4NWYA

Crystal structure of the b' domain of human protein disulfide isomerase-like protein of the testis (pdilt)
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
128
structure length
128
Chain Sequence
SVIEYNTENKDLISELHIMSHMLLFVSKSSESYGIIIQHYKLASKEFQNKILFILVDADEPRNGRVFKYFRVTEVDIPSVQILNLSSDARYKMPSDDITYESLKKFGRSFLSKNATKHQSSEEIPKYW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Isomerase
molecule keywords Protein disulfide-isomerase-like protein of the testis
publication title Structure of the substrate-binding b' domain of the Protein disulfide isomerase-like protein of the testis.
pubmed doi rcsb
source organism Homo sapiens
total genus 47
structure length 128
sequence length 128
chains with identical sequence B, C, D
ec nomenclature ec 5.3.4.1: Protein disulfide-isomerase.
pdb deposition date 2013-12-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4nwyA00
3G7YA 3CRUA 3FW2A 4WBRD 2CA8A 1XW6A 3PR8A 5F8BA 4ZB6A 3ZREA 1PKWA 5ECQB 1JHBA 2KLXA 4ZBDA 3FZAA 4ACSA 1GP1A 2FHEA 2GSTA 1WOUA 2CAQA 2HT9A 3KMOA 4RQRA 3GH6A 1A2MA 3LXTA 3FY7A 1U88A 1BJXA 3H4KA 4JBBA 3W6GA 4XTSA 4IJIA 1CQHA 5HFKA 4MJCA 1JZRA 5FHIA 3GYKA 1PMTA 4GLTA 2HE3A 3K8NA 3W8SA 4EF0A 3GKMA 3DEXA 4GSSA 1BAYA 3TRPA 4XRAA 1MD3A 2VOCA 2XPDA 4YQUA 4IP6A 3UVTA 5ECRB 3IHQA 1G0TA 2CAIA 4AF2A 1ILOA 5IOWA 5J4UA 1WIKA 1TTZA 1G7EA 4OCEA 1THXA 1GH2A 2I3YA 4BL7A 1SKWB 3ZVJA 2O89A 1WMJA 2REMA 1PRXA 3L9UA 5G1KA 1NSWA 5G2ZA 2OKAA 2YZUA 3M0FA 16GSA 2H1AA 1X5CA 3L9VA 5KN1A 3MDKA 4ZL7A 1Z6MA 1F3BA 1Z7PA 4POKA 2ON5A 1GUMA 1SK0A 2K8VA 4K0GA 2MBSA 3ZMKA 2IMIA 2JADA 4NHZA 4FYCA 2B3SA 1M2DA 3F3QA 2KHPA 5AN1A 2VCTA 5J9BA 1TP9A 4EDYA 1BX9A 2LV3A 1XWBA 2DLXA 5HR1A 1XW5A 4KAEA 1WJKA 1GSQA 3GNJA 3HCZA 5IIZA 2CX4A 4D73A 1JZWA 4MCUA 1TXXA 2VCXA 2MMZA 4QL9A 5ABRA 3HZ8A 1SU9A 4GSNA 2HSYA 3BOAA 1VF3A 2WZ9A 6GSVA 4FO5A 1OC8A 2OBIA 1XXUA 3VWXA 1M2BA 3A3TA 1IYHA 1SD9A 1FVKA 1YKAA 5IPHA 2NTOA 2C3NA 3F63A 2KP1A 3TGZA 3QMXA 1ZOFA 3ZTLA 2IMFA 3M8NA 1GUKA 2H6ZA 4ZL8A 2O85A 3IOSA 4YH2A 4EDZA 3QOUA 2MBTA 3UMAA 4QQ7A 4PNFA 3PINA 3D4TA 1GTBA 2V2GA 2C80A 3D0ZA 4K7IA 2LKUA 4ML1A 4WR5A 1YF0A 3L0HA 3ZZXA 1KTEA 2NVLA 3F4TA 1XWCA 1GSFA 3GTUA 2IIYA 5F07A 3TJFA 1W4VA 5C04A 2VM1A 1B9XC 2N5FA 1GLPA 2C0FA 2G2QA 2L4CA 2VD0A 4HZ4A 5IMAA 4KDUA 1J0FA 2YJ7A 4OFMA 5HR3A 4EUYA 1UN2A 1EEMA 2ALBA 2B1KA 3CSHA 2WB9A 1PD21 4N11A 1AQXA 5LNKe 3QAGA 4MPFA 3J7Yk 2A2SA 3GKNA 3I69A 1YJ6A 3QPMA 4GQFA 3LGCA 5HFGA 3VI7A 4PUFC 3HJOA 2E7PA 5CRWA 2YWMA 6GSWA 1GSUA 1PX7A 2YANA 5IPGA 3KCMA 1EV4A 4TR4A 4MK3A 3KP8A 2FUG2 3J7Yb 2YNXA 2X64A 4ZBBA 1SKRB 1V57A 1GTAA 4Q5NA 5FT3A 2AYTA 1GL8A 2GZYA 1MEKA 1Z6NA 5ECKB 2B5YA 2L4QA 5GSSA 1OC9B 3IK7A 3HHVA 2Z9SA 3P2AA 18GSA 1NHYA 2YWNA 1EZKA 3TRQA 5LCZA 1GSSA 4NV5A 3TOTA 5COHA 2R37A 1A23A 1USBA 1YDKA 1FO5A 2WDUA 1XIYA 1OKDA 4EO3A 2QGVA 5A4VA 3HA9A 3VK9A 1V58A 3GMFA 3QR6A 4HZ2A 1J08A 2JU5A 2RUFA 2FLSA 1GTUA 1ABAA 1IYIA 4OD7A 4XS4B 4YQVA 4IKHA 5AGYA 3CRTA 4G9HA 6GSYA 3MSZA 4TXVA 1I5GA 4V2NA 3HKRA 4NXIA 4EVMA 5E59A 4L5OA 2EC4A 1G6WA 1GNEA 4RUVA 3C8EA 1GRXA 2WULA 3D6IA 2BTOT 1ML6A 3IE3A 2JZSA 2LEGA 5E4WA 1AQWA 1BEDA 3G9BA 1AQVA 2VCQA 2GQMA 4GRFA 1S3DA 2YZHA 2LJRA 4IVFA 3VI5A 3UBLA 1T1VA 1KNGA 5D73A 3IA1A 1RQMA 4OFNA 2LNSA 2V6OA 2N5AA 3A2VA 4KNDA 4K8MA 2DIYA 4P3YB 1XCCA 2LRNA 3GL3A 5JWRB 2LS5A 4JE1A 3QFAC 1FVJA 3F8UA 1PSQA 1YEXA 1EOHA 2VCWA 2YV7A 4PX1A 3D22A 1URMA 1M7TA 8GSSA 3HVVA 2IL3A 4F9ZA 4QL7A 1K0CA 1TU7A 3VPTA 1R4WA 2I1UA 2IN3A 3ZLPA 4POLA 2B6MA 3ED3A 1O6JA 4GWRA 4PQHA 4DSSB 3DWVA 4KCAA 3FR3A 1X5DA 1I9DA 2VAFA 1GSEA 4IQ1A 1V9WA 1AXDA 1YF1A 2VL2C 3QDNA 3TCOA 20GSA 4FH8A 3KP9A 5DCGA 4IQAA 2FA8A 3HD5A 4AJ6A 1QXHA 3RAZA 2LNTA 4HS1A 4LA1A 2CX3A 3GURA 2TIRA 2DIZA 3KM6A 3APOA 3F3RA 3M9KA 1MDJA 4MA9A 5AISA 4TR0A 4TVEA 1F3AA 5D93A 5ECOB 3IR4A 1GNWA 2EIOA 2HZEB 4NMUA 4ZILA 3W8JA 4K2DA 2OBKA 2MMOA 4G10A 3F9UA 4Z7XA 5IQYA 2B5XA 4O7HA 3EC3A 1GSDA 2IMDA 4N0ZA 2V1MA 3U5RE 3HJPA 1K0AA 5INYA 4BVYA 3DD3A 3IRAA 4KX4A 1EV9A 1LU4A 3GKKA 1JZDA 5HR2A 4L8EA 2DMLA 2PUKC 2GQLA 1XWGA 5D8IA 3I9V2 2L59A 4I8BA 3F4RA 4KCEA 4FIWA 4KGIA 4E8EA 1S3AA 3LWAA 1X0RA 2RM5A 3DKSA 4MP4A 3DIEA 5F06A 5JWOB 3LSZA 1JLWA 3EU4A 1A2JA 4MJAA 3GHAA 4J56E 2VCZA 3ZIVA 4I5QA 1UC7A 3HYPA 2C3QA 2C3TA 2CZ2A 2R4VA 4O32A 1DE1A 1K0NA 2YCDA 3H8QA 1A0FA 2GZZA 3KZQA 1M0UA 5ECSA 1QGVA 4F82A 3RDWA 1GTIA 3TKSC 4KW6A 1AIUA 3CSJA 2R3XA 1GUHA 4G19A 2HFDA 3GL5A 5IMZA 1A8LA 3QAWA 4X1UA 1DSBA 3ME7A 2X8HA 4X0XA 5ECPB 4MF7A 2DJ3A 1MDIA 1OVNA 3DXBA 4ULXA 4ECIA 4EE0A 4IP1A 3Q74A 2YOIA 4KDYA 1T00A 5D9VA 5IMCA 1FHEA 2VM2A 3IV4A 2GT5A 10GSA 4AJ7A 1H75A 1VF2A 3FZ5A 4TXOB 5DALB 2J9HA 3UEMA 3VWVA 5AIXA 4HJ2A 5A5KA 2X99A 2I4AA 3N9JA 1OC3A 2KOKA 3DRNA 2H0GA 3TKSE 2GSSA 1V98A 2AUVA 2FY6A 5ID2B 4MABA 1B48A 2YPMA 4TKYA 5CYYA 