FH8A 4OFMA 5AN1A 3FW2A 4K0NA 4O92A 5D9VA 2GZPA 4K9ZA 4TR1B 1Z6MA 1JHBA 2LJKA 2YWOA 1DSBA 4ZL8A 5JCWA 3WGEA 1G7EA 4GQFA 4MK3A 5G1KA 4CHSA 4EDZA 1SD8A 2REMA 3EVIA 2DKIA 2C0GA 3DXBA 1ERUA 2B5YA 2H0HA 1HD2A 3FHKA 2FD3A 3WGXA 4BA7A 4L8EA 4L5LA 1TK0B 1OKDA 3D5JA 3DYRA 3WYWA 2RM6A 3I69A 4WF4A 1YKAA 4O7HA 4AJ7A 3Q6OA 2C3TA 1OYJA 4IS0A 2R0GA 2CZ3A 1X5DA 4KUNA 1XVQA 1Q98A 1HNCA 2HRNA 2VUPA 2H0GA 4MCUA 3L4NA 2TRXA 3TJBA 4ILFA 2HRAA 4KX4A 5F0GA 4E8EA 2M80A 1M2DA 3UL3A 2H30A 4Z2UA 1GUKA 4GLTA 1GTBA 3EU4A 4TXOB 4IKHA 5IO2A 1MD4A 2V32A 3ZITA 4EF0A 3F63A 3TKSA 3F4RA 5F8BA 4QL9A 5CRGA 5D8IA 1ZOFA 5IPHA 2LJAA 3QD9A 1HNBA 2X4AA 3FRCA 3KH9A 4MF7A 4IVFA 1NM3A 3EINA 3L9UA 3QFBC 2KP2A 5HR1A 3ME8A 1ST9A 2D2ZA 2TIRA 1XW6A 1I9DA 4K0GA 5KEJA 3VLNA 4MZCA 1CQGA 3HKRA 1FHEA 1G7OA 5ECRB 4Z7XA 2C3NA 3ZMKA 1GL8A 2HZEA 1LJRA 1EP7A 1F2EA 1B8XA 3A5IA 2LTKA 1Z6NA 2HFDA 3UMAA 2M72A 3HJMA 1QGVA 4LLRA 2VM2A 2L6CA 2H1AA 5IM9A 1SENA 1WOUA 4F03A 4XS1A 3IR4A 1TJDA 2R0CA 2FWFA 3GSTA 4NXIA 1ABAA 3ERWA 3LSZA 3L9VA 5KN1A 2WGRA 5GAPD 4OFTA 2DMLA 3A2XA 4HZ4A 4OO5A 5A4VA 5ECKB 2C4JA 5ECHB 5GSTA 8GSSA 3CSHA 4IELA 2A2SA 3MDKA 1B4PA 2P0GA 4RI7A 2QGVA 5FT3A 3H93A 4WKWA 2GQMA 4K5RA 6GSWA 4ZXGA 4TW5A 2H8LA 1QK8A 1E6BA 1FVKA 3ZVJD 4BVXA 2OA7A 3APOA 3IBHA 1X9SB 1K0CA 2R3XA 4NV5A 2JL4A 2IWTA 2CZ2A 1ZYQB 1X9MB 2E2GA 2JSZA 3NZNA 5B7CA 2K18A 5AIXA 2IMDA 4FYCA 2R6KA 1MDJA 5AIVA 4I8BA 5KOXA 3N9JA 2NVLA 1SKRB 3PR8A 5D96A 5DQYA 2CT6A 1J0FA 2TRCP 5E4WA 4BWQA 3UBKA 1U3IA 1J9BA 4G0LA 1VRSD 4ECIA 2O89A 2B5XA 4HEA2 1PKZA 2ON5A 4NWYA 3CYNA 1YZXA 2H76A 1TI1A 1OE8A 2H74A 4TXVA 4O5QA 4JEDA 1R7HA 3GX8A 1V98A 1SYXA 2XBQA 4J56E 1SKSB 3CSIA 2IMEA 2VD1A 2WULA 3M9KA 4KW6A 4POKA 2QKEA 1A24A 3UARA 1PA3A 2IFQA 1TKDB 3C1RA 4D73A 1WP0A 4I5QA 4MP4A 5GAND 1O73A 1T8EB 5DJMA 3FZAA 2P5QA 4KCEA 3TKSE 3F6FA 1TU7A 3Q19A 1WWJA 1ILOA 2QA2A 1SK0A 1F3BA 3HVXA 4RI6A 2GSRA 3CTFA 1XWAA 2YOIA 3QR6A 4K6XA 2YP6A 1AUCA 4DSQA 2J9HA 5ECOB 4XRAA 4K7NA 1F37A 1PQNA 1SK1A 2B7KA 2DJ3A 2MMAA 4GTUA 3ZIVA 4ZBAA 3A2VA 5B6MA 1QXHA 2HE3A 3IXRA 4GXZA 3H8QA 1BEDA 1V9WA 1ZL9A 5LD0A 20GSA 1O6JA 1PSQA 5IIZA 1A2JA 3HVSA 3GV1A 5BRTA 3ZZXA 3G9BA 2LNTA 4ISDA 4N11A 3P8WA 3CRTA 4ECJA 2FHEA 5CRDA 2X64A 4IJ3A 2ALBA 3TOUA 1GWCA 3W8SA 5KN2A 3CTGA 3KEBA 5IOXA 4X43A 3RHCA 3TJJA 3FR6A 2NDOA 4HOJA 1XW9A 1KBNA 3HVVA 2OBKA 5EPFA 4GSTA 2RLIA 4AGSA 3DMLA 2YWNA 2PBJA 1TK5B 3UOMA 1GLPA 5JWRB 2CVBA 4KE3A 2V6KA 4KNDA 5INYA 5G5EA 2GVPA 1R26A 5A4WA 4O5UA 3V1WA 2H6ZA 1ZZYA 4MNNA 4KGIA 3TRPA 2BMXA 2L4CA 4TRXA 5JWOB 2YNXA 2DBCA 1QQ2A 2HRKA 2L4QA 1OC9A 1MEKA 4MJBA 1SKWB 2A4HA 1GNWA 3P7XA 3ZFBA 2C0DA 3QAWA 3GURA 2GTUA 5HFGA 4CY8A 4POMA 2JZRA 3LJRA 4N10A 3F8UA 2YPMA 2LQOA 2GQLA 2Z9SA 4Q5FA 1TRUA 1TXXA 1GUMA 1WPIA 3EE2A 4NV2A 3KXOA 3TDGA 4KSMA 2FA4A 2PVQA 3QPMA 4H86A 1BX9A 3J7Yb 1FB0A 2LRCA 3TJGA 4ZL9A 5A5KA 5H5QA 4IW9A 4WBJA 1ZYEA 2N5AA 3QFAC 1N2AA 4N0ZA 1USBA 2DJ2A 3TUEA 2VD0A 4BVXB 2FNOA 4OFNA 3F4SA 5HQPA 2AJQB 1Q4JA 5IQYA 1PN0A 2R37A 1S3CA 2K6VA 4MJCA 5F07A 4EXJA 1THOA 5B8BA 1SL2B 14GSA 3P90A 1SYRA 4K2XA 2V1MA 2KLXA 4K8MA 1GTUA 3HD5A 4PURA 4PXOA 4X1UA 3QCPA 1WRYA 2PN8A 3H1NA 3LORA 3IA1A 2CVKA 3MNGA 4G0KA 3WT2A 5J3RA 1JZWA 1JZRA 4GQCA 2WCIA 4QQ7A 3PPUA 3I43A 3ISOA 1GSFA 2JU5A 1XOAA 6GSXA 4V2NA 1FB6A 5B8AA 1JFUA 2K8SA 1AC1A 4JRRA 1F9MA 1GSSA 3BD2A 3IC8A 4V2LA 5CRHA 5ABRA 3EYTA 1T00A 4WXTA 4G2EA 3CSJA 3ERGA 4D73B 4ULXA 6GSYA 22GSA 3DKSA 2FCHA 5ECMB 3TKQA 1QMVA 4O5RA 5CAXA 2HI7A 3LG6A 2XBIA 3A5WA 2KP1A 4IJIA 5FHIA 5DALA 3ZMLA 1RK4A 2O8VB 3QAGA 1TW9A 2YCDA 2I3YA 2ON7A 3DIEA 1CQHA 1LU4A 2MYGA 5F05A 4PQ1A 4DSRA 5IPGA 3IC4A 2V41A 5J4UA 1ZYPA 1DBYA 3KM6A 2VL2C 4ZBBA 1ACVA 5ID2B 5ECQB 1R4WA 2LV3A 1IYIA 1Z3EA 4KSOA 1NHOA 2PGTA 4V2MA 2HZFA 1GRXA 3HJOA 4HDEA 1G6YA 3GX0A 3MYDA 1A8YA 1TRVA 3ZYWA 3KTBA 1ON4A 2BJXA 4G0IA 2O87A 1BQ7A 2DJ1A 3H4KA 3IHGA 3QAVA 1PMTA 1DUGA 3M8NA 4IQAA 2WJUA 5H5RA 2ZNMA 4FO5A 4LL4B 4XIHA 1ZCPA 2FWHA 3APQA 3QDNA 3M0FA 3IOSA 1U3AA 1O8WA 5G2ZA 3VWXA 1B9YC 3K8NA 3FYGA 3D4TA 2VO4A 1V40A 4FYUA 1BG5A 5D9XA 4X0XA 4BVYB 1O8XA 4CDOA 1GSQA 1YJ6A 5COHA 4MF6A 5HFIA 3GTUB 2OE3A 2H71A 3FZ4A 3ME7A 3IK7A 4PGTA 3IPZA 2DIZA 3M9JA 5GZZB 2F8AA 2OE0A 5ECIB 2LNSA 3E0UA 2P31A 2H6XA 5DAKA 3EURA 3APSA 3KJYA 2YV9A 1YEXA 4KDYA 3VFIA 1TI3A 3ZLPA 4HI7A 3GKKA 5ELAA 3HY2A 3KGKA 5HFKA 2MMZA 1K3OA 1ZMAA 1VF4A 2YJHA 3IE3A 1XFLA 4EVMA 4ECBA 1X9WB 2YWMA 1EGRA 1AQWA 1FOVA 4Q5RA 4MABA 4PQIA 3TGZA 3H79A 5LCZA 3I6AA 1EP8A 3FY7A 4OO4A 1AXDA 1PL1A 1T4ZA 2RUEA 4TOPA 2HLSA 2CX3A 3KTLA 3VPTA 5KN0A 3GA4A 2RIIA 2ES7A 2C3QA 1R5AA 2DJ0A 2K8VA 9GSSA 3GRXA 1KTEA 4V1Ag 4KF9A 4GSNA 1K0OA 5IMVA 4IP6A 2VCWA 5ECSA 1GP1A 3HCZA 4EE0A 2DC5A 1A0RP 3MAKA 1PRXA 4HU9A 5G31A 2L5OA 5G1LA 1V58A 1XWKA 2H70A 1XIYA 2CQ9A 1PX6A 5IOWA 1M2AA 4CY6A 2FWGA 2VLUA 3DVWA 4ZL7A 1HNAA 2F3MA 1HYUA 4OD7A 5EL8A 5IMZA 4JE1A 3IAM2 4XRDA 2LKUA 2DMMA 1C72A 4G10A 4POLA 3HHVA 4DSSB 3TRQA 1M0UA 2HT9A 2MMNA 5IMAA 5DCHA 2DIYA 3CMIA 5H5SA 4HQZA 4K5SA 3W6GA 5GSSA 3HZ4A 3GHAA 4PQHA 4ZILA 3TRXA 1SJIA 1FVJA 4YAVA 1LBKA 4DVCA 2I4AA 4JBBA 3WGDA 4POBA 3ZFLA 1S3DA 2IMIA 5AGYA 1VGLA 2YN1A 1XWGA 5G5FA 4A5PA 3LEFA 1BYEA 4MZBA 2G2QA 3GL3A 2ZCTA 2HNLA 2N5BA 1ERVA 4MMMA 1FW1A 2YZHA 1TRWA 1HQOA 3C1SA 3AY8A 3C71A 1O81A 3F3QA 2I1UA 4IP1A 4K7IA 2GT6A 4MPFA 5CP1A 2YJ7A 2H1DA 3R3EA 4WR5A 5E59A 2H66A 3ZL5A 3MSZA 4EO3A 4KCAA 4XS4A 4I97A 2GSSA 3N5OA 4NAXA 1H75A 1S3AA 3EU3A 1BAYA 4MZWA 4AF2A 3TCOA 2PU9C 5J9CA 3ZTLA 2VL3A 1A2MA 1WJKA 5ELGA 4HU7A 1A8LA 2R0PA 2CA8A 3RBTA 4JZQA 1BJXA 2IMFA 1Z9HA 1FAAA 5D73A 1Y6EA 4K2DA 3VURA 1YEPA 5D93A 2JZTA 1OE7A 1SU9A 1XCCA 4NMUA 2AYTA 4YQUA 4BPYA 1OC3A 5DJLA 3C73A 1TP9A 1R5PA 5JCUA 4EUYA 1U87A 3D6IA 1ZGNA 3QMXA 1QUWA 3GKMA 1OKTA 5ECLB 5A4UA 1GSYA 4MPGA 5CRWA 3M1GA 2GDRA 3DD3A 2VLTA 4MF5A 1W89A 2HZEB 4ZB9A 3G7YA 3TJFA 5IO0A 3JCML 3WT1A 1EEJA 3P2AA 2HXKA 2CAQA 4RQXA 2C0EA 1T3BA 3ZREA 4ZIJA 1M7TA 2FLSA 1XZOA 1M9BA 4MDCA 4AJ8A 3L78A 2H73A 1ERWA 2J23A 3FMWA 5EVOA 3DVXA 4NHZA 2OADA 1UVZA 6GSUA 1H4OA 2C8UA 4AJ6A 1NSWA 2A2PA 2FGXA 1TOFA 4YKFA 2MBSA 3EMXA 2PPTA 6GSSA 2LRTA 3KCMA 2HSYA 2GSTA 4XS6A 5L71A 2MMOA 2QSIA 10GSA 4QL7A 4PUFC 2AHEA 2WB9A 3GKNA 2VAFA 2HSHA 1OAZA 3BBYA 3KIJA 4Z2RA 3W8JA 5DCGA 1ML6A 2FUG2 5DDLA 4LA1A 3HYPA 4J57E 5HR2A 3FKFA 2I9HA 1KEBA 3DEXA 2PMTA 4MA9A 1M2BA 4N0VA 3C8EA 3OR5A 3VWUA 2DJJA 3A2WA 1PL2A 1DE1A 2VCZA 2LUSA 1WIKA 4HQSA 2M46A 5B6NA 1EZKA 4FIWA 3US3A 1EGOA 1M99A 2WDUA 4YKGA 5IMFA 3L0HA 2E2MA 1UA5A 2O85A 2JACA 5J5NA 