5HFGA

Cytosolic disulfide reductase dsbm from pseudomonas aeruginosa
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
211
structure length
205
Chain Sequence
LTLHYLYDPLCGWCYGASPLLAAACEVTGLDVRLHGGGMMTQPVGLRHYVMPHDLRIAQLTGQPFGKDYFDGLLRDTSAVFDSAPPTAAVLAAEALDGLGAAMLARIQRAHYVEGRRIAERPVLLELGAELGLGEGFAEAFDACSGEPLRAHFADSRRLMNRLGAAGFPTFALERDGRLQVLDTGRYLGQPDDWRAFLETQLRLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Uncharacterized protein, cytosolic disulfide reductase DsbM
publication title Crystal structures of the disulfide reductase DsbM from Pseudomonas aeruginosa
pubmed doi rcsb
source organism Pseudomonas aeruginosa pao1
total genus 73
structure length 205
sequence length 211
ec nomenclature
pdb deposition date 2016-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01323 DSBA DSBA-like thioredoxin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5hfgA00
3CTFA 4FYUA 4MH2A 5EVOA 1GUKA 3GSTA 1SJIA 2TRXA 2BMXA 3TKRA 2OACA 5H5SA 3F3QA 4JE1A 4RQRA 1CQGA 4X0XA 2B6MA 3I43A 1X0RA 5KN1A 4N0ZA 10GSA 3VI5A 4HQZA 5IMVA 1OYJA 1X9SB 3TJGA 1EWXA 4HJMA 2AAWA 4BL7A 4IJIA 4K7OA 1ST9A 3QMXA 1XFLA 3GH9A 3D0ZA 4GTUA 2HXKA 3I9V2 4OO5A 5AIXA 2RUFA 3IR4A 2LS5A 3CRUA 2VO4A 4XIHA 5IMCA 2FUG2 1DBYA 2NVLA 2JACA 4AF2A 4F03A 1T3BA 3F3RA 5J9BA 3CXGA 1URMA 5IO2A 5JWOB 3GL5A 5ECLB 5ECKB 4JEDA 2CVBA 1UA5A 4WBJA 1N2AA 2EIQA 1Z7PA 3ERWA 2HRFA 1YKCA 3DD3A 1M0UA 2XBIA 4CW9A 3HDCA 4MDCA 4ZB9A 2C0EA 2H19A 4J57E 1PQNA 4L0UA 1LJRA 2WRTA 4FO5A 4XHMA 3DKSA 3GHAA 2GZPA 2IIYA 2O8VB 3HZ4A 3TOUA 4FYBA 2PBJA 3VK9A 3P8WA 3Q18A 2DSAA 2YV9A 1OC8A 2H1AA 3VI7A 6GSVA 3HVSA 3KD0A 4E8EA 6GSTA 1IYIA 4MH3A 5B7CA 4JU5A 4ULXA 4K6XA 4K0GA 5GAND 2I9HA 2R4VA 2RM5A 4ZBDA 1KTEA 4NHWA 2L5LA 4PQIA 2E2GA 1TRUA 2B5YA 2WGRA 3EMPA 19GSA 5ID2A 4EC0A 2LRNA 2GT6A 2VLTA 4HDEA 1EOGA 2H6XA 2H71A 13GSA 3ISOA 2N5FA 3ZL5A 1WJKA 2TRCP 3O6TA 3IXRA 1G7EA 4BVYA 1EGRA 5D9XA 2YWMA 9GSSA 3HD5A 4BVXA 2YWIA 3TKQA 2DJ2A 4TR3A 4IP6A 3QAVA 5EY6A 2LUSA 4AGSA 3WD6A 5DQYA 1ERWA 2PVQA 1AC1A 1VGLA 5DBQA 1ZZYA 1Z3EA 1ZGNA 2GSSA 4D73A 3QCPA 2O85A 1OC9A 4EDZA 4FYCA 2HE3A 2GTUA 1QXHA 7GSSA 1Z6NA 3ZMKA 2FA4A 1Z5YE 4I2UA 1SK0A 4YQVA 3U6VA 1GULA 1WOUA 2G2QA 2F9SA 5D8IA 2I3YA 3L9UA 3TKSC 4ML1A 4BPYA 4D73B 5HR0A 2KP1A 1H4OA 5LNKe 2C80A 17GSA 5B8AA 16GSA 1XXUA 2H01A 4BWQA 2HI7A 1OC9B 4I8BA 3UVTA 4MA9A 3P90A 4NMUA 1W89A 4DSQA 2IJYA 4EXJA 1GTUA 1U3AA 1O8XA 4WXTA 3LJRA 4TR1A 4YAVA 2H75A 2HYXA 2DMMA 3ZFLA 3TUEA 1ILOA 4Z7XA 1U3IA 2ON7A 1O6JA 1MDIA 1JZRA 4HEA2 3H1NA 1M2BA 3MNGA 2VD1A 5EL8A 1Y6EA 1XZOA 1M99A 1DE2A 3UJ1A 1SL2B 5AN1A 3GFKA 5J9CA 3EMXA 3GKMA 4N30A 3E9JB 3RBTA 4TR1B 5DJMA 5DALB 2AYTA 4GSSA 3OR5A 5CRGA 2HRNA 3FK8A 2LQOA 3QAGA 4MABA 2RM6A 1R5AA 2GS3A 3KP8A 4KSMA 3E0UA 1F3AA 1VF1A 2OE0A 3A2VA 3QPMA 3FKFA 1TKDB 3CTGA 3GRXA 2YOIA 4ECCA 3TRPA 1X5CA 2YV7A 3N9JA 1GLQA 3QDNA 2L6CA 2ES7A 4LLRA 2NPBA 2I81A 1XW9A 4N11A 2E0QA 4JR4A 2VL9A 3GMFA 3GV1A 3VFIA 2H74A 5ELAA 2IFQA 2CV4A 2JZRA 4POLA 2E2MA 3DVWA 5EPFA 2HZEB 5A4WA 4QQ7A 2DJ1A 4RI7A 1ZMAA 5HFIA 3HJOA 1ZYQB 3F0IA 1FVJA 1PX6A 4DVCA 3CRTA 3EC3A 4K8MA 4TXVA 2I1UA 4K2DA 4Q5NA 2IFQB 3FY7A 3GSSA 4IHUA 1T7PB 1THOA 1GSFA 4XS4A 1PD21 2FGXA 5ECMB 3DGQA 3FR9A 3W8JA 2X99A 1XVWA 3APQA 3UVHA 4TVEA 5HR1A 1XVQA 3HJPA 5ABRA 4HUAA 1UVZA 3ZRDA 2DJ3A 2N5BA 3C1SA 18GSA 2DJ0A 2V41A 2PERA 5HR3A 2WULA 5DCHA 1KNGA 3GKXA 2XBQA 1I9DA 4XS4B 2OE3A 1NSWA 2WCIA 1MD4A 1MTCA 4O7HA 2MYGA 3TJJA 3IA1A 4F2IA 2GZZA 1JFUA 2V6OA 1K0OA 4WR4A 3TGZA 4AJ7A 2WJUA 4LMWA 3IK7A 2LJAA 14GSA 5DAKA 2YANA 2H66A 8GSSA 4POKA 3L78A 2YP6A 3HY2A 2R37A 2C3NA 3LFLA 2HZFA 2K8VA 4IBPA 2KOKA 3M1GA 4EF0A 1FO5A 3VLNA 3CBUA 3MWHA 1WIKA 4I5QA 4GF0A 1UN2A 3BOAA 2R5GA 5HFGA 6GSWA 1JLWA 4KW6A 1TP9A 5LD0A 3NZNA 4Q5RA 1PX7A 1U6TA 4I2TA 4N0VA 2VUPA 2DMLA 4GQFA 4EE0A 1QMVA 1AQWA 2C1YA 2PVOC 2GZYA 4IQ1A 4V2MA 1G6WA 3SBCA 4IS0A 4ZL9A 5HFKA 3C8EA 3EINA 5F05A 4F0CA 1ZOFA 3M9KA 2CX3A 4OO4A 1J9BA 1J08A 3KZQA 1XCCA 1LBKA 4GRFA 1JZOA 2K9FA 3QD9A 1BQ7A 1XWBA 1TDIA 1V98A 2E7PA 1JZDA 3K8NA 1TTZA 3ZLPA 1GUHA 2K8SA 5B6NA 4OCEA 2LRTA 1TRWA 2G0FA 2H70A 1TW9A 2IPAA 3RAZA 1AW9A 3ZFBA 2H0HA 1ERTA 2OKAA 1AUCA 3LYPA 4MMMA 4L5LA 4DEJA 3GURA 2L4CA 2LTKA 3L9VA 3D6IA 2DBCA 4CDOA 4KDXA 4X43A 1SKRB 1VF2A 1O85A 3KIJA 4N10A 5GZZB 4KCAA 4V1Ap 3S9FA 2LQQA 1ERVA 2CQ9A 2VCTA 3VWXA 5KEJA 4KAEA 3J7Yb 2JSZA 5KN2A 4KB3A 3G7YA 5H5QA 1X9MB 5A4UA 5F8BA 5LCZA 2H30A 5AISA 2B1KA 5FT3A 3H93A 1S3CA 1B8XA 2GQKA 3Q6OA 1MDKA 4EVMA 3C7MA 4ISDA 1JLVA 3IAM2 3ZVJA 4OFMA 1XIYA 1TJDA 1V9WA 4OD7A 1Q4JA 3FR6A 5B8BA 2GGTA 4WBRD 3FZ4A 2K6VA 3W8SA 2FCHA 6GSXA 3IC4A 5ELGA 1TU7A 22GSA 5L71A 5CREA 4NAXA 4PNGA 3PR8A 1GSYA 2VCWA 4KX4A 2KHPA 5CRHA 4PUAA 4HOJA 4O32A 5G1LA 4EDYA 2X8CA 3V1WA 2O89A 4ZBBA 3FZ9A 3WT2A 1PL1A 4WF4A 3WYWA 1G6YA 1PA3A 3FRCA 1OKDA 3GX8A 2H1BA 3EYTA 4OCFA 1M7TA 3UIWA 3GA4A 2XPEA 2Z9SA 5GSTA 1A8YA 4K7NA 1QGVA 3HXSA 1PRXA 1M2DA 1FG4A 5DCGA 2TIRA 1WWJA 4K9ZA 2H6YA 2F8AA 3LXTA 4IELA 4MF6A 1OKTA 5D9WA 1TK8B 5HR2A 4PX1A 5ECRB 1A24A 3TKSA 4FIWA 1YZXA 2FWFA 4YQUA 4POMA 5J5NA 11GSA 5IMZA 1YKAA 1YEPA 2NDOA 2YWNA 1PMTA 3A3TA 3UAPA 4XCSA 5GAPD 3TKSE 5C00A 3KH9A 3GKKA 1QFNA 3M8NA 1RW1A 2C4JA 4V2LA 3ZITA 3FR3A 4JZQA 3TKPA 3LEFA 1X9WB 1QUWA 2IMKA 2VCVA 1O8WA 1R7HA 3UEMA 4F9ZA 2VCZA 1GL8A 2X8HA 4XS1A 5E59A 2K18A 2OBKA 1TRVA 2B7JA 2DJJA 2LKUA 1RQMA 4KNDA 4AJ6A 2EIRA 1FAAA 2CX4A 3P2AA 1T4YA 3NIVA 3GL3A 1YEXA 4MLYA 2JZSA 3TCOA 1T00A 2REMA 1X5EA 1A0RP 3DYRA 4EL1A 3IHQA 2P5RA 4Q5FA 5JCWA 1WRYA 1BX9A 1GWCA 1YF1A 4ZL7A 2OBIA 2X8GA 1GRXA 3EURA 3MAKA 2H76A 1RK4A 1GLPA 2VCQA 1YQ1A 5ECSA 1O7UA 4JR6A 1PGTA 1WP0A 5G5FA 1SYRA 4KGIA 5DALA 1SJ6A 3EU3A 1XBSA 1T4ZA 5JWQB 5ECIB 1Z6MA 5D9TA 4GSTA 4ML6A 5CNWA 4IKHA 3TB2A 1N8JA 4P3YB 1ACVA 2CAIA 3ZREA 5G2ZA 2C8UA 2GDRA 1KBNA 3IK9A 2YJ7A 2RUEA 4G2EA 3M0FA 3E3EA 4IW9A 5HQPA 2H6ZA 3HJMA 3APSA 5FHIA 1ZCPA 2GT5A 1VF4A 4EO3A 5G31A 3M3MA 1R5PA 4ACSA 1V58A 2ALBA 4O5RA 2GVPA 1ABAA 5CRDA 3MSZA 3QAWA 4IGJA 4MP4A 2GSRA 2CVKA 2HZEA 5INYA 1V2AA 3ZVJD 3A5WA 4I97A 5D9VA 1HNCA 3LGCA 3IPZA 4ZBAA 3ZIVA 1M9AA 4HS1A 2HLSA 1DUGA 5IO0A 3L0HA 2C0FA 1K0AA 4MCUA 2QC7A 1A2MA 1SL0B 2FWGA 5IM9A 2H8LA 4K1FA 1K3YA 1AIUA 4HQSA 5IPHA 3IE3A 1GSDA 1WPIA 2PN8A 3O76A 3RPNA 3UOMA 2C0GA 2L59A 5IPGA 1PL2A 3H8QA 5CO3A 1FOVA 4MF5A 1TK0B 2CA8A 3QOUA 3ZTLA 2HSYA 1XOBA 4KCEA 5J4UA 1TI3A 3IV4A 2AB6A 2VAFA 5CYYA 5C04A 2J9HA 2B5XA 1QK8A 3GN3A 3LXZA 5KN3A 1GP1A 3D22A 2D2ZA 2VIMA 2RLIA 3M9JA 3PGTA 4K7IA 2MBSA 3VPQA 2IL3A 2YZUA 1T1VA 1EV4A 1OE7A 2VLUA 5F07A 4I6XA 5DDLA 3FYGA 4LA1A 1XWGA 2YJHA 2I4AA 3F4SA 3FW2A 2WDUA 2LRCA 2JZTA 4CHSA 3I6AA 4TR4A 2KP2A 2CZ2A 1EEMA 5DJLA 1GTBA 2H1GA 3BJ5A 4RUVA 4TKYA 2ON5A 1GSSA 3IAS2 4PNFA 2FNOA 1W4VA 4KUNA 2N5AA 1GTAA 4H86A 5ECOB 2FY6A 2R6KA 4NXIA 1A2JA 2P5QA 3F6FA 3FEUA 3IDVA 1FW1A 3NOFA 1B9YC 1F2EA 1BG5A 2BTOT 4NWYA 5G30A 3RHBA 2FWHA 3D21A 1G7OA 20GSA 2LNTA 4DSRA 5IMDA 1Y25A 4LL4B 1B9XC 4V1Ag 4WETA 4MZWA 1R4WA 2JSYA 1V40A 1K0CA 3DIEA 4ID0A 3CSJA 3N5OA 6GSUA 3APOA 3UMAA 1XW5A 5A4VA 3C1RA 1AQVA 1GNWA 2L6DA 3ME7A 1OAZA 1YF0A 1K3LA 3DEXA 2YCDA 2WFCA 3EU4A 1YY7A 2J23A 5J3RA 2M80A 3G7IA 3LORA 2YPMA 1EV9A 1I5GA 2PPTA 3DMLA 3A2XA 3IBHA 4E8HA 1JZWA 1SKSB 1PN9A 1CQHA 2PU9C 2LNSA 3LYKA 1BAYA 4HU7A 3R2QA 1SYXA 2F51A 4PXOA 1YDKA 4YQMA 2LJKA 2B3SA 4KH7A 2MMOA 2AV4A 1H75A 3GX0A 2LV3A 3KTLA 1TOFA 2AHEA 1EP7A 1BEDA 2JU5A 4ILFA 5JCGA 1A0FA 4PURA 2B1LA 1MEKA 4GLTA 5CP1A 2F8FA 4OFTA 4MPFA 1U87A 3UARA 1R26A 2GSQA 2V32A 6GSYA 4MK3A 3DXBA 2V2GA 2QSIA 4ECIA 2P31A 4WR5A 3US3A 4HI7A 3GNJA 5CRWA 2A2SA 1XWAA 1AAZA 1GSUA 3GYKA 4KDYA 1A2LA 3JCML 1S3DA 1B4QA 2WB9A 4RQXA 3KM6A 4FH8A 1HQOA 2GLRA 4KE3A 4RI6A 2KLXA 1FHEA 1VF3A 5ENUA 3LSZA 1XW6A 4ZB8A 1HNBA 2MZCA 4LL1B 4V2NA 3BCIA 2XHFA 3H79A 3IOSA 4O92A 2DC5A 1KEBA 2GSTA 2CZ3A 2AUVA 1O81A 1MDJA 3LWAA 5ECPB 5D96A 4G10A 3VURA 3KJYA 3PINA 2VM2A 1TXXA 2QGVA 4TOPA 3RDWA 3TRXA 3D4MA 2B5EA 1Z7RA 2IMFA 3F4TA 1GNEA 4HJ2A 2VM1A 3FZ5A 4X1UA 2VL3A 3WGEA 3A2WA 2H73A 4PQHA 4NHZA 4OMVA 1SENA 1TU8A 4HU9A 1XOAA 3I69A 3BBYA 3FHKA 2VL2A 1ZYEA 2LEGA 3HHVA 5B6MA 3J7Yk 1B48A 4KDUA 4TN8A 2IWTA 5DVBA 2PMTA 3G9BA 3QR6A 3EVIA 2CAQA 2DJKA 2QKEA 3UL3A 2OJLA 3ERFA 1FB6A 3KMOA 2HFDA 1UC7A 3SWLA 3CSIA 2PWJA 1NHOA 4MZCA 3TJKA 4HZ4A 2YN1A 4GQCA 5D73A 3RHCA 1NHYA 4G19A 5FWGA 3ERGA 4TRXA 4TR0A 5ID2B 4Q5QA 1ZL9A 1YJ6A 3F8UA 1ERUA 3WGXA 4GWRA 1SD9A 2PGTA 3GIXA 3O3TA 2C3QA 3L4NA 4XTSA 1U88A 3P7XA 2MBTA 1EZKA 1XWKA 2HNLA 4GXZA 5IQYA 3G7JA 2ZUPA 1HNAA 1F37A 2VL2C 4ZILA 4EUYA 2VD0A 3KTBA 2DIYA 3LQ7A 4NV2A 2OA7A 2R2JA 4PGTA 3TRQA 1OVNA 2HSHA 3HZ8A 1J0FA 1O73A 1HYUA 1GTIA 5IMFA 3UBKA 5E4WA 4WKWA 5IOXA 3PH9A 2XC2A 2ZNMA 2LSTA 3ZYWA 3W6GA 2GQLA 3HKRA 4KA0A 2YWOA 1AQXA 1EEJA 2WS2A 3ED3A 2LJRA 1A23A 3CYNA 3F6DA 3EWLA 1EGOA 3HYPA 2IMEA 1K0DA 2JADA 4L5OA 1K0MA 2YZHA 2WZ9A 1EOHA 3ZZXA 2DLXA 3KCMA 4AJ8A 2M46A 4KSOA 1NW2A 5AGYA 1T8EB 2NTOA 3KP9A 1SD8A 2PUKC 2X64A 4MJBA 4TXOA 4WF5A 1PKZA 1HD2A 4BWSA 4F0BA 4HZ2A 3F4RA 1SL1B 1FVKA 1F6MC 1A8LA 2HT9A 1ML6A 3HVXA 5GSSA 3KXOA 4IQAA 3ZIJA 2IMIA 2MMNA 3BD2A 2MMAA 1X5DA 4YAPA 2L57A 2C3TA 3VPTA 5KN0A 2AJQB 5JWRB 2RIIA 4K0NA 4XRAA 6GSSA 2EIOA 2VLVA 3ZMLA 4TXOB 5AIVA 3WT1A 5H5RA 3IRAA 2FLSA 3C73A 2F3MA 3VWVA 3KEBA 2FHEA 4GSNA 4YH2A 1GSEA 2O87A 4POBA 2M72A 1DE1A 4ZIJA 5J41A 3QFBC 4XRDA 1F9MA 4IVFA 3DRNA 4EKZA 1K0NA 1C72A 1LU4A 4MPGA 1V57A 4NV5A 1OC3A 2YNXA 4NPBA 3HA9A 2H1DA 4MZBA 2XPDA 3UBLA 3KMNA 2EC4A 1MD3A 3D5JA 4MF7A 4TW5A 3VWUA 4G9HA 1OE8A 3DVXA 5DQSA 3RPPA 3F63A 4JBBA 4DSSA 4ECJA 4J2FA 2H0GA 3H4KA 4LMVA 2A4VA 2JL4A 1AXDA 2CT6A 2O7KA 4JRRA 5IOWA 3GUSA 1PKWA 3GTUA 1PSQA 5ECHB 1XWCA 3TJBA 3Q74A 1E6BA 4ZXGA 1SU9A 1GH2A 3KGKA 1TRSA 4GCIA 5IMAA 1M9BA 1SKWB 2C0DA 1GSQA 1JHBA 2GQMA 4DSSB 3BCKA 3Q19A 1DSBA 2P0GA 4MJAA 1BYEA 1E2YA 1ON4A 3HCZA 3WGDA 2L4QA 1B4PA 3LG6A 5A5KA 5JCUA 2NBSA 4F82A 5F06A 2FD3A 4XS6A 3GTUB 4IP1A 1XPVA 5G5EA 3GH6A 4WEYA 3DWVA 4OWYA 2FA8A 5CAXA 1EP8A 2CVDA 1THXA 4PQ1A 2H0IA 2IN3A 2MMZA 4ECBA 3TDGA 2V6KA 1SK2A 1Q98A 4MJCA 1USBA 3QFAC 3KH7A 1K0BA 2ZCTA 1WE0A 1Z9HA 5D93A 1TK5B 1QQ2A 2KUCA 3CMIA 4MJEA 2DIZA 2L5OA 2B7KA 12GSA 3U5RE 3EE2A 3TJFA 5DAKB 4BA7A 5F0GA 4QL9A 1SK1A 4PUFC 2VCXA 1VRSD 4IJ3A 2R3XA 5ECQB 3TOTA 1GUMA 1M2AA 1TI1A 5ECNB 3F9UA 5G1KA 2IMDA 5IIZA 1BJXA 3MDKA 3VWWA 3HVVA 3ME8A 2OE1A 2V1MA 1K3OA 4IN0A 1WMJA 2A2RA 4ZB6A 4ZL8A 4OFNA 3GKNA 4QL7A 2FWEA 3CSHA 1IYHA 1SJZA 5COHA 4L0WA 3L9SA 2OADA 4J56E 2H72A 1S3AA 3D4TA 3C71A 1FB0A 1NM3A 3FZAA 4L8EA 2VOCA 1G0TA 2BJXA 3AY8A 1F3BA
