5HFGA

Cytosolic disulfide reductase dsbm from pseudomonas aeruginosa
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
211
structure length
205
Chain Sequence
LTLHYLYDPLCGWCYGASPLLAAACEVTGLDVRLHGGGMMTQPVGLRHYVMPHDLRIAQLTGQPFGKDYFDGLLRDTSAVFDSAPPTAAVLAAEALDGLGAAMLARIQRAHYVEGRRIAERPVLLELGAELGLGEGFAEAFDACSGEPLRAHFADSRRLMNRLGAAGFPTFALERDGRLQVLDTGRYLGQPDDWRAFLETQLRLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein, cytosolic disulfide reductase DsbM
publication title Crystal structures of the disulfide reductase DsbM from Pseudomonas aeruginosa
pubmed doi rcsb
source organism Pseudomonas aeruginosa pao1
molecule tags Oxidoreductase
total genus 73
structure length 205
sequence length 211
ec nomenclature
pdb deposition date 2016-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01323 DSBA DSBA-like thioredoxin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5hfgA00
3QR6A 3GV1A 1J9BA 3M3MA 2L5LA 3TJFA 5H5SA 2EIRA 2NVLA 2H74A 1XVWA 4MZBA 1HNAA 1GSEA 1JLWA 1HYUA 4MLYA 1TU7A 1AQVA 2PVQA 1XOAA 1F6MC 4KCAA 5CRGA 1T1VA 2E7PA 1MEKA 3KTBA 3CSJA 1ERUA 4IJIA 2ALBA 3DYRA 2KHPA 3QCPA 1X5CA 5HR3A 3WT1A 3WYWA 10GSA 5B8AA 2X8GA 4ID0A 3FEUA 4FH8A 2OA7A 4MA9A 2B5XA 1WRYA 4ZB8A 2LJKA 1F37A 1GTAA 3DRNA 2WB9A 4K7IA 4G19A 2CZ2A 2JZTA 3EU4A 1W4VA 5H5RA 5CYYA 2I3YA 1O8WA 5E59A 4KSMA 5GSSA 4KDUA 2L4CA 2FY6A 1Y25A 4WETA 2O7KA 1KTEA 4OCEA 1IYIA 5F07A 2CVBA 4K0GA 1R26A 1K3YA 2H1DA 4YQUA 5B8BA 1USBA 4O92A 5DCHA 1GSFA 3ZMLA 2A4VA 1OC8A 2GT6A 2YCDA 1R7HA 3MNGA 2LKUA 2RM5A 1HD2A 3TB2A 2VOCA 3TRPA 1T00A 3TKSC 3FZAA 4TR0A 3L9SA 5G1KA 4OD7A 5KEJA 1PX7A 3EC3A 3S9FA 1FVJA 2RLIA 3QFBC 4ECBA 2GVPA 2L59A 4O7HA 3QMXA 3IOSA 1EGRA 4KGIA 2VLVA 2DJJA 3LJRA 3C71A 2B7JA 3OR5A 1YF1A 2GTUA 1WIKA 2YANA 1SD9A 1GSUA 4MP4A 3UVTA 3GKKA 4F2IA 4ZL8A 1GSDA 4DSRA 4BA7A 1SL1B 2KLXA 5AGYA 4HEA2 2A2RA 3APOA 3IAM2 3HVVA 4L0WA 1U6TA 2YJ7A 2LEGA 4XCSA 3BD2A 1XIYA 3KXOA 1XXUA 2IMEA 5DAKA 2X8HA 4I97A 2PPTA 1VF2A 1FAAA 2P31A 3F8UA 2VL2A 1XWCA 4JE1A 1OE7A 5DQSA 2HSHA 4HQSA 3A3TA 3UBLA 2WULA 4ILFA 4ECJA 4LL4B 3EMXA 1N2AA 2XHFA 5ECPB 3HXSA 1A2LA 2HXKA 1URMA 4POMA 2FNOA 2VD1A 5CAXA 1T4YA 3ZFBA 2JU5A 1G0TA 1X5EA 1TRUA 3EU3A 5H5QA 3CXGA 5J3RA 5DAKB 2AJQB 4Q5NA 3E9JB 2L6CA 1AQXA 1K0BA 1TI3A 2OKAA 2J9HA 3G7JA 3VK9A 3U6VA 4I5QA 4TOPA 3U5RE 4IS0A 1SKRB 3IAS2 3QAGA 5JWRB 2B7KA 1UVZA 2DLXA 2HZEB 2H19A 2FCHA 3CBUA 6GSXA 5F8BA 1TRVA 3KM6A 3LG6A 2H01A 1GTIA 4ML1A 1SK0A 4TW5A 5D8IA 3ZTLA 4D73A 2MMNA 3HJMA 2PMTA 5GZZB 5AISA 2L57A 4PQHA 2GZZA 2WCIA 3HKRA 4KB3A 1TJDA 1EV4A 5ECHB 5D9VA 4V1Ap 4N10A 18GSA 2IJYA 4MPFA 2R2JA 4JU5A 3GX8A 2VAFA 3TRXA 4KAEA 3PH9A 2CV4A 3Q74A 2CX4A 3TDGA 2VCXA 1M0UA 4IGJA 5J5NA 1M99A 1EV9A 1GRXA 4D73B 1WE0A 1KEBA 3HY2A 1NSWA 3F4TA 1VF4A 2I1UA 4OWYA 3VWXA 1OKDA 3RBTA 3WGXA 5ECSA 3O6TA 2H75A 4JR6A 2AHEA 5FHIA 4XS6A 3QFAC 3W6GA 3GKNA 1SYRA 1ABAA 5COHA 2QC7A 3CTFA 2AV4A 5ID2A 5GSTA 20GSA 2XC2A 2KP2A 2H6XA 1T3BA 1F9MA 3A2WA 4KE3A 1BQ7A 3TKRA 1G7OA 1EOGA 1UN2A 3LORA 4OCFA 2GQMA 5G30A 3M9KA 5GAND 4POLA 4IKHA 3F4SA 4WF4A 4PQ1A 3AY8A 3ZYWA 3VURA 1ZYQB 1OC9A 1PRXA 2VL9A 2MYGA 3GL3A 1DE1A 1U87A 2FLSA 3D0ZA 5D9TA 2WFCA 3ZITA 3IA1A 3KP8A 3FYGA 4F82A 1QMVA 4PQIA 2MMAA 4EO3A 3CSHA 4MJBA 1BX9A 3DGQA 5ID2B 5G1LA 3D4MA 2RIIA 4EKZA 4ZIJA 3P2AA 4NAXA 3VPQA 3TGZA 1GNEA 3FR6A 2O85A 1AAZA 4YAVA 5EL8A 2OBIA 3APQA 5DCGA 4MJCA 4Q5RA 2EC4A 2H0HA 16GSA 4ECCA 4RUVA 5A4VA 5D9WA 2LUSA 3C1RA 2HZFA 3IK9A 1K0NA 1QUWA 2IMKA 4NV5A 2CVKA 2MBTA 5G5FA 2HFDA 2PGTA 1I5GA 3CRTA 3KMNA 2I9HA 4OFNA 1GP1A 5IIZA 1F2EA 5HQPA 2ZNMA 1OC3A 1SENA 3BOAA 4ZL7A 1EWXA 3H93A 4GWRA 2HRNA 2VM2A 2L6DA 3D4TA 4POKA 3HA9A 3I9V2 2KP1A 1PD21 4RQXA 4MPGA 1PL2A 2FWEA 1ZCPA 1TTZA 2REMA 4EUYA 5CRWA 1KBNA 1Q4JA 1XW5A 1KNGA 4QL9A 2H72A 4IW9A 3KZQA 4TR4A 4CDOA 1VGLA 5B7CA 2ES7A 2L4QA 3RPNA 4FYUA 1U3IA 3F6FA 1TP9A 2HYXA 5IO2A 2V6KA 1V2AA 1QFNA 2FHEA 1SD8A 3M9JA 1Y6EA 1ML6A 1JLVA 4L0UA 4BVYA 1Z7RA 1RK4A 1JZOA 5E4WA 4J2FA 5CO3A 1TOFA 4G2EA 1V57A 4WR4A 5A5KA 17GSA 3QPMA 4IELA 2DIZA 5IMZA 1JZDA 2M46A 3C73A 3TRQA 4KNDA 1ZL9A 2XPDA 2JSYA 4BVXA 1H4OA 5KN1A 2N5FA 1AW9A 3FZ4A 2B5YA 3RDWA 3QOUA 2GSSA 5KN2A 1XCCA 2LJAA 1B4PA 1HQOA 2GLRA 1TU8A 4WR5A 1E2YA 2GZYA 2CA8A 6GSWA 1GSQA 2K18A 5C04A 1QK8A 1QXHA 2WGRA 5ELGA 1X5DA 2DBCA 5G31A 5JCWA 1ON4A 1PGTA 2H6ZA 2X64A 1MDIA 4NHWA 3FHKA 4WBRD 4I8BA 3GRXA 2MZCA 3IC4A 3I69A 4KUNA 4XIHA 1OE8A 4AGSA 2DSAA 2BJXA 1V40A 4MJAA 2H1BA 4CW9A 4HZ4A 2C3TA 3LWAA 1EEMA 2A2SA 3QDNA 1XW6A 2DMLA 3KEBA 1AXDA 3MAKA 3TKSE 2K8SA 1PL1A 2HLSA 3HVXA 1OVNA 3DKSA 5ELAA 5AIXA 2FWGA 3TOTA 2DJ1A 3GMFA 5B6NA 2VL2C 1I9DA 5INYA 1R5AA 1SJIA 4KW6A 1A0RP 2EIQA 4IP6A 3GKXA 4BWSA 2LTKA 5G5EA 3TJGA 1X9SB 3L0HA 4GQFA 1B9YC 2DJ3A 4XS1A 2F9SA 1YZXA 2YP6A 2LJRA 5HR1A 2IPAA 2VLUA 2B5EA 4TXOA 2BTOT 3LQ7A 1LU4A 3L9UA 1ST9A 5IQYA 2N5BA 3RPPA 2MBSA 5ENUA 1QQ2A 2IFQA 1BYEA 3LEFA 5LD0A 3HJOA 2AUVA 2LQQA 2V6OA 1WOUA 2HT9A 4XRDA 2I81A 4N30A 2YV9A 1SKSB 4F0CA 1Z3EA 2P5RA 4AJ8A 4ECIA 3DIEA 1XWKA 3LGCA 4CHSA 3KMOA 2AB6A 5J9CA 3ED3A 4TXOB 4EL1A 3VPTA 4IVFA 1B4QA 2YWMA 3D6IA 2H73A 5GAPD 1O7UA 1X0RA 4X43A 1ERTA 3GUSA 1M2AA 2GS3A 4ZBAA 3ZVJA 2KUCA 2EIOA 2IFQB 2PU9C 2OADA 2HZEA 3GFKA 5IOWA 4WF5A 12GSA 3VI5A 2R6KA 2CVDA 4BWQA 2X8CA 4TN8A 3QD9A 3ZFLA 4PNGA 4NMUA 4GLTA 5JWOB 3ZREA 2LS5A 1K0DA 4G10A 4EDZA 2V32A 6GSTA 4K7OA 4NWYA 3F0IA 4GRFA 1NM3A 3Q19A 2GSQA 3IDVA 3KGKA 4HJMA 2YWNA 5HFKA 4EVMA 1FG4A 2QKEA 3ME7A 19GSA 2H8LA 3F6DA 4HU7A 4WEYA 3H4KA 3ZMKA 4DEJA 3UEMA 3Q18A 1K0MA 3M1GA 2H66A 4ZB9A 1MDJA 4I2TA 1ILOA 1XFLA 1S3AA 1GSYA 3SWLA 1O6JA 3IR4A 2H71A 2RM6A 3TJKA 4H86A 3EINA 5HFGA 4DSQA 3GURA 5J9BA 4KH7A 5CREA 2CZ3A 4GCIA 1ZYEA 4KSOA 2FUG2 2PUKC 5F0GA 3V1WA 2CAIA 1O85A 1XWBA 2PERA 4V2NA 4BL7A 3CSIA 2E0QA 22GSA 1G6YA 3IHQA 4MH2A 4YQMA 1SK1A 1EZKA 4I2UA 4DSSB 2V1MA 1M2BA 2F3MA 4G9HA 1K0AA 3FZ9A 4ZBBA 4X1UA 1GLQA 3GA4A 2B1KA 3MWHA 2O87A 3F4RA 4J56E 5DJLA 2ON5A 1TRSA 4PURA 2E2MA 5DQYA 3Q6OA 2GSTA 1H75A 1WWJA 2LRCA 2BMXA 3KIJA 2TRXA 2FGXA 3EURA 3W8JA 4MCUA 3UARA 3MSZA 3DEXA 5JCUA 4MMMA 3ERGA 4EF0A 3N9JA 1R5PA 4MF5A 1SYXA 4NHZA 3HDCA 1GTUA 3K8NA 1TW9A 4LL1B 4ISDA 1LJRA 3PGTA 1TKDB 2WDUA 2IWTA 1PKZA 3IPZA 2GQLA 1Z6MA 3GKMA 3CTGA 2B1LA 3M8NA 1FVKA 4V1Ag 3L9VA 1U3AA 2K8VA 1J08A 1DUGA 4RI7A 1K3OA 3GSTA 2X99A 3ERFA 1A24A 1GLPA 4YQVA 1YJ6A 5IMFA 2VM1A 1IYHA 1TRWA 4PUFC 4AF2A 1EEJA 3GH6A 4LA1A 4K1FA 3GN3A 1JZWA 2C1YA 4IHUA 3KCMA 4F03A 3ISOA 4YH2A 1XW9A 1TK5B 4JZQA 1XPVA 2R5GA 3E3EA 2IMFA 3TKQA 1S3DA 3IE3A 1M9BA 2VLTA 3KD0A 5LNKe 1DBYA 1R4WA 4N0VA 5IMVA 3QAVA 4I6XA 1TK8B 4F9ZA 3SBCA 2XBQA 3LYPA 1G7EA 1HNBA 3ZVJD 3F3QA 3GSSA 3VLNA 1ZGNA 4MH3A 4LMWA 2H1GA 2GGTA 5D93A 3FW2A 1T4ZA 3UIWA 2O89A 1O8XA 3VWUA 3ME8A 3HJPA 2L5OA 2LRTA 1RQMA 2H76A 2H1AA 1N8JA 1YY7A 4IJ3A 4X0XA 2JZSA 1F3AA 4IN0A 1FW1A 3TKPA 1BG5A 3UVHA 5JCGA 2FD3A 3O76A 1YEPA 2DIYA 2VCWA 3H8QA 1SJ6A 4BPYA 4GSTA 1NW2A 1YF0A 2C8UA 2PN8A 1AQWA 3FY7A 1SK2A 3FR3A 1RW1A 2E2GA 2GZPA 4HI7A 3H79A 4MJEA 5L71A 3D21A 1PN9A 1TDIA 3VFIA 2Z9SA 4L8EA 3UJ1A 5HR2A 2C3NA 1U88A 5DDLA 5JWQB 2VCTA 3ZRDA 2B6MA 4KDYA 1THOA 4K7NA 5ABRA 4KA0A 4XHMA 1EGOA 4XTSA 2FWFA 4WXTA 3BJ5A 5EY6A 2IN3A 5DALB 5J4UA 4AJ7A 4ZL9A 1V9WA 1YEXA 1PMTA 2JL4A 1A2JA 2M80A 2H6YA 1TI1A 2HNLA 1K3LA 4LMVA 4K2DA 1OAZA 3O3TA 3D22A 3UBKA 4V2MA 3RHBA 1DE2A 2C0FA 2OBKA 4OFTA 1DSBA 1Q98A 5ECRB 2LRNA 1BEDA 1JFUA 4HU9A 5IM9A 4O5RA 4E8EA 2P5QA 4N0ZA 4XRAA 3RAZA 3IBHA 2WZ9A 1B8XA 4P3YB 2AYTA 4K0NA 1A0FA 5DBQA 3UMAA 5DJMA 3HYPA 3LXTA 3H1NA 4NPBA 3ZL5A 2VO4A 9GSSA 1XZOA 1VF1A 4ULXA 3DD3A 1CQHA 2YOIA 5ECKB 3GTUA 5A4WA 2R37A 5FT3A 3KTLA 2FWHA 2IMDA 1YQ1A 4XS4B 1GSSA 3GH9A 3VI7A 2F8FA 3CRUA 3NOFA 3F63A 5HFIA 3A5WA 2GQKA 4HUAA 5DVBA 3FKFA 3DWVA 4EXJA 4FIWA 3US3A 3BCIA 4Z7XA 1ZOFA 2LNSA 3FK8A 2VIMA 4L5OA 1GUMA 3GTUB 1FB0A 3C1SA 3PINA 1ERWA 5D73A 4K6XA 3GIXA 4PX1A 4PUAA 2VD0A 2TIRA 4F0BA 1GL8A 3R2QA 4NXIA 1PSQA 3HHVA 4TKYA 3FZ5A 4GTUA 3UL3A 1SU9A 4K8MA 7GSSA 2CT6A 1SKWB 1ZMAA 1YDKA 2YN1A 2P0GA 1AC1A 4YAPA 3VWWA 1J0FA 2WRTA 2IL3A 4ZILA 1FOVA 2YZHA 4TVEA 3WGDA 2FA4A 1JZRA 4GQCA 1XWAA 2LSTA 2GT5A 3GHAA 2YV7A 5CP1A 2HI7A 2LNTA 2DMMA 5F05A 1ZZYA 2C0GA 4KDXA 5EPFA 4KCEA 2C0DA 4OO4A 3UOMA 1Z9HA 4MK3A 1FO5A 1G6WA 1EP8A 3ZZXA 4TXVA 2PWJA 2H30A 2ON7A 2IMIA 4FYBA 4ML6A 1BAYA 1M7TA 4GF0A 5ECQB 2OE1A 3GX0A 3ZIJA 1TXXA 3FR9A 3QAWA 3IXRA 3EE2A 2MMZA 4ACSA 1C72A 4QL7A 2GSRA 2YPMA 1GWCA 3TJJA 4HOJA 2HE3A 1A23A 1OKTA 5IMCA 2K6VA 4PGTA 4EE0A 4QQ7A 3FRCA 3TKSA 1T8EB 3TUEA 4ZXGA 3F3RA 3A2VA 2AAWA 4K9ZA 2C80A 3WD6A 4LLRA 3TCOA 1S3CA 2YZUA 5CRDA 1WJKA 1MTCA 4DSSA 4MF7A 1A8YA 3HZ8A 3KP9A 5C00A 3ZIVA 4ZBDA 4TRXA 2N5AA 3F9UA 4WBJA 2LQOA 4Q5QA 1PQNA 3G9BA 1XWGA 4IBPA 3IRAA 3VWVA 4MF6A 1PA3A 4IQAA 5CNWA 4OO5A 1MD3A 14GSA 4Q5FA 1PX6A 2HSYA 4MABA 1WMJA 3WT2A 5AN1A 2YWOA 5CRHA 2QSIA 2DC5A 3P90A 1SJZA 3J7Yk 2C3QA 3P8WA 4TR3A 3CYNA 2H0IA 3GYKA 6GSYA 1YKAA 2WJUA 6GSUA 2V2GA 5ECIB 4HJ2A 2VCVA 1T7PB 3KH9A 2OACA 4KX4A 1X9WB 4RQRA 2IIYA 3G7YA 4FYCA 2DJ0A 2JSZA 4E8HA 3LXZA 4WKWA 3NIVA 3C7MA 2DJ2A 5IMAA 2CQ9A 3J7Yb 1Z6NA 1GULA 5ECLB 5A4UA 2VUPA 4FO5A 3NZNA 1PKWA 2M72A 1UC7A 3C8EA 4POBA 6GSSA 5HR0A 4V2LA 4JRRA 2JADA 3W8SA 2O8VB 2LV3A 2MMOA 4PNFA 1TK0B 5KN3A 4JR4A 3CMIA 2DJKA 3EVIA 1ERVA 3GL5A 3TJBA 5F06A 2RUFA 3A2XA 5IPHA 5B6MA 2CX3A 2C0EA 11GSA 1Z5YE 4GSSA 4NV2A 3EYTA 2NTOA 5IPGA 3MDKA 4J57E 2V41A 3UAPA 4HS1A 5ECNB 3JCML 1WPIA 2NBSA 3E0UA 5IO0A 2H0GA 4JBBA 1SL2B 4GXZA 2RUEA 2J23A 3DMLA 4MDCA 4DVCA 2CAQA 3PR8A 4JEDA 2D2ZA 4GSNA 2VL3A 2G2QA 3DVWA 2VCZA 1K0CA 1XBSA 2XPEA 3M0FA 3EWLA 4PXOA 1A2MA 2OE3A 1UA5A 13GSA 3BBYA 3HCZA 2PVOC 1V98A 1YKCA 1NHOA 3LYKA 2OJLA 3N5OA 3IK7A 1CQGA 1VF3A 4HZ2A 1THXA 1K0OA 5LCZA 1X9MB 2VCQA 4IQ1A 3IV4A 1OC9B 4O32A 1V58A 2ZUPA 1GUHA 3BCKA 2XBIA 3HD5A 4OFMA 2H70A 1B9XC 3TOUA 3HVSA 1E6BA 3APSA 3KH7A 4IP1A 1BJXA 2NDOA 1A8LA 3ERWA 1GTBA 2B3SA 2FA8A 2TRCP 2YWIA 2R4VA 5DALA 1MD4A 3DVXA 4EC0A 1EOHA 1O73A 1JHBA 1M2DA 1O81A 2KOKA 3LFLA 1NHYA 1W89A 2GDRA 2YNXA 1LBKA 5D96A 1VRSD 1GH2A 5IOXA 1HNCA 1XVQA 2JACA 5D9XA 5FWGA 2ZCTA 8GSSA 1AIUA 4HDEA 1F3BA 2JZRA 3GNJA 4TR1A 4EDYA 3KJYA 2G0FA 4HQZA 1ACVA 5ECOB 2HRFA 1EP7A 3EMPA 3WGEA 1FB6A 4RI6A 3P7XA 1SL0B 2OE0A 4N11A 4L5LA 1XOBA 2F51A 1M9AA 5J41A 2PBJA 2I4AA 1FHEA 2C4JA 5AIVA 3L78A 4MZCA 1GNWA 3LSZA 1QGVA 5IMDA 2R3XA 3I6AA 2QGVA 1AUCA 3RHCA 1MDKA 5EVOA 3DXBA 3I43A 4OMVA 1OYJA 2WS2A 1WP0A 3D5JA 4ZB6A 1Z7PA 3HZ4A 2YJHA 5ECMB 4TR1B 5G2ZA 3ZLPA 4MZWA 2F8AA 4AJ6A 5KN0A 1GUKA 6GSVA 4XS4A 2NPBA 3L4NA 2K9FA 1B48A 3G7IA
