3TKSE

Crystal structure of full-length human peroxiredoxin 4 in three different redox states
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
197
structure length
197
Chain Sequence
HLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRLEEFRSINTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDLTHQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSETIIPDPAGKLKYFDKLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peroxiredoxin-4
publication title Structural insights into the peroxidase activity and inactivation of human peroxiredoxin 4
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 65
structure length 197
sequence length 197
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2011-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00578 AhpC-TSA AhpC/TSA family
E PF10417 1-cysPrx_C C-terminal domain of 1-Cys peroxiredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3tksE00
3TKSA 4PQHA 3Q19A 2FD3A 5FHIA 3O6TA 4CDOA 1R5PA 1Z3EA 3GRXA 4L5LA 3KD0A 1F3BA 2GT5A 2C0GA 2LS5A 3UEMA 3APSA 1QGVA 4LL4B 5H5RA 2H8LA 2VCQA 4LA1A 4XS4B 4V2NA 1TP9A 3G7IA 3WGDA 4NHZA 3EC3A 2PN8A 1PKZA 2GQMA 4I6XA 4MJEA 4F03A 4WEYA 2C4JA 1IYHA 1K0DA 2QSIA 5JCGA 3GX0A 5DQYA 3CSIA 4KCEA 1USBA 5LNKe 3QFBC 4IQAA 1YY7A 2DIZA 3A3TA 1TK8B 5AIVA 4ZB9A 1EEMA 5LD0A 1T4YA 19GSA 3GV1A 3ZMKA 2V32A 10GSA 4XS4A 1XCCA 2HE3A 2IIYA 3IAS2 5JCWA 1VF3A 1OC8A 2H1BA 3UMAA 6GSWA 1YEPA 1ILOA 2LQOA 1ZMAA 18GSA 4JU5A 4Q5RA 1GNEA 1AQXA 3HVVA 4K1FA 3DGQA 3TJFA 3IC4A 4JZQA 3QR6A 2P31A 1ML6A 3JCML 5HFIA 2KLXA 2RM6A 2AAWA 3ED3A 2VUPA 3BCIA 4YAVA 4WR4A 2HSHA 4IQ1A 1SJZA 1HNCA 5B7CA 2EIQA 2X8HA 2VLUA 4MABA 2JL4A 6GSYA 3EU3A 1TRSA 4N30A 5GSTA 3DRNA 3LG6A 3VI7A 1G6WA 2CA8A 2GSQA 4IJ3A 4PX1A 2V6KA 1R7HA 1W89A 2LV3A 2XBQA 3HJMA 3KTBA 5GAND 3M1GA 3QOUA 2HFDA 3M8NA 2R3XA 3ZIJA 4TVEA 3ERFA 4E8EA 4ECIA 4KSOA 2FGXA 3UARA 1TK5B 4KDUA 3O3TA 2C0DA 2X8GA 4FO5A 2JZTA 1PL1A 6GSVA 1SJIA 4KSMA 2PBJA 2GQKA 4ULXA 2IMFA 2B5YA 5HR1A 2ES7A 2FHEA 3F0IA 3HDCA 1TK0B 1GUHA 1U3AA 4HQSA 4NPBA 1QK8A 3UOMA 1T3BA 2R4VA 13GSA 5IMVA 3Q74A 2PVQA 4J56E 3BCKA 1J08A 1M2BA 2LTKA 5HR3A 1I5GA 3PGTA 1OE7A 3EE2A 2YP6A 3DEXA 3ZFBA 3EINA 5B6NA 1K0BA 5CREA 1G7OA 1SL1B 4KDYA 1GTAA 1AAZA 2H30A 1XWKA 2KHPA 2KOKA 1AXDA 1NHOA 1WPIA 4HJMA 2JZSA 2PVOC 2ZUPA 5GSSA 3IA1A 3W6GA 1O73A 2GSTA 2OE0A 2YWMA 3GTUB 2ZNMA 2FLSA 2C8UA 3G7JA 3A2WA 3IOSA 4GSTA 3GL5A 4J57E 5ECQB 3FW2A 1X9WB 1K0OA 4MZBA 3PH9A 1M2AA 4OCEA 1H4OA 3W8JA 1SKRB 2QC7A 4MJAA 4ACSA 3D5JA 4QL9A 2WDUA 3S9FA 3FHKA 1XWCA 2K6VA 4MMMA 22GSA 2GS3A 3FZAA 5ECLB 3L0HA 5FT3A 3MSZA 2JZRA 3GTUA 2QGVA 2VLTA 3J7Yk 16GSA 5G1LA 1F37A 1YQ1A 4N0VA 1DSBA 2GQLA 2P5RA 3DKSA 2YWNA 3MNGA 4HUAA 2HLSA 5CYYA 5D9XA 3M9JA 2LKUA 1OAZA 4LLRA 1URMA 3GKMA 1E6BA 1Q4JA 1GLPA 2HXKA 1GUMA 4KA0A 5H5QA 2RIIA 5JCUA 1GH2A 5DBQA 4MZWA 2B6MA 4Z7XA 4MH3A 4AJ7A 4F9ZA 4IN0A 3N5OA 4HZ2A 3UBLA 2CZ2A 1GSSA 1O7UA 1S3CA 4RI6A 2YV7A 1FVKA 4FIWA 1PSQA 2TRCP 4OD7A 4D73B 3CRUA 1SD9A 4FYBA 1SYXA 4XTSA 4CW9A 2WFCA 6GSTA 4WBRD 2H0GA 4GRFA 2H0IA 2VCXA 1V98A 2LRCA 1YKCA 1JLWA 4TRXA 2CV4A 3HCZA 4TXOB 4TXVA 5JWRB 3VFIA 2AV4A 1A0RP 1U88A 1Z5YE 3LSZA 2RLIA 2N5AA 2JU5A 3IXRA 2VD1A 2JSZA 2QKEA 5FWGA 3UJ1A 1H75A 1SL2B 2YNXA 2HYXA 4KUNA 4D73A 1A2LA 2PERA 1T00A 2E7PA 4GSSA 4EDZA 2XPEA 1ON4A 2A2RA 4WF5A 5HFGA 5D9TA 3E0UA 1K0CA 1T1VA 1YDKA 1VF1A 4MCUA 2FWGA 4TXOA 2E2MA 3IPZA 3A2VA 4MPFA 5AIXA 1BEDA 1TXXA 4ILFA 5IQYA 2IMEA 4TKYA 5DQSA 2DJ1A 5IMCA 3F63A 1ZYEA 4KX4A 1SD8A 1A24A 2O89A 4O5RA 5J9BA 3F4RA 3GA4A 3TRXA 4N10A 3O76A 3IE3A 1X0RA 5J5NA 5L71A 2P5QA 1SK0A 1VGLA 5D93A 4TR4A 4BVYA 2RM5A 4AJ6A 1NW2A 1UC7A 3C8EA 4AGSA 4YQUA 3FR3A 2BMXA 1F6MC 1YF1A 3H93A 4JR6A 3IDVA 5CRHA 2VL2A 3QFAC 3J7Yb 2A2SA 1ERTA 1PMTA 2AHEA 4XHMA 2A4VA 1GTIA 4MK3A 4ZIJA 5ABRA 2XC2A 4MH2A 1X9MB 3BJ5A 3H79A 4XIHA 2MMOA 3FEUA 3IK9A 3FZ9A 2CX4A 3TKRA 2H1GA 4FH8A 4X43A 1M0UA 1T8EB 2WB9A 2GLRA 3ZVJD 2LUSA 2PWJA 1N2AA 1HYUA 4BPYA 2FA8A 3TKPA 2YPMA 1ACVA 4HI7A 2D2ZA 3BD2A 1ST9A 3KIJA 1TDIA 4JEDA 1E2YA 5ECRB 3VI5A 3F4SA 3FYGA 1KNGA 3ME8A 4F0BA 4RUVA 4ZB8A 3EVIA 2H73A 1LJRA 4HOJA 4PGTA 4AJ8A 5IOXA 11GSA 1VF2A 3L78A 4PNFA 3QD9A 3U5RE 1TU8A 4EUYA 4GTUA 2M72A 3D0ZA 2Z9SA 2CVDA 1AUCA 5IO2A 1SYRA 2C3QA 1V40A 5DVBA 5F0GA 2JACA 4Q5FA 2I9HA 2LRNA 1GUKA 6GSXA 3D21A 2IL3A 5D9WA 3HKRA 1V57A 1B9YC 5KN3A 1B48A 4ZBDA 3HA9A 3VURA 2I81A 5D96A 3F9UA 4IW9A 4F82A 1K3LA 2VAFA 2DC5A 4GSNA 2ON5A 4PQIA 4GXZA 4OO4A 2KP1A 3EURA 1GTBA 2H74A 1X9SB 3QMXA 1FHEA 1M7TA 3ISOA 1MTCA 3VWUA 2CX3A 5KEJA 5H5SA 1WE0A 1SL0B 3LWAA 2VCTA 4GLTA 3FZ4A 1U3IA 4KGIA 2YCDA 4I97A 3K8NA 3P7XA 2V2GA 3DVXA 3P8WA 4LMWA 4K7OA 5ID2B 3UVHA 2G2QA 2X64A 1TTZA 3TGZA 2LSTA 1KBNA 5AISA 1DBYA 1O8WA 4KAEA 4ML1A 5CAXA 2DJKA 1GSEA 3FRCA 5G5FA 1N8JA 3DYRA 4EL1A 1MD4A 5ECIB 3KMNA 5GZZB 4F2IA 1TI1A 1FAAA 3AY8A 1XOBA 2DJ2A 3I9V2 4HU7A 1FW1A 1MDIA 2H01A 3G9BA 5ID2A 2GT6A 3BOAA 3KGKA 4NHWA 3RBTA 4IHUA 4NAXA 3F3RA 3EMXA 3HD5A 3CXGA 4FYCA 2H75A 2CAIA 3TKQA 5EVOA 4ZILA 1B4PA 5IPHA 2OBKA 1T7PB 4O32A 5DAKB 1ZZYA 4IKHA 3MDKA 1PQNA 2NDOA 4K9ZA 2DLXA 1BG5A 4EKZA 4ID0A 9GSSA 1K0MA 4F0CA 3HZ4A 4P3YB 1DUGA 3MAKA 2WS2A 1B4QA 1SU9A 1JFUA 4ZL9A 1UVZA 1JLVA 4MF5A 2OADA 4DEJA 4BL7A 4V1Ap 1GSQA 2L5OA 3FZ5A 4Q5QA 3C1SA 4I2TA 1S3DA 3VWXA 2N5BA 3GURA 1AW9A 1Z6NA 5DAKA 3US3A 2H6XA 1XBSA 1KTEA 2MYGA 3GFKA 3RAZA 4V1Ag 4HDEA 1T4ZA 3LFLA 1PX6A 1GWCA 2VL3A 5G30A 1J9BA 2VD0A 2FWFA 4PUFC 5C04A 3NIVA 3GH9A 5COHA 5ECOB 3LYPA 4XS6A 1G0TA 2LNTA 4NV5A 3GL3A 4MJCA 1C72A 2JADA 2CVKA 1A0FA 1JHBA 5IPGA 4JRRA 1A2JA 2LJAA 1G7EA 1MDKA 2B1LA 3DIEA 4DVCA 4ZBAA 4IS0A 1UN2A 5G2ZA 1AIUA 4H86A 1GRXA 2TIRA 3UVTA 2LRTA 2O7KA 1CQGA 4I5QA 2NPBA 2DJ3A 4POBA 4X0XA 4XCSA 2K18A 3P2AA 4G10A 2GDRA 3H4KA 2C0EA 4EVMA 1O6JA 2CAQA 2DJJA 8GSSA 3I6AA 1RW1A 2GZZA 4K7NA 2C0FA 3R2QA 1BQ7A 4ISDA 1M9BA 2DMLA 4KB3A 1BJXA 3ERGA 4MDCA 2V41A 1XFLA 1GLQA 3HVSA 1OKTA 3TOTA 2CVBA 5AN1A 2OKAA 1Z6MA 4KW6A 4WXTA 1XWGA 1YJ6A 1SKSB 1ABAA 3VK9A 3C1RA 4BVXA 5KN2A 4OMVA 5IM9A 5DCGA 4NWYA 2DBCA 3SBCA 2DSAA 4RI7A 1QQ2A 3WT2A 4I8BA 2NBSA 2R37A 3EU4A 1XOAA 3H8QA 2B3SA 2OJLA 2RUFA 4BA7A 1DE2A 3M9KA 1XW5A 2DIYA 4RQXA 3HY2A 1GULA 5F05A 3VLNA 4MPGA 4TR1B 2I3YA 2DJ0A 1EWXA 5D9VA 2F8AA 3L4NA 5J41A 4WBJA 4JR4A 1ZGNA 5IMDA 5IMFA 3D6IA 2PU9C 1WOUA 2L6CA 1GSDA 2E2GA 3IAM2 3TKSC 2YWIA 4O92A 2H0HA 3FY7A 2FWEA 3IRAA 4IJIA 3IK7A 3HJPA 3E3EA 2CZ3A 1AQWA 3L9UA 1K3YA 2FCHA 1I9DA 2L59A 2O8VB 5HR2A 4ML6A 1PRXA 5IMZA 1EGOA 3P90A 4KH7A 4TR1A 1X5EA 3DVWA 1JZRA 4K8MA 1EEJA 1XVWA 1SJ6A 4GWRA 4K0GA 5E4WA 3CTGA 1WJKA 2LJKA 3QPMA 5F8BA 2DMMA 3Q18A 5A4WA 2FWHA 3CSHA 3CSJA 4N0ZA 3WGEA 6GSUA 3APQA 1LU4A 3ME7A 1FO5A 5IIZA 2MMAA 4POKA 2HT9A 3VPTA 2FA4A 2IJYA 1SENA 2NTOA 2F8FA 4XRDA 3HZ8A 4XRAA 1EV9A 3ZFLA 2OE1A 4IP1A 2L5LA 3VWWA 3DXBA 1Y25A 3N9JA 1A2MA 3ZITA 1V58A 1M2DA 3TJJA 3EYTA 3MWHA 1UA5A 12GSA 3D4TA 4K7IA 1SKWB 2X8CA 3GKXA 1M99A 17GSA 5A4UA 5HFKA 1ZYQB 4MF6A 3LXZA 5IOWA 3ZTLA 5A4VA 1RQMA 2FNOA 4MF7A 2F3MA 2OE3A 1EZKA 2L4CA 1TKDB 2B5XA 1K3OA 1J0FA 1OKDA 1B9XC 4K6XA 1NSWA 1OYJA 2R6KA 1PD21 2BJXA 4IGJA 4PNGA 5ECPB 3TOUA 3DMLA 3TRPA 3ZL5A 5C00A 4MP4A 3ZREA 2M46A 2LJRA 3WD6A 5HR0A 1XZOA 3L9SA 3PR8A 2IMDA 2EIOA 3KZQA 5CRWA 3TB2A 3EMPA 1WIKA 1PGTA 4GQCA 1AQVA 4BWQA 4CHSA 4DSRA 4ECBA 3GKKA 4TW5A 3NOFA 2GTUA 5EPFA 3KEBA 2H19A 2WULA 4NXIA 1X5DA 1THXA 4E8HA 3A5WA 1XWBA 2K8SA 3VWVA 2R5GA 2MMZA 1B8XA 1O81A 4HJ2A 1EOHA 2YJ7A 1GNWA 3F3QA 4EDYA 3TUEA 3M3MA 2P0GA 5DCHA 1GP1A 2L6DA 2LEGA 3D4MA 3ZZXA 3H1NA 2XBIA 2PMTA 5D8IA 3M0FA 4X1UA 2CQ9A 2O87A 3QAGA 5F06A 1MEKA 2VLVA 4KNDA 4L8EA 3RPPA 1JZOA 5G5EA 2PUKC 3GSTA 3TJKA 2I1UA 1XXUA 3ZYWA 2IPAA 2RUEA 5A5KA 3GN3A 2XHFA 3TJBA 3I69A 2MBTA 4OFMA 3C73A 1K0AA 4WKWA 2J23A 2FY6A 3GYKA 4TR0A 4OFTA 5J4UA 2JSYA 3GX8A 2H6YA 2I4AA 3WGXA 4IP6A 1Z7RA 3LJRA 3HVXA 4NMUA 4L0UA 3TJGA 4FYUA 4J2FA 2C3TA 2C3NA 1YEXA 2KP2A 1A8LA 3DD3A 2H70A 4KCAA 1O85A 1ERWA 3I43A 1BX9A 1W4VA 3KCMA 2N5FA 2ALBA 1O8XA 1ERVA 7GSSA 3GNJA 1VF4A 3PINA 1F9MA 2K8VA 1XWAA 4EO3A 2H1AA 3GH6A 3C71A 3CBUA 2M80A 1GL8A 1LBKA 4K0NA 2B5EA 1HNBA 1GSFA 3EWLA 4WF4A 4KE3A 3HJOA 1WP0A 3D22A 1Z7PA 2WZ9A 1PKWA 1YF0A 3RHBA 4ZXGA 1THOA 3RHCA 3GMFA 4HU9A 4QQ7A 4L0WA 2FUG2 2IWTA 2H71A 3KJYA 1JZWA 5DJLA 4HS1A 1PA3A 3CYNA 6GSSA 3IV4A 1XW6A 2EC4A 2GZYA 4XS1A 5KN1A 4JBBA 1G6YA 1XPVA 1PX7A 1GSUA 5CRGA 1FB6A 4G19A 5ELAA 2R2JA 4YAPA 2G0FA 1NHYA 1R5AA 5B8AA 2YZHA 3UBKA 2O85A 5IO0A 5GAPD 4ZBBA 2C1YA 2LNSA 1Y6EA 2HRFA 2V6OA 4Q5NA 3V1WA 4PQ1A 2AUVA 4DSQA 2HNLA 5AGYA 3LQ7A 1U6TA 2VCZA 4L5OA 2WGRA 1MDJA 3ZRDA 5J9CA 1SK1A 2IN3A 5CRDA 1EV4A 4EE0A 5DJMA 3GSSA 2LQQA 2X99A 4OCFA 2H66A 2GZPA 2YOIA 3HXSA 3KTLA 4AF2A 3HHVA 1V2AA 1OE8A 2OACA 2WJUA 4N11A 3Q6OA 2K9FA 5INYA 1A23A 2IFQB 1ZL9A 1PN9A 4EF0A 1F3AA 3QAVA 3KP8A 3ZIVA 2YJHA 1PL2A 1OC3A 1X5CA 1DE1A 2VOCA 1GTUA 5ECKB 5B6MA 5G31A 4MLYA 3QCPA 2ON7A 3RDWA 1XIYA 2VIMA 3NZNA 5CP1A 4TR3A 5DALB 1OC9B 1QFNA 1M9AA 1AC1A 1TOFA 1K0NA 5J3RA 1U87A 2VL2C 1BAYA 2IFQA 1TJDA 2L4QA 5CO3A 2AB6A 1FG4A 2VO4A 4YQVA 1CQHA 1FVJA 4NV2A 3WYWA 3F6DA 2HSYA 3L9VA 3CTFA 1V9WA 3ZMLA 3RPNA 1Q98A 3UL3A 4MA9A 1MD3A 2B7JA 5IMAA 3FR9A 1TRUA 4G9HA 3F4TA 5DALA 5EY6A 5G1KA 2VM1A 1OC9A 2YZUA 1FOVA 4IBPA 3G7YA 2J9HA 2VM2A 1WWJA 1EP8A 1XVQA 4YH2A 5F07A 1HQOA 2H1DA 3UIWA 1EGRA 2XPDA 2PGTA 4G2EA 4HQZA 3E9JB 3TDGA 2CT6A 1ERUA 3GIXA 3GUSA 1TI3A 2MZCA 1VRSD 1SK2A 4PUAA 2AYTA 2HZEB 4ECCA 1OVNA 4PURA 4ECJA 2GSSA 5E59A 2WCIA 2AJQB 4I2UA 4JE1A 4HZ4A 3LYKA 4KDXA 3ERWA 3GKNA 1F2EA 3DWVA 4V2MA 1HD2A 5JWOB 2ZCTA 4POMA 4ZL8A 4GCIA 2F9SA 2YV9A 2NVLA 5DDLA 3WT1A 3VPQA 3CRTA 2E0QA 2H76A 2B1KA 5ECHB 2GVPA 4WETA 1TRVA 4GQFA 2HI7A 3F6FA 2HZEA 1A8YA 1TU7A 3LORA 1WMJA 4K2DA 3QAWA 1YZXA 14GSA 1HNAA 1NM3A 5ECNB 4POLA 2VL9A 2GGTA 1R4WA 2OBIA 2YANA 3C7MA 2B7KA 4DSSB 3ZVJA 5KN0A 3KH7A 1EP7A 1Z9HA 3IR4A 4BWSA 4TN8A 4TOPA 4QL7A 5ELGA 1WRYA 1JZDA 1ZCPA 3QDNA 3W8SA 20GSA 2PPTA 3KMOA 2H72A 4YQMA 5EL8A 5B8BA 2REMA 3IHQA 4RQRA 5ECSA 5LCZA 3IBHA 3TCOA 1S3AA 2YWOA 4MZCA 2WRTA 2F51A 5ECMB 3LEFA 3SWLA 4IELA 2VCWA 4V2LA 4DSSA 3KP9A 1QMVA 2BTOT 2HRNA 3TRQA 4HEA2 1QUWA 2MBSA 3LXTA 2MMNA 4ZB6A 3OR5A 1XW9A 2GSRA 1BYEA 5D73A 4OWYA 2TRXA 3U6VA 2V1MA 4IVFA 3ZLPA 4LL1B 2HZFA 4OFNA 3CMIA 1FB0A 3F8UA 1EOGA 4PXOA 1YKAA 3GHAA 4GF0A 3FR6A 1RK4A 3APOA 5CNWA 2VCVA 4OO5A 3HYPA 4MJBA 4EC0A 3KXOA 2IMIA 2L57A 5ENUA 3BBYA 3FK8A 3TKSE 2H6ZA 1TW9A 2OA7A 2C80A 1IYIA 3UAPA 2YN1A 1R26A 3KM6A 5JWQB 4WR5A 4EXJA 1GSYA 1QXHA 1TRWA 2KUCA 4LMVA 5HQPA 1ZOFA 3FKFA 4O7HA 3LGCA 1KEBA 4ZL7A 2EIRA 2IMKA 3A2XA 3KH9A
