3TKSE

Crystal structure of full-length human peroxiredoxin 4 in three different redox states
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
197
structure length
197
Chain Sequence
HLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRLEEFRSINTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDLTHQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSETIIPDPAGKLKYFDKLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Peroxiredoxin-4
publication title Structural insights into the peroxidase activity and inactivation of human peroxiredoxin 4
pubmed doi rcsb
source organism Homo sapiens
total genus 65
structure length 197
sequence length 197
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2011-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00578 AhpC-TSA AhpC/TSA family
E PF10417 1-cysPrx_C C-terminal domain of 1-Cys peroxiredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3tksE00
2IJYA 3GIXA 2CAQA 2O87A 3A2VA 4WR4A 3GX0A 3HYPA 4FYBA 4TRXA 4E8HA 3LXZA 1GTAA 7GSSA 4MMMA 2R3XA 5E4WA 1MDIA 2GQMA 4EC0A 2DLXA 1YEPA 4N0ZA 5D93A 3H8QA 1U88A 2IWTA 1K3OA 1NHOA 5HR3A 1BAYA 2PN8A 1SD9A 4O32A 2VO4A 5J9CA 1ERTA 2KUCA 3LGCA 4JU5A 2BJXA 2GSTA 1TKDB 4TR3A 2WZ9A 4IP1A 5EPFA 4GLTA 3C8EA 2H1BA 4JRRA 3FZAA 2I3YA 5JCWA 2I1UA 4HQSA 2R6KA 3C7MA 5LNKe 2GQLA 5A5KA 3CSIA 1ACVA 2FWGA 3FZ4A 1NW2A 2R5GA 5KN0A 1HNBA 1VF4A 1A2LA 2VCQA 4F0CA 1ZMAA 1WJKA 1Z5YE 5J5NA 1RQMA 4J56E 4K7NA 3TOTA 2NPBA 5KN3A 1XCCA 1XZOA 2DJ3A 2LV3A 4RI6A 1OC9B 4IHUA 2YJ7A 3CTGA 2F9SA 3M0FA 2HYXA 3UIWA 4J57E 3EC3A 4P3YB 4ZXGA 1GSEA 1O8XA 3U6VA 3KTBA 3QAGA 3ZVJD 2XBIA 2P31A 3IHQA 3TRPA 5EY6A 1EOGA 2A4VA 3UVTA 4FO5A 2C80A 3G9BA 3WGXA 4MPGA 1R4WA 2QC7A 4OFTA 5CRWA 1SYXA 3F3RA 2GTUA 1KEBA 2G2QA 1O6JA 5EVOA 2I4AA 2FA4A 3IE3A 3FK8A 4XRDA 3FEUA 1IYIA 22GSA 5G5EA 2WDUA 5ABRA 3D5JA 2YWNA 3DKSA 4HQZA 4QQ7A 2IMKA 4IELA 4HJ2A 4OD7A 2L57A 3TKSA 2CT6A 3WT1A 5DAKB 1O8WA 1F3AA 4MZWA 3GA4A 1XWCA 2MBSA 4ISDA 4KW6A 1XFLA 2E0QA 5KN2A 2LEGA 4DSSB 5D9WA 3TJKA 4BVXA 1SL0B 5AN1A 2L5LA 3UVHA 3D22A 2C0EA 3ERFA 4GXZA 5G1LA 2HI7A 1JZRA 2YNXA 3FYGA 3F3QA 2A2SA 2C0GA 1YQ1A 3NOFA 2PU9C 4ZBDA 3QFAC 1AQXA 1AIUA 5CYYA 4EVMA 4V1Ap 1A8YA 4ID0A 2HSHA 3A2WA 3TDGA 2OKAA 3ZIVA 2LUSA 4EF0A 3IPZA 5IOWA 3C1SA 3M9JA 2KLXA 1BG5A 4TXOB 4MH3A 2OBKA 4POMA 1G7OA 2ON7A 4PXOA 17GSA 1Z7RA 3O3TA 1FB0A 3HDCA 4PUFC 4HI7A 2OA7A 3GHAA 2GLRA 1PN9A 2C8UA 2B5EA 3IC4A 4XS4B 1BYEA 3GX8A 2XPEA 3C71A 2H19A 1Q98A 2JADA 2LRTA 4Z7XA 3WD6A 1THOA 1TI1A 1JFUA 1ML6A 5KEJA 2YWMA 5HR1A 4ZBBA 1FHEA 3N5OA 2R37A 1SYRA 1WRYA 2FLSA 3VLNA 3S9FA 3LWAA 4K0GA 4NXIA 5CREA 1Y6EA 2B7KA 2E7PA 2AUVA 3SWLA 4AGSA 3PGTA 1EGRA 1WIKA 3A5WA 3KM6A 2NDOA 4FH8A 3EMXA 1TJDA 1XWBA 5IOXA 1GNWA 3L9UA 2A2RA 5F8BA 3P90A 2VD0A 3IAS2 1FAAA 3GSTA 3F6FA 3GFKA 1K0DA 2L4CA 4HDEA 3VWXA 1DBYA 3KH9A 3VFIA 1F37A 3VWWA 3QR6A 2OE3A 4DSRA 5KN1A 3HA9A 5F05A 4OFNA 3Q74A 1X9WB 3ZVJA 3D0ZA 2C0FA 2LRNA 1B8XA 4L8EA 3CTFA 4CDOA 4KAEA 2GGTA 2M80A 4MLYA 4JBBA 3DGQA 3I6AA 1PGTA 16GSA 2XC2A 2P5QA 4F2IA 3ZFBA 4MJBA 4AF2A 5ECRB 3QDNA 4XIHA 4POLA 5J41A 2VOCA 1PKWA 3F6DA 1X5EA 3DIEA 2LJKA 2VL2A 1W4VA 3WGEA 1SENA 4I6XA 1M2DA 2H74A 3V1WA 2GS3A 2RM6A 1B9YC 4ZL8A 1JZOA 1GSUA 4PQHA 2V6OA 4LLRA 2CVKA 4O92A 3TRXA 1YZXA 2HZFA 18GSA 2TIRA 5IMAA 3GNJA 3J7Yb 3KJYA 4MABA 1ZYEA 1TP9A 3I9V2 2H72A 4GF0A 3TCOA 4LL1B 3TUEA 3GTUB 5F06A 3TGZA 2K6VA 2GZPA 5ID2B 2IMDA 1QQ2A 3CSJA 1O7UA 4EUYA 5ECQB 1K0MA 4KNDA 4FYCA 5CAXA 1HNAA 1OYJA 1A23A 2XPDA 1TXXA 2AB6A 5D96A 5DALA 4Q5RA 1GP1A 2JU5A 5D9VA 2H6XA 2LRCA 1XW6A 2PBJA 4OFMA 4POKA 1AAZA 4BPYA 1OC3A 4MZBA 1J08A 5D73A 1V9WA 4HZ2A 3ZL5A 1YF0A 4NMUA 2VD1A 3LQ7A 4ILFA 3IV4A 3UAPA 1X9MB 4JZQA 5G2ZA 5GZZB 4TOPA 4NV2A 4MF6A 5D8IA 4EDYA 5CRGA 4I2TA 4YQUA 2GSQA 1XOBA 2X8GA 3HVXA 1V58A 2H66A 2WJUA 5A4UA 3UEMA 2X64A 3ME8A 5LD0A 4RUVA 2YZUA 1GH2A 4JE1A 4ML1A 4GTUA 1GSDA 2YV7A 4IS0A 1U6TA 3KD0A 1YY7A 4GWRA 2H73A 2L5OA 4WEYA 1J0FA 4IN0A 2B7JA 2CAIA 3HJPA 2K8VA 2GT6A 1J9BA 1WMJA 5IMCA 1AC1A 1MDJA 2FUG2 1K0BA 3DVXA 3Q18A 1WP0A 4FYUA 2WULA 3EWLA 3HJOA 4N0VA 3KIJA 1A2JA 3ZIJA 1QUWA 3D21A 3IRAA 3US3A 5IMDA 4NPBA 1JLVA 3ERWA 3VWUA 1Z9HA 3MNGA 2KP1A 2H75A 4BWQA 3SBCA 2HSYA 2YPMA 1RK4A 1TOFA 1GSFA 5B6NA 2EIOA 2B5XA 5HFIA 5B8AA 4K2DA 3LYKA 3ZFLA 1VRSD 4MK3A 3BCKA 2GVPA 2O85A 13GSA 5DBQA 2B6MA 4TW5A 2N5AA 3FY7A 2K18A 2ZNMA 2M72A 3DYRA 1USBA 1SJIA 4OMVA 3HY2A 2IPAA 5L71A 1PD21 3KH7A 1R7HA 1RW1A 1E6BA 2FA8A 2N5BA 4IP6A 2H1DA 1OC9A 3IA1A 3PINA 4LL4B 1V2AA 2C4JA 3RDWA 2DBCA 3CSHA 3KP8A 4ZBAA 1XWAA 1XVQA 3KGKA 1T7PB 3RPPA 3I43A 4HS1A 4ZB9A 4F03A 1EEJA 2HZEB 2TRXA 4K7IA 4OCEA 5D9XA 1YEXA 3MSZA 2VAFA 3GKXA 2OJLA 2FWHA 4ZIJA 1GSYA 2L6CA 3D4MA 4D73B 3KTLA 3EVIA 2K9FA 5G5FA 3HVSA 3M9KA 1XVWA 3ZITA 3TJGA 5DAKA 3ED3A 1K0OA 1EV4A 1Z6MA 3EURA 4G10A 4RI7A 5J4UA 3APQA 4XRAA 1BJXA 3KMNA 1A8LA 4LA1A 10GSA 1NHYA 5GAND 1PL1A 3TJFA 2M46A 3WYWA 2OE1A 2H0GA 2HXKA 1ERUA 2RUEA 3FHKA 2QSIA 2GQKA 5JWQB 1R5PA 4EE0A 5D9TA 5JCUA 1N2AA 19GSA 1S3DA 4N30A 5DDLA 3IBHA 2DJKA 1SD8A 4TN8A 3VI7A 3H79A 3CRTA 3UL3A 1EOHA 3R2QA 4I5QA 2DIZA 1GL8A 2GSSA 4TXOA 3GMFA 4K7OA 1NSWA 1Q4JA 4HZ4A 4BWSA 2MBTA 2L59A 3IDVA 1VGLA 3GSSA 2XBQA 3W6GA 2C0DA 4I97A 2VL9A 3KP9A 3H4KA 5F07A 1M99A 4CW9A 4XHMA 4XS4A 4WXTA 3M8NA 1F2EA 1M9BA 1XXUA 3ZLPA 2RM5A 1X9SB 12GSA 2C3NA 3FKFA 4Q5FA 5CNWA 3K8NA 5ECLB 4NV5A 3TOUA 4DSQA 2PPTA 3H1NA 2YCDA 3W8JA 2MZCA 5B7CA 1B4PA 1OAZA 4IJIA 1ABAA 3QMXA 3UJ1A 4K6XA 1M7TA 4EXJA 2H30A 2FCHA 1R5AA 1MD4A 4TR1B 1PKZA 3FW2A 4WBRD 2JACA 1FG4A 2NBSA 2CX3A 3ZMKA 2C3QA 4KUNA 4KX4A 2IFQA 2F51A 5AISA 2H70A 2REMA 2VLTA 1LBKA 5H5SA 4V2LA 2MYGA 5ECKB 1MTCA 5B6MA 4HEA2 4NHZA 1SK1A 5A4VA 3TJBA 2E2GA 1PMTA 5C00A 4XTSA 3ME7A 1OKDA 5E59A 2DIYA 4MJAA 2CZ3A 2DSAA 4QL7A 3BCIA 1FB6A 4YQVA 2WFCA 6GSWA 4HJMA 3U5RE 2V1MA 1SL1B 1SL2B 3M1GA 3HKRA 3FR3A 4O7HA 1K0CA 2QKEA 2HRNA 2V2GA 2BMXA 1G6WA 2JZTA 1B9XC 3TRQA 5LCZA 3FR6A 3PH9A 3UOMA 2HLSA 1AQVA 3GL5A 3J7Yk 4RQXA 2B1KA 2P5RA 1IYHA 3FR9A 2CX4A 4Q5QA 1SK2A 3KZQA 2YANA 2VCXA 3ZREA 4GSNA 3TJJA 1LJRA 1T3BA 5JWRB 1DSBA 3NZNA 3FZ9A 3HD5A 5AIVA 2JSYA 3D4TA 4G2EA 6GSUA 1A24A 4ECIA 2VCTA 1A2MA 2YWIA 1QXHA 1EZKA 4AJ8A 4V2NA 2LNTA 6GSYA 1SJ6A 3G7JA 1YKAA 2WRTA 3VPQA 2PVQA 3EE2A 3QAVA 1O85A 2P0GA 6GSVA 1VF1A 3FZ5A 4TR0A 6GSTA 1N8JA 4ECCA 1KNGA 3EYTA 1MEKA 1G6YA 4L5LA 4PQ1A 3LFLA 3E9JB 4GSTA 3W8SA 1GSSA 1JZWA 3L9SA 2VUPA 2WCIA 2CQ9A 3PR8A 2AAWA 2ES7A 4CHSA 3HCZA 3JCML 2L6DA 4DVCA 1SKWB 1TK0B 1QFNA 4IW9A 4MF7A 5DCGA 2TRCP 1WPIA 2VM2A 3F4SA 5AIXA 1TDIA 1EP8A 4YAVA 4LMWA 5C04A 11GSA 2G0FA 5IPHA 4N10A 1U3AA 1ZZYA 1GLPA 5ECSA 1XWKA 4PNGA 2MMAA 3ISOA 1G7EA 5F0GA 2D2ZA 5HR0A 4WF5A 2C3TA 4ZL7A 3DWVA 1GTBA 1K0NA 2VIMA 2ALBA 3G7YA 2KHPA 2FNOA 1AUCA 4X43A 1SKRB 5G31A 5G30A 1GTIA 1LU4A 2VLVA 3CBUA 5DCHA 2HFDA 2FWFA 1ON4A 1TU7A 3IK9A 1GRXA 1UN2A 2EC4A 1JZDA 2IMFA 2JL4A 4G9HA 1PL2A 2CVDA 3GH9A 1XBSA 2LJRA 4YH2A 2K8SA 2DMLA 3HZ4A 3APSA 3UMAA 1AW9A 4V2MA 2RLIA 1K0AA 3TKSC 1OKTA 3LYPA 2OBIA 5J9BA 6GSXA 2GZYA 3Q6OA 2H6ZA 1HNCA 4PURA 5ECHB 1T00A 1TI3A 1YDKA 1E2YA 2H0IA 1DE2A 3TKSE 3F0IA 1YF1A 1H75A 5DQSA 5GAPD 3ZRDA 1SU9A 5DALB 3DVWA 4ECJA 3KMOA 4GQFA 2YWOA 2NTOA 4JR4A 5CO3A 1HYUA 2DMMA 2AYTA 5B8BA 4K9ZA 4EL1A 2MMOA 1V57A 3C1RA 1URMA 2OADA 4XS6A 1UA5A 1HQOA 5HQPA 3EMPA 1SKSB 2MMNA 4O5RA 3RAZA 2YOIA 3TKQA 3GH6A 1EP7A 4ML6A 4GSSA 4KDXA 1Y25A 1W89A 2IMIA 3KXOA 1U87A 1YJ6A 3EINA 1I9DA 1TTZA 1PRXA 5CRDA 5IIZA 2IL3A 1XW9A 5JCGA 5JWOB 4F9ZA 1ZOFA 2VCZA 2YV9A 9GSSA 1OE8A 2CV4A 5EL8A 2GZZA 4NAXA 2V41A 4OCFA 4PQIA 1XWGA 3AY8A 4WETA 2H1AA 2YJHA 4PUAA 4EKZA 1WOUA 1AXDA 1EWXA 14GSA 3NIVA 1DUGA 1K3YA 3P8WA 3APOA 4YAPA 1GNEA 3TKPA 2H71A 2WB9A 2HT9A 1CQHA 1QK8A 2FGXA 5FWGA 2VL3A 3HVVA 5HFGA 1V98A 3F4RA 2X99A 1ZCPA 2QGVA 3CRUA 1PSQA 1ILOA 2V32A 3BBYA 4NWYA 1TRUA 1UVZA 3D6IA 2PVOC 2ZCTA 2EIQA 4QL9A 2CA8A 2VLUA 4TKYA 2FD3A 2WS2A 4OO5A 1GSQA 2GT5A 4IGJA 20GSA 2F3MA 4DSSA 4EDZA 3MWHA 1FOVA 3L78A 2X8CA 2JZRA 1F6MC 1GULA 4HU9A 2LQQA 3LEFA 2PWJA 3DXBA 5FHIA 5IO0A 1OVNA 2VL2C 1BX9A 3RPNA 2LSTA 2B5YA 1T8EB 2AV4A 4XS1A 3E0UA 5DJLA 1CQGA 2DJ0A 1MDKA 5ECNB 1SK0A 5G1KA 3UBKA 3RHBA 4DEJA 4ZILA 4IJ3A 3OR5A 4TR1A 5IM9A 3C73A 3LXTA 1KBNA 1FW1A 2BTOT 1X0RA 1YKCA 1VF3A 3VK9A 2DJJA 1ZYQB 5DJMA 3GN3A 3CXGA 1F3BA 3O76A 3VURA 3CMIA 1F9MA 2PGTA 4TR4A 3IR4A 4BL7A 4OWYA 2J23A 4ACSA 4KSOA 3P2AA 1UC7A 2XHFA 1C72A 3L0HA 2HE3A 3H93A 5H5RA 4WBJA 1NM3A 3GV1A 1PA3A 4GQCA 5CP1A 3WGDA 3RBTA 1JHBA 3IOSA 1TW9A 3F63A 1A0RP 3BJ5A 4IKHA 4H86A 2H0HA 1ZGNA 4JR6A 5ECMB 1R26A 4MPFA 2I9HA 4FIWA 4KE3A 4HUAA 2RIIA 2B3SA 2RUFA 5ECOB 5ELAA 4X1UA 3F4TA 2OACA 3GKKA 3TKRA 3I69A 1HD2A 3QFBC 1ERWA 3QOUA 3GRXA 1H4OA 1TRVA 5INYA 1EEMA 1X5DA 2R4VA 4KB3A 4ZL9A 5IO2A 1B48A 1FO5A 2L4QA 6GSSA 2R2JA 3GUSA 3L9VA 2H6YA 2IN3A 4POBA 5H5QA 4V1Ag 4L0WA 1FVKA 3GKNA 4KSMA 5AGYA 4MF5A 4YQMA 5ECIB 1TK8B 1T4ZA 2H01A 4ZB6A 2PUKC 3QAWA 3VPTA 4K0NA 2X8HA 4G19A 1PX7A 2MMZA 3QPMA 3CYNA 1O73A 2FWEA 3P7XA 1GLQA 2N5FA 4KGIA 4TXVA 5IMVA 3GKMA 2IFQB 4IBPA 2VM1A 2CZ2A 1Z6NA 1BEDA 3VI5A 1AQWA 2LQOA 1VF2A 4JEDA 2HNLA 3HZ8A 3DEXA 1XW5A 1S3CA 1TRSA 2Z9SA 5ECPB 2HRFA 1XOAA 5IMFA 4BA7A 1O81A 4ULXA 1THXA 2H8LA 1GUMA 1QGVA 5ELGA 2ZUPA 4L5OA 3BOAA 1ZL9A 3GTUA 4HU7A 4KCEA 3WT2A 5ID2A 2YZHA 2E2MA 3RHCA 3UARA 4LMVA 2IIYA 3ERGA 4BVYA 3IK7A 4E8EA 2KOKA 1PQNA 4KH7A 1G0TA 1EV9A 8GSSA 2AJQB 3G7IA 2V6KA 1X5CA 3HJMA 4X0XA 2B1LA 2LKUA 3M3MA 2OE0A 1TK5B 3HXSA 3ZZXA 4MDCA 5DQYA 4XCSA 4GRFA 2C1YA 2FHEA 3KCMA 2LNSA 2YP6A 3ZTLA 1Z3EA 4F82A 3A3TA 3MDKA 3QD9A 1M0UA 1GWCA 4MA9A 4AJ7A 1B4QA 2ON5A 4WKWA 1QMVA 4ECBA 5ENUA 4IQAA 4AJ6A 2O8VB 2H76A 4I8BA 5GSSA 3DD3A 4IQ1A 4IVFA 5DVBA 1GUKA 1ST9A 2JZSA 2GDRA 4OO4A 2F8AA 3O6TA 1OC8A 4ZB8A 2DJ2A 1TU8A 4WF4A 3A2XA 5J3RA 4MH2A 2IMEA 1XIYA 5FT3A 1FVJA 3QCPA 1KTEA 1T4YA 3L4NA 5A4WA 4NHWA 3GURA 3EU3A 3LORA 4RQRA 3LG6A 1SJZA 4N11A 1GTUA 2GSRA 4MCUA 3MAKA 1PX6A 2CVBA 3LSZA 1M2BA 4KA0A 2DJ1A 4KDYA 2FY6A 4KCAA 3GL3A 1OE7A 4MP4A 1JLWA 2DC5A 5HFKA 5HR2A 3TB2A 4HOJA 2J9HA 3EU4A 1U3IA 5IMZA 1BQ7A 1TRWA 1M9AA 1A0FA 2I81A 5IPGA 2JSZA 4WR5A 1MD3A 3LJRA 2O89A 3KEBA 1V40A 2VCWA 3Q19A 2PERA 2VCVA 4TVEA 3BD2A 3UBLA 5CRHA 1ERVA 2LJAA 2PMTA 3DRNA 1I5GA 3F8UA 2O7KA 4PX1A 3GYKA 2KP2A 2LS5A 2H1GA 3ZYWA 4K1FA 4KDUA 3F9UA 1EGOA 4PNFA 4F0BA 1GUHA 1S3AA 3N9JA 5GSTA 1Z7PA 1WWJA 3HHVA 4MJEA 1K3LA 3E3EA 4EO3A 2YN1A 1WE0A 2F8FA 1T1VA 4Q5NA 3IAM2 1XPVA 5COHA 3IXRA 2HZEA 2AHEA 4PGTA 2LTKA 4GCIA 3FRCA 2EIRA 1M2AA 2WGRA 5IQYA 3DMLA 4L0UA 3ZMLA 4MJCA 2NVLA 4I2UA 4J2FA 1DE1A 4K8MA 4D73A 4MZCA 3VWVA