3VWVA 3TKSC 1M9AA 4NPBA 2YWIA 4MH2A 4FYBA 3UBLA 2IFQB 5CYYA 2C0FA 2XHFA 11GSA 18GSA 3D0ZA 4OWYA 3GFKA 5JWQB 1Z7PA 1V2AA 3GKXA 5DQSA 3GMFA 2R5GA 3FK8A 4TKYA 2V2GA 3E3EA 4KDUA 1SL1B 2VL9A 4WR4A 3UEMA 1AIUA 2OE1A 2H19A 2EIOA 3EWLA 1SJ6A 3TJKA 2E0QA 1NW2A 2GGTA 1URMA 3M3MA 2K9FA 16GSA 2VOCA 1OVNA 2X8GA 2IMKA 3UJ1A 2AUVA 2LS5A 3LFLA 2IPAA 3Q18A 3TOTA 3LWAA 13GSA 4GRFA 3FR9A 1UC7A 4XS4B 3O3TA 2VM1A 1KNGA 2XPDA 2X8CA 2LEGA 3CRUA 3GH9A 2ZUPA 3KP8A 2PVOC 3GN3A 1YKCA 4ZB8A 4I6XA 4MLYA 3FZ5A 1VF3A 1A0FA 4HZ2A 1MTCA 2F8FA 4NHWA 2H0IA 4XTSA 4ECCA 1TTZA 4RUVA 3CXGA 4YAPA 2L57A 1G0TA 3MIXA 5LNKe 4ZB6A 2VCVA 1XWCA 12GSA 2A4VA 3IDVA 4LMWA 2GT5A 1K0MA 3D21A 4WBRD 5FWGA 3A3TA 3MWHA 1NHYA 1YY7A 4BL7A 3GUSA 2KHPA 4G19A 3RPPA 5JCGA 3LGCA 2GLRA 3NIVA 4L0WA 1XBSA 4EL1A 2VCTA 17GSA 2AV4A 2WS2A 3KMNA 1YF0A 1PX7A 2HYXA 2NBSA 1GTAA 3HDCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AW9 A;  2GS3 A;  5C04 A;  4IBP A;  4Q5N A;  4GF0 A;  1YDK A;  2FWE A;  1AAZ A;  3RPN A;  2YZU A;  2HRF A;  3U6V A;  1OC9 B;  4XCS A;  3TB2 A;  2MBT A;  1UN2 A;  1F3A A;  2DLX A;  2B1K A;  5CRE A;  4I2U A;  4V1A p;  5F06 A;  2DSA A;  3C7M A;  5HR0 A;  3F9U A;  4TR0 A;  5DVB A;  2IJY A;  5CNW A;  2YV7 A;  2GQK A;  3DRN A;  3RDW A;  3BOA A;  2DJK A;  1B48 A;  4K7O A;  1X5E A;  2X99 A;  2JZS A;  1TDI A;  1JLW A;  1PGT A;  5J9B A;  1K0B A;  1TU8 A;  4N30 A;  3CBU A;  2VL2 A;  3F0I A;  4F0C A;  5CO3 A;  3PIN A;  2NTO A;  1SJZ A;  1SD9 A;  3O76 A;  2PWJ A;  7GSS A;  4P3Y B;  1J08 A;  3VI7 A;  4JR4 A;  2G0F A;  2H75 A;  3BJ5 A;  4OCE A;  2B6M A;  2QC7 A;  4KAE A;  3GL5 A;  5HR3 A;  3L9S A;  3VPQ A;  1G6W A;  2OKA A;  4CW9 A;  3KMO A;  2L6D A;  1XWB A;  1V57 A;  2OBI A;  4IQ1 A;  1K0D A;  1YQ1 A;  1T4Y A;  1EOH A;  3I9V 2;  3FEU A;  4L5O A;  4ZBD A;  4TVE A;  4TR4 A;  5D9T A;  1F6M C;  3NOF A;  4IN0 A;  1GSD A;  3VK9 A;  2O7K A;  2RUF A;  1XPV A;  1SL0 B;  3Q74 A;  1WMJ A;  1B4Q A;  3GSS A;  1IYH A;  1E2Y A;  2F9S A;  3LQ7 A;  3RHB A;  1AQX A;  4IGJ A;  3ZRD A;  1PKW A;  3E9J B;  1N8J A;  2WZ9 A;  4XHM A;  5D9W A;  3ZIJ A;  3KH7 A;  1O85 A;  3LYK A;  3IRA A;  2OJL A;  3KP9 A;  2H6Y A;  4ML1 A;  5DBQ A;  1PN9 A;  5ECP B;  2JSY A;  4KDX A;  1I5G A;  2YAN A;  3RAZ A;  1XOB A;  1VF2 A;  2RM5 A;  2H1G A;  5DAL B;  4KA0 A;  2L59 A;  3GH6 A;  3VI5 A;  4TR1 A;  3D4M A;  3EC3 A;  2LST A;  4J2F A;  2B3S A;  1RQM A;  4DEJ A;  1EWX A;  4I2T A;  4Q5Q A;  2LJR A;  2H72 A;  2IL3 A;  1GSE A;  4MH3 A;  2A2R A;  1RW1 A;  4PUA A;  1GH2 A;  2NPB A;  2WFC A;  1X0R A;  2KOK A;  1T1V A;  1A2L A;  3KD0 A;  5IMC A;  1YF1 A;  1THX A;  2N5F A;  1JLV A;  1XVW A;  2XC2 A;  2P5R A;  3R2Q A;  1DE2 A;  2WRT A;  2H01 A;  2B1L A;  1EOG A;  1Z5Y E;  4F0B A;  3G7J A;  2EIQ A;  5ID2 A;  3ED3 A;  2CVD A;  4HJ2 A;  4G9H A;  4WEY A;  2VCQ A;  2PUK C;  4TXO A;  2BTO T;  2V6O A;  2LRN A;  5AIS A;  4HS1 A;  5C00 A;  1EV9 A;  1EEM A;  2GZY A;  1MDK A;  4YQM A;  3U5R E;  4EDY A;  3FZ9 A;  2XPE A;  4HJM A;  2H1B A;  2AAW A;  2LQQ A;  4GSS A;  2C1Y A;  1FG4 A;  2OAC A;  2PER A;  3HZ8 A;  4O32 A;  1GLQ A;  3UVH A;  4BVY A;  4E8H A;  1B9X C;  3SWL A;  4F82 A;  1AQV A;  3DWV A;  3LXT A;  1SK2 A;  4F9Z A;  3GTU A;  1XW5 A;  4MJE A;  4TN8 A;  4ML6 A;  3UAP A;  4ACS A;  4WF5 A;  5DAK B;  3TKP A;  5J41 A;  5EY6 A;  5G30 A;  3LXZ A;  2FY6 A;  1EV4 A;  4YQV A;  3LYP A;  2EC4 A;  1K0N A;  2R2J A;  3D22 A;  2I81 A;  1GUL A;  2VCX A;  4WET A;  4KH7 A;  4L0U A;  2IIY A;  3BCI A;  2CV4 A;  4LL1 B;  1U88 A;  3IAS 2;  5KN3 A;  3HJP A;  3PGT A;  2GSQ A;  2F51 A;  2FA8 A;  3IHQ A;  4LMV A;  3J7Y k;  1TK8 B;  2KUC A;  1GTI A;  6GSV A;  3S9F A;  3VWW A;  4PNG A;  19GS A;  2AB6 A;  1JZO A;  5ENU A;  3F4T A;  4RQR A;  1A23 A;  3PH9 A;  1K0A A;  2VIM A;  4GCI A;  4PNF A;  1XXU A;  3GYK A;  1Y25 A;  1QFN A;  2GZZ A;  4JR6 A;  1W4V A;  1JZD A;  4OMV A;  1K3L A;  2CX4 A;  2B7J A;  2VLV A;  4ID0 A;  4EC0 A;  1MD3 A;  5ECN B;  3UIW A;  1WE0 A;  4IHU A;  1GUH A;  1ERT A;  4EKZ A;  1U6T A;  2L5L A;  1OC8 A;  4F2I A;  4K1F A;  1X5C A;  3BCK A;  4KB3 A;  4TR3 A;  6GST A;  2X8H A;  4PX1 A;  2IN3 A;  3HA9 A;  3UVT A;  3DGQ A;  3F6D A;  1PD2 1;  2EIR A;  2JAD A;  4JU5 A;  4BWS A;  1GSU A;  1MDI A;  3GNJ A;  2B5E A;  2E7P A;  3ERF A;  3IV4 A;  4YH2 A;  1Z7R A;  2MZC A;  3HXS A;  3O6T A;  3FR3 A;  4GWR A;  3G7I A;  1GNE A;  5IMD A;  3KZQ A;  3EMP A;  3SBC A;  2R4V A;  1K3Y A;  3F3R A;  3IK9 A;  3WD6 A;  3ZVJ A;  4OCF A;  4DSS A;  3QOU A;  3GIX A;  3TKR A;  4MJA A;  4HUA A;  2C80 A;  1O7U A;  1T7P B;  1VF1 A;  2CAI A;  1FO5 A;  1TRS A;  4FH8 A;  4OFM A;  5AN1 A;  3FW2 A;  4K0N A;  4O92 A;  5D9V A;  2GZP A;  4K9Z A;  4TR1 B;  1Z6M A;  1JHB A;  2LJK A;  2YWO A;  1DSB A;  4ZL8 A;  5JCW A;  3WGE A;  1G7E A;  4GQF A;  4MK3 A;  5G1K A;  4CHS A;  4EDZ A;  1SD8 A;  2REM A;  3EVI A;  2C0G A;  3DXB A;  1ERU A;  2B5Y A;  2H0H A;  1HD2 A;  3FHK A;  2FD3 A;  3WGX A;  4BA7 A;  4L8E A;  4L5L A;  1TK0 B;  1OKD A;  3D5J A;  3DYR A;  3WYW A;  2RM6 A;  3I69 A;  4WF4 A;  1YKA A;  4O7H A;  4AJ7 A;  3Q6O A;  2C3T A;  1OYJ A;  4IS0 A;  2CZ3 A;  1X5D A;  4KUN A;  1XVQ A;  1Q98 A;  1HNC A;  2HRN A;  2VUP A;  2H0G A;  4MCU A;  3L4N A;  2TRX A;  3TJB A;  4ILF A;  4KX4 A;  5F0G A;  4E8E A;  2M80 A;  1M2D A;  3UL3 A;  2H30 A;  1GUK A;  4GLT A;  1GTB A;  3EU4 A;  4TXO B;  4IKH A;  5IO2 A;  1MD4 A;  2V32 A;  3ZIT A;  4EF0 A;  3F63 A;  3TKS A;  3F4R A;  5F8B A;  4QL9 A;  5CRG A;  5D8I A;  1ZOF A;  5IPH A;  2LJA A;  3QD9 A;  1HNB A;  3FRC A;  3KH9 A;  4MF7 A;  4IVF A;  1NM3 A;  3EIN A;  3L9U A;  3QFB C;  2KP2 A;  5HR1 A;  3ME8 A;  1ST9 A;  2D2Z A;  2TIR A;  1XW6 A;  1I9D A;  4K0G A;  5KEJ A;  3VLN A;  4MZC A;  1CQG A;  3HKR A;  1FHE A;  1G7O A;  5ECR B;  4Z7X A;  2C3N A;  3ZMK A;  1GL8 A;  2HZE A;  1LJR A;  1EP7 A;  1F2E A;  1B8X A;  2LTK A;  1Z6N A;  2HFD A;  3UMA A;  2M72 A;  3HJM A;  1QGV A;  4LLR A;  2VM2 A;  2L6C A;  2H1A A;  5IM9 A;  1SEN A;  1WOU A;  4F03 A;  4XS1 A;  3IR4 A;  1TJD A;  2FWF A;  3GST A;  4NXI A;  1ABA A;  3ERW A;  3LSZ A;  3L9V A;  5KN1 A;  2WGR A;  5GAP D;  4OFT A;  2DML A;  3A2X A;  4HZ4 A;  4OO5 A;  5A4V A;  5ECK B;  2C4J A;  5ECH B;  5GST A;  8GSS A;  3CSH A;  4IEL A;  2A2S A;  3MDK A;  1B4P A;  2P0G A;  4RI7 A;  2QGV A;  5FT3 A;  3H93 A;  4WKW A;  2GQM A;  6GSW A;  4ZXG A;  4TW5 A;  2H8L A;  1QK8 A;  1E6B A;  1FVK A;  3ZVJ D;  4BVX A;  2OA7 A;  3APO A;  3IBH