3O3TA 4GF0A 3VLNA 2F51A 5CRHA 5DBQA 5ECLB 7GSSA 2F9SA 1Z5YE 1TK5B 1XVQA 2EIRA 2C0DA 3P8WA 3EVIA 4RI6A 3EWLA 2A4VA 2FA4A 2CVKA 4K7NA 2CVBA 3VWWA 4BVXA 5D96A 5IM9A 3BJ5A 4DSRA 4H86A 2K9FA 2B5EA 3TKSA 3Q19A 1WP0A 2VL9A 1PKZA 5IO0A 3QFBC 1DUGA 2VCVA 1MD4A 1K3YA 1OC9A 4WXTA 3ZMLA 3WGEA 1SENA 3GX0A 2LQQA 2YWOA 4F0CA 3S9FA 2PN8A 3GH9A 13GSA 5ECMB 3KH7A 4ECJA 2BMXA 1JLVA 3LFLA 3IDVA 5D9TA 1XFLA 4OO5A 5IO2A 3QAVA 1T3BA 2XPEA 3D21A 1CQGA 4JEDA 4RI7A 3TDGA 3PH9A 1O7UA 1ERUA 1O8XA 3F6FA 5ENUA 4XS4A 3PGTA 1ACVA 3FRCA 5ECHB 2HLSA 4KSOA 2HXKA 2M80A 3C73A 1X9MB 3KEBA 4L0WA 1E2YA 1Z3EA 2LRCA 1ST9A 4E8HA 5G1LA 5GZZB 3GA4A 2X8CA 2JSZA 1PN9A 3TUEA 17GSA 2XHFA 1M2AA 4JZQA 3DVXA 1K0BA 2QSIA 5F0GA 4ZIJA 5J9CA 2H6XA 2YV9A 2QC7A 1PGTA 4K1FA 3BCIA 4WF4A 5IOXA 3GSTA 2IWTA 1V40A 2BJXA 4MDCA 3GRXA 1SK2A 5EL8A 2FNOA 4ZB8A 3WYWA 4YAPA 1W89A 3C71A 3TRXA 1HD2A 4OFTA 3MNGA 5H5SA 2DJKA 1AC1A 4I2UA 4BPYA 3SWLA 2LUSA 1U87A 4F0BA 1TI1A 5IMDA 4IBPA 4FYUA 11GSA 4WKWA 4MH3A 4I6XA 1NM3A 2ON7A 2HYXA 1YQ1A 3WGXA 2AJQB 1DE2A 3IAM2 4EXJA 4DSSA 1UA5A 2YP6A 3Q18A 2CVDA 3BD2A 2PVOC 1OE8A 1K0MA 3H1NA 3EMPA 1HNAA 1ZZYA 1ZMAA 1XWKA 1NHOA 3GSSA 4YQMA 4GQCA 2B1LA 4J2FA 3LEFA 5L71A 1PQNA 2B7JA 3LYPA 3TJJA 3WGDA 2RM6A 2PBJA 5DJMA 2MZCA 2RUEA 5DJLA 4I2TA 4WETA 1A24A 1N2AA 1YY7A 2H73A 4KA0A 2O7KA 2P5QA 2HZEA 4OWYA 2FWHA 1O8WA 2FD3A 1F6MC 1TRVA 1M9BA 3Q6OA 1WE0A 1M99A 5H5QA 1G7OA 2GTUA 2JZRA 2HNLA 1T8EB 3HDCA 1J9BA 2NBSA 2B7KA 3KJYA 4NV2A 1DBYA 2GGTA 5D9WA 2L5LA 2GZPA 1FOVA 5GAND 5H5RA 3APSA 2H74A 3MWHA 2H30A 1SL2B 1O73A 4TR3A 2GSQA 2MMAA 2IMKA 2HRNA 1ZCPA 1HNCA 2GVPA 12GSA 3NOFA 4MZBA 2E2MA 3KMNA 4L5LA 3UBKA 2VL3A 4ID0A 1WPIA 6GSXA 1U6TA 5CRGA 2WGRA 1LBKA 1O81A 5DCHA 2H6YA 3F4SA 2XBQA 3EYTA 2RLIA 4TN8A 1Q98A 2K18A 2WS2A 4IW9A 4ZB9A 3O6TA 4TR1B 4XHMA 4JR6A 3G7JA 2QKEA 1TI3A 3CTFA 2ZUPA 2PVQA 1WWJA 3IK9A 3RPPA 5ELGA 4LMWA 3O76A 2LJKA 4AGSA 1TJDA 3DVWA 2VUPA 3EMXA 4WF5A 1N8JA 4IS0A 3CYNA 1EGOA 2DMMA 2JZTA 1K0DA 4JRRA 3TJGA 3HJMA 4Q5QA 2DJ1A 3NIVA 1U3IA 4ML6A 1FAAA 2H72A 4KUNA 3KXOA 5ECIB 1OE7A 2C1YA 4JU5A 4TXOA 5DALA 2WFCA 2K8SA 3TKQA 4HQZA 3ZIJA 3P7XA 1R7HA 1TK8B 1VF1A 3DMLA 2OACA 1M9AA 2GSRA 1TDIA 3TJBA 1X9WB 1XBSA 2MMNA 1A2LA 3C1SA 2PGTA 5ID2A 5HFIA 2H75A 4FYBA 2L6DA 1SD8A 2X8GA 2FCHA 3MAKA 3OR5A 2IJYA 1AAZA 3ERGA 4DEJA 1FG4A 4ZBAA 2L5OA 1EP7A 1ZGNA 4MPGA 4I97A 4EKZA 5GSTA 1GWCA 2DJJA 1K0OA 3UARA 1B4QA 3I6AA 1PL2A 4X43A 2I9HA 9GSSA 3EURA 1Z9HA 4F2IA 3ISOA 1ZL9A 1Q4JA 2ZNMA 3LJRA 3GV1A 2LJAA 2LTKA 4HOJA 5B6NA 3RHCA 1HNBA 2LRTA 4XS6A 4XCSA 14GSA 3WT1A 2AB6A 2M72A 4HJMA 1MDKA 1V2AA 2CZ3A 2NDOA 4IELA 3TKPA 4N30A 5J3RA 2K6VA 4PQ1A 5JCGA 5ELAA 1R26A 1UVZA 4PXOA 5DAKB 4LLRA 3UAPA 1QMVA 4HUAA 2PU9C 3ME8A 2O8VB 2VL2A 3M9JA 3IAS2 1EP8A 3DGQA 1BQ7A 1SJ6A 2N5BA 3UJ1A 1SYRA 4IJ3A 1H4OA 1OKTA 3FR9A 2IMEA 1U3AA 4AJ8A 5GAPD 2VIMA 4POMA 3UVHA 3CSIA 3GKXA 4HI7A 1XZOA 22GSA 4ILFA 3ZVJD 1E6BA 5HR0A 5IMVA 2CT6A 2EIQA 1F2EA 4HQSA 5JCUA 1PA3A 3GX8A 4IGJA 2H0IA 2IFQB 4MZCA 4CW9A 1T7PB 3F0IA 1NW2A 1XOAA 2AV4A 2H1GA 3U6VA 4HU9A 5CP1A 3US3A 3UOMA 1QUWA 4K7OA 1A0RP 2GLRA 3L9SA 2F8AA 1TU8A 3FZ4A 2VD1A 3LXZA 1XVWA 2H19A 2M46A 5LD0A 1G6YA 1TRSA 2P0GA 2H01A 4PGTA 1F9MA 3D5JA 3KH9A 5EY6A 5DQSA 1ERTA 3HY2A 1WRYA 3A2XA 1QQ2A 1ZYEA 3LQ7A 2AHEA 2GS3A 4OCFA 4ECBA 5B8AA 2DJ2A 5JCWA 3A5WA 3BCKA 5B8BA 4V1Ap 2FWGA 2H70A 1X9SB 1TRUA 4DVCA 4PURA 3FK8A 4GXZA 4Q5RA 4IN0A 2HI7A 4MH2A 4NWYA 2KP2A 4OO4A 1RK4A 4LL4B 3VURA 2OE3A 3N5OA 2R6KA 2FGXA 3KGKA 3HXSA 4MF6A 3KTLA 3BBYA 3SBCA 1XPVA 1HYUA 1EWXA 1OAZA 1SKSB 4MZWA 2PERA 3E0UA 2E2GA 3F6DA 1ZYQB 3FEUA 3IPZA 3WD6A 1A8YA 3DYRA 1TW9A 5G31A 3CTGA 2L57A 5HQPA 5CRDA 4TRXA 1JFUA 5AIVA 5EPFA 1K3LA 3FYGA 2XBIA 3EE2A 3ERWA 4MJBA 2H1BA 2F8FA 1GLQA 1SJIA 3WT2A 2V32A 4XIHA 4BWSA 1XOBA 2L6CA 3E9JB 3TJKA 2LQOA 2OE0A 3APQA 1SL1B 2E0QA 1K3OA 2H71A 2DC5A 2V41A 3HVSA 4OMVA 4DSQA 3ZL5A 3TKRA 3G7IA 1T4YA 4O5RA 4TR1A 3FZ9A 5FWGA 2P31A 1FW1A 1SK1A 2H1DA 2RIIA 4N0VA 5CREA 1AUCA 1HQOA 4K0NA 2HZFA 2OA7A 2YN1A 2YWIA 1BYEA 3KTBA 2V6KA 2JSYA 3EU3A 3GFKA 4WBJA 2AAWA 5C00A 4PQIA 4ISDA 2VLVA 1FB6A 1F37A 2C4JA 6GSSA 4KDXA 2WCIA 1X5EA 3QCPA 5D9XA 1ERVA 3AY8A 1B8XA 1ON4A 1B4PA 2ES7A 3P90A 2PWJA 6GSTA 4F03A 3ZRDA 5B6MA 3VFIA 4EL1A 1VF4A 2H0HA 2LSTA 1EOGA 2F3MA 5DDLA 3ZFLA 4ZXGA 2J23A 3KIJA 5F05A 5CO3A 3CXGA 2OADA 2OE1A 4MF5A 5KN2A 1EGRA 3LG6A 5J41A 3M3MA 2XC2A 2D2ZA 4POBA 2JL4A 3LORA 5IMFA 2JACA 4LL1B 2PMTA 4XRDA 5A4WA 4HU7A 2MYGA 2WJUA 4GTUA 3EINA 3RPNA 2P5RA 1QFNA 5DVBA 3C1RA 1R5AA 4MMMA 4V2MA 4D73B 4NHWA 4XS1A 3VWUA 3GN3A 2VLUA 2GDRA 5KEJA 1FB0A 1YZXA 4V1Ag 5B7CA 2O87A 3JCML 3GIXA 2H76A 4PNGA 3CBUA 2C8UA 2HRFA 1GULA 1YKCA 5DAKA 4CDOA 2R2JA 4Q5FA 4LMVA 2PPTA 2TRXA 4ECCA 3M1GA 6GSUA 4NPBA 3FKFA 3CMIA 3L4NA 4PUAA 3LYKA 4KH7A 2VO4A 1C72A 4KB3A 3I43A 1YEPA 