chains in the Genus database with same CATH superfamily
2IJYA 3GIXA 2CAQA 2O87A 3A2VA 4WR4A 3GX0A 3HYPA 4FYBA 4TRXA 4E8HA 3LXZA 1GTAA 7GSSA 4MMMA 4X4JA 2R3XA 5E4WA 1MDIA 2GQMA 4EC0A 2DLXA 1YEPA 4N0ZA 5D93A 3H8QA 1U88A 2IWTA 1K3OA 1NHOA 5HR3A 1BAYA 2PN8A 1SD9A 4O32A 2VO4A 5J9CA 1ERTA 2KUCA 2R0PA 3LGCA 4JU5A 2BJXA 2GSTA 1TKDB 4TR3A 2WZ9A 4IP1A 5EPFA 4GLTA 3C8EA 2H1BA 4JRRA 4BIKA 3FZAA 2I3YA 5JCWA 2I1UA 4HQSA 2R6KA 3C7MA 5LNKe 2GQLA 5A5KA 3CSIA 1ACVA 2FWGA 3FZ4A 1NW2A 2R5GA 5KN0A 1HNBA 1VF4A 1A2LA 2VCQA 4F0CA 1ZMAA 1WJKA 1Z5YE 5J5NA 1RQMA 4J56E 4K7NA 3TOTA 2NPBA 5KN3A 1XCCA 1XZOA 2DJ3A 2LV3A 4RI6A 1OC9B 4IHUA 2YJ7A 3CTGA 2F9SA 3M0FA 2HYXA 3UIWA 4J57E 3EC3A 4P3YB 4ZXGA 1GSEA 1O8XA 3U6VA 3KTBA 1M3JA 3QAGA 3ZVJD 2XBIA 2P31A 3IHQA 3TRPA 5EY6A 4O5UA 4FQUA 1EOGA 2A4VA 3UVTA 4FO5A 2C80A 3G9BA 3WGXA 4MPGA 1R4WA 2QC7A 4OFTA 5CRWA 1SYXA 3F3RA 2GTUA 1KEBA 2G2QA 1O6JA 5EVOA 2I4AA 2FA4A 3IE3A 3FK8A 4XRDA 3FEUA 1IYIA 22GSA 5G5EA 2WDUA 5ABRA 5KOXA 3D5JA 2YWNA 3DKSA 4HQZA 4QQ7A 2IMKA 4IELA 4HJ2A 4OD7A 2L57A 3TKSA 2CT6A 3WT1A 5DAKB 1O8WA 1F3AA 4MZWA 3GA4A 1XWCA 2MBSA 4ISDA 4KW6A 1XFLA 2E0QA 5KN2A 2LEGA 4DSSB 5D9WA 3TJKA 4BVXA 1SL0B 5AN1A 2L5LA 3UVHA 3D22A 2C0EA 3ERFA 4KF9A 4GXZA 5G1LA 2HI7A 1JZRA 2YNXA 3FYGA 3F3QA 2A2SA 2C0GA 1YQ1A 3NOFA 2PU9C 4ZBDA 2DKHA 3QFAC 1AQXA 1AIUA 5CYYA 4EVMA 4V1Ap 1A8YA 4ID0A 2HSHA 3A2WA 3TDGA 2OKAA 3ZIVA 2LUSA 4EF0A 3IPZA 5IOWA 3C1SA 3M9JA 2KLXA 1BG5A 4TXOB 4G0KA 4MH3A 2OBKA 4POMA 1G7OA 2ON7A 4PXOA 17GSA 1Z7RA 3O3TA 1FB0A 3HDCA 4PUFC 4HI7A 2OA7A 3GHAA 2GLRA 1PN9A 2C8UA 2B5EA 3IC4A 4XS4B 1BYEA 3GX8A 2XPEA 3C71A 2H19A 1Q98A 2JADA 2LRTA 4Z7XA 3WD6A 1THOA 1TI1A 1JFUA 1ML6A 5KEJA 2YWMA 5HR1A 4ZBBA 1FHEA 3N5OA 2R37A 1SYRA 1WRYA 2FLSA 3VLNA 3S9FA 3LWAA 4K0GA 4NXIA 5CREA 1Y6EA 2B7KA 3HVNA 2E7PA 2AUVA 3SWLA 4AGSA 3PGTA 1EGRA 1WIKA 3A5WA 3KM6A 2NDOA 4FH8A 3EMXA 1TJDA 1XWBA 5IOXA 1GNWA 3L9UA 2A2RA 5F8BA 3P90A 2VD0A 3IAS2 1FAAA 3GSTA 3F6FA 3GFKA 1K0DA 2L4CA 4HDEA 3VWXA 1DBYA 3KH9A 3VFIA 1F37A 3VWWA 3QR6A 2OE3A 4DSRA 5KN1A 3HA9A 5F05A 4OFNA 3Q74A 1X9WB 3ZVJA 3D0ZA 2C0FA 2LRNA 1B8XA 4L8EA 3CTFA 4CDOA 4KAEA 2GGTA 2M80A 4MLYA 4JBBA 3DGQA 3I6AA 1PGTA 16GSA 2XC2A 2P5QA 4F2IA 3ZFBA 4MJBA 5KOWA 4AF2A 5ECRB 3QDNA 4XIHA 4POLA 5J41A 2VOCA 1PKWA 3F6DA 1X5EA 3DIEA 2LJKA 2VL2A 1W4VA 3WGEA 1SENA 4I6XA 4PTSA 1M2DA 2H74A 3V1WA 2GS3A 2RM6A 1B9YC 4ZL8A 1JZOA 1GSUA 4PQHA 2V6OA 4LLRA 2CVKA 4O92A 3TRXA 1YZXA 2HZFA 18GSA 2TIRA 5IMAA 3GNJA 3R3EA 3J7Yb 3KJYA 4MABA 1ZYEA 1TP9A 3I9V2 2H72A 4GF0A 3TCOA 4LL1B 3TUEA 3GTUB 5F06A 3TGZA 2K6VA 2GZPA 5ID2B 2IMDA 1QQ2A 3CSJA 1O7UA 4EUYA 5ECQB 1K0MA 4BVYB 4KNDA 4FYCA 5CAXA 1HNAA 1OYJA 1A23A 2XPDA 1TXXA 2AB6A 5D96A 5DALA 4Q5RA 1GP1A 2JU5A 5D9VA 2H6XA 1PFOA 2LRCA 1XW6A 5BRTA 2PBJA 4OFMA 4POKA 1AAZA 4BPYA 1OC3A 4MZBA 1J08A 5D73A 1V9WA 4HZ2A 3ZL5A 1YF0A 4NMUA 2VD1A 3LQ7A 2QA1A 4ILFA 3IV4A 3UAPA 1X9MB 4JZQA 5G2ZA 5GZZB 4TOPA 4K5SA 4NV2A 4MF6A 5D8IA 4EDYA 5CRGA 4I2TA 4YQUA 2GSQA 1XOBA 2X8GA 3HVXA 1V58A 2H66A 2WJUA 5A4UA 3UEMA 2QA2A 2X64A 3ME8A 5LD0A 4RUVA 2YZUA 1GH2A 4JE1A 4Z2RA 4ML1A 4GTUA 1GSDA 2YV7A 4IS0A 1U6TA 3KD0A 1YY7A 4GWRA 2H73A 2L5OA 4WEYA 1J0FA 4IN0A 2B7JA 2CAIA 3HJPA 2K8VA 2GT6A 2A4HA 1J9BA 1WMJA 5IMCA 1AC1A 1MDJA 2FUG2 1K0BA 4EIPA 3DVXA 3Q18A 1WP0A 4FYUA 2WULA 3EWLA 3HJOA 4N0VA 3KIJA 3MIXA 1A2JA 3ZIJA 1QUWA 3D21A 3IRAA 3US3A 5IMDA 4NPBA 1JLVA 3ERWA 2HSMA 3VWUA 1Z9HA 3MNGA 2KP1A 2H75A 4BWQA 3SBCA 2HSYA 2YPMA 1RK4A 1TOFA 1GSFA 5B6NA 2EIOA 2B5XA 5HFIA 5B8AA 4K2DA 3LYKA 3ZFLA 1VRSD 4MK3A 3BCKA 2GVPA 2O85A 13GSA 5DBQA 2B6MA 4TW5A 2N5AA 3FY7A 2K18A 2ZNMA 2M72A 3DYRA 1USBA 1SJIA 4OMVA 3HY2A 2IPAA 5L71A 1PD21 3KH7A 1R7HA 1RW1A 1E6BA 2FA8A 2N5BA 4IP6A 2H1DA 1OC9A 3IA1A 3PINA 4LL4B 1V2AA 2C4JA 3RDWA 2DBCA 3CSHA 3KP8A 4ZBAA 1XWAA 1XVQA 3KGKA 1T7PB 3RPPA 3I43A 4HS1A 4ZB9A 4F03A 1EEJA 2HZEB 2TRXA 4K7IA 4OCEA 5D9XA 1YEXA 3MSZA 2VAFA 3GKXA 2OJLA 2FWHA 4ZIJA 1GSYA 2L6CA 3D4MA 4D73B 3KTLA 3EVIA 2K9FA 5G5FA 3HVSA 3M9KA 1XVWA 3ZITA 3TJGA 5DAKA 3ED3A 1K0OA 1EV4A 1Z6MA 3EURA 4G10A 4RI7A 5J4UA 3APQA 4XRAA 1BJXA 4G0IA 3KMNA 1A8LA 4LA1A 10GSA 1NHYA 5GAND 1PL1A 3TJFA 2M46A 3WYWA 2OE1A 2H0GA 2HXKA 1ERUA 2RUEA 3FHKA 2QSIA 2GQKA 5JWQB 1R5PA 4EE0A 5D9TA 5JCUA 1N2AA 19GSA 1S3DA 4MNNA 3A5IA 4N30A 5DDLA 3IBHA 2DJKA 1SD8A 4TN8A 3VI7A 3H79A 3CRTA 3UL3A 1EOHA 3R2QA 4I5QA 2DIZA 1GL8A 2GSSA 4TXOA 3GMFA 4K7OA 1NSWA 1Q4JA 4HZ4A 4G0LA 4BWSA 2MBTA 2L59A 3IDVA 1VGLA 3GSSA 2XBQA 3W6GA 2C0DA 4I97A 2VL9A 3KP9A 3H4KA 5F07A 1M99A 4CW9A 4XHMA 4XS4A 4WXTA 3M8NA 1F2EA 1M9BA 1XXUA 3ZLPA 2RM5A 1X9SB 12GSA 2C3NA 3FKFA 4Q5FA 5CNWA 3K8NA 5ECLB 4NV5A 3TOUA 4DSQA 2PPTA 3H1NA 2YCDA 4USSA 3W8JA 2MZCA 5B7CA 1B4PA 1OAZA 4IJIA 1ABAA 3QMXA 3UJ1A 4K6XA 4K5RA 4ICYA 1M7TA 4EXJA 2H30A 2FCHA 1R5AA 1MD4A 4TR1B 1PKZA 3FW2A 4WBRD 2JACA 1FG4A 2NBSA 2CX3A 3ZMKA 2C3QA 4KUNA 4KX4A 2IFQA 2F51A 5AISA 2H70A 2REMA 2VLTA 1LBKA 1ZYNA 5H5SA 4V2LA 2MYGA 5ECKB 1MTCA 5B6MA 4HEA2 4NHZA 1SK1A 4BL7B 5A4VA 3TJBA 2E2GA 1PMTA 5C00A 4XTSA 3ME7A 1OKDA 5E59A 2DIYA 4MJAA 2CZ3A 2DSAA 4QL7A 3BCIA 1FB6A 4YQVA 2WFCA 6GSWA 4HJMA 3U5RE 2V1MA 1SL1B 1SL2B 3M1GA 3HKRA 3FR3A 4O7HA 1K0CA 2QKEA 2HRNA 2V2GA 2BMXA 1G6WA 2JZTA 1B9XC 3TRQA 5LCZA 3FR6A 3PH9A 3UOMA 2HLSA 1AQVA 3GL5A 3J7Yk 4RQXA 2B1KA 2P5RA 1IYHA 3FR9A 2CX4A 4Q5QA 1SK2A 3KZQA 2YANA 2VCXA 3ZREA 4GSNA 3TJJA 1LJRA 1T3BA 5JWRB 2HRAA 1DSBA 3NZNA 3FZ9A 3HD5A 5AIVA 2JSYA 3D4TA 4G2EA 1ZYPA 4CY6A 6GSUA 1A24A 4ECIA 2VCTA 1A2MA 2YWIA 1QXHA 1EZKA 4AJ8A 4V2NA 3EPTA 2LNTA 6GSYA 4HSCX 1SJ6A 3G7JA 1YKAA 2WRTA 3VPQA 2PVQA 3EE2A 3QAVA 1O85A 2P0GA 6GSVA 1VF1A 3FZ5A 4TR0A 6GSTA 1N8JA 4ECCA 1KNGA 3EYTA 1MEKA 1G6YA 4L5LA 4PQ1A 2DKIA 3E9JB 3LFLA 4GSTA 3W8SA 1GSSA 1JZWA 3L9SA 2VUPA 2WCIA 2CQ9A 3PR8A 2AAWA 2ES7A 4CHSA 3HCZA 3JCML 2L6DA 4DVCA 1SKWB 1TK0B 1QFNA 4IW9A 4MF7A 5DCGA 2TRCP 1WPIA 2VM2A 3F4SA 5AIXA 1TDIA 1EP8A 4YAVA 4LMWA 5C04A 4K2XA 11GSA 2G0FA 5IPHA 4N10A 1U3AA 1ZZYA 1GLPA 5ECSA 1XWKA 4PNGA 2MMAA 3ISOA 1G7EA 5F0GA 2D2ZA 5HR0A 4WF5A 2C3TA 4ZL7A 3DWVA 1GTBA 1K0NA 2VIMA 2ALBA 3G7YA 2KHPA 2FNOA 1AUCA 4X43A 3CQFA 1SKRB 5G31A 5G30A 1GTIA 1LU4A 2VLVA 4Z2UA 3CBUA 5DCHA 2HFDA 2FWFA 1ON4A 1TU7A 3IK9A 1GRXA 4EIQA 1UN2A 2EC4A 1JZDA 2IMFA 2JL4A 4G9HA 1PL2A 2CVDA 3GH9A 1XBSA 2LJRA 4YH2A 2K8SA 2DMLA 3HZ4A 3APSA 3UMAA 1AW9A 4V2MA 2RLIA 1K0AA 3TKSC 1OKTA 3LYPA 2OBIA 5J9BA 6GSXA 2GZYA 3Q6OA 2H6ZA 1HNCA 4PURA 5ECHB 1T00A 1TI3A 1YDKA 1E2YA 2H0IA 1DE2A 3TKSE 3F0IA 1YF1A 1H75A 5DQSA 5GAPD 3ZRDA 1SU9A 5DALB 3DVWA 4ECJA 3KMOA 4GQFA 2YWOA 2NTOA 4JR4A 3IHGA 5CO3A 1HYUA 2DMMA 2AYTA 5B8BA 4K9ZA 4EL1A 2MMOA 1V57A 3C1RA 1URMA 2OADA 4XS6A 1UA5A 2X4AA 1HQOA 5HQPA 3EMPA 1SKSB 2MMNA 4O5RA 3RAZA 2YOIA 3TKQA 3GH6A 1EP7A 4ML6A 4GSSA 4KDXA 1Y25A 1W89A 2IMIA 3KXOA 1U87A 1YJ6A 3EINA 1I9DA 1TTZA 1PRXA 5CRDA 5IIZA 2IL3A 1XW9A 5JCGA 5JWOB 1S3RA 4F9ZA 1ZOFA 2VCZA 2YV9A 9GSSA 1OE8A 2CV4A 5EL8A 2GZZA 4NAXA 2V41A 4OCFA 4PQIA 1XWGA 3AY8A 4WETA 2H1AA 2YJHA 4PUAA 1PN0A 4EKZA 1WOUA 1AXDA 1EWXA 14GSA 3NIVA 4O5QA 2A2PA 1DUGA 1K3YA 3P8WA 3APOA 4YAPA 1GNEA 3PPUA 3TKPA 5BMUA 2H71A 2WB9A 2UZ8A 2HT9A 1CQHA 1QK8A 2FGXA 5FWGA 2VL3A 3HVVA 5HFGA 1V98A 3F4RA 2X99A 1ZCPA 2QGVA 3CRUA 1PSQA 1ILOA 2V32A 3BBYA 4NWYA 2R0GA 1TRUA 1UVZA 3D6IA 2PVOC 2ZCTA 2EIQA 4QL9A 2CA8A 2VLUA 4TKYA 2FD3A 2WS2A 4OO5A 1GSQA 2GT5A 4IGJA 20GSA 2F3MA 3LW9A 4DSSA 4EDZA 3MWHA 1FOVA 3L78A 2X8CA 2JZRA 1F6MC 1GULA 4HU9A 2LQQA 3LEFA 2PWJA 3DXBA 5FHIA 5IO0A 1OVNA 2VL2C 1BX9A 3RPNA 2LSTA 2B5YA 1T8EB 2AV4A 4XS1A 3E0UA 5DJLA 1CQGA 2DJ0A 1MDKA 5ECNB 1SK0A 5G1KA 3UBKA 3RHBA 4DEJA 4ZILA 4IJ3A 3IC8A 3OR5A 4TR1A 5IM9A 3C73A 3LXTA 1KBNA 1M3IA 1FW1A 2BTOT 1X0RA 1YKCA 1VF3A 3VK9A 2DJJA 1ZYQB 5DJMA 3GN3A 1FOHA 3CXGA 1F3BA 3O76A 3VURA 3CMIA 1F9MA 2PGTA 4TR4A 3IR4A 4BL7A 4OWYA 2J23A 4YKFA 4ACSA 4KSOA 3P2AA 1UC7A 2XHFA 1C72A 3L0HA 2HE3A 3H93A 5H5RA 4WBJA 1NM3A 3GV1A 1PA3A 4GQCA 5CP1A 3WGDA 3RBTA 1JHBA 3IOSA 1TW9A 3F63A 1A0RP 3BJ5A 4IKHA 4H86A 2H0HA 1ZGNA 4JR6A 5ECMB 3MYDA 1R26A 4MPFA 2I9HA 4FIWA 4KE3A 4HUAA 2RIIA 2B3SA 2RUFA 5ECOB 5ELAA 4X1UA 3F4TA 2OACA 3GKKA 3TKRA 3I69A 1HD2A 3QFBC 1ERWA 3QOUA 3GRXA 4CY8A 1H4OA 1TRVA 4BVXB 5INYA 1EEMA 1X5DA 2R4VA 4KB3A 4ZL9A 5IO2A 1B48A 1FO5A 2L4QA 6GSSA 2R2JA 3GUSA 