chains in the Genus database with same CATH superfamily
3QR6A 3GV1A 1J9BA 3M3MA 2L5LA 3TJFA 5H5SA 2EIRA 2NVLA 2H74A 1XVWA 4MZBA 1HNAA 1GSEA 1JLWA 1HYUA 4MLYA 1TU7A 1AQVA 2PVQA 1XOAA 1F6MC 4KCAA 5CRGA 1T1VA 2E7PA 1MEKA 3KTBA 3CSJA 1ERUA 4IJIA 2ALBA 3DYRA 2KHPA 3QCPA 1X5CA 5HR3A 3WT1A 3WYWA 10GSA 5B8AA 2X8GA 4ID0A 3FEUA 4FH8A 2OA7A 4MA9A 2B5XA 1WRYA 4ZB8A 2LJKA 1F37A 1GTAA 3DRNA 2WB9A 4K7IA 4G19A 2CZ2A 2JZTA 3EU4A 1W4VA 5H5RA 5CYYA 2I3YA 1O8WA 5E59A 4KSMA 1FOHA 4KDUA 5GSSA 2L4CA 2FY6A 1Y25A 4WETA 2O7KA 1KTEA 4CY6A 4OCEA 1IYIA 5F07A 2CVBA 4K0GA 1R26A 1K3YA 2H1DA 4YQUA 5B8BA 1USBA 4O92A 5DCHA 1GSFA 3ZMLA 2A4VA 1OC8A 2GT6A 2YCDA 1R7HA 3MNGA 2LKUA 2RM5A 1HD2A 3TB2A 2VOCA 3TRPA 1T00A 3TKSC 3FZAA 4TR0A 3L9SA 5G1KA 4OD7A 5KEJA 1PX7A 3EC3A 4HSCX 3S9FA 1FVJA 2RLIA 3QFBC 4G0KA 4ECBA 2GVPA 2L59A 4O7HA 3QMXA 3IOSA 1EGRA 4KGIA 2VLVA 2DJJA 3LJRA 3C71A 2B7JA 3OR5A 1YF1A 2GTUA 1WIKA 2YANA 1SD9A 1GSUA 4MP4A 3UVTA 3GKKA 4F2IA 4ZL8A 1GSDA 4DSRA 4BA7A 1SL1B 2KLXA 5AGYA 4HEA2 2A2RA 3APOA 3IAM2 3HVVA 4L0WA 1U6TA 2YJ7A 2LEGA 4XCSA 3BD2A 1XIYA 2DKIA 1XXUA 3KXOA 2IMEA 5DAKA 2X8HA 4I97A 2PPTA 1VF2A 1FAAA 2P31A 3F8UA 2VL2A 1XWCA 4JE1A 1OE7A 5DQSA 2HSHA 4HQSA 3A3TA 3UBLA 2WULA 4ILFA 4ECJA 4LL4B 3EMXA 1N2AA 2XHFA 5ECPB 3HXSA 1A2LA 2HXKA 1URMA 4POMA 2FNOA 2VD1A 4KF9A 5CAXA 1T4YA 3ZFBA 2JU5A 1G0TA 1X5EA 1TRUA 3EU3A 5H5QA 3CXGA 5J3RA 5DAKB 2AJQB 4Q5NA 3E9JB 2L6CA 1AQXA 1K0BA 1TI3A 2OKAA 2J9HA 3G7JA 3VK9A 3U6VA 4I5QA 4TOPA 3U5RE 4IS0A 1SKRB 2QA1A 3IAS2 3QAGA 5JWRB 2B7KA 1UVZA 2DLXA 2HZEB 2H19A 2FCHA 3CBUA 6GSXA 5F8BA 1TRVA 3KM6A 3LG6A 2H01A 1GTIA 4ML1A 1SK0A 4TW5A 1XG8A 5D8IA 3ZTLA 4D73A 2MMNA 3HJMA 2PMTA 5GZZB 5AISA 2L57A 4PQHA 2GZZA 2WCIA 3HKRA 4KB3A 1TJDA 1EV4A 5ECHB 5D9VA 4V1Ap 4N10A 18GSA 4O5QA 2IJYA 4MPFA 2DKHA 2R2JA 4JU5A 3GX8A 2VAFA 1M3IA 4KAEA 3TRXA 3PH9A 2CV4A 4O5UA 3Q74A 2CX4A 3TDGA 2VCXA 1M0UA 4IGJA 5J5NA 1M99A 1EV9A 1GRXA 4K5SA 4D73B 1WE0A 1KEBA 3HY2A 1NSWA 3F4TA 1VF4A 2I1UA 4OWYA 3VWXA 4BL7B 1OKDA 3RBTA 3WGXA 5ECSA 3O6TA 2H75A 4JR6A 2AHEA 5FHIA 4XS6A 3QFAC 3W6GA 3GKNA 1SYRA 1ABAA 5COHA 2QC7A 3CTFA 4USSA 2AV4A 5ID2A 5GSTA 20GSA 2XC2A 2KP2A 2H6XA 1T3BA 1F9MA 3A2WA 4KE3A 1BQ7A 3TKRA 1G7OA 1EOGA 1UN2A 2R0CA 3LORA 4OCFA 2GQMA 5G30A 3M9KA 5GAND 4POLA 4IKHA 3F4SA 4WF4A 4PQ1A 3AY8A 3ZYWA 3VURA 1ZYQB 1OC9A 1PRXA 2VL9A 2MYGA 3GL3A 1DE1A 1U87A 2FLSA 3D0ZA 5D9TA 2WFCA 3ZITA 3IA1A 3KP8A 3FYGA 4F82A 1QMVA 5BMUA 4PQIA 2MMAA 4EO3A 3CSHA 4MJBA 1BX9A 3DGQA 5ID2B 5G1LA 3D4MA 2RIIA 4A5PA 4EKZA 4ZIJA 3P2AA 4NAXA 3VPQA 3TGZA 1GNEA 3FR6A 2O85A 1AAZA 4YAVA 5EL8A 4YKFA 3APQA 2OBIA 5DCGA 4MJCA 4Q5RA 2EC4A 2H0HA 16GSA 4ECCA 4RUVA 5A4VA 5D9WA 4X4JA 2LUSA 3C1RA 2HZFA 3IK9A 1K0NA 1QUWA 2IMKA 4NV5A 2CVKA 2MBTA 5G5FA 2HFDA 2PGTA 1I5GA 3CRTA 3KMNA 2I9HA 4OFNA 1GP1A 5IIZA 1F2EA 5HQPA 2ZNMA 1OC3A 1SENA 3BOAA 4ZL7A 1EWXA 3H93A 4GWRA 2HRNA 2VM2A 2L6DA 3D4TA 4POKA 3HA9A 3I9V2 2KP1A 1PD21 4RQXA 4MPGA 1PL2A 2FWEA 1ZCPA 1TTZA 2REMA 4EUYA 5CRWA 1KBNA 1Q4JA 1XW5A 1KNGA 4QL9A 2H72A 4IW9A 3KZQA 4TR4A 4CDOA 1VGLA 5B7CA 2ES7A 2L4QA 3RPNA 4BIKA 4FYUA 1U3IA 3F6FA 1TP9A 2HYXA 5IO2A 3MYDA 2V6KA 1V2AA 1QFNA 2FHEA 1SD8A 3M9JA 1Y6EA 1ML6A 3PPUA 1JLVA 4L0UA 4BVYA 1Z7RA 1RK4A 1JZOA 5E4WA 4J2FA 5CO3A 1TOFA 4G2EA 1V57A 4WR4A 5A5KA 17GSA 3QPMA 4IELA 4PTSA 1ZYPA 2DIZA 5IMZA 2X4AA 1JZDA 2M46A 3C73A 2X49A 3TRQA 4KNDA 1ZL9A 2XPDA 2JSYA 4BVXA 1H4OA 5KN1A 2N5FA 1AW9A 3FZ4A 2B5YA 3RDWA 3QOUA 3EPTA 2GSSA 5KN2A 1XCCA 4BVYB 2LJAA 1B4PA 1HQOA 2GLRA 1TU8A 4WR5A 1E2YA 2GZYA 2CA8A 6GSWA 1GSQA 2K18A 5C04A 1QK8A 1QXHA 2WGRA 5ELGA 1X5DA 2DBCA 5G31A 5JCWA 1ON4A 1PGTA 2H6ZA 2X64A 1MDIA 4NHWA 3FHKA 4WBRD 4I8BA 3GRXA 2MZCA 4BVXB 3IC4A 4Z2RA 3I69A 4KUNA 4XIHA 1OE8A 4AGSA 2DSAA 2BJXA 1V40A 4MJAA 2H1BA 4CW9A 4HZ4A 2C3TA 3LWAA 1EEMA 2A2SA 3QDNA 1XW6A 2DMLA 3KEBA 1AXDA 3MAKA 3TKSE 2K8SA 1PL1A 2HLSA 3HVXA 1OVNA 3DKSA 5ELAA 5AIXA 2FWGA 3TOTA 2DJ1A 3GMFA 5B6NA 2VL2C 1I9DA 5INYA 1R5AA 1SJIA 4KW6A 1A0RP 2EIQA 4IP6A 3GKXA 1PN0A 4BWSA 2LTKA 4YKGA 5G5EA 5BRTA 3TJGA 1X9SB 3L0HA 4GQFA 1B9YC 2DJ3A 4XS1A 2F9SA 1YZXA 2YP6A 2LJRA 5HR1A 2IPAA 2VLUA 2B5EA 4TXOA 2BTOT 3LQ7A 4G0IA 1LU4A 3L9UA 5KOXA 1ST9A 5IQYA 2N5BA 3RPPA 2MBSA 5ENUA 1QQ2A 2IFQA 1BYEA 3LEFA 5LD0A 3HJOA 2AUVA 2LQQA 2V6OA 1WOUA 2HT9A 4XRDA 2I81A 4N30A 2YV9A 1SKSB 4F0CA 1Z3EA 2P5RA 4AJ8A 4ECIA 3DIEA 1XWKA 3LGCA 4CHSA 3KMOA 2AB6A 5J9CA 3ED3A 4TXOB 4FQUA 4EL1A 3VPTA 4IVFA 1B4QA 2YWMA 2A4HA 3D6IA 2H73A 5GAPD 1O7UA 1X0RA 4X43A 1ERTA 3GUSA 1M2AA 2GS3A 4ZBAA 3ZVJA 2KUCA 2EIOA 2IFQB 2PU9C 2OADA 2HZEA 3GFKA 5IOWA 4WF5A 12GSA 3VI5A 2R6KA 2CVDA 4BWQA 2X8CA 4TN8A 3QD9A 3ZFLA 4PNGA 4NMUA 4GLTA 5JWOB 5KOWA 3ZREA 2LS5A 1K0DA 4G10A 4EDZA 2V32A 6GSTA 4K7OA 4NWYA 3A5IA 3F0IA 4GRFA 1NM3A 3Q19A 2GSQA 3IDVA 3KGKA 4HJMA 2YWNA 5HFKA 4EVMA 1FG4A 2QKEA 3ME7A 19GSA 2H8LA 3F6DA 4HU7A 4WEYA 1S3RA 3H4KA 3ZMKA 4DEJA 3UEMA 3Q18A 1K0MA 3M1GA 2H66A 4ZB9A 1MDJA 4I2TA 1ILOA 1XFLA 1S3AA 1GSYA 3SWLA 1O6JA 3IR4A 2H71A 2RM6A 3FMWA 4H86A 3TJKA 3EINA 5HFGA 4DSQA 3GURA 5J9BA 4EIQA 4KH7A 5CREA 2CZ3A 4GCIA 1ZYEA 4KSOA 2FUG2 2PUKC 5F0GA 3V1WA 2CAIA 1O85A 1XWBA 2PERA 4V2NA 4BL7A 3CSIA 2E0QA 22GSA 1G6YA 3IHQA 4MH2A 4YQMA 1SK1A 1EZKA 4I2UA 4DSSB 2V1MA 1M2BA 2F3MA 4G9HA 1K0AA 3FZ9A 4ZBBA 4X1UA 1GLQA 3GA4A 2B1KA 3MWHA 4G0LA 2O87A 3F4RA 4J56E 5DJLA 2ON5A 1TRSA 4PURA 2E2MA 5DQYA 3Q6OA 2GSTA 1H75A 1WWJA 2LRCA 2BMXA 3KIJA 2TRXA 2FGXA 3EURA 3W8JA 4MCUA 3UARA 3MSZA 3DEXA 5JCUA 4MMMA 3ERGA 4EF0A 3N9JA 1R5PA 4MF5A 1SYXA 4NHZA 3HDCA 1GTUA 3K8NA 1TW9A 4LL1B 4ISDA 1LJRA 3PGTA 1TKDB 2WDUA 1PFOA 4EIPA 2IWTA 1PKZA 3IPZA 2GQLA 1Z6MA 3GKMA 3CTGA 2B1LA 3M8NA 1FVKA 4V1Ag 3L9VA 1U3AA 2K8VA 1J08A 1DUGA 4RI7A 1K3OA 3GSTA 2X99A 3ERFA 1A24A 1GLPA 4YQVA 1YJ6A 5IMFA 2VM1A 1IYHA 1TRWA 4PUFC 4AF2A 1EEJA 3GH6A 4LA1A 4K1FA 3GN3A 1JZWA 2C1YA 4IHUA 3KCMA 4F03A 3ISOA 4YH2A 1XW9A 1TK5B 4JZQA 3R3EA 1XPVA 2R5GA 3E3EA 2IMFA 3TKQA 1S3DA 3IE3A 1M9BA 2VLTA 3KD0A 5LNKe 1DBYA 1R4WA 4N0VA 5IMVA 3QAVA 3IHGA 4I6XA 1TK8B 4F9ZA 3SBCA 2XBQA 3LYPA 1G7EA 2HRAA 1HNBA 3ZVJD 3F3QA 3GSSA 3VLNA 1ZGNA 4MH3A 4LMWA 2H1GA 2GGTA 5D93A 3FW2A 1T4ZA 3UIWA 2O89A 1O8XA 3VWUA 3ME8A 3HJPA 2L5OA 2LRTA 1RQMA 2H76A 2H1AA 1N8JA 1YY7A 4IJ3A 4X0XA 2JZSA 1F3AA 4IN0A 1FW1A 3TKPA 1BG5A 3UVHA 5JCGA 2FD3A 3O76A 1YEPA 2DIYA 2VCWA 3H8QA 1SJ6A 1M3JA 4BPYA 4GSTA 1NW2A 1YF0A 2C8UA 2PN8A 1AQWA 3FY7A 1SK2A 3FR3A 1RW1A 2E2GA 2GZPA 2R0PA 4HI7A 3H79A 4MJEA 5L71A 3D21A 1PN9A 1TDIA 3VFIA 2Z9SA 4L8EA 3UJ1A 5HR2A 2C3NA 1U88A 5DDLA 5JWQB 2VCTA 3ZRDA 2B6MA 4KDYA 1THOA 4K7NA 5ABRA 4KA0A 4XHMA 1EGOA 4XTSA 2FWFA 4WXTA 3BJ5A 5EY6A 2IN3A 5DALB 5J4UA 4AJ7A 4ZL9A 1V9WA 1YEXA 1PMTA 2JL4A 1A2JA 2M80A 2H6YA 1TI1A 2HNLA 1K3LA 4LMVA 4K2DA 1OAZA 3O3TA 3D22A 3UBKA 4V2MA 3RHBA 1DE2A 2C0FA 2OBKA 4OFTA 1DSBA 1Q98A 5ECRB 2LRNA 1BEDA 1JFUA 3IC8A 4HU9A 5IM9A 4Z2TA 4O5RA 4E8EA 2P5QA 4N0ZA 4XRAA 3RAZA 3IBHA 2WZ9A 1B8XA 4P3YB 2AYTA 4K0NA 1A0FA 5DBQA 3UMAA 5DJMA 4K2XA 3HYPA 3LXTA 3H1NA 4NPBA 3ZL5A 2VO4A 9GSSA 1XZOA 1VF1A 4ULXA 3DD3A 1CQHA 2YOIA 5ECKB 4K5RA 3GTUA 5A4WA 2R37A 5FT3A 3KTLA 2FWHA 2IMDA 1YQ1A 4XS4B 1GSSA 3GH9A 3VI7A 2F8FA 2A2PA 3CRUA 3NOFA 3F63A 5HFIA 3A5WA 2GQKA 4HUAA 5DVBA 3FKFA 3DWVA 4EXJA 4FIWA 3US3A 3BCIA 4Z7XA 1ZOFA 2LNSA 3FK8A 2VIMA 4L5OA 1GUMA 3GTUB 1FB0A 3C1SA 3PINA 1ERWA 5D73A 4K6XA 3GIXA 4PX1A 4PUAA 2VD0A 2TIRA 4F0BA 1GL8A 3R2QA 4NXIA 1PSQA 3HHVA 4TKYA 3FZ5A 4GTUA 3UL3A 1SU9A 4K8MA 7GSSA 2CT6A 1SKWB 1ZMAA 1YDKA 2YN1A 2P0GA 2QA2A 1AC1A 4YAPA 3VWWA 1J0FA 2WRTA 2IL3A 4ZILA 1FOVA 2YZHA 4TVEA 3WGDA 2FA4A 1JZRA 4GQCA 1XWAA 2LSTA 2GT5A 3GHAA 2YV7A 5CP1A 2HI7A 2LNTA 2DMMA 5F05A 1ZZYA 2C0GA 4KDXA 5EPFA 4KCEA 3HVNA 2C0DA 4OO4A 3UOMA 1Z9HA 4MK3A 1FO5A 1G6WA 1EP8A 3ZZXA 4TXVA 2PWJA 2H30A 2ON7A 2IMIA 4FYBA 4ML6A 1BAYA 1M7TA 4GF0A 5ECQB 2OE1A 3GX0A 3ZIJA 1TXXA 3FR9A 4CY8A 3QAWA 3IXRA 3EE2A 2MMZA 4ACSA 1C72A 4QL7A 2GSRA 2YPMA 1GWCA 3TJJA 4HOJA 2HE3A 1A23A 1OKTA 5IMCA 2K6VA 4PGTA 4EE0A 4QQ7A 3FRCA 3TKSA 1T8EB 3TUEA 4ZXGA 3F3RA 3A2VA 2AAWA 4K9ZA 2C80A 3WD6A 4LLRA 3TCOA 1S3CA 2YZUA 5CRDA 1WJKA 1MTCA 4DSSA 4MF7A 1A8YA 3HZ8A 3KP9A 5C00A 3ZIVA 4ZBDA 4TRXA 2N5AA 3F9UA 4WBJA 2LQOA 4Q5QA 1PQNA 3G9BA 1XWGA 3MIXA 4IBPA 3IRAA 3VWVA 4MF6A 1PA3A 4IQAA 5CNWA 4OO5A 1MD3A 14GSA 4Q5FA 1PX6A 2HSYA 4MABA 