chains in the Genus database with same CATH superfamily
3TKSA 4PQHA 3Q19A 2FD3A 5FHIA 3O6TA 4CDOA 1R5PA 1Z3EA 3GRXA 4L5LA 3KD0A 3MYDA 4CY8A 1F3BA 2GT5A 2C0GA 2LS5A 3UEMA 3APSA 1QGVA 4LL4B 5H5RA 2H8LA 2VCQA 4LA1A 4XS4B 4V2NA 1TP9A 3G7IA 3WGDA 4NHZA 3EC3A 2PN8A 1PKZA 2GQMA 4I6XA 4MJEA 4F03A 4WEYA 2C4JA 1IYHA 1K0DA 2QSIA 5JCGA 3GX0A 5DQYA 3CSIA 4KCEA 1USBA 5LNKe 3QFBC 4IQAA 1YY7A 2DIZA 3A3TA 1TK8B 5AIVA 4ZB9A 1EEMA 5LD0A 1T4YA 19GSA 3GV1A 3ZMKA 2V32A 10GSA 4XS4A 1XCCA 2HE3A 2IIYA 3IAS2 5JCWA 1VF3A 1OC8A 2H1BA 3UMAA 6GSWA 1YEPA 1ILOA 2LQOA 1ZMAA 18GSA 4JU5A 4Q5RA 1GNEA 1AQXA 3HVVA 4K1FA 3DGQA 3TJFA 3IC4A 4JZQA 3QR6A 2P31A 1ML6A 3JCML 5HFIA 2KLXA 2RM6A 2AAWA 3ED3A 2VUPA 3BCIA 4YAVA 4WR4A 2HSHA 4IQ1A 1SJZA 1HNCA 5B7CA 2EIQA 2X8HA 2VLUA 4MABA 2JL4A 6GSYA 3EU3A 1TRSA 4N30A 5GSTA 3DRNA 3LG6A 3VI7A 1G6WA 2CA8A 2GSQA 4IJ3A 4PX1A 2V6KA 1R7HA 1W89A 2LV3A 2XBQA 3HJMA 3KTBA 5GAND 3M1GA 4G0KA 3QOUA 2HFDA 3M8NA 2R3XA 3ZIJA 4TVEA 3ERFA 4E8EA 4ECIA 4KSOA 2FGXA 3UARA 1TK5B 4KDUA 3O3TA 2C0DA 2X8GA 4FO5A 2JZTA 1PL1A 6GSVA 1SJIA 4KSMA 2PBJA 2GQKA 4ULXA 2IMFA 2B5YA 5HR1A 2ES7A 2FHEA 3F0IA 3HDCA 1TK0B 1GUHA 1U3AA 4HQSA 4NPBA 1QK8A 3UOMA 1T3BA 2R4VA 13GSA 5IMVA 3Q74A 2PVQA 4J56E 3BCKA 1J08A 4ICYA 1M2BA 2LTKA 5HR3A 1I5GA 3PGTA 1OE7A 3EE2A 2YP6A 3DEXA 3ZFBA 3EINA 5B6NA 1K0BA 5CREA 1G7OA 1SL1B 4KDYA 1GTAA 1AAZA 2H30A 1XWKA 2KHPA 2KOKA 1AXDA 1NHOA 1WPIA 4HJMA 2JZSA 2PVOC 2ZUPA 5GSSA 3IA1A 2QA1A 3W6GA 1O73A 2GSTA 2OE0A 2YWMA 3GTUB 2X49A 2ZNMA 2FLSA 2C8UA 3G7JA 3A2WA 2A2PA 3IOSA 4GSTA 3GL5A 4J57E 4FQUA 5ECQB 3FW2A 1X9WB 1K0OA 4MZBA 3PH9A 1M2AA 4OCEA 1H4OA 3W8JA 1SKRB 2QC7A 4MJAA 4ACSA 3D5JA 4QL9A 2WDUA 3S9FA 3FHKA 1XWCA 2K6VA 4MMMA 22GSA 2GS3A 3FZAA 5ECLB 3L0HA 5FT3A 3MSZA 2JZRA 3GTUA 2QGVA 2VLTA 3J7Yk 16GSA 5G1LA 1F37A 1YQ1A 3IC8A 4N0VA 1DSBA 2GQLA 2P5RA 3DKSA 2YWNA 3MNGA 4HUAA 2HLSA 5CYYA 5D9XA 3M9JA 2LKUA 1OAZA 4LLRA 1URMA 3GKMA 1E6BA 1Q4JA 2R0PA 1GLPA 2HXKA 1GUMA 4KA0A 5H5QA 2RIIA 5JCUA 1GH2A 5DBQA 4MZWA 2B6MA 4Z7XA 4MH3A 4AJ7A 4F9ZA 4IN0A 3N5OA 4HZ2A 3UBLA 2CZ2A 1GSSA 1O7UA 1S3CA 4RI6A 2YV7A 1FVKA 4FIWA 1PSQA 2TRCP 4OD7A 4D73B 3CRUA 1SD9A 4FYBA 3FMWA 1SYXA 4XTSA 4CW9A 2WFCA 6GSTA 4WBRD 2H0GA 4GRFA 2H0IA 2VCXA 1V98A 2LRCA 1YKCA 1JLWA 4TRXA 2CV4A 3HCZA 4TXOB 4TXVA 5JWRB 3VFIA 2AV4A 1A0RP 1U88A 1Z5YE 3LSZA 2RLIA 2N5AA 2JU5A 3IXRA 2VD1A 2JSZA 2QKEA 5FWGA 3UJ1A 1H75A 1SL2B 2YNXA 2HYXA 4KUNA 4D73A 1A2LA 2PERA 1T00A 2E7PA 4GSSA 4EDZA 2XPEA 1ON4A 4BVYB 4CY6A 2A2RA 4WF5A 5HFGA 5D9TA 3E0UA 1K0CA 1T1VA 1YDKA 1VF1A 4MCUA 2FWGA 4TXOA 2E2MA 3IPZA 3A2VA 4MPFA 5AIXA 1BEDA 1TXXA 4ILFA 5IQYA 2IMEA 4TKYA 5DQSA 2DJ1A 5IMCA 3F63A 1ZYEA 4KX4A 1SD8A 1A24A 2O89A 4O5RA 5J9BA 3F4RA 3GA4A 3TRXA 4N10A 3O76A 3IE3A 1X0RA 5J5NA 5L71A 2P5QA 1SK0A 1VGLA 5D93A 4TR4A 4BVYA 2RM5A 4AJ6A 1NW2A 1UC7A 3C8EA 4AGSA 4YQUA 2DKHA 3FR3A 2BMXA 1F6MC 1YF1A 3H93A 4Z2UA 4JR6A 3IDVA 5CRHA 2VL2A 3MIXA 3QFAC 3J7Yb 2A2SA 1ERTA 1PMTA 2AHEA 4XHMA 2A4VA 5KOXA 1GTIA 4MK3A 4EIQA 4ZIJA 5ABRA 2XC2A 4MH2A 4PTSA 1X9MB 3BJ5A 3H79A 4XIHA 2MMOA 3FEUA 3IK9A 3FZ9A 2CX4A 3TKRA 2H1GA 4FH8A 4X43A 1M0UA 1T8EB 2WB9A 2GLRA 3ZVJD 2LUSA 2PWJA 1N2AA 1HYUA 4BPYA 2FA8A 3TKPA 2YPMA 1ACVA 4HI7A 2D2ZA 3BD2A 1ST9A 3KIJA 1TDIA 2R0GA 4Z2RA 4JEDA 1E2YA 5ECRB 3VI5A 3F4SA 3FYGA 1KNGA 3ME8A 4F0BA 4RUVA 4ZB8A 3EVIA 2H73A 1LJRA 4HOJA 4PGTA 4AJ8A 5IOXA 11GSA 1VF2A 3L78A 4PNFA 3QD9A 3U5RE 1TU8A 4EUYA 4GTUA 2M72A 3D0ZA 2Z9SA 2CVDA 1AUCA 4K5SA 5IO2A 1SYRA 2C3QA 1V40A 5DVBA 5F0GA 2JACA 4Q5FA 2I9HA 2LRNA 1GUKA 6GSXA 3D21A 2IL3A 5D9WA 3HKRA 1V57A 1B9YC 5KN3A 4K5RA 1B48A 2HRKA 4ZBDA 3HA9A 3VURA 2I81A 5D96A 3F9UA 4IW9A 4KF9A 4F82A 1K3LA 2VAFA 2DC5A 4GSNA 2ON5A 4PQIA 4GXZA 4OO4A 2KP1A 3EURA 1GTBA 2H74A 1X9SB 3QMXA 1FHEA 1M7TA 3ISOA 1MTCA 3VWUA 2CX3A 5KEJA 5H5SA 1WE0A 1SL0B 2A4HA 3LWAA 2VCTA 1PN0A 4GLTA 3FZ4A 1U3IA 4KGIA 2YCDA 4I97A 3K8NA 3P7XA 2V2GA 1M3JA 3DVXA 3P8WA 4LMWA 4K7OA 5ID2B 3UVHA 2G2QA 2X64A 1TTZA 3TGZA 2LSTA 1KBNA 5AISA 1DBYA 1O8WA 4KAEA 4Z2TA 4ML1A 5CAXA 2DJKA 1GSEA 3FRCA 5G5FA 1N8JA 3DYRA 4EL1A 1MD4A 5ECIB 3KMNA 5GZZB 4F2IA 1TI1A 1FAAA 3AY8A 1XOBA 2DJ2A 3I9V2 4HU7A 1FW1A 1MDIA 2H01A 3G9BA 5ID2A 2GT6A 3BOAA 3KGKA 4NHWA 3RBTA 4IHUA 4NAXA 3F3RA 3EMXA 3HD5A 3CXGA 4FYCA 2H75A 2CAIA 3TKQA 5EVOA 4BL7B 4ZILA 1B4PA 5IPHA 2OBKA 1T7PB 4O32A 5DAKB 1ZZYA 4IKHA 4G0IA 3MDKA 1PQNA 2NDOA 4K9ZA 2DLXA 1BG5A 3R3EA 4EKZA 4ID0A 9GSSA 1K0MA 4F0CA 3HZ4A 4P3YB 1DUGA 3MAKA 2WS2A 1B4QA 1SU9A 1JFUA 4ZL9A 1UVZA 1JLVA 4MF5A 2OADA 4DEJA 4BL7A 4V1Ap 1GSQA 2L5OA 3FZ5A 4Q5QA 3C1SA 4I2TA 1S3DA 3VWXA 2N5BA 3GURA 1AW9A 1Z6NA 5DAKA 3US3A 2H6XA 5BMUA 1XBSA 4K2XA 1KTEA 2MYGA 3GFKA 3RAZA 4V1Ag 4HDEA 1T4ZA 3LFLA 1PX6A 1GWCA 2VL3A 5G30A 1J9BA 2VD0A 2FWFA 4PUFC 5C04A 3NIVA 3GH9A 5COHA 5ECOB 3LYPA 4XS6A 1G0TA 2LNTA 4NV5A 3GL3A 4MJCA 1C72A 2JADA 2CVKA 1A0FA 1JHBA 5IPGA 4JRRA 1A2JA 2LJAA 1G7EA 1MDKA 2B1LA 1ZYNA 3DIEA 4DVCA 4ZBAA 4IS0A 1UN2A 5G2ZA 1AIUA 4H86A 1GRXA 2TIRA 3UVTA 2LRTA 2O7KA 1CQGA 4I5QA 2NPBA 2DJ3A 4POBA 4X0XA 4XCSA 2K18A 3P2AA 4G10A 2GDRA 3H4KA 2C0EA 4EVMA 1O6JA 2CAQA 2DJJA 4BVXB 8GSSA 3I6AA 1RW1A 2GZZA 4K7NA 2C0FA 3R2QA 1BQ7A 4ISDA 1M9BA 2DMLA 4KB3A 1BJXA 3ERGA 4MDCA 2V41A 1XFLA 1GLQA 3HVSA 4EIPA 1OKTA 3TOTA 2CVBA 5AN1A 2OKAA 1Z6MA 4KW6A 4WXTA 1XWGA 1YJ6A 5BRTA 1SKSB 1ABAA 3VK9A 3C1RA 4BVXA 2X4AA 3PPUA 5KN2A 4OMVA 5IM9A 5DCGA 4NWYA 2DBCA 3SBCA 2DSAA 4RI7A 1QQ2A 3WT2A 4I8BA 2NBSA 2R37A 3EU4A 1XOAA 1XG8A 3H8QA 4O5UA 2B3SA 3IHGA 2OJLA 2RUFA 4BA7A 1DE2A 3M9KA 1XW5A 2DIYA 4RQXA 3HY2A 1GULA 5F05A 3VLNA 4MPGA 4TR1B 2I3YA 2DJ0A 1EWXA 5D9VA 2F8AA 3L4NA 5J41A 4WBJA 4JR4A 1ZGNA 5IMDA 5IMFA 3D6IA 2PU9C 1WOUA 2L6CA 1GSDA 2E2GA 3IAM2 3TKSC 2YWIA 4O92A 2H0HA 3FY7A 2FWEA 3IRAA 4IJIA 3IK7A 3HJPA 3E3EA 2CZ3A 1AQWA 3L9UA 1K3YA 2FCHA 1I9DA 2L59A 2O8VB 5HR2A 4ML6A 1PRXA 5IMZA 1EGOA 3P90A 4KH7A 4TR1A 1X5EA 3DVWA 1JZRA 4K8MA 1EEJA 1XVWA 1SJ6A 4GWRA 4K0GA 5E4WA 3CTGA 1WJKA 2LJKA 3QPMA 5F8BA 2DMMA 3Q18A 5A4WA 2FWHA 3CSHA 3CSJA 4N0ZA 3WGEA 6GSUA 3APQA 1LU4A 3ME7A 1FO5A 5IIZA 2MMAA 4POKA 4YKGA 2HT9A 3VPTA 2FA4A 2IJYA 1SENA 2NTOA 2F8FA 4XRDA 3HZ8A 4XRAA 1EV9A 3ZFLA 2OE1A 4IP1A 2L5LA 3VWWA 3DXBA 1Y25A 3N9JA 1A2MA 3ZITA 1V58A 1M2DA 3TJJA 3EYTA 3MWHA 1UA5A 12GSA 3D4TA 1ZYPA 4K7IA 1SKWB 2X8CA 3GKXA 1M99A 17GSA 5A4UA 5HFKA 1ZYQB 4MF6A 3LXZA 5IOWA 3ZTLA 5A4VA 1RQMA 4X4JA 2FNOA 4MF7A 2F3MA 2OE3A 1EZKA 2L4CA 1TKDB 2B5XA 1K3OA 1J0FA 1OKDA 1B9XC 4K6XA 1NSWA 1OYJA 2R6KA 1PD21 2BJXA 4IGJA 4PNGA 5ECPB 3TOUA 3DMLA 3TRPA 3ZL5A 5C00A 4MP4A 3ZREA 2M46A 2LJRA 3WD6A 5HR0A 1XZOA 3L9SA 3PR8A 2IMDA 2EIOA 3KZQA 5CRWA 3TB2A 3EMPA 1WIKA 1PGTA 4GQCA 1AQVA 4BWQA 4CHSA 4DSRA 4ECBA 3GKKA 4TW5A 3NOFA 2GTUA 5EPFA 3KEBA 2H19A 2WULA 4NXIA 1X5DA 1THXA 4E8HA 3A5WA 1XWBA 2K8SA 3VWVA 2R5GA 2MMZA 1B8XA 1O81A 4HJ2A 1EOHA 2YJ7A 1GNWA 3F3QA 4EDYA 3TUEA 3M3MA 2P0GA 4YKFA 5DCHA 1GP1A 2L6DA 2LEGA 3D4MA 3ZZXA 3H1NA 2XBIA 2PMTA 5D8IA 3M0FA 4X1UA 2CQ9A 2O87A 3QAGA 5F06A 1MEKA 2VLVA 4KNDA 4L8EA 3RPPA 1JZOA 5G5EA 2PUKC 3GSTA 3TJKA 2I1UA 1XXUA 3ZYWA 2IPAA 2RUEA 5A5KA 3GN3A 2XHFA 3TJBA 3I69A 2MBTA 4OFMA 3C73A 1K0AA 4WKWA 2J23A 2FY6A 3GYKA 4TR0A 4OFTA 5J4UA 2JSYA 3GX8A 1FOHA 2H6YA 2I4AA 3WGXA 4IP6A 1Z7RA 3LJRA 3HVXA 4NMUA 4L0UA 3TJGA 4FYUA 4J2FA 2C3TA 2C3NA 1YEXA 2KP2A 1A8LA 1S3RA 3DD3A 2H70A 4KCAA 1O85A 1ERWA 3I43A 1BX9A 1W4VA 3KCMA 2N5FA 2ALBA 1O8XA 1ERVA 7GSSA 3GNJA 1VF4A 3PINA 1F9MA 2K8VA 1XWAA 4EO3A 2H1AA 3GH6A 3C71A 3CBUA 2M80A 1GL8A 1LBKA 4K0NA 2B5EA 1HNBA 1GSFA 5KOWA 3EWLA 4WF4A 4KE3A 3HJOA 1WP0A 2UZ8A 3D22A 1Z7PA 2WZ9A 1PKWA 1YF0A 3RHBA 4ZXGA 2R0CA 1THOA 3RHCA 3GMFA 4HU9A 4QQ7A 4L0WA 2FUG2 2IWTA 2H71A 3KJYA 1JZWA 5DJLA 4HS1A 1PA3A 3CYNA 6GSSA 3IV4A 1XW6A 2EC4A 2GZYA 4XS1A 5KN1A 4JBBA 1G6YA 1XPVA 1PX7A 1GSUA 5CRGA 1FB6A 4G19A 5ELAA 2R2JA 4YAPA 4G0LA 2G0FA 1NHYA 1R5AA 5B8AA 2HSMA 2YZHA 3UBKA 2O85A 5IO0A 5GAPD 4ZBBA 2C1YA 2LNSA 1Y6EA 2HRFA 2V6OA 4Q5NA 3V1WA 4PQ1A 2AUVA 4DSQA 2HNLA 5AGYA 3LQ7A 1U6TA 2VCZA 4L5OA 2WGRA 1MDJA 3ZRDA 5J9CA 1SK1A 2IN3A 5CRDA 1EV4A 4EE0A 5DJMA 3GSSA 2LQQA 2X99A 4OCFA 2H66A 2GZPA 2YOIA 3HXSA 3KTLA 4AF2A 3HHVA 1V2AA 1OE8A 2DKIA 2OACA 4N11A 2WJUA 3Q6OA 2K9FA 5INYA 1A23A 2IFQB 1ZL9A 1PN9A 4EF0A 1F3AA 3QAVA 3KP8A 3ZIVA 2YJHA 1PL2A 4HSCX 1OC3A 1X5CA 