chains in the Genus database with same CATH superfamily
3CTFA 4FYUA 4MH2A 5EVOA 1GUKA 3GSTA 1SJIA 2HRAA 2TRXA 2BMXA 3TKRA 2OACA 5H5SA 3F3QA 4JE1A 4RQRA 1CQGA 4X0XA 2B6MA 3I43A 1X0RA 5KN1A 4N0ZA 10GSA 3VI5A 4HQZA 4O5QA 5IMVA 1OYJA 1X9SB 3TJGA 1EWXA 4HJMA 2AAWA 4BL7A 4IJIA 4K7OA 1ST9A 3QMXA 1XFLA 3GH9A 3D0ZA 4GTUA 2HXKA 3I9V2 4OO5A 5AIXA 2RUFA 3IR4A 2LS5A 3CRUA 2VO4A 4XIHA 5IMCA 2FUG2 1DBYA 2NVLA 2JACA 4AF2A 4F03A 1T3BA 3F3RA 5J9BA 3CXGA 1URMA 5IO2A 5JWOB 3GL5A 5ECLB 4JEDA 5ECKB 2CVBA 1UA5A 4WBJA 1N2AA 2EIQA 1Z7PA 3ERWA 2HRFA 1YKCA 3DD3A 1M0UA 2XBIA 4CW9A 3HDCA 4MDCA 4ZB9A 2C0EA 2H19A 4J57E 1PQNA 4L0UA 1LJRA 1ZYPA 2WRTA 4FO5A 4XHMA 3DKSA 3GHAA 2GZPA 2IIYA 2O8VB 3HZ4A 3TOUA 4FYBA 2PBJA 3VK9A 3P8WA 3Q18A 2DSAA 2YV9A 1OC8A 2H1AA 3VI7A 6GSVA 3HVSA 3KD0A 4E8EA 6GSTA 1IYIA 4MH3A 5B7CA 4JU5A 4ULXA 4K6XA 4K0GA 4K2XA 5GAND 2I9HA 2R4VA 2RM5A 4ZBDA 1KTEA 4NHWA 2L5LA 4PQIA 2E2GA 1TRUA 2B5YA 2WGRA 3EMPA 19GSA 5ID2A 4EC0A 2LRNA 2GT6A 2VLTA 4HDEA 1EOGA 2H6XA 2H71A 13GSA 3ISOA 2N5FA 5KOXA 3ZL5A 1WJKA 2TRCP 3O6TA 3IXRA 1G7EA 4BVYA 1EGRA 5D9XA 2YWMA 9GSSA 3HD5A 4BVXA 2YWIA 3TKQA 2DJ2A 4TR3A 4IP6A 3QAVA 5EY6A 2LUSA 4AGSA 3WD6A 5DQYA 1ERWA 2PVQA 1AC1A 1VGLA 5DBQA 2DKIA 1ZZYA 1Z3EA 1ZGNA 2GSSA 4D73A 3QCPA 2O85A 1OC9A 4EDZA 4FYCA 2HE3A 2GTUA 1QXHA 7GSSA 1Z6NA 4EIPA 3ZMKA 2FA4A 1Z5YE 4I2UA 1SK0A 4YQVA 3U6VA 1GULA 1WOUA 2G2QA 2F9SA 4K5RA 2I3YA 3L9UA 5D8IA 3TKSC 4ML1A 4BPYA 4D73B 5HR0A 2KP1A 1H4OA 5LNKe 2C80A 17GSA 5B8AA 16GSA 1XXUA 2H01A 4BWQA 2HI7A 1OC9B 4I8BA 3UVTA 4MA9A 3P90A 4NMUA 1W89A 4DSQA 2IJYA 4EXJA 1GTUA 1U3AA 1O8XA 4WXTA 3LJRA 4TR1A 4YAVA 2H75A 2HYXA 2DMMA 3ZFLA 3TUEA 1ILOA 4Z7XA 1U3IA 2ON7A 1O6JA 1MDIA 1JZRA 4HEA2 3H1NA 1M2BA 3MNGA 2VD1A 5EL8A 1Y6EA 1XZOA 1M99A 1DE2A 3UJ1A 1SL2B 4A5PA 5AN1A 3GFKA 5J9CA 3EMXA 3GKMA 4N30A 3E9JB 3RBTA 4TR1B 5DJMA 5DALB 2AYTA 4GSSA 3OR5A 5CRGA 2HRNA 3FK8A 2LQOA 3QAGA 4MABA 2RM6A 1R5AA 2GS3A 3KP8A 4G0KA 4KSMA 3E0UA 1F3AA 1VF1A 2OE0A 3A2VA 3QPMA 3FKFA 1TKDB 3CTGA 3GRXA 2YOIA 4ECCA 3TRPA 3CQFA 1X5CA 2YV7A 3N9JA 1GLQA 3QDNA 2L6CA 2ES7A 4LLRA 2NPBA 2I81A 1XW9A 4N11A 2E0QA 4JR4A 2VL9A 3GMFA 3GV1A 4G0IA 3VFIA 2H74A 5ELAA 2IFQA 2CV4A 2JZRA 4POLA 2E2MA 3DVWA 5EPFA 2HZEB 5A4WA 4QQ7A 2DJ1A 4RI7A 1ZMAA 5HFIA 3HJOA 1ZYQB 1M3JA 3F0IA 1FVJA 1PX6A 4DVCA 3CRTA 3EC3A 4K8MA 4TXVA 2I1UA 4K2DA 4Q5NA 2IFQB 3FY7A 3GSSA 4IHUA 1T7PB 1THOA 1GSFA 4XS4A 1PD21 4BIKA 2FGXA 5ECMB 3DGQA 3FR9A 4FQUA 3W8JA 2X99A 1XVWA 3APQA 3UVHA 4TVEA 5HR1A 1XVQA 3HJPA 5ABRA 4HUAA 1UVZA 3ZRDA 2DJ3A 2N5BA 3C1SA 18GSA 2DJ0A 2V41A 2PERA 5HR3A 2WULA 5DCHA 1KNGA 3GKXA 2XBQA 1I9DA 4XS4B 2OE3A 1NSWA 2WCIA 1MD4A 1MTCA 4O7HA 2MYGA 3TJJA 3IA1A 4F2IA 2GZZA 1JFUA 2V6OA 1K0OA 4WR4A 3TGZA 4AJ7A 2WJUA 4LMWA 3IK7A 2LJAA 14GSA 5DAKA 2YANA 2H66A 8GSSA 4POKA 3L78A 2YP6A 3HY2A 2R37A 2C3NA 3LFLA 2HZFA 2K8VA 4IBPA 2KOKA 1S3RA 3M1GA 4EF0A 1FO5A 3VLNA 3CBUA 3MWHA 1WIKA 4I5QA 4GF0A 1UN2A 3BOAA 2R5GA 5HFGA 6GSWA 1JLWA 4KW6A 1TP9A 5LD0A 3NZNA 2QA2A 4Q5RA 1PX7A 1U6TA 4I2TA 4N0VA 2VUPA 2DMLA 4GQFA 4EE0A 1QMVA 1AQWA 2C1YA 2PVOC 2GZYA 4IQ1A 4V2MA 1G6WA 3SBCA 4IS0A 4ZL9A 5HFKA 3C8EA 3EINA 5F05A 4F0CA 1ZOFA 3M9KA 2CX3A 4OO4A 1J9BA 1J08A 3KZQA 1XCCA 1LBKA 4GRFA 1JZOA 2K9FA 3QD9A 1BQ7A 1XWBA 1TDIA 1V98A 2E7PA 1JZDA 3K8NA 1TTZA 3ZLPA 1GUHA 2K8SA 5B6NA 4OCEA 2LRTA 1TRWA 2G0FA 2H70A 1TW9A 2IPAA 3RAZA 1AW9A 3ZFBA 2H0HA 1ERTA 2OKAA 1AUCA 3LYPA 4MMMA 4L5LA 4DEJA 3GURA 2L4CA 2LTKA 3L9VA 3D6IA 2DBCA 4CDOA 4KDXA 4X43A 1SKRB 1VF2A 1O85A 3KIJA 4N10A 5GZZB 4KCAA 4V1Ap 1M3IA 3S9FA 2LQQA 1ERVA 2CQ9A 2VCTA 3VWXA 5KEJA 4KAEA 3J7Yb 2JSZA 5KN2A 4KB3A 3G7YA 5H5QA 1X9MB 5A4UA 5F8BA 5LCZA 2H30A 5AISA 2B1KA 5FT3A 3H93A 1S3CA 1B8XA 2GQKA 3PPUA 3Q6OA 1MDKA 4EVMA 3C7MA 1ZYNA 4ISDA 1JLVA 3IAM2 3ZVJA 4OFMA 1XIYA 1TJDA 1V9WA 4OD7A 1Q4JA 3FR6A 5B8BA 2GGTA 4WBRD 3FZ4A 2K6VA 3W8SA 2FCHA 6GSXA 3IC4A 5KOWA 5ELGA 1TU7A 22GSA 5L71A 5CREA 4NAXA 4PNGA 3PR8A 1GSYA 2VCWA 4KX4A 4CY8A 2KHPA 5CRHA 4PUAA 4HOJA 4MNNA 4Z2RA 4O32A 5G1LA 4EDYA 2X8CA 3V1WA 2O89A 4ZBBA 3FZ9A 3WT2A 1PL1A 4WF4A 3WYWA 1G6YA 1PA3A 3FRCA 1OKDA 3GX8A 2H1BA 3EYTA 4OCFA 1M7TA 3UIWA 3GA4A 2XPEA 2Z9SA 5GSTA 1A8YA 4K7NA 1QGVA 3HXSA 1PRXA 1M2DA 1FG4A 5DCGA 2TIRA 1WWJA 4K9ZA 3MYDA 2H6YA 2F8AA 3LXTA 4IELA 4MF6A 1OKTA 5D9WA 1TK8B 5HR2A 4PX1A 5ECRB 1A24A 3TKSA 4FIWA 1YZXA 2FWFA 4YQUA 4POMA 5J5NA 11GSA 5IMZA 1YKAA 1YEPA 2NDOA 2YWNA 1PMTA 3A3TA 3UAPA 4XCSA 5GAPD 3TKSE 5C00A 3KH9A 3GKKA 1QFNA 3M8NA 1RW1A 2C4JA 4V2LA 3ZITA 3FR3A 4JZQA 3TKPA 3LEFA 1X9WB 1QUWA 2IMKA 2VCVA 1O8WA 1R7HA 3UEMA 4F9ZA 2VCZA 1GL8A 2X8HA 4XS1A 5E59A 2K18A 2OBKA 1TRVA 2B7JA 2DJJA 2LKUA 1RQMA 4KNDA 5BMUA 4AJ6A 2EIRA 4CY6A 1FAAA 2CX4A 3P2AA 1T4YA 5BRTA 3NIVA 3GL3A 1YEXA 4MLYA 2JZSA 3TCOA 1T00A 2REMA 1X5EA 1A0RP 3DYRA 4EL1A 3IHQA 1PN0A 2P5RA 4Q5FA 5JCWA 1WRYA 1BX9A 1GWCA 1YF1A 4ZL7A 2OBIA 2X8GA 1GRXA 3EURA 4HSCX 3MAKA 2H76A 1RK4A 1GLPA 2VCQA 1YQ1A 3EPTA 5ECSA 4PTSA 1O7UA 4KF9A 4JR6A 1PGTA 1WP0A 5G5FA 1SYRA 4KGIA 3EU3A 1SJ6A 5DALA 1XBSA 1T4ZA 5JWQB 5ECIB 1Z6MA 5D9TA 4GSTA 4ML6A 5CNWA 4IKHA 3TB2A 1N8JA 4P3YB 1ACVA 2CAIA 3ZREA 5G2ZA 2C8UA 2GDRA 1KBNA 3IK9A 2YJ7A 2RUEA 4G2EA 3M0FA 3E3EA 4IW9A 5HQPA 2H6ZA 3HJMA 3APSA 5FHIA 1ZCPA 2GT5A 1VF4A 4EO3A 2HSMA 4K5SA 5G31A 3M3MA 1R5PA 4ACSA 1V58A 2ALBA 4O5RA 2GVPA 1ABAA 5CRDA 3MSZA 3QAWA 4IGJA 4MP4A 2GSRA 2CVKA 2HZEA 5INYA 1V2AA 3ZVJD 3A5WA 4I97A 3IHGA 5D9VA 1HNCA 3LGCA 3IPZA 4ZBAA 3ZIVA 1M9AA 4HS1A 2HLSA 1DUGA 5IO0A 3L0HA 2C0FA 1K0AA 4MCUA 2QC7A 1A2MA 1SL0B 2FWGA 5IM9A 2H8LA 4K1FA 1K3YA 1AIUA 4HQSA 5IPHA 3IE3A 1GSDA 1WPIA 2PN8A 3O76A 3RPNA 3UOMA 2C0GA 2L59A 5IPGA 1PL2A 3H8QA 5CO3A 1FOVA 4MF5A 1TK0B 2CA8A 3QOUA 3ZTLA 2HSYA 1XOBA 4KCEA 5J4UA 1TI3A 3IV4A 2AB6A 2VAFA 5CYYA 5C04A 2J9HA 2B5XA 1QK8A 3GN3A 3LXZA 5KN3A 1GP1A 3D22A 2D2ZA 2VIMA 2RLIA 3M9JA 3PGTA 4K7IA 2MBSA 3VPQA 2IL3A 2YZUA 1T1VA 1EV4A 1OE7A 2VLUA 5F07A 4I6XA 5DDLA 3FYGA 4LA1A 1XWGA 2YJHA 2I4AA 3F4SA 3FW2A 2WDUA 2LRCA 2JZTA 4CHSA 3I6AA 4TR4A 2KP2A 2CZ2A 1EEMA 5DJLA 1GTBA 2H1GA 3BJ5A 4RUVA 4TKYA 2ON5A 1GSSA 3IAS2 4PNFA 2FNOA 1W4VA 4KUNA 2N5AA 1GTAA 4H86A 5ECOB 2FY6A 2R6KA 3MIXA 4NXIA 2X49A 1A2JA 2P5QA 3F6FA 3FEUA 3IDVA 1FW1A 3NOFA 1B9YC 4X4JA 1F2EA 1BG5A 2BTOT 4NWYA 5G30A 3RHBA 2FWHA 3D21A 1G7OA 20GSA 2LNTA 4DSRA 5IMDA 1Y25A 4LL4B 1B9XC 4V1Ag 2QA1A 4WETA 4MZWA 1R4WA 2JSYA 1V40A 1K0CA 3DIEA 4ID0A 3CSJA 3N5OA 6GSUA 3APOA 3UMAA 1XW5A 5A4VA 3C1RA 1AQVA 1GNWA 2L6DA 3ME7A 1OAZA 1YF0A 1K3LA 3DEXA 2YCDA 2WFCA 1PFOA 3EU4A 1YY7A 2J23A 5J3RA 2M80A 3G7IA 3LORA 2YPMA 1EV9A 1I5GA 2PPTA 3DMLA 3A2XA 3IBHA 4E8HA 4G0LA 1JZWA 1SKSB 1PN9A 1CQHA 2PU9C 2LNSA 3LYKA 1BAYA 4HU7A 3R2QA 3R3EA 1SYXA 2F51A 4PXOA 1YDKA 4YQMA 2LJKA 2B3SA 4KH7A 2MMOA 2AV4A 1H75A 3GX0A 2LV3A 3KTLA 1TOFA 2AHEA 1EP7A 1BEDA 3HVNA 3IC8A 2JU5A 4ILFA 5JCGA 1A0FA 4PURA 2B1LA 1MEKA 4GLTA 5CP1A 2F8FA 4OFTA 4MPFA 1U87A 3UARA 1R26A 2GSQA 2V32A 6GSYA 4MK3A 3DXBA 2V2GA 2QSIA 4ECIA 2P31A 4WR5A 3US3A 4HI7A 3GNJA 5CRWA 2A2SA 1XWAA 1AAZA 1GSUA 3GYKA 4KDYA 1A2LA 3JCML 1S3DA 1B4QA 2WB9A 4RQXA 3KM6A 4FH8A 1HQOA 2GLRA 4KE3A 4RI6A 2KLXA 1FHEA 1VF3A 4EIQA 5ENUA 4BL7B 3LSZA 1XW6A 4ZB8A 1HNBA 2MZCA 4LL1B 4V2NA 3BCIA 2XHFA 3H79A 3IOSA 4O92A 2DC5A 1KEBA 2GSTA 2CZ3A 2AUVA 1O81A 1MDJA 3LWAA 5ECPB 5D96A 4G10A 3VURA 3KJYA 4ICYA 3PINA 2VM2A 1TXXA 2QGVA 4TOPA 3RDWA 2A4HA 3D4MA 3TRXA 2B5EA 1Z7RA 2IMFA 3F4TA 1GNEA 4HJ2A 2VM1A 3FZ5A 4X1UA 2VL3A 3WGEA 3A2WA 2H73A 4PQHA 4NHZA 4OMVA 1SENA 1TU8A 4HU9A 1XOAA 3I69A 3BBYA 3FHKA 2VL2A 1ZYEA 2LEGA 3HHVA 5B6MA 3J7Yk 1B48A 4KDUA 4TN8A 2IWTA 5DVBA 2PMTA 3G9BA 3QR6A 3EVIA 2CAQA 2DJKA 2QKEA 3UL3A 2OJLA 3ERFA 1FB6A 3KMOA 2HFDA 1UC7A 3SWLA 3CSIA 2PWJA 1NHOA 4MZCA 3TJKA 4HZ4A 2YN1A 4GQCA 5D73A 3RHCA 1NHYA 4G19A 5FWGA 3ERGA 4TRXA 4TR0A 5ID2B 4Q5QA 1ZL9A 1YJ6A 4Z2TA 3F8UA 1ERUA 3WGXA 4GWRA 1SD9A 2PGTA 3GIXA 3O3TA 2C3QA 3L4NA 4XTSA 1U88A 3P7XA 2MBTA 1EZKA 1XWKA 2HNLA 4BVYB 4GXZA 5IQYA 3G7JA 4BVXB 2ZUPA 1HNAA 1F37A 2VL2C 4ZILA 4EUYA 2VD0A 3KTBA 2DIYA 3LQ7A 4NV2A 2OA7A 2R2JA 4PGTA 3TRQA 1OVNA 2HRKA 2HSHA 3HZ8A 1J0FA 1O73A 1HYUA 1GTIA 5IMFA 3UBKA 5E4WA 4WKWA 5IOXA 3PH9A 2XC2A 2ZNMA 2LSTA 3ZYWA 3W6GA 2GQLA 3HKRA 4KA0A 2YWOA 1AQXA 1EEJA 2WS2A 3ED3A 2LJRA 1A23A 3CYNA 2R0GA 3F6DA 3EWLA 1EGOA 3HYPA 2IMEA 1K0DA 2JADA 4L5OA 1K0MA 