1WMJA 2R0GA 3WT2A 5AN1A 2YWOA 5CRHA 2QSIA 2DC5A 3P90A 1SJZA 3J7Yk 2C3QA 3P8WA 2HRKA 4TR3A 3CYNA 2H0IA 3GYKA 6GSYA 1YKAA 2WJUA 6GSUA 2V2GA 5ECIB 4HJ2A 2VCVA 1T7PB 3KH9A 2OACA 4KX4A 1X9WB 4RQRA 2IIYA 3G7YA 4FYCA 2DJ0A 2JSZA 4E8HA 3LXZA 4WKWA 3NIVA 3C7MA 2DJ2A 5IMAA 2CQ9A 3J7Yb 1Z6NA 1GULA 5ECLB 5A4UA 2VUPA 4FO5A 3NZNA 1PKWA 2M72A 1UC7A 3C8EA 4POBA 6GSSA 5HR0A 4V2LA 4JRRA 2JADA 3W8SA 2O8VB 2LV3A 2MMOA 4PNFA 1TK0B 5KN3A 4JR4A 3CMIA 2DJKA 3EVIA 1ERVA 3GL5A 3TJBA 5F06A 2RUFA 3A2XA 5IPHA 5B6MA 2CX3A 2C0EA 11GSA 1Z5YE 4GSSA 4NV2A 3EYTA 2NTOA 5IPGA 3MDKA 4J57E 2V41A 3UAPA 4HS1A 5ECNB 3JCML 1WPIA 2NBSA 3E0UA 5IO0A 2H0GA 4JBBA 1SL2B 4Z2UA 4GXZA 2RUEA 2J23A 3DMLA 4MDCA 4DVCA 2CAQA 3PR8A 4JEDA 2D2ZA 4GSNA 2VL3A 2G2QA 3DVWA 2VCZA 1K0CA 1XBSA 4MNNA 2XPEA 3M0FA 3EWLA 4PXOA 1A2MA 2OE3A 1UA5A 13GSA 3BBYA 3HCZA 2PVOC 1V98A 1YKCA 1NHOA 3LYKA 2OJLA 3N5OA 3IK7A 1CQGA 1VF3A 4HZ2A 1THXA 1K0OA 5LCZA 1X9MB 2VCQA 4IQ1A 3IV4A 1OC9B 4O32A 1V58A 2ZUPA 1GUHA 3BCKA 2XBIA 3HD5A 4OFMA 2H70A 1B9XC 3TOUA 3HVSA 1E6BA 3APSA 3KH7A 4IP1A 1BJXA 2NDOA 1A8LA 3ERWA 1GTBA 2B3SA 2FA8A 2TRCP 2YWIA 2R4VA 5DALA 3CQFA 1MD4A 3DVXA 4EC0A 1EOHA 1O73A 1JHBA 1M2DA 1O81A 2KOKA 3LFLA 2HSMA 1NHYA 1W89A 2GDRA 2YNXA 1LBKA 1ZYNA 5D96A 1VRSD 1GH2A 5IOXA 1HNCA 1XVQA 2JACA 5D9XA 5FWGA 2ZCTA 8GSSA 1AIUA 4HDEA 1F3BA 2JZRA 3GNJA 4TR1A 4EDYA 3KJYA 2G0FA 4HQZA 1ACVA 2HRFA 5ECOB 1EP7A 3EMPA 3WGEA 1FB6A 4RI6A 3P7XA 1SL0B 2OE0A 4N11A 4ICYA 4L5LA 1XOBA 2F51A 1M9AA 5J41A 2PBJA 2I4AA 1FHEA 2C4JA 5AIVA 3L78A 4MZCA 1GNWA 3LSZA 1QGVA 5IMDA 2R3XA 3I6AA 2QGVA 1AUCA 3RHCA 1MDKA 5EVOA 3DXBA 3I43A 4OMVA 1OYJA 2WS2A 1WP0A 3D5JA 4ZB6A 1Z7PA 3HZ4A 2YJHA 5ECMB 4TR1B 5G2ZA 3ZLPA 4MZWA 2F8AA 4AJ6A 5KN0A 1GUKA 6GSVA 4XS4A 2NPBA 3L4NA 3LW9A 2K9FA 1B48A 3G7IA 2UZ8A
chains in the Genus database with same CATH topology
3QR6A 3GV1A 1J9BA 3M3MA 2L5LA 3TJFA 5H5SA 2EIRA 2NVLA 2H74A 1XVWA 4MZBA 1HNAA 1GSEA 1JLWA 1HYUA 4MLYA 1TU7A 1AQVA 2PVQA 1XOAA 1F6MC 4KCAA 5CRGA 1T1VA 2E7PA 1MEKA 3KTBA 3CSJA 1ERUA 4IJIA 2ALBA 3DYRA 2KHPA 3QCPA 1X5CA 5HR3A 3WT1A 3WYWA 10GSA 5B8AA 2X8GA 4ID0A 3FEUA 4FH8A 2OA7A 4MA9A 2B5XA 1WRYA 4ZB8A 2LJKA 1F37A 1GTAA 3DRNA 2WB9A 4K7IA 4G19A 2CZ2A 2JZTA 3EU4A 1W4VA 5H5RA 5CYYA 2I3YA 1O8WA 5E59A 4KSMA 1FOHA 4KDUA 5GSSA 2L4CA 2FY6A 1Y25A 4WETA 2O7KA 1KTEA 4CY6A 4OCEA 1IYIA 5F07A 2CVBA 4K0GA 1R26A 1K3YA 2H1DA 4YQUA 5B8BA 1USBA 4O92A 5DCHA 1GSFA 3ZMLA 2A4VA 1OC8A 2GT6A 2YCDA 1R7HA 3MNGA 2LKUA 2RM5A 1HD2A 3TB2A 2VOCA 3TRPA 1T00A 3TKSC 3FZAA 4TR0A 3L9SA 5G1KA 4OD7A 5KEJA 1PX7A 3EC3A 3S9FA 1FVJA 2RLIA 3QFBC 4G0KA 4ECBA 2GVPA 2L59A 4O7HA 3QMXA 3IOSA 1EGRA 4KGIA 2VLVA 2DJJA 3LJRA 3C71A 2B7JA 3OR5A 1YF1A 2GTUA 1WIKA 2YANA 1SD9A 1GSUA 4MP4A 3UVTA 3GKKA 4F2IA 4ZL8A 1GSDA 4DSRA 4BA7A 1SL1B 2KLXA 5AGYA 4HEA2 2A2RA 3APOA 3IAM2 3HVVA 4L0WA 1U6TA 2YJ7A 2LEGA 4XCSA 3BD2A 1XIYA 2DKIA 1XXUA 3KXOA 2IMEA 5DAKA 2X8HA 4I97A 2PPTA 1VF2A 1FAAA 2P31A 3F8UA 2VL2A 1XWCA 4JE1A 1OE7A 5DQSA 2HSHA 4HQSA 3A3TA 3UBLA 2WULA 4ILFA 4ECJA 4LL4B 3EMXA 1N2AA 2XHFA 5ECPB 3HXSA 1A2LA 2HXKA 1URMA 4POMA 2FNOA 2VD1A 4KF9A 5CAXA 1T4YA 3ZFBA 2JU5A 1G0TA 1X5EA 1TRUA 3EU3A 5H5QA 3CXGA 5J3RA 5DAKB 2AJQB 4Q5NA 3E9JB 2L6CA 1AQXA 1K0BA 1TI3A 2OKAA 2J9HA 3G7JA 3VK9A 3U6VA 4I5QA 4TOPA 3U5RE 4IS0A 1SKRB 2QA1A 3IAS2 3QAGA 5JWRB 2B7KA 1UVZA 2DLXA 2HZEB 2H19A 2FCHA 3CBUA 6GSXA 5F8BA 1TRVA 3KM6A 3LG6A 2H01A 1GTIA 4ML1A 1SK0A 4TW5A 5D8IA 3ZTLA 4D73A 2MMNA 3HJMA 2PMTA 5GZZB 5AISA 2L57A 4PQHA 2GZZA 2WCIA 3HKRA 4KB3A 1TJDA 1EV4A 5ECHB 5D9VA 4V1Ap 4N10A 18GSA 4O5QA 2IJYA 4MPFA 2DKHA 2R2JA 4JU5A 3GX8A 2VAFA 3TRXA 4KAEA 3PH9A 2CV4A 4O5UA 3Q74A 2CX4A 3TDGA 2VCXA 1M0UA 4IGJA 5J5NA 1M99A 1EV9A 1GRXA 4K5SA 4D73B 1WE0A 1KEBA 3HY2A 1NSWA 3F4TA 1VF4A 2I1UA 4OWYA 3VWXA 4BL7B 1OKDA 3RBTA 3WGXA 5ECSA 3O6TA 2H75A 4JR6A 2AHEA 5FHIA 4XS6A 3QFAC 3W6GA 3GKNA 1SYRA 1ABAA 5COHA 2QC7A 3CTFA 4USSA 2AV4A 5ID2A 5GSTA 20GSA 2XC2A 2KP2A 2H6XA 1T3BA 1F9MA 3A2WA 4KE3A 1BQ7A 3TKRA 1G7OA 1EOGA 1UN2A 2R0CA 3LORA 4OCFA 2GQMA 5G30A 3M9KA 5GAND 4POLA 4IKHA 3F4SA 4WF4A 4PQ1A 3AY8A 3ZYWA 3VURA 1ZYQB 1OC9A 1PRXA 2VL9A 2MYGA 3GL3A 1DE1A 1U87A 2FLSA 3D0ZA 5D9TA 2WFCA 3ZITA 3IA1A 3KP8A 3FYGA 4F82A 1QMVA 5BMUA 4PQIA 2MMAA 4EO3A 3CSHA 4MJBA 1BX9A 3DGQA 5ID2B 5G1LA 3D4MA 2RIIA 4A5PA 4EKZA 4ZIJA 3P2AA 4NAXA 3VPQA 3TGZA 1GNEA 3FR6A 2O85A 1AAZA 4YAVA 5EL8A 4YKFA 3APQA 2OBIA 5DCGA 4MJCA 4Q5RA 2EC4A 2H0HA 16GSA 4ECCA 4RUVA 5A4VA 5D9WA 4X4JA 2LUSA 3C1RA 2HZFA 3IK9A 1K0NA 1QUWA 2IMKA 4NV5A 2CVKA 2MBTA 5G5FA 2HFDA 2PGTA 1I5GA 3CRTA 3KMNA 2I9HA 4OFNA 1GP1A 5IIZA 1F2EA 5HQPA 2ZNMA 1OC3A 1SENA 3BOAA 4ZL7A 1EWXA 3H93A 4GWRA 2HRNA 2VM2A 2L6DA 3D4TA 4POKA 3HA9A 3I9V2 2KP1A 1PD21 4RQXA 4MPGA 1PL2A 2FWEA 1ZCPA 1TTZA 2REMA 4EUYA 5CRWA 1KBNA 1Q4JA 1XW5A 1KNGA 4QL9A 2H72A 4IW9A 3KZQA 4TR4A 4CDOA 1VGLA 5B7CA 2ES7A 2L4QA 3RPNA 4FYUA 1U3IA 3F6FA 1TP9A 2HYXA 5IO2A 3MYDA 2V6KA 1V2AA 1QFNA 2FHEA 1SD8A 3M9JA 1Y6EA 1ML6A 3PPUA 1JLVA 4L0UA 4BVYA 1Z7RA 1RK4A 1JZOA 5E4WA 4J2FA 5CO3A 1TOFA 4G2EA 1V57A 4WR4A 5A5KA 17GSA 3QPMA 4IELA 4PTSA 1ZYPA 2DIZA 5IMZA 2X4AA 1JZDA 2M46A 3C73A 2X49A 3TRQA 4KNDA 1ZL9A 2XPDA 2JSYA 4BVXA 1H4OA 5KN1A 2N5FA 1AW9A 3FZ4A 2B5YA 3RDWA 3QOUA 3EPTA 2GSSA 5KN2A 1XCCA 4BVYB 2LJAA 1B4PA 1HQOA 2GLRA 1TU8A 4WR5A 1E2YA 2GZYA 2CA8A 6GSWA 1GSQA 2K18A 5C04A 1QK8A 1QXHA 2WGRA 5ELGA 1X5DA 2DBCA 5G31A 5JCWA 1ON4A 1PGTA 2H6ZA 2X64A 1MDIA 4NHWA 3FHKA 4WBRD 4I8BA 3GRXA 2MZCA 4BVXB 3IC4A 4Z2RA 3I69A 4KUNA 4XIHA 1OE8A 4AGSA 2DSAA 2BJXA 1V40A 4MJAA 2H1BA 4CW9A 4HZ4A 2C3TA 3LWAA 1EEMA 2A2SA 3QDNA 1XW6A 2DMLA 3KEBA 1AXDA 3MAKA 3TKSE 2K8SA 1PL1A 2HLSA 3HVXA 1OVNA 3DKSA 5ELAA 5AIXA 2FWGA 3TOTA 2DJ1A 3GMFA 5B6NA 2VL2C 1I9DA 5INYA 1R5AA 1SJIA 4KW6A 1A0RP 2EIQA 4IP6A 3GKXA 1PN0A 4BWSA 2LTKA 4YKGA 5G5EA 5BRTA 3TJGA 1X9SB 3L0HA 4GQFA 1B9YC 2DJ3A 4XS1A 2F9SA 1YZXA 2YP6A 2LJRA 5HR1A 2IPAA 2VLUA 2B5EA 4TXOA 2BTOT 3LQ7A 4G0IA 1LU4A 3L9UA 5KOXA 1ST9A 5IQYA 2N5BA 3RPPA 2MBSA 5ENUA 1QQ2A 2IFQA 1BYEA 3LEFA 5LD0A 3HJOA 2AUVA 2LQQA 2V6OA 1WOUA 2HT9A 4XRDA 2I81A 4N30A 2YV9A 1SKSB 4F0CA 1Z3EA 2P5RA 4AJ8A 4ECIA 3DIEA 1XWKA 3LGCA 4CHSA 3KMOA 2AB6A 5J9CA 3ED3A 4TXOB 4FQUA 4EL1A 3VPTA 4IVFA 1B4QA 2YWMA 2A4HA 3D6IA 2H73A 5GAPD 1O7UA 1X0RA 4X43A 1ERTA 3GUSA 1M2AA 2GS3A 4ZBAA 3ZVJA 2KUCA 2EIOA 2IFQB 2PU9C 2OADA 2HZEA 3GFKA 5IOWA 4WF5A 12GSA 3VI5A 2R6KA 2CVDA 4BWQA 2X8CA 4TN8A 3QD9A 3ZFLA 4PNGA 4NMUA 4GLTA 5JWOB 5KOWA 3ZREA 2LS5A 1K0DA 4G10A 4EDZA 2V32A 6GSTA 4K7OA 4NWYA 3A5IA 3F0IA 4GRFA 1NM3A 3Q19A 2GSQA 3IDVA 3KGKA 4HJMA 2YWNA 5HFKA 4EVMA 1FG4A 2QKEA 3ME7A 19GSA 2H8LA 3F6DA 4HU7A 4WEYA 3H4KA 3ZMKA 4DEJA 3UEMA 3Q18A 1K0MA 3M1GA 2H66A 4ZB9A 1MDJA 4I2TA 1ILOA 1XFLA 1S3AA 1GSYA 3SWLA 1O6JA 3IR4A 2H71A 2RM6A 3FMWA 4H86A 3TJKA 3EINA 5HFGA 4DSQA 3GURA 5J9BA 4EIQA 4KH7A 5CREA 2CZ3A 4GCIA 1ZYEA 4KSOA 2FUG2 2PUKC 5F0GA 3V1WA 2CAIA 1O85A 1XWBA 2PERA 4V2NA 4BL7A 3CSIA 2E0QA 22GSA 1G6YA 3IHQA 4MH2A 4YQMA 1SK1A 1EZKA 4I2UA 4DSSB 2V1MA 1M2BA 2F3MA 4G9HA 1K0AA 3FZ9A 4ZBBA 4X1UA 1GLQA 3GA4A 2B1KA 3MWHA 4G0LA 2O87A 3F4RA 4J56E 5DJLA 2ON5A 1TRSA 4PURA 2E2MA 5DQYA 3Q6OA 2GSTA 1H75A 1WWJA 2LRCA 2BMXA 3KIJA 2TRXA 2FGXA 3EURA 3W8JA 4MCUA 3UARA 3MSZA 3DEXA 5JCUA 4MMMA 3ERGA 4EF0A 3N9JA 1R5PA 4MF5A 1SYXA 4NHZA 3HDCA 1GTUA 3K8NA 1TW9A 4LL1B 4ISDA 1LJRA 3PGTA 1TKDB 2WDUA 4EIPA 2IWTA 1PKZA 3IPZA 2GQLA 1Z6MA 3GKMA 3CTGA 2B1LA 3M8NA 1FVKA 4V1Ag 3L9VA 1U3AA 2K8VA 1J08A 1DUGA 4RI7A 1K3OA 3GSTA 2X99A 3ERFA 1A24A 1GLPA 4YQVA 1YJ6A 5IMFA 2VM1A 1IYHA 1TRWA 4PUFC 4AF2A 1EEJA 3GH6A 4LA1A 4K1FA 3GN3A 1JZWA 2C1YA 4IHUA 3KCMA 4F03A 3ISOA 4YH2A 1XW9A 1TK5B 4JZQA 3R3EA 1XPVA 2R5GA 3E3EA 2IMFA 3TKQA 1S3DA 3IE3A 1M9BA 2VLTA 3KD0A 5LNKe 1DBYA 1R4WA 4N0VA 5IMVA 3QAVA 3IHGA 4I6XA 1TK8B 4F9ZA 3SBCA 2XBQA 3LYPA 1G7EA 2HRAA 1HNBA 3ZVJD 3F3QA 3GSSA 3VLNA 1ZGNA 4MH3A 4LMWA 2H1GA 2GGTA 5D93A 3FW2A 1T4ZA 3UIWA 2O89A 1O8XA 3VWUA 3ME8A 3HJPA 2L5OA 2LRTA 1RQMA 2H76A 2H1AA 1N8JA 1YY7A 4IJ3A 4X0XA 2JZSA 1F3AA 4IN0A 1FW1A 3TKPA 1BG5A 3UVHA 5JCGA 2FD3A 3O76A 1YEPA 2DIYA 2VCWA 3H8QA 1SJ6A 4BPYA 4GSTA 1NW2A 1YF0A 2C8UA 2PN8A 1AQWA 3FY7A 1SK2A 3FR3A 1RW1A 2E2GA 2GZPA 2R0PA 4HI7A 3H79A 4MJEA 5L71A 3D21A 1PN9A 1TDIA 3VFIA 2Z9SA 4L8EA 3UJ1A 5HR2A 2C3NA 1U88A 5DDLA 5JWQB 2VCTA 3ZRDA 2B6MA 4KDYA 1THOA 4K7NA 5ABRA 4KA0A 4XHMA 1EGOA 4XTSA 2FWFA 4WXTA 3BJ5A 5EY6A 2IN3A 5DALB 5J4UA 4AJ7A 4ZL9A 1V9WA 1YEXA 1PMTA 2JL4A 1A2JA 2M80A 2H6YA 1TI1A 2HNLA 1K3LA 4LMVA 4K2DA 1OAZA 3O3TA 3D22A 3UBKA 4V2MA 3RHBA 1DE2A 2C0FA 2OBKA 4OFTA 1DSBA 1Q98A 5ECRB 2LRNA 1BEDA 1JFUA 3IC8A 4HU9A 5IM9A 4Z2TA 4O5RA 4E8EA 2P5QA 4N0ZA 4XRAA 3RAZA 3IBHA 2WZ9A 1B8XA 4P3YB 2AYTA 4K0NA 1A0FA 5DBQA 3UMAA 5DJMA 4K2XA 3HYPA 3LXTA 3H1NA 4NPBA 3ZL5A 2VO4A 9GSSA 1XZOA 1VF1A 4ULXA 3DD3A 1CQHA 2YOIA 5ECKB 4K5RA 3GTUA 5A4WA 2R37A 5FT3A 3KTLA 2FWHA 2IMDA 1YQ1A 4XS4B 1GSSA 3GH9A 3VI7A 2F8FA 2A2PA 3CRUA 3NOFA 3F63A 5HFIA 3A5WA 2GQKA 4HUAA 5DVBA 3FKFA 3DWVA 4EXJA 4FIWA 3US3A 3BCIA 4Z7XA 1ZOFA 2LNSA 3FK8A 2VIMA 4L5OA 1GUMA 3GTUB 1FB0A 3C1SA 3PINA 1ERWA 5D73A 4K6XA 3GIXA 4PX1A 4PUAA 2VD0A 2TIRA 4F0BA 1GL8A 3R2QA 4NXIA 1PSQA 3HHVA 4TKYA 3FZ5A 4GTUA 3UL3A 1SU9A 4K8MA 7GSSA 2CT6A 1SKWB 1ZMAA 1YDKA 2YN1A 2P0GA 2QA2A 1AC1A 4YAPA 3VWWA 1J0FA 2WRTA 2IL3A 4ZILA 1FOVA 2YZHA 4TVEA 3WGDA 2FA4A 1JZRA 4GQCA 1XWAA 2LSTA 2GT5A 3GHAA 2YV7A 5CP1A 2HI7A 2LNTA 2DMMA 5F05A 1ZZYA 2C0GA 