A;  1X9S B;  1K0C A;  2R3X A;  4NV5 A;  2JL4 A;  2IWT A;  2CZ2 A;  1ZYQ B;  1X9M B;  2E2G A;  2JSZ A;  3NZN A;  5B7C A;  2K18 A;  5AIX A;  2IMD A;  4FYC A;  2R6K A;  1MDJ A;  5AIV A;  4I8B A;  3N9J A;  2NVL A;  1SKR B;  3PR8 A;  5D96 A;  5DQY A;  2CT6 A;  1J0F A;  2TRC P;  5E4W A;  4BWQ A;  3UBK A;  1U3I A;  1J9B A;  1VRS D;  4ECI A;  2O89 A;  2B5X A;  4HEA 2;  1PKZ A;  2ON5 A;  4NWY A;  3CYN A;  1YZX A;  2H76 A;  1TI1 A;  1OE8 A;  2H74 A;  4TXV A;  4JED A;  1R7H A;  3GX8 A;  1V98 A;  1SYX A;  2XBQ A;  4J56 E;  1SKS B;  3CSI A;  2IME A;  2VD1 A;  2WUL A;  3M9K A;  4KW6 A;  4POK A;  2QKE A;  1A24 A;  3UAR A;  1PA3 A;  2IFQ A;  1TKD B;  3C1R A;  4D73 A;  1WP0 A;  4I5Q A;  4MP4 A;  5GAN D;  1O73 A;  1T8E B;  5DJM A;  3FZA A;  2P5Q A;  4KCE A;  3TKS E;  3F6F A;  1TU7 A;  3Q19 A;  1WWJ A;  1ILO A;  1SK0 A;  1F3B A;  3HVX A;  4RI6 A;  2GSR A;  3CTF A;  1XWA A;  2YOI A;  3QR6 A;  4K6X A;  2YP6 A;  1AUC A;  4DSQ A;  2J9H A;  5ECO B;  4XRA A;  4K7N A;  1F37 A;  1PQN A;  1SK1 A;  2B7K A;  2DJ3 A;  2MMA A;  4GTU A;  3ZIV A;  4ZBA A;  3A2V A;  5B6M A;  1QXH A;  2HE3 A;  3IXR A;  4GXZ A;  3H8Q A;  1BED A;  1V9W A;  1ZL9 A;  5LD0 A;  20GS A;  1O6J A;  1PSQ A;  5IIZ A;  1A2J A;  3HVS A;  3GV1 A;  3ZZX A;  3G9B A;  2LNT A;  4ISD A;  4N11 A;  3P8W A;  3CRT A;  4ECJ A;  2FHE A;  5CRD A;  2X64 A;  4IJ3 A;  2ALB A;  3TOU A;  1GWC A;  3W8S A;  5KN2 A;  3CTG A;  3KEB A;  5IOX A;  4X43 A;  3RHC A;  3TJJ A;  3FR6 A;  2NDO A;  4HOJ A;  1XW9 A;  1KBN A;  3HVV A;  2OBK A;  5EPF A;  4GST A;  2RLI A;  4AGS A;  3DML A;  2YWN A;  2PBJ A;  1TK5 B;  3UOM A;  1GLP A;  5JWR B;  2CVB A;  4KE3 A;  2V6K A;  4KND A;  5INY A;  5G5E A;  2GVP A;  1R26 A;  5A4W A;  3V1W A;  2H6Z A;  1ZZY A;  4KGI A;  3TRP A;  2BMX A;  2L4C A;  4TRX A;  5JWO B;  2YNX A;  2DBC A;  1QQ2 A;  2L4Q A;  1OC9 A;  1MEK A;  4MJB A;  1SKW B;  1GNW A;  3P7X A;  3ZFB A;  2C0D A;  3QAW A;  3GUR A;  2GTU A;  5HFG A;  4POM A;  2JZR A;  3LJR A;  4N10 A;  3F8U A;  2YPM A;  2LQO A;  2GQL A;  2Z9S A;  4Q5F A;  1TRU A;  1TXX A;  1GUM A;  1WPI A;  3EE2 A;  4NV2 A;  3KXO A;  3TDG A;  4KSM A;  2FA4 A;  2PVQ A;  3QPM A;  4H86 A;  1BX9 A;  3J7Y b;  1FB0 A;  2LRC A;  3TJG A;  4ZL9 A;  5A5K A;  5H5Q A;  4IW9 A;  4WBJ A;  1ZYE A;  2N5A A;  3QFA C;  1N2A A;  4N0Z A;  1USB A;  2DJ2 A;  3TUE A;  2VD0 A;  2FNO A;  4OFN A;  3F4S A;  5HQP A;  2AJQ B;  1Q4J A;  5IQY A;  2R37 A;  1S3C A;  2K6V A;  4MJC A;  5F07 A;  4EXJ A;  1THO A;  5B8B A;  1SL2 B;  14GS A;  3P90 A;  1SYR A;  2V1M A;  2KLX A;  4K8M A;  1GTU A;  3HD5 A;  4PUR A;  4PXO A;  4X1U A;  3QCP A;  1WRY A;  2PN8 A;  3H1N A;  3LOR A;  3IA1 A;  2CVK A;  3MNG A;  3WT2 A;  5J3R A;  1JZW A;  1JZR A;  4GQC A;  2WCI A;  4QQ7 A;  3I43 A;  3ISO A;  1GSF A;  2JU5 A;  1XOA A;  6GSX A;  4V2N A;  1FB6 A;  5B8A A;  1JFU A;  2K8S A;  1AC1 A;  4JRR A;  1F9M A;  1GSS A;  3BD2 A;  4V2L A;  5CRH A;  5ABR A;  3EYT A;  1T00 A;  4WXT A;  4G2E A;  3CSJ A;  3ERG A;  4D73 B;  4ULX A;  6GSY A;  22GS A;  3DKS A;  2FCH A;  5ECM B;  3TKQ A;  1QMV A;  4O5R A;  5CAX A;  2HI7 A;  3LG6 A;  2XBI A;  3A5W A;  2KP1 A;  4IJI A;  5FHI A;  5DAL A;  3ZML A;  1RK4 A;  2O8V B;  3QAG A;  1TW9 A;  2YCD A;  2I3Y A;  2ON7 A;  3DIE A;  1CQH A;  1LU4 A;  2MYG A;  5F05 A;  4PQ1 A;  4DSR A;  5IPG A;  3IC4 A;  2V41 A;  5J4U A;  1DBY A;  3KM6 A;  2VL2 C;  4ZBB A;  1ACV A;  5ID2 B;  5ECQ B;  1R4W A;  2LV3 A;  1IYI A;  1Z3E A;  4KSO A;  1NHO A;  2PGT A;  4V2M A;  2HZF A;  1GRX A;  3HJO A;  4HDE A;  1G6Y A;  3GX0 A;  1A8Y A;  1TRV A;  3ZYW A;  3KTB A;  1ON4 A;  2BJX A;  2O87 A;  1BQ7 A;  2DJ1 A;  3H4K A;  3QAV A;  1PMT A;  1DUG A;  3M8N A;  4IQA A;  2WJU A;  5H5R A;  2ZNM A;  4FO5 A;  4LL4 B;  4XIH A;  1ZCP A;  2FWH A;  3APQ A;  3QDN A;  3M0F A;  3IOS A;  1U3A A;  1O8W A;  5G2Z A;  3VWX A;  1B9Y C;  3K8N A;  3FYG A;  3D4T A;  2VO4 A;  1V40 A;  4FYU A;  1BG5 A;  5D9X A;  4X0X A;  4CDO A;  1O8X A;  1GSQ A;  1YJ6 A;  5COH A;  4MF6 A;  5HFI A;  3GTU B;  2OE3 A;  2H71 A;  3FZ4 A;  3ME7 A;  3IK7 A;  4PGT A;  3IPZ A;  2DIZ A;  3M9J A;  5GZZ B;  2F8A A;  2OE0 A;  5ECI B;  2LNS A;  3E0U A;  2P31 A;  2H6X A;  5DAK A;  3EUR A;  3APS A;  3KJY A;  2YV9 A;  1YEX A;  4KDY A;  3VFI A;  1TI3 A;  3ZLP A;  4HI7 A;  3GKK A;  5ELA A;  3HY2 A;  3KGK A;  5HFK A;  2MMZ A;  1K3O A;  1ZMA A;  1VF4 A;  2YJH A;  3IE3 A;  1XFL A;  4EVM A;  4ECB A;  1X9W B;  2YWM A;  1EGR A;  1AQW A;  1FOV A;  4Q5R A;  4MAB A;  4PQI A;  3TGZ A;  3H79 A;  5LCZ A;  3I6A A;  1EP8 A;  3FY7 A;  4OO4 A;  1AXD A;  1PL1 A;  1T4Z A;  2RUE A;  4TOP A;  2HLS A;  2CX3 A;  3KTL A;  3VPT A;  5KN0 A;  3GA4 A;  2RII A;  2ES7 A;  2C3Q A;  1R5A A;  2DJ0 A;  2K8V A;  9GSS A;  3GRX A;  1KTE A;  4V1A g;  4GSN A;  1K0O A;  5IMV A;  4IP6 A;  2VCW A;  5ECS A;  1GP1 A;  3HCZ A;  4EE0 A;  2DC5 A;  1A0R P;  3MAK A;  1PRX A;  4HU9 A;  5G31 A;  2L5O A;  5G1L A;  1V58 A;  1XWK A;  2H70 A;  1XIY A;  2CQ9 A;  1PX6 A;  5IOW A;  1M2A A;  2FWG A;  2VLU A;  3DVW A;  4ZL7 A;  1HNA A;  2F3M A;  1HYU A;  4OD7 A;  5EL8 A;  5IMZ A;  4JE1 A;  3IAM 2;  4XRD A;  2LKU A;  2DMM A;  1C72 A;  4G10 A;  4POL A;  3HHV A;  4DSS B;  3TRQ A;  1M0U A;  2HT9 A;  2MMN A;  5IMA A;  5DCH A;  2DIY A;  3CMI A;  5H5S A;  4HQZ A;  3W6G A;  5GSS A;  3HZ4 A;  3GHA A;  4PQH A;  4ZIL A;  3TRX A;  1SJI A;  1FVJ A;  4YAV A;  1LBK A;  4DVC A;  2I4A A;  4JBB A;  3WGD A;  4POB A;  3ZFL A;  1S3D A;  2IMI A;  5AGY A;  1VGL A;  2YN1 A;  1XWG A;  5G5F A;  3LEF A;  1BYE A;  4MZB A;  2G2Q A;  3GL3 A;  2ZCT A;  2HNL A;  2N5B A;  1ERV A;  4MMM A;  1FW1 A;  2YZH A;  1TRW A;  1HQO A;  3C1S A;  3AY8 A;  3C71 A;  1O81 A;  3F3Q A;  2I1U A;  4IP1 A;  4K7I A;  2GT6 A;  4MPF A;  5CP1 A;  2YJ7 A;  2H1D A;  4WR5 A;  5E59 A;  2H66 A;  3ZL5 A;  3MSZ A;  4EO3 A;  4KCA A;  4XS4 A;  4I97 A;  2GSS A;  3N5O A;  4NAX A;  1H75 A;  1S3A A;  3EU3 A;  1BAY A;  4MZW A;  4AF2 A;  3TCO A;  2PU9 C;  5J9C A;  3ZTL A;  2VL3 A;  1A2M A;  1WJK A;  5ELG A;  4HU7 A;  1A8L A;  2CA8 A;  3RBT A;  4JZQ A;  1BJX A;  2IMF A;  1Z9H A;  1FAA A;  5D73 A;  1Y6E A;  4K2D A;  3VUR A;  1YEP A;  5D93 A;  2JZT A;  1OE7 A;  1SU9 A;  1XCC A;  4NMU A;  2AYT A;  4YQU A;  4BPY A;  1OC3 A;  5DJL A;  3C73 A;  1TP9 A;  1R5P A;  5JCU A;  4EUY A;  1U87 A;  3D6I A;  1ZGN A;  3QMX A;  1QUW A;  3GKM A;  1OKT A;  5ECL B;  5A4U A;  1GSY A;  4MPG A;  5CRW A;  3M1G A;  2GDR A;  3DD3 A;  2VLT A;  