1DE1A 2VOCA 1GTUA 5ECKB 5B6MA 5G31A 4MLYA 3QCPA 2ON7A 2HRAA 3RDWA 1XIYA 2VIMA 3NZNA 5CP1A 4TR3A 5DALB 4USSA 1OC9B 1QFNA 1M9AA 1AC1A 1TOFA 1K0NA 5J3RA 1U87A 2VL2C 1BAYA 2IFQA 1TJDA 2L4QA 5CO3A 2AB6A 1FG4A 2VO4A 4YQVA 1CQHA 1FVJA 4NV2A 3WYWA 3F6DA 2HSYA 3L9VA 3CTFA 1V9WA 3ZMLA 3RPNA 1Q98A 3UL3A 4MA9A 1MD3A 2B7JA 5IMAA 3FR9A 1TRUA 4G9HA 2QA2A 3F4TA 5DALA 5EY6A 5G1KA 2VM1A 1OC9A 3CQFA 2YZUA 1FOVA 4IBPA 3G7YA 1M3IA 2J9HA 2VM2A 4MNNA 1WWJA 1EP8A 1XVQA 1PFOA 4YH2A 5F07A 1HQOA 2H1DA 3UIWA 1EGRA 2XPDA 2PGTA 4G2EA 4HQZA 3E9JB 3TDGA 2CT6A 1ERUA 3GIXA 3GUSA 1TI3A 2MZCA 1VRSD 1SK2A 4PUAA 2AYTA 2HZEB 4ECCA 1OVNA 4PURA 4ECJA 2GSSA 5E59A 2WCIA 2AJQB 4I2UA 3A5IA 4JE1A 4HZ4A 3LYKA 4KDXA 3ERWA 3GKNA 1F2EA 3DWVA 4V2MA 1HD2A 5JWOB 2ZCTA 4POMA 4ZL8A 4GCIA 2F9SA 2YV9A 2NVLA 5DDLA 3WT1A 3VPQA 3CRTA 2E0QA 2H76A 2B1KA 5ECHB 2GVPA 4WETA 1TRVA 4GQFA 2HI7A 3F6FA 2HZEA 1A8YA 1TU7A 3LORA 1WMJA 4K2DA 3QAWA 1YZXA 14GSA 1HNAA 4BIKA 1NM3A 5ECNB 4POLA 2VL9A 2GGTA 1R4WA 2OBIA 2YANA 3C7MA 2B7KA 4DSSB 3ZVJA 5KN0A 3KH7A 1EP7A 3LW9A 3EPTA 1Z9HA 3IR4A 4BWSA 4TN8A 4TOPA 4QL7A 5ELGA 1WRYA 1JZDA 1ZCPA 3QDNA 3W8SA 20GSA 2PPTA 3KMOA 2H72A 4YQMA 5EL8A 5B8BA 2REMA 3IHQA 4RQRA 5ECSA 5LCZA 3IBHA 3TCOA 1S3AA 2YWOA 4MZCA 2WRTA 2F51A 5ECMB 3LEFA 3SWLA 4IELA 2VCWA 4V2LA 4DSSA 3KP9A 1QMVA 2BTOT 2HRNA 3TRQA 4HEA2 1QUWA 2MBSA 3LXTA 2MMNA 4ZB6A 3OR5A 1XW9A 2GSRA 1BYEA 5D73A 4OWYA 2TRXA 3U6VA 2V1MA 4IVFA 3ZLPA 4LL1B 2HZFA 4OFNA 3CMIA 1FB0A 3F8UA 1EOGA 4PXOA 1YKAA 3GHAA 4GF0A 3FR6A 1RK4A 3APOA 5CNWA 2VCVA 4OO5A 3HYPA 4MJBA 4EC0A 4O5QA 3KXOA 2IMIA 2L57A 5ENUA 3BBYA 3FK8A 3HVNA 3TKSE 2H6ZA 1TW9A 2OA7A 2C80A 1IYIA 3UAPA 2YN1A 1R26A 3KM6A 5JWQB 4WR5A 4EXJA 1GSYA 1QXHA 1TRWA 2KUCA 4A5PA 4LMVA 5HQPA 1ZOFA 3FKFA 4O7HA 3LGCA 1KEBA 4ZL7A 2EIRA 2IMKA 3A2XA 3KH9A
chains in the Genus database with same CATH topology
3TKSA 4PQHA 3Q19A 2FD3A 5FHIA 3O6TA 4CDOA 1R5PA 1Z3EA 3GRXA 4L5LA 3KD0A 3MYDA 4CY8A 1F3BA 2GT5A 2C0GA 2LS5A 3UEMA 3APSA 1QGVA 4LL4B 5H5RA 2H8LA 2VCQA 4LA1A 4XS4B 4V2NA 1TP9A 3G7IA 3WGDA 4NHZA 3EC3A 2PN8A 1PKZA 2GQMA 4I6XA 4MJEA 4F03A 4WEYA 2C4JA 1IYHA 1K0DA 2QSIA 5JCGA 3GX0A 5DQYA 3CSIA 4KCEA 1USBA 5LNKe 3QFBC 4IQAA 1YY7A 2DIZA 3A3TA 1TK8B 5AIVA 4ZB9A 1EEMA 5LD0A 1T4YA 19GSA 3GV1A 3ZMKA 2V32A 10GSA 4XS4A 1XCCA 2HE3A 2IIYA 3IAS2 5JCWA 1VF3A 1OC8A 2H1BA 3UMAA 6GSWA 1YEPA 1ILOA 2LQOA 1ZMAA 18GSA 4JU5A 4Q5RA 1GNEA 1AQXA 3HVVA 4K1FA 3DGQA 3TJFA 3IC4A 4JZQA 3QR6A 2P31A 1ML6A 3JCML 5HFIA 2KLXA 2RM6A 2AAWA 3ED3A 2VUPA 3BCIA 4YAVA 4WR4A 2HSHA 4IQ1A 1SJZA 1HNCA 5B7CA 2EIQA 2X8HA 2VLUA 4MABA 2JL4A 6GSYA 3EU3A 1TRSA 4N30A 5GSTA 3DRNA 3LG6A 3VI7A 1G6WA 2CA8A 2GSQA 4IJ3A 4PX1A 2V6KA 1R7HA 1W89A 2LV3A 2XBQA 3HJMA 3KTBA 5GAND 3M1GA 4G0KA 3QOUA 2HFDA 3M8NA 2R3XA 3ZIJA 4TVEA 3ERFA 4E8EA 4ECIA 4KSOA 2FGXA 3UARA 1TK5B 4KDUA 3O3TA 2C0DA 2X8GA 4FO5A 2JZTA 1PL1A 6GSVA 1SJIA 4KSMA 2PBJA 2GQKA 4ULXA 2IMFA 2B5YA 5HR1A 2ES7A 2FHEA 3F0IA 3HDCA 1TK0B 1GUHA 1U3AA 4HQSA 4NPBA 1QK8A 3UOMA 1T3BA 2R4VA 13GSA 5IMVA 3Q74A 2PVQA 4J56E 3BCKA 1J08A 4ICYA 1M2BA 2LTKA 5HR3A 1I5GA 3PGTA 1OE7A 3EE2A 2YP6A 3DEXA 3ZFBA 3EINA 5B6NA 1K0BA 5CREA 1G7OA 1SL1B 4KDYA 1GTAA 1AAZA 2H30A 1XWKA 2KHPA 2KOKA 1AXDA 1NHOA 1WPIA 4HJMA 2JZSA 2PVOC 2ZUPA 5GSSA 3IA1A 2QA1A 3W6GA 1O73A 2GSTA 2OE0A 2YWMA 3GTUB 2X49A 2ZNMA 2FLSA 2C8UA 3G7JA 3A2WA 2A2PA 3IOSA 4GSTA 3GL5A 4J57E 4FQUA 5ECQB 3FW2A 1X9WB 1K0OA 4MZBA 3PH9A 1M2AA 4OCEA 1H4OA 3W8JA 1SKRB 2QC7A 4MJAA 4ACSA 3D5JA 4QL9A 2WDUA 3S9FA 3FHKA 1XWCA 2K6VA 4MMMA 22GSA 2GS3A 3FZAA 5ECLB 3L0HA 5FT3A 3MSZA 2JZRA 3GTUA 2QGVA 2VLTA 3J7Yk 16GSA 5G1LA 1F37A 1YQ1A 3IC8A 4N0VA 1DSBA 2GQLA 2P5RA 3DKSA 2YWNA 3MNGA 4HUAA 2HLSA 5CYYA 5D9XA 3M9JA 2LKUA 1OAZA 4LLRA 1URMA 3GKMA 1E6BA 1Q4JA 2R0PA 1GLPA 2HXKA 1GUMA 4KA0A 5H5QA 2RIIA 5JCUA 1GH2A 5DBQA 4MZWA 2B6MA 4Z7XA 4MH3A 4AJ7A 4F9ZA 4IN0A 3N5OA 4HZ2A 3UBLA 2CZ2A 1GSSA 1O7UA 1S3CA 4RI6A 2YV7A 1FVKA 4FIWA 1PSQA 2TRCP 4OD7A 4D73B 3CRUA 1SD9A 4FYBA 3FMWA 1SYXA 4XTSA 4CW9A 2WFCA 6GSTA 4WBRD 2H0GA 4GRFA 2H0IA 2VCXA 1V98A 2LRCA 1YKCA 1JLWA 4TRXA 2CV4A 3HCZA 4TXOB 4TXVA 5JWRB 3VFIA 2AV4A 1A0RP 1U88A 1Z5YE 3LSZA 2RLIA 2N5AA 2JU5A 3IXRA 2VD1A 2JSZA 2QKEA 5FWGA 3UJ1A 1H75A 1SL2B 2YNXA 2HYXA 4KUNA 4D73A 1A2LA 2PERA 1T00A 2E7PA 4GSSA 4EDZA 2XPEA 1ON4A 4BVYB 4CY6A 2A2RA 4WF5A 5HFGA 5D9TA 3E0UA 1K0CA 1T1VA 1YDKA 1VF1A 4MCUA 2FWGA 4TXOA 2E2MA 3IPZA 3A2VA 4MPFA 5AIXA 1BEDA 1TXXA 4ILFA 5IQYA 2IMEA 4TKYA 5DQSA 2DJ1A 5IMCA 3F63A 1ZYEA 4KX4A 1SD8A 1A24A 2O89A 4O5RA 5J9BA 3F4RA 3GA4A 3TRXA 4N10A 3O76A 3IE3A 1X0RA 5J5NA 5L71A 2P5QA 1SK0A 1VGLA 5D93A 4TR4A 4BVYA 2RM5A 4AJ6A 1NW2A 1UC7A 3C8EA 4AGSA 4YQUA 2DKHA 3FR3A 2BMXA 1F6MC 1YF1A 3H93A 4Z2UA 4JR6A 3IDVA 5CRHA 2VL2A 3MIXA 3QFAC 3J7Yb 2A2SA 1ERTA 1PMTA 2AHEA 4XHMA 2A4VA 5KOXA 1GTIA 4MK3A 4EIQA 4ZIJA 5ABRA 2XC2A 4MH2A 4PTSA 1X9MB 3BJ5A 3H79A 4XIHA 2MMOA 3FEUA 3IK9A 3FZ9A 2CX4A 3TKRA 2H1GA 4FH8A 4X43A 1M0UA 1T8EB 2WB9A 2GLRA 3ZVJD 2LUSA 2PWJA 1N2AA 1HYUA 4BPYA 2FA8A 3TKPA 2YPMA 1ACVA 4HI7A 2D2ZA 3BD2A 1ST9A 3KIJA 1TDIA 2R0GA 4Z2RA 4JEDA 1E2YA 5ECRB 3VI5A 3F4SA 3FYGA 1KNGA 3ME8A 4F0BA 4RUVA 4ZB8A 3EVIA 2H73A 1LJRA 4HOJA 4PGTA 4AJ8A 5IOXA 11GSA 1VF2A 3L78A 4PNFA 3QD9A 3U5RE 1TU8A 4EUYA 4GTUA 2M72A 3D0ZA 2Z9SA 2CVDA 1AUCA 4K5SA 5IO2A 1SYRA 2C3QA 1V40A 5DVBA 5F0GA 2JACA 4Q5FA 2I9HA 2LRNA 1GUKA 6GSXA 3D21A 2IL3A 5D9WA 3HKRA 1V57A 1B9YC 5KN3A 4K5RA 1B48A 2HRKA 4ZBDA 3HA9A 3VURA 2I81A 5D96A 3F9UA 4IW9A 4KF9A 4F82A 1K3LA 2VAFA 2DC5A 4GSNA 2ON5A 4PQIA 4GXZA 4OO4A 2KP1A 3EURA 1GTBA 2H74A 1X9SB 3QMXA 1FHEA 1M7TA 3ISOA 1MTCA 3VWUA 2CX3A 5KEJA 5H5SA 1WE0A 1SL0B 2A4HA 3LWAA 2VCTA 1PN0A 4GLTA 3FZ4A 1U3IA 4KGIA 2YCDA 4I97A 3K8NA 3P7XA 2V2GA 3DVXA 3P8WA 4LMWA 4K7OA 5ID2B 3UVHA 2G2QA 2X64A 1TTZA 3TGZA 2LSTA 1KBNA 5AISA 1DBYA 1O8WA 4KAEA 4Z2TA 4ML1A 5CAXA 2DJKA 1GSEA 3FRCA 5G5FA 1N8JA 3DYRA 4EL1A 1MD4A 5ECIB 3KMNA 5GZZB 4F2IA 1TI1A 1FAAA 3AY8A 1XOBA 2DJ2A 3I9V2 4HU7A 1FW1A 1MDIA 2H01A 3G9BA 5ID2A 2GT6A 3BOAA 3KGKA 4NHWA 3RBTA 4IHUA 4NAXA 3F3RA 3EMXA 3HD5A 3CXGA 4FYCA 2H75A 2CAIA 3TKQA 5EVOA 4BL7B 4ZILA 1B4PA 5IPHA 2OBKA 1T7PB 4O32A 5DAKB 1ZZYA 4IKHA 4G0IA 3MDKA 1PQNA 2NDOA 4K9ZA 2DLXA 1BG5A 3R3EA 4EKZA 4ID0A 9GSSA 1K0MA 4F0CA 3HZ4A 4P3YB 1DUGA 3MAKA 2WS2A 1B4QA 1SU9A 1JFUA 4ZL9A 1UVZA 1JLVA 4MF5A 2OADA 4DEJA 4BL7A 4V1Ap 1GSQA 2L5OA 3FZ5A 4Q5QA 3C1SA 4I2TA 1S3DA 3VWXA 2N5BA 3GURA 1AW9A 1Z6NA 5DAKA 3US3A 2H6XA 5BMUA 1XBSA 4K2XA 1KTEA 2MYGA 3GFKA 3RAZA 4V1Ag 4HDEA 1T4ZA 3LFLA 1PX6A 1GWCA 2VL3A 5G30A 1J9BA 2VD0A 2FWFA 4PUFC 5C04A 3NIVA 3GH9A 5COHA 5ECOB 3LYPA 4XS6A 1G0TA 2LNTA 4NV5A 3GL3A 4MJCA 1C72A 2JADA 2CVKA 1A0FA 1JHBA 5IPGA 4JRRA 1A2JA 2LJAA 1G7EA 1MDKA 2B1LA 1ZYNA 3DIEA 4DVCA 4ZBAA 4IS0A 1UN2A 5G2ZA 1AIUA 4H86A 1GRXA 2TIRA 3UVTA 2LRTA 2O7KA 1CQGA 4I5QA 2NPBA 2DJ3A 4POBA 4X0XA 4XCSA 2K18A 3P2AA 4G10A 2GDRA 3H4KA 2C0EA 4EVMA 1O6JA 2CAQA 2DJJA 4BVXB 8GSSA 3I6AA 1RW1A 2GZZA 4K7NA 2C0FA 3R2QA 1BQ7A 4ISDA 1M9BA 2DMLA 4KB3A 1BJXA 3ERGA 4MDCA 2V41A 1XFLA 1GLQA 3HVSA 4EIPA 1OKTA 3TOTA 2CVBA 5AN1A 2OKAA 1Z6MA 4KW6A 4WXTA 1XWGA 1YJ6A 5BRTA 1SKSB 1ABAA 3VK9A 3C1RA 4BVXA 2X4AA 3PPUA 5KN2A 4OMVA 5IM9A 5DCGA 4NWYA 2DBCA 3SBCA 2DSAA 4RI7A 1QQ2A 3WT2A 4I8BA 2NBSA 2R37A 3EU4A 1XOAA 3H8QA 4O5UA 2B3SA 3IHGA 2OJLA 2RUFA 4BA7A 1DE2A 3M9KA 1XW5A 2DIYA 4RQXA 3HY2A 1GULA 5F05A 3VLNA 4MPGA 4TR1B 2I3YA 2DJ0A 1EWXA 5D9VA 2F8AA 3L4NA 5J41A 4WBJA 4JR4A 1ZGNA 5IMDA 5IMFA 3D6IA 2PU9C 1WOUA 2L6CA 1GSDA 2E2GA 3IAM2 3TKSC 2YWIA 4O92A 2H0HA 3FY7A 2FWEA 3IRAA 4IJIA 3IK7A 3HJPA 3E3EA 2CZ3A 1AQWA 3L9UA 1K3YA 2FCHA 1I9DA 2L59A 2O8VB 5HR2A 4ML6A 1PRXA 5IMZA 1EGOA 3P90A 4KH7A 4TR1A 1X5EA 3DVWA 1JZRA 4K8MA 1EEJA 1XVWA 1SJ6A 4GWRA 4K0GA 5E4WA 3CTGA 1WJKA 2LJKA 3QPMA 5F8BA 2DMMA 3Q18A 5A4WA 2FWHA 3CSHA 3CSJA 4N0ZA 3WGEA 6GSUA 3APQA 1LU4A 3ME7A 1FO5A 5IIZA 2MMAA 4POKA 4YKGA 2HT9A 3VPTA 2FA4A 2IJYA 1SENA 2NTOA 2F8FA 4XRDA 3HZ8A 4XRAA 1EV9A 3ZFLA 2OE1A 4IP1A 2L5LA 3VWWA 3DXBA 1Y25A 3N9JA 1A2MA 3ZITA 1V58A 1M2DA 3TJJA 3EYTA 3MWHA 1UA5A 12GSA 3D4TA 1ZYPA 4K7IA 1SKWB 2X8CA 3GKXA 1M99A 17GSA 5A4UA 5HFKA 1ZYQB 4MF6A 3LXZA 5IOWA 3ZTLA 5A4VA 1RQMA 4X4JA 2FNOA 4MF7A 2F3MA 2OE3A 1EZKA 2L4CA 1TKDB 2B5XA 1K3OA 1J0FA 1OKDA 1B9XC 4K6XA 1NSWA 1OYJA 2R6KA 1PD21 2BJXA 4IGJA 4PNGA 5ECPB 3TOUA 3DMLA 3TRPA 3ZL5A 5C00A 4MP4A 3ZREA 2M46A 2LJRA 3WD6A 5HR0A 1XZOA 3L9SA 3PR8A 2IMDA 2EIOA 3KZQA 5CRWA 3TB2A 3EMPA 1WIKA 1PGTA 4GQCA 1AQVA 4BWQA 4CHSA 4DSRA 4ECBA 3GKKA 4TW5A 3NOFA 2GTUA 5EPFA 3KEBA 2H19A 2WULA 4NXIA 1X5DA 1THXA 4E8HA 3A5WA 1XWBA 2K8SA 3VWVA 2R5GA 2MMZA 1B8XA 1O81A 4HJ2A 1EOHA 2YJ7A 1GNWA 3F3QA 4EDYA 3TUEA 3M3MA 2P0GA 4YKFA 5DCHA 1GP1A 2L6DA 2LEGA 3D4MA 3ZZXA 3H1NA 2XBIA 2PMTA 5D8IA 3M0FA 4X1UA 2CQ9A 2O87A 3QAGA 5F06A 1MEKA 2VLVA 4KNDA 4L8EA 3RPPA 1JZOA 5G5EA 2PUKC 3GSTA 3TJKA 2I1UA 1XXUA 3ZYWA 2IPAA 2RUEA 5A5KA 3GN3A 2XHFA 3TJBA 3I69A 2MBTA 4OFMA 3C73A 1K0AA 4WKWA 2J23A 2FY6A 3GYKA 4TR0A 4OFTA 5J4UA 2JSYA 3GX8A 1FOHA 2H6YA 2I4AA 3WGXA 4IP6A 1Z7RA 3LJRA 3HVXA 4NMUA 4L0UA 3TJGA 4FYUA 4J2FA 2C3TA 2C3NA 1YEXA 2KP2A 1A8LA 3DD3A 2H70A 4KCAA 1O85A 1ERWA 3I43A 1BX9A 1W4VA 3KCMA 2N5FA 2ALBA 1O8XA 1ERVA 7GSSA 3GNJA 1VF4A 3PINA 1F9MA 2K8VA 1XWAA 4EO3A 2H1AA 3GH6A 3C71A 3CBUA 2M80A 1GL8A 1LBKA 4K0NA 2B5EA 1HNBA 1GSFA 5KOWA 3EWLA 4WF4A 4KE3A 3HJOA 1WP0A 2UZ8A 3D22A 1Z7PA 2WZ9A 1PKWA 1YF0A 3RHBA 4ZXGA 2R0CA 1THOA 