2YZHA 2WZ9A 1EOHA 3ZZXA 2DLXA 1FOHA 3KCMA 4AJ8A 2M46A 4KSOA 1NW2A 2UZ8A 5AGYA 1T8EB 2NTOA 3KP9A 4YKFA 1SD8A 2PUKC 2X64A 4MJBA 4TXOA 4WF5A 2R0PA 1PKZA 3FMWA 1HD2A 4BWSA 4F0BA 4HZ2A 3F4RA 1SL1B 1FVKA 4O5UA 1F6MC 1A8LA 2HT9A 1ML6A 3HVXA 5GSSA 3KXOA 4IQAA 3ZIJA 2IMIA 2MMNA 3BD2A 2MMAA 1X5DA 4YAPA 2L57A 2C3TA 3VPTA 5KN0A 2AJQB 5JWRB 2RIIA 4K0NA 4XRAA 6GSSA 2EIOA 2VLVA 3ZMLA 4TXOB 5AIVA 3WT1A 5H5RA 3IRAA 2FLSA 3C73A 2F3MA 3VWVA 3KEBA 2FHEA 4GSNA 4YH2A 1GSEA 2O87A 4POBA 2M72A 1DE1A 4ZIJA 5J41A 3QFBC 4XRDA 1F9MA 4IVFA 3DRNA 4EKZA 1K0NA 1C72A 1LU4A 4MPGA 1V57A 4NV5A 1OC3A 2YNXA 4NPBA 3HA9A 2H1DA 4MZBA 2R0CA 2XPDA 4YKGA 3UBLA 3KMNA 2EC4A 1MD3A 3D5JA 4MF7A 4TW5A 3VWUA 4G9HA 1OE8A 3DVXA 5DQSA 3RPPA 3F63A 4JBBA 4DSSA 1XG8A 4ECJA 4J2FA 2H0GA 3H4KA 4LMVA 2A4VA 2JL4A 2A2PA 1AXDA 2CT6A 2O7KA 4JRRA 5IOWA 4USSA 3GUSA 1PKWA 3GTUA 1PSQA 5ECHB 1XWCA 3TJBA 3Q74A 1E6BA 4ZXGA 1SU9A 1GH2A 3KGKA 1TRSA 4GCIA 5IMAA 1M9BA 1SKWB 2C0DA 1GSQA 1JHBA 2GQMA 4DSSB 3BCKA 3Q19A 1DSBA 2P0GA 4MJAA 1BYEA 1E2YA 1ON4A 3HCZA 3WGDA 2L4QA 1B4PA 3LG6A 5A5KA 5JCUA 2NBSA 4F82A 5F06A 2FD3A 4XS6A 3GTUB 4IP1A 1XPVA 5G5EA 3GH6A 4WEYA 3DWVA 4OWYA 2FA8A 5CAXA 1EP8A 2CVDA 4Z2UA 1THXA 4PQ1A 2H0IA 2IN3A 2MMZA 4ECBA 3TDGA 2V6KA 1SK2A 1Q98A 4MJCA 1USBA 3QFAC 3KH7A 1K0BA 2ZCTA 1WE0A 1Z9HA 5D93A 2DKHA 1TK5B 1QQ2A 2KUCA 3CMIA 4MJEA 2DIZA 2L5OA 2B7KA 12GSA 3U5RE 3EE2A 3TJFA 5DAKB 4BA7A 5F0GA 4QL9A 1SK1A 4PUFC 2VCXA 1VRSD 4IJ3A 2R3XA 5ECQB 3TOTA 1GUMA 1M2AA 1TI1A 5ECNB 3F9UA 3LW9A 5G1KA 2IMDA 5IIZA 1BJXA 3MDKA 3VWWA 3HVVA 3ME8A 2OE1A 4IN0A 2V1MA 1K3OA 3A5IA 1WMJA 2A2RA 4ZB6A 4ZL8A 4OFNA 3GKNA 4QL7A 2FWEA 3CSHA 1IYHA 1SJZA 5COHA 4L0WA 3L9SA 2OADA 4J56E 2H72A 1S3AA 3D4TA 3C71A 2X4AA 1FB0A 1NM3A 3FZAA 4L8EA 2VOCA 1G0TA 2BJXA 3AY8A 1F3BA
chains in the Genus database with same CATH topology
3CTFA 4FYUA 4MH2A 5EVOA 1GUKA 3GSTA 1SJIA 2HRAA 2TRXA 2BMXA 3TKRA 2OACA 5H5SA 3F3QA 4JE1A 4RQRA 1CQGA 4X0XA 2B6MA 3I43A 1X0RA 5KN1A 4N0ZA 10GSA 3VI5A 4HQZA 4O5QA 5IMVA 1OYJA 1X9SB 3TJGA 1EWXA 4HJMA 2AAWA 4BL7A 4IJIA 4K7OA 1ST9A 3QMXA 1XFLA 3GH9A 3D0ZA 4GTUA 2HXKA 3I9V2 4OO5A 5AIXA 2RUFA 3IR4A 2LS5A 3CRUA 2VO4A 4XIHA 5IMCA 2FUG2 1DBYA 2NVLA 2JACA 4AF2A 4F03A 1T3BA 3F3RA 5J9BA 3CXGA 1URMA 5IO2A 5JWOB 3GL5A 5ECLB 4JEDA 5ECKB 2CVBA 1UA5A 4WBJA 1N2AA 2EIQA 1Z7PA 3ERWA 2HRFA 1YKCA 3DD3A 1M0UA 2XBIA 4CW9A 3HDCA 4MDCA 4ZB9A 2C0EA 2H19A 4J57E 1PQNA 4L0UA 1LJRA 1ZYPA 2WRTA 4FO5A 4XHMA 3DKSA 3GHAA 2GZPA 2IIYA 2O8VB 3HZ4A 3TOUA 4FYBA 2PBJA 3VK9A 3P8WA 3Q18A 2DSAA 2YV9A 1OC8A 2H1AA 3VI7A 6GSVA 3HVSA 3KD0A 4E8EA 6GSTA 1IYIA 4MH3A 5B7CA 4JU5A 4ULXA 4K6XA 4K0GA 4K2XA 5GAND 2I9HA 2R4VA 2RM5A 4ZBDA 1KTEA 4NHWA 2L5LA 4PQIA 2E2GA 1TRUA 2B5YA 2WGRA 3EMPA 19GSA 5ID2A 4EC0A 2LRNA 2GT6A 2VLTA 4HDEA 1EOGA 2H6XA 2H71A 13GSA 3ISOA 2N5FA 5KOXA 3ZL5A 1WJKA 2TRCP 3O6TA 3IXRA 1G7EA 4BVYA 1EGRA 5D9XA 2YWMA 9GSSA 3HD5A 4BVXA 2YWIA 3TKQA 2DJ2A 4TR3A 4IP6A 3QAVA 5EY6A 2LUSA 4AGSA 3WD6A 5DQYA 1ERWA 2PVQA 1AC1A 1VGLA 5DBQA 2DKIA 1ZZYA 1Z3EA 1ZGNA 2GSSA 4D73A 3QCPA 2O85A 1OC9A 4EDZA 4FYCA 2HE3A 2GTUA 1QXHA 7GSSA 1Z6NA 4EIPA 3ZMKA 2FA4A 1Z5YE 4I2UA 1SK0A 4YQVA 3U6VA 1GULA 1WOUA 2G2QA 2F9SA 4K5RA 2I3YA 3L9UA 5D8IA 3TKSC 4ML1A 4BPYA 4D73B 5HR0A 2KP1A 1H4OA 5LNKe 2C80A 17GSA 5B8AA 16GSA 1XXUA 2H01A 4BWQA 2HI7A 1OC9B 4I8BA 3UVTA 4MA9A 3P90A 4NMUA 1W89A 4DSQA 2IJYA 4EXJA 1GTUA 1U3AA 1O8XA 4WXTA 3LJRA 4TR1A 4YAVA 2H75A 2HYXA 2DMMA 3ZFLA 3TUEA 1ILOA 4Z7XA 1U3IA 2ON7A 1O6JA 1MDIA 1JZRA 4HEA2 3H1NA 1M2BA 3MNGA 2VD1A 5EL8A 1Y6EA 1XZOA 1M99A 1DE2A 3UJ1A 1SL2B 4A5PA 5AN1A 3GFKA 5J9CA 3EMXA 3GKMA 4N30A 3E9JB 3RBTA 4TR1B 5DJMA 5DALB 2AYTA 4GSSA 3OR5A 5CRGA 2HRNA 3FK8A 2LQOA 3QAGA 4MABA 2RM6A 1R5AA 2GS3A 3KP8A 4G0KA 4KSMA 3E0UA 1F3AA 1VF1A 2OE0A 3A2VA 3QPMA 3FKFA 1TKDB 3CTGA 3GRXA 2YOIA 4ECCA 3TRPA 1X5CA 2YV7A 3N9JA 1GLQA 3QDNA 2L6CA 2ES7A 4LLRA 2NPBA 2I81A 1XW9A 4N11A 2E0QA 4JR4A 2VL9A 3GMFA 3GV1A 4G0IA 3VFIA 2H74A 5ELAA 2IFQA 2CV4A 2JZRA 4POLA 2E2MA 3DVWA 5EPFA 2HZEB 5A4WA 4QQ7A 2DJ1A 4RI7A 1ZMAA 5HFIA 3HJOA 1ZYQB 3F0IA 1FVJA 1PX6A 4DVCA 3CRTA 3EC3A 4K8MA 4TXVA 2I1UA 4K2DA 4Q5NA 2IFQB 3FY7A 3GSSA 4IHUA 1T7PB 1THOA 1GSFA 4XS4A 1PD21 2FGXA 5ECMB 3DGQA 3FR9A 4FQUA 3W8JA 2X99A 1XVWA 3APQA 3UVHA 4TVEA 5HR1A 1XVQA 3HJPA 5ABRA 4HUAA 1UVZA 3ZRDA 2DJ3A 2N5BA 3C1SA 18GSA 2DJ0A 2V41A 2PERA 5HR3A 2WULA 5DCHA 1KNGA 3GKXA 2XBQA 1I9DA 4XS4B 2OE3A 1NSWA 2WCIA 1MD4A 1MTCA 4O7HA 2MYGA 3TJJA 3IA1A 4F2IA 2GZZA 1JFUA 2V6OA 1K0OA 4WR4A 3TGZA 4AJ7A 2WJUA 4LMWA 3IK7A 2LJAA 14GSA 5DAKA 2YANA 2H66A 8GSSA 4POKA 3L78A 2YP6A 3HY2A 2R37A 2C3NA 3LFLA 2HZFA 2K8VA 4IBPA 2KOKA 3M1GA 4EF0A 1FO5A 3VLNA 3CBUA 3MWHA 1WIKA 4I5QA 4GF0A 1UN2A 3BOAA 2R5GA 5HFGA 6GSWA 1JLWA 4KW6A 1TP9A 5LD0A 3NZNA 2QA2A 4Q5RA 1PX7A 1U6TA 4I2TA 4N0VA 2VUPA 2DMLA 4GQFA 4EE0A 1QMVA 1AQWA 2C1YA 2PVOC 2GZYA 4IQ1A 4V2MA 1G6WA 3SBCA 4IS0A 4ZL9A 5HFKA 3C8EA 3EINA 5F05A 4F0CA 1ZOFA 3M9KA 2CX3A 4OO4A 1J9BA 1J08A 3KZQA 1XCCA 1LBKA 4GRFA 1JZOA 2K9FA 3QD9A 1BQ7A 1XWBA 1TDIA 1V98A 2E7PA 1JZDA 3K8NA 1TTZA 3ZLPA 1GUHA 2K8SA 5B6NA 4OCEA 2LRTA 1TRWA 2G0FA 2H70A 1TW9A 2IPAA 3RAZA 1AW9A 3ZFBA 2H0HA 1ERTA 2OKAA 1AUCA 3LYPA 4MMMA 4L5LA 4DEJA 3GURA 2L4CA 2LTKA 3L9VA 3D6IA 2DBCA 4CDOA 4KDXA 4X43A 1SKRB 1VF2A 1O85A 3KIJA 4N10A 5GZZB 4KCAA 4V1Ap 3S9FA 2LQQA 1ERVA 2CQ9A 2VCTA 3VWXA 5KEJA 4KAEA 3J7Yb 2JSZA 5KN2A 4KB3A 3G7YA 5H5QA 1X9MB 5A4UA 5F8BA 5LCZA 2H30A 5AISA 2B1KA 5FT3A 3H93A 1S3CA 1B8XA 2GQKA 3PPUA 3Q6OA 1MDKA 4EVMA 3C7MA 1ZYNA 4ISDA 1JLVA 3IAM2 3ZVJA 4OFMA 1XIYA 1TJDA 1V9WA 4OD7A 1Q4JA 3FR6A 5B8BA 2GGTA 4WBRD 3FZ4A 2K6VA 3W8SA 2FCHA 6GSXA 3IC4A 5KOWA 5ELGA 1TU7A 22GSA 5L71A 5CREA 4NAXA 4PNGA 3PR8A 1GSYA 2VCWA 4KX4A 4CY8A 2KHPA 5CRHA 4PUAA 4HOJA 4MNNA 4Z2RA 4O32A 5G1LA 4EDYA 2X8CA 3V1WA 2O89A 4ZBBA 3FZ9A 3WT2A 1PL1A 4WF4A 3WYWA 1G6YA 1PA3A 3FRCA 1OKDA 3GX8A 2H1BA 3EYTA 4OCFA 1M7TA 3UIWA 3GA4A 2XPEA 2Z9SA 5GSTA 1A8YA 4K7NA 1QGVA 3HXSA 1PRXA 1M2DA 1FG4A 5DCGA 2TIRA 1WWJA 4K9ZA 3MYDA 2H6YA 2F8AA 3LXTA 4IELA 4MF6A 1OKTA 5D9WA 1TK8B 5HR2A 4PX1A 5ECRB 1A24A 3TKSA 4FIWA 1YZXA 2FWFA 4YQUA 4POMA 5J5NA 11GSA 5IMZA 1YKAA 1YEPA 2NDOA 2YWNA 1PMTA 3A3TA 3UAPA 4XCSA 5GAPD 3TKSE 5C00A 3KH9A 3GKKA 1QFNA 3M8NA 1RW1A 2C4JA 4V2LA 3ZITA 3FR3A 4JZQA 3TKPA 3LEFA 1X9WB 1QUWA 2IMKA 2VCVA 1O8WA 1R7HA 3UEMA 4F9ZA 2VCZA 1GL8A 2X8HA 4XS1A 5E59A 2K18A 2OBKA 1TRVA 2B7JA 2DJJA 2LKUA 1RQMA 4KNDA 5BMUA 4AJ6A 2EIRA 4CY6A 1FAAA 2CX4A 3P2AA 1T4YA 5BRTA 3NIVA 3GL3A 1YEXA 4MLYA 2JZSA 3TCOA 1T00A 2REMA 1X5EA 1A0RP 3DYRA 4EL1A 3IHQA 1PN0A 2P5RA 4Q5FA 5JCWA 1WRYA 1BX9A 1GWCA 1YF1A 4ZL7A 2OBIA 2X8GA 1GRXA 3EURA 3MAKA 2H76A 1RK4A 1GLPA 2VCQA 1YQ1A 3EPTA 5ECSA 4PTSA 1O7UA 4KF9A 4JR6A 1PGTA 1WP0A 5G5FA 1SYRA 4KGIA 3EU3A 1SJ6A 5DALA 1XBSA 1T4ZA 5JWQB 5ECIB 1Z6MA 5D9TA 4GSTA 4ML6A 5CNWA 4IKHA 3TB2A 1N8JA 4P3YB 1ACVA 2CAIA 3ZREA 5G2ZA 2C8UA 2GDRA 1KBNA 3IK9A 2YJ7A 2RUEA 4G2EA 3M0FA 3E3EA 4IW9A 5HQPA 2H6ZA 3HJMA 3APSA 5FHIA 1ZCPA 2GT5A 1VF4A 4EO3A 2HSMA 4K5SA 5G31A 3M3MA 1R5PA 4ACSA 1V58A 2ALBA 4O5RA 2GVPA 1ABAA 5CRDA 3MSZA 3QAWA 4IGJA 4MP4A 2GSRA 2CVKA 2HZEA 5INYA 1V2AA 3ZVJD 3A5WA 4I97A 3IHGA 5D9VA 1HNCA 3LGCA 3IPZA 4ZBAA 3ZIVA 1M9AA 4HS1A 2HLSA 1DUGA 5IO0A 3L0HA 2C0FA 1K0AA 4MCUA 2QC7A 1A2MA 1SL0B 2FWGA 5IM9A 2H8LA 4K1FA 1K3YA 1AIUA 4HQSA 5IPHA 3IE3A 1GSDA 1WPIA 2PN8A 3O76A 3RPNA 3UOMA 2C0GA 2L59A 5IPGA 1PL2A 3H8QA 5CO3A 1FOVA 4MF5A 1TK0B 2CA8A 3QOUA 3ZTLA 2HSYA 1XOBA 4KCEA 5J4UA 1TI3A 3IV4A 2AB6A 2VAFA 5CYYA 5C04A 2J9HA 2B5XA 1QK8A 3GN3A 3LXZA 5KN3A 1GP1A 3D22A 2D2ZA 2VIMA 2RLIA 3M9JA 3PGTA 4K7IA 2MBSA 3VPQA 2IL3A 2YZUA 1T1VA 1EV4A 1OE7A 2VLUA 5F07A 4I6XA 5DDLA 3FYGA 4LA1A 1XWGA 2YJHA 2I4AA 3F4SA 3FW2A 2WDUA 2LRCA 2JZTA 4CHSA 3I6AA 4TR4A 2KP2A 2CZ2A 1EEMA 5DJLA 1GTBA 2H1GA 3BJ5A 4RUVA 4TKYA 2ON5A 1GSSA 3IAS2 4PNFA 2FNOA 1W4VA 4KUNA 2N5AA 1GTAA 4H86A 5ECOB 2FY6A 2R6KA 3MIXA 4NXIA 2X49A 1A2JA 2P5QA 3F6FA 3FEUA 3IDVA 1FW1A 3NOFA 1B9YC 4X4JA 1F2EA 1BG5A 2BTOT 4NWYA 5G30A 3RHBA 2FWHA 3D21A 1G7OA 20GSA 2LNTA 4DSRA 5IMDA 1Y25A 4LL4B 1B9XC 4V1Ag 2QA1A 4WETA 4MZWA 1R4WA 2JSYA 1V40A 1K0CA 3DIEA 4ID0A 3CSJA 3N5OA 6GSUA 3APOA 3UMAA 1XW5A 5A4VA 3C1RA 1AQVA 1GNWA 2L6DA 3ME7A 1OAZA 1YF0A 1K3LA 3DEXA 2YCDA 2WFCA 3EU4A 1YY7A 2J23A 5J3RA 2M80A 3G7IA 3LORA 2YPMA 1EV9A 1I5GA 2PPTA 3DMLA 3A2XA 3IBHA 4E8HA 4G0LA 1JZWA 1SKSB 1PN9A 1CQHA 2PU9C 2LNSA 3LYKA 1BAYA 4HU7A 3R2QA 3R3EA 1SYXA 2F51A 4PXOA 1YDKA 4YQMA 2LJKA 2B3SA 4KH7A 2MMOA 2AV4A 1H75A 3GX0A 2LV3A 3KTLA 1TOFA 2AHEA 1EP7A 1BEDA 3IC8A 2JU5A 4ILFA 5JCGA 1A0FA 4PURA 2B1LA 1MEKA 4GLTA 5CP1A 2F8FA 4OFTA 4MPFA 1U87A 3UARA 1R26A 2GSQA 2V32A 6GSYA 4MK3A 3DXBA 2V2GA 2QSIA 4ECIA 2P31A 4WR5A 3US3A 4HI7A 3GNJA 5CRWA 2A2SA 1XWAA 1AAZA 1GSUA 3GYKA 4KDYA 1A2LA 3JCML 1S3DA 1B4QA 2WB9A 4RQXA 3KM6A 4FH8A 1HQOA 2GLRA 4KE3A 4RI6A 2KLXA 1FHEA 1VF3A 4EIQA 5ENUA 4BL7B 3LSZA 1XW6A 4ZB8A 1HNBA 2MZCA 4LL1B 4V2NA 3BCIA 2XHFA 3H79A 3IOSA 4O92A 2DC5A 1KEBA 2GSTA 2CZ3A 2AUVA 1O81A 1MDJA 3LWAA 5ECPB 5D96A 4G10A 3VURA 3KJYA 4ICYA 3PINA 2VM2A 1TXXA 2QGVA 4TOPA 3RDWA 2A4HA 3D4MA 3TRXA 2B5EA 1Z7RA 2IMFA 3F4TA 1GNEA 4HJ2A 2VM1A 3FZ5A 4X1UA 2VL3A 3WGEA 3A2WA 2H73A 4PQHA 4NHZA 4OMVA 1SENA 1TU8A 4HU9A 1XOAA 3I69A 3BBYA 3FHKA 2VL2A 1ZYEA 2LEGA 3HHVA 5B6MA 3J7Yk 1B48A 4KDUA 4TN8A 2IWTA 5DVBA 2PMTA 3G9BA 3QR6A 3EVIA 2CAQA 2DJKA 2QKEA 3UL3A 2OJLA 3ERFA 1FB6A 3KMOA 2HFDA 1UC7A 