3L9VA 2H6YA 2IN3A 4POBA 5H5QA 4V1Ag 4L0WA 1FVKA 3GKNA 4KSMA 5AGYA 4Z2TA 4MF5A 4YQMA 5ECIB 1TK8B 1T4ZA 2H01A 4ZB6A 2PUKC 3QAWA 3VPTA 4K0NA 2X8HA 4G19A 1PX7A 2MMZA 3QPMA 3CYNA 1O73A 2FWEA 3P7XA 1GLQA 2N5FA 4KGIA 4TXVA 5IMVA 3GKMA 2IFQB 4IBPA 2VM1A 2CZ2A 1Z6NA 1BEDA 3VI5A 1AQWA 2LQOA 1VF2A 4JEDA 2HNLA 3HZ8A 3DEXA 1XW5A 4YKGA 1S3CA 1TRSA 2Z9SA 5ECPB 2HRFA 1XOAA 5IMFA 4BA7A 1O81A 4ULXA 1THXA 2H8LA 1GUMA 1QGVA 5ELGA 2ZUPA 4L5OA 3BOAA 1ZL9A 3GTUA 4HU7A 4KCEA 3WT2A 5ID2A 2YZHA 2E2MA 3RHCA 3UARA 4LMVA 2IIYA 3ERGA 4BVYA 3IK7A 4E8EA 2KOKA 1PQNA 4KH7A 1G0TA 1EV9A 8GSSA 2AJQB 3G7IA 2V6KA 1X5CA 4A5PA 3HJMA 4X0XA 2B1LA 2LKUA 3M3MA 2OE0A 1TK5B 3HXSA 3ZZXA 4MDCA 5DQYA 4XCSA 4GRFA 2C1YA 2FHEA 3KCMA 2LNSA 2YP6A 3ZTLA 1Z3EA 4F82A 3A3TA 3MDKA 3QD9A 1M0UA 1GWCA 4MA9A 4AJ7A 1B4QA 2ON5A 4WKWA 1QMVA 3FMWA 4ECBA 5ENUA 4IQAA 4AJ6A 2O8VB 2H76A 4I8BA 5GSSA 3DD3A 4IQ1A 4IVFA 5DVBA 1GUKA 1ST9A 2JZSA 2GDRA 4OO4A 2F8AA 3O6TA 1OC8A 4ZB8A 2DJ2A 1TU8A 4WF4A 3A2XA 5J3RA 4MH2A 2IMEA 1XIYA 5FT3A 2HRKA 1FVJA 3QCPA 1KTEA 1T4YA 3L4NA 5A4WA 4NHWA 3GURA 2X49A 3EU3A 1XG8A 3LORA 4RQRA 3LG6A 1SJZA 4N11A 1GTUA 2GSRA 4MCUA 3MAKA 1PX6A 2CVBA 3LSZA 1M2BA 4KA0A 2DJ1A 4KDYA 2FY6A 4KCAA 3GL3A 1OE7A 4MP4A 1JLWA 2DC5A 5HFKA 5HR2A 3TB2A 4HOJA 2J9HA 3EU4A 1U3IA 5IMZA 1BQ7A 1TRWA 1M9AA 1A0FA 2I81A 5IPGA 2JSZA 4WR5A 1MD3A 3LJRA 2O89A 3KEBA 1V40A 2VCWA 3Q19A 2PERA 2VCVA 2R0CA 4TVEA 3BD2A 3UBLA 5CRHA 1ERVA 2LJAA 2PMTA 3DRNA 1I5GA 3F8UA 2O7KA 4PX1A 3GYKA 2KP2A 2LS5A 2H1GA 3ZYWA 4K1FA 4KDUA 3F9UA 1EGOA 4PNFA 4F0BA 1GUHA 1S3AA 3N9JA 5GSTA 1Z7PA 1WWJA 3HHVA 4MJEA 1K3LA 3E3EA 4EO3A 2YN1A 1WE0A 2F8FA 1T1VA 4Q5NA 3IAM2 1XPVA 5COHA 3IXRA 2HZEA 2AHEA 4PGTA 2LTKA 4GCIA 3FRCA 2EIRA 1M2AA 2WGRA 5IQYA 3DMLA 4L0UA 3ZMLA 4MJCA 2NVLA 4I2UA 4J2FA 1DE1A 4K8MA 4D73A 4MZCA 3VWVA
chains in the Genus database with same CATH topology
2IJYA 3GIXA 2CAQA 2O87A 3A2VA 4WR4A 3GX0A 3HYPA 4FYBA 4TRXA 4E8HA 3LXZA 1GTAA 7GSSA 4MMMA 4X4JA 2R3XA 5E4WA 1MDIA 2GQMA 4EC0A 2DLXA 1YEPA 4N0ZA 5D93A 3H8QA 1U88A 2IWTA 1K3OA 1NHOA 5HR3A 1BAYA 2PN8A 1SD9A 4O32A 2VO4A 5J9CA 1ERTA 2KUCA 2R0PA 3LGCA 4JU5A 2BJXA 2GSTA 1TKDB 4TR3A 2WZ9A 4IP1A 5EPFA 4GLTA 3C8EA 2H1BA 4JRRA 3FZAA 2I3YA 5JCWA 2I1UA 4HQSA 2R6KA 3C7MA 5LNKe 2GQLA 5A5KA 3CSIA 1ACVA 2FWGA 3FZ4A 1NW2A 2R5GA 5KN0A 1HNBA 1VF4A 1A2LA 2VCQA 4F0CA 1ZMAA 1WJKA 1Z5YE 5J5NA 1RQMA 4J56E 4K7NA 3TOTA 2NPBA 5KN3A 1XCCA 1XZOA 2DJ3A 2LV3A 4RI6A 1OC9B 4IHUA 2YJ7A 3CTGA 2F9SA 3M0FA 2HYXA 3UIWA 4J57E 3EC3A 4P3YB 4ZXGA 1GSEA 1O8XA 3U6VA 3KTBA 3QAGA 3ZVJD 2XBIA 2P31A 3IHQA 3TRPA 5EY6A 4O5UA 4FQUA 1EOGA 2A4VA 3UVTA 4FO5A 2C80A 3G9BA 3WGXA 4MPGA 1R4WA 2QC7A 4OFTA 5CRWA 1SYXA 3F3RA 2GTUA 1KEBA 2G2QA 1O6JA 5EVOA 2I4AA 2FA4A 3IE3A 3FK8A 4XRDA 3FEUA 1IYIA 22GSA 5G5EA 2WDUA 5ABRA 5KOXA 3D5JA 2YWNA 3DKSA 4HQZA 4QQ7A 2IMKA 4IELA 4HJ2A 4OD7A 2L57A 3TKSA 2CT6A 3WT1A 5DAKB 1O8WA 1F3AA 4MZWA 3GA4A 1XWCA 2MBSA 4ISDA 4KW6A 1XFLA 2E0QA 5KN2A 2LEGA 4DSSB 5D9WA 3TJKA 4BVXA 1SL0B 5AN1A 2L5LA 3UVHA 3D22A 2C0EA 3ERFA 4KF9A 4GXZA 5G1LA 2HI7A 1JZRA 2YNXA 3FYGA 3F3QA 2A2SA 2C0GA 1YQ1A 3NOFA 2PU9C 4ZBDA 2DKHA 3QFAC 1AQXA 1AIUA 5CYYA 4EVMA 4V1Ap 1A8YA 4ID0A 2HSHA 3A2WA 3TDGA 2OKAA 3ZIVA 2LUSA 4EF0A 3IPZA 5IOWA 3C1SA 3M9JA 2KLXA 1BG5A 4TXOB 4G0KA 4MH3A 2OBKA 4POMA 1G7OA 2ON7A 4PXOA 17GSA 1Z7RA 3O3TA 1FB0A 3HDCA 4PUFC 4HI7A 2OA7A 3GHAA 2GLRA 1PN9A 2C8UA 2B5EA 3IC4A 4XS4B 1BYEA 3GX8A 2XPEA 3C71A 2H19A 1Q98A 2JADA 2LRTA 4Z7XA 3WD6A 1THOA 1TI1A 1JFUA 1ML6A 5KEJA 2YWMA 5HR1A 4ZBBA 1FHEA 3N5OA 2R37A 1SYRA 1WRYA 2FLSA 3VLNA 3S9FA 3LWAA 4K0GA 4NXIA 5CREA 1Y6EA 2B7KA 2E7PA 2AUVA 3SWLA 4AGSA 3PGTA 1EGRA 1WIKA 3A5WA 3KM6A 2NDOA 4FH8A 3EMXA 1TJDA 1XWBA 5IOXA 1GNWA 3L9UA 2A2RA 5F8BA 3P90A 2VD0A 3IAS2 1FAAA 3GSTA 3F6FA 3GFKA 1K0DA 2L4CA 4HDEA 3VWXA 1DBYA 3KH9A 3VFIA 1F37A 3VWWA 3QR6A 2OE3A 4DSRA 5KN1A 3HA9A 5F05A 4OFNA 3Q74A 1X9WB 3ZVJA 3D0ZA 2C0FA 2LRNA 1B8XA 4L8EA 3CTFA 4CDOA 4KAEA 2GGTA 2M80A 4MLYA 4JBBA 3DGQA 3I6AA 1PGTA 16GSA 2XC2A 2P5QA 4F2IA 3ZFBA 4MJBA 5KOWA 4AF2A 5ECRB 3QDNA 4XIHA 4POLA 5J41A 2VOCA 1PKWA 3F6DA 1X5EA 3DIEA 2LJKA 2VL2A 1W4VA 3WGEA 1SENA 4I6XA 4PTSA 1M2DA 2H74A 3V1WA 2GS3A 2RM6A 1B9YC 4ZL8A 1JZOA 1GSUA 4PQHA 2V6OA 4LLRA 2CVKA 4O92A 3TRXA 1YZXA 2HZFA 18GSA 2TIRA 5IMAA 3GNJA 3R3EA 3J7Yb 3KJYA 4MABA 1ZYEA 1TP9A 3I9V2 2H72A 4GF0A 3TCOA 4LL1B 3TUEA 3GTUB 5F06A 3TGZA 2K6VA 2GZPA 5ID2B 2IMDA 1QQ2A 3CSJA 1O7UA 4EUYA 5ECQB 1K0MA 4BVYB 4KNDA 4FYCA 5CAXA 1HNAA 1OYJA 1A23A 2XPDA 1TXXA 2AB6A 5D96A 5DALA 4Q5RA 1GP1A 2JU5A 5D9VA 2H6XA 2LRCA 1XW6A 5BRTA 2PBJA 4OFMA 4POKA 1AAZA 4BPYA 1OC3A 4MZBA 1J08A 5D73A 1V9WA 4HZ2A 3ZL5A 1YF0A 4NMUA 2VD1A 3LQ7A 2QA1A 4ILFA 3IV4A 3UAPA 1X9MB 4JZQA 5G2ZA 5GZZB 4TOPA 4K5SA 4NV2A 4MF6A 5D8IA 4EDYA 5CRGA 4I2TA 4YQUA 2GSQA 1XOBA 2X8GA 3HVXA 1V58A 2H66A 2WJUA 5A4UA 3UEMA 2QA2A 2X64A 3ME8A 5LD0A 4RUVA 2YZUA 1GH2A 4JE1A 4Z2RA 4ML1A 4GTUA 1GSDA 2YV7A 4IS0A 1U6TA 3KD0A 1YY7A 4GWRA 2H73A 2L5OA 4WEYA 1J0FA 4IN0A 2B7JA 2CAIA 3HJPA 2K8VA 2GT6A 2A4HA 1J9BA 1WMJA 5IMCA 1AC1A 1MDJA 2FUG2 1K0BA 4EIPA 3DVXA 3Q18A 1WP0A 4FYUA 2WULA 3EWLA 3HJOA 4N0VA 3KIJA 3MIXA 1A2JA 3ZIJA 1QUWA 3D21A 3IRAA 3US3A 5IMDA 4NPBA 1JLVA 3ERWA 2HSMA 3VWUA 1Z9HA 3MNGA 2KP1A 2H75A 4BWQA 3SBCA 2HSYA 2YPMA 1RK4A 1TOFA 1GSFA 5B6NA 2EIOA 2B5XA 5HFIA 5B8AA 4K2DA 3LYKA 3ZFLA 1VRSD 4MK3A 3BCKA 2GVPA 2O85A 13GSA 5DBQA 2B6MA 4TW5A 2N5AA 3FY7A 2K18A 2ZNMA 2M72A 3DYRA 1USBA 1SJIA 4OMVA 3HY2A 2IPAA 5L71A 1PD21 3KH7A 1R7HA 1RW1A 1E6BA 2FA8A 2N5BA 4IP6A 2H1DA 1OC9A 3IA1A 3PINA 4LL4B 1V2AA 2C4JA 3RDWA 2DBCA 3CSHA 3KP8A 4ZBAA 1XWAA 1XVQA 3KGKA 1T7PB 3RPPA 3I43A 4HS1A 4ZB9A 4F03A 1EEJA 2HZEB 2TRXA 4K7IA 4OCEA 5D9XA 1YEXA 3MSZA 2VAFA 3GKXA 2OJLA 2FWHA 4ZIJA 1GSYA 2L6CA 3D4MA 4D73B 3KTLA 3EVIA 2K9FA 5G5FA 3HVSA 3M9KA 1XVWA 3ZITA 3TJGA 5DAKA 3ED3A 1K0OA 1EV4A 1Z6MA 3EURA 4G10A 4RI7A 5J4UA 3APQA 4XRAA 1BJXA 4G0IA 3KMNA 1A8LA 4LA1A 10GSA 1NHYA 5GAND 1PL1A 3TJFA 2M46A 3WYWA 2OE1A 2H0GA 2HXKA 1ERUA 2RUEA 3FHKA 2QSIA 2GQKA 5JWQB 1R5PA 4EE0A 5D9TA 5JCUA 1N2AA 19GSA 1S3DA 4MNNA 3A5IA 4N30A 5DDLA 3IBHA 2DJKA 1SD8A 4TN8A 3VI7A 3H79A 3CRTA 3UL3A 1EOHA 3R2QA 4I5QA 2DIZA 1GL8A 2GSSA 4TXOA 3GMFA 4K7OA 1NSWA 1Q4JA 4HZ4A 4G0LA 4BWSA 2MBTA 2L59A 3IDVA 1VGLA 3GSSA 2XBQA 3W6GA 2C0DA 4I97A 2VL9A 3KP9A 3H4KA 5F07A 1M99A 4CW9A 4XHMA 4XS4A 4WXTA 3M8NA 1F2EA 1M9BA 1XXUA 3ZLPA 2RM5A 1X9SB 12GSA 2C3NA 3FKFA 4Q5FA 5CNWA 3K8NA 5ECLB 4NV5A 3TOUA 4DSQA 2PPTA 3H1NA 2YCDA 4USSA 3W8JA 2MZCA 5B7CA 1B4PA 1OAZA 4IJIA 1ABAA 3QMXA 3UJ1A 4K6XA 4K5RA 4ICYA 1M7TA 4EXJA 2H30A 2FCHA 1R5AA 1MD4A 4TR1B 1PKZA 3FW2A 4WBRD 2JACA 1FG4A 2NBSA 2CX3A 3ZMKA 2C3QA 4KUNA 4KX4A 2IFQA 2F51A 5AISA 2H70A 2REMA 2VLTA 1LBKA 1ZYNA 5H5SA 4V2LA 2MYGA 5ECKB 1MTCA 5B6MA 4HEA2 4NHZA 1SK1A 4BL7B 5A4VA 3TJBA 2E2GA 1PMTA 5C00A 4XTSA 3ME7A 1OKDA 5E59A 2DIYA 4MJAA 2CZ3A 2DSAA 4QL7A 3BCIA 1FB6A 4YQVA 2WFCA 6GSWA 4HJMA 3U5RE 2V1MA 1SL1B 1SL2B 3M1GA 3HKRA 3FR3A 4O7HA 1K0CA 2QKEA 2HRNA 2V2GA 2BMXA 1G6WA 2JZTA 1B9XC 3TRQA 5LCZA 3FR6A 3PH9A 3UOMA 2HLSA 1AQVA 3GL5A 3J7Yk 4RQXA 2B1KA 2P5RA 1IYHA 3FR9A 2CX4A 4Q5QA 1SK2A 3KZQA 2YANA 2VCXA 3ZREA 4GSNA 3TJJA 1LJRA 1T3BA 5JWRB 2HRAA 1DSBA 3NZNA 3FZ9A 3HD5A 5AIVA 2JSYA 3D4TA 4G2EA 1ZYPA 4CY6A 6GSUA 1A24A 4ECIA 2VCTA 1A2MA 2YWIA 1QXHA 1EZKA 4AJ8A 4V2NA 3EPTA 2LNTA 6GSYA 1SJ6A 3G7JA 1YKAA 2WRTA 3VPQA 2PVQA 3EE2A 3QAVA 1O85A 2P0GA 6GSVA 1VF1A 3FZ5A 4TR0A 6GSTA 1N8JA 4ECCA 1KNGA 3EYTA 1MEKA 1G6YA 4L5LA 4PQ1A 2DKIA 3E9JB 3LFLA 4GSTA 3W8SA 1GSSA 1JZWA 3L9SA 2VUPA 2WCIA 2CQ9A 3PR8A 2AAWA 2ES7A 4CHSA 3HCZA 3JCML 2L6DA 4DVCA 1SKWB 1TK0B 1QFNA 4IW9A 4MF7A 5DCGA 2TRCP 1WPIA 2VM2A 3F4SA 5AIXA 1TDIA 1EP8A 4YAVA 4LMWA 5C04A 4K2XA 11GSA 2G0FA 5IPHA 4N10A 1U3AA 1ZZYA 1GLPA 5ECSA 1XWKA 4PNGA 2MMAA 3ISOA 1G7EA 5F0GA 2D2ZA 5HR0A 4WF5A 2C3TA 4ZL7A 3DWVA 1GTBA 1K0NA 2VIMA 2ALBA 3G7YA 2KHPA 2FNOA 1AUCA 4X43A 1SKRB 5G31A 5G30A 1GTIA 1LU4A 2VLVA 4Z2UA 3CBUA 5DCHA 2HFDA 2FWFA 1ON4A 1TU7A 3IK9A 1GRXA 4EIQA 1UN2A 2EC4A 1JZDA 2IMFA 2JL4A 4G9HA 1PL2A 2CVDA 3GH9A 1XBSA 2LJRA 4YH2A 2K8SA 2DMLA 3HZ4A 3APSA 3UMAA 1AW9A 4V2MA 2RLIA 1K0AA 3TKSC 1OKTA 3LYPA 2OBIA 5J9BA 6GSXA 2GZYA 3Q6OA 2H6ZA 1HNCA 4PURA 5ECHB 1T00A 1TI3A 1YDKA 1E2YA 2H0IA 1DE2A 3TKSE 3F0IA 1YF1A 1H75A 5DQSA 5GAPD 3ZRDA 1SU9A 5DALB 3DVWA 4ECJA 3KMOA 4GQFA 2YWOA 2NTOA 4JR4A 3IHGA 5CO3A 1HYUA 2DMMA 2AYTA 5B8BA 4K9ZA 4EL1A 2MMOA 1V57A 3C1RA 1URMA 2OADA 4XS6A 1UA5A 2X4AA 1HQOA 5HQPA 3EMPA 1SKSB 2MMNA 4O5RA 3RAZA 2YOIA 3TKQA 3GH6A 1EP7A 4ML6A 4GSSA 4KDXA 1Y25A 1W89A 2IMIA 3KXOA 1U87A 1YJ6A 3EINA 1I9DA 1TTZA 1PRXA 5CRDA 5IIZA 2IL3A 1XW9A 5JCGA 5JWOB 4F9ZA 1ZOFA 2VCZA 2YV9A 9GSSA 1OE8A 2CV4A 5EL8A 2GZZA 4NAXA 2V41A 4OCFA 4PQIA 1XWGA 3AY8A 4WETA 2H1AA 2YJHA 4PUAA 1PN0A 4EKZA 1WOUA 1AXDA 1EWXA 14GSA 3NIVA 4O5QA 2A2PA 1DUGA 1K3YA 3P8WA 3APOA 4YAPA 1GNEA 3PPUA 3TKPA 5BMUA 2H71A 2WB9A 2UZ8A 2HT9A 1CQHA 1QK8A 2FGXA 5FWGA 2VL3A 3HVVA 5HFGA 1V98A 3F4RA 2X99A 1ZCPA 2QGVA 3CRUA 1PSQA 1ILOA 2V32A 3BBYA 4NWYA 2R0GA 1TRUA 1UVZA 3D6IA 2PVOC 2ZCTA 2EIQA 4QL9A 2CA8A 2VLUA 4TKYA 2FD3A 2WS2A 4OO5A 1GSQA 2GT5A 4IGJA 20GSA 2F3MA 3LW9A 4DSSA 4EDZA 3MWHA 1FOVA 3L78A 2X8CA 2JZRA 1F6MC 1GULA 4HU9A 2LQQA 3LEFA 2PWJA 3DXBA 5FHIA 5IO0A 1OVNA 2VL2C 1BX9A 3RPNA 2LSTA 2B5YA 1T8EB 2AV4A 4XS1A 3E0UA 5DJLA 1CQGA 2DJ0A 1MDKA 5ECNB 1SK0A 5G1KA 3UBKA 3RHBA 4DEJA 4ZILA 4IJ3A 3IC8A 3OR5A 4TR1A 