3RHCA 3GMFA 4HU9A 4QQ7A 4L0WA 2FUG2 2IWTA 2H71A 3KJYA 1JZWA 5DJLA 4HS1A 1PA3A 3CYNA 6GSSA 3IV4A 1XW6A 2EC4A 2GZYA 4XS1A 5KN1A 4JBBA 1G6YA 1XPVA 1PX7A 1GSUA 5CRGA 1FB6A 4G19A 5ELAA 2R2JA 4YAPA 4G0LA 2G0FA 1NHYA 1R5AA 5B8AA 2HSMA 2YZHA 3UBKA 2O85A 5IO0A 5GAPD 4ZBBA 2C1YA 2LNSA 1Y6EA 2HRFA 2V6OA 4Q5NA 3V1WA 4PQ1A 2AUVA 4DSQA 2HNLA 5AGYA 3LQ7A 1U6TA 2VCZA 4L5OA 2WGRA 1MDJA 3ZRDA 5J9CA 1SK1A 2IN3A 5CRDA 1EV4A 4EE0A 5DJMA 3GSSA 2LQQA 2X99A 4OCFA 2H66A 2GZPA 2YOIA 3HXSA 3KTLA 4AF2A 3HHVA 1V2AA 1OE8A 2DKIA 2OACA 4N11A 2WJUA 3Q6OA 2K9FA 5INYA 1A23A 2IFQB 1ZL9A 1PN9A 4EF0A 1F3AA 3QAVA 3KP8A 3ZIVA 2YJHA 1PL2A 1OC3A 1X5CA 1DE1A 2VOCA 1GTUA 5ECKB 5B6MA 5G31A 4MLYA 3QCPA 2ON7A 2HRAA 3RDWA 1XIYA 2VIMA 3NZNA 5CP1A 4TR3A 5DALB 4USSA 1OC9B 1QFNA 1M9AA 1AC1A 1TOFA 1K0NA 5J3RA 1U87A 2VL2C 1BAYA 2IFQA 1TJDA 2L4QA 5CO3A 2AB6A 1FG4A 2VO4A 4YQVA 1CQHA 1FVJA 4NV2A 3WYWA 3F6DA 2HSYA 3L9VA 3CTFA 1V9WA 3ZMLA 3RPNA 1Q98A 3UL3A 4MA9A 1MD3A 2B7JA 5IMAA 3FR9A 1TRUA 4G9HA 2QA2A 3F4TA 5DALA 5EY6A 5G1KA 2VM1A 1OC9A 2YZUA 1FOVA 4IBPA 3G7YA 2J9HA 2VM2A 4MNNA 1WWJA 1EP8A 1XVQA 4YH2A 5F07A 1HQOA 2H1DA 3UIWA 1EGRA 2XPDA 2PGTA 4G2EA 4HQZA 3E9JB 3TDGA 2CT6A 1ERUA 3GIXA 3GUSA 1TI3A 2MZCA 1VRSD 1SK2A 4PUAA 2AYTA 2HZEB 4ECCA 1OVNA 4PURA 4ECJA 2GSSA 5E59A 2WCIA 2AJQB 4I2UA 3A5IA 4JE1A 4HZ4A 3LYKA 4KDXA 3ERWA 3GKNA 1F2EA 3DWVA 4V2MA 1HD2A 5JWOB 2ZCTA 4POMA 4ZL8A 4GCIA 2F9SA 2YV9A 2NVLA 5DDLA 3WT1A 3VPQA 3CRTA 2E0QA 2H76A 2B1KA 5ECHB 2GVPA 4WETA 1TRVA 4GQFA 2HI7A 3F6FA 2HZEA 1A8YA 1TU7A 3LORA 1WMJA 4K2DA 3QAWA 1YZXA 14GSA 1HNAA 1NM3A 5ECNB 4POLA 2VL9A 2GGTA 1R4WA 2OBIA 2YANA 3C7MA 2B7KA 4DSSB 3ZVJA 5KN0A 3KH7A 1EP7A 3LW9A 3EPTA 1Z9HA 3IR4A 4BWSA 4TN8A 4TOPA 4QL7A 5ELGA 1WRYA 1JZDA 1ZCPA 3QDNA 3W8SA 20GSA 2PPTA 3KMOA 2H72A 4YQMA 5EL8A 5B8BA 2REMA 3IHQA 4RQRA 5ECSA 5LCZA 3IBHA 3TCOA 1S3AA 2YWOA 4MZCA 2WRTA 2F51A 5ECMB 3LEFA 3SWLA 4IELA 2VCWA 4V2LA 4DSSA 3KP9A 1QMVA 2BTOT 2HRNA 3TRQA 4HEA2 1QUWA 2MBSA 3LXTA 2MMNA 4ZB6A 3OR5A 1XW9A 2GSRA 1BYEA 5D73A 4OWYA 2TRXA 3U6VA 2V1MA 4IVFA 3ZLPA 4LL1B 2HZFA 4OFNA 3CMIA 1FB0A 3F8UA 1EOGA 4PXOA 1YKAA 3GHAA 4GF0A 3FR6A 1RK4A 3APOA 5CNWA 2VCVA 4OO5A 3HYPA 4MJBA 4EC0A 4O5QA 3KXOA 2IMIA 2L57A 5ENUA 3BBYA 3FK8A 3TKSE 2H6ZA 1TW9A 2OA7A 2C80A 1IYIA 3UAPA 2YN1A 1R26A 3KM6A 5JWQB 4WR5A 4EXJA 1GSYA 1QXHA 1TRWA 2KUCA 4A5PA 4LMVA 5HQPA 1ZOFA 3FKFA 4O7HA 3LGCA 1KEBA 4ZL7A 2EIRA 2IMKA 3A2XA 3KH9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TKS A;  4PQH A;  3Q19 A;  2FD3 A;  5FHI A;  3O6T A;  4CDO A;  1R5P A;  1Z3E A;  3GRX A;  4L5L A;  3KD0 A;  1F3B A;  2GT5 A;  2C0G A;  2LS5 A;  3UEM A;  3APS A;  1QGV A;  4LL4 B;  5H5R A;  2H8L A;  2VCQ A;  4LA1 A;  4XS4 B;  4V2N A;  1TP9 A;  3G7I A;  3WGD A;  4NHZ A;  3EC3 A;  2PN8 A;  1PKZ A;  2GQM A;  4I6X A;  4MJE A;  4F03 A;  4WEY A;  2C4J A;  1IYH A;  1K0D A;  2QSI A;  5JCG A;  3GX0 A;  5DQY A;  3CSI A;  4KCE A;  1USB A;  5LNK e;  3QFB C;  4IQA A;  1YY7 A;  2DIZ A;  3A3T A;  1TK8 B;  5AIV A;  4ZB9 A;  1EEM A;  5LD0 A;  1T4Y A;  19GS A;  3GV1 A;  3ZMK A;  2V32 A;  10GS A;  4XS4 A;  1XCC A;  2HE3 A;  2IIY A;  3IAS 2;  5JCW A;  1VF3 A;  1OC8 A;  2H1B A;  3UMA A;  6GSW A;  1YEP A;  1ILO A;  2LQO A;  1ZMA A;  18GS A;  4JU5 A;  4Q5R A;  1GNE A;  1AQX A;  3HVV A;  4K1F A;  3DGQ A;  3TJF A;  3IC4 A;  4JZQ A;  3QR6 A;  2P31 A;  1ML6 A;  3JCM L;  5HFI A;  2KLX A;  2RM6 A;  2AAW A;  3ED3 A;  2VUP A;  3BCI A;  4YAV A;  4WR4 A;  2HSH A;  4IQ1 A;  1SJZ A;  1HNC A;  5B7C A;  2EIQ A;  2X8H A;  2VLU A;  4MAB A;  2JL4 A;  6GSY A;  3EU3 A;  1TRS A;  4N30 A;  5GST A;  3DRN A;  3LG6 A;  3VI7 A;  1G6W A;  2CA8 A;  2GSQ A;  4IJ3 A;  4PX1 A;  2V6K A;  1R7H A;  1W89 A;  2LV3 A;  2XBQ A;  3HJM A;  3KTB A;  5GAN D;  3M1G A;  3QOU A;  2HFD A;  3M8N A;  2R3X A;  3ZIJ A;  4TVE A;  3ERF A;  4E8E A;  4ECI A;  4KSO A;  2FGX A;  3UAR A;  1TK5 B;  4KDU A;  3O3T A;  2C0D A;  2X8G A;  4FO5 A;  2JZT A;  1PL1 A;  6GSV A;  1SJI A;  4KSM A;  2PBJ A;  2GQK A;  4ULX A;  2IMF A;  2B5Y A;  5HR1 A;  2ES7 A;  2FHE A;  3F0I A;  3HDC A;  1TK0 B;  1GUH A;  1U3A A;  4HQS A;  4NPB A;  1QK8 A;  3UOM A;  1T3B A;  2R4V A;  13GS A;  5IMV A;  3Q74 A;  2PVQ A;  4J56 E;  3BCK A;  1J08 A;  1M2B A;  2LTK A;  5HR3 A;  1I5G A;  3PGT A;  1OE7 A;  3EE2 A;  2YP6 A;  3DEX A;  3ZFB A;  3EIN A;  5B6N A;  1K0B A;  5CRE A;  1G7O A;  1SL1 B;  4KDY A;  1GTA A;  1AAZ A;  2H30 A;  1XWK A;  2KHP A;  2KOK A;  1AXD A;  1NHO A;  1WPI A;  4HJM A;  2JZS A;  2PVO C;  2ZUP A;  5GSS A;  3IA1 A;  3W6G A;  1O73 A;  2GST A;  2OE0 A;  2YWM A;  3GTU B;  2ZNM A;  2FLS A;  2C8U A;  3G7J A;  3A2W A;  3IOS A;  4GST A;  3GL5 A;  4J57 E;  5ECQ B;  3FW2 A;  1X9W B;  1K0O A;  4MZB A;  3PH9 A;  1M2A A;  4OCE A;  1H4O A;  3W8J A;  1SKR B;  2QC7 A;  4MJA A;  4ACS A;  3D5J A;  4QL9 A;  2WDU A;  3S9F A;  3FHK A;  1XWC A;  2K6V A;  4MMM A;  22GS A;  2GS3 A;  3FZA A;  5ECL B;  3L0H A;  5FT3 A;  3MSZ A;  2JZR A;  3GTU A;  2QGV A;  2VLT A;  3J7Y k;  16GS A;  5G1L A;  1F37 A;  1YQ1 A;  4N0V A;  1DSB A;  2GQL A;  2P5R A;  3DKS A;  2YWN A;  3MNG A;  4HUA A;  2HLS A;  5CYY A;  5D9X A;  3M9J A;  2LKU A;  1OAZ A;  4LLR A;  1URM A;  3GKM A;  1E6B A;  1Q4J A;  1GLP A;  2HXK A;  1GUM A;  4KA0 A;  5H5Q A;  2RII A;  5JCU A;  1GH2 A;  5DBQ A;  4MZW A;  2B6M A;  4Z7X A;  4MH3 A;  4AJ7 A;  4F9Z A;  4IN0 A;  3N5O A;  4HZ2 A;  3UBL A;  2CZ2 A;  1GSS A;  1O7U A;  1S3C A;  4RI6 A;  2YV7 A;  1FVK A;  4FIW A;  1PSQ A;  2TRC P;  4OD7 A;  4D73 B;  3CRU A;  1SD9 A;  4FYB A;  1SYX A;  4XTS A;  4CW9 A;  2WFC A;  6GST A;  4WBR D;  2H0G A;  4GRF A;  2H0I A;  2VCX A;  1V98 A;  2LRC A;  1YKC A;  1JLW A;  4TRX A;  2CV4 A;  3HCZ A;  4TXO B;  4TXV A;  5JWR B;  3VFI A;  2AV4 A;  1A0R P;  1U88 A;  1Z5Y E;  3LSZ A;  2RLI A;  2N5A A;  2JU5 A;  3IXR A;  2VD1 A;  2JSZ A;  2QKE A;  5FWG A;  3UJ1 A;  1H75 A;  1SL2 B;  2YNX A;  2HYX A;  4KUN A;  4D73 A;  1A2L A;  2PER A;  1T00 A;  2E7P A;  4GSS A;  4EDZ A;  2XPE A;  1ON4 A;  2A2R A;  4WF5 A;  5HFG A;  5D9T A;  3E0U A;  1K0C A;  1T1V A;  1YDK A;  1VF1 A;  4MCU A;  2FWG A;  4TXO A;  2E2M A;  3IPZ A;  3A2V A;  4MPF A;  5AIX A;  1BED A;  1TXX A;  4ILF A;  5IQY A;  2IME A;  4TKY A;  5DQS A;  2DJ1 A;  5IMC A;  3F63 A;  1ZYE A;  4KX4 A;  1SD8 A;  1A24 A;  2O89 A;  4O5R A;  5J9B A;  3F4R A;  3GA4 A;  3TRX A;  4N10 A;  3O76 A;  3IE3 A;  1X0R A;  5J5N A;  5L71 A;  2P5Q A;  1SK0 A;  1VGL A;  5D93 A;  4TR4 A;  4BVY A;  2RM5 A;  4AJ6 A;  1NW2 A;  1UC7 A;  3C8E A;  4AGS A;  4YQU A;  3FR3 A;  2BMX A;  1F6M C;  1YF1 A;  3H93 A;  4JR6 A;  3IDV A;  5CRH A;  2VL2 A;  3QFA C;  3J7Y b;  2A2S A;  1ERT A;  1PMT A;  2AHE A;  4XHM A;  2A4V A;  1GTI A;  4MK3 A;  4ZIJ A;  5ABR A;  2XC2 A;  4MH2 A;  1X9M B;  3BJ5 A;  3H79 A;  4XIH A;  2MMO A;  3FEU A;  3IK9 A;  3FZ9 A;  2CX4 A;  3TKR A;  2H1G A;  4FH8 A;  4X43 A;  1M0U A;  1T8E B;  2WB9 A;  2GLR A;  3ZVJ D;  2LUS A;  2PWJ A;  1N2A A;  1HYU A;  4BPY A;  2FA8 A;  3TKP A;  2YPM A;  1ACV A;  4HI7 A;  2D2Z A;  3BD2 A;  1ST9 A;  3KIJ A;  1TDI A;  4JED A;  1E2Y A;  5ECR B;  3VI5 A;  3F4S A;  3FYG A;  1KNG A;  3ME8 A;  4F0B A;  4RUV A;  4ZB8 A;  3EVI A;  2H73 A;  1LJR A;  4HOJ A;  4PGT A;  4AJ8 A;  5IOX A;  11GS A;  1VF2 A;  3L78 A;  4PNF A;  3QD9 A;  3U5R E;  1TU8 A;  4EUY A;  4GTU A;  2M72 A;  3D0Z A;  2Z9S A;  2CVD A;  1AUC A;  5IO2 A;  1SYR A;  2C3Q A;  1V40 A;  5DVB A;  5F0G A;  2JAC A;  4Q5F A;  2I9H A;  2LRN A;  1GUK A;  6GSX A;  3D21 A;  2IL3 A;  5D9W A;  3HKR A;  1V57 A;  1B9Y C;  5KN3 A;  1B48 A;  4ZBD A;  3HA9 A;  3VUR A;  2I81 A;  5D96 A;  3F9U A;  4IW9 A;  4F82 A;  1K3L A;  2VAF A;  2DC5 A;  4GSN A;  2ON5 A;  4PQI A;  4GXZ A;  4OO4 A;  2KP1 A;  3EUR A;  1GTB A;  2H74 A;  1X9S B;  3QMX A;  1FHE A;  1M7T A;  3ISO A;  1MTC A;  3VWU A;  2CX3 A;  5KEJ A;  5H5S A;  1WE0 A;  1SL0 B;  3LWA A;  2VCT A;  4GLT A;  3FZ4 A;  1U3I A;  4KGI A;  2YCD A;  4I97 A;  3K8N A;  3P7X A;  2V2G A;  3DVX A;  3P8W A;  4LMW A;  4K7O A;  5ID2 B;  3UVH A;  2G2Q A;  2X64 A;  1TTZ A;  3TGZ A;  2LST A;  1KBN A;  5AIS A;  1DBY A;  1O8W A;  4KAE A;  4ML1 A;  5CAX A;  2DJK A;  1GSE A;  3FRC A;  5G5F A;  1N8J A;  3DYR A;  4EL1 A;  1MD4 A;  5ECI B;  3KMN A;  5GZZ B;  4F2I A;  1TI1 A;  1FAA A;  3AY8 A;  1XOB A;  2DJ2 A;  3I9V 2;  4HU7 A;  1FW1 A;  1MDI A;  2H01 A;  3G9B A;  5ID2 A;  2GT6 A;  3BOA A;  3KGK A;  4NHW A;  3RBT A;  4IHU A;  4NAX A;  3F3R A;  3EMX A;  3HD5 A;  3CXG A;  4FYC A;  2H75 A;  2CAI A;  3TKQ A;  5EVO A;  4ZIL A;  1B4P A;  5IPH A;  2OBK A;  1T7P B;  4O32 A;  5DAK B;  1ZZY A;  4IKH A;  3MDK A;  1PQN A;  2NDO A;  4K9Z A;  2DLX A;  1BG5 A;  4EKZ A;  4ID0 A;  9GSS A;  1K0M A;  4F0C A;  3HZ4 A;  4P3Y B;  1DUG A;  3MAK A;  2WS2 A;  1B4Q A;  1SU9 A;  1JFU A;  4ZL9 A;  1UVZ A;  1JLV A;  4MF5 A;  2OAD A;  4DEJ A;  4BL7 A;  4V1A p;  1GSQ A;  2L5O A;  3FZ5 A;  4Q5Q A;  3C1S A;  4I2T A;  1S3D A;  3VWX A;  2N5B A;  3GUR A;  1AW9 A;  1Z6N A;  5DAK A;  3US3 A;  2H6X A;  1XBS A;  1KTE A;  2MYG A;  3GFK A;  3RAZ A;  4V1A g;  4HDE A;  1T4Z A;  3LFL A;  1PX6 A;  1GWC A;  2VL3 A;  5G30 A;  1J9B A;  2VD0 A;  2FWF A;  4PUF C;  5C04 A;  3NIV A;  3GH9 A;  5COH A;  5ECO B;  3LYP A;  4XS6 A;  1G0T A;  2LNT A;  4NV5 A;  3GL3 A;  4MJC A;  1C72 A;  2JAD A;  2CVK A;  1A0F A;  1JHB A;  5IPG A;  4JRR A;  1A2J A;  