4HDEA 3UIWA 3IC4A 2ZCTA 3ZYWA 2C0GA 3VPQA 2H66A 1LJRA 4J57E 1RW1A 2C0EA 1JZOA 4KSMA 4ZL9A 2G0FA 1GSYA 5A4UA 1AW9A 3L78A 2GQKA 1VRSD 4BA7A 2FWEA 4TW5A 1KEBA 3KD0A 2IFQA 1SL0B 3HZ4A 2DJ0A 4WR4A 4RQXA 3V1WA 3GTUB 5G30A 1XW9A 4O92A 4BWQA 2CV4A 2A2RA 2I81A 4K6XA 2DSAA 5G5FA 1R5PA 2OJLA 3TB2A 1O85A 1SJZA 3ERFA 1XWAA 3ZITA 2HSHA 2CQ9A 1S3CA 1EEJA 3A2WA 5CAXA 1OYJA 4MJEA 3NZNA 2NPBA 4EC0A 3IBHA 3IXRA 1PL1A 4V2LA 1TRWA 3H93A 3UL3A 1ERWA 4CHSA 1Y25A 4L0UA 5KN0A 5DQYA 5JWQB 5J5NA 1KBNA 4NAXA 1QK8A 2GT6A 5G5EA 1TOFA 3H79A 1BG5A 2YJHA 2KUCA 3R2QA 1Y6EA 3QD9A 1Z7RA 3D4MA 19GSA 4MLYA 3FHKA 4TOPA 5KN3A 1PX6A 1MTCA 5EVOA 3HVXA 5CNWA 3TOUA 4N10A 1TK0B 5ECNB 2DBCA 1THOA 2TRCP 4K9ZA 4YAVA 3E3EA 3ZFBA 4KE3A 4JR4A 4HEA2 2FWFA 3RBTA 1SYXA 4WEYA 2WRTA 3RHBA 3C7MA 1VGLA 2H8LA 4GSTA 3FR6A 2IPAA 1B9YC 4GCIA 1TKDB 1T4ZA 4G2EA 2VLTA 4IHUA 2R5GA 3GUSA
chains in the Genus database with same CATH superfamily
3G7YA 3CRUA 3FW2A 4WBRD 2CA8A 1XW6A 3PR8A 5F8BA 4ZB6A 3ZREA 1PKWA 5ECQB 1JHBA 2KLXA 4ZBDA 3FZAA 4ACSA 1GP1A 2FHEA 2GSTA 1WOUA 2CAQA 2HT9A 3KMOA 4RQRA 3GH6A 1A2MA 2R0GA 3LXTA 3FY7A 1U88A 1BJXA 3H4KA 4JBBA 3W6GA 4XTSA 4IJIA 1CQHA 5HFKA 4MJCA 1JZRA 5FHIA 3GYKA 1PMTA 4GLTA 2HE3A 3K8NA 3W8SA 4EF0A 3GKMA 3DEXA 4GSSA 1BAYA 3TRPA 4XRAA 1MD3A 2VOCA 2XPDA 4YQUA 3FMWA 4IP6A 3UVTA 5ECRB 3IHQA 1G0TA 2CAIA 4K2XA 4AF2A 1ILOA 5IOWA 5J4UA 1WIKA 1TTZA 1G7EA 4OCEA 1THXA 1GH2A 2A4HA 2I3YA 4BL7A 1SKWB 3ZVJA 2O89A 1WMJA 2REMA 1PRXA 3L9UA 5G1KA 1NSWA 4G0LA 5G2ZA 2OKAA 2YZUA 3M0FA 16GSA 2H1AA 1X5CA 3L9VA 5KN1A 3MDKA 4ZL7A 1Z6MA 1F3BA 1Z7PA 4POKA 2ON5A 1GUMA 1SK0A 2K8VA 4K0GA 2MBSA 3ZMKA 2IMIA 2JADA 4NHZA 4FYCA 2B3SA 1M2DA 3F3QA 2KHPA 5AN1A 2VCTA 5J9BA 1TP9A 4EDYA 1BX9A 2LV3A 1XWBA 2DLXA 5HR1A 1XW5A 4KAEA 1WJKA 1GSQA 4Z2UA 3GNJA 3HCZA 5IIZA 2CX4A 4D73A 1JZWA 4MCUA 4BVYB 1TXXA 2VCXA 2MMZA 4QL9A 5ABRA 3HZ8A 1SU9A 4GSNA 2HSYA 3BOAA 1VF3A 2WZ9A 6GSVA 4FO5A 1OC8A 2OBIA 1XXUA 3VWXA 1M2BA 3A3TA 1IYHA 1SD9A 1FVKA 1YKAA 5IPHA 2NTOA 2C3NA 3F63A 2KP1A 3TGZA 3QMXA 1ZOFA 3ZTLA 2IMFA 3M8NA 1GUKA 2H6ZA 4ZL8A 2O85A 3IOSA 4YH2A 4EDZA 3QOUA 2MBTA 3UMAA 4QQ7A 4PNFA 3PINA 3D4TA 1GTBA 2V2GA 2C80A 3D0ZA 4K7IA 2LKUA 4ML1A 4WR5A 1YF0A 3L0HA 3ZZXA 1KTEA 2NVLA 3F4TA 1XWCA 4CY6A 1GSFA 2X49A 3GTUA 2IIYA 5F07A 3TJFA 1XG8A 1W4VA 5C04A 2VM1A 1B9XC 2N5FA 1GLPA 2C0FA 2G2QA 2L4CA 3IHGA 4MNNA 2VD0A 4HZ4A 5IMAA 4KDUA 1J0FA 2YJ7A 4OFMA 5HR3A 4EUYA 1UN2A 1EEMA 2ALBA 2B1KA 3CSHA 2WB9A 1PD21 4N11A 1AQXA 5LNKe 3QAGA 4MPFA 3J7Yk 2A2SA 3GKNA 3I69A 1YJ6A 3QPMA 4GQFA 3LGCA 5HFGA 3VI7A 4PUFC 3HJOA 2E7PA 5CRWA 2YWMA 6GSWA 1GSUA 1PX7A 2YANA 5IPGA 3KCMA 1EV4A 4TR4A 4MK3A 3KP8A 2FUG2 3J7Yb 2YNXA 4A5PA 2X64A 4ZBBA 4BVXB 1SKRB 1V57A 1GTAA 4Q5NA 5FT3A 2AYTA 1GL8A 2GZYA 1MEKA 1Z6NA 1M3IA 5ECKB 2B5YA 2L4QA 5GSSA 1OC9B 3IK7A 3HHVA 2Z9SA 3P2AA 18GSA 1NHYA 2YWNA 1EZKA 3TRQA 4CY8A 5LCZA 1GSSA 4NV5A 3TOTA 5COHA 2R37A 1A23A 1USBA 1YDKA 1FO5A 2WDUA 1XIYA 3MYDA 1OKDA 4EO3A 2QGVA 5A4VA 3HA9A 3VK9A 1V58A 3GMFA 3QR6A 4HZ2A 1J08A 2JU5A 2RUFA 2FLSA 1GTUA 4YKGA 1ABAA 1IYIA 4OD7A 4XS4B 4YQVA 4IKHA 5AGYA 2HSMA 3CRTA 4G9HA 6GSYA 3MSZA 4TXVA 1I5GA 4V2NA 3HKRA 4NXIA 4EVMA 5E59A 4L5OA 2EC4A 1G6WA 1GNEA 4RUVA 3C8EA 1GRXA 2WULA 3D6IA 2BTOT 1ML6A 3IE3A 2JZSA 2LEGA 5E4WA 1AQWA 1BEDA 3G9BA 1AQVA 2VCQA 2GQMA 4GRFA 1S3DA 2YZHA 2LJRA 4IVFA 3VI5A 3UBLA 1T1VA 1KNGA 5D73A 3IA1A 1RQMA 4OFNA 2LNSA 2V6OA 2N5AA 3A2VA 4KNDA 4K8MA 2DIYA 4P3YB 1XCCA 2LRNA 3GL3A 5JWRB 5KOXA 2LS5A 4JE1A 3QFAC 1FVJA 3F8UA 1PSQA 1YEXA 1EOHA 2VCWA 4K5SA 2YV7A 4PX1A 3D22A 1URMA 3PPUA 1M7TA 8GSSA 3HVVA 2IL3A 4F9ZA 4QL7A 1K0CA 1TU7A 3VPTA 1R4WA 1S3RA 2I1UA 2IN3A 3ZLPA 4POLA 2B6MA 3ED3A 1O6JA 4GWRA 4PQHA 4DSSB 3DWVA 4KCAA 3FR3A 1X5DA 1I9DA 2VAFA 1GSEA 4IQ1A 1V9WA 1AXDA 1YF1A 2VL2C 3QDNA 3TCOA 20GSA 4FH8A 3KP9A 5DCGA 4IQAA 2FA8A 3HD5A 4AJ6A 1QXHA 3RAZA 2LNTA 4HS1A 4LA1A 2CX3A 3GURA 2TIRA 2DIZA 3KM6A 3APOA 3F3RA 3M9KA 1MDJA 4MA9A 5AISA 4TR0A 4TVEA 1F3AA 5D93A 5ECOB 3IR4A 1GNWA 4HSCX 2EIOA 2HZEB 4O5QA 4NMUA 4ZILA 3W8JA 4K2DA 2OBKA 2MMOA 4G10A 3F9UA 4Z7XA 5IQYA 2B5XA 4O7HA 3EC3A 1GSDA 2IMDA 4N0ZA 2V1MA 3U5RE 3HJPA 1K0AA 5INYA 4BVYA 3DD3A 3IRAA 4KX4A 1EV9A 1LU4A 3GKKA 1JZDA 5HR2A 4L8EA 2DMLA 2PUKC 2GQLA 4KF9A 1XWGA 5D8IA 3I9V2 2L59A 4I8BA 3F4RA 4KCEA 4FIWA 4KGIA 4E8EA 1S3AA 3LWAA 1X0RA 2RM5A 3DKSA 4MP4A 3DIEA 5F06A 5JWOB 3LSZA 1JLWA 3EU4A 1A2JA 4MJAA 3GHAA 4J56E 2VCZA 3ZIVA 4I5QA 1UC7A 3HYPA 2C3QA 2C3TA 2CZ2A 2R4VA 4O32A 1DE1A 1K0NA 2YCDA 3H8QA 4EIQA 1A0FA 2GZZA 3KZQA 1M0UA 5ECSA 1QGVA 4F82A 3RDWA 1GTIA 3TKSC 4KW6A 1AIUA 3CSJA 2R3XA 4G0KA 1GUHA 4G19A 2HFDA 3GL5A 5IMZA 1A8LA 3QAWA 4X1UA 1DSBA 3ME7A 2X8HA 4X0XA 5ECPB 4MF7A 2DJ3A 1MDIA 1OVNA 3DXBA 4ULXA 4ECIA 4EE0A 5KOWA 4IP1A 3Q74A 2YOIA 4KDYA 1T00A 5D9VA 5IMCA 1FHEA 2VM2A 3IV4A 2GT5A 10GSA 