5IM9A 3C73A 3LXTA 1KBNA 1FW1A 2BTOT 1X0RA 1YKCA 1VF3A 3VK9A 2DJJA 1ZYQB 5DJMA 3GN3A 1FOHA 3CXGA 1F3BA 3O76A 3VURA 3CMIA 1F9MA 2PGTA 4TR4A 3IR4A 4BL7A 4OWYA 2J23A 4YKFA 4ACSA 4KSOA 3P2AA 1UC7A 2XHFA 1C72A 3L0HA 2HE3A 3H93A 5H5RA 4WBJA 1NM3A 3GV1A 1PA3A 4GQCA 5CP1A 3WGDA 3RBTA 1JHBA 3IOSA 1TW9A 3F63A 1A0RP 3BJ5A 4IKHA 4H86A 2H0HA 1ZGNA 4JR6A 5ECMB 3MYDA 1R26A 4MPFA 2I9HA 4FIWA 4KE3A 4HUAA 2RIIA 2B3SA 2RUFA 5ECOB 5ELAA 4X1UA 3F4TA 2OACA 3GKKA 3TKRA 3I69A 1HD2A 3QFBC 1ERWA 3QOUA 3GRXA 4CY8A 1H4OA 1TRVA 4BVXB 5INYA 1EEMA 1X5DA 2R4VA 4KB3A 4ZL9A 5IO2A 1B48A 1FO5A 2L4QA 6GSSA 2R2JA 3GUSA 3L9VA 2H6YA 2IN3A 4POBA 5H5QA 4V1Ag 4L0WA 1FVKA 3GKNA 4KSMA 5AGYA 4Z2TA 4MF5A 4YQMA 5ECIB 1TK8B 1T4ZA 2H01A 4ZB6A 2PUKC 3QAWA 3VPTA 4K0NA 2X8HA 4G19A 1PX7A 2MMZA 3QPMA 3CYNA 1O73A 2FWEA 3P7XA 1GLQA 2N5FA 4KGIA 4TXVA 5IMVA 3GKMA 2IFQB 4IBPA 2VM1A 2CZ2A 1Z6NA 1BEDA 3VI5A 1AQWA 2LQOA 1VF2A 4JEDA 2HNLA 3HZ8A 3DEXA 1XW5A 4YKGA 1S3CA 1TRSA 2Z9SA 5ECPB 2HRFA 1XOAA 5IMFA 4BA7A 1O81A 4ULXA 1THXA 2H8LA 1GUMA 1QGVA 5ELGA 2ZUPA 4L5OA 3BOAA 1ZL9A 3GTUA 4HU7A 4KCEA 3WT2A 5ID2A 2YZHA 2E2MA 3RHCA 3UARA 4LMVA 2IIYA 3ERGA 4BVYA 3IK7A 4E8EA 2KOKA 1PQNA 4KH7A 1G0TA 1EV9A 8GSSA 2AJQB 3G7IA 2V6KA 1X5CA 4A5PA 3HJMA 4X0XA 2B1LA 2LKUA 3M3MA 2OE0A 1TK5B 3HXSA 3ZZXA 4MDCA 5DQYA 4XCSA 4GRFA 2C1YA 2FHEA 3KCMA 2LNSA 2YP6A 3ZTLA 1Z3EA 4F82A 3A3TA 3MDKA 3QD9A 1M0UA 1GWCA 4MA9A 4AJ7A 1B4QA 2ON5A 4WKWA 1QMVA 3FMWA 4ECBA 5ENUA 4IQAA 4AJ6A 2O8VB 2H76A 4I8BA 5GSSA 3DD3A 4IQ1A 4IVFA 5DVBA 1GUKA 1ST9A 2JZSA 2GDRA 4OO4A 2F8AA 3O6TA 1OC8A 4ZB8A 2DJ2A 1TU8A 4WF4A 3A2XA 5J3RA 4MH2A 2IMEA 1XIYA 5FT3A 2HRKA 1FVJA 3QCPA 1KTEA 1T4YA 3L4NA 5A4WA 4NHWA 3GURA 2X49A 3EU3A 3LORA 4RQRA 3LG6A 1SJZA 4N11A 1GTUA 2GSRA 4MCUA 3MAKA 1PX6A 2CVBA 3LSZA 1M2BA 4KA0A 2DJ1A 4KDYA 2FY6A 4KCAA 3GL3A 1OE7A 4MP4A 1JLWA 2DC5A 5HFKA 5HR2A 3TB2A 4HOJA 2J9HA 3EU4A 1U3IA 5IMZA 1BQ7A 1TRWA 1M9AA 1A0FA 2I81A 5IPGA 2JSZA 4WR5A 1MD3A 3LJRA 2O89A 3KEBA 1V40A 2VCWA 3Q19A 2PERA 2VCVA 2R0CA 4TVEA 3BD2A 3UBLA 5CRHA 1ERVA 2LJAA 2PMTA 3DRNA 1I5GA 3F8UA 2O7KA 4PX1A 3GYKA 2KP2A 2LS5A 2H1GA 3ZYWA 4K1FA 4KDUA 3F9UA 1EGOA 4PNFA 4F0BA 1GUHA 1S3AA 3N9JA 5GSTA 1Z7PA 1WWJA 3HHVA 4MJEA 1K3LA 3E3EA 4EO3A 2YN1A 1WE0A 2F8FA 1T1VA 4Q5NA 3IAM2 1XPVA 5COHA 3IXRA 2HZEA 2AHEA 4PGTA 2LTKA 4GCIA 3FRCA 2EIRA 1M2AA 2WGRA 5IQYA 3DMLA 4L0UA 3ZMLA 4MJCA 2NVLA 4I2UA 4J2FA 1DE1A 4K8MA 4D73A 4MZCA 3VWVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IJY A;  3GIX A;  2CAQ A;  2O87 A;  3A2V A;  4WR4 A;  3GX0 A;  3HYP A;  4FYB A;  4TRX A;  4E8H A;  3LXZ A;  1GTA A;  7GSS A;  4MMM A;  2R3X A;  5E4W A;  1MDI A;  2GQM A;  4EC0 A;  2DLX A;  1YEP A;  4N0Z A;  5D93 A;  3H8Q A;  1U88 A;  2IWT A;  1K3O A;  1NHO A;  5HR3 A;  1BAY A;  2PN8 A;  1SD9 A;  4O32 A;  2VO4 A;  5J9C A;  1ERT A;  2KUC A;  3LGC A;  4JU5 A;  2BJX A;  2GST A;  1TKD B;  4TR3 A;  2WZ9 A;  4IP1 A;  5EPF A;  4GLT A;  3C8E A;  2H1B A;  4JRR A;  3FZA A;  2I3Y A;  5JCW A;  2I1U A;  4HQS A;  2R6K A;  3C7M A;  5LNK e;  2GQL A;  5A5K A;  3CSI A;  1ACV A;  2FWG A;  3FZ4 A;  1NW2 A;  2R5G A;  5KN0 A;  1HNB A;  1VF4 A;  1A2L A;  2VCQ A;  4F0C A;  1ZMA A;  1WJK A;  1Z5Y E;  5J5N A;  1RQM A;  4J56 E;  4K7N A;  3TOT A;  2NPB A;  5KN3 A;  1XCC A;  1XZO A;  2DJ3 A;  2LV3 A;  4RI6 A;  1OC9 B;  4IHU A;  2YJ7 A;  3CTG A;  2F9S A;  3M0F A;  2HYX A;  3UIW A;  4J57 E;  3EC3 A;  4P3Y B;  4ZXG A;  1GSE A;  1O8X A;  3U6V A;  3KTB A;  3QAG A;  3ZVJ D;  2XBI A;  2P31 A;  3IHQ A;  3TRP A;  5EY6 A;  1EOG A;  2A4V A;  3UVT A;  4FO5 A;  2C80 A;  3G9B A;  3WGX A;  4MPG A;  1R4W A;  2QC7 A;  4OFT A;  5CRW A;  1SYX A;  3F3R A;  2GTU A;  1KEB A;  2G2Q A;  1O6J A;  5EVO A;  2I4A A;  2FA4 A;  3IE3 A;  3FK8 A;  4XRD A;  3FEU A;  1IYI A;  22GS A;  5G5E A;  2WDU A;  5ABR A;  3D5J A;  2YWN A;  3DKS A;  4HQZ A;  4QQ7 A;  2IMK A;  4IEL A;  4HJ2 A;  4OD7 A;  2L57 A;  3TKS A;  2CT6 A;  3WT1 A;  5DAK B;  1O8W A;  1F3A A;  4MZW A;  3GA4 A;  1XWC A;  2MBS A;  4ISD A;  4KW6 A;  1XFL A;  2E0Q A;  5KN2 A;  2LEG A;  4DSS B;  5D9W A;  3TJK A;  4BVX A;  1SL0 B;  5AN1 A;  2L5L A;  3UVH A;  3D22 A;  2C0E A;  3ERF A;  4GXZ A;  5G1L A;  2HI7 A;  1JZR A;  2YNX A;  3FYG A;  3F3Q A;  2A2S A;  2C0G A;  1YQ1 A;  3NOF A;  2PU9 C;  4ZBD A;  3QFA C;  1AQX A;  1AIU A;  5CYY A;  4EVM A;  4V1A p;  1A8Y A;  4ID0 A;  2HSH A;  3A2W A;  3TDG A;  2OKA A;  3ZIV A;  2LUS A;  4EF0 A;  3IPZ A;  5IOW A;  3C1S A;  3M9J A;  2KLX A;  1BG5 A;  4TXO B;  4MH3 A;  2OBK A;  4POM A;  1G7O A;  2ON7 A;  4PXO A;  17GS A;  1Z7R A;  3O3T A;  1FB0 A;  3HDC A;  4PUF C;  4HI7 A;  2OA7 A;  3GHA A;  2GLR A;  1PN9 A;  2C8U A;  2B5E A;  3IC4 A;  4XS4 B;  1BYE A;  3GX8 A;  2XPE A;  3C71 A;  2H19 A;  1Q98 A;  2JAD A;  2LRT A;  4Z7X A;  3WD6 A;  1THO A;  1TI1 A;  1JFU A;  1ML6 A;  5KEJ A;  2YWM A;  5HR1 A;  4ZBB A;  1FHE A;  3N5O A;  2R37 A;  1SYR A;  1WRY A;  2FLS A;  3VLN A;  3S9F A;  3LWA A;  4K0G A;  4NXI A;  5CRE A;  1Y6E A;  2B7K A;  2E7P A;  2AUV A;  3SWL A;  4AGS A;  3PGT A;  1EGR A;  1WIK A;  3A5W A;  3KM6 A;  2NDO A;  4FH8 A;  3EMX A;  1TJD A;  1XWB A;  5IOX A;  1GNW A;  3L9U A;  2A2R A;  5F8B A;  3P90 A;  2VD0 A;  3IAS 2;  1FAA A;  3GST A;  3F6F A;  3GFK A;  1K0D A;  2L4C A;  4HDE A;  3VWX A;  1DBY A;  3KH9 A;  3VFI A;  1F37 A;  3VWW A;  3QR6 A;  2OE3 A;  4DSR A;  5KN1 A;  3HA9 A;  5F05 A;  4OFN A;  3Q74 A;  1X9W B;  3ZVJ A;  3D0Z A;  2C0F A;  2LRN A;  1B8X A;  4L8E A;  3CTF A;  4CDO A;  4KAE A;  2GGT A;  2M80 A;  4MLY A;  4JBB A;  3DGQ A;  3I6A A;  1PGT A;  16GS A;  2XC2 A;  2P5Q A;  4F2I A;  3ZFB A;  4MJB A;  4AF2 A;  5ECR B;  3QDN A;  4XIH A;  4POL A;  5J41 A;  2VOC A;  1PKW A;  3F6D A;  1X5E A;  3DIE A;  2LJK A;  2VL2 A;  1W4V A;  3WGE A;  1SEN A;  4I6X A;  1M2D A;  2H74 A;  3V1W A;  2GS3 A;  2RM6 A;  1B9Y C;  4ZL8 A;  1JZO A;  1GSU A;  4PQH A;  2V6O A;  4LLR A;  2CVK A;  4O92 A;  3TRX A;  1YZX A;  2HZF A;  18GS A;  2TIR A;  5IMA A;  3GNJ A;  3J7Y b;  3KJY A;  4MAB A;  1ZYE A;  1TP9 A;  3I9V 2;  2H72 A;  4GF0 A;  3TCO A;  4LL1 B;  3TUE A;  3GTU B;  5F06 A;  3TGZ A;  2K6V A;  2GZP A;  5ID2 B;  2IMD A;  1QQ2 A;  3CSJ A;  1O7U A;  4EUY A;  5ECQ B;  1K0M A;  4KND A;  4FYC A;  5CAX A;  1HNA A;  1OYJ A;  1A23 A;  2XPD A;  1TXX A;  2AB6 A;  5D96 A;  5DAL A;  4Q5R A;  1GP1 A;  2JU5 A;  5D9V A;  2H6X A;  2LRC A;  1XW6 A;  2PBJ A;  4OFM A;  4POK A;  1AAZ A;  4BPY A;  1OC3 A;  4MZB A;  1J08 A;  5D73 A;  1V9W A;  4HZ2 A;  3ZL5 A;  1YF0 A;  4NMU A;  2VD1 A;  3LQ7 A;  4ILF A;  3IV4 A;  3UAP A;  1X9M B;  4JZQ A;  5G2Z A;  5GZZ B;  4TOP A;  4NV2 A;  4MF6 A;  5D8I A;  4EDY A;  5CRG A;  4I2T A;  4YQU A;  2GSQ A;  1XOB A;  2X8G A;  3HVX A;  1V58 A;  2H66 A;  2WJU A;  5A4U A;  3UEM A;  2X64 A;  3ME8 A;  5LD0 A;  4RUV A;  2YZU A;  1GH2 A;  4JE1 A;  4ML1 A;  4GTU A;  1GSD A;  2YV7 A;  4IS0 A;  1U6T A;  3KD0 A;  1YY7 A;  4GWR A;  2H73 A;  2L5O A;  4WEY A;  1J0F A;  4IN0 A;  2B7J A;  2CAI A;  3HJP A;  2K8V A;  2GT6 A;  1J9B A;  1WMJ A;  5IMC A;  1AC1 A;  1MDJ A;  2FUG 2;  1K0B A;  3DVX A;  3Q18 A;  1WP0 A;  4FYU A;  2WUL A;  3EWL A;  3HJO A;  4N0V A;  3KIJ A;  1A2J A;  3ZIJ A;  1QUW A;  3D21 A;  3IRA A;  3US3 A;  5IMD A;  4NPB A;  1JLV A;  3ERW A;  3VWU A;  1Z9H A;  3MNG A;  2KP1 A;  2H75 A;  4BWQ A;  3SBC A;  2HSY A;  2YPM A;  1RK4 A;  1TOF A;  1GSF A;  5B6N A;  2EIO A;  2B5X A;  5HFI A;  5B8A A;  4K2D A;  3LYK A;  3ZFL A;  1VRS D;  4MK3 A;  3BCK A;  2GVP A;  2O85 A;  13GS A;  5DBQ A;  2B6M A;  4TW5 A;  2N5A A;  3FY7 A;  2K18 A;  2ZNM A;  2M72 A;  3DYR A;  1USB A;  1SJI A;  4OMV A;  3HY2 A;  2IPA A;  5L71 A;  1PD2 1;  3KH7 A;  1R7H A;  1RW1 A;  1E6B A;  2FA8 A;  2N5B A;  4IP6 A;  2H1D A;  1OC9 A;  3IA1 A;  3PIN A;  4LL4 B;  1V2A A;  2C4J A;  3RDW A;  2DBC A;  3CSH A;  3KP8 A;  4ZBA A;  1XWA A;  1XVQ A;  3KGK A;  1T7P B;  3RPP A;  3I43 A;  4HS1 A;  4ZB9 A;  4F03 A;  1EEJ A;  2HZE B;  2TRX A;  4K7I A;  4OCE A;  5D9X A;  1YEX A;  3MSZ A;  2VAF A;  3GKX A;  2OJL A;  2FWH A;  4ZIJ A;  1GSY A;  2L6C A;  3D4M A;  4D73 B;  3KTL A;  3EVI A;  2K9F A;  5G5F A;  3HVS A;  3M9K A;  1XVW A;  3ZIT A;  3TJG A;  5DAK A;  3ED3 A;  1K0O A;  1EV4 A;  1Z6M A;  3EUR A;  4G10 A;  4RI7 A;  5J4U A;  3APQ A;  4XRA A;  1BJX A;  3KMN A;  1A8L A;  4LA1 A;  10GS A;  1NHY A;  5GAN D;  1PL1 A;  3TJF A;  2M46 A;  3WYW A;  2OE1 A;  2H0G A;  2HXK A;  1ERU A;  2RUE A;  3FHK A;  2QSI A;  2GQK A;  5JWQ B;  1R5P A;  4EE0 A;  5D9T A;  5JCU A;  1N2A A;  19GS A;  1S3D A;  4N30 A;  5DDL A;  3IBH A;  2DJK A;  1SD8 A;  4TN8 A;  3VI7 A;  3H79 A;  3CRT A;  3UL3 A;  1EOH A;  3R2Q A;  4I5Q A;  2DIZ A;  1GL8 A;  2GSS A;  4TXO A;  3GMF A;  4K7O A;  1NSW A;  1Q4J A;  4HZ4 A;  4BWS A;  2MBT A;  2L59 A;  3IDV A;  1VGL A;  3GSS A;  2XBQ A;  3W6G A;  2C0D A;  4I97 A;  2VL9 A;  3KP9 A;  3H4K A;  5F07 A;  1M99 A;  4CW9 A;  4XHM A;  4XS4 A;  4WXT A;  3M8N A;  1F2E A;  1M9B A;  1XXU A;  3ZLP A;  2RM5 A;  1X9S B;  12GS A;  2C3N A;  3FKF A;  4Q5F A;  5CNW A;  3K8N A;  5ECL B;  4NV5 A;  3TOU A;  4DSQ A;  2PPT A;  3H1N A;  2YCD A;  3W8J A;  2MZC A;  5B7C A;  1B4P A;  1OAZ A;  4IJI A;  1ABA A;  3QMX A;  3UJ1 A;  4K6X A;  1M7T A;  4EXJ A;  2H30 A;  2FCH A;  1R5A A;  1MD4 A;  4TR1 B;  1PKZ A;  3FW2 A;  4WBR D;  2JAC A;  1FG4 A;  2NBS A;  2CX3 A;  3ZMK A;  2C3Q