2LJA A;  1G7E A;  1MDK A;  2B1L A;  3DIE A;  4DVC A;  4ZBA A;  4IS0 A;  1UN2 A;  5G2Z A;  1AIU A;  4H86 A;  1GRX A;  2TIR A;  3UVT A;  2LRT A;  2O7K A;  1CQG A;  4I5Q A;  2NPB A;  2DJ3 A;  4POB A;  4X0X A;  4XCS A;  2K18 A;  3P2A A;  4G10 A;  2GDR A;  3H4K A;  2C0E A;  4EVM A;  1O6J A;  2CAQ A;  2DJJ A;  8GSS A;  3I6A A;  1RW1 A;  2GZZ A;  4K7N A;  2C0F A;  3R2Q A;  1BQ7 A;  4ISD A;  1M9B A;  2DML A;  4KB3 A;  1BJX A;  3ERG A;  4MDC A;  2V41 A;  1XFL A;  1GLQ A;  3HVS A;  1OKT A;  3TOT A;  2CVB A;  5AN1 A;  2OKA A;  1Z6M A;  4KW6 A;  4WXT A;  1XWG A;  1YJ6 A;  1SKS B;  1ABA A;  3VK9 A;  3C1R A;  4BVX A;  5KN2 A;  4OMV A;  5IM9 A;  5DCG A;  4NWY A;  2DBC A;  3SBC A;  2DSA A;  4RI7 A;  1QQ2 A;  3WT2 A;  4I8B A;  2NBS A;  2R37 A;  3EU4 A;  1XOA A;  3H8Q A;  2B3S A;  2OJL A;  2RUF A;  4BA7 A;  1DE2 A;  3M9K A;  1XW5 A;  2DIY A;  4RQX A;  3HY2 A;  1GUL A;  5F05 A;  3VLN A;  4MPG A;  4TR1 B;  2I3Y A;  2DJ0 A;  1EWX A;  5D9V A;  2F8A A;  3L4N A;  5J41 A;  4WBJ A;  4JR4 A;  1ZGN A;  5IMD A;  5IMF A;  3D6I A;  2PU9 C;  1WOU A;  2L6C A;  1GSD A;  2E2G A;  3IAM 2;  3TKS C;  2YWI A;  4O92 A;  2H0H A;  3FY7 A;  2FWE A;  3IRA A;  4IJI A;  3IK7 A;  3HJP A;  3E3E A;  2CZ3 A;  1AQW A;  3L9U A;  1K3Y A;  2FCH A;  1I9D A;  2L59 A;  2O8V B;  5HR2 A;  4ML6 A;  1PRX A;  5IMZ A;  1EGO A;  3P90 A;  4KH7 A;  4TR1 A;  1X5E A;  3DVW A;  1JZR A;  4K8M A;  1EEJ A;  1XVW A;  1SJ6 A;  4GWR A;  4K0G A;  5E4W A;  3CTG A;  1WJK A;  2LJK A;  3QPM A;  5F8B A;  2DMM A;  3Q18 A;  5A4W A;  2FWH A;  3CSH A;  3CSJ A;  4N0Z A;  3WGE A;  6GSU A;  3APQ A;  1LU4 A;  3ME7 A;  1FO5 A;  5IIZ A;  2MMA A;  4POK A;  2HT9 A;  3VPT A;  2FA4 A;  2IJY A;  1SEN A;  2NTO A;  2F8F A;  4XRD A;  3HZ8 A;  4XRA A;  1EV9 A;  3ZFL A;  2OE1 A;  4IP1 A;  2L5L A;  3VWW A;  3DXB A;  1Y25 A;  3N9J A;  1A2M A;  3ZIT A;  1V58 A;  1M2D A;  3TJJ A;  3EYT A;  3MWH A;  1UA5 A;  12GS A;  3D4T A;  4K7I A;  1SKW B;  2X8C A;  3GKX A;  1M99 A;  17GS A;  5A4U A;  5HFK A;  1ZYQ B;  4MF6 A;  3LXZ A;  5IOW A;  3ZTL A;  5A4V A;  1RQM A;  2FNO A;  4MF7 A;  2F3M A;  2OE3 A;  1EZK A;  2L4C A;  1TKD B;  2B5X A;  1K3O A;  1J0F A;  1OKD A;  1B9X C;  4K6X A;  1NSW A;  1OYJ A;  2R6K A;  1PD2 1;  2BJX A;  4IGJ A;  4PNG A;  5ECP B;  3TOU A;  3DML A;  3TRP A;  3ZL5 A;  5C00 A;  4MP4 A;  3ZRE A;  2M46 A;  2LJR A;  3WD6 A;  5HR0 A;  1XZO A;  3L9S A;  3PR8 A;  2IMD A;  2EIO A;  3KZQ A;  5CRW A;  3TB2 A;  3EMP A;  1WIK A;  1PGT A;  4GQC A;  1AQV A;  4BWQ A;  4CHS A;  4DSR A;  4ECB A;  3GKK A;  4TW5 A;  3NOF A;  2GTU A;  5EPF A;  3KEB A;  2H19 A;  2WUL A;  4NXI A;  1X5D A;  1THX A;  4E8H A;  3A5W A;  1XWB A;  2K8S A;  3VWV A;  2R5G A;  2MMZ A;  1B8X A;  1O81 A;  4HJ2 A;  1EOH A;  2YJ7 A;  1GNW A;  3F3Q A;  4EDY A;  3TUE A;  3M3M A;  2P0G A;  5DCH A;  1GP1 A;  2L6D A;  2LEG A;  3D4M A;  3ZZX A;  3H1N A;  2XBI A;  2PMT A;  5D8I A;  3M0F A;  4X1U A;  2CQ9 A;  2O87 A;  3QAG A;  5F06 A;  1MEK A;  2VLV A;  4KND A;  4L8E A;  3RPP A;  1JZO A;  5G5E A;  2PUK C;  3GST A;  3TJK A;  2I1U A;  1XXU A;  3ZYW A;  2IPA A;  2RUE A;  5A5K A;  3GN3 A;  2XHF A;  3TJB A;  3I69 A;  2MBT A;  4OFM A;  3C73 A;  1K0A A;  4WKW A;  2J23 A;  2FY6 A;  3GYK A;  4TR0 A;  4OFT A;  5J4U A;  2JSY A;  3GX8 A;  2H6Y A;  2I4A A;  3WGX A;  4IP6 A;  1Z7R A;  3LJR A;  3HVX A;  4NMU A;  4L0U A;  3TJG A;  4FYU A;  4J2F A;  2C3T A;  2C3N A;  1YEX A;  2KP2 A;  1A8L A;  3DD3 A;  2H70 A;  4KCA A;  1O85 A;  1ERW A;  3I43 A;  1BX9 A;  1W4V A;  3KCM A;  2N5F A;  2ALB A;  1O8X A;  1ERV A;  7GSS A;  3GNJ A;  1VF4 A;  3PIN A;  1F9M A;  2K8V A;  1XWA A;  4EO3 A;  2H1A A;  3GH6 A;  3C71 A;  3CBU A;  2M80 A;  1GL8 A;  1LBK A;  4K0N A;  2B5E A;  1HNB A;  1GSF A;  3EWL A;  4WF4 A;  4KE3 A;  3HJO A;  1WP0 A;  3D22 A;  1Z7P A;  2WZ9 A;  1PKW A;  1YF0 A;  3RHB A;  4ZXG A;  1THO A;  3RHC A;  3GMF A;  4HU9 A;  4QQ7 A;  4L0W A;  2FUG 2;  2IWT A;  2H71 A;  3KJY A;  1JZW A;  5DJL A;  4HS1 A;  1PA3 A;  3CYN A;  6GSS A;  3IV4 A;  1XW6 A;  2EC4 A;  2GZY A;  4XS1 A;  5KN1 A;  4JBB A;  1G6Y A;  1XPV A;  1PX7 A;  1GSU A;  5CRG A;  1FB6 A;  4G19 A;  5ELA A;  2R2J A;  4YAP A;  2G0F A;  1NHY A;  1R5A A;  5B8A A;  2YZH A;  3UBK A;  2O85 A;  5IO0 A;  5GAP D;  4ZBB A;  2C1Y A;  2LNS A;  1Y6E A;  2HRF A;  2V6O A;  4Q5N A;  3V1W A;  4PQ1 A;  2AUV A;  4DSQ A;  2HNL A;  5AGY A;  3LQ7 A;  1U6T A;  2VCZ A;  4L5O A;  2WGR A;  1MDJ A;  3ZRD A;  5J9C A;  1SK1 A;  2IN3 A;  5CRD A;  1EV4 A;  4EE0 A;  5DJM A;  3GSS A;  2LQQ A;  2X99 A;  4OCF A;  2H66 A;  2GZP A;  2YOI A;  3HXS A;  3KTL A;  4AF2 A;  3HHV A;  1V2A A;  1OE8 A;  2OAC A;  2WJU A;  4N11 A;  3Q6O A;  2K9F A;  5INY A;  1A23 A;  2IFQ B;  1ZL9 A;  1PN9 A;  4EF0 A;  1F3A A;  3QAV A;  3KP8 A;  3ZIV A;  2YJH A;  1PL2 A;  1OC3 A;  1X5C A;  1DE1 A;  2VOC A;  1GTU A;  5ECK B;  5B6M A;  5G31 A;  4MLY A;  3QCP A;  2ON7 A;  3RDW A;  1XIY A;  2VIM A;  3NZN A;  5CP1 A;  4TR3 A;  5DAL B;  1OC9 B;  1QFN A;  1M9A A;  1AC1 A;  1TOF A;  1K0N A;  5J3R A;  1U87 A;  2VL2 C;  1BAY A;  2IFQ A;  1TJD A;  2L4Q A;  5CO3 A;  2AB6 A;  1FG4 A;  2VO4 A;  4YQV A;  1CQH A;  1FVJ A;  4NV2 A;  3WYW A;  3F6D A;  2HSY A;  3L9V A;  3CTF A;  1V9W A;  3ZML A;  3RPN A;  1Q98 A;  3UL3 A;  4MA9 A;  1MD3 A;  2B7J A;  5IMA A;  3FR9 A;  1TRU A;  4G9H A;  3F4T A;  5DAL A;  5EY6 A;  5G1K A;  2VM1 A;  1OC9 A;  2YZU A;  1FOV A;  4IBP A;  3G7Y A;  2J9H A;  2VM2 A;  1WWJ A;  1EP8 A;  1XVQ A;  4YH2 A;  5F07 A;  1HQO A;  2H1D A;  3UIW A;  1EGR A;  2XPD A;  2PGT A;  4G2E A;  4HQZ A;  3E9J B;  3TDG A;  2CT6 A;  1ERU A;  3GIX A;  3GUS A;  1TI3 A;  2MZC A;  1VRS D;  1SK2 A;  4PUA A;  2AYT A;  2HZE B;  4ECC A;  1OVN A;  4PUR A;  4ECJ A;  2GSS A;  5E59 A;  2WCI A;  2AJQ B;  4I2U A;  4JE1 A;  4HZ4 A;  3LYK A;  4KDX A;  3ERW A;  3GKN A;  1F2E A;  3DWV A;  4V2M A;  1HD2 A;  5JWO B;  2ZCT A;  4POM A;  4ZL8 A;  4GCI A;  2F9S A;  2YV9 A;  2NVL A;  5DDL A;  3WT1 A;  3VPQ A;  3CRT A;  2E0Q A;  2H76 A;  2B1K A;  5ECH B;  2GVP A;  4WET A;  1TRV A;  4GQF A;  2HI7 A;  3F6F A;  2HZE A;  1A8Y A;  1TU7 A;  3LOR A;  1WMJ A;  4K2D A;  3QAW A;  1YZX A;  14GS A;  1HNA A;  1NM3 A;  5ECN B;  4POL A;  2VL9 A;  2GGT A;  1R4W A;  2OBI A;  2YAN A;  3C7M A;  2B7K A;  4DSS B;  3ZVJ A;  5KN0 A;  3KH7 A;  1EP7 A;  1Z9H A;  3IR4 A;  4BWS A;  4TN8 A;  4TOP A;  4QL7 A;  5ELG A;  1WRY A;  1JZD A;  1ZCP A;  3QDN A;  3W8S A;  20GS A;  2PPT A;  3KMO A;  2H72 A;  4YQM A;  5EL8 A;  5B8B A;  2REM A;  3IHQ A;  4RQR A;  5ECS A;  5LCZ A;  3IBH A;  3TCO A;  1S3A A;  2YWO A;  4MZC A;  2WRT A;  2F51 A;  5ECM B;  3LEF A;  3SWL A;  4IEL A;  2VCW A;  4V2L A;  4DSS A;  3KP9 A;  1QMV A;  2BTO T;  2HRN A;  3TRQ A;  4HEA 2;  1QUW A;  2MBS A;  3LXT A;  2MMN A;  4ZB6 A;  3OR5 A;  1XW9 A;  2GSR A;  1BYE A;  5D73 A;  4OWY A;  2TRX A;  3U6V A;  2V1M A;  4IVF A;  3ZLP A;  4LL1 B;  2HZF A;  4OFN A;  3CMI A;  1FB0 A;  3F8U A;  1EOG A;  4PXO A;  1YKA A;  3GHA A;  4GF0 A;  3FR6 A;  1RK4 A;  3APO A;  5CNW A;  2VCV A;  4OO5 A;  3HYP A;  4MJB A;  4EC0 A;  3KXO A;  2IMI A;  2L57 A;  5ENU A;  3BBY A;  3FK8 A;  3TKS E;  2H6Z A;  1TW9 A;  2OA7 A;  2C80 A;  1IYI A;  3UAP A;  2YN1 A;  1R26 A;  3KM6 A;  5JWQ B;  4WR5 A;  4EXJ A;  1GSY A;  1QXH A;  1TRW A;  2KUC A;  4LMV A;  5HQP A;  1ZOF A;  3FKF A;  4O7H A;  3LGC A;  1KEB A;  4ZL7 A;  2EIR A;  2IMK A;  3A2X A;  3KH9 A; 
#chains in the Genus database with same CATH topology
 3TKS A;  4PQH A;  3Q19 A;  2FD3 A;  5FHI A;  3O6T A;  4CDO A;  1R5P A;  1Z3E A;  3GRX A;  4L5L A;  3KD0 A;  3MYD A;  4CY8 A;  1F3B A;  2GT5 A;  2C0G A;  2LS5 A;  3UEM A;  3APS A;  1QGV A;  4LL4 B;  5H5R A;  2H8L A;  2VCQ A;  4LA1 A;  4XS4 B;  4V2N A;  1TP9 A;  3G7I A;  3WGD A;  4NHZ A;  3EC3 A;  2PN8 A;  1PKZ A;  2GQM A;  4I6X A;  4MJE A;  4F03 A;  4WEY A;  2C4J A;  1IYH A;  1K0D A;  2QSI A;  5JCG A;  3GX0 A;  5DQY A;  3CSI A;  4KCE A;  1USB A;  5LNK e;  3QFB C;  4IQA A;  1YY7 A;  2DIZ A;  3A3T A;  1TK8 B;  5AIV A;  4ZB9 A;  1EEM A;  5LD0 A;  1T4Y A;  19GS A;  3GV1 A;  3ZMK A;  2V32 A;  10GS A;  4XS4 A;  1XCC A;  2HE3 A;  2IIY A;  3IAS 2;  5JCW A;  1VF3 A;  1OC8 A;  2H1B A;  3UMA A;  6GSW A;  1YEP A;  1ILO A;  2LQO A;  1ZMA A;  18GS A;  4JU5 A;  4Q5R A;  1GNE A;  1AQX A;  3HVV A;  4K1F A;  3DGQ A;  3TJF A;  3IC4 A;  4JZQ A;  3QR6 A;  2P31 A;  1ML6 A;  3JCM L;  5HFI A;  2KLX A;  2RM6 A;  2AAW A;  3ED3 A;  2VUP A;  3BCI A;  4YAV A;  4WR4 A;  2HSH A;  4IQ1 A;  1SJZ A;  1HNC A;  5B7C A;  2EIQ A;  2X8H A;  2VLU A;  4MAB A;  2JL4 A;  6GSY A;  3EU3 A;  1TRS A;  4N30 A;  5GST A;  3DRN A;  3LG6 A;  3VI7 A;  1G6W A;  2CA8 A;  2GSQ A;  4IJ3 A;  4PX1 A;  2V6K A;  1R7H A;  1W89 A;  2LV3 A;  2XBQ A;  3HJM A;  3KTB A;  5GAN D;  3M1G A;  4G0K A;  3QOU A;  2HFD A;  3M8N A;  2R3X A;  3ZIJ A;  4TVE A;  3ERF A;  4E8E A;  4ECI A;  4KSO A;  2FGX A;  3UAR A;  1TK5 B;  4KDU A;  3O3T A;  2C0D A;  2X8G A;  4FO5 A;  2JZT A;  1PL1 A;  6GSV A;  1SJI A;  4KSM A;  2PBJ A;  2GQK A;  4ULX A;  2IMF A;  2B5Y A;  5HR1 A;  2ES7 A;  2FHE A;  3F0I A;  3HDC A;  1TK0 B;  1GUH A;  1U3A A;  4HQS A;  4NPB A;  1QK8 A;  3UOM A;  1T3B A;  2R4V A;  13GS A;  5IMV A;  3Q74 A;  2PVQ A;  4J56 E;  3BCK A;  1J08 A;  4ICY A;  1M2B A;  2LTK A;  5HR3 A;  1I5G A;  3PGT A;  1OE7 A;  3EE2 A;  2YP6 A;  3DEX A;  