4MF5 A;  1W89 A;  2HZE B;  4ZB9 A;  3G7Y A;  3TJF A;  5IO0 A;  3JCM L;  3WT1 A;  1EEJ A;  3P2A A;  2HXK A;  2CAQ A;  4RQX A;  2C0E A;  1T3B A;  3ZRE A;  4ZIJ A;  1M7T A;  2FLS A;  1XZO A;  1M9B A;  4MDC A;  4AJ8 A;  3L78 A;  2H73 A;  1ERW A;  2J23 A;  5EVO A;  3DVX A;  4NHZ A;  2OAD A;  1UVZ A;  6GSU A;  1H4O A;  2C8U A;  4AJ6 A;  1NSW A;  2FGX A;  1TOF A;  2MBS A;  3EMX A;  2PPT A;  6GSS A;  2LRT A;  3KCM A;  2HSY A;  2GST A;  4XS6 A;  5L71 A;  2MMO A;  2QSI A;  10GS A;  4QL7 A;  4PUF C;  2AHE A;  2WB9 A;  3GKN A;  2VAF A;  2HSH A;  1OAZ A;  3BBY A;  3KIJ A;  3W8J A;  5DCG A;  1ML6 A;  2FUG 2;  5DDL A;  4LA1 A;  3HYP A;  4J57 E;  5HR2 A;  3FKF A;  2I9H A;  1KEB A;  3DEX A;  2PMT A;  4MA9 A;  1M2B A;  4N0V A;  3C8E A;  3OR5 A;  3VWU A;  2DJJ A;  3A2W A;  1PL2 A;  1DE1 A;  2VCZ A;  2LUS A;  1WIK A;  4HQS A;  2M46 A;  5B6N A;  1EZK A;  4FIW A;  3US3 A;  1EGO A;  1M99 A;  2WDU A;  5IMF A;  3L0H A;  2E2M A;  1UA5 A;  2O85 A;  2JAC A;  5J5N A;  3VWV A;  3TKS C;  1M9A A;  4NPB A;  2YWI A;  4MH2 A;  4FYB A;  3UBL A;  2IFQ B;  5CYY A;  2C0F A;  2XHF A;  11GS A;  18GS A;  3D0Z A;  4OWY A;  3GFK A;  5JWQ B;  1Z7P A;  1V2A A;  3GKX A;  5DQS A;  3GMF A;  2R5G A;  3FK8 A;  4TKY A;  2V2G A;  3E3E A;  4KDU A;  1SL1 B;  2VL9 A;  4WR4 A;  3UEM A;  1AIU A;  2OE1 A;  2H19 A;  2EIO A;  3EWL A;  1SJ6 A;  3TJK A;  2E0Q A;  1NW2 A;  2GGT A;  1URM A;  3M3M A;  2K9F A;  16GS A;  2VOC A;  1OVN A;  2X8G A;  2IMK A;  3UJ1 A;  2AUV A;  2LS5 A;  3LFL A;  2IPA A;  3Q18 A;  3TOT A;  3LWA A;  13GS A;  4GRF A;  3FR9 A;  1UC7 A;  4XS4 B;  3O3T A;  2VM1 A;  1KNG A;  2XPD A;  2X8C A;  2LEG A;  3CRU A;  3GH9 A;  2ZUP A;  3KP8 A;  2PVO C;  3GN3 A;  1YKC A;  4ZB8 A;  4I6X A;  4MLY A;  3FZ5 A;  1VF3 A;  1A0F A;  4HZ2 A;  1MTC A;  2F8F A;  4NHW A;  2H0I A;  4XTS A;  4ECC A;  1TTZ A;  4RUV A;  3CXG A;  4YAP A;  2L57 A;  1G0T A;  5LNK e;  4ZB6 A;  2VCV A;  1XWC A;  12GS A;  2A4V A;  3IDV A;  4LMW A;  2GT5 A;  1K0M A;  3D21 A;  4WBR D;  5FWG A;  3A3T A;  3MWH A;  1NHY A;  1YY7 A;  4BL7 A;  3GUS A;  2KHP A;  4G19 A;  3RPP A;  5JCG A;  3LGC A;  2GLR A;  3NIV A;  4L0W A;  1XBS A;  4EL1 A;  2VCT A;  17GS A;  2AV4 A;  2WS2 A;  3KMN A;  1YF0 A;  1PX7 A;  2HYX A;  2NBS A;  1GTA A;  3HDC A; 
#chains in the Genus database with same CATH topology
 1AW9 A;  2GS3 A;  5C04 A;  4IBP A;  4Q5N A;  4GF0 A;  1YDK A;  2FWE A;  1AAZ A;  3RPN A;  2YZU A;  2HRF A;  3U6V A;  1OC9 B;  4XCS A;  3TB2 A;  2MBT A;  1UN2 A;  1F3A A;  2DLX A;  2B1K A;  5CRE A;  4I2U A;  4V1A p;  5F06 A;  2DSA A;  3C7M A;  5HR0 A;  3F9U A;  4TR0 A;  5DVB A;  2IJY A;  5CNW A;  2YV7 A;  2GQK A;  3DRN A;  3RDW A;  3BOA A;  2DJK A;  1B48 A;  4K7O A;  1X5E A;  2X99 A;  2JZS A;  1TDI A;  1JLW A;  1PGT A;  5J9B A;  1K0B A;  1TU8 A;  4N30 A;  3CBU A;  2VL2 A;  3F0I A;  4F0C A;  5CO3 A;  3PIN A;  2NTO A;  1SJZ A;  1SD9 A;  3O76 A;  2PWJ A;  7GSS A;  4P3Y B;  1J08 A;  3VI7 A;  4JR4 A;  2G0F A;  2H75 A;  3BJ5 A;  4ICY A;  4OCE A;  2B6M A;  2QC7 A;  4KAE A;  3GL5 A;  5HR3 A;  3L9S A;  3VPQ A;  1G6W A;  2OKA A;  4CW9 A;  3KMO A;  2L6D A;  1XWB A;  1V57 A;  2OBI A;  4IQ1 A;  1K0D A;  1YQ1 A;  1T4Y A;  1EOH A;  3I9V 2;  3FEU A;  4L5O A;  4ZBD A;  1PFO A;  4TVE A;  4TR4 A;  5D9T A;  1F6M C;  3NOF A;  4IN0 A;  1GSD A;  3VK9 A;  2O7K A;  2RUF A;  1XPV A;  1SL0 B;  3Q74 A;  1WMJ A;  1B4Q A;  3GSS A;  1IYH A;  1E2Y A;  2F9S A;  3LQ7 A;  4EIP A;  4Z2T A;  3RHB A;  1AQX A;  4IGJ A;  3ZRD A;  1FOH A;  1PKW A;  4X4J A;  3E9J B;  1N8J A;  2WZ9 A;  2QA1 A;  4XHM A;  5D9W A;  3ZIJ A;  3KH7 A;  1O85 A;  3LYK A;  3IRA A;  2OJL A;  3KP9 A;  2H6Y A;  4EIQ A;  4ML1 A;  5DBQ A;  1PN9 A;  2JSY A;  5ECP B;  4KDX A;  1I5G A;  2YAN A;  3RAZ A;  1XOB A;  1VF2 A;  2RM5 A;  2H1G A;  5KOW A;  5DAL B;  4KA0 A;  2L59 A;  3GH6 A;  3VI5 A;  4TR1 A;  3D4M A;  3EC3 A;  2LST A;  4J2F A;  2B3S A;  1RQM A;  4DEJ A;  1EWX A;  4I2T A;  4Q5Q A;  2LJR A;  2H72 A;  2IL3 A;  1GSE A;  4MH3 A;  2A2R A;  1RW1 A;  4PUA A;  1GH2 A;  2NPB A;  2WFC A;  1X0R A;  2KOK A;  1T1V A;  1A2L A;  3KD0 A;  5IMC A;  1YF1 A;  1THX A;  2N5F A;  5BMU A;  1JLV A;  1XVW A;  2XC2 A;  2P5R A;  3R2Q A;  1DE2 A;  2WRT A;  3LW9 A;  2H01 A;  2B1L A;  1EOG A;  1Z5Y E;  4F0B A;  3G7J A;  2EIQ A;  5ID2 A;  3ED3 A;  2CVD A;  4HJ2 A;  4G9H A;  4WEY A;  2VCQ A;  2PUK C;  4TXO A;  2BTO T;  2V6O A;  2LRN A;  5AIS A;  4BL7 B;  4HS1 A;  5C00 A;  1EV9 A;  1EEM A;  2GZY A;  1MDK A;  4YQM A;  3U5R E;  4EDY A;  3FZ9 A;  2XPE A;  4HJM A;  2H1B A;  2AAW A;  2LQQ A;  4GSS A;  2C1Y A;  1FG4 A;  2OAC A;  2PER A;  3HZ8 A;  4O32 A;  1GLQ A;  3UVH A;  4BVY A;  4E8H A;  1B9X C;  3SWL A;  4F82 A;  1AQV A;  3DWV A;  3LXT A;  1SK2 A;  4FQU A;  4F9Z A;  3GTU A;  1XW5 A;  4MJE A;  4TN8 A;  4ML6 A;  3UAP A;  4ACS A;  4WF5 A;  5DAK B;  1ZYN A;  3TKP A;  5EY6 A;  5J41 A;  5G30 A;  2DKH A;  3LXZ A;  2FY6 A;  1EV4 A;  4YQV A;  3LYP A;  2EC4 A;  1K0N A;  2R2J A;  3D22 A;  2I81 A;  1GUL A;  2VCX A;  4WET A;  2UZ8 A;  4KH7 A;  4L0U A;  2IIY A;  3BCI A;  2CV4 A;  4LL1 B;  1U88 A;  3IAS 2;  5KN3 A;  3HJP A;  3PGT A;  2GSQ A;  2F51 A;  2FA8 A;  3IHQ A;  4LMV A;  3J7Y k;  1TK8 B;  2KUC A;  1GTI A;  6GSV A;  3S9F A;  3VWW A;  4PNG A;  19GS A;  2AB6 A;  1JZO A;  5ENU A;  3F4T A;  4RQR A;  1A23 A;  3PH9 A;  1K0A A;  2VIM A;  4GCI A;  4PNF A;  1XXU A;  3GYK A;  1Y25 A;  1QFN A;  2GZZ A;  4JR6 A;  1W4V A;  1JZD A;  4OMV A;  1K3L A;  2CX4 A;  2B7J A;  3EPT A;  2VLV A;  4ID0 A;  4EC0 A;  1MD3 A;  2HSM A;  5ECN B;  3UIW A;  1WE0 A;  4IHU A;  1GUH A;  1ERT A;  4EKZ A;  1U6T A;  2L5L A;  1OC8 A;  4F2I A;  4K1F A;  1X5C A;  3BCK A;  4KB3 A;  4TR3 A;  6GST A;  2X8H A;  4PX1 A;  2IN3 A;  3HA9 A;  3UVT A;  3DGQ A;  3F6D A;  1PD2 1;  2EIR A;  2JAD A;  4JU5 A;  4BWS A;  1GSU A;  1MDI A;  3GNJ A;  2B5E A;  2E7P A;  3ERF A;  3IV4 A;  1Z7R A;  4YH2 A;  2MZC A;  3HXS A;  4PTS A;  2X49 A;  3O6T A;  3FR3 A;  4GWR A;  3G7I A;  1GNE A;  5IMD A;  3KZQ A;  3EMP A;  3SBC A;  2R4V A;  1K3Y A;  3F3R A;  3IK9 A;  3WD6 A;  3ZVJ A;  4OCF A;  4DSS A;  3QOU A;  3GIX A;  4USS A;  3TKR A;  4MJA A;  4HUA A;  2C80 A;  1O7U A;  1T7P B;  1VF1 A;  2CAI A;  1FO5 A;  1TRS A;  4FH8 A;  4OFM A;  5AN1 A;  3FW2 A;  4K0N A;  4O92 A;  5D9V A;  2GZP A;  4K9Z A;  4TR1 B;  1Z6M A;  1JHB A;  2LJK A;  2YWO A;  1DSB A;  4ZL8 A;  5JCW A;  3WGE A;  1G7E A;  4GQF A;  4MK3 A;  5G1K A;  