A;  4KUN A;  4KX4 A;  2IFQ A;  2F51 A;  5AIS A;  2H70 A;  2REM A;  2VLT A;  1LBK A;  5H5S A;  4V2L A;  2MYG A;  5ECK B;  1MTC A;  5B6M A;  4HEA 2;  4NHZ A;  1SK1 A;  5A4V A;  3TJB A;  2E2G A;  1PMT A;  5C00 A;  4XTS A;  3ME7 A;  1OKD A;  5E59 A;  2DIY A;  4MJA A;  2CZ3 A;  2DSA A;  4QL7 A;  3BCI A;  1FB6 A;  4YQV A;  2WFC A;  6GSW A;  4HJM A;  3U5R E;  2V1M A;  1SL1 B;  1SL2 B;  3M1G A;  3HKR A;  3FR3 A;  4O7H A;  1K0C A;  2QKE A;  2HRN A;  2V2G A;  2BMX A;  1G6W A;  2JZT A;  1B9X C;  3TRQ A;  5LCZ A;  3FR6 A;  3PH9 A;  3UOM A;  2HLS A;  1AQV A;  3GL5 A;  3J7Y k;  4RQX A;  2B1K A;  2P5R A;  1IYH A;  3FR9 A;  2CX4 A;  4Q5Q A;  1SK2 A;  3KZQ A;  2YAN A;  2VCX A;  3ZRE A;  4GSN A;  3TJJ A;  1LJR A;  1T3B A;  5JWR B;  1DSB A;  3NZN A;  3FZ9 A;  3HD5 A;  5AIV A;  2JSY A;  3D4T A;  4G2E A;  6GSU A;  1A24 A;  4ECI A;  2VCT A;  1A2M A;  2YWI A;  1QXH A;  1EZK A;  4AJ8 A;  4V2N A;  2LNT A;  6GSY A;  1SJ6 A;  3G7J A;  1YKA A;  2WRT A;  3VPQ A;  2PVQ A;  3EE2 A;  3QAV A;  1O85 A;  2P0G A;  6GSV A;  1VF1 A;  3FZ5 A;  4TR0 A;  6GST A;  1N8J A;  4ECC A;  1KNG A;  3EYT A;  1MEK A;  1G6Y A;  4L5L A;  4PQ1 A;  3LFL A;  3E9J B;  4GST A;  3W8S A;  1GSS A;  1JZW A;  3L9S A;  2VUP A;  2WCI A;  2CQ9 A;  3PR8 A;  2AAW A;  2ES7 A;  4CHS A;  3HCZ A;  3JCM L;  2L6D A;  4DVC A;  1SKW B;  1TK0 B;  1QFN A;  4IW9 A;  4MF7 A;  5DCG A;  2TRC P;  1WPI A;  2VM2 A;  3F4S A;  5AIX A;  1TDI A;  1EP8 A;  4YAV A;  4LMW A;  5C04 A;  11GS A;  2G0F A;  5IPH A;  4N10 A;  1U3A A;  1ZZY A;  1GLP A;  5ECS A;  1XWK A;  4PNG A;  2MMA A;  3ISO A;  1G7E A;  5F0G A;  2D2Z A;  5HR0 A;  4WF5 A;  2C3T A;  4ZL7 A;  3DWV A;  1GTB A;  1K0N A;  2VIM A;  2ALB A;  3G7Y A;  2KHP A;  2FNO A;  1AUC A;  4X43 A;  1SKR B;  5G31 A;  5G30 A;  1GTI A;  1LU4 A;  2VLV A;  3CBU A;  5DCH A;  2HFD A;  2FWF A;  1ON4 A;  1TU7 A;  3IK9 A;  1GRX A;  1UN2 A;  2EC4 A;  1JZD A;  2IMF A;  2JL4 A;  4G9H A;  1PL2 A;  2CVD A;  3GH9 A;  1XBS A;  2LJR A;  4YH2 A;  2K8S A;  2DML A;  3HZ4 A;  3APS A;  3UMA A;  1AW9 A;  4V2M A;  2RLI A;  1K0A A;  3TKS C;  1OKT A;  3LYP A;  2OBI A;  5J9B A;  6GSX A;  2GZY A;  3Q6O A;  2H6Z A;  1HNC A;  4PUR A;  5ECH B;  1T00 A;  1TI3 A;  1YDK A;  1E2Y A;  2H0I A;  1DE2 A;  3TKS E;  3F0I A;  1YF1 A;  1H75 A;  5DQS A;  5GAP D;  3ZRD A;  1SU9 A;  5DAL B;  3DVW A;  4ECJ A;  3KMO A;  4GQF A;  2YWO A;  2NTO A;  4JR4 A;  5CO3 A;  1HYU A;  2DMM A;  2AYT A;  5B8B A;  4K9Z A;  4EL1 A;  2MMO A;  1V57 A;  3C1R A;  1URM A;  2OAD A;  4XS6 A;  1UA5 A;  1HQO A;  5HQP A;  3EMP A;  1SKS B;  2MMN A;  4O5R A;  3RAZ A;  2YOI A;  3TKQ A;  3GH6 A;  1EP7 A;  4ML6 A;  4GSS A;  4KDX A;  1Y25 A;  1W89 A;  2IMI A;  3KXO A;  1U87 A;  1YJ6 A;  3EIN A;  1I9D A;  1TTZ A;  1PRX A;  5CRD A;  5IIZ A;  2IL3 A;  1XW9 A;  5JCG A;  5JWO B;  4F9Z A;  1ZOF A;  2VCZ A;  2YV9 A;  9GSS A;  1OE8 A;  2CV4 A;  5EL8 A;  2GZZ A;  4NAX A;  2V41 A;  4OCF A;  4PQI A;  1XWG A;  3AY8 A;  4WET A;  2H1A A;  2YJH A;  4PUA A;  4EKZ A;  1WOU A;  1AXD A;  1EWX A;  14GS A;  3NIV A;  1DUG A;  1K3Y A;  3P8W A;  3APO A;  4YAP A;  1GNE A;  3TKP A;  2H71 A;  2WB9 A;  2HT9 A;  1CQH A;  1QK8 A;  2FGX A;  5FWG A;  2VL3 A;  3HVV A;  5HFG A;  1V98 A;  3F4R A;  2X99 A;  1ZCP A;  2QGV A;  3CRU A;  1PSQ A;  1ILO A;  2V32 A;  3BBY A;  4NWY A;  1TRU A;  1UVZ A;  3D6I A;  2PVO C;  2ZCT A;  2EIQ A;  4QL9 A;  2CA8 A;  2VLU A;  4TKY A;  2FD3 A;  2WS2 A;  4OO5 A;  1GSQ A;  2GT5 A;  4IGJ A;  20GS A;  2F3M A;  4DSS A;  4EDZ A;  3MWH A;  1FOV A;  3L78 A;  2X8C A;  2JZR A;  1F6M C;  1GUL A;  4HU9 A;  2LQQ A;  3LEF A;  2PWJ A;  3DXB A;  5FHI A;  5IO0 A;  1OVN A;  2VL2 C;  1BX9 A;  3RPN A;  2LST A;  2B5Y A;  1T8E B;  2AV4 A;  4XS1 A;  3E0U A;  5DJL A;  1CQG A;  2DJ0 A;  1MDK A;  5ECN B;  1SK0 A;  5G1K A;  3UBK A;  3RHB A;  4DEJ A;  4ZIL A;  4IJ3 A;  3OR5 A;  4TR1 A;  5IM9 A;  3C73 A;  3LXT A;  1KBN A;  1FW1 A;  2BTO T;  1X0R A;  1YKC A;  1VF3 A;  3VK9 A;  2DJJ A;  1ZYQ B;  5DJM A;  3GN3 A;  3CXG A;  1F3B A;  3O76 A;  3VUR A;  3CMI A;  1F9M A;  2PGT A;  4TR4 A;  3IR4 A;  4BL7 A;  4OWY A;  2J23 A;  4ACS A;  4KSO A;  3P2A A;  1UC7 A;  2XHF A;  1C72 A;  3L0H A;  2HE3 A;  3H93 A;  5H5R A;  4WBJ A;  1NM3 A;  3GV1 A;  1PA3 A;  4GQC A;  5CP1 A;  3WGD A;  3RBT A;  1JHB A;  3IOS A;  1TW9 A;  3F63 A;  1A0R P;  3BJ5 A;  4IKH A;  4H86 A;  2H0H A;  1ZGN A;  4JR6 A;  5ECM B;  1R26 A;  4MPF A;  2I9H A;  4FIW A;  4KE3 A;  4HUA A;  2RII A;  2B3S A;  2RUF A;  5ECO B;  5ELA A;  4X1U A;  3F4T A;  2OAC A;  3GKK A;  3TKR A;  3I69 A;  1HD2 A;  3QFB C;  1ERW A;  3QOU A;  3GRX A;  1H4O A;  1TRV A;  5INY A;  1EEM A;  1X5D A;  2R4V A;  4KB3 A;  4ZL9 A;  5IO2 A;  1B48 A;  1FO5 A;  2L4Q A;  6GSS A;  2R2J A;  3GUS A;  3L9V A;  2H6Y A;  2IN3 A;  4POB A;  5H5Q A;  4V1A g;  4L0W A;  1FVK A;  3GKN A;  4KSM A;  5AGY A;  4MF5 A;  4YQM A;  5ECI B;  1TK8 B;  1T4Z A;  2H01 A;  4ZB6 A;  2PUK C;  3QAW A;  3VPT A;  4K0N A;  2X8H A;  4G19 A;  1PX7 A;  2MMZ A;  3QPM A;  3CYN A;  1O73 A;  2FWE A;  3P7X A;  1GLQ A;  2N5F A;  4KGI A;  4TXV A;  5IMV A;  3GKM A;  2IFQ B;  4IBP A;  2VM1 A;  2CZ2 A;  1Z6N A;  1BED A;  3VI5 A;  1AQW A;  2LQO A;  1VF2 A;  4JED A;  2HNL A;  3HZ8 A;  3DEX A;  1XW5 A;  1S3C A;  1TRS A;  2Z9S A;  5ECP B;  2HRF A;  1XOA A;  5IMF A;  4BA7 A;  1O81 A;  4ULX A;  1THX A;  2H8L A;  1GUM A;  1QGV A;  5ELG A;  2ZUP A;  4L5O A;  3BOA A;  1ZL9 A;  3GTU A;  4HU7 A;  4KCE A;  3WT2 A;  5ID2 A;  2YZH A;  2E2M A;  3RHC A;  3UAR A;  4LMV A;  2IIY A;  3ERG A;  4BVY A;  3IK7 A;  4E8E A;  2KOK A;  1PQN A;  4KH7 A;  1G0T A;  1EV9 A;  8GSS A;  2AJQ B;  3G7I A;  2V6K A;  1X5C A;  3HJM A;  4X0X A;  2B1L A;  2LKU A;  3M3M A;  2OE0 A;  1TK5 B;  3HXS A;  3ZZX A;  4MDC A;  5DQY A;  4XCS A;  4GRF A;  2C1Y A;  2FHE A;  3KCM A;  2LNS A;  2YP6 A;  3ZTL A;  1Z3E A;  4F82 A;  3A3T A;  3MDK A;  3QD9 A;  1M0U A;  1GWC A;  4MA9 A;  4AJ7 A;  1B4Q A;  2ON5 A;  4WKW A;  1QMV A;  4ECB A;  5ENU A;  4IQA A;  4AJ6 A;  2O8V B;  2H76 A;  4I8B A;  5GSS A;  3DD3 A;  4IQ1 A;  4IVF A;  5DVB A;  1GUK A;  1ST9 A;  2JZS A;  2GDR A;  4OO4 A;  2F8A A;  3O6T A;  1OC8 A;  4ZB8 A;  2DJ2 A;  1TU8 A;  4WF4 A;  3A2X A;  5J3R A;  4MH2 A;  2IME A;  1XIY A;  5FT3 A;  1FVJ A;  3QCP A;  1KTE A;  1T4Y A;  3L4N A;  5A4W A;  4NHW A;  3GUR A;  3EU3 A;  3LOR A;  4RQR A;  3LG6 A;  1SJZ A;  4N11 A;  1GTU A;  2GSR A;  4MCU A;  3MAK A;  1PX6 A;  2CVB A;  3LSZ A;  1M2B A;  4KA0 A;  2DJ1 A;  4KDY A;  2FY6 A;  4KCA A;  3GL3 A;  1OE7 A;  4MP4 A;  1JLW A;  2DC5 A;  5HFK A;  5HR2 A;  3TB2 A;  4HOJ A;  2J9H A;  3EU4 A;  1U3I A;  5IMZ A;  1BQ7 A;  1TRW A;  1M9A A;  1A0F A;  2I81 A;  5IPG A;  2JSZ A;  4WR5 A;  1MD3 A;  3LJR A;  2O89 A;  3KEB A;  1V40 A;  2VCW A;  3Q19 A;  2PER A;  2VCV A;  4TVE A;  3BD2 A;  3UBL A;  5CRH A;  1ERV A;  2LJA A;  2PMT A;  3DRN A;  1I5G A;  3F8U A;  2O7K A;  4PX1 A;  3GYK A;  2KP2 A;  2LS5 A;  2H1G A;  3ZYW A;  4K1F A;  4KDU A;  3F9U A;  1EGO A;  4PNF A;  4F0B A;  1GUH A;  1S3A A;  3N9J A;  5GST A;  1Z7P A;  1WWJ A;  3HHV A;  4MJE A;  1K3L A;  3E3E A;  4EO3 A;  2YN1 A;  1WE0 A;  2F8F A;  1T1V A;  4Q5N A;  3IAM 2;  1XPV A;  5COH A;  3IXR A;  2HZE A;  2AHE A;  4PGT A;  2LTK A;  4GCI A;  3FRC A;  2EIR A;  1M2A A;  2WGR A;  5IQY A;  3DML A;  4L0U A;  3ZML A;  4MJC A;  2NVL A;  4I2U A;  4J2F A;  1DE1 A;  4K8M A;  4D73 A;  4MZC A;  3VWV A; 
#chains in the Genus database with same CATH topology
 2IJY A;  3GIX A;  2CAQ A;  2O87 A;  3A2V A;  4WR4 A;  3GX0 A;  3HYP A;  4FYB A;  4TRX A;  4E8H A;  3LXZ A;  1GTA A;  7GSS A;  4MMM A;  4X4J A;  2R3X A;  5E4W A;  1MDI A;  2GQM A;  4EC0 A;  2DLX A;  1YEP A;  4N0Z A;  5D93 A;  3H8Q A;  1U88 A;  2IWT A;  1K3O A;  1NHO A;  5HR3 A;  1BAY A;  2PN8 A;  1SD9 A;  4O32 A;  2VO4 A;  5J9C A;  1ERT A;  2KUC A;  2R0P A;  3LGC A;  4JU5 A;  2BJX A;  2GST A;  1TKD B;  4TR3 A;  2WZ9 A;  4IP1 A;  5EPF A;  4GLT A;  3C8E A;  2H1B A;  4JRR A;  4BIK A;  3FZA A;  2I3Y A;  5JCW A;  2I1U A;  4HQS A;  2R6K A;  3C7M A;  5LNK e;  2GQL A;  5A5K A;  3CSI A;  1ACV A;  2FWG A;  3FZ4 A;  1NW2 A;  2R5G A;  5KN0 A;  1HNB A;  1VF4 A;  1A2L A;  2VCQ A;  4F0C A;  1ZMA A;  1WJK A;  1Z5Y E;  5J5N A;  1RQM A;  4J56 E;  4K7N A;  3TOT A;  2NPB A;  5KN3 A;  1XCC A;  1XZO A;  2DJ3 A;  2LV3 A;  4RI6 A;  1OC9 B;  4IHU A;  2YJ7 A;  3CTG A;  2F9S A;  3M0F A;  2HYX A;  3UIW A;  4J57 E;  3EC3 A;  4P3Y B;  4ZXG A;  1GSE A;  1O8X A;  3U6V A;  3KTB A;  1M3J A;  3QAG A;  3ZVJ D;  2XBI A;  2P31 A;  3IHQ A;  3TRP A;  5EY6 A;  4O5U A;  4FQU A;  1EOG A;  2A4V A;  3UVT A;  4FO5 A;  2C80 A;  3G9B A;  3WGX A;  4MPG A;  1R4W A;  2QC7 A;  4OFT A;  5CRW A;  1SYX A;  3F3R A;  2GTU A;  1KEB A;  2G2Q A;  1O6J A;  5EVO A;  2I4A A;  2FA4 A;  3IE3 A;  3FK8 A;  4XRD A;  3FEU A;  1IYI A;  22GS A;  5G5E A;  2WDU A;  5ABR A;  5KOX A;  3D5J A;  2YWN A;  3DKS A;  4HQZ A;  4QQ7 A;  2IMK A;  4IEL A;  4HJ2 A;  4OD7 A;  2L57 A;  3TKS A;  2CT6 A;  3WT1 A;  5DAK B;  1O8W A;  1F3A A;  4MZW A;  3GA4 A;  1XWC A;  2MBS A;  4ISD A;  4KW6 A;  1XFL A;  2E0Q A;  5KN2 A;  2LEG A;  4DSS B;  5D9W A;  3TJK A;  4BVX A;  1SL0 B;  5AN1 A;  2L5L A;  3UVH A;  3D22 A;  2C0E A;  3ERF A;  4KF9 A;  4GXZ A;  5G1L A;  2HI7 A;  1JZR A;  2YNX A;  3FYG A;  3F3Q A;  2A2S A;  2C0G A;  1YQ1 A;  3NOF A;  2PU9 