3SWLA 3CSIA 2PWJA 1NHOA 4MZCA 3TJKA 4HZ4A 2YN1A 4GQCA 5D73A 3RHCA 1NHYA 4G19A 5FWGA 3ERGA 4TRXA 4TR0A 5ID2B 4Q5QA 1ZL9A 1YJ6A 4Z2TA 3F8UA 1ERUA 3WGXA 4GWRA 1SD9A 2PGTA 3GIXA 3O3TA 2C3QA 3L4NA 4XTSA 1U88A 3P7XA 2MBTA 1EZKA 1XWKA 2HNLA 4BVYB 4GXZA 5IQYA 3G7JA 4BVXB 2ZUPA 1HNAA 1F37A 2VL2C 4ZILA 4EUYA 2VD0A 3KTBA 2DIYA 3LQ7A 4NV2A 2OA7A 2R2JA 4PGTA 3TRQA 1OVNA 2HRKA 2HSHA 3HZ8A 1J0FA 1O73A 1HYUA 1GTIA 5IMFA 3UBKA 5E4WA 4WKWA 5IOXA 3PH9A 2XC2A 2ZNMA 2LSTA 3ZYWA 3W6GA 2GQLA 3HKRA 4KA0A 2YWOA 1AQXA 1EEJA 2WS2A 3ED3A 2LJRA 1A23A 3CYNA 2R0GA 3F6DA 3EWLA 1EGOA 3HYPA 2IMEA 1K0DA 2JADA 4L5OA 1K0MA 2YZHA 2WZ9A 1EOHA 3ZZXA 2DLXA 1FOHA 3KCMA 4AJ8A 2M46A 4KSOA 1NW2A 2UZ8A 5AGYA 1T8EB 2NTOA 3KP9A 4YKFA 1SD8A 2PUKC 2X64A 4MJBA 4TXOA 4WF5A 2R0PA 1PKZA 3FMWA 1HD2A 4BWSA 4F0BA 4HZ2A 3F4RA 1SL1B 1FVKA 4O5UA 1F6MC 1A8LA 2HT9A 1ML6A 3HVXA 5GSSA 3KXOA 4IQAA 3ZIJA 2IMIA 2MMNA 3BD2A 2MMAA 1X5DA 4YAPA 2L57A 2C3TA 3VPTA 5KN0A 2AJQB 5JWRB 2RIIA 4K0NA 4XRAA 6GSSA 2EIOA 2VLVA 3ZMLA 4TXOB 5AIVA 3WT1A 5H5RA 3IRAA 2FLSA 3C73A 2F3MA 3VWVA 3KEBA 2FHEA 4GSNA 4YH2A 1GSEA 2O87A 4POBA 2M72A 1DE1A 4ZIJA 5J41A 3QFBC 4XRDA 1F9MA 4IVFA 3DRNA 4EKZA 1K0NA 1C72A 1LU4A 4MPGA 1V57A 4NV5A 1OC3A 2YNXA 4NPBA 3HA9A 2H1DA 4MZBA 2R0CA 2XPDA 4YKGA 3UBLA 3KMNA 2EC4A 1MD3A 3D5JA 4MF7A 4TW5A 3VWUA 4G9HA 1OE8A 3DVXA 5DQSA 3RPPA 3F63A 4JBBA 4DSSA 4ECJA 4J2FA 2H0GA 3H4KA 4LMVA 2A4VA 2JL4A 2A2PA 1AXDA 2CT6A 2O7KA 4JRRA 5IOWA 4USSA 3GUSA 1PKWA 3GTUA 1PSQA 5ECHB 1XWCA 3TJBA 3Q74A 1E6BA 4ZXGA 1SU9A 1GH2A 3KGKA 1TRSA 4GCIA 5IMAA 1M9BA 1SKWB 2C0DA 1GSQA 1JHBA 2GQMA 4DSSB 3BCKA 3Q19A 1DSBA 2P0GA 4MJAA 1BYEA 1E2YA 1ON4A 3HCZA 3WGDA 2L4QA 1B4PA 3LG6A 5A5KA 5JCUA 2NBSA 4F82A 5F06A 2FD3A 4XS6A 3GTUB 4IP1A 1XPVA 5G5EA 3GH6A 4WEYA 3DWVA 4OWYA 2FA8A 5CAXA 1EP8A 2CVDA 4Z2UA 1THXA 4PQ1A 2H0IA 2IN3A 2MMZA 4ECBA 3TDGA 2V6KA 1SK2A 1Q98A 4MJCA 1USBA 3QFAC 3KH7A 1K0BA 2ZCTA 1WE0A 1Z9HA 5D93A 2DKHA 1TK5B 1QQ2A 2KUCA 3CMIA 4MJEA 2DIZA 2L5OA 2B7KA 12GSA 3U5RE 3EE2A 3TJFA 5DAKB 4BA7A 5F0GA 4QL9A 1SK1A 4PUFC 2VCXA 1VRSD 4IJ3A 2R3XA 5ECQB 3TOTA 1GUMA 1M2AA 1TI1A 5ECNB 3F9UA 3LW9A 5G1KA 2IMDA 5IIZA 1BJXA 3MDKA 3VWWA 3HVVA 3ME8A 2OE1A 2V1MA 1K3OA 3A5IA 4IN0A 1WMJA 2A2RA 4ZB6A 4ZL8A 4OFNA 3GKNA 4QL7A 2FWEA 3CSHA 1IYHA 1SJZA 5COHA 4L0WA 3L9SA 2OADA 4J56E 2H72A 1S3AA 3D4TA 3C71A 2X4AA 1FB0A 1NM3A 3FZAA 4L8EA 2VOCA 1G0TA 2BJXA 3AY8A 1F3BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CTF A;  4FYU A;  4MH2 A;  5EVO A;  1GUK A;  3GST A;  1SJI A;  2TRX A;  2BMX A;  3TKR A;  2OAC A;  5H5S A;  3F3Q A;  4JE1 A;  4RQR A;  1CQG A;  4X0X A;  2B6M A;  3I43 A;  1X0R A;  5KN1 A;  4N0Z A;  10GS A;  3VI5 A;  4HQZ A;  5IMV A;  1OYJ A;  1X9S B;  3TJG A;  1EWX A;  4HJM A;  2AAW A;  4BL7 A;  4IJI A;  4K7O A;  1ST9 A;  3QMX A;  1XFL A;  3GH9 A;  3D0Z A;  4GTU A;  2HXK A;  3I9V 2;  4OO5 A;  5AIX A;  2RUF A;  3IR4 A;  2LS5 A;  3CRU A;  2VO4 A;  4XIH A;  5IMC A;  2FUG 2;  1DBY A;  2NVL A;  2JAC A;  4AF2 A;  4F03 A;  1T3B A;  3F3R A;  5J9B A;  3CXG A;  1URM A;  5IO2 A;  5JWO B;  3GL5 A;  5ECL B;  5ECK B;  4JED A;  2CVB A;  1UA5 A;  4WBJ A;  1N2A A;  2EIQ A;  1Z7P A;  3ERW A;  2HRF A;  1YKC A;  3DD3 A;  1M0U A;  2XBI A;  4CW9 A;  3HDC A;  4MDC A;  4ZB9 A;  2C0E A;  2H19 A;  4J57 E;  1PQN A;  4L0U A;  1LJR A;  2WRT A;  4FO5 A;  4XHM A;  3DKS A;  3GHA A;  2GZP A;  2IIY A;  2O8V B;  3HZ4 A;  3TOU A;  4FYB A;  2PBJ A;  3VK9 A;  3P8W A;  3Q18 A;  2DSA A;  2YV9 A;  1OC8 A;  2H1A A;  3VI7 A;  6GSV A;  3HVS A;  3KD0 A;  4E8E A;  6GST A;  1IYI A;  4MH3 A;  5B7C A;  4JU5 A;  4ULX A;  4K6X A;  4K0G A;  5GAN D;  2I9H A;  2R4V A;  2RM5 A;  4ZBD A;  1KTE A;  4NHW A;  2L5L A;  4PQI A;  2E2G A;  1TRU A;  2B5Y A;  2WGR A;  3EMP A;  19GS A;  5ID2 A;  4EC0 A;  2LRN A;  2GT6 A;  2VLT A;  4HDE A;  1EOG A;  2H6X A;  2H71 A;  13GS A;  3ISO A;  2N5F A;  3ZL5 A;  1WJK A;  2TRC P;  3O6T A;  3IXR A;  1G7E A;  4BVY A;  1EGR A;  5D9X A;  2YWM A;  9GSS A;  3HD5 A;  4BVX A;  2YWI A;  3TKQ A;  2DJ2 A;  4TR3 A;  4IP6 A;  3QAV A;  5EY6 A;  2LUS A;  4AGS A;  3WD6 A;  5DQY A;  1ERW A;  2PVQ A;  1AC1 A;  1VGL A;  5DBQ A;  1ZZY A;  1Z3E A;  1ZGN A;  2GSS A;  4D73 A;  3QCP A;  2O85 A;  1OC9 A;  4EDZ A;  4FYC A;  2HE3 A;  2GTU A;  1QXH A;  7GSS A;  1Z6N A;  3ZMK A;  2FA4 A;  1Z5Y E;  4I2U A;  1SK0 A;  4YQV A;  3U6V A;  1GUL A;  1WOU A;  2G2Q A;  2F9S A;  5D8I A;  2I3Y A;  3L9U A;  3TKS C;  4ML1 A;  4BPY A;  4D73 B;  5HR0 A;  2KP1 A;  1H4O A;  5LNK e;  2C80 A;  17GS A;  5B8A A;  16GS A;  1XXU A;  2H01 A;  4BWQ A;  2HI7 A;  1OC9 B;  4I8B A;  3UVT A;  4MA9 A;  3P90 A;  4NMU A;  1W89 A;  4DSQ A;  2IJY A;  4EXJ A;  1GTU A;  1U3A A;  1O8X A;  4WXT A;  3LJR A;  4TR1 A;  4YAV A;  2H75 A;  2HYX A;  2DMM A;  3ZFL A;  3TUE A;  1ILO A;  4Z7X A;  1U3I A;  2ON7 A;  1O6J A;  1MDI A;  1JZR A;  4HEA 2;  3H1N A;  1M2B A;  3MNG A;  2VD1 A;  5EL8 A;  1Y6E A;  1XZO A;  1M99 A;  1DE2 A;  3UJ1 A;  1SL2 B;  5AN1 A;  3GFK A;  5J9C A;  3EMX A;  3GKM A;  4N30 A;  3E9J B;  3RBT A;  4TR1 B;  5DJM A;  5DAL B;  2AYT A;  4GSS A;  3OR5 A;  5CRG A;  2HRN A;  3FK8 A;  2LQO A;  3QAG A;  4MAB A;  2RM6 A;  1R5A A;  2GS3 A;  3KP8 A;  4KSM A;  3E0U A;  1F3A A;  1VF1 A;  2OE0 A;  3A2V A;  3QPM A;  3FKF A;  1TKD B;  3CTG A;  3GRX A;  2YOI A;  4ECC A;  3TRP A;  1X5C A;  2YV7 A;  3N9J A;  1GLQ A;  3QDN A;  2L6C A;  2ES7 A;  4LLR A;  2NPB A;  2I81 A;  1XW9 A;  4N11 A;  2E0Q A;  4JR4 A;  2VL9 A;  3GMF A;  3GV1 A;  3VFI A;  2H74 A;  5ELA A;  2IFQ A;  2CV4 A;  2JZR A;  4POL A;  2E2M A;  3DVW A;  5EPF A;  2HZE B;  5A4W A;  4QQ7 A;  2DJ1 A;  4RI7 A;  1ZMA A;  5HFI A;  3HJO A;  1ZYQ B;  3F0I A;  1FVJ A;  1PX6 A;  4DVC A;  3CRT A;  3EC3 A;  4K8M A;  4TXV A;  2I1U A;  4K2D A;  4Q5N A;  2IFQ B;  3FY7 A;  3GSS A;  4IHU A;  1T7P B;  1THO A;  1GSF A;  4XS4 A;  1PD2 1;  2FGX A;  5ECM B;  3DGQ A;  3FR9 A;  3W8J A;  2X99 A;  1XVW A;  3APQ A;  3UVH A;  4TVE A;  5HR1 A;  1XVQ A;  3HJP A;  5ABR A;  4HUA A;  1UVZ A;  3ZRD A;  2DJ3 A;  2N5B A;  3C1S A;  18GS A;  2DJ0 A;  2V41 A;  2PER A;  5HR3 A;  2WUL A;  5DCH A;  1KNG A;  3GKX A;  2XBQ A;  1I9D A;  4XS4 B;  2OE3 A;  1NSW A;  2WCI A;  1MD4 A;  1MTC A;  4O7H A;  2MYG A;  3TJJ A;  3IA1 A;  4F2I A;  2GZZ A;  1JFU A;  2V6O A;  1K0O A;  4WR4 A;  3TGZ A;  4AJ7 A;  2WJU A;  4LMW A;  3IK7 A;  2LJA A;  14GS A;  5DAK A;  2YAN A;  2H66 A;  8GSS A;  4POK A;  3L78 A;  2YP6 A;  3HY2 A;  2R37 A;  2C3N A;  3LFL A;  2HZF A;  2K8V A;  4IBP A;  2KOK A;  3M1G A;  4EF0 A;  1FO5 A;  3VLN A;  3CBU A;  3MWH A;  1WIK A;  4I5Q A;  4GF0 A;  1UN2 A;  3BOA A;  2R5G A;  5HFG A;  6GSW A;  1JLW A;  4KW6 A;  1TP9 A;  5LD0 A;  3NZN A;  4Q5R A;  1PX7 A;  1U6T A;  4I2T A;  4N0V A;  2VUP A;  2DML A;  4GQF A;  4EE0 A;  1QMV A;  1AQW A;  2C1Y A;  2PVO C;  2GZY A;  4IQ1 A;  4V2M A;  1G6W A;  3SBC A;  4IS0 A;  4ZL9 A;  5HFK A;  3C8E A;  3EIN A;  5F05 A;  4F0C A;  1ZOF A;  3M9K A;  2CX3 A;  4OO4 A;  1J9B A;  1J08 A;  3KZQ A;  1XCC A;  1LBK A;  4GRF A;  1JZO A;  2K9F A;  3QD9 A;  1BQ7 A;  1XWB A;  1TDI A;  1V98 A;  2E7P A;  1JZD A;  3K8N A;  1TTZ A;  3ZLP A;  1GUH A;  2K8S A;  5B6N A;  4OCE A;  2LRT A;  1TRW A;  2G0F A;  2H70 A;  1TW9 A;  2IPA A;  3RAZ A;  1AW9 A;  3ZFB A;  2H0H A;  1ERT A;  2OKA A;  1AUC A;  3LYP A;  4MMM A;  4L5L A;  4DEJ A;  3GUR A;  2L4C A;  2LTK A;  3L9V A;  3D6I A;  2DBC A;  4CDO A;  4KDX A;  4X43 A;  1SKR B;  1VF2 A;  1O85 A;  3KIJ A;  4N10 A;  5GZZ B;  4KCA A;  4V1A p;  3S9F A;  2LQQ A;  1ERV A;  2CQ9 A;  2VCT A;  3VWX A;  5KEJ A;  4KAE A;  3J7Y b;  2JSZ A;  5KN2 A;  4KB3 A;  3G7Y A;  5H5Q A;  1X9M B;  5A4U A;  5F8B A;  5LCZ A;  2H30 A;  5AIS A;  2B1K A;  5FT3 A;  3H93 A;  1S3C A;  1B8X A;  2GQK A;  3Q6O A;  1MDK A;  4EVM A;  3C7M A;  4ISD A;  1JLV A;  3IAM 2;  3ZVJ A;  4OFM A;  1XIY A;  1TJD A;  1V9W A;  4OD7 A;  1Q4J A;  3FR6 A;  5B8B A;  2GGT A;  4WBR D;  3FZ4 A;  2K6V A;  3W8S A;  2FCH A;  6GSX A;  3IC4 A;  5ELG A;  1TU7 A;  22GS A;  5L71 A;  5CRE A;  4NAX A;  4PNG A;  3PR8 A;  1GSY A;  2VCW A;  4KX4 A;  2KHP A;  5CRH A;  4PUA A;  4HOJ A;  4O32 A;  5G1L A;  4EDY A;  2X8C A;  3V1W A;  2O89 A;  4ZBB A;  3FZ9 A;  3WT2 A;  1PL1 A;  4WF4 A;  3WYW A;  1G6Y A;  1PA3 A;  3FRC A;  1OKD A;  3GX8 A;  2H1B A;  3EYT A;  4OCF A;  1M7T A;  3UIW A;  3GA4 A;  2XPE A;  2Z9S A;  5GST A;  1A8Y A;  4K7N A;  1QGV A;  3HXS A;  1PRX A;  1M2D A;  1FG4 A;  5DCG A;  2TIR A;  1WWJ A;  4K9Z A;  2H6Y A;  2F8A A;  3LXT A;  4IEL A;  4MF6 A;  1OKT A;  5D9W A;  1TK8 B;  5HR2 A;  4PX1 A;  5ECR B;  1A24 A;  3TKS A;  4FIW A;  1YZX A;  2FWF A;  4YQU A;  4POM A;  5J5N A;  11GS A;  5IMZ A;  1YKA A;  1YEP A;  2NDO A;  2YWN A;  1PMT A;  3A3T A;  3UAP A;  4XCS A;  5GAP D;  3TKS E;  5C00 A;  3KH9 A;  3GKK A;  1QFN A;  3M8N A;  1RW1 A;  2C4J A;  4V2L A;  3ZIT A;  3FR3 A;  4JZQ A;  3TKP A;  3LEF A;  1X9W B;  1QUW A;  2IMK A;  2VCV A;  1O8W A;  1R7H A;  3UEM A;  4F9Z A;  2VCZ A;  1GL8 A;  2X8H A;  4XS1 A;  5E59 A;  2K18 A;  2OBK A;  1TRV A;  2B7J A;  2DJJ A;  2LKU A;  1RQM A;  4KND A;  4AJ6 A;  2EIR A;  1FAA A;  2CX4 A;  3P2A A;  1T4Y A;  3NIV A;  3GL3 A;  1YEX A;  4MLY A;  2JZS A;  3TCO A;  1T00 A;  2REM A;  1X5E A;  1A0R P;  3DYR A;  4EL1 A;  3IHQ A;  2P5R A;  4Q5F A;  5JCW A;  1WRY A;  1BX9 A;  1GWC A;  1YF1 A;  4ZL7 A;  2OBI A;  