4AJ7A 1H75A 1VF2A 3FZ5A 4TXOB 5DALB 2J9HA 3UEMA 3VWVA 5AIXA 4HJ2A 5A5KA 2X99A 2I4AA 3N9JA 1OC3A 2KOKA 3DRNA 2H0GA 3TKSE 2GSSA 1V98A 2DKIA 2AUVA 2FY6A 4ICYA 5ID2B 4MABA 1B48A 2YPMA 4TKYA 5CYYA 3O3TA 4GF0A 3VLNA 2F51A 5CRHA 5DBQA 5ECLB 7GSSA 2F9SA 1Z5YE 1TK5B 1XVQA 2EIRA 2C0DA 3P8WA 3EVIA 4RI6A 3EWLA 2A4VA 2FA4A 2CVKA 4K7NA 2CVBA 3VWWA 4BVXA 5D96A 5IM9A 3BJ5A 4DSRA 4H86A 2K9FA 2B5EA 3TKSA 3Q19A 1WP0A 2VL9A 1PKZA 5IO0A 3QFBC 1DUGA 2VCVA 1MD4A 1K3YA 1OC9A 4WXTA 3ZMLA 3WGEA 1SENA 3GX0A 2LQQA 2YWOA 4F0CA 3S9FA 2PN8A 3GH9A 13GSA 5ECMB 3KH7A 4ECJA 2BMXA 1JLVA 3EPTA 3LFLA 3IDVA 5D9TA 1XFLA 4OO5A 5IO2A 3QAVA 1T3BA 2XPEA 3D21A 1CQGA 4JEDA 4RI7A 3TDGA 3PH9A 2R0CA 1PN0A 1O7UA 1ERUA 1O8XA 3F6FA 5ENUA 4XS4A 3PGTA 1ACVA 3FRCA 5ECHB 2HLSA 4KSOA 2HXKA 2M80A 3C73A 1X9MB 3KEBA 4L0WA 1E2YA 1Z3EA 2LRCA 1ST9A 4E8HA 5G1LA 5GZZB 3GA4A 2X8CA 2JSZA 1PN9A 3TUEA 17GSA 2XHFA 1M2AA 4JZQA 3DVXA 1K0BA 2QSIA 5F0GA 4ZIJA 4EIPA 5J9CA 4X4JA 2H6XA 2YV9A 2QC7A 1PGTA 4K1FA 3BCIA 4WF4A 5IOXA 3GSTA 2IWTA 1V40A 2BJXA 4MDCA 3GRXA 1SK2A 5EL8A 4O5UA 2FNOA 4ZB8A 3WYWA 4YAPA 1W89A 3C71A 3TRXA 1HD2A 4OFTA 3MNGA 1ZYNA 5H5SA 2DJKA 1AC1A 1PFOA 4I2UA 4BPYA 3SWLA 2LUSA 1U87A 4F0BA 4BIKA 1TI1A 5IMDA 4IBPA 4FYUA 11GSA 4WKWA 4MH3A 4I6XA 1NM3A 2ON7A 2HYXA 1YQ1A 3WGXA 2AJQB 4Z2RA 1DE2A 3IAM2 4EXJA 4DSSA 1UA5A 2YP6A 3Q18A 2CVDA 3BD2A 2PVOC 1OE8A 3CQFA 1K0MA 3H1NA 3EMPA 1HNAA 1ZZYA 1ZMAA 1XWKA 1NHOA 3GSSA 4YQMA 4GQCA 2B1LA 4J2FA 3LEFA 5L71A 1PQNA 2B7JA 3LYPA 3TJJA 3WGDA 2RM6A 2PBJA 5DJMA 2MZCA 2RUEA 5DJLA 4I2TA 4WETA 1A24A 1N2AA 1YY7A 2H73A 4KA0A 2O7KA 2P5QA 2HZEA 4OWYA 2FWHA 1O8WA 2FD3A 4USSA 1F6MC 1TRVA 1M9BA 3Q6OA 1WE0A 1M99A 5H5QA 1G7OA 2GTUA 2JZRA 2HNLA 1T8EB 3HDCA 1J9BA 2NBSA 2B7KA 3KJYA 4NV2A 1DBYA 2GGTA 5D9WA 4YKFA 2L5LA 2GZPA 1FOVA 5GAND 5H5RA 3APSA 2H74A 3MWHA 2H30A 1SL2B 1O73A 4TR3A 2GSQA 2MMAA 2IMKA 2HRNA 1ZCPA 1HNCA 2GVPA 12GSA 3NOFA 4MZBA 2E2MA 3KMNA 4L5LA 3UBKA 2VL3A 2X4AA 4ID0A 1WPIA 6GSXA 1U6TA 5CRGA 2WGRA 1LBKA 1O81A 5DCHA 2H6YA 3F4SA 2XBQA 3EYTA 2RLIA 4TN8A 1Q98A 2K18A 2WS2A 4IW9A 4ZB9A 3O6TA 4TR1B 4XHMA 4JR6A 4K5RA 3G7JA 2QKEA 1TI3A 3CTFA 2ZUPA 2PVQA 1WWJA 3IK9A 3RPPA 5ELGA 4LMWA 3O76A 2LJKA 4AGSA 1TJDA 3DVWA 2VUPA 3EMXA 4WF5A 1N8JA 4IS0A 3CYNA 1EGOA 1FOHA 2DMMA 2JZTA 1K0DA 4JRRA 3TJGA 3HJMA 4Q5QA 2DJ1A 3NIVA 1U3IA 4ML6A 1FAAA 2H72A 4KUNA 3KXOA 5ECIB 1OE7A 2C1YA 4JU5A 4TXOA 5DALA 2WFCA 2K8SA 3TKQA 4HQZA 3ZIJA 3P7XA 1R7HA 1TK8B 1VF1A 3DMLA 2OACA 1M9AA 2GSRA 1TDIA 3TJBA 1X9WB 1XBSA 2MMNA 1A2LA 3C1SA 2PGTA 5ID2A 5HFIA 2H75A 4FYBA 2L6DA 1SD8A 2X8GA 2FCHA 3MAKA 3OR5A 2IJYA 1AAZA 3ERGA 4DEJA 1FG4A 2R0PA 4ZBAA 2L5OA 1EP7A 1ZGNA 4MPGA 4I97A 4EKZA 2HRKA 5GSTA 1GWCA 2DJJA 1K0OA 3UARA 1B4QA 3I6AA 1PL2A 4X43A 2I9HA 9GSSA 3EURA 1Z9HA 4F2IA 3ISOA 1ZL9A 1Q4JA 2ZNMA 3LJRA 3GV1A 2LJAA 2LTKA 4HOJA 5B6NA 3RHCA 1HNBA 2LRTA 4XS6A 4XCSA 14GSA 3WT1A 2AB6A 2M72A 4HJMA 1MDKA 1V2AA 2CZ3A 2NDOA 4IELA 3TKPA 4N30A 5J3RA 2K6VA 4PQ1A 5JCGA 5ELAA 5BRTA 1R26A 1UVZA 4PXOA 5DAKB 4LLRA 3UAPA 1QMVA 4HUAA 2PU9C 3ME8A 2O8VB 2VL2A 3M9JA 3IAS2 1EP8A 3DGQA 1BQ7A 1SJ6A 2N5BA 3UJ1A 1SYRA 4IJ3A 1H4OA 1OKTA 3FR9A 2IMEA 1U3AA 4AJ8A 5GAPD 2VIMA 4POMA 3UVHA 3CSIA 3GKXA 4HI7A 1XZOA 22GSA 4ILFA 3ZVJD 1E6BA 5HR0A 5IMVA 2CT6A 2EIQA 1ZYPA 1F2EA 4HQSA 5JCUA 1PA3A 3GX8A 4IGJA 2H0IA 2IFQB 4MZCA 4CW9A 1T7PB 3F0IA 1NW2A 1XOAA 2AV4A 2H1GA 3U6VA 4HU9A 5CP1A 3US3A 3UOMA 1QUWA 4K7OA 1A0RP 2GLRA 3L9SA 2F8AA 1TU8A 3FZ4A 2VD1A 3LXZA 1XVWA 2H19A 2M46A 5LD0A 1G6YA 1TRSA 2P0GA 2H01A 4PGTA 1F9MA 3D5JA 3KH9A 5EY6A 5DQSA 1ERTA 3HY2A 1WRYA 3A2XA 1QQ2A 1ZYEA 3LQ7A 2AHEA 2GS3A 4OCFA 4ECBA 5B8AA 2DJ2A 5JCWA 3A5WA 3BCKA 5B8BA 4V1Ap 2FWGA 2H70A 1X9SB 1TRUA 4DVCA 4PURA 3FK8A 4GXZA 4Q5RA 4IN0A 2HI7A 4MH2A 4NWYA 2KP2A 4OO4A 1RK4A 4LL4B 3VURA 2OE3A 3N5OA 2R6KA 2FGXA 3KGKA 3HXSA 4MF6A 4G0IA 3KTLA 3BBYA 3SBCA 2QA1A 1XPVA 1HYUA 1EWXA 1OAZA 1SKSB 4MZWA 2PERA 3E0UA 2E2GA 3F6DA 1ZYQB 3FEUA 3IPZA 3WD6A 1A8YA 3DYRA 1TW9A 5G31A 3CTGA 3R3EA 2L57A 5HQPA 5CRDA 4TRXA 1JFUA 5AIVA 5EPFA 1K3LA 3FYGA 2XBIA 3EE2A 3ERWA 4MJBA 2H1BA 2F8FA 1GLQA 1SJIA 3WT2A 2V32A 4XIHA 4BWSA 1XOBA 2L6CA 3E9JB 3TJKA 2LQOA 2OE0A 3APQA 1SL1B 2E0QA 1K3OA 2H71A 2DC5A 2V41A 3HVSA 4OMVA 4DSQA 3ZL5A 3TKRA 3G7IA 1T4YA 4O5RA 4TR1A 3FZ9A 5FWGA 2P31A 1FW1A 1SK1A 2DKHA 2H1DA 2RIIA 4N0VA 5CREA 1AUCA 1HQOA 4K0NA 2HZFA 2OA7A 2YN1A 2YWIA 1BYEA 3KTBA 2V6KA 2JSYA 3EU3A 3GFKA 4WBJA 2AAWA 5C00A 4PQIA 4ISDA 2VLVA 1FB6A 1F37A 2C4JA 6GSSA 4KDXA 2WCIA 1X5EA 3IC8A 3QCPA 5D9XA 1ERVA 3AY8A 1B8XA 1ON4A 1B4PA 2ES7A 3P90A 2PWJA 6GSTA 4BL7B 4F03A 3ZRDA 5B6MA 3HVNA 3VFIA 4EL1A 1VF4A 2H0HA 2LSTA 1EOGA 2F3MA 5DDLA 3ZFLA 4ZXGA 3A5IA 2J23A 3KIJA 5F05A 5CO3A 3CXGA 2OADA 2OE1A 4MF5A 5KN2A 1EGRA 3LG6A 1M3JA 5J41A 3M3MA 2XC2A 2D2ZA 4POBA 2JL4A 3LORA 5IMFA 2JACA 4LL1B 