4KDXA 5EPFA 4KCEA 2C0DA 4OO4A 3UOMA 1Z9HA 4MK3A 1FO5A 1G6WA 1EP8A 3ZZXA 4TXVA 2PWJA 2H30A 2ON7A 2IMIA 4FYBA 4ML6A 1BAYA 1M7TA 4GF0A 5ECQB 2OE1A 3GX0A 3ZIJA 1TXXA 3FR9A 4CY8A 3QAWA 3IXRA 3EE2A 2MMZA 4ACSA 1C72A 4QL7A 2GSRA 2YPMA 1GWCA 3TJJA 4HOJA 2HE3A 1A23A 1OKTA 5IMCA 2K6VA 4PGTA 4EE0A 4QQ7A 3FRCA 3TKSA 1T8EB 3TUEA 4ZXGA 3F3RA 3A2VA 2AAWA 4K9ZA 2C80A 3WD6A 4LLRA 3TCOA 1S3CA 2YZUA 5CRDA 1WJKA 1MTCA 4DSSA 4MF7A 1A8YA 3HZ8A 3KP9A 5C00A 3ZIVA 4ZBDA 4TRXA 2N5AA 3F9UA 4WBJA 2LQOA 4Q5QA 1PQNA 3G9BA 1XWGA 3MIXA 4IBPA 3IRAA 3VWVA 4MF6A 1PA3A 4IQAA 5CNWA 4OO5A 1MD3A 14GSA 4Q5FA 1PX6A 2HSYA 4MABA 1WMJA 2R0GA 3WT2A 5AN1A 2YWOA 5CRHA 2QSIA 2DC5A 3P90A 1SJZA 3J7Yk 2C3QA 3P8WA 2HRKA 4TR3A 3CYNA 2H0IA 3GYKA 6GSYA 1YKAA 2WJUA 6GSUA 2V2GA 5ECIB 4HJ2A 2VCVA 1T7PB 3KH9A 2OACA 4KX4A 1X9WB 4RQRA 2IIYA 3G7YA 4FYCA 2DJ0A 2JSZA 4E8HA 3LXZA 4WKWA 3NIVA 3C7MA 2DJ2A 5IMAA 2CQ9A 3J7Yb 1Z6NA 1GULA 5ECLB 5A4UA 2VUPA 4FO5A 3NZNA 1PKWA 2M72A 1UC7A 3C8EA 4POBA 6GSSA 5HR0A 4V2LA 4JRRA 2JADA 3W8SA 2O8VB 2LV3A 2MMOA 4PNFA 1TK0B 5KN3A 4JR4A 3CMIA 2DJKA 3EVIA 1ERVA 3GL5A 3TJBA 5F06A 2RUFA 3A2XA 5IPHA 5B6MA 2CX3A 2C0EA 11GSA 1Z5YE 4GSSA 4NV2A 3EYTA 2NTOA 5IPGA 3MDKA 4J57E 2V41A 3UAPA 4HS1A 5ECNB 3JCML 1WPIA 2NBSA 3E0UA 5IO0A 2H0GA 4JBBA 1SL2B 4Z2UA 4GXZA 2RUEA 2J23A 3DMLA 4MDCA 4DVCA 2CAQA 3PR8A 4JEDA 2D2ZA 4GSNA 2VL3A 2G2QA 3DVWA 2VCZA 1K0CA 1XBSA 4MNNA 2XPEA 3M0FA 3EWLA 4PXOA 1A2MA 2OE3A 1UA5A 13GSA 3BBYA 3HCZA 2PVOC 1V98A 1YKCA 1NHOA 3LYKA 2OJLA 3N5OA 3IK7A 1CQGA 1VF3A 4HZ2A 1THXA 1K0OA 5LCZA 1X9MB 2VCQA 4IQ1A 3IV4A 1OC9B 4O32A 1V58A 2ZUPA 1GUHA 3BCKA 2XBIA 3HD5A 4OFMA 2H70A 1B9XC 3TOUA 3HVSA 1E6BA 3APSA 3KH7A 4IP1A 1BJXA 2NDOA 1A8LA 3ERWA 1GTBA 2B3SA 2FA8A 2TRCP 2YWIA 2R4VA 5DALA 1MD4A 3DVXA 4EC0A 1EOHA 1O73A 1JHBA 1M2DA 1O81A 2KOKA 3LFLA 2HSMA 1NHYA 1W89A 2GDRA 2YNXA 1LBKA 1ZYNA 5D96A 1VRSD 1GH2A 5IOXA 1HNCA 1XVQA 2JACA 5D9XA 5FWGA 2ZCTA 8GSSA 1AIUA 4HDEA 1F3BA 2JZRA 3GNJA 4TR1A 4EDYA 3KJYA 2G0FA 4HQZA 1ACVA 2HRFA 5ECOB 1EP7A 3EMPA 3WGEA 1FB6A 4RI6A 3P7XA 1SL0B 2OE0A 4N11A 4ICYA 4L5LA 1XOBA 2F51A 1M9AA 5J41A 2PBJA 2I4AA 1FHEA 2C4JA 5AIVA 3L78A 4MZCA 1GNWA 3LSZA 1QGVA 5IMDA 2R3XA 3I6AA 2QGVA 1AUCA 3RHCA 1MDKA 5EVOA 3DXBA 3I43A 4OMVA 1OYJA 2WS2A 1WP0A 3D5JA 4ZB6A 1Z7PA 3HZ4A 2YJHA 5ECMB 4TR1B 5G2ZA 3ZLPA 4MZWA 2F8AA 4AJ6A 5KN0A 1GUKA 6GSVA 4XS4A 2NPBA 3L4NA 3LW9A 2K9FA 1B48A 3G7IA 2UZ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QR6 A;  3GV1 A;  1J9B A;  3M3M A;  2L5L A;  3TJF A;  5H5S A;  2EIR A;  2NVL A;  2H74 A;  1XVW A;  4MZB A;  1HNA A;  1GSE A;  1JLW A;  1HYU A;  4MLY A;  1TU7 A;  1AQV A;  2PVQ A;  1XOA A;  1F6M C;  4KCA A;  5CRG A;  1T1V A;  2E7P A;  1MEK A;  3KTB A;  3CSJ A;  1ERU A;  4IJI A;  2ALB A;  3DYR A;  2KHP A;  3QCP A;  1X5C A;  5HR3 A;  3WT1 A;  3WYW A;  10GS A;  5B8A A;  2X8G A;  4ID0 A;  3FEU A;  4FH8 A;  2OA7 A;  4MA9 A;  2B5X A;  1WRY A;  4ZB8 A;  2LJK A;  1F37 A;  1GTA A;  3DRN A;  2WB9 A;  4K7I A;  4G19 A;  2CZ2 A;  2JZT A;  3EU4 A;  1W4V A;  5H5R A;  5CYY A;  2I3Y A;  1O8W A;  5E59 A;  4KSM A;  5GSS A;  4KDU A;  2L4C A;  2FY6 A;  1Y25 A;  4WET A;  2O7K A;  1KTE A;  4OCE A;  1IYI A;  5F07 A;  2CVB A;  4K0G A;  1R26 A;  1K3Y A;  2H1D A;  4YQU A;  5B8B A;  1USB A;  4O92 A;  5DCH A;  1GSF A;  3ZML A;  2A4V A;  1OC8 A;  2GT6 A;  2YCD A;  1R7H A;  3MNG A;  2LKU A;  2RM5 A;  1HD2 A;  3TB2 A;  2VOC A;  3TRP A;  1T00 A;  3TKS C;  3FZA A;  4TR0 A;  3L9S A;  5G1K A;  4OD7 A;  5KEJ A;  1PX7 A;  3EC3 A;  3S9F A;  1FVJ A;  2RLI A;  3QFB C;  4ECB A;  2GVP A;  2L59 A;  4O7H A;  3QMX A;  3IOS A;  1EGR A;  4KGI A;  2VLV A;  2DJJ A;  3LJR A;  3C71 A;  2B7J A;  3OR5 A;  1YF1 A;  2GTU A;  1WIK A;  2YAN A;  1SD9 A;  1GSU A;  4MP4 A;  3UVT A;  3GKK A;  4F2I A;  4ZL8 A;  1GSD A;  4DSR A;  4BA7 A;  1SL1 B;  2KLX A;  5AGY A;  4HEA 2;  2A2R A;  3APO A;  3IAM 2;  3HVV A;  4L0W A;  1U6T A;  2YJ7 A;  2LEG A;  4XCS A;  3BD2 A;  1XIY A;  3KXO A;  1XXU A;  2IME A;  5DAK A;  2X8H A;  4I97 A;  2PPT A;  1VF2 A;  1FAA A;  2P31 A;  3F8U A;  2VL2 A;  1XWC A;  4JE1 A;  1OE7 A;  5DQS A;  2HSH A;  4HQS A;  3A3T A;  3UBL A;  2WUL A;  4ILF A;  4ECJ A;  4LL4 B;  3EMX A;  1N2A A;  2XHF A;  5ECP B;  3HXS A;  1A2L A;  2HXK A;  1URM A;  4POM A;  2FNO A;  2VD1 A;  5CAX A;  1T4Y A;  3ZFB A;  2JU5 A;  1G0T A;  1X5E A;  1TRU A;  3EU3 A;  5H5Q A;  3CXG A;  5J3R A;  5DAK B;  2AJQ B;  4Q5N A;  3E9J B;  2L6C A;  1AQX A;  1K0B A;  1TI3 A;  2OKA A;  2J9H A;  3G7J A;  3VK9 A;  3U6V A;  4I5Q A;  4TOP A;  3U5R E;  4IS0 A;  1SKR B;  3IAS 2;  3QAG A;  5JWR B;  2B7K A;  1UVZ A;  2DLX A;  2HZE B;  2H19 A;  2FCH A;  3CBU A;  6GSX A;  5F8B A;  1TRV A;  3KM6 A;  3LG6 A;  2H01 A;  1GTI A;  4ML1 A;  1SK0 A;  4TW5 A;  5D8I A;  3ZTL A;  4D73 A;  2MMN A;  3HJM A;  2PMT A;  5GZZ B;  5AIS A;  2L57 A;  4PQH A;  2GZZ A;  2WCI A;  3HKR A;  4KB3 A;  1TJD A;  1EV4 A;  5ECH B;  5D9V A;  4V1A p;  4N10 A;  18GS A;  2IJY A;  4MPF A;  2R2J A;  4JU5 A;  3GX8 A;  2VAF A;  3TRX A;  4KAE A;  3PH9 A;  2CV4 A;  3Q74 A;  2CX4 A;  3TDG A;  2VCX A;  1M0U A;  4IGJ A;  5J5N A;  1M99 A;  1EV9 A;  1GRX A;  4D73 B;  1WE0 A;  1KEB A;  3HY2 A;  1NSW A;  3F4T A;  1VF4 A;  2I1U A;  4OWY A;  3VWX A;  1OKD A;  3RBT A;  3WGX A;  5ECS A;  3O6T A;  2H75 A;  4JR6 A;  2AHE A;  5FHI A;  4XS6 A;  3QFA C;  3W6G A;  3GKN A;  1SYR A;  1ABA A;  5COH A;  2QC7 A;  3CTF A;  2AV4 A;  5ID2 A;  5GST A;  20GS A;  2XC2 A;  2KP2 A;  2H6X A;  1T3B A;  1F9M A;  3A2W A;  4KE3 A;  1BQ7 A;  3TKR A;  1G7O A;  1EOG A;  1UN2 A;  3LOR A;  4OCF A;  2GQM A;  5G30 A;  3M9K A;  5GAN D;  4POL A;  4IKH A;  3F4S A;  4WF4 A;  4PQ1 A;  3AY8 A;  3ZYW A;  3VUR A;  1ZYQ B;  1OC9 A;  1PRX A;  2VL9 A;  2MYG A;  3GL3 A;  1DE1 A;  1U87 A;  2FLS A;  3D0Z A;  5D9T A;  2WFC A;  3ZIT A;  3IA1 A;  3KP8 A;  3FYG A;  4F82 A;  1QMV A;  4PQI A;  2MMA A;  4EO3 A;  3CSH A;  4MJB A;  1BX9 A;  3DGQ A;  5ID2 B;  5G1L A;  3D4M A;  2RII A;  4EKZ A;  4ZIJ A;  3P2A A;  4NAX A;  3VPQ A;  3TGZ A;  1GNE A;  3FR6 A;  2O85 A;  1AAZ A;  4YAV A;  5EL8 A;  2OBI A;  3APQ A;  5DCG A;  4MJC A;  4Q5R A;  2EC4 A;  2H0H A;  16GS A;  4ECC A;  4RUV A;  5A4V A;  5D9W A;  2LUS A;  3C1R A;  2HZF A;  3IK9 A;  1K0N A;  1QUW A;  2IMK A;  4NV5 A;  2CVK A;  2MBT A;  5G5F A;  2HFD A;  2PGT A;  1I5G A;  3CRT A;  3KMN A;  2I9H A;  4OFN A;  1GP1 A;  5IIZ A;  1F2E A;  5HQP A;  2ZNM A;  1OC3 A;  1SEN A;  3BOA A;  4ZL7 A;  1EWX A;  3H93 A;  4GWR A;  2HRN A;  2VM2 A;  2L6D A;  3D4T A;  4POK A;  3HA9 A;  3I9V 2;  2KP1 A;  1PD2 1;  4RQX A;  4MPG A;  1PL2 A;  2FWE A;  1ZCP A;  1TTZ A;  2REM A;  4EUY A;  5CRW A;  1KBN A;  1Q4J A;  1XW5 A;  1KNG A;  4QL9 A;  2H72 A;  4IW9 A;  3KZQ A;  4TR4 A;  4CDO A;  1VGL A;  5B7C A;  2ES7 A;  2L4Q A;  3RPN A;  4FYU A;  1U3I A;  3F6F A;  1TP9 A;  2HYX A;  5IO2 A;  2V6K A;  1V2A A;  1QFN A;  2FHE A;  1SD8 A;  3M9J A;  1Y6E A;  1ML6 A;  1JLV A;  4L0U A;  4BVY A;  1Z7R A;  1RK4 A;  1JZO A;  5E4W A;  4J2F A;  5CO3 A;  1TOF A;  4G2E A;  1V57 A;  4WR4 A;  5A5K A;  17GS A;  3QPM A;  4IEL A;  2DIZ A;  5IMZ A;  1JZD A;  2M46 A;  3C73 A;  3TRQ A;  4KND A;  1ZL9 A;  2XPD A;  2JSY A;  4BVX A;  1H4O A;  5KN1 A;  2N5F A;  1AW9 A;  3FZ4 A;  2B5Y A;  3RDW A;  3QOU A;  2GSS A;  5KN2 A;  1XCC A;  2LJA A;  1B4P A;  1HQO A;  2GLR A;  1TU8 A;  4WR5 A;  1E2Y A;  2GZY A;  2CA8 A;  6GSW A;  1GSQ A;  2K18 A;  5C04 A;  1QK8 A;  1QXH A;  2WGR A;  5ELG A;  1X5D A;  2DBC A;  5G31 A;  5JCW A;  1ON4 A;  1PGT A;  2H6Z A;  2X64 A;  1MDI A;  4NHW A;  3FHK A;  4WBR D;  4I8B A;  3GRX A;  2MZC A;  3IC4 A;  3I69 A;  4KUN A;  4XIH A;  1OE8 A;  4AGS A;  2DSA A;  2BJX A;  1V40 A;  4MJA A;  2H1B A;  4CW9 A;  4HZ4 A;  2C3T A;  3LWA A;  1EEM A;  2A2S A;  3QDN A;  1XW6 A;  2DML A;  3KEB A;  1AXD A;  3MAK A;  3TKS E;  2K8S A;  1PL1 A;  2HLS A;  3HVX A;  1OVN A;  3DKS A;  5ELA A;  5AIX A;  2FWG A;  3TOT A;  2DJ1 A;  3GMF A;  5B6N A;  2VL2 C;  1I9D A;  5INY A;  1R5A A;  1SJI A;  4KW6 A;  1A0R P;  2EIQ A;  4IP6 A;  3GKX A;  4BWS A;  2LTK A;  5G5E A;  3TJG A;  1X9S B;  3L0H A;  4GQF A;  1B9Y C;  2DJ3 A;  4XS1 A;  2F9S A;  1YZX A;  2YP6 A;  2LJR A;  5HR1 A;  2IPA A;  2VLU A;  2B5E A;  4TXO A;  2BTO T;  3LQ7 A;  1LU4 A;  3L9U A;  1ST9 A;  5IQY A;  2N5B A;  3RPP A;  2MBS A;  5ENU A;  1QQ2 A;  2IFQ A;  1BYE A;  3LEF A;  5LD0 A;  3HJO A;  2AUV A;  2LQQ A;  2V6O A;  1WOU A;  2HT9 A;  4XRD A;  2I81 A;  4N30 A;  2YV9 A;  1SKS B;  4F0C A;  1Z3E A;  2P5R A;  4AJ8 A;  4ECI A;  3DIE A;  1XWK A;  3LGC A;  4CHS A;  3KMO A;  2AB6 A;  5J9C A;  3ED3 A;  4TXO B;  4EL1 A;  3VPT A;  4IVF A;  1B4Q A;  2YWM A;  3D6I A;  2H73 A;  5GAP D;  1O7U A;  1X0R A;  4X43 A;  1ERT A;  3GUS A;  1M2A A;  2GS3 A;  4ZBA A;  3ZVJ A;  2KUC A;  2EIO A;  2IFQ B;  2PU9 C;  2OAD A;  2HZE A;  3GFK A;  5IOW A;  4WF5 A;  12GS A;  3VI5 A;  2R6K A;  2CVD A;  4BWQ A;  2X8C A;  4TN8 A;  3QD9 A;  3ZFL A;  4PNG A;  4NMU A;  4GLT A;  5JWO B;  3ZRE A;  2LS5 A;  1K0D A;  4G10 A;  4EDZ A;  2V32 A;  6GST A;  4K7O A;  4NWY A;  3F0I A;  4GRF A;  1NM3 A;  3Q19 A;  2GSQ A;  3IDV A;  3KGK A;  4HJM A;  2YWN A;  5HFK A;  4EVM A;  1FG4 A;  2QKE A;  3ME7 A;  19GS A;  2H8L A;  3F6D A;  4HU7 A;  4WEY A;  3H4K A;  3ZMK A;  4DEJ A;  3UEM A;  3Q18 A;  1K0M A;  3M1G A;  2H66 A;  4ZB9 A;  1MDJ A;  4I2T