2X8G A;  1GRX A;  3EUR A;  3MAK A;  2H76 A;  1RK4 A;  1GLP A;  2VCQ A;  1YQ1 A;  5ECS A;  1O7U A;  4JR6 A;  1PGT A;  1WP0 A;  5G5F A;  1SYR A;  4KGI A;  5DAL A;  1SJ6 A;  3EU3 A;  1XBS A;  1T4Z A;  5JWQ B;  5ECI B;  1Z6M A;  5D9T A;  4GST A;  4ML6 A;  5CNW A;  4IKH A;  3TB2 A;  1N8J A;  4P3Y B;  1ACV A;  2CAI A;  3ZRE A;  5G2Z A;  2C8U A;  2GDR A;  1KBN A;  3IK9 A;  2YJ7 A;  2RUE A;  4G2E A;  3M0F A;  3E3E A;  4IW9 A;  5HQP A;  2H6Z A;  3HJM A;  3APS A;  5FHI A;  1ZCP A;  2GT5 A;  1VF4 A;  4EO3 A;  5G31 A;  3M3M A;  1R5P A;  4ACS A;  1V58 A;  2ALB A;  4O5R A;  2GVP A;  1ABA A;  5CRD A;  3MSZ A;  3QAW A;  4IGJ A;  4MP4 A;  2GSR A;  2CVK A;  2HZE A;  5INY A;  1V2A A;  3ZVJ D;  3A5W A;  4I97 A;  5D9V A;  1HNC A;  3LGC A;  3IPZ A;  4ZBA A;  3ZIV A;  1M9A A;  4HS1 A;  2HLS A;  1DUG A;  5IO0 A;  3L0H A;  2C0F A;  1K0A A;  4MCU A;  2QC7 A;  1A2M A;  1SL0 B;  2FWG A;  5IM9 A;  2H8L A;  4K1F A;  1K3Y A;  1AIU A;  4HQS A;  5IPH A;  3IE3 A;  1GSD A;  1WPI A;  2PN8 A;  3O76 A;  3RPN A;  3UOM A;  2C0G A;  2L59 A;  5IPG A;  1PL2 A;  3H8Q A;  5CO3 A;  1FOV A;  4MF5 A;  1TK0 B;  2CA8 A;  3QOU A;  3ZTL A;  2HSY A;  1XOB A;  4KCE A;  5J4U A;  1TI3 A;  3IV4 A;  2AB6 A;  2VAF A;  5CYY A;  5C04 A;  2J9H A;  2B5X A;  1QK8 A;  3GN3 A;  3LXZ A;  5KN3 A;  1GP1 A;  3D22 A;  2D2Z A;  2VIM A;  2RLI A;  3M9J A;  3PGT A;  4K7I A;  2MBS A;  3VPQ A;  2IL3 A;  2YZU A;  1T1V A;  1EV4 A;  1OE7 A;  2VLU A;  5F07 A;  4I6X A;  5DDL A;  3FYG A;  4LA1 A;  1XWG A;  2YJH A;  2I4A A;  3F4S A;  3FW2 A;  2WDU A;  2LRC A;  2JZT A;  4CHS A;  3I6A A;  4TR4 A;  2KP2 A;  2CZ2 A;  1EEM A;  5DJL A;  1GTB A;  2H1G A;  3BJ5 A;  4RUV A;  4TKY A;  2ON5 A;  1GSS A;  3IAS 2;  4PNF A;  2FNO A;  1W4V A;  4KUN A;  2N5A A;  1GTA A;  4H86 A;  5ECO B;  2FY6 A;  2R6K A;  4NXI A;  1A2J A;  2P5Q A;  3F6F A;  3FEU A;  3IDV A;  1FW1 A;  3NOF A;  1B9Y C;  1F2E A;  1BG5 A;  2BTO T;  4NWY A;  5G30 A;  3RHB A;  2FWH A;  3D21 A;  1G7O A;  20GS A;  2LNT A;  4DSR A;  5IMD A;  1Y25 A;  4LL4 B;  1B9X C;  4V1A g;  4WET A;  4MZW A;  1R4W A;  2JSY A;  1V40 A;  1K0C A;  3DIE A;  4ID0 A;  3CSJ A;  3N5O A;  6GSU A;  3APO A;  3UMA A;  1XW5 A;  5A4V A;  3C1R A;  1AQV A;  1GNW A;  2L6D A;  3ME7 A;  1OAZ A;  1YF0 A;  1K3L A;  3DEX A;  2YCD A;  2WFC A;  3EU4 A;  1YY7 A;  2J23 A;  5J3R A;  2M80 A;  3G7I A;  3LOR A;  2YPM A;  1EV9 A;  1I5G A;  2PPT A;  3DML A;  3A2X A;  3IBH A;  4E8H A;  1JZW A;  1SKS B;  1PN9 A;  1CQH A;  2PU9 C;  2LNS A;  3LYK A;  1BAY A;  4HU7 A;  3R2Q A;  1SYX A;  2F51 A;  4PXO A;  1YDK A;  4YQM A;  2LJK A;  2B3S A;  4KH7 A;  2MMO A;  2AV4 A;  1H75 A;  3GX0 A;  2LV3 A;  3KTL A;  1TOF A;  2AHE A;  1EP7 A;  1BED A;  2JU5 A;  4ILF A;  5JCG A;  1A0F A;  4PUR A;  2B1L A;  1MEK A;  4GLT A;  5CP1 A;  2F8F A;  4OFT A;  4MPF A;  1U87 A;  3UAR A;  1R26 A;  2GSQ A;  2V32 A;  6GSY A;  4MK3 A;  3DXB A;  2V2G A;  2QSI A;  4ECI A;  2P31 A;  4WR5 A;  3US3 A;  4HI7 A;  3GNJ A;  5CRW A;  2A2S A;  1XWA A;  1AAZ A;  1GSU A;  3GYK A;  4KDY A;  1A2L A;  3JCM L;  1S3D A;  1B4Q A;  2WB9 A;  4RQX A;  3KM6 A;  4FH8 A;  1HQO A;  2GLR A;  4KE3 A;  4RI6 A;  2KLX A;  1FHE A;  1VF3 A;  5ENU A;  3LSZ A;  1XW6 A;  4ZB8 A;  1HNB A;  2MZC A;  4LL1 B;  4V2N A;  3BCI A;  2XHF A;  3H79 A;  3IOS A;  4O92 A;  2DC5 A;  1KEB A;  2GST A;  2CZ3 A;  2AUV A;  1O81 A;  1MDJ A;  3LWA A;  5ECP B;  5D96 A;  4G10 A;  3VUR A;  3KJY A;  3PIN A;  2VM2 A;  1TXX A;  2QGV A;  4TOP A;  3RDW A;  3TRX A;  3D4M A;  2B5E A;  1Z7R A;  2IMF A;  3F4T A;  1GNE A;  4HJ2 A;  2VM1 A;  3FZ5 A;  4X1U A;  2VL3 A;  3WGE A;  3A2W A;  2H73 A;  4PQH A;  4NHZ A;  4OMV A;  1SEN A;  1TU8 A;  4HU9 A;  1XOA A;  3I69 A;  3BBY A;  3FHK A;  2VL2 A;  1ZYE A;  2LEG A;  3HHV A;  5B6M A;  3J7Y k;  1B48 A;  4KDU A;  4TN8 A;  2IWT A;  5DVB A;  2PMT A;  3G9B A;  3QR6 A;  3EVI A;  2CAQ A;  2DJK A;  2QKE A;  3UL3 A;  2OJL A;  3ERF A;  1FB6 A;  3KMO A;  2HFD A;  1UC7 A;  3SWL A;  3CSI A;  2PWJ A;  1NHO A;  4MZC A;  3TJK A;  4HZ4 A;  2YN1 A;  4GQC A;  5D73 A;  3RHC A;  1NHY A;  4G19 A;  5FWG A;  3ERG A;  4TRX A;  4TR0 A;  5ID2 B;  4Q5Q A;  1ZL9 A;  1YJ6 A;  3F8U A;  1ERU A;  3WGX A;  4GWR A;  1SD9 A;  2PGT A;  3GIX A;  3O3T A;  2C3Q A;  3L4N A;  4XTS A;  1U88 A;  3P7X A;  2MBT A;  1EZK A;  1XWK A;  2HNL A;  4GXZ A;  5IQY A;  3G7J A;  2ZUP A;  1HNA A;  1F37 A;  2VL2 C;  4ZIL A;  4EUY A;  2VD0 A;  3KTB A;  2DIY A;  3LQ7 A;  4NV2 A;  2OA7 A;  2R2J A;  4PGT A;  3TRQ A;  1OVN A;  2HSH A;  3HZ8 A;  1J0F A;  1O73 A;  1HYU A;  1GTI A;  5IMF A;  3UBK A;  5E4W A;  4WKW A;  5IOX A;  3PH9 A;  2XC2 A;  2ZNM A;  2LST A;  3ZYW A;  3W6G A;  2GQL A;  3HKR A;  4KA0 A;  2YWO A;  1AQX A;  1EEJ A;  2WS2 A;  3ED3 A;  2LJR A;  1A23 A;  3CYN A;  3F6D A;  3EWL A;  1EGO A;  3HYP A;  2IME A;  1K0D A;  2JAD A;  4L5O A;  1K0M A;  2YZH A;  2WZ9 A;  1EOH A;  3ZZX A;  2DLX A;  3KCM A;  4AJ8 A;  2M46 A;  4KSO A;  1NW2 A;  5AGY A;  1T8E B;  2NTO A;  3KP9 A;  1SD8 A;  2PUK C;  2X64 A;  4MJB A;  4TXO A;  4WF5 A;  1PKZ A;  1HD2 A;  4BWS A;  4F0B A;  4HZ2 A;  3F4R A;  1SL1 B;  1FVK A;  1F6M C;  1A8L A;  2HT9 A;  1ML6 A;  3HVX A;  5GSS A;  3KXO A;  4IQA A;  3ZIJ A;  2IMI A;  2MMN A;  3BD2 A;  2MMA A;  1X5D A;  4YAP A;  2L57 A;  2C3T A;  3VPT A;  5KN0 A;  2AJQ B;  5JWR B;  2RII A;  4K0N A;  4XRA A;  6GSS A;  2EIO A;  2VLV A;  3ZML A;  4TXO B;  5AIV A;  3WT1 A;  5H5R A;  3IRA A;  2FLS A;  3C73 A;  2F3M A;  3VWV A;  3KEB A;  2FHE A;  4GSN A;  4YH2 A;  1GSE A;  2O87 A;  4POB A;  2M72 A;  1DE1 A;  4ZIJ A;  5J41 A;  3QFB C;  4XRD A;  1F9M A;  4IVF A;  3DRN A;  4EKZ A;  1K0N A;  1C72 A;  1LU4 A;  4MPG A;  1V57 A;  4NV5 A;  1OC3 A;  2YNX A;  4NPB A;  3HA9 A;  2H1D A;  4MZB A;  2XPD A;  3UBL A;  3KMN A;  2EC4 A;  1MD3 A;  3D5J A;  4MF7 A;  4TW5 A;  3VWU A;  4G9H A;  1OE8 A;  3DVX A;  5DQS A;  3RPP A;  3F63 A;  4JBB A;  4DSS A;  4ECJ A;  4J2F A;  2H0G A;  3H4K A;  4LMV A;  2A4V A;  2JL4 A;  1AXD A;  2CT6 A;  2O7K A;  4JRR A;  5IOW A;  3GUS A;  1PKW A;  3GTU A;  1PSQ A;  5ECH B;  1XWC A;  3TJB A;  3Q74 A;  1E6B A;  4ZXG A;  1SU9 A;  1GH2 A;  3KGK A;  1TRS A;  4GCI A;  5IMA A;  1M9B A;  1SKW B;  2C0D A;  1GSQ A;  1JHB A;  2GQM A;  4DSS B;  3BCK A;  3Q19 A;  1DSB A;  2P0G A;  4MJA A;  1BYE A;  1E2Y A;  1ON4 A;  3HCZ A;  3WGD A;  2L4Q A;  1B4P A;  3LG6 A;  5A5K A;  5JCU A;  2NBS A;  4F82 A;  5F06 A;  2FD3 A;  4XS6 A;  3GTU B;  4IP1 A;  1XPV A;  5G5E A;  3GH6 A;  4WEY A;  3DWV A;  4OWY A;  2FA8 A;  5CAX A;  1EP8 A;  2CVD A;  1THX A;  4PQ1 A;  2H0I A;  2IN3 A;  2MMZ A;  4ECB A;  3TDG A;  2V6K A;  1SK2 A;  1Q98 A;  4MJC A;  1USB A;  3QFA C;  3KH7 A;  1K0B A;  2ZCT A;  1WE0 A;  1Z9H A;  5D93 A;  1TK5 B;  1QQ2 A;  2KUC A;  3CMI A;  4MJE A;  2DIZ A;  2L5O A;  2B7K A;  12GS A;  3U5R E;  3EE2 A;  3TJF A;  5DAK B;  4BA7 A;  5F0G A;  4QL9 A;  1SK1 A;  4PUF C;  2VCX A;  1VRS D;  4IJ3 A;  2R3X A;  5ECQ B;  3TOT A;  1GUM A;  1M2A A;  1TI1 A;  5ECN B;  3F9U A;  5G1K A;  2IMD A;  5IIZ A;  1BJX A;  3MDK A;  3VWW A;  3HVV A;  3ME8 A;  2OE1 A;  2V1M A;  1K3O A;  4IN0 A;  1WMJ A;  2A2R A;  4ZB6 A;  4ZL8 A;  4OFN A;  3GKN A;  4QL7 A;  2FWE A;  3CSH A;  1IYH A;  1SJZ A;  5COH A;  4L0W A;  3L9S A;  2OAD A;  4J56 E;  2H72 A;  1S3A A;  3D4T A;  3C71 A;  1FB0 A;  1NM3 A;  3FZA A;  4L8E A;  2VOC A;  1G0T A;  2BJX A;  3AY8 A;  1F3B A; 
#chains in the Genus database with same CATH topology
 3CTF A;  4FYU A;  4MH2 A;  5EVO A;  1GUK A;  3GST A;  1SJI A;  2HRA A;  2TRX A;  2BMX A;  3TKR A;  2OAC A;  5H5S A;  3F3Q A;  4JE1 A;  4RQR A;  1CQG A;  4X0X A;  2B6M A;  3I43 A;  1X0R A;  5KN1 A;  4N0Z A;  10GS A;  3VI5 A;  4HQZ A;  4O5Q A;  5IMV A;  1OYJ A;  1X9S B;  3TJG A;  1EWX A;  4HJM A;  2AAW A;  4BL7 A;  4IJI A;  4K7O A;  1ST9 A;  3QMX A;  1XFL A;  3GH9 A;  3D0Z A;  4GTU A;  2HXK A;  3I9V 2;  4OO5 A;  5AIX A;  2RUF A;  3IR4 A;  2LS5 A;  3CRU A;  2VO4 A;  4XIH A;  5IMC A;  2FUG 2;  1DBY A;  2NVL A;  2JAC A;  4AF2 A;  4F03 A;  1T3B A;  3F3R A;  5J9B A;  3CXG A;  1URM A;  5IO2 A;  5JWO B;  3GL5 A;  5ECL B;  4JED A;  5ECK B;  2CVB A;  1UA5 A;  4WBJ A;  1N2A A;  2EIQ A;  1Z7P A;  3ERW A;  2HRF A;  1YKC A;  3DD3 A;  1M0U A;  2XBI A;  4CW9 A;  3HDC A;  4MDC A;  4ZB9 A;  2C0E A;  2H19 A;  4J57 E;  1PQN A;  4L0U A;  1LJR A;  1ZYP A;  2WRT A;  4FO5 A;  4XHM A;  3DKS A;  3GHA A;  2GZP A;  2IIY A;  2O8V B;  3HZ4 A;  3TOU A;  4FYB A;  2PBJ A;  3VK9 A;  3P8W A;  3Q18 A;  2DSA A;  2YV9 A;  1OC8 A;  2H1A A;  3VI7 A;  6GSV A;  3HVS A;  3KD0 A;  4E8E A;  6GST A;  1IYI A;  4MH3 A;  5B7C A;  4JU5 A;  4ULX A;  4K6X A;  4K0G A;  4K2X A;  5GAN D;  2I9H A;  2R4V A;  2RM5 A;  4ZBD A;  1KTE A;  4NHW A;  2L5L A;  4PQI A;  2E2G A;  1TRU A;  2B5Y A;  2WGR A;  3EMP A;  19GS A;  5ID2 A;  4EC0 A;  2LRN A;  2GT6 A;  2VLT A;  4HDE A;  1EOG A;  2H6X A;  2H71 A;  13GS A;  3ISO A;  2N5F A;  5KOX A;  3ZL5 A;  1WJK A;  2TRC P;  3O6T A;  3IXR A;  1G7E A;  4BVY A;  1EGR A;  5D9X A;  2YWM A;  9GSS A;  3HD5 A;  4BVX A;  2YWI A;  3TKQ A;  2DJ2 A;  4TR3 A;  4IP6 A;  3QAV A;  5EY6 A;  2LUS A;  4AGS A;  3WD6 A;  5DQY A;  1ERW A;  2PVQ A;  1AC1 A;  1VGL A;  5DBQ A;  2DKI A;  1ZZY A;  1Z3E A;  1ZGN A;  2GSS A;  4D73 A;  3QCP A;  2O85 A;  1OC9 A;  4EDZ A;  4FYC A;  2HE3 A;  2GTU A;  1QXH A;  7GSS A;  1Z6N