3ZFB A;  3EIN A;  5B6N A;  1K0B A;  5CRE A;  1G7O A;  1SL1 B;  4KDY A;  1GTA A;  1AAZ A;  2H30 A;  1XWK A;  2KHP A;  2KOK A;  1AXD A;  1NHO A;  1WPI A;  4HJM A;  2JZS A;  2PVO C;  2ZUP A;  5GSS A;  3IA1 A;  2QA1 A;  3W6G A;  1O73 A;  2GST A;  2OE0 A;  2YWM A;  3GTU B;  2X49 A;  2ZNM A;  2FLS A;  2C8U A;  3G7J A;  3A2W A;  2A2P A;  3IOS A;  4GST A;  3GL5 A;  4J57 E;  4FQU A;  5ECQ B;  3FW2 A;  1X9W B;  1K0O A;  4MZB A;  3PH9 A;  1M2A A;  4OCE A;  1H4O A;  3W8J A;  1SKR B;  2QC7 A;  4MJA A;  4ACS A;  3D5J A;  4QL9 A;  2WDU A;  3S9F A;  3FHK A;  1XWC A;  2K6V A;  4MMM A;  22GS A;  2GS3 A;  3FZA A;  5ECL B;  3L0H A;  5FT3 A;  3MSZ A;  2JZR A;  3GTU A;  2QGV A;  2VLT A;  3J7Y k;  16GS A;  5G1L A;  1F37 A;  1YQ1 A;  3IC8 A;  4N0V A;  1DSB A;  2GQL A;  2P5R A;  3DKS A;  2YWN A;  3MNG A;  4HUA A;  2HLS A;  5CYY A;  5D9X A;  3M9J A;  2LKU A;  1OAZ A;  4LLR A;  1URM A;  3GKM A;  1E6B A;  1Q4J A;  2R0P A;  1GLP A;  2HXK A;  1GUM A;  4KA0 A;  5H5Q A;  2RII A;  5JCU A;  1GH2 A;  5DBQ A;  4MZW A;  2B6M A;  4Z7X A;  4MH3 A;  4AJ7 A;  4F9Z A;  4IN0 A;  3N5O A;  4HZ2 A;  3UBL A;  2CZ2 A;  1GSS A;  1O7U A;  1S3C A;  4RI6 A;  2YV7 A;  1FVK A;  4FIW A;  1PSQ A;  2TRC P;  4OD7 A;  4D73 B;  3CRU A;  1SD9 A;  4FYB A;  3FMW A;  1SYX A;  4XTS A;  4CW9 A;  2WFC A;  6GST A;  4WBR D;  2H0G A;  4GRF A;  2H0I A;  2VCX A;  1V98 A;  2LRC A;  1YKC A;  1JLW A;  4TRX A;  2CV4 A;  3HCZ A;  4TXO B;  4TXV A;  5JWR B;  3VFI A;  2AV4 A;  1A0R P;  1U88 A;  1Z5Y E;  3LSZ A;  2RLI A;  2N5A A;  2JU5 A;  3IXR A;  2VD1 A;  2JSZ A;  2QKE A;  5FWG A;  3UJ1 A;  1H75 A;  1SL2 B;  2YNX A;  2HYX A;  4KUN A;  4D73 A;  1A2L A;  2PER A;  1T00 A;  2E7P A;  4GSS A;  4EDZ A;  2XPE A;  1ON4 A;  4BVY B;  4CY6 A;  2A2R A;  4WF5 A;  5HFG A;  5D9T A;  3E0U A;  1K0C A;  1T1V A;  1YDK A;  1VF1 A;  4MCU A;  2FWG A;  4TXO A;  2E2M A;  3IPZ A;  3A2V A;  4MPF A;  5AIX A;  1BED A;  1TXX A;  4ILF A;  5IQY A;  2IME A;  4TKY A;  5DQS A;  2DJ1 A;  5IMC A;  3F63 A;  1ZYE A;  4KX4 A;  1SD8 A;  1A24 A;  2O89 A;  4O5R A;  5J9B A;  3F4R A;  3GA4 A;  3TRX A;  4N10 A;  3O76 A;  3IE3 A;  1X0R A;  5J5N A;  5L71 A;  2P5Q A;  1SK0 A;  1VGL A;  5D93 A;  4TR4 A;  4BVY A;  2RM5 A;  4AJ6 A;  1NW2 A;  1UC7 A;  3C8E A;  4AGS A;  4YQU A;  2DKH A;  3FR3 A;  2BMX A;  1F6M C;  1YF1 A;  3H93 A;  4Z2U A;  4JR6 A;  3IDV A;  5CRH A;  2VL2 A;  3MIX A;  3QFA C;  3J7Y b;  2A2S A;  1ERT A;  1PMT A;  2AHE A;  4XHM A;  2A4V A;  5KOX A;  1GTI A;  4MK3 A;  4EIQ A;  4ZIJ A;  5ABR A;  2XC2 A;  4MH2 A;  4PTS A;  1X9M B;  3BJ5 A;  3H79 A;  4XIH A;  2MMO A;  3FEU A;  3IK9 A;  3FZ9 A;  2CX4 A;  3TKR A;  2H1G A;  4FH8 A;  4X43 A;  1M0U A;  1T8E B;  2WB9 A;  2GLR A;  3ZVJ D;  2LUS A;  2PWJ A;  1N2A A;  1HYU A;  4BPY A;  2FA8 A;  3TKP A;  2YPM A;  1ACV A;  4HI7 A;  2D2Z A;  3BD2 A;  1ST9 A;  3KIJ A;  1TDI A;  2R0G A;  4Z2R A;  4JED A;  1E2Y A;  5ECR B;  3VI5 A;  3F4S A;  3FYG A;  1KNG A;  3ME8 A;  4F0B A;  4RUV A;  4ZB8 A;  3EVI A;  2H73 A;  1LJR A;  4HOJ A;  4PGT A;  4AJ8 A;  5IOX A;  11GS A;  1VF2 A;  3L78 A;  4PNF A;  3QD9 A;  3U5R E;  1TU8 A;  4EUY A;  4GTU A;  2M72 A;  3D0Z A;  2Z9S A;  2CVD A;  1AUC A;  4K5S A;  5IO2 A;  1SYR A;  2C3Q A;  1V40 A;  5DVB A;  5F0G A;  2JAC A;  4Q5F A;  2I9H A;  2LRN A;  1GUK A;  6GSX A;  3D21 A;  2IL3 A;  5D9W A;  3HKR A;  1V57 A;  1B9Y C;  5KN3 A;  4K5R A;  1B48 A;  2HRK A;  4ZBD A;  3HA9 A;  3VUR A;  2I81 A;  5D96 A;  3F9U A;  4IW9 A;  4KF9 A;  4F82 A;  1K3L A;  2VAF A;  2DC5 A;  4GSN A;  2ON5 A;  4PQI A;  4GXZ A;  4OO4 A;  2KP1 A;  3EUR A;  1GTB A;  2H74 A;  1X9S B;  3QMX A;  1FHE A;  1M7T A;  3ISO A;  1MTC A;  3VWU A;  2CX3 A;  5KEJ A;  5H5S A;  1WE0 A;  1SL0 B;  2A4H A;  3LWA A;  2VCT A;  1PN0 A;  4GLT A;  3FZ4 A;  1U3I A;  4KGI A;  2YCD A;  4I97 A;  3K8N A;  3P7X A;  2V2G A;  1M3J A;  3DVX A;  3P8W A;  4LMW A;  4K7O A;  5ID2 B;  3UVH A;  2G2Q A;  2X64 A;  1TTZ A;  3TGZ A;  2LST A;  1KBN A;  5AIS A;  1DBY A;  1O8W A;  4KAE A;  4Z2T A;  4ML1 A;  5CAX A;  2DJK A;  1GSE A;  3FRC A;  5G5F A;  1N8J A;  3DYR A;  4EL1 A;  1MD4 A;  5ECI B;  3KMN A;  5GZZ B;  4F2I A;  1TI1 A;  1FAA A;  3AY8 A;  1XOB A;  2DJ2 A;  3I9V 2;  4HU7 A;  1FW1 A;  1MDI A;  2H01 A;  3G9B A;  5ID2 A;  2GT6 A;  3BOA A;  3KGK A;  4NHW A;  3RBT A;  4IHU A;  4NAX A;  3F3R A;  3EMX A;  3HD5 A;  3CXG A;  4FYC A;  2H75 A;  2CAI A;  3TKQ A;  5EVO A;  4BL7 B;  4ZIL A;  1B4P A;  5IPH A;  2OBK A;  1T7P B;  4O32 A;  5DAK B;  1ZZY A;  4IKH A;  4G0I A;  3MDK A;  1PQN A;  2NDO A;  4K9Z A;  2DLX A;  1BG5 A;  3R3E A;  4EKZ A;  4ID0 A;  9GSS A;  1K0M A;  4F0C A;  3HZ4 A;  4P3Y B;  1DUG A;  3MAK A;  2WS2 A;  1B4Q A;  1SU9 A;  1JFU A;  4ZL9 A;  1UVZ A;  1JLV A;  4MF5 A;  2OAD A;  4DEJ A;  4BL7 A;  4V1A p;  1GSQ A;  2L5O A;  3FZ5 A;  4Q5Q A;  3C1S A;  4I2T A;  1S3D A;  3VWX A;  2N5B A;  3GUR A;  1AW9 A;  1Z6N A;  5DAK A;  3US3 A;  2H6X A;  5BMU A;  1XBS A;  4K2X A;  1KTE A;  2MYG A;  3GFK A;  3RAZ A;  4V1A g;  4HDE A;  1T4Z A;  3LFL A;  1PX6 A;  1GWC A;  2VL3 A;  5G30 A;  1J9B A;  2VD0 A;  2FWF A;  4PUF C;  5C04 A;  3NIV A;  3GH9 A;  5COH A;  5ECO B;  3LYP A;  4XS6 A;  1G0T A;  2LNT A;  4NV5 A;  3GL3 A;  4MJC A;  1C72 A;  2JAD A;  2CVK A;  1A0F A;  1JHB A;  5IPG A;  4JRR A;  1A2J A;  2LJA A;  1G7E A;  1MDK A;  2B1L A;  1ZYN A;  3DIE A;  4DVC A;  4ZBA A;  4IS0 A;  1UN2 A;  5G2Z A;  1AIU A;  4H86 A;  1GRX A;  2TIR A;  3UVT A;  2LRT A;  2O7K A;  1CQG A;  4I5Q A;  2NPB A;  2DJ3 A;  4POB A;  4X0X A;  4XCS A;  2K18 A;  3P2A A;  4G10 A;  2GDR A;  3H4K A;  2C0E A;  4EVM A;  1O6J A;  2CAQ A;  2DJJ A;  4BVX B;  8GSS A;  3I6A A;  1RW1 A;  2GZZ A;  4K7N A;  2C0F A;  3R2Q A;  1BQ7 A;  4ISD A;  1M9B A;  2DML A;  4KB3 A;  1BJX A;  3ERG A;  4MDC A;  2V41 A;  1XFL A;  1GLQ A;  3HVS A;  4EIP A;  1OKT A;  3TOT A;  2CVB A;  5AN1 A;  2OKA A;  1Z6M A;  4KW6 A;  4WXT A;  1XWG A;  1YJ6 A;  5BRT A;  1SKS B;  1ABA A;  3VK9 A;  3C1R A;  4BVX A;  2X4A A;  3PPU A;  5KN2 A;  4OMV A;  5IM9 A;  5DCG A;  4NWY A;  2DBC A;  3SBC A;  2DSA A;  4RI7 A;  1QQ2 A;  3WT2 A;  4I8B A;  2NBS A;  2R37 A;  3EU4 A;  1XOA A;  1XG8 A;  3H8Q A;  4O5U A;  2B3S A;  3IHG A;  2OJL A;  2RUF A;  4BA7 A;  1DE2 A;  3M9K A;  1XW5 A;  2DIY A;  4RQX A;  3HY2 A;  1GUL A;  5F05 A;  3VLN A;  4MPG A;  4TR1 B;  2I3Y A;  2DJ0 A;  1EWX A;  5D9V A;  2F8A A;  3L4N A;  5J41 A;  4WBJ A;  4JR4 A;  1ZGN A;  5IMD A;  5IMF A;  3D6I A;  2PU9 C;  1WOU A;  2L6C A;  1GSD A;  2E2G A;  3IAM 2;  3TKS C;  2YWI A;  4O92 A;  2H0H A;  3FY7 A;  2FWE A;  3IRA A;  4IJI A;  3IK7 A;  3HJP A;  3E3E A;  2CZ3 A;  1AQW A;  3L9U A;  1K3Y A;  2FCH A;  1I9D A;  2L59 A;  2O8V B;  5HR2 A;  4ML6 A;  1PRX A;  5IMZ A;  1EGO A;  3P90 A;  4KH7 A;  4TR1 A;  1X5E A;  3DVW A;  1JZR A;  4K8M A;  1EEJ A;  1XVW A;  1SJ6 A;  4GWR A;  4K0G A;  5E4W A;  3CTG A;  1WJK A;  2LJK A;  3QPM A;  5F8B A;  2DMM A;  3Q18 A;  5A4W A;  2FWH A;  3CSH A;  3CSJ A;  4N0Z A;  3WGE A;  6GSU A;  3APQ A;  1LU4 A;  3ME7 A;  1FO5 A;  5IIZ A;  2MMA A;  4POK A;  4YKG A;  2HT9 A;  3VPT A;  2FA4 A;  2IJY A;  1SEN A;  2NTO A;  2F8F A;  4XRD A;  3HZ8 A;  4XRA A;  1EV9 A;  3ZFL A;  2OE1 A;  4IP1 A;  2L5L A;  3VWW A;  3DXB A;  1Y25 A;  3N9J A;  1A2M A;  3ZIT A;  1V58 A;  1M2D A;  3TJJ A;  3EYT A;  3MWH A;  1UA5 A;  12GS A;  3D4T A;  1ZYP A;  4K7I A;  1SKW B;  2X8C A;  3GKX A;  1M99 A;  17GS A;  5A4U A;  5HFK A;  1ZYQ B;  4MF6 A;  3LXZ A;  5IOW A;  3ZTL A;  5A4V A;  1RQM A;  4X4J A;  2FNO A;  4MF7 A;  2F3M A;  2OE3 A;  1EZK A;  2L4C A;  1TKD B;  2B5X A;  1K3O A;  1J0F A;  1OKD A;  1B9X C;  4K6X A;  1NSW A;  1OYJ A;  2R6K A;  1PD2 1;  2BJX A;  4IGJ A;  4PNG A;  5ECP B;  3TOU A;  3DML A;  3TRP A;  3ZL5 A;  5C00 A;  4MP4 A;  3ZRE A;  2M46 A;  2LJR A;  3WD6 A;  5HR0 A;  1XZO A;  3L9S A;  3PR8 A;  2IMD A;  2EIO A;  3KZQ A;  5CRW A;  3TB2 A;  3EMP A;  1WIK A;  1PGT A;  4GQC A;  1AQV A;  4BWQ A;  4CHS A;  4DSR A;  4ECB A;  3GKK A;  4TW5 A;  3NOF A;  2GTU A;  5EPF A;  3KEB A;  2H19 A;  2WUL A;  4NXI A;  1X5D A;  1THX A;  4E8H A;  3A5W A;  1XWB A;  2K8S A;  3VWV A;  2R5G A;  2MMZ A;  1B8X A;  1O81 A;  4HJ2 A;  1EOH A;  2YJ7 A;  1GNW A;  3F3Q A;  4EDY A;  3TUE A;  3M3M A;  2P0G A;  4YKF A;  5DCH A;  1GP1 A;  2L6D A;  2LEG A;  3D4M A;  3ZZX A;  3H1N A;  2XBI A;  2PMT A;  5D8I A;  3M0F A;  4X1U A;  2CQ9 A;  2O87 A;  3QAG A;  5F06 A;  1MEK A;  2VLV A;  4KND A;  4L8E A;  3RPP A;  1JZO A;  5G5E A;  2PUK C;  3GST A;  3TJK A;  2I1U A;  1XXU A;  3ZYW A;  2IPA A;  2RUE A;  5A5K A;  3GN3 A;  2XHF A;  3TJB A;  3I69 A;  2MBT A;  4OFM A;  3C73 A;  1K0A A;  4WKW A;  2J23 A;  2FY6 A;  3GYK A;  4TR0 A;  4OFT A;  5J4U A;  2JSY A;  3GX8 A;  1FOH A;  2H6Y A;  2I4A A;  3WGX A;  4IP6 A;  1Z7R A;  3LJR A;  3HVX A;  4NMU A;  4L0U A;  3TJG A;  4FYU A;  4J2F A;  2C3T A;  2C3N A;  1YEX A;  2KP2 A;  1A8L A;  1S3R A;  3DD3 A;  2H70 A;  4KCA A;  1O85 A;  1ERW A;  3I43 A;  1BX9 A;  1W4V A;  3KCM A;  2N5F A;  2ALB A;  1O8X A;  1ERV A;  7GSS A;  3GNJ A;  1VF4 A;  3PIN A;  1F9M A;  2K8V A;  1XWA A;  4EO3 A;  2H1A A;  3GH6 A;  3C71 A;  3CBU A;  2M80 A;  1GL8 A;  1LBK A;  4K0N A;  2B5E A;  1HNB A;  1GSF A;  5KOW A;  3EWL A;  4WF4 A;  4KE3 A;  3HJO A;  1WP0 A;  2UZ8 A;  3D22 A;  1Z7P A;  2WZ9 A;  1PKW A;  1YF0 A;  3RHB A;  4ZXG A;  2R0C A;  1THO A;  3RHC A;  3GMF A;  4HU9 A;  4QQ7 A;  4L0W A;  2FUG 2;  2IWT A;  2H71 A;  3KJY A;  1JZW A;  5DJL A;  4HS1 A;  1PA3 A;  3CYN A;  6GSS A;  3IV4 A;  1XW6 A;  2EC4 A;  2GZY A;  4XS1 A;  5KN1 A;  4JBB A;  1G6Y A;  1XPV A;  1PX7 A;  1GSU A;  5CRG A;  1FB6 A;  4G19 A;  5ELA A;  2R2J A;  4YAP A;  4G0L A;  2G0F A;  1NHY A;  1R5A A;  5B8A A;  2HSM A;  2YZH A;  3UBK A;  2O85 A;  5IO0 A;  5GAP D;  4ZBB A;  2C1Y A;  2LNS A;  1Y6E A;  2HRF A;  2V6O A;  4Q5N A;  3V1W A;  4PQ1 A;  2AUV A;  4DSQ A;  2HNL A;  5AGY A;  3LQ7 A;  1U6T A;  2VCZ A;  4L5O A;  2WGR A;  1MDJ A;  3ZRD A;  5J9C A;  1SK1 A;  2IN3 A;  5CRD A;  1EV4 A;  4EE0 A;  5DJM A;  3GSS A;  2LQQ A;  2X99 A;  4OCF A;  2H66 A;  2GZP A;  2YOI A;  3HXS A;  3KTL A;  4AF2 A;  3HHV A;  1V2A A;  1OE8 A;  2DKI A;  2OAC A;  4N11 A;  2WJU A;  3Q6O A;  2K9F A;  5INY A;  1A23 A;  2IFQ B;  1ZL9 A;  1PN9 A;  4EF0 A;  1F3A A;  3QAV A;  3KP8 A;  3ZIV A;  2YJH A;  1PL2 A;  4HSC X;  1OC3 A;  1X5C A;  1DE1 A;  2VOC A;  1GTU A;  5ECK B;  5B6M A;  5G31 A;  4MLY A;  3QCP A;  2ON7 A;  2HRA A;  3RDW A;  1XIY A;  2VIM A;  3NZN A;  5CP1 A;  4TR3 A;  5DAL B;  4USS A;  1OC9 B;  1QFN A;  1M9A A;  1AC1 A;  1TOF A;  1K0N A;  5J3R A;  1U87 A;  2VL2 C;  1BAY A;  2IFQ A;  1TJD A;  2L4Q A;  5CO3 A;  2AB6 A;  1FG4 A;  2VO4 A;  4YQV A;  1CQH A;  1FVJ A;  4NV2 A;  3WYW A;  3F6D A;  2HSY A;  3L9V A;  3CTF A;  1V9W A;  3ZML A;  3RPN A;  1Q98 A;  3UL3 A;  4MA9 A;  1MD3 A;  2B7J A;  5IMA A;  3FR9 A;  1TRU A;  4G9H A;  2QA2 A;  3F4T A;  5DAL A;  5EY6 A;  5G1K A;  2VM1 A;  1OC9 A;  3CQF A;  2YZU A;  1FOV A;  4IBP A;  3G7Y A;  1M3I A;  2J9H A;  2VM2 A;  4MNN A;  1WWJ A;  1EP8 A;  1XVQ A;  1PFO A;  4YH2 A;  5F07 A;  1HQO A;  2H1D A;  3UIW A;  1EGR A;  2XPD A;  2PGT A;  4G2E A;  4HQZ A;  3E9J B;  3TDG A;  2CT6 A;  1ERU A;  3GIX A;  3GUS A;  1TI3 A;  2MZC A;  1VRS D;  1SK2 A;  4PUA A;  2AYT A;  2HZE B;  4ECC A;  1OVN A;  4PUR A;  4ECJ A;  2GSS A;  5E59 A;  2WCI A;  2AJQ B;  4I2U A;  3A5I A;  4JE1 A;  4HZ4 A;  3LYK A;  4KDX A;  3ERW A;  3GKN A;  1F2E A;  3DWV A;  4V2M A;  1HD2 A;  5JWO B;  2ZCT A;  4POM A;  4ZL8 A;  4GCI A;  2F9S A;  2YV9 A;  2NVL A;  5DDL A;  3WT1 A;  3VPQ A;  3CRT A;  2E0Q A;  2H76 A;  2B1K A;  5ECH B;  2GVP A;  4WET A;  1TRV A;  4GQF A;  2HI7 A;  3F6F A;  2HZE A;  1A8Y A;  1TU7 A;  3LOR A;  1WMJ A;  4K2D A;  3QAW A;  1YZX A;  14GS A;  1HNA A;  4BIK A;  1NM3 A;  5ECN B;  4POL A;  2VL9 A;  2GGT A;  1R4W A;  2OBI A;  2YAN A;  3C7M A;  2B7K A;  4DSS B;  3ZVJ A;  5KN0 A;  3KH7 A;  1EP7 A;  3LW9 A;  3EPT A;  1Z9H A;  3IR4 A;  4BWS A;  4TN8 A;  4TOP A;  4QL7 A;  5ELG A;  1WRY A;  1JZD A;  1ZCP A;  3QDN A;  3W8S A;  20GS A;  2PPT A;  3KMO A;  2H72 A;  4YQM A;  5EL8 A;  5B8B A;  2REM A;  3IHQ A;  4RQR A;  5ECS A;  5LCZ A;  3IBH A;  3TCO A;  1S3A A;  2YWO A;  4MZC A;  2WRT A;  2F51 A;  5ECM B;  3LEF A;  3SWL A;  4IEL A;  2VCW A;  4V2L A;  4DSS A;  3KP9 A;  1QMV A;  2BTO T;  2HRN A;  3TRQ A;  4HEA 2;  1QUW A;  2MBS A;  3LXT A;  2MMN A;  4ZB6 A;  3OR5 A;  1XW9 A;  2GSR A;  1BYE A;  5D73 A;  4OWY A;  2TRX A;  3U6V A;  2V1M A;  4IVF A;  3ZLP A;  4LL1 B;  2HZF A;  4OFN A;  3CMI A;  1FB0 A;  3F8U A;  1EOG A;  4PXO A;  1YKA A;  3GHA A;  4GF0 A;  3FR6 A;  1RK4 A;  3APO A;  5CNW A;  2VCV A;  4OO5 A;  3HYP A;  4MJB A;  4EC0 A;  4O5Q A;  3KXO A;  2IMI A;  2L57 A;  5ENU A;  3BBY A;  3FK8 A;  3HVN A;  3TKS E;  2H6Z A;  1TW9 A;  2OA7 A;  2C80 A;  1IYI A;  3UAP A;  2YN1 A;  1R26 A;  3KM6 A;  5JWQ B;  4WR5 A;  4EXJ A;  1GSY A;  1QXH A;  1TRW A;  2KUC A;  4A5P A;  4LMV A;  5HQP A;  1ZOF A;  3FKF A;  4O7H A;  3LGC A;  1KEB A;  4ZL7 A;  2EIR A;  2IMK A;  3A2X A;  3KH9 A; 
#chains in the Genus database with same CATH homology
 3TKS A;  4PQH A;  3Q19 A;  2FD3 A;  5FHI A;  3O6T A;  4CDO A;  1R5P A;  1Z3E A;  3GRX A;  4L5L A;  3KD0 A;  3MYD A;  4CY8 A;  1F3B A;  2GT5 A;  2C0G A;  2LS5 A;  3UEM A;  3APS A;  1QGV A;  4LL4 B;  5H5R A;  2H8L A;  2VCQ A;  4LA1 A;  4XS4 B;  4V2N A;  1TP9 A;  3G7I A;  3WGD A;  4NHZ A;  3EC3 A;  2PN8 A;  1PKZ A;  2GQM A;  4I6X A;  4MJE A;  4F03 A;  4WEY A;  2C4J A;  1IYH A;  1K0D A;  2QSI A;  5JCG A;  3GX0 A;  5DQY A;  3CSI A;  4KCE A;  1USB A;  5LNK e;  3QFB C;  4IQA A;  1YY7 A;  2DIZ A;  3A3T A;  1TK8 B;  5AIV A;  4ZB9 A;  1EEM A;  5LD0 A;  1T4Y A;  19GS A;  3GV1 A;  3ZMK A;  2V32 A;  10GS A;  4XS4 A;  1XCC A;  2HE3 A;  2IIY A;  3IAS 2;  5JCW A;  1VF3 A;  1OC8 A;  2H1B A;  3UMA A;  6GSW A;  1YEP A;  1ILO A;  2LQO A;  1ZMA A;  18GS A;  4JU5 A;  4Q5R A;  1GNE A;  1AQX A;  3HVV A;  4K1F A;  3DGQ A;  3TJF A;  3IC4 A;  4JZQ A;  3QR6 A;  2P31 A;  1ML6 A;  3JCM L;  5HFI A;  2KLX A;  2RM6 A;  2AAW A;  3ED3 A;  2VUP A;  3BCI A;  4YAV A;  4WR4 A;  2HSH A;  4IQ1 A;  1SJZ A;  1HNC A;  5B7C A;  2EIQ A;  2X8H A;  2VLU A;  4MAB A;  2JL4 A;  6GSY A;  3EU3 A;  1TRS A;  4N30 A;  5GST A;  3DRN A;  3LG6 A;  3VI7 A;  1G6W A;  2CA8 A;  2GSQ A;  4IJ3 A;  4PX1 A;  2V6K A;  1R7H A;  1W89 A;  2LV3 A;  2XBQ A;  3HJM A;  3KTB A;  5GAN D;  3M1G A;  4G0K A;  3QOU A;  2HFD A;  3M8N A;  2R3X A;  3ZIJ A;  4TVE A;  3ERF A;  4E8E A;  4ECI A;  4KSO A;  2FGX A;  3UAR A;  1TK5 B;  4KDU A;  3O3T A;  2C0D A;  2X8G A;  4FO5 A;  2JZT A;  1PL1 A;  6GSV A;  1SJI A;  4KSM A;  2PBJ A;  2GQK A;  4ULX A;  2IMF A;  2B5Y A;  5HR1 A;  2ES7 A;  2FHE A;  3F0I A;  3HDC A;  1TK0 B;  1GUH A;  1U3A A;  4HQS A;  4NPB A;  1QK8 A;  3UOM A;  1T3B A;  2R4V A;  13GS A;  5IMV A;  3Q74 A;  2PVQ A;  4J56 E;  3BCK A;  1J08 A;  4ICY A;  1M2B A;  2LTK A;  5HR3 A;  1I5G A;  3PGT A;  1OE7 A;  3EE2 A;  2YP6 A;  3DEX A;  3ZFB A;  3EIN A;  5B6N A;  1K0B A;  5CRE A;  1G7O A;  1SL1 B;  4KDY A;  1GTA A;  1AAZ A;  2H30 A;  1XWK A;  2KHP A;  2KOK A;  1AXD A;  1NHO A;  1WPI A;  4HJM A;  2JZS A;  2PVO C;  2ZUP A;  5GSS A;  3IA1 A;  2QA1 A;  3W6G A;  1O73 A;  2GST A;  2OE0 A;  2YWM A;  3GTU B;  2X49 A;  2ZNM A;  2FLS A;  2C8U A;  3G7J A;  3A2W A;  2A2P A;  3IOS A;  4GST A;  3GL5 A;  4J57 E;  4FQU A;  5ECQ B;  3FW2 A;  1X9W B;  1K0O A;  4MZB A;  3PH9 A;  1M2A A;  4OCE A;  1H4O A;  3W8J A;  1SKR B;  2QC7 A;  4MJA A;  4ACS A;  3D5J A;  4QL9 A;  2WDU A;  3S9F A;  3FHK A;  1XWC A;  2K6V A;  4MMM A;  22GS A;  2GS3 A;  3FZA A;  5ECL B;  3L0H A;  5FT3 A;  3MSZ A;  2JZR A;  3GTU A;  2QGV A;  2VLT A;  3J7Y k;  16GS A;  5G1L A;  1F37 A;  1YQ1 A;  3IC8 A;  4N0V A;  1DSB A;  2GQL A;  2P5R A;  3DKS A;  2YWN A;  3MNG A;  4HUA A;  2HLS A;  5CYY A;  5D9X A;  3M9J A;  2LKU A;  1OAZ A;  4LLR A;  1URM A;  3GKM A;  1E6B A;  1Q4J A;  2R0P A;  1GLP A;  2HXK A;  1GUM A;  4KA0 A;  5H5Q A;  2RII A;  5JCU A;  1GH2 A;  5DBQ A;  4MZW A;  2B6M A;  4Z7X A;  4MH3 A;  4AJ7 A;  4F9Z A;  4IN0 A;  3N5O A;  4HZ2 A;  3UBL A;  2CZ2 A;  1GSS A;  1O7U A;  1S3C A;  4RI6 A;  2YV7 A;  1FVK A;  4FIW A;  1PSQ A;  2TRC P;  4OD7 A;  4D73 B;  3CRU A;  1SD9 A;  4FYB A;  3FMW A;  1SYX A;  4XTS A;  4CW9 A;  2WFC A;  6GST A;  4WBR D;  2H0G A;  4GRF A;  2H0I A;  2VCX A;  1V98 A;  2LRC A;  1YKC A;  1JLW A;  4TRX A;  2CV4 A;  3HCZ A;  4TXO B;  4TXV A;  5JWR B;  3VFI A;  2AV4 A;  1A0R P;  1U88 A;  1Z5Y E;  3LSZ A;  2RLI A;  2N5A A;  2JU5 A;  3IXR A;  2VD1 A;  2JSZ A;  2QKE A;  5FWG A;  3UJ1 A;  1H75 A;  1SL2 B;  2YNX A;  2HYX A;  4KUN A;  4D73 A;  1A2L A;  2PER A;  1T00 A;  2E7P A;  4GSS A;  4EDZ A;  2XPE A;  1ON4 A;  4BVY B;  4CY6 A;  2A2R A;  4WF5 A;  5HFG A;  5D9T A;  3E0U A;  1K0C A;  1T1V A;  1YDK A;  1VF1 A;  4MCU A;  2FWG A;  4TXO A;  2E2M A;  3IPZ A;  3A2V A;  4MPF A;  5AIX A;  1BED A;  1TXX A;  4ILF A;  5IQY A;  2IME A;  4TKY A;  5DQS A;  2DJ1 A;  5IMC A;  3F63 A;  1ZYE A;  4KX4 A;  1SD8 A;  1A24 A;  2O89 A;  4O5R A;  5J9B A;  3F4R A;  3GA4 A;  3TRX A;  4N10 A;  3O76 A;  3IE3 A;  1X0R A;  5J5N A;  5L71 A;  2P5Q A;  1SK0 A;  1VGL A;  5D93 A;  4TR4 A;  4BVY A;  2RM5 A;  4AJ6 A;  1NW2 A;  1UC7 A;  3C8E A;  4AGS A;  4YQU A;  2DKH A;  3FR3 A;  2BMX A;  1F6M C;  1YF1 A;  3H93 A;  4Z2U A;  4JR6 A;  3IDV A;  5CRH A;  2VL2 A;  3MIX A;  3QFA C;  3J7Y b;  2A2S A;  1ERT A;  1PMT A;  2AHE A;  4XHM A;  2A4V A;  5KOX A;  1GTI A;  4MK3 A;  4EIQ A;  4ZIJ A;  5ABR A;  2XC2 A;  4MH2 A;  4PTS A;  1X9M B;  3BJ5 A;  3H79 A;  4XIH A;  2MMO A;  3FEU A;  3IK9 A;  3FZ9 A;  2CX4 A;  3TKR A;  2H1G A;  4FH8 A;  4X43 A;  1M0U A;  1T8E B;  2WB9 A;  2GLR A;  3ZVJ D;  2LUS A;  2PWJ A;  1N2A A;  1HYU A;  4BPY A;  2FA8 A;  3TKP A;  2YPM A;  1ACV A;  4HI7 A;  2D2Z A;  3BD2 A;  1ST9 A;  3KIJ A;  1TDI A;  2R0G A;  4Z2R A;  4JED A;  1E2Y A;  5ECR B;  3VI5 A;  3F4S A;  3FYG A;  1KNG A;  3ME8 A;  4F0B A;  4RUV A;  4ZB8 A;  3EVI A;  2H73 A;  1LJR A;  4HOJ A;  4PGT A;  4AJ8 A;  5IOX A;  11GS A;  1VF2 A;  3L78 A;  4PNF A;  3QD9 A;  3U5R E;  1TU8 A;  4EUY A;  4GTU A;  2M72 A;  3D0Z A;  2Z9S A;  2CVD A;  1AUC A;  4K5S A;  5IO2 A;  1SYR A;  2C3Q A;  1V40 A;  5DVB A;  5F0G A;  2JAC A;  4Q5F A;  2I9H A;  2LRN A;  1GUK A;  6GSX A;  3D21 A;  2IL3 A;  5D9W A;  3HKR A;  1V57 A;  1B9Y C;  5KN3 A;  4K5R A;  1B48 A;  2HRK A;  4ZBD A;  3HA9 A;  3VUR A;  2I81 A;  5D96 A;  3F9U A;  4IW9 A;  4KF9 A;  4F82 A;  1K3L A;  2VAF A;  2DC5 A;  4GSN A;  2ON5 A;  4PQI A;  4GXZ A;  4OO4 A;  2KP1 A;  3EUR A;  1GTB A;  2H74 A;  1X9S B;  3QMX A;  1FHE A;  1M7T A;  3ISO A;  1MTC A;  3VWU