2PMTA 4XRDA 5A4WA 4HU7A 2MYGA 2WJUA 4GTUA 3EINA 3RPNA 2P5RA 1QFNA 5DVBA 3C1RA 1R5AA 4MMMA 4V2MA 4D73B 4NHWA 4XS1A 3VWUA 3GN3A 2VLUA 2GDRA 4Z2TA 5KEJA 1FB0A 1YZXA 4V1Ag 5B7CA 2O87A 3JCML 3GIXA 2H76A 4PNGA 3CBUA 2A2PA 2C8UA 2HRFA 1GULA 1YKCA 5DAKA 4CDOA 2R2JA 4Q5FA 4LMVA 2PPTA 2TRXA 4ECCA 3M1GA 6GSUA 4NPBA 3FKFA 3CMIA 3L4NA 4PUAA 3LYKA 4KH7A 2VO4A 1C72A 4KB3A 3I43A 1YEPA 4HDEA 3UIWA 3IC4A 2ZCTA 3ZYWA 2C0GA 3VPQA 2UZ8A 2H66A 1LJRA 4J57E 1RW1A 2C0EA 1JZOA 4FQUA 4KSMA 4ZL9A 2G0FA 4PTSA 1GSYA 2QA2A 5A4UA 1AW9A 3L78A 2GQKA 1VRSD 4BA7A 2FWEA 4TW5A 1KEBA 3KD0A 2IFQA 1SL0B 3HZ4A 2DJ0A 4WR4A 4RQXA 3V1WA 3GTUB 5G30A 1XW9A 3LW9A 4O92A 4BWQA 2CV4A 5BMUA 2A2RA 2I81A 4K6XA 2DSAA 5G5FA 3MIXA 1R5PA 2OJLA 3TB2A 1O85A 1SJZA 3ERFA 1XWAA 3ZITA 2HSHA 2CQ9A 1S3CA 1EEJA 3A2WA 5CAXA 1OYJA 4MJEA 3NZNA 2NPBA 4EC0A 3IBHA 3IXRA 1PL1A 4V2LA 1TRWA 3H93A 3UL3A 1ERWA 4CHSA 1Y25A 4L0UA 5KN0A 5DQYA 5JWQB 5J5NA 1KBNA 4NAXA 1QK8A 2GT6A 5G5EA 1TOFA 3H79A 1BG5A 2YJHA 2KUCA 3R2QA 1Y6EA 3QD9A 1Z7RA 2HRAA 3D4MA 19GSA 4MLYA 3FHKA 4TOPA 5KN3A 1PX6A 1MTCA 5EVOA 3HVXA 5CNWA 3TOUA 4N10A 1TK0B 5ECNB 2DBCA 1THOA 2TRCP 4K9ZA 4YAVA 3E3EA 3ZFBA 4KE3A 4JR4A 4HEA2 2FWFA 3RBTA 1SYXA 4WEYA 2WRTA 3RHBA 3C7MA 1VGLA 2H8LA 4GSTA 3FR6A 2IPAA 1B9YC 4GCIA 1TKDB 1T4ZA 4G2EA 2VLTA 4IHUA 2R5GA 3GUSA
chains in the Genus database with same CATH topology
3G7YA 3CRUA 3FW2A 4WBRD 2CA8A 1XW6A 3PR8A 5F8BA 4ZB6A 3ZREA 1PKWA 5ECQB 1JHBA 2KLXA 4ZBDA 3FZAA 4ACSA 1GP1A 2FHEA 2GSTA 1WOUA 2CAQA 2HT9A 3KMOA 4RQRA 3GH6A 1A2MA 2R0GA 3LXTA 3FY7A 1U88A 1BJXA 3H4KA 4JBBA 3W6GA 4XTSA 4IJIA 1CQHA 5HFKA 4MJCA 1JZRA 5FHIA 3GYKA 1PMTA 4GLTA 2HE3A 3K8NA 3W8SA 4EF0A 3GKMA 3DEXA 4GSSA 1BAYA 3TRPA 4XRAA 1MD3A 2VOCA 2XPDA 4YQUA 3FMWA 4IP6A 3UVTA 5ECRB 3IHQA 1G0TA 2CAIA 4K2XA 4AF2A 1ILOA 5IOWA 5J4UA 1WIKA 1TTZA 1G7EA 4OCEA 1THXA 1GH2A 2A4HA 2I3YA 4BL7A 1SKWB 3ZVJA 2O89A 1WMJA 2REMA 1PRXA 3L9UA 5G1KA 1NSWA 4G0LA 5G2ZA 2OKAA 2YZUA 3M0FA 16GSA 2H1AA 1X5CA 3L9VA 5KN1A 3MDKA 4ZL7A 1Z6MA 1F3BA 1Z7PA 4POKA 2ON5A 1GUMA 1SK0A 2K8VA 4K0GA 2MBSA 3ZMKA 2IMIA 2JADA 4NHZA 4FYCA 2B3SA 1M2DA 3F3QA 2KHPA 5AN1A 2VCTA 5J9BA 1TP9A 4EDYA 1BX9A 2LV3A 1XWBA 2DLXA 5HR1A 1XW5A 4KAEA 1WJKA 1GSQA 4Z2UA 3GNJA 3HCZA 5IIZA 2CX4A 4D73A 1JZWA 4MCUA 4BVYB 1TXXA 2VCXA 2MMZA 4QL9A 5ABRA 3HZ8A 1SU9A 4GSNA 2HSYA 3BOAA 1VF3A 2WZ9A 6GSVA 4FO5A 1OC8A 2OBIA 1XXUA 3VWXA 1M2BA 3A3TA 1IYHA 1SD9A 1FVKA 1YKAA 5IPHA 2NTOA 2C3NA 3F63A 2KP1A 3TGZA 3QMXA 1ZOFA 3ZTLA 2IMFA 3M8NA 1GUKA 2H6ZA 4ZL8A 2O85A 3IOSA 4YH2A 4EDZA 3QOUA 2MBTA 3UMAA 4QQ7A 4PNFA 3PINA 3D4TA 1GTBA 2V2GA 2C80A 3D0ZA 4K7IA 2LKUA 4ML1A 4WR5A 1YF0A 3L0HA 3ZZXA 1KTEA 2NVLA 3F4TA 1XWCA 4CY6A 1GSFA 2X49A 3GTUA 2IIYA 5F07A 3TJFA 1W4VA 5C04A 2VM1A 1B9XC 2N5FA 1GLPA 2C0FA 2G2QA 2L4CA 3IHGA 4MNNA 2VD0A 4HZ4A 5IMAA 4KDUA 1J0FA 2YJ7A 4OFMA 5HR3A 4EUYA 1UN2A 1EEMA 2ALBA 2B1KA 3CSHA 2WB9A 1PD21 4N11A 1AQXA 5LNKe 3QAGA 4MPFA 3J7Yk 2A2SA 3GKNA 3I69A 1YJ6A 3QPMA 4GQFA 3LGCA 5HFGA 3VI7A 4PUFC 3HJOA 2E7PA 5CRWA 2YWMA 6GSWA 1GSUA 1PX7A 2YANA 5IPGA 3KCMA 1EV4A 4TR4A 4MK3A 3KP8A 2FUG2 3J7Yb 2YNXA 4A5PA 2X64A 4ZBBA 4BVXB 1SKRB 1V57A 1GTAA 4Q5NA 5FT3A 2AYTA 1GL8A 2GZYA 1MEKA 1Z6NA 5ECKB 2B5YA 2L4QA 5GSSA 1OC9B 3IK7A 3HHVA 2Z9SA 3P2AA 18GSA 1NHYA 2YWNA 1EZKA 3TRQA 4CY8A 5LCZA 1GSSA 4NV5A 3TOTA 5COHA 2R37A 1A23A 1USBA 1YDKA 1FO5A 2WDUA 1XIYA 3MYDA 1OKDA 4EO3A 2QGVA 5A4VA 3HA9A 3VK9A 1V58A 3GMFA 3QR6A 4HZ2A 1J08A 2JU5A 2RUFA 2FLSA 1GTUA 4YKGA 1ABAA 1IYIA 4OD7A 4XS4B 4YQVA 4IKHA 5AGYA 2HSMA 3CRTA 4G9HA 6GSYA 3MSZA 4TXVA 1I5GA 4V2NA 3HKRA 4NXIA 4EVMA 5E59A 4L5OA 2EC4A 1G6WA 1GNEA 4RUVA 3C8EA 1GRXA 2WULA 3D6IA 2BTOT 1ML6A 3IE3A 2JZSA 2LEGA 5E4WA 1AQWA 1BEDA 3G9BA 1AQVA 2VCQA 2GQMA 4GRFA 1S3DA 2YZHA 2LJRA 4IVFA 3VI5A 3UBLA 1T1VA 1KNGA 5D73A 3IA1A 1RQMA 4OFNA 2LNSA 2V6OA 2N5AA 3A2VA 4KNDA 4K8MA 2DIYA 4P3YB 1XCCA 2LRNA 3GL3A 5JWRB 5KOXA 2LS5A 4JE1A 3QFAC 1FVJA 3F8UA 1PSQA 1YEXA 1EOHA 2VCWA 4K5SA 2YV7A 4PX1A 3D22A 1URMA 3PPUA 1M7TA 8GSSA 3HVVA 2IL3A 4F9ZA 4QL7A 1K0CA 1TU7A 3VPTA 1R4WA 2I1UA 2IN3A 3ZLPA 4POLA 2B6MA 3ED3A 1O6JA 4GWRA 4PQHA 4DSSB 3DWVA 4KCAA 3FR3A 1X5DA 1I9DA 2VAFA 1GSEA 4IQ1A 1V9WA 1AXDA 1YF1A 2VL2C 3QDNA 3TCOA 20GSA 4FH8A 3KP9A 5DCGA 4IQAA 2FA8A 3HD5A 4AJ6A 1QXHA 3RAZA 2LNTA 4HS1A 4LA1A 2CX3A 3GURA 2TIRA 2DIZA 3KM6A 3APOA 3F3RA 3M9KA 1MDJA 4MA9A 5AISA 4TR0A 4TVEA 1F3AA 5D93A 5ECOB 3IR4A 1GNWA 2EIOA 2HZEB 4O5QA 4NMUA 4ZILA 3W8JA 4K2DA 2OBKA 2MMOA 4G10A 3F9UA 4Z7XA 5IQYA 2B5XA 4O7HA 3EC3A 1GSDA 2IMDA 4N0ZA 2V1MA 3U5RE 3HJPA 1K0AA 5INYA 4BVYA 3DD3A 3IRAA 4KX4A 1EV9A 1LU4A 3GKKA 1JZDA 5HR2A 4L8EA 2DMLA 2PUKC 2GQLA 4KF9A 1XWGA 5D8IA 3I9V2 2L59A 4I8BA 3F4RA 4KCEA 4FIWA 4KGIA 4E8EA 1S3AA 3LWAA 1X0RA 2RM5A 3DKSA 4MP4A 3DIEA 5F06A 5JWOB 3LSZA 1JLWA 3EU4A 1A2JA 4MJAA 