A;  1ILO A;  1XFL A;  1S3A A;  1GSY A;  3SWL A;  1O6J A;  3IR4 A;  2H71 A;  2RM6 A;  3TJK A;  4H86 A;  3EIN A;  5HFG A;  4DSQ A;  3GUR A;  5J9B A;  4KH7 A;  5CRE A;  2CZ3 A;  4GCI A;  1ZYE A;  4KSO A;  2FUG 2;  2PUK C;  5F0G A;  3V1W A;  2CAI A;  1O85 A;  1XWB A;  2PER A;  4V2N A;  4BL7 A;  3CSI A;  2E0Q A;  22GS A;  1G6Y A;  3IHQ A;  4MH2 A;  4YQM A;  1SK1 A;  1EZK A;  4I2U A;  4DSS B;  2V1M A;  1M2B A;  2F3M A;  4G9H A;  1K0A A;  3FZ9 A;  4ZBB A;  4X1U A;  1GLQ A;  3GA4 A;  2B1K A;  3MWH A;  2O87 A;  3F4R A;  4J56 E;  5DJL A;  2ON5 A;  1TRS A;  4PUR A;  2E2M A;  5DQY A;  3Q6O A;  2GST A;  1H75 A;  1WWJ A;  2LRC A;  2BMX A;  3KIJ A;  2TRX A;  2FGX A;  3EUR A;  3W8J A;  4MCU A;  3UAR A;  3MSZ A;  3DEX A;  5JCU A;  4MMM A;  3ERG A;  4EF0 A;  3N9J A;  1R5P A;  4MF5 A;  1SYX A;  4NHZ A;  3HDC A;  1GTU A;  3K8N A;  1TW9 A;  4LL1 B;  4ISD A;  1LJR A;  3PGT A;  1TKD B;  2WDU A;  2IWT A;  1PKZ A;  3IPZ A;  2GQL A;  1Z6M A;  3GKM A;  3CTG A;  2B1L A;  3M8N A;  1FVK A;  4V1A g;  3L9V A;  1U3A A;  2K8V A;  1J08 A;  1DUG A;  4RI7 A;  1K3O A;  3GST A;  2X99 A;  3ERF A;  1A24 A;  1GLP A;  4YQV A;  1YJ6 A;  5IMF A;  2VM1 A;  1IYH A;  1TRW A;  4PUF C;  4AF2 A;  1EEJ A;  3GH6 A;  4LA1 A;  4K1F A;  3GN3 A;  1JZW A;  2C1Y A;  4IHU A;  3KCM A;  4F03 A;  3ISO A;  4YH2 A;  1XW9 A;  1TK5 B;  4JZQ A;  1XPV A;  2R5G A;  3E3E A;  2IMF A;  3TKQ A;  1S3D A;  3IE3 A;  1M9B A;  2VLT A;  3KD0 A;  5LNK e;  1DBY A;  1R4W A;  4N0V A;  5IMV A;  3QAV A;  4I6X A;  1TK8 B;  4F9Z A;  3SBC A;  2XBQ A;  3LYP A;  1G7E A;  1HNB A;  3ZVJ D;  3F3Q A;  3GSS A;  3VLN A;  1ZGN A;  4MH3 A;  4LMW A;  2H1G A;  2GGT A;  5D93 A;  3FW2 A;  1T4Z A;  3UIW A;  2O89 A;  1O8X A;  3VWU A;  3ME8 A;  3HJP A;  2L5O A;  2LRT A;  1RQM A;  2H76 A;  2H1A A;  1N8J A;  1YY7 A;  4IJ3 A;  4X0X A;  2JZS A;  1F3A A;  4IN0 A;  1FW1 A;  3TKP A;  1BG5 A;  3UVH A;  5JCG A;  2FD3 A;  3O76 A;  1YEP A;  2DIY A;  2VCW A;  3H8Q A;  1SJ6 A;  4BPY A;  4GST A;  1NW2 A;  1YF0 A;  2C8U A;  2PN8 A;  1AQW A;  3FY7 A;  1SK2 A;  3FR3 A;  1RW1 A;  2E2G A;  2GZP A;  4HI7 A;  3H79 A;  4MJE A;  5L71 A;  3D21 A;  1PN9 A;  1TDI A;  3VFI A;  2Z9S A;  4L8E A;  3UJ1 A;  5HR2 A;  2C3N A;  1U88 A;  5DDL A;  5JWQ B;  2VCT A;  3ZRD A;  2B6M A;  4KDY A;  1THO A;  4K7N A;  5ABR A;  4KA0 A;  4XHM A;  1EGO A;  4XTS A;  2FWF A;  4WXT A;  3BJ5 A;  5EY6 A;  2IN3 A;  5DAL B;  5J4U A;  4AJ7 A;  4ZL9 A;  1V9W A;  1YEX A;  1PMT A;  2JL4 A;  1A2J A;  2M80 A;  2H6Y A;  1TI1 A;  2HNL A;  1K3L A;  4LMV A;  4K2D A;  1OAZ A;  3O3T A;  3D22 A;  3UBK A;  4V2M A;  3RHB A;  1DE2 A;  2C0F A;  2OBK A;  4OFT A;  1DSB A;  1Q98 A;  5ECR B;  2LRN A;  1BED A;  1JFU A;  4HU9 A;  5IM9 A;  4O5R A;  4E8E A;  2P5Q A;  4N0Z A;  4XRA A;  3RAZ A;  3IBH A;  2WZ9 A;  1B8X A;  4P3Y B;  2AYT A;  4K0N A;  1A0F A;  5DBQ A;  3UMA A;  5DJM A;  3HYP A;  3LXT A;  3H1N A;  4NPB A;  3ZL5 A;  2VO4 A;  9GSS A;  1XZO A;  1VF1 A;  4ULX A;  3DD3 A;  1CQH A;  2YOI A;  5ECK B;  3GTU A;  5A4W A;  2R37 A;  5FT3 A;  3KTL A;  2FWH A;  2IMD A;  1YQ1 A;  4XS4 B;  1GSS A;  3GH9 A;  3VI7 A;  2F8F A;  3CRU A;  3NOF A;  3F63 A;  5HFI A;  3A5W A;  2GQK A;  4HUA A;  5DVB A;  3FKF A;  3DWV A;  4EXJ A;  4FIW A;  3US3 A;  3BCI A;  4Z7X A;  1ZOF A;  2LNS A;  3FK8 A;  2VIM A;  4L5O A;  1GUM A;  3GTU B;  1FB0 A;  3C1S A;  3PIN A;  1ERW A;  5D73 A;  4K6X A;  3GIX A;  4PX1 A;  4PUA A;  2VD0 A;  2TIR A;  4F0B A;  1GL8 A;  3R2Q A;  4NXI A;  1PSQ A;  3HHV A;  4TKY A;  3FZ5 A;  4GTU A;  3UL3 A;  1SU9 A;  4K8M A;  7GSS A;  2CT6 A;  1SKW B;  1ZMA A;  1YDK A;  2YN1 A;  2P0G A;  1AC1 A;  4YAP A;  3VWW A;  1J0F A;  2WRT A;  2IL3 A;  4ZIL A;  1FOV A;  2YZH A;  4TVE A;  3WGD A;  2FA4 A;  1JZR A;  4GQC A;  1XWA A;  2LST A;  2GT5 A;  3GHA A;  2YV7 A;  5CP1 A;  2HI7 A;  2LNT A;  2DMM A;  5F05 A;  1ZZY A;  2C0G A;  4KDX A;  5EPF A;  4KCE A;  2C0D A;  4OO4 A;  3UOM A;  1Z9H A;  4MK3 A;  1FO5 A;  1G6W A;  1EP8 A;  3ZZX A;  4TXV A;  2PWJ A;  2H30 A;  2ON7 A;  2IMI A;  4FYB A;  4ML6 A;  1BAY A;  1M7T A;  4GF0 A;  5ECQ B;  2OE1 A;  3GX0 A;  3ZIJ A;  1TXX A;  3FR9 A;  3QAW A;  3IXR A;  3EE2 A;  2MMZ A;  4ACS A;  1C72 A;  4QL7 A;  2GSR A;  2YPM A;  1GWC A;  3TJJ A;  4HOJ A;  2HE3 A;  1A23 A;  1OKT A;  5IMC A;  2K6V A;  4PGT A;  4EE0 A;  4QQ7 A;  3FRC A;  3TKS A;  1T8E B;  3TUE A;  4ZXG A;  3F3R A;  3A2V A;  2AAW A;  4K9Z A;  2C80 A;  3WD6 A;  4LLR A;  3TCO A;  1S3C A;  2YZU A;  5CRD A;  1WJK A;  1MTC A;  4DSS A;  4MF7 A;  1A8Y A;  3HZ8 A;  3KP9 A;  5C00 A;  3ZIV A;  4ZBD A;  4TRX A;  2N5A A;  3F9U A;  4WBJ A;  2LQO A;  4Q5Q A;  1PQN A;  3G9B A;  1XWG A;  4IBP A;  3IRA A;  3VWV A;  4MF6 A;  1PA3 A;  4IQA A;  5CNW A;  4OO5 A;  1MD3 A;  14GS A;  4Q5F A;  1PX6 A;  2HSY A;  4MAB A;  1WMJ A;  3WT2 A;  5AN1 A;  2YWO A;  5CRH A;  2QSI A;  2DC5 A;  3P90 A;  1SJZ A;  3J7Y k;  2C3Q A;  3P8W A;  4TR3 A;  3CYN A;  2H0I A;  3GYK A;  6GSY A;  1YKA A;  2WJU A;  6GSU A;  2V2G A;  5ECI B;  4HJ2 A;  2VCV A;  1T7P B;  3KH9 A;  2OAC A;  4KX4 A;  1X9W B;  4RQR A;  2IIY A;  3G7Y A;  4FYC A;  2DJ0 A;  2JSZ A;  4E8H A;  3LXZ A;  4WKW A;  3NIV A;  3C7M A;  2DJ2 A;  5IMA A;  2CQ9 A;  3J7Y b;  1Z6N A;  1GUL A;  5ECL B;  5A4U A;  2VUP A;  4FO5 A;  3NZN A;  1PKW A;  2M72 A;  1UC7 A;  3C8E A;  4POB A;  6GSS A;  5HR0 A;  4V2L A;  4JRR A;  2JAD A;  3W8S A;  2O8V B;  2LV3 A;  2MMO A;  4PNF A;  1TK0 B;  5KN3 A;  4JR4 A;  3CMI A;  2DJK A;  3EVI A;  1ERV A;  3GL5 A;  3TJB A;  5F06 A;  2RUF A;  3A2X A;  5IPH A;  5B6M A;  2CX3 A;  2C0E A;  11GS A;  1Z5Y E;  4GSS A;  4NV2 A;  3EYT A;  2NTO A;  5IPG A;  3MDK A;  4J57 E;  2V41 A;  3UAP A;  4HS1 A;  5ECN B;  3JCM L;  1WPI A;  2NBS A;  3E0U A;  5IO0 A;  2H0G A;  4JBB A;  1SL2 B;  4GXZ A;  2RUE A;  2J23 A;  3DML A;  4MDC A;  4DVC A;  2CAQ A;  3PR8 A;  4JED A;  2D2Z A;  4GSN A;  2VL3 A;  2G2Q A;  3DVW A;  2VCZ A;  1K0C A;  1XBS A;  2XPE A;  3M0F A;  3EWL A;  4PXO A;  1A2M A;  2OE3 A;  1UA5 A;  13GS A;  3BBY A;  3HCZ A;  2PVO C;  1V98 A;  1YKC A;  1NHO A;  3LYK A;  2OJL A;  3N5O A;  3IK7 A;  1CQG A;  1VF3 A;  4HZ2 A;  1THX A;  1K0O A;  5LCZ A;  1X9M B;  2VCQ A;  4IQ1 A;  3IV4 A;  1OC9 B;  4O32 A;  1V58 A;  2ZUP A;  1GUH A;  3BCK A;  2XBI A;  3HD5 A;  4OFM A;  2H70 A;  1B9X C;  3TOU A;  3HVS A;  1E6B A;  3APS A;  3KH7 A;  4IP1 A;  1BJX A;  2NDO A;  1A8L A;  3ERW A;  1GTB A;  2B3S A;  2FA8 A;  2TRC P;  2YWI A;  2R4V A;  5DAL A;  1MD4 A;  3DVX A;  4EC0 A;  1EOH A;  1O73 A;  1JHB A;  1M2D A;  1O81 A;  2KOK A;  3LFL A;  1NHY A;  1W89 A;  2GDR A;  2YNX A;  1LBK A;  5D96 A;  1VRS D;  1GH2 A;  5IOX A;  1HNC A;  1XVQ A;  2JAC A;  5D9X A;  5FWG A;  2ZCT A;  8GSS A;  1AIU A;  4HDE A;  1F3B A;  2JZR A;  3GNJ A;  4TR1 A;  4EDY A;  3KJY A;  2G0F A;  4HQZ A;  1ACV A;  5ECO B;  2HRF A;  1EP7 A;  3EMP A;  3WGE A;  1FB6 A;  4RI6 A;  3P7X A;  1SL0 B;  2OE0 A;  4N11 A;  4L5L A;  1XOB A;  2F51 A;  1M9A A;  5J41 A;  2PBJ A;  2I4A A;  1FHE A;  2C4J A;  5AIV A;  3L78 A;  4MZC A;  1GNW A;  3LSZ A;  1QGV A;  5IMD A;  2R3X A;  3I6A A;  2QGV A;  1AUC A;  3RHC A;  1MDK A;  5EVO A;  3DXB A;  3I43 A;  4OMV A;  1OYJ A;  2WS2 A;  1WP0 A;  3D5J A;  4ZB6 A;  1Z7P A;  3HZ4 A;  2YJH A;  5ECM B;  4TR1 B;  5G2Z A;  3ZLP A;  4MZW A;  2F8A A;  4AJ6 A;  5KN0 A;  1GUK A;  6GSV A;  4XS4 A;  2NPB A;  3L4N A;  2K9F A;  1B48 A;  3G7I A; 
#chains in the Genus database with same CATH topology
 3QR6 A;  3GV1 A;  1J9B A;  3M3M A;  2L5L A;  3TJF A;  5H5S A;  2EIR A;  2NVL A;  2H74 A;  1XVW A;  4MZB A;  1HNA A;  1GSE A;  1JLW A;  1HYU A;  4MLY A;  1TU7 A;  1AQV A;  2PVQ A;  1XOA A;  1F6M C;  4KCA A;  5CRG A;  1T1V A;  2E7P A;  1MEK A;  3KTB A;  3CSJ A;  1ERU A;  4IJI A;  2ALB A;  3DYR A;  2KHP A;  3QCP A;  1X5C A;  5HR3 A;  3WT1 A;  3WYW A;  10GS A;  5B8A A;  2X8G A;  4ID0 A;  3FEU A;  4FH8 A;  2OA7 A;  4MA9 A;  2B5X A;  1WRY A;  4ZB8 A;  2LJK A;  1F37 A;  1GTA A;  3DRN A;  2WB9 A;  4K7I A;  4G19 A;  2CZ2 A;  2JZT A;  3EU4 A;  1W4V A;  5H5R A;  5CYY A;  2I3Y A;  1O8W A;  5E59 A;  4KSM A;  1FOH A;  4KDU A;  5GSS A;  2L4C A;  2FY6 A;  1Y25 A;  4WET A;  2O7K A;  1KTE A;  4CY6 A;  4OCE A;  1IYI A;  5F07 A;  2CVB A;  4K0G A;  1R26 A;  1K3Y A;  2H1D A;  4YQU A;  5B8B A;  1USB A;  4O92 A;  5DCH A;  1GSF A;  3ZML A;  2A4V A;  1OC8 A;  2GT6 A;  2YCD A;  1R7H A;  3MNG A;  2LKU A;  2RM5 A;  1HD2 A;  3TB2 A;  2VOC A;  3TRP A;  1T00 A;  3TKS C;  3FZA A;  4TR0 A;  3L9S A;  5G1K A;  4OD7 A;  5KEJ A;  1PX7 A;  3EC3 A;  4HSC X;  3S9F A;  1FVJ A;  2RLI A;  3QFB C;  4G0K A;  4ECB A;  2GVP A;  2L59 A;  4O7H A;  3QMX A;  3IOS A;  1EGR A;  4KGI A;  2VLV A;  2DJJ A;  3LJR A;  3C71 A;  2B7J A;  3OR5 A;  1YF1 A;  2GTU A;  1WIK A;  2YAN A;  1SD9 A;  1GSU A;  4MP4 A;  3UVT A;  3GKK A;  4F2I A;  4ZL8 A;  1GSD A;  4DSR A;  4BA7 A;  1SL1 B;  2KLX A;  5AGY A;  4HEA 2;  2A2R A;  3APO A;  3IAM 2;  3HVV A;  4L0W A;  1U6T A;  2YJ7 A;  2LEG A;  4XCS A;  3BD2 A;  1XIY A;  2DKI A;  1XXU A;  3KXO A;  2IME A;  5DAK A;  2X8H A;  4I97 A;  2PPT A;  1VF2 A;  1FAA A;  2P31 A;  3F8U A;  2VL2 A;  1XWC A;  4JE1 A;  1OE7 A;  5DQS A;  2HSH A;  4HQS A;  3A3T A;  3UBL A;  2WUL A;  4ILF A;  4ECJ A;  4LL4 B;  3EMX A;  1N2A A;  2XHF A;  5ECP B;  3HXS A;  1A2L A;  2HXK A;  1URM A;  4POM A;  2FNO A;  2VD1 A;  