3HVN A;  4CHS A;  4EDZ A;  1SD8 A;  2REM A;  3EVI A;  2DKI A;  2C0G A;  3DXB A;  1ERU A;  2B5Y A;  2H0H A;  1HD2 A;  3FHK A;  2FD3 A;  3WGX A;  4BA7 A;  4L8E A;  4L5L A;  1TK0 B;  1OKD A;  3D5J A;  3DYR A;  3WYW A;  2RM6 A;  3I69 A;  4WF4 A;  1YKA A;  4O7H A;  4AJ7 A;  3Q6O A;  2C3T A;  1OYJ A;  4IS0 A;  2R0G A;  2CZ3 A;  1X5D A;  4KUN A;  1XVQ A;  1Q98 A;  1HNC A;  2HRN A;  2VUP A;  2H0G A;  4MCU A;  3L4N A;  2TRX A;  3TJB A;  4ILF A;  2HRA A;  4KX4 A;  5F0G A;  4E8E A;  1XG8 A;  2M80 A;  1M2D A;  3UL3 A;  2H30 A;  4Z2U A;  1GUK A;  4GLT A;  1GTB A;  3EU4 A;  4TXO B;  4IKH A;  5IO2 A;  1MD4 A;  2V32 A;  3ZIT A;  4EF0 A;  3F63 A;  3TKS A;  3F4R A;  5F8B A;  4QL9 A;  5CRG A;  5D8I A;  1ZOF A;  5IPH A;  2LJA A;  3QD9 A;  1HNB A;  2X4A A;  3FRC A;  3KH9 A;  4MF7 A;  4IVF A;  1NM3 A;  3EIN A;  3L9U A;  3QFB C;  2KP2 A;  5HR1 A;  3ME8 A;  1ST9 A;  2D2Z A;  2TIR A;  1XW6 A;  1I9D A;  4K0G A;  5KEJ A;  3VLN A;  4MZC A;  1CQG A;  3HKR A;  1FHE A;  1G7O A;  5ECR B;  4Z7X A;  2C3N A;  3ZMK A;  1GL8 A;  2HZE A;  1LJR A;  1EP7 A;  1F2E A;  1B8X A;  3A5I A;  2LTK A;  1Z6N A;  2HFD A;  3UMA A;  2M72 A;  3HJM A;  1QGV A;  4LLR A;  2VM2 A;  2L6C A;  2H1A A;  5IM9 A;  1SEN A;  1WOU A;  4F03 A;  4XS1 A;  3IR4 A;  1TJD A;  2R0C A;  2FWF A;  3GST A;  4NXI A;  1ABA A;  3ERW A;  3LSZ A;  3L9V A;  5KN1 A;  2WGR A;  5GAP D;  4OFT A;  2DML A;  3A2X A;  4HZ4 A;  4OO5 A;  5A4V A;  5ECK B;  2C4J A;  5ECH B;  5GST A;  8GSS A;  3CSH A;  4IEL A;  2A2S A;  3MDK A;  1B4P A;  2P0G A;  4RI7 A;  2QGV A;  5FT3 A;  3H93 A;  4WKW A;  2GQM A;  4K5R A;  6GSW A;  4ZXG A;  4TW5 A;  2H8L A;  1QK8 A;  1E6B A;  1FVK A;  3ZVJ D;  4BVX A;  2OA7 A;  3APO A;  3IBH A;  1X9S B;  1K0C A;  2R3X A;  4NV5 A;  2JL4 A;  2IWT A;  2CZ2 A;  1ZYQ B;  1X9M B;  2E2G A;  2JSZ A;  3NZN A;  5B7C A;  2K18 A;  5AIX A;  2IMD A;  4FYC A;  2R6K A;  1MDJ A;  5AIV A;  4I8B A;  5KOX A;  3N9J A;  2NVL A;  1SKR B;  3PR8 A;  5D96 A;  5DQY A;  2CT6 A;  1J0F A;  2TRC P;  5E4W A;  4BWQ A;  3UBK A;  1U3I A;  1J9B A;  4G0L A;  1VRS D;  4ECI A;  2O89 A;  2B5X A;  4HEA 2;  1PKZ A;  2ON5 A;  4NWY A;  3CYN A;  1YZX A;  2H76 A;  1TI1 A;  1OE8 A;  2H74 A;  4TXV A;  4O5Q A;  4JED A;  1R7H A;  3GX8 A;  1V98 A;  1SYX A;  2XBQ A;  4J56 E;  1SKS B;  3CSI A;  2IME A;  2VD1 A;  2WUL A;  3M9K A;  4KW6 A;  4POK A;  2QKE A;  1A24 A;  3UAR A;  1PA3 A;  2IFQ A;  1TKD B;  3C1R A;  4D73 A;  1WP0 A;  4I5Q A;  4MP4 A;  5GAN D;  1O73 A;  1T8E B;  5DJM A;  3FZA A;  2P5Q A;  4KCE A;  3TKS E;  3F6F A;  1TU7 A;  3Q19 A;  1WWJ A;  1ILO A;  2QA2 A;  1SK0 A;  1F3B A;  3HVX A;  4RI6 A;  2GSR A;  3CTF A;  1XWA A;  2YOI A;  3QR6 A;  4K6X A;  2YP6 A;  1AUC A;  4DSQ A;  2J9H A;  5ECO B;  4XRA A;  4K7N A;  1F37 A;  1PQN A;  1SK1 A;  2B7K A;  2DJ3 A;  2MMA A;  4GTU A;  3ZIV A;  4ZBA A;  3A2V A;  5B6M A;  1QXH A;  2HE3 A;  3IXR A;  4GXZ A;  3H8Q A;  1BED A;  1V9W A;  1ZL9 A;  5LD0 A;  20GS A;  1O6J A;  1PSQ A;  5IIZ A;  1A2J A;  3HVS A;  3GV1 A;  5BRT A;  3ZZX A;  3G9B A;  2LNT A;  4ISD A;  4N11 A;  3P8W A;  3CRT A;  4ECJ A;  2FHE A;  5CRD A;  2X64 A;  4IJ3 A;  2ALB A;  3TOU A;  1GWC A;  3W8S A;  5KN2 A;  3CTG A;  3KEB A;  5IOX A;  4X43 A;  3RHC A;  3TJJ A;  3FR6 A;  2NDO A;  4HOJ A;  1XW9 A;  1KBN A;  3HVV A;  2OBK A;  5EPF A;  4GST A;  2RLI A;  4AGS A;  3DML A;  2YWN A;  2PBJ A;  1TK5 B;  3UOM A;  1GLP A;  5JWR B;  2CVB A;  4KE3 A;  2V6K A;  4KND A;  5INY A;  5G5E A;  2GVP A;  1R26 A;  5A4W A;  4O5U A;  3V1W A;  2H6Z A;  1ZZY A;  4MNN A;  4KGI A;  3TRP A;  2BMX A;  2L4C A;  4TRX A;  5JWO B;  2YNX A;  2DBC A;  1QQ2 A;  2HRK A;  2L4Q A;  1OC9 A;  1MEK A;  4MJB A;  1SKW B;  2A4H A;  1GNW A;  3P7X A;  3ZFB A;  2C0D A;  3QAW A;  3GUR A;  2GTU A;  5HFG A;  4CY8 A;  4POM A;  2JZR A;  3LJR A;  4N10 A;  3F8U A;  2YPM A;  2LQO A;  2GQL A;  2Z9S A;  4Q5F A;  1TRU A;  1TXX A;  1GUM A;  1WPI A;  3EE2 A;  4NV2 A;  3KXO A;  3TDG A;  4KSM A;  2FA4 A;  2PVQ A;  3QPM A;  4H86 A;  1BX9 A;  3J7Y b;  1FB0 A;  2LRC A;  3CQF A;  3TJG A;  4ZL9 A;  5A5K A;  5H5Q A;  4IW9 A;  4WBJ A;  1ZYE A;  2N5A A;  3QFA C;  1N2A A;  4N0Z A;  1USB A;  2DJ2 A;  3TUE A;  2VD0 A;  4BVX B;  2FNO A;  4OFN A;  3F4S A;  5HQP A;  2AJQ B;  1Q4J A;  5IQY A;  1PN0 A;  2R37 A;  1S3C A;  2K6V A;  4MJC A;  5F07 A;  4EXJ A;  1THO A;  5B8B A;  1SL2 B;  14GS A;  3P90 A;  1SYR A;  4K2X A;  2V1M A;  2KLX A;  4K8M A;  1GTU A;  3HD5 A;  4PUR A;  4PXO A;  4X1U A;  3QCP A;  1WRY A;  2PN8 A;  3H1N A;  3LOR A;  3IA1 A;  2CVK A;  3MNG A;  4G0K A;  3WT2 A;  5J3R A;  1JZW A;  1JZR A;  4GQC A;  2WCI A;  4QQ7 A;  3PPU A;  3I43 A;  3ISO A;  1GSF A;  2JU5 A;  1XOA A;  6GSX A;  4V2N A;  1FB6 A;  5B8A A;  1JFU A;  2K8S A;  1AC1 A;  4JRR A;  1F9M A;  1GSS A;  3BD2 A;  3IC8 A;  4V2L A;  5CRH A;  5ABR A;  3EYT A;  1T00 A;  4WXT A;  4G2E A;  3CSJ A;  3ERG A;  4D73 B;  4ULX A;  6GSY A;  22GS A;  3DKS A;  2FCH A;  5ECM B;  3TKQ A;  1QMV A;  4O5R A;  5CAX A;  2HI7 A;  3LG6 A;  2XBI A;  3A5W A;  2KP1 A;  4IJI A;  5FHI A;  5DAL A;  3ZML A;  1RK4 A;  2O8V B;  3QAG A;  4BIK A;  1TW9 A;  2YCD A;  2I3Y A;  2ON7 A;  3DIE A;  1CQH A;  1LU4 A;  2MYG A;  5F05 A;  4PQ1 A;  4DSR A;  5IPG A;  3IC4 A;  2V41 A;  5J4U A;  1ZYP A;  1DBY A;  3KM6 A;  2VL2 C;  4ZBB A;  1ACV A;  5ID2 B;  5ECQ B;  1R4W A;  2LV3 A;  1IYI A;  1Z3E A;  4KSO A;  1NHO A;  2PGT A;  4V2M A;  2HZF A;  1GRX A;  3HJO A;  4HDE A;  1G6Y A;  3GX0 A;  3MYD A;  1A8Y A;  1TRV A;  3ZYW A;  3KTB A;  1ON4 A;  2BJX A;  4G0I A;  2O87 A;  1BQ7 A;  2DJ1 A;  3H4K A;  3IHG A;  3QAV A;  1PMT A;  1DUG A;  3M8N A;  4IQA A;  2WJU A;  5H5R A;  2ZNM A;  4FO5 A;  4LL4 B;  4XIH A;  1ZCP A;  2FWH A;  3APQ A;  3QDN A;  3M0F A;  3IOS A;  1U3A A;  1O8W A;  5G2Z A;  3VWX A;  1B9Y C;  3K8N A;  3FYG A;  3D4T A;  2VO4 A;  1V40 A;  4FYU A;  1BG5 A;  5D9X A;  4X0X A;  4BVY B;  1O8X A;  4CDO A;  1GSQ A;  1YJ6 A;  5COH A;  4MF6 A;  5HFI A;  3GTU B;  1S3R A;  2OE3 A;  2H71 A;  3FZ4 A;  3ME7 A;  1M3J A;  3IK7 A;  4PGT A;  3IPZ A;  2DIZ A;  3M9J A;  5GZZ B;  2F8A A;  2OE0 A;  5ECI B;  2LNS A;  3E0U A;  2P31 A;  2H6X A;  5DAK A;  3EUR A;  3APS A;  3KJY A;  2YV9 A;  1YEX A;  4KDY A;  3VFI A;  1TI3 A;  3ZLP A;  4HI7 A;  3GKK A;  5ELA A;  3HY2 A;  3KGK A;  5HFK A;  2MMZ A;  1K3O A;  1ZMA A;  4HSC X;  1VF4 A;  2YJH A;  3IE3 A;  1XFL A;  4EVM A;  4ECB A;  1X9W B;  2YWM A;  1EGR A;  1AQW A;  1FOV A;  4Q5R