A;  4EIP A;  3ZMK A;  2FA4 A;  1Z5Y E;  4I2U A;  1SK0 A;  4YQV A;  3U6V A;  1GUL A;  1WOU A;  2G2Q A;  2F9S A;  4K5R A;  2I3Y A;  3L9U A;  5D8I A;  3TKS C;  4ML1 A;  4BPY A;  4D73 B;  5HR0 A;  2KP1 A;  1H4O A;  5LNK e;  2C80 A;  17GS A;  5B8A A;  16GS A;  1XXU A;  2H01 A;  4BWQ A;  2HI7 A;  1OC9 B;  4I8B A;  3UVT A;  4MA9 A;  3P90 A;  4NMU A;  1W89 A;  4DSQ A;  2IJY A;  4EXJ A;  1GTU A;  1U3A A;  1O8X A;  4WXT A;  3LJR A;  4TR1 A;  4YAV A;  2H75 A;  2HYX A;  2DMM A;  3ZFL A;  3TUE A;  1ILO A;  4Z7X A;  1U3I A;  2ON7 A;  1O6J A;  1MDI A;  1JZR A;  4HEA 2;  3H1N A;  1M2B A;  3MNG A;  2VD1 A;  5EL8 A;  1Y6E A;  1XZO A;  1M99 A;  1DE2 A;  3UJ1 A;  1SL2 B;  4A5P A;  5AN1 A;  3GFK A;  5J9C A;  3EMX A;  3GKM A;  4N30 A;  3E9J B;  3RBT A;  4TR1 B;  5DJM A;  5DAL B;  2AYT A;  4GSS A;  3OR5 A;  5CRG A;  2HRN A;  3FK8 A;  2LQO A;  3QAG A;  4MAB A;  2RM6 A;  1R5A A;  2GS3 A;  3KP8 A;  4G0K A;  4KSM A;  3E0U A;  1F3A A;  1VF1 A;  2OE0 A;  3A2V A;  3QPM A;  3FKF A;  1TKD B;  3CTG A;  3GRX A;  2YOI A;  4ECC A;  3TRP A;  3CQF A;  1X5C A;  2YV7 A;  3N9J A;  1GLQ A;  3QDN A;  2L6C A;  2ES7 A;  4LLR A;  2NPB A;  2I81 A;  1XW9 A;  4N11 A;  2E0Q A;  4JR4 A;  2VL9 A;  3GMF A;  3GV1 A;  4G0I A;  3VFI A;  2H74 A;  5ELA A;  2IFQ A;  2CV4 A;  2JZR A;  4POL A;  2E2M A;  3DVW A;  5EPF A;  2HZE B;  5A4W A;  4QQ7 A;  2DJ1 A;  4RI7 A;  1ZMA A;  5HFI A;  3HJO A;  1ZYQ B;  1M3J A;  3F0I A;  1FVJ A;  1PX6 A;  4DVC A;  3CRT A;  3EC3 A;  4K8M A;  4TXV A;  2I1U A;  4K2D A;  4Q5N A;  2IFQ B;  3FY7 A;  3GSS A;  4IHU A;  1T7P B;  1THO A;  1GSF A;  4XS4 A;  1PD2 1;  4BIK A;  2FGX A;  5ECM B;  3DGQ A;  3FR9 A;  4FQU A;  3W8J A;  2X99 A;  1XVW A;  3APQ A;  3UVH A;  4TVE A;  5HR1 A;  1XVQ A;  3HJP A;  5ABR A;  4HUA A;  1UVZ A;  3ZRD A;  2DJ3 A;  2N5B A;  3C1S A;  18GS A;  2DJ0 A;  2V41 A;  2PER A;  5HR3 A;  2WUL A;  5DCH A;  1KNG A;  3GKX A;  2XBQ A;  1I9D A;  4XS4 B;  2OE3 A;  1NSW A;  2WCI A;  1MD4 A;  1MTC A;  4O7H A;  2MYG A;  3TJJ A;  3IA1 A;  4F2I A;  2GZZ A;  1JFU A;  2V6O A;  1K0O A;  4WR4 A;  3TGZ A;  4AJ7 A;  2WJU A;  4LMW A;  3IK7 A;  2LJA A;  14GS A;  5DAK A;  2YAN A;  2H66 A;  8GSS A;  4POK A;  3L78 A;  2YP6 A;  3HY2 A;  2R37 A;  2C3N A;  3LFL A;  2HZF A;  2K8V A;  4IBP A;  2KOK A;  1S3R A;  3M1G A;  4EF0 A;  1FO5 A;  3VLN A;  3CBU A;  3MWH A;  1WIK A;  4I5Q A;  4GF0 A;  1UN2 A;  3BOA A;  2R5G A;  5HFG A;  6GSW A;  1JLW A;  4KW6 A;  1TP9 A;  5LD0 A;  3NZN A;  2QA2 A;  4Q5R A;  1PX7 A;  1U6T A;  4I2T A;  4N0V A;  2VUP A;  2DML A;  4GQF A;  4EE0 A;  1QMV A;  1AQW A;  2C1Y A;  2PVO C;  2GZY A;  4IQ1 A;  4V2M A;  1G6W A;  3SBC A;  4IS0 A;  4ZL9 A;  5HFK A;  3C8E A;  3EIN A;  5F05 A;  4F0C A;  1ZOF A;  3M9K A;  2CX3 A;  4OO4 A;  1J9B A;  1J08 A;  3KZQ A;  1XCC A;  1LBK A;  4GRF A;  1JZO A;  2K9F A;  3QD9 A;  1BQ7 A;  1XWB A;  1TDI A;  1V98 A;  2E7P A;  1JZD A;  3K8N A;  1TTZ A;  3ZLP A;  1GUH A;  2K8S A;  5B6N A;  4OCE A;  2LRT A;  1TRW A;  2G0F A;  2H70 A;  1TW9 A;  2IPA A;  3RAZ A;  1AW9 A;  3ZFB A;  2H0H A;  1ERT A;  2OKA A;  1AUC A;  3LYP A;  4MMM A;  4L5L A;  4DEJ A;  3GUR A;  2L4C A;  2LTK A;  3L9V A;  3D6I A;  2DBC A;  4CDO A;  4KDX A;  4X43 A;  1SKR B;  1VF2 A;  1O85 A;  3KIJ A;  4N10 A;  5GZZ B;  4KCA A;  4V1A p;  1M3I A;  3S9F A;  2LQQ A;  1ERV A;  2CQ9 A;  2VCT A;  3VWX A;  5KEJ A;  4KAE A;  3J7Y b;  2JSZ A;  5KN2 A;  4KB3 A;  3G7Y A;  5H5Q A;  1X9M B;  5A4U A;  5F8B A;  5LCZ A;  2H30 A;  5AIS A;  2B1K A;  5FT3 A;  3H93 A;  1S3C A;  1B8X A;  2GQK A;  3PPU A;  3Q6O A;  1MDK A;  4EVM A;  3C7M A;  1ZYN A;  4ISD A;  1JLV A;  3IAM 2;  3ZVJ A;  4OFM A;  1XIY A;  1TJD A;  1V9W A;  4OD7 A;  1Q4J A;  3FR6 A;  5B8B A;  2GGT A;  4WBR D;  3FZ4 A;  2K6V A;  3W8S A;  2FCH A;  6GSX A;  3IC4 A;  5KOW A;  5ELG A;  1TU7 A;  22GS A;  5L71 A;  5CRE A;  4NAX A;  4PNG A;  3PR8 A;  1GSY A;  2VCW A;  4KX4 A;  4CY8 A;  2KHP A;  5CRH A;  4PUA A;  4HOJ A;  4MNN A;  4Z2R A;  4O32 A;  5G1L A;  4EDY A;  2X8C A;  3V1W A;  2O89 A;  4ZBB A;  3FZ9 A;  3WT2 A;  1PL1 A;  4WF4 A;  3WYW A;  1G6Y A;  1PA3 A;  3FRC A;  1OKD A;  3GX8 A;  2H1B A;  3EYT A;  4OCF A;  1M7T A;  3UIW A;  3GA4 A;  2XPE A;  2Z9S A;  5GST A;  1A8Y A;  4K7N A;  1QGV A;  3HXS A;  1PRX A;  1M2D A;  1FG4 A;  5DCG A;  2TIR A;  1WWJ A;  4K9Z A;  3MYD A;  2H6Y A;  2F8A A;  3LXT A;  4IEL A;  4MF6 A;  1OKT A;  5D9W A;  1TK8 B;  5HR2 A;  4PX1 A;  5ECR B;  1A24 A;  3TKS A;  4FIW A;  1YZX A;  2FWF A;  4YQU A;  4POM A;  5J5N A;  11GS A;  5IMZ A;  1YKA A;  1YEP A;  2NDO A;  2YWN A;  1PMT A;  3A3T A;  3UAP A;  4XCS A;  5GAP D;  3TKS E;  5C00 A;  3KH9 A;  3GKK A;  1QFN A;  3M8N A;  1RW1 A;  2C4J A;  4V2L A;  3ZIT A;  3FR3 A;  4JZQ A;  3TKP A;  3LEF A;  1X9W B;  1QUW A;  2IMK A;  2VCV A;  1O8W A;  1R7H A;  3UEM A;  4F9Z A;  2VCZ A;  1GL8 A;  2X8H A;  4XS1 A;  5E59 A;  2K18 A;  2OBK A;  1TRV A;  2B7J A;  2DJJ A;  2LKU A;  1RQM A;  4KND A;  5BMU A;  4AJ6 A;  2EIR A;  4CY6 A;  1FAA A;  2CX4 A;  3P2A A;  1T4Y A;  5BRT A;  3NIV A;  3GL3 A;  1YEX A;  4MLY A;  2JZS A;  3TCO A;  1T00 A;  2REM A;  1X5E A;  1A0R P;  3DYR A;  4EL1 A;  3IHQ A;  1PN0 A;  2P5R A;  4Q5F A;  5JCW A;  1WRY A;  1BX9 A;  1GWC A;  1YF1 A;  4ZL7 A;  2OBI A;  2X8G A;  1GRX A;  3EUR A;  4HSC X;  3MAK A;  2H76 A;  1RK4 A;  1GLP A;  2VCQ A;  1YQ1 A;  3EPT A;  5ECS A;  4PTS A;  1O7U A;  4KF9 A;  4JR6 A;  1PGT A;  1WP0 A;  5G5F A;  1SYR A;  4KGI A;  3EU3 A;  1SJ6 A;  5DAL A;  1XBS A;  1T4Z A;  5JWQ B;  5ECI B;  1Z6M A;  5D9T A;  4GST A;  4ML6 A;  5CNW A;  4IKH A;  3TB2 A;  1N8J A;  4P3Y B;  1ACV A;  2CAI A;  3ZRE A;  5G2Z A;  2C8U A;  2GDR A;  1KBN A;  3IK9 A;  2YJ7 A;  2RUE A;  4G2E A;  3M0F A;  3E3E A;  4IW9 A;  5HQP A;  2H6Z A;  3HJM A;  3APS A;  5FHI A;  1ZCP A;  2GT5 A;  1VF4 A;  4EO3 A;  2HSM A;  4K5S A;  5G31 A;  3M3M A;  1R5P A;  4ACS A;  1V58 A;  2ALB A;  4O5R A;  2GVP A;  1ABA A;  5CRD A;  3MSZ A;  3QAW A;  4IGJ A;  4MP4 A;  2GSR A;  2CVK A;  2HZE A;  5INY A;  1V2A A;  3ZVJ D;  3A5W A;  4I97 A;  3IHG A;  5D9V A;  1HNC A;  3LGC A;  3IPZ A;  4ZBA A;  3ZIV A;  1M9A A;  4HS1 A;  2HLS A;  1DUG A;  5IO0 A;  3L0H A;  2C0F A;  1K0A A;  4MCU A;  2QC7 A;  1A2M A;  1SL0 B;  2FWG A;  5IM9 A;  2H8L A;  4K1F A;  1K3Y A;  1AIU A;  4HQS A;  5IPH A;  3IE3 A;  1GSD A;  1WPI A;  2PN8 A;  3O76 A;  3RPN A;  3UOM A;  2C0G A;  2L59 A;  5IPG A;  1PL2 A;  3H8Q A;  5CO3 A;  1FOV A;  4MF5 A;  1TK0 B;  2CA8 A;  3QOU A;  3ZTL A;  2HSY A;  1XOB A;  4KCE A;  5J4U A;  1TI3 A;  3IV4 A;  2AB6 A;  2VAF A;  5CYY A;  5C04 A;  2J9H A;  2B5X A;  1QK8 A;  3GN3 A;  3LXZ A;  5KN3 A;  1GP1 A;  3D22 A;  2D2Z A;  2VIM A;  2RLI A;  3M9J A;  3PGT A;  4K7I A;  2MBS A;  3VPQ A;  2IL3 A;  2YZU A;  1T1V A;  1EV4 A;  1OE7 A;  2VLU A;  5F07 A;  4I6X A;  5DDL A;  3FYG A;  4LA1 A;  1XWG A;  2YJH A;  2I4A A;  3F4S A;  3FW2 A;  2WDU A;  2LRC A;  2JZT A;  4CHS A;  3I6A A;  4TR4 A;  2KP2 A;  2CZ2 A;  1EEM A;  5DJL A;  1GTB A;  2H1G A;  3BJ5 A;  4RUV A;  4TKY A;  2ON5 A;  1GSS A;  3IAS 2;  4PNF A;  2FNO A;  1W4V A;  4KUN A;  2N5A A;  1GTA A;  4H86 A;  5ECO B;  2FY6 A;  2R6K A;  3MIX A;  4NXI A;  2X49 A;  1A2J A;  2P5Q A;  3F6F A;  3FEU A;  3IDV A;  1FW1 A;  3NOF A;  1B9Y C;  4X4J A;  1F2E A;  1BG5 A;  2BTO T;  4NWY A;  5G30 A;  3RHB A;  2FWH A;  3D21 A;  1G7O A;  20GS A;  2LNT A;  4DSR A;  5IMD A;  1Y25 A;  4LL4 B;  1B9X C;  4V1A g;  2QA1 A;  4WET A;  4MZW A;  1R4W A;  2JSY A;  1V40 A;  1K0C A;  3DIE A;  4ID0 A;  3CSJ A;  3N5O A;  6GSU A;  3APO A;  3UMA A;  1XW5 A;  5A4V A;  3C1R A;  1AQV A;  1GNW A;  2L6D A;  3ME7 A;  1OAZ A;  1YF0 A;  1K3L A;  3DEX A;  2YCD A;  2WFC A;  1PFO A;  3EU4 A;  1YY7 A;  2J23 A;  5J3R A;  2M80 A;  3G7I A;  3LOR A;  2YPM A;  1EV9 A;  1I5G A;  2PPT A;  3DML A;  3A2X A;  3IBH A;  4E8H A;  4G0L A;  1JZW A;  1SKS B;  1PN9 A;  1CQH A;  2PU9 C;  2LNS A;  3LYK A;  1BAY A;  4HU7 A;  3R2Q A;  3R3E A;  1SYX A;  2F51 A;  4PXO A;  1YDK A;  4YQM A;  2LJK A;  2B3S A;  4KH7 A;  2MMO A;  2AV4 A;  1H75 A;  3GX0 A;  2LV3 A;  3KTL A;  1TOF A;  2AHE A;  1EP7 A;  1BED A;  3HVN A;  3IC8 A;  2JU5 A;  4ILF A;  5JCG A;  1A0F A;  4PUR A;  2B1L A;  1MEK A;  4GLT A;  5CP1 A;  2F8F A;  4OFT A;  4MPF A;  1U87 A;  3UAR A;  1R26 A;  2GSQ A;  2V32 A;  6GSY A;  4MK3 A;  3DXB A;  2V2G A;  2QSI A;  4ECI A;  2P31 A;  4WR5 A;  3US3 A;  4HI7 A;  3GNJ A;  5CRW A;  2A2S A;  1XWA A;  1AAZ A;  1GSU A;  3GYK A;  4KDY A;  1A2L A;  3JCM L;  1S3D A;  1B4Q A;  2WB9 A;  4RQX A;  3KM6 A;  4FH8 A;  1HQO A;  2GLR A;  4KE3 A;  4RI6 A;  2KLX A;  1FHE A;  1VF3 A;  4EIQ A;  5ENU A;  4BL7 B;  3LSZ A;  1XW6 A;  4ZB8 A;  1HNB A;  2MZC A;  4LL1 B;  4V2N A;  3BCI A;  2XHF A;  3H79 A;  3IOS A;  4O92 A;  2DC5 A;  1KEB A;  2GST A;  2CZ3 A;  2AUV A;  1O81 A;  1MDJ A;  3LWA A;  5ECP B;  5D96 A;  4G10 A;  3VUR A;  3KJY A;  4ICY A;  3PIN A;  2VM2 A;  1TXX A;  2QGV A;  4TOP A;  3RDW A;  2A4H A;  3D4M A;  3TRX A;  2B5E A;  1Z7R A;  2IMF A;  3F4T A;  1GNE A;  4HJ2 A;  2VM1 A;  3FZ5 A;  4X1U A;  2VL3 A;  3WGE A;  3A2W A;  2H73 A;  4PQH A;  4NHZ A;  4OMV A;  1SEN A;  1TU8 A;  4HU9 A;  1XOA A;  3I69 A;  3BBY A;  3FHK A;  2VL2 A;  1ZYE A;  2LEG A;  3HHV A;  5B6M A;  3J7Y k;  1B48 A;  4KDU A;  4TN8 A;  2IWT A;  5DVB A;  2PMT A;  3G9B A;  3QR6 A;  3EVI A;  