3GHAA 4J56E 2VCZA 3ZIVA 4I5QA 1UC7A 3HYPA 2C3QA 2C3TA 2CZ2A 2R4VA 4O32A 1DE1A 1K0NA 2YCDA 3H8QA 4EIQA 1A0FA 2GZZA 3KZQA 1M0UA 5ECSA 1QGVA 4F82A 3RDWA 1GTIA 3TKSC 4KW6A 1AIUA 3CSJA 2R3XA 4G0KA 1GUHA 4G19A 2HFDA 3GL5A 5IMZA 1A8LA 3QAWA 4X1UA 1DSBA 3ME7A 2X8HA 4X0XA 5ECPB 4MF7A 2DJ3A 1MDIA 1OVNA 3DXBA 4ULXA 4ECIA 4EE0A 5KOWA 4IP1A 3Q74A 2YOIA 4KDYA 1T00A 5D9VA 5IMCA 1FHEA 2VM2A 3IV4A 2GT5A 10GSA 4AJ7A 1H75A 1VF2A 3FZ5A 4TXOB 5DALB 2J9HA 3UEMA 3VWVA 5AIXA 4HJ2A 5A5KA 2X99A 2I4AA 3N9JA 1OC3A 2KOKA 3DRNA 2H0GA 3TKSE 2GSSA 1V98A 2DKIA 2AUVA 2FY6A 4ICYA 5ID2B 4MABA 1B48A 2YPMA 4TKYA 5CYYA 3O3TA 4GF0A 3VLNA 2F51A 5CRHA 5DBQA 5ECLB 7GSSA 2F9SA 1Z5YE 1TK5B 1XVQA 2EIRA 2C0DA 3P8WA 3EVIA 4RI6A 3EWLA 2A4VA 2FA4A 2CVKA 4K7NA 2CVBA 3VWWA 4BVXA 5D96A 5IM9A 3BJ5A 4DSRA 4H86A 2K9FA 2B5EA 3TKSA 3Q19A 1WP0A 2VL9A 1PKZA 5IO0A 3QFBC 1DUGA 2VCVA 1MD4A 1K3YA 1OC9A 4WXTA 3ZMLA 3WGEA 1SENA 3GX0A 2LQQA 2YWOA 4F0CA 3S9FA 2PN8A 3GH9A 13GSA 5ECMB 3KH7A 4ECJA 2BMXA 1JLVA 3EPTA 3LFLA 3IDVA 5D9TA 1XFLA 4OO5A 5IO2A 3QAVA 1T3BA 2XPEA 3D21A 1CQGA 4JEDA 4RI7A 3TDGA 3PH9A 2R0CA 1PN0A 1O7UA 1ERUA 1O8XA 3F6FA 5ENUA 4XS4A 3PGTA 1ACVA 3FRCA 5ECHB 2HLSA 4KSOA 2HXKA 2M80A 3C73A 1X9MB 3KEBA 4L0WA 1E2YA 1Z3EA 2LRCA 1ST9A 4E8HA 5G1LA 5GZZB 3GA4A 2X8CA 2JSZA 1PN9A 3TUEA 17GSA 2XHFA 1M2AA 4JZQA 3DVXA 1K0BA 2QSIA 5F0GA 4ZIJA 4EIPA 5J9CA 4X4JA 2H6XA 2YV9A 2QC7A 1PGTA 4K1FA 3BCIA 4WF4A 5IOXA 3GSTA 2IWTA 1V40A 2BJXA 4MDCA 3GRXA 1SK2A 5EL8A 4O5UA 2FNOA 4ZB8A 3WYWA 4YAPA 1W89A 3C71A 3TRXA 1HD2A 4OFTA 3MNGA 1ZYNA 5H5SA 2DJKA 1AC1A 4I2UA 4BPYA 3SWLA 2LUSA 1U87A 4F0BA 1TI1A 5IMDA 4IBPA 4FYUA 11GSA 4WKWA 4MH3A 4I6XA 1NM3A 2ON7A 2HYXA 1YQ1A 3WGXA 2AJQB 4Z2RA 1DE2A 3IAM2 4EXJA 4DSSA 1UA5A 2YP6A 3Q18A 2CVDA 3BD2A 2PVOC 1OE8A 1K0MA 3H1NA 3EMPA 1HNAA 1ZZYA 1ZMAA 1XWKA 1NHOA 3GSSA 4YQMA 4GQCA 2B1LA 4J2FA 3LEFA 5L71A 1PQNA 2B7JA 3LYPA 3TJJA 3WGDA 2RM6A 2PBJA 5DJMA 2MZCA 2RUEA 5DJLA 4I2TA 4WETA 1A24A 1N2AA 1YY7A 2H73A 4KA0A 2O7KA 2P5QA 2HZEA 4OWYA 2FWHA 1O8WA 2FD3A 4USSA 1F6MC 1TRVA 1M9BA 3Q6OA 1WE0A 1M99A 5H5QA 1G7OA 2GTUA 2JZRA 2HNLA 1T8EB 3HDCA 1J9BA 2NBSA 2B7KA 3KJYA 4NV2A 1DBYA 2GGTA 5D9WA 4YKFA 2L5LA 2GZPA 1FOVA 5GAND 5H5RA 3APSA 2H74A 3MWHA 2H30A 1SL2B 1O73A 4TR3A 2GSQA 2MMAA 2IMKA 2HRNA 1ZCPA 1HNCA 2GVPA 12GSA 3NOFA 4MZBA 2E2MA 3KMNA 4L5LA 3UBKA 2VL3A 2X4AA 4ID0A 1WPIA 6GSXA 1U6TA 5CRGA 2WGRA 1LBKA 1O81A 5DCHA 2H6YA 3F4SA 2XBQA 3EYTA 2RLIA 4TN8A 1Q98A 2K18A 2WS2A 4IW9A 4ZB9A 3O6TA 4TR1B 4XHMA 4JR6A 4K5RA 3G7JA 2QKEA 1TI3A 3CTFA 2ZUPA 2PVQA 1WWJA 3IK9A 3RPPA 5ELGA 4LMWA 3O76A 2LJKA 4AGSA 1TJDA 3DVWA 2VUPA 3EMXA 4WF5A 1N8JA 4IS0A 3CYNA 1EGOA 1FOHA 2DMMA 2JZTA 1K0DA 4JRRA 3TJGA 3HJMA 4Q5QA 2DJ1A 3NIVA 1U3IA 4ML6A 1FAAA 2H72A 4KUNA 3KXOA 5ECIB 1OE7A 2C1YA 4JU5A 4TXOA 5DALA 2WFCA 2K8SA 3TKQA 4HQZA 3ZIJA 3P7XA 1R7HA 1TK8B 1VF1A 3DMLA 2OACA 1M9AA 2GSRA 1TDIA 3TJBA 1X9WB 1XBSA 2MMNA 1A2LA 3C1SA 2PGTA 5ID2A 5HFIA 2H75A 4FYBA 2L6DA 1SD8A 2X8GA 2FCHA 3MAKA 3OR5A 2IJYA 1AAZA 3ERGA 4DEJA 1FG4A 2R0PA 4ZBAA 2L5OA 1EP7A 1ZGNA 4MPGA 4I97A 4EKZA 2HRKA 5GSTA 1GWCA 2DJJA 1K0OA 3UARA 1B4QA 3I6AA 1PL2A 4X43A 2I9HA 9GSSA 3EURA 1Z9HA 4F2IA 3ISOA 1ZL9A 1Q4JA 2ZNMA 3LJRA 3GV1A 2LJAA 2LTKA 4HOJA 5B6NA 3RHCA 1HNBA 2LRTA 4XS6A 4XCSA 14GSA 3WT1A 2AB6A 2M72A 4HJMA 1MDKA 1V2AA 2CZ3A 2NDOA 4IELA 3TKPA 4N30A 5J3RA 2K6VA 4PQ1A 5JCGA 5ELAA 5BRTA 1R26A 1UVZA 4PXOA 5DAKB 4LLRA 3UAPA 1QMVA 4HUAA 2PU9C 3ME8A 2O8VB 2VL2A 3M9JA 3IAS2 1EP8A 3DGQA 1BQ7A 1SJ6A 2N5BA 3UJ1A 1SYRA 4IJ3A 1H4OA 1OKTA 3FR9A 2IMEA 1U3AA 4AJ8A 5GAPD 2VIMA 4POMA 3UVHA 3CSIA 3GKXA 4HI7A 1XZOA 22GSA 4ILFA 3ZVJD 1E6BA 5HR0A 5IMVA 2CT6A 2EIQA 1ZYPA 1F2EA 4HQSA 5JCUA 1PA3A 3GX8A 4IGJA 2H0IA 2IFQB 4MZCA 4CW9A 1T7PB 3F0IA 1NW2A 1XOAA 2AV4A 2H1GA 3U6VA 4HU9A 5CP1A 3US3A 3UOMA 1QUWA 4K7OA 1A0RP 2GLRA 3L9SA 2F8AA 1TU8A 3FZ4A 2VD1A 3LXZA 1XVWA 2H19A 2M46A 5LD0A 1G6YA 1TRSA 2P0GA 2H01A 4PGTA 1F9MA 3D5JA 3KH9A 5EY6A 5DQSA 1ERTA 3HY2A 1WRYA 3A2XA 1QQ2A 1ZYEA 3LQ7A 2AHEA 2GS3A 4OCFA 4ECBA 5B8AA 2DJ2A 5JCWA 3A5WA 3BCKA 5B8BA 4V1Ap 2FWGA 2H70A 1X9SB 1TRUA 4DVCA 4PURA 3FK8A 4GXZA 4Q5RA 4IN0A 2HI7A 4MH2A 4NWYA 2KP2A 4OO4A 1RK4A 4LL4B 3VURA 2OE3A 3N5OA 2R6KA 2FGXA 3KGKA 3HXSA 4MF6A 4G0IA 3KTLA 3BBYA 3SBCA 2QA1A 1XPVA 1HYUA 1EWXA 1OAZA 1SKSB 4MZWA 2PERA 3E0UA 2E2GA 3F6DA 1ZYQB 3FEUA 3IPZA 3WD6A 1A8YA 3DYRA 1TW9A 5G31A 3CTGA 3R3EA 2L57A 5HQPA 5CRDA 4TRXA 1JFUA 5AIVA 5EPFA 1K3LA 3FYGA 2XBIA 3EE2A 3ERWA 4MJBA 2H1BA 2F8FA 1GLQA 1SJIA 3WT2A 2V32A 4XIHA 4BWSA 1XOBA 2L6CA 3E9JB 3TJKA 2LQOA 2OE0A 3APQA 1SL1B 2E0QA 1K3OA 2H71A 2DC5A 2V41A 3HVSA 4OMVA 4DSQA 3ZL5A 3TKRA 3G7IA 1T4YA 4O5RA 4TR1A 3FZ9A 5FWGA 2P31A 1FW1A 1SK1A 2DKHA 2H1DA 2RIIA 4N0VA 5CREA 1AUCA 1HQOA 4K0NA 2HZFA 2OA7A 2YN1A 2YWIA 1BYEA 3KTBA 2V6KA 2JSYA 3EU3A 