A;  4MAB A;  4PQI A;  3TGZ A;  3H79 A;  5LCZ A;  3I6A A;  1EP8 A;  3FY7 A;  4OO4 A;  1AXD A;  1PL1 A;  1T4Z A;  2RUE A;  4TOP A;  2HLS A;  2CX3 A;  3KTL A;  3VPT A;  5KN0 A;  3GA4 A;  2RII A;  2ES7 A;  2C3Q A;  1R5A A;  2DJ0 A;  2K8V A;  9GSS A;  3GRX A;  1KTE A;  4V1A g;  4KF9 A;  4GSN A;  1K0O A;  5IMV A;  4IP6 A;  2VCW A;  5ECS A;  1GP1 A;  3HCZ A;  4EE0 A;  2DC5 A;  1A0R P;  3MAK A;  1PRX A;  4HU9 A;  5G31 A;  2L5O A;  5G1L A;  1V58 A;  1XWK A;  2H70 A;  1XIY A;  2CQ9 A;  1PX6 A;  5IOW A;  1M2A A;  4CY6 A;  2FWG A;  2VLU A;  3DVW A;  4ZL7 A;  1HNA A;  2F3M A;  1HYU A;  4OD7 A;  5EL8 A;  5IMZ A;  4JE1 A;  3IAM 2;  4XRD A;  2LKU A;  2DMM A;  1C72 A;  4G10 A;  4POL A;  3HHV A;  4DSS B;  3TRQ A;  1M0U A;  2HT9 A;  2MMN A;  5IMA A;  5DCH A;  2DIY A;  3CMI A;  5H5S A;  4HQZ A;  4K5S A;  3W6G A;  5GSS A;  3HZ4 A;  3GHA A;  4PQH A;  4ZIL A;  3TRX A;  1SJI A;  1FVJ A;  4YAV A;  1LBK A;  4DVC A;  2I4A A;  4JBB A;  3WGD A;  4POB A;  3ZFL A;  1S3D A;  2IMI A;  5AGY A;  1VGL A;  2YN1 A;  1XWG A;  5G5F A;  4A5P A;  3LEF A;  1BYE A;  4MZB A;  2G2Q A;  3GL3 A;  2ZCT A;  2HNL A;  2N5B A;  1ERV A;  4MMM A;  1FW1 A;  2YZH A;  1TRW A;  1HQO A;  3C1S A;  3AY8 A;  3C71 A;  1O81 A;  3F3Q A;  2I1U A;  4IP1 A;  4K7I A;  2GT6 A;  4MPF A;  5CP1 A;  2YJ7 A;  2H1D A;  3R3E A;  4WR5 A;  5E59 A;  2H66 A;  3ZL5 A;  3MSZ A;  4EO3 A;  4KCA A;  4XS4 A;  4I97 A;  2GSS A;  3N5O A;  4NAX A;  1H75 A;  1S3A A;  3EU3 A;  1BAY A;  4MZW A;  4AF2 A;  3TCO A;  2PU9 C;  5J9C A;  3ZTL A;  2VL3 A;  1A2M A;  1WJK A;  5ELG A;  4HU7 A;  1A8L A;  2R0P A;  2CA8 A;  3RBT A;  4JZQ A;  1BJX A;  2IMF A;  1Z9H A;  1FAA A;  5D73 A;  1Y6E A;  4K2D A;  3VUR A;  1YEP A;  5D93 A;  2JZT A;  1OE7 A;  1XCC A;  1SU9 A;  4NMU A;  2AYT A;  4YQU A;  4BPY A;  1OC3 A;  5DJL A;  3C73 A;  1TP9 A;  1R5P A;  5JCU A;  4EUY A;  1U87 A;  3D6I A;  1ZGN A;  3QMX A;  1QUW A;  3GKM A;  1OKT A;  5ECL B;  5A4U A;  1GSY A;  4MPG A;  5CRW A;  3M1G A;  2GDR A;  3DD3 A;  2VLT A;  4MF5 A;  1W89 A;  2HZE B;  4ZB9 A;  3G7Y A;  3TJF A;  5IO0 A;  3JCM L;  3WT1 A;  1EEJ A;  3P2A A;  2HXK A;  2CAQ A;  4RQX A;  2C0E A;  1T3B A;  3ZRE A;  4ZIJ A;  1M7T A;  2FLS A;  1XZO A;  1M9B A;  4MDC A;  4AJ8 A;  3L78 A;  2H73 A;  1ERW A;  2J23 A;  3FMW A;  5EVO A;  3DVX A;  4NHZ A;  2OAD A;  1UVZ A;  6GSU A;  1H4O A;  2C8U A;  4AJ6 A;  1NSW A;  2A2P A;  2FGX A;  1TOF A;  4YKF A;  2MBS A;  3EMX A;  2PPT A;  6GSS A;  2LRT A;  3KCM A;  2HSY A;  2GST A;  4XS6 A;  5L71 A;  2MMO A;  2QSI A;  10GS A;  4QL7 A;  4PUF C;  2AHE A;  2WB9 A;  3GKN A;  2VAF A;  2HSH A;  1OAZ A;  3BBY A;  3KIJ A;  4Z2R A;  3W8J A;  5DCG A;  1ML6 A;  2FUG 2;  5DDL A;  4LA1 A;  3HYP A;  4J57 E;  5HR2 A;  3FKF A;  2I9H A;  1KEB A;  3DEX A;  2PMT A;  4MA9 A;  1M2B A;  4N0V A;  3C8E A;  3OR5 A;  3VWU A;  2DJJ A;  3A2W A;  1PL2 A;  1DE1 A;  2VCZ A;  2LUS A;  1WIK A;  4HQS A;  2M46 A;  5B6N A;  1EZK A;  4FIW A;  3US3 A;  1EGO A;  1M99 A;  2WDU A;  4YKG A;  5IMF A;  3L0H A;  2E2M A;  1UA5 A;  2O85 A;  2JAC A;  5J5N A;  3VWV A;  3TKS C;  1M9A A;  4NPB A;  2YWI A;  4MH2 A;  4FYB A;  3UBL A;  2IFQ B;  5CYY A;  2C0F A;  2XHF A;  11GS A;  18GS A;  3D0Z A;  4OWY A;  3GFK A;  5JWQ B;  1Z7P A;  1V2A A;  3GKX A;  5DQS A;  3GMF A;  2R5G A;  3FK8 A;  4TKY A;  2V2G A;  3E3E A;  4KDU A;  1SL1 B;  2VL9 A;  4WR4 A;  3UEM A;  1AIU A;  2OE1 A;  2H19 A;  2EIO A;  3EWL A;  1SJ6 A;  3TJK A;  2E0Q A;  1NW2 A;  2GGT A;  1URM A;  3M3M A;  2K9F A;  16GS A;  2VOC A;  1OVN A;  2X8G A;  2IMK A;  3UJ1 A;  2AUV A;  2LS5 A;  3LFL A;  2IPA A;  3Q18 A;  3TOT A;  3LWA A;  13GS A;  4GRF A;  3FR9 A;  1UC7 A;  4XS4 B;  3O3T A;  2VM1 A;  1KNG A;  2XPD A;  2X8C A;  2LEG A;  3CRU A;  3GH9 A;  2ZUP A;  3KP8 A;  2PVO C;  3GN3 A;  1YKC A;  4ZB8 A;  4I6X A;  4MLY A;  1M3I A;  3FZ5 A;  1VF3 A;  1A0F A;  4HZ2 A;  1MTC A;  2F8F A;  4NHW A;  2H0I A;  4XTS A;  4ECC A;  1TTZ A;  4RUV A;  3CXG A;  4YAP A;  2L57 A;  1G0T A;  3MIX A;  5LNK e;  4ZB6 A;  2VCV A;  1XWC A;  12GS A;  2A4V A;  3IDV A;  4LMW A;  2GT5 A;  1K0M A;  3D21 A;  4WBR D;  5FWG A;  3A3T A;  3MWH A;  1NHY A;  1YY7 A;  4BL7 A;  3GUS A;  2KHP A;  4G19 A;  3RPP A;  5JCG A;  3LGC A;  2GLR A;  3NIV A;  4L0W A;  1XBS A;  4EL1 A;  2VCT A;  17GS A;  2AV4 A;  2WS2 A;  3KMN A;  1YF0 A;  1PX7 A;  2HYX A;  2NBS A;  1GTA A;  3HDC A; 
#chains in the Genus database with same CATH homology
 1AW9 A;  2GS3 A;  5C04 A;  4IBP A;  4Q5N A;  4GF0 A;  1YDK A;  2FWE A;  1AAZ A;  3RPN A;  2YZU A;  2HRF A;  3U6V A;  1OC9 B;  4XCS A;  3TB2 A;  2MBT A;  1UN2 A;  1F3A A;  2DLX A;  2B1K A;  5CRE A;  4I2U A;  4V1A p;  5F06 A;  2DSA A;  3C7M A;  5HR0 A;  3F9U A;  4TR0 A;  5DVB A;  2IJY A;  5CNW A;  2YV7 A;  2GQK A;  3DRN A;  3RDW A;  3BOA A;  2DJK A;  1B48 A;  4K7O A;  1X5E A;  2X99 A;  2JZS A;  1TDI A;  1JLW A;  1PGT A;  5J9B A;  1K0B A;  1TU8 A;  4N30 A;  3CBU A;  2VL2 A;  3F0I A;  4F0C A;  5CO3 A;  3PIN A;  2NTO A;  1SJZ A;  1SD9 A;  3O76 A;  2PWJ A;  7GSS A;  4P3Y B;  1J08 A;  3VI7 A;  4JR4 A;  2G0F A;  2H75 A;  3BJ5 A;  4ICY A;  4OCE A;  2B6M A;  2QC7 A;  4KAE A;  3GL5 A;  5HR3 A;  3L9S A;  3VPQ A;  1G6W A;  2OKA A;  4CW9 A;  3KMO A;  2L6D A;  1XWB A;  1V57 A;  2OBI A;  4IQ1 A;  1K0D A;  1YQ1 A;  1T4Y A;  1EOH A;  3I9V 2;  3FEU A;  4L5O A;  4ZBD A;  4TVE A;  4TR4 A;  5D9T A;  1F6M C;  3NOF A;  4IN0 A;  1GSD A;  3VK9 A;  2O7K A;  2RUF A;  1XPV A;  1SL0 B;  3Q74 A;  1WMJ A;  1B4Q A;  3GSS A;  1IYH A;  1E2Y A;  2F9S A;  3LQ7 A;  4EIP A;  4Z2T A;  3RHB A;  1AQX A;  4IGJ A;  3ZRD A;  1FOH A;  1PKW A;  4X4J A;  3E9J B;  1N8J A;  2WZ9 A;  2QA1 A;  4XHM A;  5D9W A;  3ZIJ A;  3KH7 A;  1O85 A;  3LYK A;  3IRA A;  2OJL A;  3KP9 A;  2H6Y A;  4EIQ A;  4ML1 A;  5DBQ A;  1PN9 A;  2JSY A;  5ECP B;  4KDX A;  1I5G A;  2YAN A;  3RAZ A;  1XOB A;  1VF2 A;  2RM5 A;  2H1G A;  5KOW A;  5DAL B;  4KA0 A;  2L59 A;  3GH6 A;  3VI5 A;  4TR1 A;  3D4M A;  3EC3 A;  2LST A;  4J2F A;  2B3S A;  1RQM A;  4DEJ A;  1EWX A;  4I2T A;  4Q5Q A;  2LJR A;  2H72 A;  2IL3 A;  1GSE A;  4MH3 A;  2A2R A;  1RW1 A;  4PUA A;  1GH2 A;  2NPB A;  2WFC A;  1X0R A;  2KOK A;  1T1V A;  1A2L A;  3KD0 A;  5IMC A;  1YF1 A;  1THX A;  2N5F A;  5BMU A;  1JLV A;  1XVW A;  2XC2 A;  2P5R A;  3R2Q A;  1DE2 A;  2WRT A;  3LW9 A;  2H01 A;  2B1L A;  1EOG A;  1Z5Y E;  4F0B A;  3G7J A;  2EIQ A;  5ID2 A;  3ED3 A;  2CVD A;  4HJ2 A;  4G9H A;  4WEY A;  