2CAQ A;  2DJK A;  2QKE A;  3UL3 A;  2OJL A;  3ERF A;  1FB6 A;  3KMO A;  2HFD A;  1UC7 A;  3SWL A;  3CSI A;  2PWJ A;  1NHO A;  4MZC A;  3TJK A;  4HZ4 A;  2YN1 A;  4GQC A;  5D73 A;  3RHC A;  1NHY A;  4G19 A;  5FWG A;  3ERG A;  4TRX A;  4TR0 A;  5ID2 B;  4Q5Q A;  1ZL9 A;  1YJ6 A;  4Z2T A;  3F8U A;  1ERU A;  3WGX A;  4GWR A;  1SD9 A;  2PGT A;  3GIX A;  3O3T A;  2C3Q A;  3L4N A;  4XTS A;  1U88 A;  3P7X A;  2MBT A;  1EZK A;  1XWK A;  2HNL A;  4BVY B;  4GXZ A;  5IQY A;  3G7J A;  4BVX B;  2ZUP A;  1HNA A;  1F37 A;  2VL2 C;  4ZIL A;  4EUY A;  2VD0 A;  3KTB A;  2DIY A;  3LQ7 A;  4NV2 A;  2OA7 A;  2R2J A;  4PGT A;  3TRQ A;  1OVN A;  2HRK A;  2HSH A;  3HZ8 A;  1J0F A;  1O73 A;  1HYU A;  1GTI A;  5IMF A;  3UBK A;  5E4W A;  4WKW A;  5IOX A;  3PH9 A;  2XC2 A;  2ZNM A;  2LST A;  3ZYW A;  3W6G A;  2GQL A;  3HKR A;  4KA0 A;  2YWO A;  1AQX A;  1EEJ A;  2WS2 A;  3ED3 A;  2LJR A;  1A23 A;  3CYN A;  2R0G A;  3F6D A;  3EWL A;  1EGO A;  3HYP A;  2IME A;  1K0D A;  2JAD A;  4L5O A;  1K0M A;  2YZH A;  2WZ9 A;  1EOH A;  3ZZX A;  2DLX A;  1FOH A;  3KCM A;  4AJ8 A;  2M46 A;  4KSO A;  1NW2 A;  2UZ8 A;  5AGY A;  1T8E B;  2NTO A;  3KP9 A;  4YKF A;  1SD8 A;  2PUK C;  2X64 A;  4MJB A;  4TXO A;  4WF5 A;  2R0P A;  1PKZ A;  3FMW A;  1HD2 A;  4BWS A;  4F0B A;  4HZ2 A;  3F4R A;  1SL1 B;  1FVK A;  4O5U A;  1F6M C;  1A8L A;  2HT9 A;  1ML6 A;  3HVX A;  5GSS A;  3KXO A;  4IQA A;  3ZIJ A;  2IMI A;  2MMN A;  3BD2 A;  2MMA A;  1X5D A;  4YAP A;  2L57 A;  2C3T A;  3VPT A;  5KN0 A;  2AJQ B;  5JWR B;  2RII A;  4K0N A;  4XRA A;  6GSS A;  2EIO A;  2VLV A;  3ZML A;  4TXO B;  5AIV A;  3WT1 A;  5H5R A;  3IRA A;  2FLS A;  3C73 A;  2F3M A;  3VWV A;  3KEB A;  2FHE A;  4GSN A;  4YH2 A;  1GSE A;  2O87 A;  4POB A;  2M72 A;  1DE1 A;  4ZIJ A;  5J41 A;  3QFB C;  4XRD A;  1F9M A;  4IVF A;  3DRN A;  4EKZ A;  1K0N A;  1C72 A;  1LU4 A;  4MPG A;  1V57 A;  4NV5 A;  1OC3 A;  2YNX A;  4NPB A;  3HA9 A;  2H1D A;  4MZB A;  2R0C A;  2XPD A;  4YKG A;  3UBL A;  3KMN A;  2EC4 A;  1MD3 A;  3D5J A;  4MF7 A;  4TW5 A;  3VWU A;  4G9H A;  1OE8 A;  3DVX A;  5DQS A;  3RPP A;  3F63 A;  4JBB A;  4DSS A;  1XG8 A;  4ECJ A;  4J2F A;  2H0G A;  3H4K A;  4LMV A;  2A4V A;  2JL4 A;  2A2P A;  1AXD A;  2CT6 A;  2O7K A;  4JRR A;  5IOW A;  4USS A;  3GUS A;  1PKW A;  3GTU A;  1PSQ A;  5ECH B;  1XWC A;  3TJB A;  3Q74 A;  1E6B A;  4ZXG A;  1SU9 A;  1GH2 A;  3KGK A;  1TRS A;  4GCI A;  5IMA A;  1M9B A;  1SKW B;  2C0D A;  1GSQ A;  1JHB A;  2GQM A;  4DSS B;  3BCK A;  3Q19 A;  1DSB A;  2P0G A;  4MJA A;  1BYE A;  1E2Y A;  1ON4 A;  3HCZ A;  3WGD A;  2L4Q A;  1B4P A;  3LG6 A;  5A5K A;  5JCU A;  2NBS A;  4F82 A;  5F06 A;  2FD3 A;  4XS6 A;  3GTU B;  4IP1 A;  1XPV A;  5G5E A;  3GH6 A;  4WEY A;  3DWV A;  4OWY A;  2FA8 A;  5CAX A;  1EP8 A;  2CVD A;  4Z2U A;  1THX A;  4PQ1 A;  2H0I A;  2IN3 A;  2MMZ A;  4ECB A;  3TDG A;  2V6K A;  1SK2 A;  1Q98 A;  4MJC A;  1USB A;  3QFA C;  3KH7 A;  1K0B A;  2ZCT A;  1WE0 A;  1Z9H A;  5D93 A;  2DKH A;  1TK5 B;  1QQ2 A;  2KUC A;  3CMI A;  4MJE A;  2DIZ A;  2L5O A;  2B7K A;  12GS A;  3U5R E;  3EE2 A;  3TJF A;  5DAK B;  4BA7 A;  5F0G A;  4QL9 A;  1SK1 A;  4PUF C;  2VCX A;  1VRS D;  4IJ3 A;  2R3X A;  5ECQ B;  3TOT A;  1GUM A;  1M2A A;  1TI1 A;  5ECN B;  3F9U A;  3LW9 A;  5G1K A;  2IMD A;  5IIZ A;  1BJX A;  3MDK A;  3VWW A;  3HVV A;  3ME8 A;  2OE1 A;  4IN0 A;  2V1M A;  1K3O A;  3A5I A;  1WMJ A;  2A2R A;  4ZB6 A;  4ZL8 A;  4OFN A;  3GKN A;  4QL7 A;  2FWE A;  3CSH A;  1IYH A;  1SJZ A;  5COH A;  4L0W A;  3L9S A;  2OAD A;  4J56 E;  2H72 A;  1S3A A;  3D4T A;  3C71 A;  2X4A A;  1FB0 A;  1NM3 A;  3FZA A;  4L8E A;  2VOC A;  1G0T A;  2BJX A;  3AY8 A;  1F3B A; 
#chains in the Genus database with same CATH homology
 3CTF A;  4FYU A;  4MH2 A;  5EVO A;  1GUK A;  3GST A;  1SJI A;  2HRA A;  2TRX A;  2BMX A;  3TKR A;  2OAC A;  5H5S A;  3F3Q A;  4JE1 A;  4RQR A;  1CQG A;  4X0X A;  2B6M A;  3I43 A;  1X0R A;  5KN1 A;  4N0Z A;  10GS A;  3VI5 A;  4HQZ A;  4O5Q A;  5IMV A;  1OYJ A;  1X9S B;  3TJG A;  1EWX A;  4HJM A;  2AAW A;  4BL7 A;  4IJI A;  4K7O A;  1ST9 A;  3QMX A;  1XFL A;  3GH9 A;  3D0Z A;  4GTU A;  2HXK A;  3I9V 2;  4OO5 A;  5AIX A;  2RUF A;  3IR4 A;  2LS5 A;  3CRU A;  2VO4 A;  4XIH A;  5IMC A;  2FUG 2;  1DBY A;  2NVL A;  2JAC A;  4AF2 A;  4F03 A;  1T3B A;  3F3R A;  5J9B A;  3CXG A;  1URM A;  5IO2 A;  5JWO B;  3GL5 A;  5ECL B;  4JED A;  5ECK B;  2CVB A;  1UA5 A;  4WBJ A;  1N2A A;  2EIQ A;  1Z7P A;  3ERW A;  2HRF A;  1YKC A;  3DD3 A;  1M0U A;  2XBI A;  4CW9 A;  3HDC A;  4MDC A;  4ZB9 A;  2C0E A;  2H19 A;  4J57 E;  1PQN A;  4L0U A;  1LJR A;  1ZYP A;  2WRT A;  4FO5 A;  4XHM A;  3DKS A;  3GHA A;  2GZP A;  2IIY A;  2O8V B;  3HZ4 A;  3TOU A;  4FYB A;  2PBJ A;  3VK9 A;  3P8W A;  3Q18 A;  2DSA A;  2YV9 A;  1OC8 A;  2H1A A;  3VI7 A;  6GSV A;  3HVS A;  3KD0 A;  4E8E A;  6GST A;  1IYI A;  4MH3 A;  5B7C A;  4JU5 A;  4ULX A;  4K6X A;  4K0G A;  4K2X A;  5GAN D;  2I9H A;  2R4V A;  2RM5 A;  4ZBD A;  1KTE A;  4NHW A;  2L5L A;  4PQI A;  2E2G A;  1TRU A;  2B5Y A;  2WGR A;  3EMP A;  19GS A;  5ID2 A;  4EC0 A;  2LRN A;  2GT6 A;  2VLT A;  4HDE A;  1EOG A;  2H6X A;  2H71 A;  13GS A;  3ISO A;  2N5F A;  5KOX A;  3ZL5 A;  1WJK A;  2TRC P;  3O6T A;  3IXR A;  1G7E A;  4BVY A;  1EGR A;  5D9X A;  2YWM A;  9GSS A;  3HD5 A;  4BVX A;  2YWI A;  3TKQ A;  2DJ2 A;  4TR3 A;  4IP6 A;  3QAV A;  5EY6 A;  2LUS A;  4AGS A;  3WD6 A;  5DQY A;  1ERW A;  2PVQ A;  1AC1 A;  1VGL A;  5DBQ A;  2DKI A;  1ZZY A;  1Z3E A;  1ZGN A;  2GSS A;  4D73 A;  3QCP A;  2O85 A;  1OC9 A;  4EDZ A;  4FYC A;  2HE3 A;  2GTU A;  1QXH A;  7GSS A;  1Z6N A;  4EIP A;  3ZMK A;  2FA4 A;  1Z5Y E;  4I2U A;  1SK0 A;  4YQV A;  3U6V A;  1GUL A;  1WOU A;  2G2Q A;  2F9S A;  4K5R A;  2I3Y A;  3L9U A;  5D8I A;  3TKS C;  4ML1 A;  4BPY A;  4D73 B;  5HR0 A;  2KP1 A;  1H4O A;  5LNK e;  2C80 A;  17GS A;  5B8A A;  16GS A;  1XXU A;  2H01 A;  4BWQ A;  2HI7 A;  1OC9 B;  4I8B A;  3UVT A;  4MA9 A;  3P90 A;  4NMU A;  1W89 A;  4DSQ A;  2IJY A;  4EXJ A;  1GTU A;  1U3A A;  1O8X A;  4WXT A;  3LJR A;  4TR1 A;  4YAV A;  2H75 A;  2HYX A;  2DMM A;  3ZFL A;  3TUE A;  1ILO A;  4Z7X A;  1U3I A;  2ON7 A;  1O6J A;  1MDI A;  1JZR A;  4HEA 2;  3H1N A;  1M2B A;  3MNG A;  2VD1 A;  5EL8 A;  1Y6E A;  1XZO A;  1M99 A;  1DE2 A;  3UJ1 A;  1SL2 B;  4A5P A;  5AN1 A;  3GFK A;  5J9C A;  3EMX A;  3GKM A;  4N30 A;  3E9J B;  3RBT A;  4TR1 B;  5DJM A;  5DAL B;  2AYT A;  4GSS A;  3OR5 A;  5CRG A;  2HRN A;  3FK8 A;  2LQO A;  3QAG A;  4MAB A;  2RM6 A;  1R5A A;  2GS3 A;  3KP8 A;  4G0K A;  4KSM A;  3E0U A;  1F3A A;  1VF1 A;  2OE0 A;  3A2V A;  3QPM A;  3FKF A;  1TKD B;  3CTG A;  3GRX A;  2YOI A;  4ECC A;  3TRP A;  1X5C A;  2YV7 A;  3N9J A;  1GLQ A;  3QDN A;  2L6C A;  2ES7 A;  4LLR A;  2NPB A;  2I81 A;  1XW9 A;  4N11 A;  2E0Q A;  4JR4 A;  2VL9 A;  3GMF A;  3GV1 A;  4G0I A;  3VFI A;  2H74 A;  5ELA A;  2IFQ A;  2CV4 A;  2JZR A;  4POL A;  2E2M A;  3DVW A;  5EPF A;  2HZE B;  5A4W A;  4QQ7 A;  2DJ1 A;  4RI7 A;  1ZMA A;  5HFI A;  3HJO A;  1ZYQ B;  3F0I A;  1FVJ A;  1PX6 A;  4DVC A;  3CRT A;  3EC3 A;  4K8M A;  4TXV A;  2I1U A;  4K2D A;  4Q5N A;  2IFQ B;  3FY7 A;  3GSS A;  4IHU A;  1T7P B;  1THO A;  1GSF A;  4XS4 A;  1PD2 1;  2FGX A;  5ECM B;  3DGQ A;  3FR9 A;  4FQU A;  3W8J A;  2X99 A;  1XVW A;  3APQ A;  3UVH A;  4TVE A;  5HR1 A;  1XVQ A;  3HJP A;  5ABR A;  4HUA A;  1UVZ A;  3ZRD A;  2DJ3 A;  2N5B A;  3C1S A;  18GS A;  2DJ0 A;  2V41 A;  2PER A;  5HR3 A;  2WUL A;  5DCH A;  1KNG A;  3GKX A;  2XBQ A;  1I9D A;  4XS4 B;  2OE3 A;  1NSW A;  2WCI A;  1MD4 A;  1MTC A;  4O7H A;  2MYG A;  3TJJ A;  3IA1 A;  4F2I A;  2GZZ A;  1JFU A;  2V6O A;  1K0O A;  4WR4 A;  3TGZ A;  4AJ7 A;  2WJU A;  4LMW A;  3IK7 A;  2LJA A;  14GS A;  5DAK A;  2YAN A;  2H66 A;  8GSS A;  4POK A;  3L78 A;  2YP6 A;  3HY2 A;  2R37 A;  2C3N A;  3LFL A;  2HZF A;  2K8V A;  4IBP A;  2KOK A;  3M1G A;  4EF0 A;  1FO5 A;  3VLN A;  3CBU A;  3MWH A;  1WIK A;  4I5Q A;  4GF0 A;  1UN2 A;  3BOA A;  2R5G A;  5HFG A;  6GSW A;  1JLW A;  4KW6 A;  1TP9 A;  5LD0 A;  3NZN A;  2QA2 A;  4Q5R A;  1PX7 A;  1U6T A;  4I2T A;  4N0V A;  2VUP A;  2DML A;  4GQF A;  4EE0 A;  1QMV A;  1AQW A;  2C1Y A;  2PVO C;  2GZY A;  4IQ1 A;  4V2M A;  1G6W A;  3SBC A;  4IS0 A;  4ZL9 A;  5HFK A;  3C8E A;  3EIN A;  5F05 A;  4F0C A;  1ZOF A;  3M9K A;  2CX3 A;  4OO4 A;  1J9B A;  1J08 A;  3KZQ A;  1XCC A;  1LBK A;  4GRF A;  1JZO A;  2K9F A;  3QD9 A;  1BQ7 A;  1XWB A;  1TDI A;  1V98 A;  2E7P A;  1JZD A;  3K8N A;  1TTZ A;  3ZLP A;  1GUH A;  2K8S A;  5B6N A;  4OCE A;  2LRT A;  1TRW A;  2G0F A;  2H70 A;  1TW9 A;  2IPA A;  3RAZ A;  1AW9 A;  3ZFB A;  2H0H A;  1ERT A;  2OKA A;  1AUC A;  3LYP A;  4MMM A;  4L5L A;  4DEJ A;  3GUR A;  2L4C A;  2LTK A;  3L9V A;  3D6I A;  2DBC A;  4CDO A;  4KDX A;  4X43 A;  1SKR B;  1VF2 A;  1O85 A;  3KIJ A;  4N10 A;  5GZZ B;  4KCA A;  4V1A p;  3S9F A;  2LQQ A;  1ERV A;  2CQ9 A;  2VCT A;  3VWX A;  5KEJ A;  4KAE A;  3J7Y b;  2JSZ A;  5KN2 A;  4KB3 A;  3G7Y A;  5H5Q A;  1X9M B;  5A4U A;  5F8B A;  5LCZ A;  2H30 A;  5AIS A;  2B1K A;  5FT3 A;  3H93 A;  1S3C A;  1B8X A;  2GQK A;  3PPU A;  3Q6O A;  1MDK A;  4EVM A;  3C7M A;  1ZYN A;  4ISD A;  1JLV A;  3IAM 2;  3ZVJ A;  4OFM A;  1XIY A;  1TJD A;  1V9W A;  4OD7 A;  1Q4J A;  3FR6 A;  