C;  4ZBD A;  2DKH A;  3QFA C;  1AQX A;  1AIU A;  5CYY A;  4EVM A;  4V1A p;  1A8Y A;  4ID0 A;  2HSH A;  3A2W A;  3TDG A;  2OKA A;  3ZIV A;  2LUS A;  4EF0 A;  3IPZ A;  5IOW A;  3C1S A;  3M9J A;  2KLX A;  1BG5 A;  4TXO B;  4G0K A;  4MH3 A;  2OBK A;  4POM A;  1G7O A;  2ON7 A;  4PXO A;  17GS A;  1Z7R A;  3O3T A;  1FB0 A;  3HDC A;  4PUF C;  4HI7 A;  2OA7 A;  3GHA A;  2GLR A;  1PN9 A;  2C8U A;  2B5E A;  3IC4 A;  4XS4 B;  1BYE A;  3GX8 A;  2XPE A;  3C71 A;  2H19 A;  1Q98 A;  2JAD A;  2LRT A;  4Z7X A;  3WD6 A;  1THO A;  1TI1 A;  1JFU A;  1ML6 A;  5KEJ A;  2YWM A;  5HR1 A;  4ZBB A;  1FHE A;  3N5O A;  2R37 A;  1SYR A;  1WRY A;  2FLS A;  3VLN A;  3S9F A;  3LWA A;  4K0G A;  4NXI A;  5CRE A;  1Y6E A;  2B7K A;  3HVN A;  2E7P A;  2AUV A;  3SWL A;  4AGS A;  3PGT A;  1EGR A;  1WIK A;  3A5W A;  3KM6 A;  2NDO A;  4FH8 A;  3EMX A;  1TJD A;  1XWB A;  5IOX A;  1GNW A;  3L9U A;  2A2R A;  5F8B A;  3P90 A;  2VD0 A;  3IAS 2;  1FAA A;  3GST A;  3F6F A;  3GFK A;  1K0D A;  2L4C A;  4HDE A;  3VWX A;  1DBY A;  3KH9 A;  3VFI A;  1F37 A;  3VWW A;  3QR6 A;  2OE3 A;  4DSR A;  5KN1 A;  3HA9 A;  5F05 A;  4OFN A;  3Q74 A;  1X9W B;  3ZVJ A;  3D0Z A;  2C0F A;  2LRN A;  1B8X A;  4L8E A;  3CTF A;  4CDO A;  4KAE A;  2GGT A;  2M80 A;  4MLY A;  4JBB A;  3DGQ A;  3I6A A;  1PGT A;  16GS A;  2XC2 A;  2P5Q A;  4F2I A;  3ZFB A;  4MJB A;  5KOW A;  4AF2 A;  5ECR B;  3QDN A;  4XIH A;  4POL A;  5J41 A;  2VOC A;  1PKW A;  3F6D A;  1X5E A;  3DIE A;  2LJK A;  2VL2 A;  1W4V A;  3WGE A;  1SEN A;  4I6X A;  4PTS A;  1M2D A;  2H74 A;  3V1W A;  2GS3 A;  2RM6 A;  1B9Y C;  4ZL8 A;  1JZO A;  1GSU A;  4PQH A;  2V6O A;  4LLR A;  2CVK A;  4O92 A;  3TRX A;  1YZX A;  2HZF A;  18GS A;  2TIR A;  5IMA A;  3GNJ A;  3R3E A;  3J7Y b;  3KJY A;  4MAB A;  1ZYE A;  1TP9 A;  3I9V 2;  2H72 A;  4GF0 A;  3TCO A;  4LL1 B;  3TUE A;  3GTU B;  5F06 A;  3TGZ A;  2K6V A;  2GZP A;  5ID2 B;  2IMD A;  1QQ2 A;  3CSJ A;  1O7U A;  4EUY A;  5ECQ B;  1K0M A;  4BVY B;  4KND A;  4FYC A;  5CAX A;  1HNA A;  1OYJ A;  1A23 A;  2XPD A;  1TXX A;  2AB6 A;  5D96 A;  5DAL A;  4Q5R A;  1GP1 A;  2JU5 A;  5D9V A;  2H6X A;  1PFO A;  2LRC A;  1XW6 A;  5BRT A;  2PBJ A;  4OFM A;  4POK A;  1AAZ A;  4BPY A;  1OC3 A;  4MZB A;  1J08 A;  5D73 A;  1V9W A;  4HZ2 A;  3ZL5 A;  1YF0 A;  4NMU A;  2VD1 A;  3LQ7 A;  2QA1 A;  4ILF A;  3IV4 A;  3UAP A;  1X9M B;  4JZQ A;  5G2Z A;  5GZZ B;  4TOP A;  4K5S A;  4NV2 A;  4MF6 A;  5D8I A;  4EDY A;  5CRG A;  4I2T A;  4YQU A;  2GSQ A;  1XOB A;  2X8G A;  3HVX A;  1V58 A;  2H66 A;  2WJU A;  5A4U A;  3UEM A;  2QA2 A;  2X64 A;  3ME8 A;  5LD0 A;  4RUV A;  2YZU A;  1GH2 A;  4JE1 A;  4Z2R A;  4ML1 A;  4GTU A;  1GSD A;  2YV7 A;  4IS0 A;  1U6T A;  3KD0 A;  1YY7 A;  4GWR A;  2H73 A;  2L5O A;  4WEY A;  1J0F A;  4IN0 A;  2B7J A;  2CAI A;  3HJP A;  2K8V A;  2GT6 A;  2A4H A;  1J9B A;  1WMJ A;  5IMC A;  1AC1 A;  1MDJ A;  2FUG 2;  1K0B A;  4EIP A;  3DVX A;  3Q18 A;  1WP0 A;  4FYU A;  2WUL A;  3EWL A;  3HJO A;  4N0V A;  3KIJ A;  3MIX A;  1A2J A;  3ZIJ A;  1QUW A;  3D21 A;  3IRA A;  3US3 A;  5IMD A;  4NPB A;  1JLV A;  3ERW A;  2HSM A;  3VWU A;  1Z9H A;  3MNG A;  2KP1 A;  2H75 A;  4BWQ A;  3SBC A;  2HSY A;  2YPM A;  1RK4 A;  1TOF A;  1GSF A;  5B6N A;  2EIO A;  2B5X A;  5HFI A;  5B8A A;  4K2D A;  3LYK A;  3ZFL A;  1VRS D;  4MK3 A;  3BCK A;  2GVP A;  2O85 A;  13GS A;  5DBQ A;  2B6M A;  4TW5 A;  2N5A A;  3FY7 A;  2K18 A;  2ZNM A;  2M72 A;  3DYR A;  1USB A;  1SJI A;  4OMV A;  3HY2 A;  2IPA A;  5L71 A;  1PD2 1;  3KH7 A;  1R7H A;  1RW1 A;  1E6B A;  2FA8 A;  2N5B A;  4IP6 A;  2H1D A;  1OC9 A;  3IA1 A;  3PIN A;  4LL4 B;  1V2A A;  2C4J A;  3RDW A;  2DBC A;  3CSH A;  3KP8 A;  4ZBA A;  1XWA A;  1XVQ A;  3KGK A;  1T7P B;  3RPP A;  3I43 A;  4HS1 A;  4ZB9 A;  4F03 A;  1EEJ A;  2HZE B;  2TRX A;  4K7I A;  4OCE A;  5D9X A;  1YEX A;  3MSZ A;  2VAF A;  3GKX A;  2OJL A;  2FWH A;  4ZIJ A;  1GSY A;  2L6C A;  3D4M A;  4D73 B;  3KTL A;  3EVI A;  2K9F A;  5G5F A;  3HVS A;  3M9K A;  1XVW A;  3ZIT A;  3TJG A;  5DAK A;  3ED3 A;  1K0O A;  1EV4 A;  1Z6M A;  3EUR A;  4G10 A;  4RI7 A;  5J4U A;  3APQ A;  4XRA A;  1BJX A;  4G0I A;  3KMN A;  1A8L A;  4LA1 A;  10GS A;  1NHY A;  5GAN D;  1PL1 A;  3TJF A;  2M46 A;  3WYW A;  2OE1 A;  2H0G A;  2HXK A;  1ERU A;  2RUE A;  3FHK A;  2QSI A;  2GQK A;  5JWQ B;  1R5P A;  4EE0 A;  5D9T A;  5JCU A;  1N2A A;  19GS A;  1S3D A;  4MNN A;  3A5I A;  4N30 A;  5DDL A;  3IBH A;  2DJK A;  1SD8 A;  4TN8 A;  3VI7 A;  3H79 A;  3CRT A;  3UL3 A;  1EOH A;  3R2Q A;  4I5Q A;  2DIZ A;  1GL8 A;  2GSS A;  4TXO A;  3GMF A;  4K7O A;  1NSW A;  1Q4J A;  4HZ4 A;  4G0L A;  4BWS A;  2MBT A;  2L59 A;  3IDV A;  1VGL A;  3GSS A;  2XBQ A;  3W6G A;  2C0D A;  4I97 A;  2VL9 A;  3KP9 A;  3H4K A;  5F07 A;  1M99 A;  4CW9 A;  4XHM A;  4XS4 A;  4WXT A;  3M8N A;  1F2E A;  1M9B A;  1XXU A;  3ZLP A;  2RM5 A;  1X9S B;  12GS A;  2C3N A;  3FKF A;  4Q5F A;  5CNW A;  3K8N A;  5ECL B;  4NV5 A;  3TOU A;  4DSQ A;  2PPT A;  3H1N A;  2YCD A;  4USS A;  3W8J A;  2MZC A;  5B7C A;  1B4P A;  1OAZ A;  4IJI A;  1ABA A;  3QMX A;  3UJ1 A;  4K6X A;  4K5R A;  4ICY A;  1M7T A;  4EXJ A;  2H30 A;  2FCH A;  1R5A A;  1MD4 A;  4TR1 B;  1PKZ A;  3FW2 A;  4WBR D;  2JAC A;  1FG4 A;  2NBS A;  2CX3 A;  3ZMK A;  2C3Q A;  4KUN A;  4KX4 A;  2IFQ A;  2F51 A;  5AIS A;  2H70 A;  2REM A;  2VLT A;  1LBK A;  1ZYN A;  5H5S A;  4V2L A;  2MYG A;  5ECK B;  1MTC A;  5B6M A;  4HEA 2;  4NHZ A;  1SK1 A;  4BL7 B;  5A4V A;  3TJB A;  2E2G A;  1PMT A;  5C00 A;  4XTS A;  3ME7 A;  1OKD A;  5E59 A;  2DIY A;  4MJA A;  2CZ3 A;  2DSA A;  4QL7 A;  3BCI A;  1FB6 A;  4YQV A;  2WFC A;  6GSW A;  4HJM A;  3U5R E;  2V1M A;  1SL1 B;  1SL2 B;  3M1G A;  3HKR A;  3FR3 A;  4O7H A;  1K0C A;  2QKE A;  2HRN A;  2V2G A;  2BMX A;  1G6W A;  2JZT A;  1B9X C;  3TRQ A;  5LCZ A;  3FR6 A;  3PH9 A;  3UOM A;  2HLS A;  1AQV A;  3GL5 A;  3J7Y k;  4RQX A;  2B1K A;  2P5R A;  1IYH A;  3FR9 A;  2CX4 A;  4Q5Q A;  1SK2 A;  3KZQ A;  2YAN A;  2VCX A;  3ZRE A;  4GSN A;  3TJJ A;  1LJR A;  1T3B A;  5JWR B;  2HRA A;  1DSB A;  3NZN A;  3FZ9 A;  3HD5 A;  5AIV A;  2JSY A;  3D4T A;  4G2E A;  1ZYP A;  4CY6 A;  6GSU A;  1A24 A;  4ECI A;  2VCT A;  1A2M A;  2YWI A;  1QXH A;  1EZK A;  4AJ8 A;  4V2N A;  3EPT A;  2LNT A;  6GSY A;  4HSC X;  1SJ6 A;  3G7J A;  1YKA A;  2WRT A;  3VPQ A;  2PVQ A;  3EE2 A;  3QAV A;  1O85 A;  2P0G A;  6GSV A;  1VF1 A;  3FZ5 A;  4TR0 A;  6GST A;  1N8J A;  4ECC A;  1KNG A;  3EYT A;  1MEK A;  1G6Y A;  4L5L A;  4PQ1 A;  2DKI A;  3E9J B;  3LFL A;  4GST A;  3W8S A;  1GSS A;  1JZW A;  3L9S A;  2VUP A;  2WCI A;  2CQ9 A;  3PR8 A;  2AAW A;  2ES7 A;  4CHS A;  3HCZ A;  3JCM L;  2L6D A;  4DVC A;  1SKW B;  1TK0 B;  1QFN A;  4IW9 A;  4MF7 A;  5DCG A;  2TRC P;  1WPI A;  2VM2 A;  3F4S A;  5AIX A;  1TDI A;  1EP8 A;  4YAV A;  4LMW A;  5C04 A;  4K2X A;  11GS A;  2G0F A;  5IPH A;  4N10 A;  1U3A A;  1ZZY A;  1GLP A;  5ECS A;  1XWK A;  4PNG A;  2MMA A;  3ISO A;  1G7E A;  5F0G A;  2D2Z A;  5HR0 A;  4WF5 A;  2C3T A;  4ZL7 A;  3DWV A;  1GTB A;  1K0N A;  2VIM A;  2ALB A;  3G7Y A;  2KHP A;  2FNO A;  1AUC A;  4X43 A;  3CQF A;  1SKR B;  5G31 A;  5G30 A;  1GTI A;  1LU4 A;  2VLV A;  4Z2U A;  3CBU A;  5DCH A;  2HFD A;  2FWF A;  1ON4 A;  1TU7 A;  3IK9 A;  1GRX A;  4EIQ A;  1UN2 A;  2EC4 A;  1JZD A;  2IMF A;  2JL4 A;  4G9H A;  1PL2 A;  2CVD A;  3GH9 A;  1XBS A;  2LJR A;  4YH2 A;  2K8S A;  2DML A;  3HZ4 A;  3APS A;  3UMA A;  1AW9 A;  4V2M A;  2RLI A;  1K0A A;  3TKS C;  1OKT A;  3LYP A;  2OBI A;  5J9B A;  6GSX A;  2GZY A;  3Q6O A;  2H6Z A;  1HNC A;  4PUR A;  5ECH B;  1T00 A;  1TI3 A;  1YDK A;  1E2Y A;  2H0I A;  1DE2 A;  3TKS E;  3F0I A;  1YF1 A;  1H75 A;  5DQS A;  5GAP D;  3ZRD A;  1SU9 A;  5DAL B;  3DVW A;  4ECJ A;  3KMO A;  4GQF A;  2YWO A;  2NTO A;  4JR4 A;  3IHG A;  5CO3 A;  1HYU A;  2DMM A;  2AYT A;  5B8B A;  4K9Z A;  4EL1 A;  2MMO A;  1V57 A;  3C1R A;  1URM A;  2OAD A;  4XS6 A;  1UA5 A;  2X4A A;  1HQO A;  5HQP A;  3EMP A;  1SKS B;  2MMN A;  4O5R A;  3RAZ A;  2YOI A;  3TKQ A;  3GH6 A;  1EP7 A;  4ML6 A;  4GSS A;  4KDX A;  1Y25 A;  1W89 A;  2IMI A;  3KXO A;  1U87 A;  1YJ6 A;  3EIN A;  1I9D A;  1TTZ A;  1PRX A;  5CRD A;  5IIZ A;  2IL3 A;  1XW9 A;  5JCG A;  5JWO B;  1S3R A;  4F9Z A;  1ZOF A;  2VCZ A;  2YV9 A;  9GSS A;  1OE8 A;  2CV4 A;  5EL8 A;  2GZZ A;  4NAX A;  2V41 A;  4OCF A;  4PQI A;  1XWG A;  3AY8 A;  4WET A;  2H1A A;  2YJH A;  4PUA A;  1PN0 A;  4EKZ A;  1WOU A;  1AXD A;  1EWX A;  14GS A;  3NIV A;  4O5Q A;  2A2P A;  1DUG A;  1K3Y A;  3P8W A;  3APO A;  4YAP A;  1GNE A;  3PPU A;  3TKP A;  5BMU A;  2H71 A;  2WB9 A;  2UZ8 A;  2HT9 A;  1CQH A;  1QK8 A;  2FGX A;  5FWG A;  2VL3 A;  3HVV A;  5HFG A;  1V98 A;  3F4R A;  2X99 A;  1ZCP A;  2QGV A;  3CRU A;  1PSQ A;  1ILO A;  2V32 A;  3BBY A;  4NWY A;  2R0G A;  1TRU A;  1UVZ A;  3D6I A;  2PVO C;  2ZCT A;  2EIQ A;  4QL9 A;  2CA8 A;  2VLU A;  4TKY A;  2FD3 A;  2WS2 A;  4OO5 A;  1GSQ A;  2GT5 A;  4IGJ A;  20GS A;  2F3M A;  3LW9 A;  4DSS A;  4EDZ A;  3MWH A;  1FOV A;  3L78 A;  2X8C A;  2JZR A;  1F6M C;  1GUL A;  4HU9 A;  2LQQ A;  3LEF A;  2PWJ A;  3DXB A;  5FHI A;  5IO0 A;  1OVN A;  2VL2 C;  1BX9 A;  3RPN A;  2LST A;  2B5Y A;  1T8E B;  2AV4 A;  4XS1 A;  3E0U A;  5DJL A;  1CQG A;  2DJ0 A;  1MDK A;  5ECN B;  1SK0 A;  5G1K A;  3UBK A;  3RHB