4KF9 A;  5CAX A;  1T4Y A;  3ZFB A;  2JU5 A;  1G0T A;  1X5E A;  1TRU A;  3EU3 A;  5H5Q A;  3CXG A;  5J3R A;  5DAK B;  2AJQ B;  4Q5N A;  3E9J B;  2L6C A;  1AQX A;  1K0B A;  1TI3 A;  2OKA A;  2J9H A;  3G7J A;  3VK9 A;  3U6V A;  4I5Q A;  4TOP A;  3U5R E;  4IS0 A;  1SKR B;  2QA1 A;  3IAS 2;  3QAG A;  5JWR B;  2B7K A;  1UVZ A;  2DLX A;  2HZE B;  2H19 A;  2FCH A;  3CBU A;  6GSX A;  5F8B A;  1TRV A;  3KM6 A;  3LG6 A;  2H01 A;  1GTI A;  4ML1 A;  1SK0 A;  4TW5 A;  1XG8 A;  5D8I A;  3ZTL A;  4D73 A;  2MMN A;  3HJM A;  2PMT A;  5GZZ B;  5AIS A;  2L57 A;  4PQH A;  2GZZ A;  2WCI A;  3HKR A;  4KB3 A;  1TJD A;  1EV4 A;  5ECH B;  5D9V A;  4V1A p;  4N10 A;  18GS A;  4O5Q A;  2IJY A;  4MPF A;  2DKH A;  2R2J A;  4JU5 A;  3GX8 A;  2VAF A;  1M3I A;  4KAE A;  3TRX A;  3PH9 A;  2CV4 A;  4O5U A;  3Q74 A;  2CX4 A;  3TDG A;  2VCX A;  1M0U A;  4IGJ A;  5J5N A;  1M99 A;  1EV9 A;  1GRX A;  4K5S A;  4D73 B;  1WE0 A;  1KEB A;  3HY2 A;  1NSW A;  3F4T A;  1VF4 A;  2I1U A;  4OWY A;  3VWX A;  4BL7 B;  1OKD A;  3RBT A;  3WGX A;  5ECS A;  3O6T A;  2H75 A;  4JR6 A;  2AHE A;  5FHI A;  4XS6 A;  3QFA C;  3W6G A;  3GKN A;  1SYR A;  1ABA A;  5COH A;  2QC7 A;  3CTF A;  4USS A;  2AV4 A;  5ID2 A;  5GST A;  20GS A;  2XC2 A;  2KP2 A;  2H6X A;  1T3B A;  1F9M A;  3A2W A;  4KE3 A;  1BQ7 A;  3TKR A;  1G7O A;  1EOG A;  1UN2 A;  2R0C A;  3LOR A;  4OCF A;  2GQM A;  5G30 A;  3M9K A;  5GAN D;  4POL A;  4IKH A;  3F4S A;  4WF4 A;  4PQ1 A;  3AY8 A;  3ZYW A;  3VUR A;  1ZYQ B;  1OC9 A;  1PRX A;  2VL9 A;  2MYG A;  3GL3 A;  1DE1 A;  1U87 A;  2FLS A;  3D0Z A;  5D9T A;  2WFC A;  3ZIT A;  3IA1 A;  3KP8 A;  3FYG A;  4F82 A;  1QMV A;  5BMU A;  4PQI A;  2MMA A;  4EO3 A;  3CSH A;  4MJB A;  1BX9 A;  3DGQ A;  5ID2 B;  5G1L A;  3D4M A;  2RII A;  4A5P A;  4EKZ A;  4ZIJ A;  3P2A A;  4NAX A;  3VPQ A;  3TGZ A;  1GNE A;  3FR6 A;  2O85 A;  1AAZ A;  4YAV A;  5EL8 A;  4YKF A;  3APQ A;  2OBI A;  5DCG A;  4MJC A;  4Q5R A;  2EC4 A;  2H0H A;  16GS A;  4ECC A;  4RUV A;  5A4V A;  5D9W A;  4X4J A;  2LUS A;  3C1R A;  2HZF A;  3IK9 A;  1K0N A;  1QUW A;  2IMK A;  4NV5 A;  2CVK A;  2MBT A;  5G5F A;  2HFD A;  2PGT A;  1I5G A;  3CRT A;  3KMN A;  2I9H A;  4OFN A;  1GP1 A;  5IIZ A;  1F2E A;  5HQP A;  2ZNM A;  1OC3 A;  1SEN A;  3BOA A;  4ZL7 A;  1EWX A;  3H93 A;  4GWR A;  2HRN A;  2VM2 A;  2L6D A;  3D4T A;  4POK A;  3HA9 A;  3I9V 2;  2KP1 A;  1PD2 1;  4RQX A;  4MPG A;  1PL2 A;  2FWE A;  1ZCP A;  1TTZ A;  2REM A;  4EUY A;  5CRW A;  1KBN A;  1Q4J A;  1XW5 A;  1KNG A;  4QL9 A;  2H72 A;  4IW9 A;  3KZQ A;  4TR4 A;  4CDO A;  1VGL A;  5B7C A;  2ES7 A;  2L4Q A;  3RPN A;  4BIK A;  4FYU A;  1U3I A;  3F6F A;  1TP9 A;  2HYX A;  5IO2 A;  3MYD A;  2V6K A;  1V2A A;  1QFN A;  2FHE A;  1SD8 A;  3M9J A;  1Y6E A;  1ML6 A;  3PPU A;  1JLV A;  4L0U A;  4BVY A;  1Z7R A;  1RK4 A;  1JZO A;  5E4W A;  4J2F A;  5CO3 A;  1TOF A;  4G2E A;  1V57 A;  4WR4 A;  5A5K A;  17GS A;  3QPM A;  4IEL A;  4PTS A;  1ZYP A;  2DIZ A;  5IMZ A;  2X4A A;  1JZD A;  2M46 A;  3C73 A;  2X49 A;  3TRQ A;  4KND A;  1ZL9 A;  2XPD A;  2JSY A;  4BVX A;  1H4O A;  5KN1 A;  2N5F A;  1AW9 A;  3FZ4 A;  2B5Y A;  3RDW A;  3QOU A;  3EPT A;  2GSS A;  5KN2 A;  1XCC A;  4BVY B;  2LJA A;  1B4P A;  1HQO A;  2GLR A;  1TU8 A;  4WR5 A;  1E2Y A;  2GZY A;  2CA8 A;  6GSW A;  1GSQ A;  2K18 A;  5C04 A;  1QK8 A;  1QXH A;  2WGR A;  5ELG A;  1X5D A;  2DBC A;  5G31 A;  5JCW A;  1ON4 A;  1PGT A;  2H6Z A;  2X64 A;  1MDI A;  4NHW A;  3FHK A;  4WBR D;  4I8B A;  3GRX A;  2MZC A;  4BVX B;  3IC4 A;  4Z2R A;  3I69 A;  4KUN A;  4XIH A;  1OE8 A;  4AGS A;  2DSA A;  2BJX A;  1V40 A;  4MJA A;  2H1B A;  4CW9 A;  4HZ4 A;  2C3T A;  3LWA A;  1EEM A;  2A2S A;  3QDN A;  1XW6 A;  2DML A;  3KEB A;  1AXD A;  3MAK A;  3TKS E;  2K8S A;  1PL1 A;  2HLS A;  3HVX A;  1OVN A;  3DKS A;  5ELA A;  5AIX A;  2FWG A;  3TOT A;  2DJ1 A;  3GMF A;  5B6N A;  2VL2 C;  1I9D A;  5INY A;  1R5A A;  1SJI A;  4KW6 A;  1A0R P;  2EIQ A;  4IP6 A;  3GKX A;  1PN0 A;  4BWS A;  2LTK A;  4YKG A;  5G5E A;  5BRT A;  3TJG A;  1X9S B;  3L0H A;  4GQF A;  1B9Y C;  2DJ3 A;  4XS1 A;  2F9S A;  1YZX A;  2YP6 A;  2LJR A;  5HR1 A;  2IPA A;  2VLU A;  2B5E A;  4TXO A;  2BTO T;  3LQ7 A;  4G0I A;  1LU4 A;  3L9U A;  5KOX A;  1ST9 A;  5IQY A;  2N5B A;  3RPP A;  2MBS A;  5ENU A;  1QQ2 A;  2IFQ A;  1BYE A;  3LEF A;  5LD0 A;  3HJO A;  2AUV A;  2LQQ A;  2V6O A;  1WOU A;  2HT9 A;  4XRD A;  2I81 A;  4N30 A;  2YV9 A;  1SKS B;  4F0C A;  1Z3E A;  2P5R A;  4AJ8 A;  4ECI A;  3DIE A;  1XWK A;  3LGC A;  4CHS A;  3KMO A;  2AB6 A;  5J9C A;  3ED3 A;  4TXO B;  4FQU A;  4EL1 A;  3VPT A;  4IVF A;  1B4Q A;  2YWM A;  2A4H A;  3D6I A;  2H73 A;  5GAP D;  1O7U A;  1X0R A;  4X43 A;  1ERT A;  3GUS A;  1M2A A;  2GS3 A;  4ZBA A;  3ZVJ A;  2KUC A;  2EIO A;  2IFQ B;  2PU9 C;  2OAD A;  2HZE A;  3GFK A;  5IOW A;  4WF5 A;  12GS A;  3VI5 A;  2R6K A;  2CVD A;  4BWQ A;  2X8C A;  4TN8 A;  3QD9 A;  3ZFL A;  4PNG A;  4NMU A;  4GLT A;  5JWO B;  5KOW A;  3ZRE A;  2LS5 A;  1K0D A;  4G10 A;  4EDZ A;  2V32 A;  6GST A;  4K7O A;  4NWY A;  3A5I A;  3F0I A;  4GRF A;  1NM3 A;  3Q19 A;  2GSQ A;  3IDV A;  3KGK A;  4HJM A;  2YWN A;  5HFK A;  4EVM A;  1FG4 A;  2QKE A;  3ME7 A;  19GS A;  2H8L A;  3F6D A;  4HU7 A;  4WEY A;  1S3R A;  3H4K A;  3ZMK A;  4DEJ A;  3UEM A;  3Q18 A;  1K0M A;  3M1G A;  2H66 A;  4ZB9 A;  1MDJ A;  4I2T A;  1ILO A;  1XFL A;  1S3A A;  1GSY A;  3SWL A;  1O6J A;  3IR4 A;  2H71 A;  2RM6 A;  3FMW A;  4H86 A;  3TJK A;  3EIN A;  5HFG A;  4DSQ A;  3GUR A;  5J9B A;  4EIQ A;  4KH7 A;  5CRE A;  2CZ3 A;  4GCI A;  1ZYE A;  4KSO A;  2FUG 2;  2PUK C;  5F0G A;  3V1W A;  2CAI A;  1O85 A;  1XWB A;  2PER A;  4V2N A;  4BL7 A;  3CSI A;  2E0Q A;  22GS A;  1G6Y A;  3IHQ A;  4MH2 A;  4YQM A;  1SK1 A;  1EZK A;  4I2U A;  4DSS B;  2V1M A;  1M2B A;  2F3M A;  4G9H A;  1K0A A;  3FZ9 A;  4ZBB A;  4X1U A;  1GLQ A;  3GA4 A;  2B1K A;  3MWH A;  4G0L A;  2O87 A;  3F4R A;  4J56 E;  5DJL A;  2ON5 A;  1TRS A;  4PUR A;  2E2M A;  5DQY A;  3Q6O A;  2GST A;  1H75 A;  1WWJ A;  2LRC A;  2BMX A;  3KIJ A;  2TRX A;  2FGX A;  3EUR A;  3W8J A;  4MCU A;  3UAR A;  3MSZ A;  3DEX A;  5JCU A;  4MMM A;  3ERG A;  4EF0 A;  3N9J A;  1R5P A;  4MF5 A;  1SYX A;  4NHZ A;  3HDC A;  1GTU A;  3K8N A;  1TW9 A;  4LL1 B;  4ISD A;  1LJR A;  3PGT A;  1TKD B;  2WDU A;  1PFO A;  4EIP A;  2IWT A;  1PKZ A;  3IPZ A;  2GQL A;  1Z6M A;  3GKM A;  3CTG A;  2B1L A;  3M8N A;  1FVK A;  4V1A g;  3L9V A;  1U3A A;  2K8V A;  1J08 A;  1DUG A;  4RI7 A;  1K3O A;  3GST A;  2X99 A;  3ERF A;  1A24 A;  1GLP A;  4YQV A;  1YJ6 A;  5IMF A;  2VM1 A;  1IYH A;  1TRW A;  4PUF C;  4AF2 A;  1EEJ A;  3GH6 A;  4LA1 A;  4K1F A;  3GN3 A;  1JZW A;  2C1Y A;  4IHU A;  3KCM A;  4F03 A;  3ISO A;  4YH2 A;  1XW9 A;  1TK5 B;  4JZQ A;  3R3E A;  1XPV A;  2R5G A;  3E3E A;  2IMF A;  3TKQ A;  1S3D A;  3IE3 A;  1M9B A;  2VLT A;  3KD0 A;  5LNK e;  1DBY A;  1R4W A;  4N0V A;  5IMV A;  3QAV A;  3IHG A;  4I6X A;  1TK8 B;  4F9Z A;  3SBC A;  2XBQ A;  3LYP A;  1G7E A;  2HRA A;  1HNB A;  3ZVJ D;  3F3Q A;  3GSS A;  3VLN A;  1ZGN A;  4MH3 A;  4LMW A;  2H1G A;  2GGT A;  5D93 A;  3FW2 A;  1T4Z A;  3UIW A;  2O89 A;  1O8X A;  3VWU A;  3ME8 A;  3HJP A;  2L5O A;  2LRT A;  1RQM A;  2H76 A;  2H1A A;  1N8J A;  1YY7 A;  4IJ3 A;  4X0X A;  2JZS A;  1F3A A;  4IN0 A;  1FW1 A;  3TKP A;  1BG5 A;  3UVH A;  5JCG A;  2FD3 A;  3O76 A;  1YEP A;  2DIY A;  2VCW A;  3H8Q A;  1SJ6 A;  1M3J A;  4BPY A;  4GST A;  1NW2 A;  1YF0 A;  2C8U A;  2PN8 A;  1AQW A;  3FY7 A;  1SK2 A;  3FR3 A;  1RW1 A;  2E2G A;  2GZP A;  2R0P A;  4HI7 A;  3H79 A;  4MJE A;  5L71 A;  3D21 A;  1PN9 A;  1TDI A;  3VFI A;  2Z9S A;  4L8E A;  3UJ1 A;  5HR2 A;  2C3N A;  1U88 A;  5DDL A;  5JWQ B;  2VCT A;  3ZRD A;  2B6M A;  4KDY A;  1THO A;  4K7N A;  5ABR A;  4KA0 A;  4XHM A;  1EGO A;  4XTS A;  2FWF A;  4WXT A;  3BJ5 A;  5EY6 A;  2IN3 A;  5DAL B;  5J4U A;  4AJ7 A;  4ZL9 A;  1V9W A;  1YEX A;  1PMT A;  2JL4 A;  1A2J A;  2M80 A;  2H6Y A;  1TI1 A;  2HNL A;  1K3L A;  4LMV A;  4K2D A;  1OAZ A;  3O3T A;  3D22 A;  3UBK A;  4V2M A;  3RHB A;  1DE2 A;  2C0F A;  2OBK A;  4OFT A;  1DSB A;  1Q98 A;  5ECR B;  2LRN A;  1BED A;  1JFU A;  3IC8 A;  4HU9 A;  5IM9 A;  4Z2T A;  4O5R A;  4E8E A;  2P5Q A;  4N0Z A;  4XRA A;  3RAZ A;  3IBH A;  2WZ9 A;  1B8X A;  4P3Y B;  2AYT A;  4K0N A;  1A0F A;  5DBQ A;  3UMA A;  5DJM A;  4K2X A;  3HYP A;  3LXT A;  3H1N A;  4NPB A;  3ZL5 A;  2VO4 A;  9GSS A;  1XZO A;  1VF1 A;  4ULX A;  3DD3 A;  1CQH A;  2YOI A;  5ECK B;  4K5R A;  3GTU A;  5A4W A;  2R37 A;  5FT3 A;  3KTL A;  2FWH A;  2IMD A;  1YQ1 A;  4XS4 B;  1GSS A;  3GH9 A;  3VI7 A;  2F8F A;  2A2P A;  3CRU A;  3NOF A;  3F63 A;  5HFI A;  3A5W A;  2GQK A;  4HUA A;  5DVB A;  3FKF A;  3DWV A;  4EXJ A;  4FIW A;  3US3 A;  3BCI A;  4Z7X A;  1ZOF A;  2LNS A;  3FK8 A;  2VIM A;  4L5O A;  1GUM A;  3GTU B;  1FB0 A;  3C1S A;  3PIN A;  1ERW A;  5D73 A;  4K6X A;  3GIX A;  4PX1 A;  4PUA A;  2VD0 A;  2TIR A;  4F0B A;  1GL8 A;  3R2Q A;  4NXI A;  1PSQ A;  3HHV A;  4TKY A;  3FZ5 A;  4GTU A;  3UL3 A;  1SU9 A;  4K8M A;  7GSS A;  2CT6 A;  1SKW B;  1ZMA A;  1YDK A;  2YN1 A;  2P0G A;  2QA2 A;  1AC1 A;  4YAP A;  3VWW A;  1J0F A;  2WRT A;  2IL3 A;  4ZIL A;  1FOV A;  2YZH A;  4TVE A;  3WGD A;  2FA4 A;  1JZR A;  4GQC A;  1XWA A;  2LST A;  2GT5 A;  3GHA