5B8B A;  2GGT A;  4WBR D;  3FZ4 A;  2K6V A;  3W8S A;  2FCH A;  6GSX A;  3IC4 A;  5KOW A;  5ELG A;  1TU7 A;  22GS A;  5L71 A;  5CRE A;  4NAX A;  4PNG A;  3PR8 A;  1GSY A;  2VCW A;  4KX4 A;  4CY8 A;  2KHP A;  5CRH A;  4PUA A;  4HOJ A;  4MNN A;  4Z2R A;  4O32 A;  5G1L A;  4EDY A;  2X8C A;  3V1W A;  2O89 A;  4ZBB A;  3FZ9 A;  3WT2 A;  1PL1 A;  4WF4 A;  3WYW A;  1G6Y A;  1PA3 A;  3FRC A;  1OKD A;  3GX8 A;  2H1B A;  3EYT A;  4OCF A;  1M7T A;  3UIW A;  3GA4 A;  2XPE A;  2Z9S A;  5GST A;  1A8Y A;  4K7N A;  1QGV A;  3HXS A;  1PRX A;  1M2D A;  1FG4 A;  5DCG A;  2TIR A;  1WWJ A;  4K9Z A;  3MYD A;  2H6Y A;  2F8A A;  3LXT A;  4IEL A;  4MF6 A;  1OKT A;  5D9W A;  1TK8 B;  5HR2 A;  4PX1 A;  5ECR B;  1A24 A;  3TKS A;  4FIW A;  1YZX A;  2FWF A;  4YQU A;  4POM A;  5J5N A;  11GS A;  5IMZ A;  1YKA A;  1YEP A;  2NDO A;  2YWN A;  1PMT A;  3A3T A;  3UAP A;  4XCS A;  5GAP D;  3TKS E;  5C00 A;  3KH9 A;  3GKK A;  1QFN A;  3M8N A;  1RW1 A;  2C4J A;  4V2L A;  3ZIT A;  3FR3 A;  4JZQ A;  3TKP A;  3LEF A;  1X9W B;  1QUW A;  2IMK A;  2VCV A;  1O8W A;  1R7H A;  3UEM A;  4F9Z A;  2VCZ A;  1GL8 A;  2X8H A;  4XS1 A;  5E59 A;  2K18 A;  2OBK A;  1TRV A;  2B7J A;  2DJJ A;  2LKU A;  1RQM A;  4KND A;  5BMU A;  4AJ6 A;  2EIR A;  4CY6 A;  1FAA A;  2CX4 A;  3P2A A;  1T4Y A;  5BRT A;  3NIV A;  3GL3 A;  1YEX A;  4MLY A;  2JZS A;  3TCO A;  1T00 A;  2REM A;  1X5E A;  1A0R P;  3DYR A;  4EL1 A;  3IHQ A;  1PN0 A;  2P5R A;  4Q5F A;  5JCW A;  1WRY A;  1BX9 A;  1GWC A;  1YF1 A;  4ZL7 A;  2OBI A;  2X8G A;  1GRX A;  3EUR A;  3MAK A;  2H76 A;  1RK4 A;  1GLP A;  2VCQ A;  1YQ1 A;  3EPT A;  5ECS A;  4PTS A;  1O7U A;  4KF9 A;  4JR6 A;  1PGT A;  1WP0 A;  5G5F A;  1SYR A;  4KGI A;  3EU3 A;  1SJ6 A;  5DAL A;  1XBS A;  1T4Z A;  5JWQ B;  5ECI B;  1Z6M A;  5D9T A;  4GST A;  4ML6 A;  5CNW A;  4IKH A;  3TB2 A;  1N8J A;  4P3Y B;  1ACV A;  2CAI A;  3ZRE A;  5G2Z A;  2C8U A;  2GDR A;  1KBN A;  3IK9 A;  2YJ7 A;  2RUE A;  4G2E A;  3M0F A;  3E3E A;  4IW9 A;  5HQP A;  2H6Z A;  3HJM A;  3APS A;  5FHI A;  1ZCP A;  2GT5 A;  1VF4 A;  4EO3 A;  2HSM A;  4K5S A;  5G31 A;  3M3M A;  1R5P A;  4ACS A;  1V58 A;  2ALB A;  4O5R A;  2GVP A;  1ABA A;  5CRD A;  3MSZ A;  3QAW A;  4IGJ A;  4MP4 A;  2GSR A;  2CVK A;  2HZE A;  5INY A;  1V2A A;  3ZVJ D;  3A5W A;  4I97 A;  3IHG A;  5D9V A;  1HNC A;  3LGC A;  3IPZ A;  4ZBA A;  3ZIV A;  1M9A A;  4HS1 A;  2HLS A;  1DUG A;  5IO0 A;  3L0H A;  2C0F A;  1K0A A;  4MCU A;  2QC7 A;  1A2M A;  1SL0 B;  2FWG A;  5IM9 A;  2H8L A;  4K1F A;  1K3Y A;  1AIU A;  4HQS A;  5IPH A;  3IE3 A;  1GSD A;  1WPI A;  2PN8 A;  3O76 A;  3RPN A;  3UOM A;  2C0G A;  2L59 A;  5IPG A;  1PL2 A;  3H8Q A;  5CO3 A;  1FOV A;  4MF5 A;  1TK0 B;  2CA8 A;  3QOU A;  3ZTL A;  2HSY A;  1XOB A;  4KCE A;  5J4U A;  1TI3 A;  3IV4 A;  2AB6 A;  2VAF A;  5CYY A;  5C04 A;  2J9H A;  2B5X A;  1QK8 A;  3GN3 A;  3LXZ A;  5KN3 A;  1GP1 A;  3D22 A;  2D2Z A;  2VIM A;  2RLI A;  3M9J A;  3PGT A;  4K7I A;  2MBS A;  3VPQ A;  2IL3 A;  2YZU A;  1T1V A;  1EV4 A;  1OE7 A;  2VLU A;  5F07 A;  4I6X A;  5DDL A;  3FYG A;  4LA1 A;  1XWG A;  2YJH A;  2I4A A;  3F4S A;  3FW2 A;  2WDU A;  2LRC A;  2JZT A;  4CHS A;  3I6A A;  4TR4 A;  2KP2 A;  2CZ2 A;  1EEM A;  5DJL A;  1GTB A;  2H1G A;  3BJ5 A;  4RUV A;  4TKY A;  2ON5 A;  1GSS A;  3IAS 2;  4PNF A;  2FNO A;  1W4V A;  4KUN A;  2N5A A;  1GTA A;  4H86 A;  5ECO B;  2FY6 A;  2R6K A;  3MIX A;  4NXI A;  2X49 A;  1A2J A;  2P5Q A;  3F6F A;  3FEU A;  3IDV A;  1FW1 A;  3NOF A;  1B9Y C;  4X4J A;  1F2E A;  1BG5 A;  2BTO T;  4NWY A;  5G30 A;  3RHB A;  2FWH A;  3D21 A;  1G7O A;  20GS A;  2LNT A;  4DSR A;  5IMD A;  1Y25 A;  4LL4 B;  1B9X C;  4V1A g;  2QA1 A;  4WET A;  4MZW A;  1R4W A;  2JSY A;  1V40 A;  1K0C A;  3DIE A;  4ID0 A;  3CSJ A;  3N5O A;  6GSU A;  3APO A;  3UMA A;  1XW5 A;  5A4V A;  3C1R A;  1AQV A;  1GNW A;  2L6D A;  3ME7 A;  1OAZ A;  1YF0 A;  1K3L A;  3DEX A;  2YCD A;  2WFC A;  3EU4 A;  1YY7 A;  2J23 A;  5J3R A;  2M80 A;  3G7I A;  3LOR A;  2YPM A;  1EV9 A;  1I5G A;  2PPT A;  3DML A;  3A2X A;  3IBH A;  4E8H A;  4G0L A;  1JZW A;  1SKS B;  1PN9 A;  1CQH A;  2PU9 C;  2LNS A;  3LYK A;  1BAY A;  4HU7 A;  3R2Q A;  3R3E A;  1SYX A;  2F51 A;  4PXO A;  1YDK A;  4YQM A;  2LJK A;  2B3S A;  4KH7 A;  2MMO A;  2AV4 A;  1H75 A;  3GX0 A;  2LV3 A;  3KTL A;  1TOF A;  2AHE A;  1EP7 A;  1BED A;  3IC8 A;  2JU5 A;  4ILF A;  5JCG A;  1A0F A;  4PUR A;  2B1L A;  1MEK A;  4GLT A;  5CP1 A;  2F8F A;  4OFT A;  4MPF A;  1U87 A;  3UAR A;  1R26 A;  2GSQ A;  2V32 A;  6GSY A;  4MK3 A;  3DXB A;  2V2G A;  2QSI A;  4ECI A;  2P31 A;  4WR5 A;  3US3 A;  4HI7 A;  3GNJ A;  5CRW A;  2A2S A;  1XWA A;  1AAZ A;  1GSU A;  3GYK A;  4KDY A;  1A2L A;  3JCM L;  1S3D A;  1B4Q A;  2WB9 A;  4RQX A;  3KM6 A;  4FH8 A;  1HQO A;  2GLR A;  4KE3 A;  4RI6 A;  2KLX A;  1FHE A;  1VF3 A;  4EIQ A;  5ENU A;  4BL7 B;  3LSZ A;  1XW6 A;  4ZB8 A;  1HNB A;  2MZC A;  4LL1 B;  4V2N A;  3BCI A;  2XHF A;  3H79 A;  3IOS A;  4O92 A;  2DC5 A;  1KEB A;  2GST A;  2CZ3 A;  2AUV A;  1O81 A;  1MDJ A;  3LWA A;  5ECP B;  5D96 A;  4G10 A;  3VUR A;  3KJY A;  4ICY A;  3PIN A;  2VM2 A;  1TXX A;  2QGV A;  4TOP A;  3RDW A;  2A4H A;  3D4M A;  3TRX A;  2B5E A;  1Z7R A;  2IMF A;  3F4T A;  1GNE A;  4HJ2 A;  2VM1 A;  3FZ5 A;  4X1U A;  2VL3 A;  3WGE A;  3A2W A;  2H73 A;  4PQH A;  4NHZ A;  4OMV A;  1SEN A;  1TU8 A;  4HU9 A;  1XOA A;  3I69 A;  3BBY A;  3FHK A;  2VL2 A;  1ZYE A;  2LEG A;  3HHV A;  5B6M A;  3J7Y k;  1B48 A;  4KDU A;  4TN8 A;  2IWT A;  5DVB A;  2PMT A;  3G9B A;  3QR6 A;  3EVI A;  2CAQ A;  2DJK A;  2QKE A;  3UL3 A;  2OJL A;  3ERF A;  1FB6 A;  3KMO A;  2HFD A;  1UC7 A;  3SWL A;  3CSI A;  2PWJ A;  1NHO A;  4MZC A;  3TJK A;  4HZ4 A;  2YN1 A;  4GQC A;  5D73 A;  3RHC A;  1NHY A;  4G19 A;  5FWG A;  3ERG A;  4TRX A;  4TR0 A;  5ID2 B;  4Q5Q A;  1ZL9 A;  1YJ6 A;  4Z2T A;  3F8U A;  1ERU A;  3WGX A;  4GWR A;  1SD9 A;  2PGT A;  3GIX A;  3O3T A;  2C3Q A;  3L4N A;  4XTS A;  1U88 A;  3P7X A;  2MBT A;  1EZK A;  1XWK A;  2HNL A;  4BVY B;  4GXZ A;  5IQY A;  3G7J A;  4BVX B;  2ZUP A;  1HNA A;  1F37 A;  2VL2 C;  4ZIL A;  4EUY A;  2VD0 A;  3KTB A;  2DIY A;  3LQ7 A;  4NV2 A;  2OA7 A;  2R2J A;  4PGT A;  3TRQ A;  1OVN A;  2HRK A;  2HSH A;  3HZ8 A;  1J0F A;  1O73 A;  1HYU A;  1GTI A;  5IMF A;  3UBK A;  5E4W A;  4WKW A;  5IOX A;  3PH9 A;  2XC2 A;  2ZNM A;  2LST A;  3ZYW A;  3W6G A;  2GQL A;  3HKR A;  4KA0 A;  2YWO A;  1AQX A;  1EEJ A;  2WS2 A;  3ED3 A;  2LJR A;  1A23 A;  3CYN A;  2R0G A;  3F6D A;  3EWL A;  1EGO A;  3HYP A;  2IME A;  1K0D A;  2JAD A;  4L5O A;  1K0M A;  2YZH A;  2WZ9 A;  1EOH A;  3ZZX A;  2DLX A;  1FOH A;  3KCM A;  4AJ8 A;  2M46 A;  4KSO A;  1NW2 A;  2UZ8 A;  5AGY A;  1T8E B;  2NTO A;  3KP9 A;  4YKF A;  1SD8 A;  2PUK C;  2X64 A;  4MJB A;  4TXO A;  4WF5 A;  2R0P A;  1PKZ A;  3FMW A;  1HD2 A;  4BWS A;  4F0B A;  4HZ2 A;  3F4R A;  1SL1 B;  1FVK A;  4O5U A;  1F6M C;  1A8L A;  2HT9 A;  1ML6 A;  3HVX A;  5GSS A;  3KXO A;  4IQA A;  3ZIJ A;  2IMI A;  2MMN A;  3BD2 A;  2MMA A;  1X5D A;  4YAP A;  2L57 A;  2C3T A;  3VPT A;  5KN0 A;  2AJQ B;  5JWR B;  2RII A;  4K0N A;  4XRA A;  6GSS A;  2EIO A;  2VLV A;  3ZML A;  4TXO B;  5AIV A;  3WT1 A;  5H5R A;  3IRA A;  2FLS A;  3C73 A;  2F3M A;  3VWV A;  3KEB A;  2FHE A;  4GSN A;  4YH2 A;  1GSE A;  2O87 A;  4POB A;  2M72 A;  1DE1 A;  4ZIJ A;  5J41 A;  3QFB C;  4XRD A;  1F9M A;  4IVF A;  3DRN A;  4EKZ A;  1K0N A;  1C72 A;  1LU4 A;  4MPG A;  1V57 A;  4NV5 A;  1OC3 A;  2YNX A;  4NPB A;  3HA9 A;  2H1D A;  4MZB A;  2R0C A;  2XPD A;  4YKG A;  3UBL A;  3KMN A;  2EC4 A;  1MD3 A;  3D5J A;  4MF7 A;  4TW5 A;  3VWU A;  4G9H A;  1OE8 A;  3DVX A;  5DQS A;  3RPP A;  3F63 A;  4JBB A;  4DSS A;  4ECJ A;  4J2F A;  2H0G A;  3H4K A;  4LMV A;  2A4V A;  2JL4 A;  2A2P A;  1AXD A;  2CT6 A;  2O7K A;  4JRR A;  5IOW A;  4USS A;  3GUS A;  1PKW A;  3GTU A;  1PSQ A;  5ECH B;  1XWC A;  3TJB A;  3Q74 A;  1E6B A;  4ZXG A;  1SU9 A;  1GH2 A;  3KGK A;  1TRS A;  4GCI A;  5IMA A;  1M9B A;  1SKW B;  2C0D A;  1GSQ A;  1JHB A;  2GQM A;  4DSS B;  3BCK A;  3Q19 A;  1DSB A;  2P0G A;  4MJA A;  1BYE A;  1E2Y A;  1ON4 A;  3HCZ A;  3WGD A;  2L4Q A;  1B4P A;  3LG6 A;  5A5K A;  5JCU A;  2NBS A;  4F82 A;  5F06 A;  2FD3 A;  4XS6 A;  3GTU B;  4IP1 A;  1XPV A;  5G5E A;  3GH6 A;  4WEY A;  3DWV A;  4OWY A;  2FA8 A;  5CAX A;  1EP8 A;  2CVD A;  4Z2U A;  1THX A;  4PQ1 A;  2H0I A;  2IN3 A;  2MMZ A;  4ECB A;  3TDG A;  2V6K A;  1SK2 A;  1Q98 A;  4MJC A;  1USB A;  3QFA C;  3KH7 A;  1K0B A;  2ZCT A;  1WE0 A;  1Z9H A;  5D93 A;  2DKH A;  1TK5 B;  1QQ2 A;  2KUC A;  3CMI A;  4MJE A;  2DIZ A;  2L5O A;  2B7K A;  12GS A;  3U5R E;  3EE2 A;  3TJF A;  5DAK B;  4BA7 A;  5F0G A;  4QL9 A;  1SK1 A;  4PUF C;  2VCX A;  1VRS D;  4IJ3 A;  2R3X A;  5ECQ B;  3TOT A;  1GUM A;  1M2A A;  1TI1 A;  5ECN B;  3F9U A;  3LW9 A;  5G1K A;  2IMD A;  5IIZ A;  1BJX A;  3MDK A;  3VWW A;  3HVV A;  3ME8 A;  2OE1 A;  2V1M A;  1K3O A;  3A5I A;  4IN0 A;  1WMJ A;  2A2R A;  4ZB6 A;  4ZL8 A;  4OFN A;  3GKN A;  4QL7 A;  2FWE A;  3CSH A;  1IYH A;  1SJZ A;  5COH A;  4L0W A;  3L9S A;  2OAD A;  4J56 E;  2H72 A;  1S3A A;  3D4T A;  3C71 A;  2X4A A;  1FB0 A;  1NM3 A;  3FZA A;  4L8E A;  2VOC A;  1G0T A;  2BJX A;  3AY8 A;  1F3B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...