A;  2CX3 A;  5KEJ A;  5H5S A;  1WE0 A;  1SL0 B;  2A4H A;  3LWA A;  2VCT A;  1PN0 A;  4GLT A;  3FZ4 A;  1U3I A;  4KGI A;  2YCD A;  4I97 A;  3K8N A;  3P7X A;  2V2G A;  3DVX A;  3P8W A;  4LMW A;  4K7O A;  5ID2 B;  3UVH A;  2G2Q A;  2X64 A;  1TTZ A;  3TGZ A;  2LST A;  1KBN A;  5AIS A;  1DBY A;  1O8W A;  4KAE A;  4Z2T A;  4ML1 A;  5CAX A;  2DJK A;  1GSE A;  3FRC A;  5G5F A;  1N8J A;  3DYR A;  4EL1 A;  1MD4 A;  5ECI B;  3KMN A;  5GZZ B;  4F2I A;  1TI1 A;  1FAA A;  3AY8 A;  1XOB A;  2DJ2 A;  3I9V 2;  4HU7 A;  1FW1 A;  1MDI A;  2H01 A;  3G9B A;  5ID2 A;  2GT6 A;  3BOA A;  3KGK A;  4NHW A;  3RBT A;  4IHU A;  4NAX A;  3F3R A;  3EMX A;  3HD5 A;  3CXG A;  4FYC A;  2H75 A;  2CAI A;  3TKQ A;  5EVO A;  4BL7 B;  4ZIL A;  1B4P A;  5IPH A;  2OBK A;  1T7P B;  4O32 A;  5DAK B;  1ZZY A;  4IKH A;  4G0I A;  3MDK A;  1PQN A;  2NDO A;  4K9Z A;  2DLX A;  1BG5 A;  3R3E A;  4EKZ A;  4ID0 A;  9GSS A;  1K0M A;  4F0C A;  3HZ4 A;  4P3Y B;  1DUG A;  3MAK A;  2WS2 A;  1B4Q A;  1SU9 A;  1JFU A;  4ZL9 A;  1UVZ A;  1JLV A;  4MF5 A;  2OAD A;  4DEJ A;  4BL7 A;  4V1A p;  1GSQ A;  2L5O A;  3FZ5 A;  4Q5Q A;  3C1S A;  4I2T A;  1S3D A;  3VWX A;  2N5B A;  3GUR A;  1AW9 A;  1Z6N A;  5DAK A;  3US3 A;  2H6X A;  5BMU A;  1XBS A;  4K2X A;  1KTE A;  2MYG A;  3GFK A;  3RAZ A;  4V1A g;  4HDE A;  1T4Z A;  3LFL A;  1PX6 A;  1GWC A;  2VL3 A;  5G30 A;  1J9B A;  2VD0 A;  2FWF A;  4PUF C;  5C04 A;  3NIV A;  3GH9 A;  5COH A;  5ECO B;  3LYP A;  4XS6 A;  1G0T A;  2LNT A;  4NV5 A;  3GL3 A;  4MJC A;  1C72 A;  2JAD A;  2CVK A;  1A0F A;  1JHB A;  5IPG A;  4JRR A;  1A2J A;  2LJA A;  1G7E A;  1MDK A;  2B1L A;  1ZYN A;  3DIE A;  4DVC A;  4ZBA A;  4IS0 A;  1UN2 A;  5G2Z A;  1AIU A;  4H86 A;  1GRX A;  2TIR A;  3UVT A;  2LRT A;  2O7K A;  1CQG A;  4I5Q A;  2NPB A;  2DJ3 A;  4POB A;  4X0X A;  4XCS A;  2K18 A;  3P2A A;  4G10 A;  2GDR A;  3H4K A;  2C0E A;  4EVM A;  1O6J A;  2CAQ A;  2DJJ A;  4BVX B;  8GSS A;  3I6A A;  1RW1 A;  2GZZ A;  4K7N A;  2C0F A;  3R2Q A;  1BQ7 A;  4ISD A;  1M9B A;  2DML A;  4KB3 A;  1BJX A;  3ERG A;  4MDC A;  2V41 A;  1XFL A;  1GLQ A;  3HVS A;  4EIP A;  1OKT A;  3TOT A;  2CVB A;  5AN1 A;  2OKA A;  1Z6M A;  4KW6 A;  4WXT A;  1XWG A;  1YJ6 A;  5BRT A;  1SKS B;  1ABA A;  3VK9 A;  3C1R A;  4BVX A;  2X4A A;  3PPU A;  5KN2 A;  4OMV A;  5IM9 A;  5DCG A;  4NWY A;  2DBC A;  3SBC A;  2DSA A;  4RI7 A;  1QQ2 A;  3WT2 A;  4I8B A;  2NBS A;  2R37 A;  3EU4 A;  1XOA A;  3H8Q A;  4O5U A;  2B3S A;  3IHG A;  2OJL A;  2RUF A;  4BA7 A;  1DE2 A;  3M9K A;  1XW5 A;  2DIY A;  4RQX A;  3HY2 A;  1GUL A;  5F05 A;  3VLN A;  4MPG A;  4TR1 B;  2I3Y A;  2DJ0 A;  1EWX A;  5D9V A;  2F8A A;  3L4N A;  5J41 A;  4WBJ A;  4JR4 A;  1ZGN A;  5IMD A;  5IMF A;  3D6I A;  2PU9 C;  1WOU A;  2L6C A;  1GSD A;  2E2G A;  3IAM 2;  3TKS C;  2YWI A;  4O92 A;  2H0H A;  3FY7 A;  2FWE A;  3IRA A;  4IJI A;  3IK7 A;  3HJP A;  3E3E A;  2CZ3 A;  1AQW A;  3L9U A;  1K3Y A;  2FCH A;  1I9D A;  2L59 A;  2O8V B;  5HR2 A;  4ML6 A;  1PRX A;  5IMZ A;  1EGO A;  3P90 A;  4KH7 A;  4TR1 A;  1X5E A;  3DVW A;  1JZR A;  4K8M A;  1EEJ A;  1XVW A;  1SJ6 A;  4GWR A;  4K0G A;  5E4W A;  3CTG A;  1WJK A;  2LJK A;  3QPM A;  5F8B A;  2DMM A;  3Q18 A;  5A4W A;  2FWH A;  3CSH A;  3CSJ A;  4N0Z A;  3WGE A;  6GSU A;  3APQ A;  1LU4 A;  3ME7 A;  1FO5 A;  5IIZ A;  2MMA A;  4POK A;  4YKG A;  2HT9 A;  3VPT A;  2FA4 A;  2IJY A;  1SEN A;  2NTO A;  2F8F A;  4XRD A;  3HZ8 A;  4XRA A;  1EV9 A;  3ZFL A;  2OE1 A;  4IP1 A;  2L5L A;  3VWW A;  3DXB A;  1Y25 A;  3N9J A;  1A2M A;  3ZIT A;  1V58 A;  1M2D A;  3TJJ A;  3EYT A;  3MWH A;  1UA5 A;  12GS A;  3D4T A;  1ZYP A;  4K7I A;  1SKW B;  2X8C A;  3GKX A;  1M99 A;  17GS A;  5A4U A;  5HFK A;  1ZYQ B;  4MF6 A;  3LXZ A;  5IOW A;  3ZTL A;  5A4V A;  1RQM A;  4X4J A;  2FNO A;  4MF7 A;  2F3M A;  2OE3 A;  1EZK A;  2L4C A;  1TKD B;  2B5X A;  1K3O A;  1J0F A;  1OKD A;  1B9X C;  4K6X A;  1NSW A;  1OYJ A;  2R6K A;  1PD2 1;  2BJX A;  4IGJ A;  4PNG A;  5ECP B;  3TOU A;  3DML A;  3TRP A;  3ZL5 A;  5C00 A;  4MP4 A;  3ZRE A;  2M46 A;  2LJR A;  3WD6 A;  5HR0 A;  1XZO A;  3L9S A;  3PR8 A;  2IMD A;  2EIO A;  3KZQ A;  5CRW A;  3TB2 A;  3EMP A;  1WIK A;  1PGT A;  4GQC A;  1AQV A;  4BWQ A;  4CHS A;  4DSR A;  4ECB A;  3GKK A;  4TW5 A;  3NOF A;  2GTU A;  5EPF A;  3KEB A;  2H19 A;  2WUL A;  4NXI A;  1X5D A;  1THX A;  4E8H A;  3A5W A;  1XWB A;  2K8S A;  3VWV A;  2R5G A;  2MMZ A;  1B8X A;  1O81 A;  4HJ2 A;  1EOH A;  2YJ7 A;  1GNW A;  3F3Q A;  4EDY A;  3TUE A;  3M3M A;  2P0G A;  4YKF A;  5DCH A;  1GP1 A;  2L6D A;  2LEG A;  3D4M A;  3ZZX A;  3H1N A;  2XBI A;  2PMT A;  5D8I A;  3M0F A;  4X1U A;  2CQ9 A;  2O87 A;  3QAG A;  5F06 A;  1MEK A;  2VLV A;  4KND A;  4L8E A;  3RPP A;  1JZO A;  5G5E A;  2PUK C;  3GST A;  3TJK A;  2I1U A;  1XXU A;  3ZYW A;  2IPA A;  2RUE A;  5A5K A;  3GN3 A;  2XHF A;  3TJB A;  3I69 A;  2MBT A;  4OFM A;  3C73 A;  1K0A A;  4WKW A;  2J23 A;  2FY6 A;  3GYK A;  4TR0 A;  4OFT A;  5J4U A;  2JSY A;  3GX8 A;  1FOH A;  2H6Y A;  2I4A A;  3WGX A;  4IP6 A;  1Z7R A;  3LJR A;  3HVX A;  4NMU A;  4L0U A;  3TJG A;  4FYU A;  4J2F A;  2C3T A;  2C3N A;  1YEX A;  2KP2 A;  1A8L A;  3DD3 A;  2H70 A;  4KCA A;  1O85 A;  1ERW A;  3I43 A;  1BX9 A;  1W4V A;  3KCM A;  2N5F A;  2ALB A;  1O8X A;  1ERV A;  7GSS A;  3GNJ A;  1VF4 A;  3PIN A;  1F9M A;  2K8V A;  1XWA A;  4EO3 A;  2H1A A;  3GH6 A;  3C71 A;  3CBU A;  2M80 A;  1GL8 A;  1LBK A;  4K0N A;  2B5E A;  1HNB A;  1GSF A;  5KOW A;  3EWL A;  4WF4 A;  4KE3 A;  3HJO A;  1WP0 A;  2UZ8 A;  3D22 A;  1Z7P A;  2WZ9 A;  1PKW A;  1YF0 A;  3RHB A;  4ZXG A;  2R0C A;  1THO A;  3RHC A;  3GMF A;  4HU9 A;  4QQ7 A;  4L0W A;  2FUG 2;  2IWT A;  2H71 A;  3KJY A;  1JZW A;  5DJL A;  4HS1 A;  1PA3 A;  3CYN A;  6GSS A;  3IV4 A;  1XW6 A;  2EC4 A;  2GZY A;  4XS1 A;  5KN1 A;  4JBB A;  1G6Y A;  1XPV A;  1PX7 A;  1GSU A;  5CRG A;  1FB6 A;  4G19 A;  5ELA A;  2R2J A;  4YAP A;  4G0L A;  2G0F A;  1NHY A;  1R5A A;  5B8A A;  2HSM A;  2YZH A;  3UBK A;  2O85 A;  5IO0 A;  5GAP D;  4ZBB A;  2C1Y A;  2LNS A;  1Y6E A;  2HRF A;  2V6O A;  4Q5N A;  3V1W A;  4PQ1 A;  2AUV A;  4DSQ A;  2HNL A;  5AGY A;  3LQ7 A;  1U6T A;  2VCZ A;  4L5O A;  2WGR A;  1MDJ A;  3ZRD A;  5J9C A;  1SK1 A;  2IN3 A;  5CRD A;  1EV4 A;  4EE0 A;  5DJM A;  3GSS A;  2LQQ A;  2X99 A;  4OCF A;  2H66 A;  2GZP A;  2YOI A;  3HXS A;  3KTL A;  4AF2 A;  3HHV A;  1V2A A;  1OE8 A;  2DKI A;  2OAC A;  4N11 A;  2WJU A;  3Q6O A;  2K9F A;  5INY A;  1A23 A;  2IFQ B;  1ZL9 A;  1PN9 A;  4EF0 A;  1F3A A;  3QAV A;  3KP8 A;  3ZIV A;  2YJH A;  1PL2 A;  1OC3 A;  1X5C A;  1DE1 A;  2VOC A;  1GTU A;  5ECK B;  5B6M A;  5G31 A;  4MLY A;  3QCP A;  2ON7 A;  2HRA A;  3RDW A;  1XIY A;  2VIM A;  3NZN A;  5CP1 A;  4TR3 A;  5DAL B;  4USS A;  1OC9 B;  1QFN A;  1M9A A;  1AC1 A;  1TOF A;  1K0N A;  5J3R A;  1U87 A;  2VL2 C;  1BAY A;  2IFQ A;  1TJD A;  2L4Q A;  5CO3 A;  2AB6 A;  1FG4 A;  2VO4 A;  4YQV A;  1CQH A;  1FVJ A;  4NV2 A;  3WYW A;  3F6D A;  2HSY A;  3L9V A;  3CTF A;  1V9W A;  3ZML A;  3RPN A;  1Q98 A;  3UL3 A;  4MA9 A;  1MD3 A;  2B7J A;  5IMA A;  3FR9 A;  1TRU A;  4G9H A;  2QA2 A;  3F4T A;  5DAL A;  5EY6 A;  5G1K A;  2VM1 A;  1OC9 A;  2YZU A;  1FOV A;  4IBP A;  3G7Y A;  2J9H A;  2VM2 A;  4MNN A;  1WWJ A;  1EP8 A;  1XVQ A;  4YH2 A;  5F07 A;  1HQO A;  2H1D A;  3UIW A;  1EGR A;  2XPD A;  2PGT A;  4G2E A;  4HQZ A;  3E9J B;  3TDG A;  2CT6 A;  1ERU A;  3GIX A;  3GUS A;  1TI3 A;  2MZC A;  1VRS D;  1SK2 A;  4PUA A;  2AYT A;  2HZE B;  4ECC A;  1OVN A;  4PUR A;  4ECJ A;  2GSS A;  5E59 A;  2WCI A;  2AJQ B;  4I2U A;  3A5I A;  4JE1 A;  4HZ4 A;  3LYK A;  4KDX A;  3ERW A;  3GKN A;  1F2E A;  3DWV A;  4V2M A;  1HD2 A;  5JWO B;  2ZCT A;  4POM A;  4ZL8 A;  4GCI A;  2F9S A;  2YV9 A;  2NVL A;  5DDL A;  3WT1 A;  3VPQ A;  3CRT A;  2E0Q A;  2H76 A;  2B1K A;  5ECH B;  2GVP A;  4WET A;  1TRV A;  4GQF A;  2HI7 A;  3F6F A;  2HZE A;  1A8Y A;  1TU7 A;  3LOR A;  1WMJ A;  4K2D A;  3QAW A;  1YZX A;  14GS A;  1HNA A;  1NM3 A;  5ECN B;  4POL A;  2VL9 A;  2GGT A;  1R4W A;  2OBI A;  2YAN A;  3C7M A;  2B7K A;  4DSS B;  3ZVJ A;  5KN0 A;  3KH7 A;  1EP7 A;  3LW9 A;  3EPT A;  1Z9H A;  3IR4 A;  4BWS A;  4TN8 A;  4TOP A;  4QL7 A;  5ELG A;  1WRY A;  1JZD A;  1ZCP A;  3QDN A;  3W8S A;  20GS A;  2PPT A;  3KMO A;  2H72 A;  4YQM A;  5EL8 A;  5B8B A;  2REM A;  3IHQ A;  4RQR A;  5ECS A;  5LCZ A;  3IBH A;  3TCO A;  1S3A A;  2YWO A;  4MZC A;  2WRT A;  2F51 A;  5ECM B;  3LEF A;  3SWL A;  4IEL A;  2VCW A;  4V2L A;  4DSS A;  3KP9 A;  1QMV A;  2BTO T;  2HRN A;  3TRQ A;  4HEA 2;  1QUW A;  2MBS A;  3LXT A;  2MMN A;  4ZB6 A;  3OR5 A;  1XW9 A;  2GSR A;  1BYE A;  5D73 A;  4OWY A;  2TRX A;  3U6V A;  2V1M A;  4IVF A;  3ZLP A;  4LL1 B;  2HZF A;  4OFN A;  3CMI A;  1FB0 A;  3F8U A;  1EOG A;  4PXO A;  1YKA A;  3GHA A;  4GF0 A;  3FR6 A;  1RK4 A;  3APO A;  5CNW A;  2VCV A;  4OO5 A;  3HYP A;  4MJB A;  4EC0 A;  4O5Q A;  3KXO A;  2IMI A;  2L57 A;  5ENU A;  3BBY A;  3FK8 A;  3TKS E;  2H6Z A;  1TW9 A;  2OA7 A;  2C80 A;  1IYI A;  3UAP A;  2YN1 A;  1R26 A;  3KM6 A;  5JWQ B;  4WR5 A;  4EXJ A;  1GSY A;  1QXH A;  1TRW A;  2KUC A;  4A5P A;  4LMV A;  5HQP A;  1ZOF A;  3FKF A;  4O7H A;  3LGC A;  1KEB A;  4ZL7 A;  2EIR A;  2IMK A;  3A2X A;  3KH9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...