3GFKA 4WBJA 2AAWA 5C00A 4PQIA 4ISDA 2VLVA 1FB6A 1F37A 2C4JA 6GSSA 4KDXA 2WCIA 1X5EA 3IC8A 3QCPA 5D9XA 1ERVA 3AY8A 1B8XA 1ON4A 1B4PA 2ES7A 3P90A 2PWJA 6GSTA 4BL7B 4F03A 3ZRDA 5B6MA 3VFIA 4EL1A 1VF4A 2H0HA 2LSTA 1EOGA 2F3MA 5DDLA 3ZFLA 4ZXGA 3A5IA 2J23A 3KIJA 5F05A 5CO3A 3CXGA 2OADA 2OE1A 4MF5A 5KN2A 1EGRA 3LG6A 5J41A 3M3MA 2XC2A 2D2ZA 4POBA 2JL4A 3LORA 5IMFA 2JACA 4LL1B 2PMTA 4XRDA 5A4WA 4HU7A 2MYGA 2WJUA 4GTUA 3EINA 3RPNA 2P5RA 1QFNA 5DVBA 3C1RA 1R5AA 4MMMA 4V2MA 4D73B 4NHWA 4XS1A 3VWUA 3GN3A 2VLUA 2GDRA 4Z2TA 5KEJA 1FB0A 1YZXA 4V1Ag 5B7CA 2O87A 3JCML 3GIXA 2H76A 4PNGA 3CBUA 2A2PA 2C8UA 2HRFA 1GULA 1YKCA 5DAKA 4CDOA 2R2JA 4Q5FA 4LMVA 2PPTA 2TRXA 4ECCA 3M1GA 6GSUA 4NPBA 3FKFA 3CMIA 3L4NA 4PUAA 3LYKA 4KH7A 2VO4A 1C72A 4KB3A 3I43A 1YEPA 4HDEA 3UIWA 3IC4A 2ZCTA 3ZYWA 2C0GA 3VPQA 2UZ8A 2H66A 1LJRA 4J57E 1RW1A 2C0EA 1JZOA 4FQUA 4KSMA 4ZL9A 2G0FA 4PTSA 1GSYA 2QA2A 5A4UA 1AW9A 3L78A 2GQKA 1VRSD 4BA7A 2FWEA 4TW5A 1KEBA 3KD0A 2IFQA 1SL0B 3HZ4A 2DJ0A 4WR4A 4RQXA 3V1WA 3GTUB 5G30A 1XW9A 3LW9A 4O92A 4BWQA 2CV4A 5BMUA 2A2RA 2I81A 4K6XA 2DSAA 5G5FA 3MIXA 1R5PA 2OJLA 3TB2A 1O85A 1SJZA 3ERFA 1XWAA 3ZITA 2HSHA 2CQ9A 1S3CA 1EEJA 3A2WA 5CAXA 1OYJA 4MJEA 3NZNA 2NPBA 4EC0A 3IBHA 3IXRA 1PL1A 4V2LA 1TRWA 3H93A 3UL3A 1ERWA 4CHSA 1Y25A 4L0UA 5KN0A 5DQYA 5JWQB 5J5NA 1KBNA 4NAXA 1QK8A 2GT6A 5G5EA 1TOFA 3H79A 1BG5A 2YJHA 2KUCA 3R2QA 1Y6EA 3QD9A 1Z7RA 2HRAA 3D4MA 19GSA 4MLYA 3FHKA 4TOPA 5KN3A 1PX6A 1MTCA 5EVOA 3HVXA 5CNWA 3TOUA 4N10A 1TK0B 5ECNB 2DBCA 1THOA 2TRCP 4K9ZA 4YAVA 3E3EA 3ZFBA 4KE3A 4JR4A 4HEA2 2FWFA 3RBTA 1SYXA 4WEYA 2WRTA 3RHBA 3C7MA 1VGLA 2H8LA 4GSTA 3FR6A 2IPAA 1B9YC 4GCIA 1TKDB 1T4ZA 4G2EA 2VLTA 4IHUA 2R5GA 3GUSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G7Y A;  3CRU A;  3FW2 A;  4WBR D;  2CA8 A;  1XW6 A;  3PR8 A;  5F8B A;  4ZB6 A;  3ZRE A;  1PKW A;  5ECQ B;  1JHB A;  2KLX A;  4ZBD A;  3FZA A;  4ACS A;  1GP1 A;  2FHE A;  2GST A;  1WOU A;  2CAQ A;  2HT9 A;  3KMO A;  4RQR A;  3GH6 A;  1A2M A;  3LXT A;  3FY7 A;  1U88 A;  1BJX A;  3H4K A;  4JBB A;  3W6G A;  4XTS A;  4IJI A;  1CQH A;  5HFK A;  4MJC A;  1JZR A;  5FHI A;  3GYK A;  1PMT A;  4GLT A;  2HE3 A;  3K8N A;  3W8S A;  4EF0 A;  3GKM A;  3DEX A;  4GSS A;  1BAY A;  3TRP A;  4XRA A;  1MD3 A;  2VOC A;  2XPD A;  4YQU A;  4IP6 A;  3UVT A;  5ECR B;  3IHQ A;  1G0T A;  2CAI A;  4AF2 A;  1ILO A;  5IOW A;  5J4U A;  1WIK A;  1TTZ A;  1G7E A;  4OCE A;  1THX A;  1GH2 A;  2I3Y A;  4BL7 A;  1SKW B;  3ZVJ A;  2O89 A;  1WMJ A;  2REM A;  1PRX A;  3L9U A;  5G1K A;  1NSW A;  5G2Z A;  2OKA A;  2YZU A;  3M0F A;  16GS A;  2H1A A;  1X5C A;  3L9V A;  5KN1 A;  3MDK A;  4ZL7 A;  1Z6M A;  1F3B A;  1Z7P A;  4POK A;  2ON5 A;  1GUM A;  1SK0 A;  2K8V A;  4K0G A;  2MBS A;  3ZMK A;  2IMI A;  2JAD A;  4NHZ A;  4FYC A;  2B3S A;  1M2D A;  3F3Q A;  2KHP A;  5AN1 A;  2VCT A;  5J9B A;  1TP9 A;  4EDY A;  1BX9 A;  2LV3 A;  1XWB A;  2DLX A;  5HR1 A;  1XW5 A;  4KAE A;  1WJK A;  1GSQ A;  3GNJ A;  3HCZ A;  5IIZ A;  2CX4 A;  4D73 A;  1JZW A;  4MCU A;  1TXX A;  2VCX A;  2MMZ A;  4QL9 A;  5ABR A;  3HZ8 A;  1SU9 A;  4GSN A;  2HSY A;  3BOA A;  1VF3 A;  2WZ9 A;  6GSV A;  4FO5 A;  1OC8 A;  2OBI A;  1XXU A;  3VWX A;  1M2B A;  3A3T A;  1IYH A;  1SD9 A;  1FVK A;  1YKA A;  5IPH A;  2NTO A;  2C3N A;  3F63 A;  2KP1 A;  3TGZ A;  3QMX A;  1ZOF A;  3ZTL A;  2IMF A;  3M8N A;  1GUK A;  2H6Z A;  4ZL8 A;  2O85 A;  3IOS A;  4YH2 A;  4EDZ A;  3QOU A;  2MBT A;  3UMA A;  4QQ7 A;  4PNF A;  3PIN A;  3D4T A;  1GTB A;  2V2G A;  2C80 A;  3D0Z A;  4K7I A;  2LKU A;  4ML1 A;  4WR5 A;  1YF0 A;  3L0H A;  3ZZX A;  1KTE A;  2NVL A;  3F4T A;  1XWC A;  1GSF A;  3GTU A;  2IIY A;  5F07 A;  3TJF A;  1W4V A;  5C04 A;  2VM1 A;  1B9X C;  2N5F A;  1GLP A;  2C0F A;  2G2Q A;  2L4C A;  2VD0 A;  4HZ4 A;  5IMA A;  4KDU A;  1J0F A;  2YJ7 A;  4OFM A;  5HR3 A;  4EUY A;  1UN2 A;  1EEM A;  2ALB A;  2B1K A;  3CSH A;  2WB9 A;  1PD2 1;  4N11 A;  1AQX A;  5LNK e;  3QAG A;  4MPF A;  3J7Y k;  2A2S A;  3GKN A;  3I69 A;  1YJ6 A;  3QPM A;  4GQF A;  3LGC A;  5HFG A;  3VI7 A;  4PUF C;  3HJO A;  2E7P A;  5CRW A;  2YWM A;  6GSW A;  1GSU A;  1PX7 A;  2YAN A;  5IPG A;  3KCM A;  1EV4 A;  4TR4 A;  4MK3 A;  3KP8 A;  2FUG 2;  3J7Y b;  2YNX A;  2X64 A;  4ZBB A;  1SKR B;  1V57 A;  1GTA A;  4Q5N A;  5FT3 A;  2AYT A;  1GL8 A;  2GZY A;  1MEK A;  1Z6N A;  5ECK B;  2B5Y A;  2L4Q A;  5GSS A;  1OC9 B;  3IK7 A;  3HHV A;  2Z9S A;  3P2A A;  18GS A;  1NHY A;  2YWN A;  1EZK A;  3TRQ A;  5LCZ A;  1GSS A;  4NV5 A;  3TOT A;  5COH A;  2R37 A;  1A23 A;  1USB A;  1YDK A;  1FO5 A;  2WDU A;  1XIY A;  1OKD A;  4EO3 A;  2QGV A;  5A4V A;  3HA9 A;  3VK9 A;  1V58 A;  3GMF A;  3QR6 A;  4HZ2 A;  1J08 A;  2JU5 A;  2RUF A;  2FLS A;  1GTU A;  1ABA A;  1IYI A;  4OD7 A;  4XS4 