2VCQ A;  2PUK C;  4TXO A;  2BTO T;  2V6O A;  2LRN A;  5AIS A;  4BL7 B;  4HS1 A;  5C00 A;  1EV9 A;  1EEM A;  2GZY A;  1MDK A;  4YQM A;  3U5R E;  4EDY A;  3FZ9 A;  2XPE A;  4HJM A;  2H1B A;  2AAW A;  2LQQ A;  4GSS A;  2C1Y A;  1FG4 A;  2OAC A;  2PER A;  3HZ8 A;  4O32 A;  1GLQ A;  3UVH A;  4BVY A;  4E8H A;  1B9X C;  3SWL A;  4F82 A;  1AQV A;  3DWV A;  3LXT A;  1SK2 A;  4FQU A;  4F9Z A;  3GTU A;  1XW5 A;  4MJE A;  4TN8 A;  4ML6 A;  3UAP A;  4ACS A;  4WF5 A;  5DAK B;  1ZYN A;  3TKP A;  5EY6 A;  5J41 A;  5G30 A;  2DKH A;  3LXZ A;  2FY6 A;  1EV4 A;  4YQV A;  3LYP A;  2EC4 A;  1K0N A;  2R2J A;  3D22 A;  2I81 A;  1GUL A;  2VCX A;  4WET A;  2UZ8 A;  4KH7 A;  4L0U A;  2IIY A;  3BCI A;  2CV4 A;  4LL1 B;  1U88 A;  3IAS 2;  5KN3 A;  3HJP A;  3PGT A;  2GSQ A;  2F51 A;  2FA8 A;  3IHQ A;  4LMV A;  3J7Y k;  1TK8 B;  2KUC A;  1GTI A;  6GSV A;  3S9F A;  3VWW A;  4PNG A;  19GS A;  2AB6 A;  1JZO A;  5ENU A;  3F4T A;  4RQR A;  1A23 A;  3PH9 A;  1K0A A;  2VIM A;  4GCI A;  4PNF A;  1XXU A;  3GYK A;  1Y25 A;  1QFN A;  2GZZ A;  4JR6 A;  1W4V A;  1JZD A;  4OMV A;  1K3L A;  2CX4 A;  2B7J A;  3EPT A;  2VLV A;  4ID0 A;  4EC0 A;  1MD3 A;  2HSM A;  5ECN B;  3UIW A;  1WE0 A;  4IHU A;  1GUH A;  1ERT A;  4EKZ A;  1U6T A;  2L5L A;  1OC8 A;  4F2I A;  4K1F A;  1X5C A;  3BCK A;  4KB3 A;  4TR3 A;  6GST A;  2X8H A;  4PX1 A;  2IN3 A;  3HA9 A;  3UVT A;  3DGQ A;  3F6D A;  1PD2 1;  2EIR A;  2JAD A;  4JU5 A;  4BWS A;  1GSU A;  1MDI A;  3GNJ A;  2B5E A;  2E7P A;  3ERF A;  3IV4 A;  4YH2 A;  1Z7R A;  2MZC A;  3HXS A;  4PTS A;  2X49 A;  3O6T A;  3FR3 A;  4GWR A;  3G7I A;  1GNE A;  5IMD A;  3KZQ A;  3EMP A;  3SBC A;  2R4V A;  1K3Y A;  3F3R A;  3IK9 A;  3WD6 A;  3ZVJ A;  4OCF A;  4DSS A;  3QOU A;  3GIX A;  4USS A;  3TKR A;  4MJA A;  4HUA A;  2C80 A;  1O7U A;  1T7P B;  1VF1 A;  2CAI A;  1FO5 A;  1TRS A;  4FH8 A;  4OFM A;  5AN1 A;  3FW2 A;  4K0N A;  4O92 A;  5D9V A;  2GZP A;  4K9Z A;  4TR1 B;  1Z6M A;  1JHB A;  2LJK A;  2YWO A;  1DSB A;  4ZL8 A;  5JCW A;  3WGE A;  1G7E A;  4GQF A;  4MK3 A;  5G1K A;  4CHS A;  4EDZ A;  1SD8 A;  2REM A;  3EVI A;  2DKI A;  2C0G A;  3DXB A;  1ERU A;  2B5Y A;  2H0H A;  1HD2 A;  3FHK A;  2FD3 A;  3WGX A;  4BA7 A;  4L8E A;  4L5L A;  1TK0 B;  1OKD A;  3D5J A;  3DYR A;  3WYW A;  2RM6 A;  3I69 A;  4WF4 A;  1YKA A;  4O7H A;  4AJ7 A;  3Q6O A;  2C3T A;  1OYJ A;  4IS0 A;  2R0G A;  2CZ3 A;  1X5D A;  4KUN A;  1XVQ A;  1Q98 A;  1HNC A;  2HRN A;  2VUP A;  2H0G A;  4MCU A;  3L4N A;  2TRX A;  3TJB A;  4ILF A;  2HRA A;  4KX4 A;  5F0G A;  4E8E A;  2M80 A;  1M2D A;  3UL3 A;  2H30 A;  4Z2U A;  1GUK A;  4GLT A;  1GTB A;  3EU4 A;  4TXO B;  4IKH A;  5IO2 A;  1MD4 A;  2V32 A;  3ZIT A;  4EF0 A;  3F63 A;  3TKS A;  3F4R A;  5F8B A;  4QL9 A;  5CRG A;  5D8I A;  1ZOF A;  5IPH A;  2LJA A;  3QD9 A;  1HNB A;  2X4A A;  3FRC A;  3KH9 A;  4MF7 A;  4IVF A;  1NM3 A;  3EIN A;  3L9U A;  3QFB C;  2KP2 A;  5HR1 A;  3ME8 A;  1ST9 A;  2D2Z A;  2TIR A;  1XW6 A;  1I9D A;  4K0G A;  5KEJ A;  3VLN A;  4MZC A;  1CQG A;  3HKR A;  1FHE A;  1G7O A;  5ECR B;  4Z7X A;  2C3N A;  3ZMK A;  1GL8 A;  2HZE A;  1LJR A;  1EP7 A;  1F2E A;  1B8X A;  3A5I A;  2LTK A;  1Z6N A;  2HFD A;  3UMA A;  2M72 A;  3HJM A;  1QGV A;  4LLR A;  2VM2 A;  2L6C A;  2H1A A;  5IM9 A;  1SEN A;  1WOU A;  4F03 A;  4XS1 A;  3IR4 A;  1TJD A;  2R0C A;  2FWF A;  3GST A;  4NXI A;  1ABA A;  3ERW A;  3LSZ A;  3L9V A;  5KN1 A;  2WGR A;  5GAP D;  4OFT A;  2DML A;  3A2X A;  4HZ4 A;  4OO5 A;  5A4V A;  5ECK B;  2C4J A;  5ECH B;  5GST A;  8GSS A;  3CSH A;  4IEL A;  2A2S A;  3MDK A;  1B4P A;  2P0G A;  4RI7 A;  2QGV A;  5FT3 A;  3H93 A;  4WKW A;  2GQM A;  4K5R A;  6GSW A;  4ZXG A;  4TW5 A;  2H8L A;  1QK8 A;  1E6B A;  1FVK A;  3ZVJ D;  4BVX A;  2OA7 A;  3APO A;  3IBH A;  1X9S B;  1K0C A;  2R3X A;  4NV5 A;  2JL4 A;  2IWT A;  2CZ2 A;  1ZYQ B;  1X9M B;  2E2G A;  2JSZ A;  3NZN A;  5B7C A;  2K18 A;  5AIX A;  2IMD A;  4FYC A;  2R6K A;  1MDJ A;  5AIV A;  4I8B A;  5KOX A;  3N9J A;  2NVL A;  1SKR B;  3PR8 A;  5D96 A;  5DQY A;  2CT6 A;  1J0F A;  2TRC P;  5E4W A;  4BWQ A;  3UBK A;  1U3I A;  1J9B A;  4G0L A;  1VRS D;  4ECI A;  2O89 A;  2B5X A;  4HEA 2;  1PKZ A;  2ON5 A;  4NWY A;  3CYN A;  1YZX A;  2H76 A;  1TI1 A;  1OE8 A;  2H74 A;  4TXV A;  4O5Q A;  4JED A;  1R7H A;  3GX8 A;  1V98 A;  1SYX A;  2XBQ A;  4J56 E;  1SKS B;  3CSI A;  2IME A;  2VD1 A;  2WUL A;  3M9K A;  4KW6 A;  4POK A;  2QKE A;  1A24 A;  3UAR A;  1PA3 A;  2IFQ A;  1TKD B;  3C1R A;  4D73 A;  1WP0 A;  4I5Q A;  4MP4 A;  5GAN D;  1O73 A;  1T8E B;  5DJM A;  3FZA A;  2P5Q A;  4KCE A;  3TKS E;  3F6F A;  1TU7 A;  3Q19 A;  1WWJ A;  1ILO A;  2QA2 A;  1SK0 A;  1F3B A;  3HVX A;  4RI6 A;  2GSR A;  3CTF A;  1XWA A;  2YOI A;  3QR6 A;  4K6X A;  2YP6 A;  1AUC A;  4DSQ A;  2J9H A;  5ECO B;  4XRA A;  4K7N A;  1F37 A;  1PQN A;  1SK1 A;  2B7K A;  2DJ3 A;  2MMA A;  4GTU A;  3ZIV A;  4ZBA A;  3A2V A;  5B6M A;  1QXH A;  2HE3 A;  3IXR A;  4GXZ A;  3H8Q A;  1BED A;  1V9W A;  1ZL9 A;  5LD0 A;  20GS A;  1O6J A;  1PSQ A;  5IIZ A;  1A2J A;  3HVS A;  3GV1 A;  5BRT A;  3ZZX A;  3G9B A;  2LNT A;  4ISD A;  4N11 A;  3P8W A;  3CRT A;  4ECJ A;  2FHE A;  5CRD A;  2X64 A;  4IJ3 A;  2ALB A;  3TOU A;  1GWC A;  3W8S A;  5KN2 A;  3CTG A;  3KEB A;  5IOX A;  4X43 A;  3RHC A;  3TJJ A;  3FR6 A;  2NDO A;  4HOJ A;  1XW9 A;  1KBN A;  3HVV A;  2OBK A;  5EPF A;  4GST A;  2RLI A;  4AGS A;  3DML A;  2YWN A;  2PBJ A;  1TK5 B;  3UOM A;  1GLP A;  5JWR B;  2CVB A;  4KE3 A;  2V6K A;  4KND A;  5INY A;  5G5E A;  2GVP A;  1R26 A;  5A4W A;  4O5U A;  3V1W A;  2H6Z A;  1ZZY A;  4MNN A;  4KGI A;  3TRP A;  2BMX A;  2L4C A;  4TRX A;  5JWO B;  2YNX A;  2DBC A;  1QQ2 A;  2HRK A;  2L4Q A;  1OC9 A;  1MEK A;  4MJB A;  1SKW B;  2A4H A;  1GNW A;  3P7X A;  3ZFB A;  2C0D A;  3QAW A;  3GUR A;  2GTU A;  5HFG A;  4CY8 A;  4POM A;  2JZR A;  3LJR A;  4N10 A;  3F8U A;  2YPM A;  2LQO A;  2GQL A;  2Z9S A;  4Q5F A;  1TRU A;  1TXX A;  1GUM A;  1WPI A;  3EE2 A;  4NV2 A;  3KXO A;  3TDG A;  4KSM A;  2FA4 A;  2PVQ A;  3QPM A;  4H86 A;  1BX9 A;  3J7Y b;  1FB0 A;  2LRC A;  3TJG A;  4ZL9 A;  5A5K A;  5H5Q A;  4IW9 A;  4WBJ A;  1ZYE A;  2N5A A;  3QFA C;  1N2A A;  4N0Z A;  1USB A;  2DJ2 A;  3TUE A;  2VD0 A;  4BVX B;  2FNO A;  4OFN A;  3F4S A;  5HQP A;  2AJQ B;  1Q4J A;  5IQY A;  1PN0 A;  2R37 A;  1S3C A;  2K6V A;  4MJC A;  5F07 A;  4EXJ A;  1THO A;  5B8B A;  1SL2 B;  14GS A;  3P90 A;  1SYR