A;  4DEJ A;  4ZIL A;  4IJ3 A;  3IC8 A;  3OR5 A;  4TR1 A;  5IM9 A;  3C73 A;  3LXT A;  1KBN A;  1M3I A;  1FW1 A;  2BTO T;  1X0R A;  1YKC A;  1VF3 A;  3VK9 A;  2DJJ A;  1ZYQ B;  5DJM A;  3GN3 A;  1FOH A;  3CXG A;  1F3B A;  3O76 A;  3VUR A;  3CMI A;  1F9M A;  2PGT A;  4TR4 A;  3IR4 A;  4BL7 A;  4OWY A;  2J23 A;  4YKF A;  4ACS A;  4KSO A;  3P2A A;  1UC7 A;  2XHF A;  1C72 A;  3L0H A;  2HE3 A;  3H93 A;  5H5R A;  4WBJ A;  1NM3 A;  3GV1 A;  1PA3 A;  4GQC A;  5CP1 A;  3WGD A;  3RBT A;  1JHB A;  3IOS A;  1TW9 A;  3F63 A;  1A0R P;  3BJ5 A;  4IKH A;  4H86 A;  2H0H A;  1ZGN A;  4JR6 A;  5ECM B;  3MYD A;  1R26 A;  4MPF A;  2I9H A;  4FIW A;  4KE3 A;  4HUA A;  2RII A;  2B3S A;  2RUF A;  5ECO B;  5ELA A;  4X1U A;  3F4T A;  2OAC A;  3GKK A;  3TKR A;  3I69 A;  1HD2 A;  3QFB C;  1ERW A;  3QOU A;  3GRX A;  4CY8 A;  1H4O A;  1TRV A;  4BVX B;  5INY A;  1EEM A;  1X5D A;  2R4V A;  4KB3 A;  4ZL9 A;  5IO2 A;  1B48 A;  1FO5 A;  2L4Q A;  6GSS A;  2R2J A;  3GUS A;  3L9V A;  2H6Y A;  2IN3 A;  4POB A;  5H5Q A;  4V1A g;  4L0W A;  1FVK A;  3GKN A;  4KSM A;  5AGY A;  4Z2T A;  4MF5 A;  4YQM A;  5ECI B;  1TK8 B;  1T4Z A;  2H01 A;  4ZB6 A;  2PUK C;  3QAW A;  3VPT A;  4K0N A;  2X8H A;  4G19 A;  1PX7 A;  2MMZ A;  3QPM A;  3CYN A;  1O73 A;  2FWE A;  3P7X A;  1GLQ A;  2N5F A;  4KGI A;  4TXV A;  5IMV A;  3GKM A;  2IFQ B;  4IBP A;  2VM1 A;  2CZ2 A;  1Z6N A;  1BED A;  3VI5 A;  1AQW A;  2LQO A;  1VF2 A;  4JED A;  2HNL A;  3HZ8 A;  3DEX A;  1XW5 A;  4YKG A;  1S3C A;  1TRS A;  2Z9S A;  5ECP B;  2HRF A;  1XOA A;  5IMF A;  4BA7 A;  1O81 A;  4ULX A;  1THX A;  2H8L A;  1GUM A;  1QGV A;  5ELG A;  2ZUP A;  4L5O A;  3BOA A;  1ZL9 A;  3GTU A;  4HU7 A;  4KCE A;  3WT2 A;  5ID2 A;  2YZH A;  2E2M A;  3RHC A;  3UAR A;  4LMV A;  2IIY A;  3ERG A;  4BVY A;  3IK7 A;  4E8E A;  2KOK A;  1PQN A;  4KH7 A;  1G0T A;  1EV9 A;  8GSS A;  2AJQ B;  3G7I A;  2V6K A;  1X5C A;  4A5P A;  3HJM A;  4X0X A;  2B1L A;  2LKU A;  3M3M A;  2OE0 A;  1TK5 B;  3HXS A;  3ZZX A;  4MDC A;  5DQY A;  4XCS A;  4GRF A;  2C1Y A;  2FHE A;  3KCM A;  2LNS A;  2YP6 A;  3ZTL A;  1Z3E A;  4F82 A;  3A3T A;  3MDK A;  3QD9 A;  1M0U A;  1GWC A;  4MA9 A;  4AJ7 A;  1B4Q A;  2ON5 A;  4WKW A;  1QMV A;  3FMW A;  4ECB A;  5ENU A;  4IQA A;  4AJ6 A;  2O8V B;  2H76 A;  4I8B A;  5GSS A;  3DD3 A;  4IQ1 A;  4IVF A;  5DVB A;  1GUK A;  1ST9 A;  2JZS A;  2GDR A;  4OO4 A;  2F8A A;  3O6T A;  1OC8 A;  4ZB8 A;  2DJ2 A;  1TU8 A;  4WF4 A;  3A2X A;  5J3R A;  4MH2 A;  2IME A;  1XIY A;  5FT3 A;  2HRK A;  1FVJ A;  3QCP A;  1KTE A;  1T4Y A;  3L4N A;  5A4W A;  4NHW A;  3GUR A;  2X49 A;  3EU3 A;  1XG8 A;  3LOR A;  4RQR A;  3LG6 A;  1SJZ A;  4N11 A;  1GTU A;  2GSR A;  4MCU A;  3MAK A;  1PX6 A;  2CVB A;  3LSZ A;  1M2B A;  4KA0 A;  2DJ1 A;  4KDY A;  2FY6 A;  4KCA A;  3GL3 A;  1OE7 A;  4MP4 A;  1JLW A;  2DC5 A;  5HFK A;  5HR2 A;  3TB2 A;  4HOJ A;  2J9H A;  3EU4 A;  1U3I A;  5IMZ A;  1BQ7 A;  1TRW A;  1M9A A;  1A0F A;  2I81 A;  5IPG A;  2JSZ A;  4WR5 A;  1MD3 A;  3LJR A;  2O89 A;  3KEB A;  1V40 A;  2VCW A;  3Q19 A;  2PER A;  2VCV A;  2R0C A;  4TVE A;  3BD2 A;  3UBL A;  5CRH A;  1ERV A;  2LJA A;  2PMT A;  3DRN A;  1I5G A;  3F8U A;  2O7K A;  4PX1 A;  3GYK A;  2KP2 A;  2LS5 A;  2H1G A;  3ZYW A;  4K1F A;  4KDU A;  3F9U A;  1EGO A;  4PNF A;  4F0B A;  1GUH A;  1S3A A;  3N9J A;  5GST A;  1Z7P A;  1WWJ A;  3HHV A;  4MJE A;  1K3L A;  3E3E A;  4EO3 A;  2YN1 A;  1WE0 A;  2F8F A;  1T1V A;  4Q5N A;  3IAM 2;  1XPV A;  5COH A;  3IXR A;  2HZE A;  2AHE A;  4PGT A;  2LTK A;  4GCI A;  3FRC A;  2EIR A;  1M2A A;  2WGR A;  5IQY A;  3DML A;  4L0U A;  3ZML A;  4MJC A;  2NVL A;  4I2U A;  4J2F A;  1DE1 A;  4K8M A;  4D73 A;  4MZC A;  3VWV A; 
#chains in the Genus database with same CATH homology
 2IJY A;  3GIX A;  2CAQ A;  2O87 A;  3A2V A;  4WR4 A;  3GX0 A;  3HYP A;  4FYB A;  4TRX A;  4E8H A;  3LXZ A;  1GTA A;  7GSS A;  4MMM A;  4X4J A;  2R3X A;  5E4W A;  1MDI A;  2GQM A;  4EC0 A;  2DLX A;  1YEP A;  4N0Z A;  5D93 A;  3H8Q A;  1U88 A;  2IWT A;  1K3O A;  1NHO A;  5HR3 A;  1BAY A;  2PN8 A;  1SD9 A;  4O32 A;  2VO4 A;  5J9C A;  1ERT A;  2KUC A;  2R0P A;  3LGC A;  4JU5 A;  2BJX A;  2GST A;  1TKD B;  4TR3 A;  2WZ9 A;  4IP1 A;  5EPF A;  4GLT A;  3C8E A;  2H1B A;  4JRR A;  3FZA A;  2I3Y A;  5JCW A;  2I1U A;  4HQS A;  2R6K A;  3C7M A;  5LNK e;  2GQL A;  5A5K A;  3CSI A;  1ACV A;  2FWG A;  3FZ4 A;  1NW2 A;  2R5G A;  5KN0 A;  1HNB A;  1VF4 A;  1A2L A;  2VCQ A;  4F0C A;  1ZMA A;  1WJK A;  1Z5Y E;  5J5N A;  1RQM A;  4J56 E;  4K7N A;  3TOT A;  2NPB A;  5KN3 A;  1XCC A;  1XZO A;  2DJ3 A;  2LV3 A;  4RI6 A;  1OC9 B;  4IHU A;  2YJ7 A;  3CTG A;  2F9S A;  3M0F A;  2HYX A;  3UIW A;  4J57 E;  3EC3 A;  4P3Y B;  4ZXG A;  1GSE A;  1O8X A;  3U6V A;  3KTB A;  3QAG A;  3ZVJ D;  2XBI A;  2P31 A;  3IHQ A;  3TRP A;  5EY6 A;  4O5U A;  4FQU A;  1EOG A;  2A4V A;  3UVT A;  4FO5 A;  2C80 A;  3G9B A;  3WGX A;  4MPG A;  1R4W A;  2QC7 A;  4OFT A;  5CRW A;  1SYX A;  3F3R A;  2GTU A;  1KEB A;  2G2Q A;  1O6J A;  5EVO A;  2I4A A;  2FA4 A;  3IE3 A;  3FK8 A;  4XRD A;  3FEU A;  1IYI A;  22GS A;  5G5E A;  2WDU A;  5ABR A;  5KOX A;  3D5J A;  2YWN A;  3DKS A;  4HQZ A;  4QQ7 A;  2IMK A;  4IEL A;  4HJ2 A;  4OD7 A;  2L57 A;  3TKS A;  2CT6 A;  3WT1 A;  5DAK B;  1O8W A;  1F3A A;  4MZW A;  3GA4 A;  1XWC A;  2MBS A;  4ISD A;  4KW6 A;  1XFL A;  2E0Q A;  5KN2 A;  2LEG A;  4DSS B;  5D9W A;  3TJK A;  4BVX A;  1SL0 B;  5AN1 A;  2L5L A;  3UVH A;  3D22 A;  2C0E A;  3ERF A;  4KF9 A;  4GXZ A;  5G1L A;  2HI7 A;  1JZR A;  2YNX A;  3FYG A;  3F3Q A;  2A2S A;  2C0G A;  1YQ1 A;  3NOF A;  2PU9 C;  4ZBD A;  2DKH A;  3QFA C;  1AQX A;  1AIU A;  5CYY A;  4EVM A;  4V1A p;  1A8Y A;  4ID0 A;  2HSH A;  3A2W A;  3TDG A;  2OKA A;  3ZIV A;  2LUS A;  4EF0 A;  3IPZ A;  5IOW A;  3C1S A;  3M9J A;  2KLX A;  1BG5 A;  4TXO B;  4G0K A;  4MH3 A;  2OBK A;  4POM A;  1G7O A;  2ON7 A;  4PXO A;  17GS A;  1Z7R A;  3O3T A;  1FB0 A;  3HDC A;  4PUF C;  4HI7 A;  2OA7 A;  3GHA A;  2GLR A;  1PN9 A;  2C8U A;  2B5E A;  3IC4 A;  4XS4 B;  1BYE A;  3GX8 A;  2XPE A;  3C71 A;  2H19 A;  1Q98 A;  2JAD A;  2LRT A;  4Z7X A;  3WD6 A;  1THO A;  1TI1 A;  1JFU A;  1ML6 A;  5KEJ A;  2YWM A;  5HR1 A;  4ZBB A;  1FHE A;  3N5O A;  2R37 A;  1SYR A;  1WRY A;  2FLS A;  3VLN A;  3S9F A;  3LWA A;  4K0G A;  4NXI A;  5CRE A;  1Y6E A;  2B7K A;  2E7P A;  2AUV A;  3SWL A;  4AGS A;  3PGT A;  1EGR A;  1WIK A;  3A5W A;  3KM6 A;  2NDO A;  4FH8 A;  3EMX A;  1TJD A;  1XWB A;  5IOX A;  1GNW A;  3L9U A;  2A2R A;  5F8B A;  3P90 A;  2VD0 A;  3IAS 2;  1FAA A;  3GST A;  3F6F A;  3GFK A;  1K0D A;  2L4C A;  4HDE A;  3VWX A;  1DBY A;  3KH9 A;  3VFI A;  1F37 A;  3VWW A;  3QR6 A;  2OE3 A;  4DSR A;  5KN1 A;  3HA9 A;  5F05 A;  4OFN A;  3Q74 A;  1X9W B;  3ZVJ A;  3D0Z A;  2C0F A;  2LRN A;  1B8X A;  4L8E A;  3CTF A;  4CDO A;  4KAE A;  2GGT A;  2M80 A;  4MLY A;  4JBB A;  3DGQ A;  3I6A A;  1PGT A;  16GS A;  2XC2 A;  2P5Q A;  4F2I A;  3ZFB A;  4MJB A;  5KOW A;  4AF2 A;  5ECR B;  3QDN A;  4XIH A;  4POL A;  5J41 A;  2VOC A;  1PKW A;  3F6D A;  1X5E A;  3DIE A;  2LJK A;  2VL2 A;  1W4V A;  3WGE A;  1SEN A;  4I6X A;  4PTS A;  1M2D A;  2H74 A;  3V1W A;  2GS3 A;  2RM6 A;  1B9Y C;  4ZL8 A;  1JZO A;  1GSU A;  4PQH A;  2V6O A;  4LLR A;  2CVK A;  4O92 A;  3TRX A;  1YZX A;  2HZF A;  18GS A;  2TIR A;  5IMA A;  3GNJ A;  3R3E A;  3J7Y b;  3KJY A;  4MAB A;  1ZYE A;  1TP9 A;  3I9V 2;  2H72 A;  4GF0 A;  3TCO A;  4LL1 B;  3TUE A;  3GTU B;  5F06 A;  3TGZ A;  2K6V A;  2GZP A;  5ID2 B;  2IMD A;  1QQ2 A;  3CSJ A;  1O7U A;  4EUY A;  5ECQ B;  1K0M A;  4BVY B;  4KND A;  4FYC A;  5CAX A;  1HNA A;  1OYJ A;  1A23 A;  2XPD A;  1TXX A;  2AB6 A;  5D96 A;  5DAL A;  4Q5R A;  1GP1 A;  2JU5 A;  5D9V A;  2H6X A;  2LRC A;  1XW6 A;  5BRT A;  2PBJ A;  4OFM A;  4POK A;  1AAZ A;  4BPY A;  1OC3 A;  4MZB A;  1J08 A;  5D73 A;  1V9W A;  4HZ2 A;  3ZL5 A;  1YF0 A;  4NMU A;  2VD1 A;  3LQ7 A;  2QA1 A;  4ILF A;  3IV4 A;  3UAP A;  1X9M B;  4JZQ A;  5G2Z A;  5GZZ B;  4TOP A;  4K5S A;  4NV2 A;  4MF6 A;  5D8I A;  4EDY A;  5CRG A;  4I2T A;  4YQU A;  2GSQ A;  1XOB A;  2X8G A;  3HVX A;  1V58 A;  2H66 A;  2WJU A;  5A4U A;  3UEM A;  2QA2 A;  2X64 A;  3ME8 A;  5LD0 A;  4RUV A;  2YZU A;  1GH2 A;  4JE1 A;  4Z2R A;  4ML1 A;  4GTU A;  1GSD A;  2YV7 A;  4IS0 A;  1U6T A;  3KD0 A;  1YY7 A;  4GWR A;  2H73 A;  2L5O A;  4WEY A;  1J0F A;  4IN0 A;  2B7J A;  2CAI A;  3HJP A;  2K8V A;  2GT6 A;  2A4H A;  1J9B A;  1WMJ A;  5IMC A;  1AC1 A;  1MDJ A;  2FUG 2;  1K0B A;  4EIP A;  3DVX A;  3Q18 A;  1WP0 A;  4FYU A;  2WUL A;  3EWL A;  3HJO A;  4N0V A;  3KIJ A;  3MIX A;  1A2J A;  3ZIJ A;  1QUW A;  3D21 A;  3IRA A;  3US3 A;  5IMD A;  4NPB A;  1JLV A;  3ERW A;  2HSM A;  3VWU A;  1Z9H A;  3MNG A;  2KP1 A;  2H75 A;  4BWQ A;  3SBC A;  2HSY A;  2YPM A;  1RK4 A;  1TOF A;  1GSF A;  5B6N A;  2EIO A;  2B5X A;  5HFI A;  5B8A A;  4K2D A;  3LYK A;  3ZFL A;  1VRS D;  4MK3 A;  3BCK A;  2GVP A;  2O85 A;  13GS A;  5DBQ A;  2B6M A;  4TW5 A;  2N5A A;  3FY7 A;  2K18 A;  2ZNM A;  2M72 A;  3DYR A;  1USB A;  1SJI A;  4OMV A;  3HY2 A;  2IPA A;  5L71 A;  1PD2 1;  3KH7 A;  1R7H A;  1RW1 A;  1E6B A;  2FA8 A;  2N5B A;  4IP6 A;  2H1D A;  1OC9 A;  3IA1 A;  3PIN A;  4LL4 B;  1V2A A;  2C4J A;  3RDW A;  2DBC A;  3CSH A;  3KP8 A;  4ZBA A;  1XWA A;  1XVQ A;  3KGK A;  1T7P B;  3RPP A;  3I43 A;  4HS1 A;  4ZB9 A;  4F03 A;  1EEJ A;  2HZE B;  2TRX A;  4K7I A;  4OCE A;  5D9X A;  1YEX A;  3MSZ A;  2VAF A;  3GKX A;  2OJL A;  2FWH A;  4ZIJ A;  1GSY A;  2L6C A;  3D4M A;  4D73 B;  3KTL A;  3EVI A;  2K9F A;  5G5F A;  3HVS A;  3M9K A;  1XVW A;  3ZIT A;  3TJG A;  5DAK A;  3ED3 A;  1K0O A;  1EV4 A;  1Z6M A;  3EUR A;  4G10 A;  4RI7 A;  5J4U A;  3APQ A;  4XRA A;  1BJX A;  4G0I A;  3KMN A;  1A8L A;  4LA1 A;  10GS A;  1NHY A;  5GAN D;  1PL1 A;  3TJF A;  2M46 A;  3WYW A;  2OE1 A;  2H0G A;  2HXK A;  1ERU A;  2RUE A;  3FHK A;  2QSI A;  2GQK A;  5JWQ B;  1R5P A;  4EE0 A;  5D9T A;  5JCU A;  1N2A A;  19GS A;  1S3D A;  4MNN A;  3A5I A;  4N30 A;  5DDL A;  3IBH A;  2DJK A;  1SD8 A;  4TN8 A;  3VI7 A;  3H79 A;  3CRT A;  3UL3 A;  1EOH A;  3R2Q A;  4I5Q A;  2DIZ A;  1GL8 A;  2GSS A;  4TXO A;  3GMF A;  4K7O A;  1NSW A;  1Q4J A;  4HZ4 A;  4G0L A;  4BWS A;  2MBT A;  2L59 A;  3IDV A;  1VGL A;  3GSS A;  2XBQ A;  3W6G A;  2C0D A;  4I97 A;  2VL9 A;  3KP9 A;  3H4K A;  5F07 A;  1M99 A;  4CW9 A;  4XHM A;  4XS4 A;  4WXT A;  3M8N A;  1F2E A;  1M9B A;  1XXU A;  3ZLP A;  2RM5 A;  1X9S B;  12GS A;  2C3N A;  3FKF A;  4Q5F A;  5CNW A;  3K8N A;  5ECL B;  4NV5 A;  3TOU A;  4DSQ A;  2PPT A;  3H1N A;  2YCD A;  4USS A;  3W8J A;  2MZC A;  5B7C A;  1B4P A;  1OAZ A;  4IJI A;  1ABA A;  3QMX A;  3UJ1 A;  4K6X A;  4K5R A;  4ICY A;  1M7T A;  4EXJ A;  2H30 A;  2FCH A;  1R5A A;  1MD4 A;  4TR1 B;  1PKZ A;  3FW2 A;  4WBR D;  2JAC A;  1FG4 A;  2NBS A;  2CX3 A;  3ZMK A;  2C3Q A;  4KUN A;  4KX4 A;  2IFQ A;  2F51 A;  5AIS A;  2H70 A;  2REM A;  2VLT A;  1LBK A;  1ZYN A;  5H5S A;  4V2L A;  2MYG A;  5ECK B;  1MTC A;  5B6M A;  4HEA 2;  4NHZ A;  1SK1 A;  4BL7 B;  5A4V A;  3TJB A;  2E2G A;  1PMT A;  5C00 A;  4XTS A;  3ME7 A;  1OKD A;  5E59 A;  2DIY A;  4MJA A;  2CZ3 A;  2DSA A;  4QL7 A;  3BCI A;  1FB6 A;  4YQV A;  2WFC A;  6GSW A;  4HJM A;  3U5R E;  2V1M A;  1SL1 B;  1SL2 B;  3M1G A;  3HKR A;  3FR3 A;  4O7H A;  1K0C A;  2QKE A;  2HRN A;  2V2G A;  2BMX A;  1G6W A;  2JZT A;  1B9X C;  3TRQ A;  5LCZ A;  3FR6 A;  3PH9 A;  3UOM A;  2HLS A;  1AQV A;  3GL5 A;  3J7Y k;  4RQX A;  2B1K A;  2P5R A;  1IYH A;  3FR9 A;  2CX4 A;  4Q5Q A;  1SK2 A;  3KZQ A;  2YAN A;  2VCX A;  3ZRE A;  4GSN A;  3TJJ A;  1LJR A;  1T3B A;  5JWR B;  2HRA A;  1DSB A;  3NZN A;  3FZ9 A;  3HD5 A;  5AIV A;  2JSY A;  3D4T A;  4G2E A;  1ZYP A;  4CY6 A;  6GSU A;  1A24 A;  4ECI A;  2VCT A;  1A2M A;  2YWI A;  1QXH A;  1EZK A;  4AJ8 A;  4V2N A;  3EPT A;  2LNT A;  6GSY A;  1SJ6 A;  3G7J A;  1YKA A;  2WRT A;  3VPQ A;  2PVQ A;  3EE2 A;  3QAV A;  1O85 A;  2P0G A;  6GSV A;  1VF1 A;  3FZ5 A;  4TR0 A;  6GST A;  1N8J A;  4ECC A;  1KNG A;  3EYT A;  1MEK A;  1G6Y A;  4L5L A;  4PQ1 A;  2DKI A;  3E9J B;  3LFL A;  4GST A;  3W8S A;  1GSS A;  1JZW A;  3L9S A;  2VUP A;  2WCI A;  2CQ9 A;  3PR8 A;  2AAW A;  2ES7 A;  4CHS A;  3HCZ A;  3JCM L;  2L6D A;  4DVC A;  1SKW B;  1TK0 B;  1QFN A;  4IW9 A;  4MF7 A;  5DCG A;  2TRC P;  1WPI A;  2VM2 A;  3F4S A;  5AIX A;  1TDI A;  1EP8 A;  4YAV A;  4LMW A;  5C04 A;  4K2X A;  11GS A;  2G0F A;  5IPH A;  4N10 A;  1U3A A;  1ZZY A;  1GLP A;  5ECS A;  1XWK A;  4PNG A;  2MMA A;  3ISO A;  1G7E A;  5F0G A;  2D2Z A;  5HR0 A;  4WF5 A;  2C3T A;  4ZL7 A;  3DWV A;  1GTB A;  1K0N A;  2VIM A;  2ALB A;  3G7Y A;  2KHP A;  2FNO A;  1AUC A;  4X43 A;  1SKR B;  5G31 A;  5G30 A;  1GTI A;  1LU4 A;  2VLV A;  4Z2U A;  3CBU A;  5DCH A;  2HFD A;  2FWF A;  1ON4 A;  1TU7 A;  3IK9 A;  1GRX A;  4EIQ A;  1UN2 A;  2EC4 A;  1JZD A;  2IMF A;  2JL4 A;  4G9H A;  1PL2 A;  2CVD A;  3GH9 A;  1XBS A;  2LJR A;  4YH2 A;  2K8S A;  2DML A;  3HZ4 A;  3APS A;  3UMA A;  1AW9 A;  4V2M A;  2RLI A;  1K0A A;  3TKS C;  1OKT A;  3LYP A;  2OBI A;  5J9B A;  6GSX A;  2GZY A;  3Q6O A;  2H6Z A;  1HNC A;  4PUR A;  5ECH B;  1T00 A;  1TI3 A;  1YDK A;  1E2Y A;  2H0I A;  1DE2 A;  3TKS E;  3F0I A;  1YF1 A;  1H75 A;  5DQS A;  5GAP D;  3ZRD A;  1SU9 A;  5DAL B;  3DVW A;  4ECJ A;  3KMO A;  4GQF A;  2YWO A;  2NTO A;  4JR4 A;  3IHG A;  5CO3 A;  1HYU A;  2DMM A;  2AYT A;  5B8B A;  4K9Z A;  4EL1 A;  2MMO A;  1V57 A;  3C1R A;  1URM A;  2OAD A;  4XS6 A;  1UA5 A;  2X4A A;  1HQO A;  5HQP A;  3EMP A;  1SKS B;  2MMN A;  4O5R A;  3RAZ A;  2YOI A;  3TKQ A;  3GH6 A;  1EP7 A;  4ML6 A;  4GSS A;  4KDX A;  1Y25 A;  1W89 A;  2IMI A;  3KXO A;  1U87 A;  1YJ6 A;  3EIN A;  1I9D A;  1TTZ A;  1PRX A;  5CRD A;  5IIZ A;  2IL3 A;  1XW9 A;  5JCG A;  5JWO B;  4F9Z A;  1ZOF A;  2VCZ A;  2YV9 A;  9GSS A;  1OE8 A;  2CV4 A;  5EL8 A;  2GZZ A;  4NAX A;  2V41 A;  4OCF A;  4PQI A;  1XWG A;  3AY8 A;  4WET A;  2H1A A;  2YJH A;  4PUA A;  1PN0 A;  4EKZ A;  1WOU A;  1AXD A;  1EWX A;  14GS A;  3NIV A;  4O5Q A;  2A2P A;  1DUG A;  1K3Y A;  3P8W A;  3APO A;  4YAP A;  1GNE A;  3PPU A;  3TKP A;  5BMU A;  2H71 A;  2WB9 A;  2UZ8 A;  2HT9 A;  1CQH A;  1QK8 A;  2FGX A;  5FWG A;  2VL3 A;  3HVV A;  5HFG A;  1V98 A;  3F4R A;  2X99 A;  1ZCP A;  2QGV A;  3CRU A;  1PSQ A;  1ILO A;  2V32 A;  3BBY A;  4NWY A;  2R0G A;  1TRU A;  1UVZ A;  3D6I A;  2PVO C;  2ZCT A;  2EIQ A;  4QL9 A;  2CA8 A;  2VLU A;  4TKY A;  2FD3 A;  2WS2 A;  4OO5 A;  1GSQ A;  2GT5 A;  4IGJ A;  20GS A;  2F3M A;  3LW9 A;  4DSS A;  4EDZ A;  3MWH A;  1FOV A;  3L78 A;  2X8C A;  2JZR A;  1F6M C;  1GUL A;  4HU9 A;  2LQQ A;  3LEF A;  2PWJ A;  3DXB A;  5FHI A;  5IO0 A;  1OVN A;  2VL2 C;  1BX9 A;  3RPN A;  2LST A;  2B5Y A;  1T8E B;  2AV4 A;  4XS1 A;  3E0U A;  5DJL A;  1CQG A;  2DJ0 A;  1MDK A;  5ECN B;  1SK0 A;  5G1K A;  3UBK A;  3RHB A;  4DEJ A;  4ZIL A;  4IJ3 A;  3IC8 A;  3OR5 A;  4TR1 A;  5IM9 A;  3C73 A;  3LXT A;  1KBN A;  1FW1 A;  2BTO T;  1X0R A;  1YKC A;  1VF3 A;  3VK9 A;  2DJJ A;  1ZYQ B;  5DJM A;  3GN3 A;  1FOH A;  3CXG A;  1F3B A;  3O76 A;  3VUR A;  3CMI A;  1F9M A;  2PGT A;  4TR4 A;  3IR4 A;  4BL7 A;  4OWY A;  2J23 A;  4YKF A;  4ACS A;  4KSO A;  3P2A A;  1UC7 A;  2XHF A;  1C72 A;  3L0H A;  2HE3 A;  3H93 A;  5H5R A;  4WBJ A;  1NM3 A;  3GV1 A;  1PA3 A;  4GQC A;  5CP1 A;  3WGD A;  3RBT A;  1JHB A;  3IOS A;  1TW9 A;  3F63 A;  1A0R P;  3BJ5 A;  4IKH A;  4H86 A;  2H0H A;  1ZGN A;  4JR6 A;  5ECM B;  3MYD A;  1R26 A;  4MPF A;  2I9H A;  4FIW A;  4KE3 A;  4HUA A;  2RII A;  2B3S A;  2RUF A;  5ECO B;  5ELA A;  4X1U A;  3F4T A;  2OAC A;  3GKK A;  3TKR A;  3I69 A;  1HD2 A;  3QFB C;  1ERW A;  3QOU A;  3GRX A;  4CY8 A;  1H4O A;  1TRV A;  4BVX B;  5INY A;  1EEM A;  1X5D A;  2R4V A;  4KB3 A;  4ZL9 A;  5IO2 A;  1B48 A;  1FO5 A;  2L4Q A;  6GSS A;  2R2J A;  3GUS A;  3L9V A;  2H6Y A;  2IN3 A;  4POB A;  5H5Q A;  4V1A g;  4L0W A;  1FVK A;  3GKN A;  4KSM A;  5AGY A;  4Z2T A;  4MF5 A;  4YQM A;  5ECI B;  1TK8 B;  1T4Z A;  2H01 A;  4ZB6 A;  2PUK C;  3QAW A;  3VPT A;  4K0N A;  2X8H A;  4G19 A;  1PX7 A;  2MMZ A;  3QPM A;  3CYN A;  1O73 A;  2FWE A;  3P7X A;  1GLQ A;  2N5F A;  4KGI A;  4TXV A;  5IMV A;  3GKM A;  2IFQ B;  4IBP A;  2VM1 A;  2CZ2 A;  1Z6N A;  1BED A;  3VI5 A;  1AQW A;  2LQO A;  1VF2 A;  4JED A;  2HNL A;  3HZ8 A;  3DEX A;  1XW5 A;  4YKG A;  1S3C A;  1TRS A;  2Z9S A;  5ECP B;  2HRF A;  1XOA A;  5IMF A;  4BA7 A;  1O81 A;  4ULX A;  1THX A;  2H8L A;  1GUM A;  1QGV A;  5ELG A;  2ZUP A;  4L5O A;  3BOA A;  1ZL9 A;  3GTU A;  4HU7 A;  4KCE A;  3WT2 A;  5ID2 A;  2YZH A;  2E2M A;  3RHC A;  3UAR A;  4LMV A;  2IIY A;  3ERG A;  4BVY A;  3IK7 A;  4E8E A;  2KOK A;  1PQN A;  4KH7 A;  1G0T A;  1EV9 A;  8GSS A;  2AJQ B;  3G7I A;  2V6K A;  1X5C A;  4A5P A;  3HJM A;  4X0X A;  2B1L A;  2LKU A;  3M3M A;  2OE0 A;  1TK5 B;  3HXS A;  3ZZX A;  4MDC A;  5DQY A;  4XCS A;  4GRF A;  2C1Y A;  2FHE A;  3KCM A;  2LNS A;  2YP6 A;  3ZTL A;  1Z3E A;  4F82 A;  3A3T A;  3MDK A;  3QD9 A;  1M0U A;  1GWC A;  4MA9 A;  4AJ7 A;  1B4Q A;  2ON5 A;  4WKW A;  1QMV A;  3FMW A;  4ECB A;  5ENU A;  4IQA A;  4AJ6 A;  2O8V B;  2H76 A;  4I8B A;  5GSS A;  3DD3 A;  4IQ1 A;  4IVF A;  5DVB A;  1GUK A;  1ST9 A;  2JZS A;  2GDR A;  4OO4 A;  2F8A A;  3O6T A;  1OC8 A;  4ZB8 A;  2DJ2 A;  1TU8 A;  4WF4 A;  3A2X A;  5J3R A;  4MH2 A;  2IME A;  1XIY A;  5FT3 A;  2HRK A;  1FVJ A;  3QCP A;  1KTE A;  1T4Y A;  3L4N A;  5A4W A;  4NHW A;  3GUR A;  2X49 A;  3EU3 A;  3LOR A;  4RQR A;  3LG6 A;  1SJZ A;  4N11 A;  1GTU A;  2GSR A;  4MCU A;  3MAK A;  1PX6 A;  2CVB A;  3LSZ A;  1M2B A;  4KA0 A;  2DJ1 A;  4KDY A;  2FY6 A;  4KCA A;  3GL3 A;  1OE7 A;  4MP4 A;  1JLW A;  2DC5 A;  5HFK A;  5HR2 A;  3TB2 A;  4HOJ A;  2J9H A;  3EU4 A;  1U3I A;  5IMZ A;  1BQ7 A;  1TRW A;  1M9A A;  1A0F A;  2I81 A;  5IPG A;  2JSZ A;  4WR5 A;  1MD3 A;  3LJR A;  2O89 A;  3KEB A;  1V40 A;  2VCW A;  3Q19 A;  2PER A;  2VCV A;  2R0C A;  4TVE A;  3BD2 A;  3UBL A;  5CRH A;  1ERV A;  2LJA A;  2PMT A;  3DRN A;  1I5G A;  3F8U A;  2O7K A;  4PX1 A;  3GYK A;  2KP2 A;  2LS5 A;  2H1G A;  3ZYW A;  4K1F A;  4KDU A;  3F9U A;  1EGO A;  4PNF A;  4F0B A;  1GUH A;  1S3A A;  3N9J A;  5GST A;  1Z7P A;  1WWJ A;  3HHV A;  4MJE A;  1K3L A;  3E3E A;  4EO3 A;  2YN1 A;  1WE0 A;  2F8F A;  1T1V A;  4Q5N A;  3IAM 2;  1XPV A;  5COH A;  3IXR A;  2HZE A;  2AHE A;  4PGT A;  2LTK A;  4GCI A;  3FRC A;  2EIR A;  1M2A A;  2WGR A;  5IQY A;  3DML A;  4L0U A;  3ZML A;  4MJC A;  2NVL A;  4I2U A;  4J2F A;  1DE1 A;  4K8M A;  4D73 A;  4MZC A;  3VWV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...