A;  2YV7 A;  5CP1 A;  2HI7 A;  2LNT A;  2DMM A;  5F05 A;  1ZZY A;  2C0G A;  4KDX A;  5EPF A;  4KCE A;  3HVN A;  2C0D A;  4OO4 A;  3UOM A;  1Z9H A;  4MK3 A;  1FO5 A;  1G6W A;  1EP8 A;  3ZZX A;  4TXV A;  2PWJ A;  2H30 A;  2ON7 A;  2IMI A;  4FYB A;  4ML6 A;  1BAY A;  1M7T A;  4GF0 A;  5ECQ B;  2OE1 A;  3GX0 A;  3ZIJ A;  1TXX A;  3FR9 A;  4CY8 A;  3QAW A;  3IXR A;  3EE2 A;  2MMZ A;  4ACS A;  1C72 A;  4QL7 A;  2GSR A;  2YPM A;  1GWC A;  3TJJ A;  4HOJ A;  2HE3 A;  1A23 A;  1OKT A;  5IMC A;  2K6V A;  4PGT A;  4EE0 A;  4QQ7 A;  3FRC A;  3TKS A;  1T8E B;  3TUE A;  4ZXG A;  3F3R A;  3A2V A;  2AAW A;  4K9Z A;  2C80 A;  3WD6 A;  4LLR A;  3TCO A;  1S3C A;  2YZU A;  5CRD A;  1WJK A;  1MTC A;  4DSS A;  4MF7 A;  1A8Y A;  3HZ8 A;  3KP9 A;  5C00 A;  3ZIV A;  4ZBD A;  4TRX A;  2N5A A;  3F9U A;  4WBJ A;  2LQO A;  4Q5Q A;  1PQN A;  3G9B A;  1XWG A;  3MIX A;  4IBP A;  3IRA A;  3VWV A;  4MF6 A;  1PA3 A;  4IQA A;  5CNW A;  4OO5 A;  1MD3 A;  14GS A;  4Q5F A;  1PX6 A;  2HSY A;  4MAB A;  1WMJ A;  2R0G A;  3WT2 A;  5AN1 A;  2YWO A;  5CRH A;  2QSI A;  2DC5 A;  3P90 A;  1SJZ A;  3J7Y k;  2C3Q A;  3P8W A;  2HRK A;  4TR3 A;  3CYN A;  2H0I A;  3GYK A;  6GSY A;  1YKA A;  2WJU A;  6GSU A;  2V2G A;  5ECI B;  4HJ2 A;  2VCV A;  1T7P B;  3KH9 A;  2OAC A;  4KX4 A;  1X9W B;  4RQR A;  2IIY A;  3G7Y A;  4FYC A;  2DJ0 A;  2JSZ A;  4E8H A;  3LXZ A;  4WKW A;  3NIV A;  3C7M A;  2DJ2 A;  5IMA A;  2CQ9 A;  3J7Y b;  1Z6N A;  1GUL A;  5ECL B;  5A4U A;  2VUP A;  4FO5 A;  3NZN A;  1PKW A;  2M72 A;  1UC7 A;  3C8E A;  4POB A;  6GSS A;  5HR0 A;  4V2L A;  4JRR A;  2JAD A;  3W8S A;  2O8V B;  2LV3 A;  2MMO A;  4PNF A;  1TK0 B;  5KN3 A;  4JR4 A;  3CMI A;  2DJK A;  3EVI A;  1ERV A;  3GL5 A;  3TJB A;  5F06 A;  2RUF A;  3A2X A;  5IPH A;  5B6M A;  2CX3 A;  2C0E A;  11GS A;  1Z5Y E;  4GSS A;  4NV2 A;  3EYT A;  2NTO A;  5IPG A;  3MDK A;  4J57 E;  2V41 A;  3UAP A;  4HS1 A;  5ECN B;  3JCM L;  1WPI A;  2NBS A;  3E0U A;  5IO0 A;  2H0G A;  4JBB A;  1SL2 B;  4Z2U A;  4GXZ A;  2RUE A;  2J23 A;  3DML A;  4MDC A;  4DVC A;  2CAQ A;  3PR8 A;  4JED A;  2D2Z A;  4GSN A;  2VL3 A;  2G2Q A;  3DVW A;  2VCZ A;  1K0C A;  1XBS A;  4MNN A;  2XPE A;  3M0F A;  3EWL A;  4PXO A;  1A2M A;  2OE3 A;  1UA5 A;  13GS A;  3BBY A;  3HCZ A;  2PVO C;  1V98 A;  1YKC A;  1NHO A;  3LYK A;  2OJL A;  3N5O A;  3IK7 A;  1CQG A;  1VF3 A;  4HZ2 A;  1THX A;  1K0O A;  5LCZ A;  1X9M B;  2VCQ A;  4IQ1 A;  3IV4 A;  1OC9 B;  4O32 A;  1V58 A;  2ZUP A;  1GUH A;  3BCK A;  2XBI A;  3HD5 A;  4OFM A;  2H70 A;  1B9X C;  3TOU A;  3HVS A;  1E6B A;  3APS A;  3KH7 A;  4IP1 A;  1BJX A;  2NDO A;  1A8L A;  3ERW A;  1GTB A;  2B3S A;  2FA8 A;  2TRC P;  2YWI A;  2R4V A;  5DAL A;  3CQF A;  1MD4 A;  3DVX A;  4EC0 A;  1EOH A;  1O73 A;  1JHB A;  1M2D A;  1O81 A;  2KOK A;  3LFL A;  2HSM A;  1NHY A;  1W89 A;  2GDR A;  2YNX A;  1LBK A;  1ZYN A;  5D96 A;  1VRS D;  1GH2 A;  5IOX A;  1HNC A;  1XVQ A;  2JAC A;  5D9X A;  5FWG A;  2ZCT A;  8GSS A;  1AIU A;  4HDE A;  1F3B A;  2JZR A;  3GNJ A;  4TR1 A;  4EDY A;  3KJY A;  2G0F A;  4HQZ A;  1ACV A;  2HRF A;  5ECO B;  1EP7 A;  3EMP A;  3WGE A;  1FB6 A;  4RI6 A;  3P7X A;  1SL0 B;  2OE0 A;  4N11 A;  4ICY A;  4L5L A;  1XOB A;  2F51 A;  1M9A A;  5J41 A;  2PBJ A;  2I4A A;  1FHE A;  2C4J A;  5AIV A;  3L78 A;  4MZC A;  1GNW A;  3LSZ A;  1QGV A;  5IMD A;  2R3X A;  3I6A A;  2QGV A;  1AUC A;  3RHC A;  1MDK A;  5EVO A;  3DXB A;  3I43 A;  4OMV A;  1OYJ A;  2WS2 A;  1WP0 A;  3D5J A;  4ZB6 A;  1Z7P A;  3HZ4 A;  2YJH A;  5ECM B;  4TR1 B;  5G2Z A;  3ZLP A;  4MZW A;  2F8A A;  4AJ6 A;  5KN0 A;  1GUK A;  6GSV A;  4XS4 A;  2NPB A;  3L4N A;  3LW9 A;  2K9F A;  1B48 A;  3G7I A;  2UZ8 A; 
#chains in the Genus database with same CATH homology
 3QR6 A;  3GV1 A;  1J9B A;  3M3M A;  2L5L A;  3TJF A;  5H5S A;  2EIR A;  2NVL A;  2H74 A;  1XVW A;  4MZB A;  1HNA A;  1GSE A;  1JLW A;  1HYU A;  4MLY A;  1TU7 A;  1AQV A;  2PVQ A;  1XOA A;  1F6M C;  4KCA A;  5CRG A;  1T1V A;  2E7P A;  1MEK A;  3KTB A;  3CSJ A;  1ERU A;  4IJI A;  2ALB A;  3DYR A;  2KHP A;  3QCP A;  1X5C A;  5HR3 A;  3WT1 A;  3WYW A;  10GS A;  5B8A A;  2X8G A;  4ID0 A;  3FEU A;  4FH8 A;  2OA7 A;  4MA9 A;  2B5X A;  1WRY A;  4ZB8 A;  2LJK A;  1F37 A;  1GTA A;  3DRN A;  2WB9 A;  4K7I A;  4G19 A;  2CZ2 A;  2JZT A;  3EU4 A;  1W4V A;  5H5R A;  5CYY A;  2I3Y A;  1O8W A;  5E59 A;  4KSM A;  1FOH A;  4KDU A;  5GSS A;  2L4C A;  2FY6 A;  1Y25 A;  4WET A;  2O7K A;  1KTE A;  4CY6 A;  4OCE A;  1IYI A;  5F07 A;  2CVB A;  4K0G A;  1R26 A;  1K3Y A;  2H1D A;  4YQU A;  5B8B A;  1USB A;  4O92 A;  5DCH A;  1GSF A;  3ZML A;  2A4V A;  1OC8 A;  2GT6 A;  2YCD A;  1R7H A;  3MNG A;  2LKU A;  2RM5 A;  1HD2 A;  3TB2 A;  2VOC A;  3TRP A;  1T00 A;  3TKS C;  3FZA A;  4TR0 A;  3L9S A;  5G1K A;  4OD7 A;  5KEJ A;  1PX7 A;  3EC3 A;  3S9F A;  1FVJ A;  2RLI A;  3QFB C;  4G0K A;  4ECB A;  2GVP A;  2L59 A;  4O7H A;  3QMX A;  3IOS A;  1EGR A;  4KGI A;  2VLV A;  2DJJ A;  3LJR A;  3C71 A;  2B7J A;  3OR5 A;  1YF1 A;  2GTU A;  1WIK A;  2YAN A;  1SD9 A;  1GSU A;  4MP4 A;  3UVT A;  3GKK A;  4F2I A;  4ZL8 A;  1GSD A;  4DSR A;  4BA7 A;  1SL1 B;  2KLX A;  5AGY A;  4HEA 2;  2A2R A;  3APO A;  3IAM 2;  3HVV A;  4L0W A;  1U6T A;  2YJ7 A;  2LEG A;  4XCS A;  3BD2 A;  1XIY A;  2DKI A;  1XXU A;  3KXO A;  2IME A;  5DAK A;  2X8H A;  4I97 A;  2PPT A;  1VF2 A;  1FAA A;  2P31 A;  3F8U A;  2VL2 A;  1XWC A;  4JE1 A;  1OE7 A;  5DQS A;  2HSH A;  4HQS A;  3A3T A;  3UBL A;  2WUL A;  4ILF A;  4ECJ A;  4LL4 B;  3EMX A;  1N2A A;  2XHF A;  5ECP B;  3HXS A;  1A2L A;  2HXK A;  1URM A;  4POM A;  2FNO A;  2VD1 A;  4KF9 A;  5CAX A;  1T4Y A;  3ZFB A;  2JU5 A;  1G0T A;  1X5E A;  1TRU A;  3EU3 A;  5H5Q A;  3CXG A;  5J3R A;  5DAK B;  2AJQ B;  4Q5N A;  3E9J B;  2L6C A;  1AQX A;  1K0B A;  1TI3 A;  2OKA A;  2J9H A;  3G7J A;  3VK9 A;  3U6V A;  4I5Q A;  4TOP A;  3U5R E;  4IS0 A;  1SKR B;  2QA1 A;  3IAS 2;  3QAG A;  5JWR B;  2B7K A;  1UVZ A;  2DLX A;  2HZE B;  2H19 A;  2FCH A;  3CBU A;  6GSX A;  5F8B A;  1TRV A;  3KM6 A;  3LG6 A;  2H01 A;  1GTI A;  4ML1 A;  1SK0 A;  4TW5 A;  5D8I A;  3ZTL A;  4D73 A;  2MMN A;  3HJM A;  2PMT A;  5GZZ B;  5AIS A;  2L57 A;  4PQH A;  2GZZ A;  2WCI A;  3HKR A;  4KB3 A;  1TJD A;  1EV4 A;  5ECH B;  5D9V A;  4V1A p;  4N10 A;  18GS A;  4O5Q A;  2IJY A;  4MPF A;  2DKH A;  2R2J A;  4JU5 A;  3GX8 A;  2VAF A;  3TRX A;  4KAE A;  3PH9 A;  2CV4 A;  4O5U A;  3Q74 A;  2CX4 A;  3TDG A;  2VCX A;  1M0U A;  4IGJ A;  5J5N A;  1M99 A;  1EV9 A;  1GRX A;  4K5S A;  4D73 B;  1WE0 A;  1KEB A;  3HY2 A;  1NSW A;  3F4T A;  1VF4 A;  2I1U A;  4OWY A;  3VWX A;  4BL7 B;  1OKD A;  3RBT A;  3WGX A;  5ECS A;  3O6T A;  2H75 A;  4JR6 A;  2AHE A;  5FHI A;  4XS6 A;  3QFA C;  3W6G A;  3GKN A;  1SYR A;  1ABA A;  5COH A;  2QC7 A;  3CTF A;  4USS A;  2AV4 A;  5ID2 A;  5GST A;  20GS A;  2XC2 A;  2KP2 A;  2H6X A;  1T3B A;  1F9M A;  3A2W A;  4KE3 A;  1BQ7 A;  3TKR A;  1G7O A;  1EOG A;  1UN2 A;  2R0C A;  3LOR A;  4OCF A;  2GQM A;  5G30 A;  3M9K A;  5GAN D;  4POL A;  4IKH A;  3F4S A;  4WF4 A;  4PQ1 A;  3AY8 A;  3ZYW A;  3VUR A;  1ZYQ B;  1OC9 A;  1PRX A;  2VL9 A;  2MYG A;  3GL3 A;  1DE1 A;  1U87 A;  2FLS A;  3D0Z A;  5D9T A;  2WFC A;  3ZIT A;  3IA1 A;  3KP8 A;  3FYG A;  4F82 A;  1QMV A;  5BMU A;  4PQI A;  2MMA A;  4EO3 A;  3CSH A;  4MJB A;  1BX9 A;  3DGQ A;  5ID2 B;  5G1L A;  3D4M A;  2RII A;  4A5P A;  4EKZ A;  4ZIJ A;  3P2A A;  4NAX A;  3VPQ A;  3TGZ A;  1GNE A;  3FR6 A;  2O85 A;  1AAZ A;  4YAV A;  5EL8 A;  4YKF A;  3APQ A;  2OBI A;  5DCG A;  4MJC A;  4Q5R A;  2EC4 A;  2H0H A;  16GS A;  4ECC A;  4RUV A;  5A4V A;  5D9W A;  4X4J A;  2LUS A;  3C1R A;  2HZF A;  3IK9 A;  1K0N A;  1QUW A;  2IMK A;  4NV5 A;  2CVK A;  2MBT A;  5G5F A;  2HFD A;  2PGT A;  1I5G A;  3CRT A;  3KMN A;  2I9H A;  4OFN A;  1GP1 A;  5IIZ A;  1F2E A;  5HQP A;  2ZNM A;  1OC3 A;  1SEN A;  3BOA A;  4ZL7 A;  1EWX A;  3H93 A;  4GWR A;  2HRN A;  2VM2 A;  2L6D A;  3D4T A;  4POK A;  3HA9 A;  3I9V 2;  2KP1 A;  1PD2 1;  4RQX A;  4MPG A;  1PL2 A;  2FWE A;  1ZCP A;  1TTZ A;  2REM A;  4EUY A;  5CRW A;  1KBN A;  1Q4J A;  1XW5 A;  1KNG A;  4QL9 A;  2H72 A;  4IW9 A;  3KZQ A;  4TR4 A;  4CDO A;  1VGL A;  5B7C A;  2ES7 A;  2L4Q A;  3RPN A;  4FYU A;  1U3I A;  3F6F A;  1TP9 A;  2HYX A;  5IO2 A;  3MYD A;  2V6K A;  1V2A A;  1QFN A;  2FHE A;  1SD8 A;  3M9J A;  1Y6E A;  1ML6 A;  3PPU A;  1JLV A;  4L0U A;  4BVY A;  1Z7R A;  1RK4 A;  1JZO A;  5E4W A;  4J2F A;  5CO3 A;  1TOF A;  4G2E A;  1V57 A;  4WR4 A;  5A5K A;  17GS A;  3QPM A;  4IEL A;  4PTS A;  1ZYP A;  2DIZ A;  5IMZ A;  2X4A A;  1JZD A;  2M46 A;  3C73 A;  2X49 A;  3TRQ A;  4KND A;  1ZL9 A;  2XPD A;  2JSY A;  4BVX A;  1H4O A;  5KN1 A;  2N5F A;  1AW9 A;  3FZ4 A;  2B5Y A;  3RDW A;  3QOU A;  3EPT A;  2GSS A;  5KN2 A;  1XCC A;  4BVY B;  2LJA A;  1B4P A;  1HQO A;  2GLR A;  1TU8 A;  4WR5 A;  1E2Y A;  2GZY A;  2CA8 A;  6GSW A;  1GSQ A;  2K18 A;  5C04 A;  1QK8 A;  1QXH A;  2WGR A;  5ELG A;  1X5D A;  2DBC A;  5G31 A;  5JCW A;  1ON4 A;  1PGT A;  2H6Z A;  2X64 A;  1MDI A;  4NHW A;  3FHK A;  4WBR D;  4I8B A;  3GRX A;  2MZC A;  4BVX B;  3IC4 A;  4Z2R A;  3I69 A;  4KUN A;  4XIH A;  1OE8 A;  4AGS A;  2DSA A;  2BJX A;  1V40 A;  4MJA A;  2H1B A;  4CW9 A;  4HZ4 A;  2C3T A;  3LWA A;  1EEM A;  2A2S A;  3QDN A;  