A;  4K2X A;  2V1M A;  2KLX A;  4K8M A;  1GTU A;  3HD5 A;  4PUR A;  4PXO A;  4X1U A;  3QCP A;  1WRY A;  2PN8 A;  3H1N A;  3LOR A;  3IA1 A;  2CVK A;  3MNG A;  4G0K A;  3WT2 A;  5J3R A;  1JZW A;  1JZR A;  4GQC A;  2WCI A;  4QQ7 A;  3PPU A;  3I43 A;  3ISO A;  1GSF A;  2JU5 A;  1XOA A;  6GSX A;  4V2N A;  1FB6 A;  5B8A A;  1JFU A;  2K8S A;  1AC1 A;  4JRR A;  1F9M A;  1GSS A;  3BD2 A;  3IC8 A;  4V2L A;  5CRH A;  5ABR A;  3EYT A;  1T00 A;  4WXT A;  4G2E A;  3CSJ A;  3ERG A;  4D73 B;  4ULX A;  6GSY A;  22GS A;  3DKS A;  2FCH A;  5ECM B;  3TKQ A;  1QMV A;  4O5R A;  5CAX A;  2HI7 A;  3LG6 A;  2XBI A;  3A5W A;  2KP1 A;  4IJI A;  5FHI A;  5DAL A;  3ZML A;  1RK4 A;  2O8V B;  3QAG A;  1TW9 A;  2YCD A;  2I3Y A;  2ON7 A;  3DIE A;  1CQH A;  1LU4 A;  2MYG A;  5F05 A;  4PQ1 A;  4DSR A;  5IPG A;  3IC4 A;  2V41 A;  5J4U A;  1ZYP A;  1DBY A;  3KM6 A;  2VL2 C;  4ZBB A;  1ACV A;  5ID2 B;  5ECQ B;  1R4W A;  2LV3 A;  1IYI A;  1Z3E A;  4KSO A;  1NHO A;  2PGT A;  4V2M A;  2HZF A;  1GRX A;  3HJO A;  4HDE A;  1G6Y A;  3GX0 A;  3MYD A;  1A8Y A;  1TRV A;  3ZYW A;  3KTB A;  1ON4 A;  2BJX A;  4G0I A;  2O87 A;  1BQ7 A;  2DJ1 A;  3H4K A;  3IHG A;  3QAV A;  1PMT A;  1DUG A;  3M8N A;  4IQA A;  2WJU A;  5H5R A;  2ZNM A;  4FO5 A;  4LL4 B;  4XIH A;  1ZCP A;  2FWH A;  3APQ A;  3QDN A;  3M0F A;  3IOS A;  1U3A A;  1O8W A;  5G2Z A;  3VWX A;  1B9Y C;  3K8N A;  3FYG A;  3D4T A;  2VO4 A;  1V40 A;  4FYU A;  1BG5 A;  5D9X A;  4X0X A;  4BVY B;  1O8X A;  4CDO A;  1GSQ A;  1YJ6 A;  5COH A;  4MF6 A;  5HFI A;  3GTU B;  2OE3 A;  2H71 A;  3FZ4 A;  3ME7 A;  3IK7 A;  4PGT A;  3IPZ A;  2DIZ A;  3M9J A;  5GZZ B;  2F8A A;  2OE0 A;  5ECI B;  2LNS A;  3E0U A;  2P31 A;  2H6X A;  5DAK A;  3EUR A;  3APS A;  3KJY A;  2YV9 A;  1YEX A;  4KDY A;  3VFI A;  1TI3 A;  3ZLP A;  4HI7 A;  3GKK A;  5ELA A;  3HY2 A;  3KGK A;  5HFK A;  2MMZ A;  1K3O A;  1ZMA A;  1VF4 A;  2YJH A;  3IE3 A;  1XFL A;  4EVM A;  4ECB A;  1X9W B;  2YWM A;  1EGR A;  1AQW A;  1FOV A;  4Q5R A;  4MAB A;  4PQI A;  3TGZ A;  3H79 A;  5LCZ A;  3I6A A;  1EP8 A;  3FY7 A;  4OO4 A;  1AXD A;  1PL1 A;  1T4Z A;  2RUE A;  4TOP A;  2HLS A;  2CX3 A;  3KTL A;  3VPT A;  5KN0 A;  3GA4 A;  2RII A;  2ES7 A;  2C3Q A;  1R5A A;  2DJ0 A;  2K8V A;  9GSS A;  3GRX A;  1KTE A;  4V1A g;  4KF9 A;  4GSN A;  1K0O A;  5IMV A;  4IP6 A;  2VCW A;  5ECS A;  1GP1 A;  3HCZ A;  4EE0 A;  2DC5 A;  1A0R P;  3MAK A;  1PRX A;  4HU9 A;  5G31 A;  2L5O A;  5G1L A;  1V58 A;  1XWK A;  2H70 A;  1XIY A;  2CQ9 A;  1PX6 A;  5IOW A;  1M2A A;  4CY6 A;  2FWG A;  2VLU A;  3DVW A;  4ZL7 A;  1HNA A;  2F3M A;  1HYU A;  4OD7 A;  5EL8 A;  5IMZ A;  4JE1 A;  3IAM 2;  4XRD A;  2LKU A;  2DMM A;  1C72 A;  4G10 A;  4POL A;  3HHV A;  4DSS B;  3TRQ A;  1M0U A;  2HT9 A;  2MMN A;  5IMA A;  5DCH A;  2DIY A;  3CMI A;  5H5S A;  4HQZ A;  4K5S A;  3W6G A;  5GSS A;  3HZ4 A;  3GHA A;  4PQH A;  4ZIL A;  3TRX A;  1SJI A;  1FVJ A;  4YAV A;  1LBK A;  4DVC A;  2I4A A;  4JBB A;  3WGD A;  4POB A;  3ZFL A;  1S3D A;  2IMI A;  5AGY A;  1VGL A;  2YN1 A;  1XWG A;  5G5F A;  4A5P A;  3LEF A;  1BYE A;  4MZB A;  2G2Q A;  3GL3 A;  2ZCT A;  2HNL A;  2N5B A;  1ERV A;  4MMM A;  1FW1 A;  2YZH A;  1TRW A;  1HQO A;  3C1S A;  3AY8 A;  3C71 A;  1O81 A;  3F3Q A;  2I1U A;  4IP1 A;  4K7I A;  2GT6 A;  4MPF A;  5CP1 A;  2YJ7 A;  2H1D A;  3R3E A;  4WR5 A;  5E59 A;  2H66 A;  3ZL5 A;  3MSZ A;  4EO3 A;  4KCA A;  4XS4 A;  4I97 A;  2GSS A;  3N5O A;  4NAX A;  1H75 A;  1S3A A;  3EU3 A;  1BAY A;  4MZW A;  4AF2 A;  3TCO A;  2PU9 C;  5J9C A;  3ZTL A;  2VL3 A;  1A2M A;  1WJK A;  5ELG A;  4HU7 A;  1A8L A;  2R0P A;  2CA8 A;  3RBT A;  4JZQ A;  1BJX A;  2IMF A;  1Z9H A;  1FAA A;  5D73 A;  1Y6E A;  4K2D A;  3VUR A;  1YEP A;  5D93 A;  2JZT A;  1OE7 A;  1SU9 A;  1XCC A;  4NMU A;  2AYT A;  4YQU A;  4BPY A;  1OC3 A;  5DJL A;  3C73 A;  1TP9 A;  1R5P A;  5JCU A;  4EUY A;  1U87 A;  3D6I A;  1ZGN A;  3QMX A;  1QUW A;  3GKM A;  1OKT A;  5ECL B;  5A4U A;  1GSY A;  4MPG A;  5CRW A;  3M1G A;  2GDR A;  3DD3 A;  2VLT A;  4MF5 A;  1W89 A;  2HZE B;  4ZB9 A;  3G7Y A;  3TJF A;  5IO0 A;  3JCM L;  3WT1 A;  1EEJ A;  3P2A A;  2HXK A;  2CAQ A;  4RQX A;  2C0E A;  1T3B A;  3ZRE A;  4ZIJ A;  1M7T A;  2FLS A;  1XZO A;  1M9B A;  4MDC A;  4AJ8 A;  3L78 A;  2H73 A;  1ERW A;  2J23 A;  3FMW A;  5EVO A;  3DVX A;  4NHZ A;  2OAD A;  1UVZ A;  6GSU A;  1H4O A;  2C8U A;  4AJ6 A;  1NSW A;  2A2P A;  2FGX A;  1TOF A;  4YKF A;  2MBS A;  3EMX A;  2PPT A;  6GSS A;  2LRT A;  3KCM A;  2HSY A;  2GST A;  4XS6 A;  5L71 A;  2MMO A;  2QSI A;  10GS A;  4QL7 A;  4PUF C;  2AHE A;  2WB9 A;  3GKN A;  2VAF A;  2HSH A;  1OAZ A;  3BBY A;  3KIJ A;  4Z2R A;  3W8J A;  5DCG A;  1ML6 A;  2FUG 2;  5DDL A;  4LA1 A;  3HYP A;  4J57 E;  5HR2 A;  3FKF A;  2I9H A;  1KEB A;  3DEX A;  2PMT A;  4MA9 A;  1M2B A;  4N0V A;  3C8E A;  3OR5 A;  3VWU A;  2DJJ A;  3A2W A;  1PL2 A;  1DE1 A;  2VCZ A;  2LUS A;  1WIK A;  4HQS A;  2M46 A;  5B6N A;  1EZK A;  4FIW A;  3US3 A;  1EGO A;  1M99 A;  2WDU A;  4YKG A;  5IMF A;  3L0H A;  2E2M A;  1UA5 A;  2O85 A;  2JAC A;  5J5N A;  3VWV A;  3TKS C;  1M9A A;  4NPB A;  2YWI A;  4MH2 A;  4FYB A;  3UBL A;  2IFQ B;  5CYY A;  2C0F A;  2XHF A;  11GS A;  18GS A;  3D0Z A;  4OWY A;  3GFK A;  5JWQ B;  1Z7P A;  1V2A A;  3GKX A;  5DQS A;  3GMF A;  2R5G A;  3FK8 A;  4TKY A;  2V2G A;  3E3E A;  4KDU A;  1SL1 B;  2VL9 A;  4WR4 A;  3UEM A;  1AIU A;  2OE1 A;  2H19 A;  2EIO A;  3EWL A;  1SJ6 A;  3TJK A;  2E0Q A;  1NW2 A;  2GGT A;  1URM A;  3M3M A;  2K9F A;  16GS A;  2VOC A;  1OVN A;  2X8G A;  2IMK A;  3UJ1 A;  2AUV A;  2LS5 A;  3LFL A;  2IPA A;  3Q18 A;  3TOT A;  3LWA A;  13GS A;  4GRF A;  3FR9 A;  1UC7 A;  4XS4 B;  3O3T A;  2VM1 A;  1KNG A;  2XPD A;  2X8C A;  2LEG A;  3CRU A;  3GH9 A;  2ZUP A;  3KP8 A;  2PVO C;  3GN3 A;  1YKC A;  4ZB8 A;  4I6X A;  4MLY A;  3FZ5 A;  1VF3 A;  1A0F A;  4HZ2 A;  1MTC A;  2F8F A;  4NHW A;  2H0I A;  4XTS A;  4ECC A;  1TTZ A;  4RUV A;  3CXG A;  4YAP A;  2L57 A;  1G0T A;  3MIX A;  5LNK e;  4ZB6 A;  2VCV A;  1XWC A;  12GS A;  2A4V A;  3IDV A;  4LMW A;  2GT5 A;  1K0M A;  3D21 A;  4WBR D;  5FWG A;  3A3T A;  3MWH A;  1NHY A;  1YY7 A;  4BL7 A;  3GUS A;  2KHP A;  4G19 A;  3RPP A;  5JCG A;  3LGC A;  2GLR A;  3NIV A;  4L0W A;  1XBS A;  4EL1 A;  2VCT A;  17GS A;  2AV4 A;  2WS2 A;  3KMN A;  1YF0 A;  1PX7 A;  2HYX A;  2NBS A;  1GTA A;  3HDC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...