1XW6 A;  2DML A;  3KEB A;  1AXD A;  3MAK A;  3TKS E;  2K8S A;  1PL1 A;  2HLS A;  3HVX A;  1OVN A;  3DKS A;  5ELA A;  5AIX A;  2FWG A;  3TOT A;  2DJ1 A;  3GMF A;  5B6N A;  2VL2 C;  1I9D A;  5INY A;  1R5A A;  1SJI A;  4KW6 A;  1A0R P;  2EIQ A;  4IP6 A;  3GKX A;  1PN0 A;  4BWS A;  2LTK A;  4YKG A;  5G5E A;  5BRT A;  3TJG A;  1X9S B;  3L0H A;  4GQF A;  1B9Y C;  2DJ3 A;  4XS1 A;  2F9S A;  1YZX A;  2YP6 A;  2LJR A;  5HR1 A;  2IPA A;  2VLU A;  2B5E A;  4TXO A;  2BTO T;  3LQ7 A;  4G0I A;  1LU4 A;  3L9U A;  5KOX A;  1ST9 A;  5IQY A;  2N5B A;  3RPP A;  2MBS A;  5ENU A;  1QQ2 A;  2IFQ A;  1BYE A;  3LEF A;  5LD0 A;  3HJO A;  2AUV A;  2LQQ A;  2V6O A;  1WOU A;  2HT9 A;  4XRD A;  2I81 A;  4N30 A;  2YV9 A;  1SKS B;  4F0C A;  1Z3E A;  2P5R A;  4AJ8 A;  4ECI A;  3DIE A;  1XWK A;  3LGC A;  4CHS A;  3KMO A;  2AB6 A;  5J9C A;  3ED3 A;  4TXO B;  4FQU A;  4EL1 A;  3VPT A;  4IVF A;  1B4Q A;  2YWM A;  2A4H A;  3D6I A;  2H73 A;  5GAP D;  1O7U A;  1X0R A;  4X43 A;  1ERT A;  3GUS A;  1M2A A;  2GS3 A;  4ZBA A;  3ZVJ A;  2KUC A;  2EIO A;  2IFQ B;  2PU9 C;  2OAD A;  2HZE A;  3GFK A;  5IOW A;  4WF5 A;  12GS A;  3VI5 A;  2R6K A;  2CVD A;  4BWQ A;  2X8C A;  4TN8 A;  3QD9 A;  3ZFL A;  4PNG A;  4NMU A;  4GLT A;  5JWO B;  5KOW A;  3ZRE A;  2LS5 A;  1K0D A;  4G10 A;  4EDZ A;  2V32 A;  6GST A;  4K7O A;  4NWY A;  3A5I A;  3F0I A;  4GRF A;  1NM3 A;  3Q19 A;  2GSQ A;  3IDV A;  3KGK A;  4HJM A;  2YWN A;  5HFK A;  4EVM A;  1FG4 A;  2QKE A;  3ME7 A;  19GS A;  2H8L A;  3F6D A;  4HU7 A;  4WEY A;  3H4K A;  3ZMK A;  4DEJ A;  3UEM A;  3Q18 A;  1K0M A;  3M1G A;  2H66 A;  4ZB9 A;  1MDJ A;  4I2T A;  1ILO A;  1XFL A;  1S3A A;  1GSY A;  3SWL A;  1O6J A;  3IR4 A;  2H71 A;  2RM6 A;  3FMW A;  4H86 A;  3TJK A;  3EIN A;  5HFG A;  4DSQ A;  3GUR A;  5J9B A;  4EIQ A;  4KH7 A;  5CRE A;  2CZ3 A;  4GCI A;  1ZYE A;  4KSO A;  2FUG 2;  2PUK C;  5F0G A;  3V1W A;  2CAI A;  1O85 A;  1XWB A;  2PER A;  4V2N A;  4BL7 A;  3CSI A;  2E0Q A;  22GS A;  1G6Y A;  3IHQ A;  4MH2 A;  4YQM A;  1SK1 A;  1EZK A;  4I2U A;  4DSS B;  2V1M A;  1M2B A;  2F3M A;  4G9H A;  1K0A A;  3FZ9 A;  4ZBB A;  4X1U A;  1GLQ A;  3GA4 A;  2B1K A;  3MWH A;  4G0L A;  2O87 A;  3F4R A;  4J56 E;  5DJL A;  2ON5 A;  1TRS A;  4PUR A;  2E2M A;  5DQY A;  3Q6O A;  2GST A;  1H75 A;  1WWJ A;  2LRC A;  2BMX A;  3KIJ A;  2TRX A;  2FGX A;  3EUR A;  3W8J A;  4MCU A;  3UAR A;  3MSZ A;  3DEX A;  5JCU A;  4MMM A;  3ERG A;  4EF0 A;  3N9J A;  1R5P A;  4MF5 A;  1SYX A;  4NHZ A;  3HDC A;  1GTU A;  3K8N A;  1TW9 A;  4LL1 B;  4ISD A;  1LJR A;  3PGT A;  1TKD B;  2WDU A;  4EIP A;  2IWT A;  1PKZ A;  3IPZ A;  2GQL A;  1Z6M A;  3GKM A;  3CTG A;  2B1L A;  3M8N A;  1FVK A;  4V1A g;  3L9V A;  1U3A A;  2K8V A;  1J08 A;  1DUG A;  4RI7 A;  1K3O A;  3GST A;  2X99 A;  3ERF A;  1A24 A;  1GLP A;  4YQV A;  1YJ6 A;  5IMF A;  2VM1 A;  1IYH A;  1TRW A;  4PUF C;  4AF2 A;  1EEJ A;  3GH6 A;  4LA1 A;  4K1F A;  3GN3 A;  1JZW A;  2C1Y A;  4IHU A;  3KCM A;  4F03 A;  3ISO A;  4YH2 A;  1XW9 A;  1TK5 B;  4JZQ A;  3R3E A;  1XPV A;  2R5G A;  3E3E A;  2IMF A;  3TKQ A;  1S3D A;  3IE3 A;  1M9B A;  2VLT A;  3KD0 A;  5LNK e;  1DBY A;  1R4W A;  4N0V A;  5IMV A;  3QAV A;  3IHG A;  4I6X A;  1TK8 B;  4F9Z A;  3SBC A;  2XBQ A;  3LYP A;  1G7E A;  2HRA A;  1HNB A;  3ZVJ D;  3F3Q A;  3GSS A;  3VLN A;  1ZGN A;  4MH3 A;  4LMW A;  2H1G A;  2GGT A;  5D93 A;  3FW2 A;  1T4Z A;  3UIW A;  2O89 A;  1O8X A;  3VWU A;  3ME8 A;  3HJP A;  2L5O A;  2LRT A;  1RQM A;  2H76 A;  2H1A A;  1N8J A;  1YY7 A;  4IJ3 A;  4X0X A;  2JZS A;  1F3A A;  4IN0 A;  1FW1 A;  3TKP A;  1BG5 A;  3UVH A;  5JCG A;  2FD3 A;  3O76 A;  1YEP A;  2DIY A;  2VCW A;  3H8Q A;  1SJ6 A;  4BPY A;  4GST A;  1NW2 A;  1YF0 A;  2C8U A;  2PN8 A;  1AQW A;  3FY7 A;  1SK2 A;  3FR3 A;  1RW1 A;  2E2G A;  2GZP A;  2R0P A;  4HI7 A;  3H79 A;  4MJE A;  5L71 A;  3D21 A;  1PN9 A;  1TDI A;  3VFI A;  2Z9S A;  4L8E A;  3UJ1 A;  5HR2 A;  2C3N A;  1U88 A;  5DDL A;  5JWQ B;  2VCT A;  3ZRD A;  2B6M A;  4KDY A;  1THO A;  4K7N A;  5ABR A;  4KA0 A;  4XHM A;  1EGO A;  4XTS A;  2FWF A;  4WXT A;  3BJ5 A;  5EY6 A;  2IN3 A;  5DAL B;  5J4U A;  4AJ7 A;  4ZL9 A;  1V9W A;  1YEX A;  1PMT A;  2JL4 A;  1A2J A;  2M80 A;  2H6Y A;  1TI1 A;  2HNL A;  1K3L A;  4LMV A;  4K2D A;  1OAZ A;  3O3T A;  3D22 A;  3UBK A;  4V2M A;  3RHB A;  1DE2 A;  2C0F A;  2OBK A;  4OFT A;  1DSB A;  1Q98 A;  5ECR B;  2LRN A;  1BED A;  1JFU A;  3IC8 A;  4HU9 A;  5IM9 A;  4Z2T A;  4O5R A;  4E8E A;  2P5Q A;  4N0Z A;  4XRA A;  3RAZ A;  3IBH A;  2WZ9 A;  1B8X A;  4P3Y B;  2AYT A;  4K0N A;  1A0F A;  5DBQ A;  3UMA A;  5DJM A;  4K2X A;  3HYP A;  3LXT A;  3H1N A;  4NPB A;  3ZL5 A;  2VO4 A;  9GSS A;  1XZO A;  1VF1 A;  4ULX A;  3DD3 A;  1CQH A;  2YOI A;  5ECK B;  4K5R A;  3GTU A;  5A4W A;  2R37 A;  5FT3 A;  3KTL A;  2FWH A;  2IMD A;  1YQ1 A;  4XS4 B;  1GSS A;  3GH9 A;  3VI7 A;  2F8F A;  2A2P A;  3CRU A;  3NOF A;  3F63 A;  5HFI A;  3A5W A;  2GQK A;  4HUA A;  5DVB A;  3FKF A;  3DWV A;  4EXJ A;  4FIW A;  3US3 A;  3BCI A;  4Z7X A;  1ZOF A;  2LNS A;  3FK8 A;  2VIM A;  4L5O A;  1GUM A;  3GTU B;  1FB0 A;  3C1S A;  3PIN A;  1ERW A;  5D73 A;  4K6X A;  3GIX A;  4PX1 A;  4PUA A;  2VD0 A;  2TIR A;  4F0B A;  1GL8 A;  3R2Q A;  4NXI A;  1PSQ A;  3HHV A;  4TKY A;  3FZ5 A;  4GTU A;  3UL3 A;  1SU9 A;  4K8M A;  7GSS A;  2CT6 A;  1SKW B;  1ZMA A;  1YDK A;  2YN1 A;  2P0G A;  2QA2 A;  1AC1 A;  4YAP A;  3VWW A;  1J0F A;  2WRT A;  2IL3 A;  4ZIL A;  1FOV A;  2YZH A;  4TVE A;  3WGD A;  2FA4 A;  1JZR A;  4GQC A;  1XWA A;  2LST A;  2GT5 A;  3GHA A;  2YV7 A;  5CP1 A;  2HI7 A;  2LNT A;  2DMM A;  5F05 A;  1ZZY A;  2C0G A;  4KDX A;  5EPF A;  4KCE A;  2C0D A;  4OO4 A;  3UOM A;  1Z9H A;  4MK3 A;  1FO5 A;  1G6W A;  1EP8 A;  3ZZX A;  4TXV A;  2PWJ A;  2H30 A;  2ON7 A;  2IMI A;  4FYB A;  4ML6 A;  1BAY A;  1M7T A;  4GF0 A;  5ECQ B;  2OE1 A;  3GX0 A;  3ZIJ A;  1TXX A;  3FR9 A;  4CY8 A;  3QAW A;  3IXR A;  3EE2 A;  2MMZ A;  4ACS A;  1C72 A;  4QL7 A;  2GSR A;  2YPM A;  1GWC A;  3TJJ A;  4HOJ A;  2HE3 A;  1A23 A;  1OKT A;  5IMC A;  2K6V A;  4PGT A;  4EE0 A;  4QQ7 A;  3FRC A;  3TKS A;  1T8E B;  3TUE A;  4ZXG A;  3F3R A;  3A2V A;  2AAW A;  4K9Z A;  2C80 A;  3WD6 A;  4LLR A;  3TCO A;  1S3C A;  2YZU A;  5CRD A;  1WJK A;  1MTC A;  4DSS A;  4MF7 A;  1A8Y A;  3HZ8 A;  3KP9 A;  5C00 A;  3ZIV A;  4ZBD A;  4TRX A;  2N5A A;  3F9U A;  4WBJ A;  2LQO A;  4Q5Q A;  1PQN A;  3G9B A;  1XWG A;  3MIX A;  4IBP A;  3IRA A;  3VWV A;  4MF6 A;  1PA3 A;  4IQA A;  5CNW A;  4OO5 A;  1MD3 A;  14GS A;  4Q5F A;  1PX6 A;  2HSY A;  4MAB A;  1WMJ A;  2R0G A;  3WT2 A;  5AN1 A;  2YWO A;  5CRH A;  2QSI A;  2DC5 A;  3P90 A;  1SJZ A;  3J7Y k;  2C3Q A;  3P8W A;  2HRK A;  4TR3 A;  3CYN A;  2H0I A;  3GYK A;  6GSY A;  1YKA A;  2WJU A;  6GSU A;  2V2G A;  5ECI B;  4HJ2 A;  2VCV A;  1T7P B;  3KH9 A;  2OAC A;  4KX4 A;  1X9W B;  4RQR A;  2IIY A;  3G7Y A;  4FYC A;  2DJ0 A;  2JSZ A;  4E8H A;  3LXZ A;  4WKW A;  3NIV A;  3C7M A;  2DJ2 A;  5IMA A;  2CQ9 A;  3J7Y b;  1Z6N A;  1GUL A;  5ECL B;  5A4U A;  2VUP A;  4FO5 A;  3NZN A;  1PKW A;  2M72 A;  1UC7 A;  3C8E A;  4POB A;  6GSS A;  5HR0 A;  4V2L A;  4JRR A;  2JAD A;  3W8S A;  2O8V B;  2LV3 A;  2MMO A;  4PNF A;  1TK0 B;  5KN3 A;  4JR4 A;  3CMI A;  2DJK A;  3EVI A;  1ERV A;  3GL5 A;  3TJB A;  5F06 A;  2RUF A;  3A2X A;  5IPH A;  5B6M A;  2CX3 A;  2C0E A;  11GS A;  1Z5Y E;  4GSS A;  4NV2 A;  3EYT A;  2NTO A;  5IPG A;  3MDK A;  4J57 E;  2V41 A;  3UAP A;  4HS1 A;  5ECN B;  3JCM L;  1WPI A;  2NBS A;  3E0U A;  5IO0 A;  2H0G A;  4JBB A;  1SL2 B;  4Z2U A;  4GXZ A;  2RUE A;  2J23 A;  3DML A;  4MDC A;  4DVC A;  2CAQ A;  3PR8 A;  4JED A;  2D2Z A;  4GSN A;  2VL3 A;  2G2Q A;  3DVW A;  2VCZ A;  1K0C A;  1XBS A;  4MNN A;  2XPE A;  3M0F A;  3EWL A;  4PXO A;  1A2M A;  2OE3 A;  1UA5 A;  13GS A;  3BBY A;  3HCZ A;  2PVO C;  1V98 A;  1YKC A;  1NHO A;  3LYK A;  2OJL A;  3N5O A;  3IK7 A;  1CQG A;  1VF3 A;  4HZ2 A;  1THX A;  1K0O A;  5LCZ A;  1X9M B;  2VCQ A;  4IQ1 A;  3IV4 A;  1OC9 B;  4O32 A;  1V58 A;  2ZUP A;  1GUH A;  3BCK A;  2XBI A;  3HD5 A;  4OFM A;  2H70 A;  1B9X C;  3TOU A;  3HVS A;  1E6B A;  3APS A;  3KH7 A;  4IP1 A;  1BJX A;  2NDO A;  1A8L A;  3ERW A;  1GTB A;  2B3S A;  2FA8 A;  2TRC P;  2YWI A;  2R4V A;  5DAL A;  1MD4 A;  3DVX A;  4EC0 A;  1EOH A;  1O73 A;  1JHB A;  1M2D A;  1O81 A;  2KOK A;  3LFL A;  2HSM A;  1NHY A;  1W89 A;  2GDR A;  2YNX A;  1LBK A;  1ZYN A;  5D96 A;  1VRS D;  1GH2 A;  5IOX A;  1HNC A;  1XVQ A;  2JAC A;  5D9X A;  5FWG A;  2ZCT A;  8GSS A;  1AIU A;  4HDE A;  1F3B A;  2JZR A;  3GNJ A;  4TR1 A;  4EDY A;  3KJY A;  2G0F A;  4HQZ A;  1ACV A;  2HRF A;  5ECO B;  1EP7 A;  3EMP A;  3WGE A;  1FB6 A;  4RI6 A;  3P7X A;  1SL0 B;  2OE0 A;  4N11 A;  4ICY A;  4L5L A;  1XOB A;  2F51 A;  1M9A A;  5J41 A;  2PBJ A;  2I4A A;  1FHE A;  2C4J A;  5AIV A;  3L78 A;  4MZC A;  1GNW A;  3LSZ A;  1QGV A;  5IMD A;  2R3X A;  3I6A A;  2QGV A;  1AUC A;  3RHC A;  1MDK A;  5EVO A;  3DXB A;  3I43 A;  4OMV A;  1OYJ A;  2WS2 A;  1WP0 A;  3D5J A;  4ZB6 A;  1Z7P A;  3HZ4 A;  2YJH A;  5ECM B;  4TR1 B;  5G2Z A;  3ZLP A;  4MZW A;  2F8A A;  4AJ6 A;  5KN0 A;  1GUK A;  6GSV A;  4XS4 A;  2NPB A;  3L4N A;  3LW9 A;  2K9F A;  1B48 A;  3G7I A;  2UZ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...