B;  4YQV A;  4IKH A;  5AGY A;  3CRT A;  4G9H A;  6GSY A;  3MSZ A;  4TXV A;  1I5G A;  4V2N A;  3HKR A;  4NXI A;  4EVM A;  5E59 A;  4L5O A;  2EC4 A;  1G6W A;  1GNE A;  4RUV A;  3C8E A;  1GRX A;  2WUL A;  3D6I A;  2BTO T;  1ML6 A;  3IE3 A;  2JZS A;  2LEG A;  5E4W A;  1AQW A;  1BED A;  3G9B A;  1AQV A;  2VCQ A;  2GQM A;  4GRF A;  1S3D A;  2YZH A;  2LJR A;  4IVF A;  3VI5 A;  3UBL A;  1T1V A;  1KNG A;  5D73 A;  3IA1 A;  1RQM A;  4OFN A;  2LNS A;  2V6O A;  2N5A A;  3A2V A;  4KND A;  4K8M A;  2DIY A;  4P3Y B;  1XCC A;  2LRN A;  3GL3 A;  5JWR B;  2LS5 A;  4JE1 A;  3QFA C;  1FVJ A;  3F8U A;  1PSQ A;  1YEX A;  1EOH A;  2VCW A;  2YV7 A;  4PX1 A;  3D22 A;  1URM A;  1M7T A;  8GSS A;  3HVV A;  2IL3 A;  4F9Z A;  4QL7 A;  1K0C A;  1TU7 A;  3VPT A;  1R4W A;  2I1U A;  2IN3 A;  3ZLP A;  4POL A;  2B6M A;  3ED3 A;  1O6J A;  4GWR A;  4PQH A;  4DSS B;  3DWV A;  4KCA A;  3FR3 A;  1X5D A;  1I9D A;  2VAF A;  1GSE A;  4IQ1 A;  1V9W A;  1AXD A;  1YF1 A;  2VL2 C;  3QDN A;  3TCO A;  20GS A;  4FH8 A;  3KP9 A;  5DCG A;  4IQA A;  2FA8 A;  3HD5 A;  4AJ6 A;  1QXH A;  3RAZ A;  2LNT A;  4HS1 A;  4LA1 A;  2CX3 A;  3GUR A;  2TIR A;  2DIZ A;  3KM6 A;  3APO A;  3F3R A;  3M9K A;  1MDJ A;  4MA9 A;  5AIS A;  4TR0 A;  4TVE A;  1F3A A;  5D93 A;  5ECO B;  3IR4 A;  1GNW A;  2EIO A;  2HZE B;  4NMU A;  4ZIL A;  3W8J A;  4K2D A;  2OBK A;  2MMO A;  4G10 A;  3F9U A;  4Z7X A;  5IQY A;  2B5X A;  4O7H A;  3EC3 A;  1GSD A;  2IMD A;  4N0Z A;  2V1M A;  3U5R E;  3HJP A;  1K0A A;  5INY A;  4BVY A;  3DD3 A;  3IRA A;  4KX4 A;  1EV9 A;  1LU4 A;  3GKK A;  1JZD A;  5HR2 A;  4L8E A;  2DML A;  2PUK C;  2GQL A;  1XWG A;  5D8I A;  3I9V 2;  2L59 A;  4I8B A;  3F4R A;  4KCE A;  4FIW A;  4KGI A;  4E8E A;  1S3A A;  3LWA A;  1X0R A;  2RM5 A;  3DKS A;  4MP4 A;  3DIE A;  5F06 A;  5JWO B;  3LSZ A;  1JLW A;  3EU4 A;  1A2J A;  4MJA A;  3GHA A;  4J56 E;  2VCZ A;  3ZIV A;  4I5Q A;  1UC7 A;  3HYP A;  2C3Q A;  2C3T A;  2CZ2 A;  2R4V A;  4O32 A;  1DE1 A;  1K0N A;  2YCD A;  3H8Q A;  1A0F A;  2GZZ A;  3KZQ A;  1M0U A;  5ECS A;  1QGV A;  4F82 A;  3RDW A;  1GTI A;  3TKS C;  4KW6 A;  1AIU A;  3CSJ A;  2R3X A;  1GUH A;  4G19 A;  2HFD A;  3GL5 A;  5IMZ A;  1A8L A;  3QAW A;  4X1U A;  1DSB A;  3ME7 A;  2X8H A;  4X0X A;  5ECP B;  4MF7 A;  2DJ3 A;  1MDI A;  1OVN A;  3DXB A;  4ULX A;  4ECI A;  4EE0 A;  4IP1 A;  3Q74 A;  2YOI A;  4KDY A;  1T00 A;  5D9V A;  5IMC A;  1FHE A;  2VM2 A;  3IV4 A;  2GT5 A;  10GS A;  4AJ7 A;  1H75 A;  1VF2 A;  3FZ5 A;  4TXO B;  5DAL B;  2J9H A;  3UEM A;  3VWV A;  5AIX A;  4HJ2 A;  5A5K A;  2X99 A;  2I4A A;  3N9J A;  1OC3 A;  2KOK A;  3DRN A;  2H0G A;  3TKS E;  2GSS A;  1V98 A;  2AUV A;  2FY6 A;  5ID2 B;  4MAB A;  1B48 A;  2YPM A;  4TKY A;  5CYY A;  3O3T A;  4GF0 A;  3VLN A;  2F51 A;  5CRH A;  5DBQ A;  5ECL B;  7GSS A;  2F9S A;  1Z5Y E;  1TK5 B;  1XVQ A;  2EIR A;  2C0D A;  3P8W A;  3EVI A;  4RI6 A;  3EWL A;  2A4V A;  2FA4 A;  2CVK A;  4K7N A;  2CVB A;  3VWW A;  4BVX A;  5D96 A;  5IM9 A;  3BJ5 A;  4DSR A;  4H86 A;  2K9F A;  2B5E A;  3TKS A;  3Q19 A;  1WP0 A;  2VL9 A;  1PKZ A;  5IO0 A;  3QFB C;  1DUG A;  2VCV A;  1MD4 A;  1K3Y A;  1OC9 A;  4WXT A;  3ZML A;  3WGE A;  1SEN A;  3GX0 A;  2LQQ A;  2YWO A;  4F0C A;  3S9F A;  2PN8 A;  3GH9 A;  13GS A;  5ECM B;  3KH7 A;  4ECJ A;  2BMX A;  1JLV A;  3LFL A;  3IDV A;  5D9T A;  1XFL A;  4OO5 A;  5IO2 A;  3QAV A;  1T3B A;  2XPE A;  3D21 A;  1CQG A;  4JED A;  4RI7 A;  3TDG A;  3PH9 A;  1O7U A;  1ERU A;  1O8X A;  3F6F A;  5ENU A;  4XS4 A;  3PGT A;  1ACV A;  3FRC A;  5ECH B;  2HLS A;  4KSO A;  2HXK A;  2M80 A;  3C73 A;  1X9M B;  3KEB A;  4L0W A;  1E2Y A;  1Z3E A;  2LRC A;  1ST9 A;  4E8H A;  5G1L A;  5GZZ B;  3GA4 A;  2X8C A;  2JSZ A;  1PN9 A;  3TUE A;  17GS A;  2XHF A;  1M2A A;  4JZQ A;  3DVX A;  1K0B A;  2QSI A;  5F0G A;  4ZIJ A;  5J9C A;  2H6X A;  2YV9 A;  2QC7 A;  1PGT A;  4K1F A;  3BCI A;  4WF4 A;  5IOX A;  3GST A;  2IWT A;  1V40 A;  2BJX A;  4MDC A;  3GRX A;  1SK2 A;  5EL8 A;  2FNO A;  4ZB8 A;  3WYW A;  4YAP A;  1W89 A;  3C71 A;  3TRX A;  1HD2 A;  4OFT A;  3MNG A;  5H5S A;  2DJK A;  1AC1 A;  4I2U A;  4BPY A;  3SWL A;  2LUS A;  1U87 A;  4F0B A;  1TI1 A;  5IMD A;  4IBP A;  4FYU A;  11GS A;  4WKW A;  4MH3 A;  4I6X A;  1NM3 A;  2ON7 A;  2HYX A;  1YQ1 A;  3WGX A;  2AJQ B;  1DE2 A;  3IAM 2;  4EXJ A;  4DSS A;  1UA5 A;  2YP6 A;  3Q18 A;  2CVD A;  3BD2 A;  2PVO C;  1OE8 A;  1K0M A;  3H1N A;  3EMP A;  1HNA A;  1ZZY A;  1ZMA A;  1XWK A;  1NHO A;  3GSS A;  4YQM A;  4GQC A;  2B1L A;  4J2F A;  3LEF A;  5L71 A;  1PQN A;  2B7J A;  3LYP A;  3TJJ A;  3WGD A;  2RM6 A;  2PBJ A;  5DJM A;  2MZC A;  2RUE A;  5DJL A;  4I2T A;  4WET A;  1A24 A;  1N2A A;  1YY7 A;  2H73 A;  4KA0 A;  2O7K A;  2P5Q A;  2HZE A;  4OWY A;  2FWH A;  1O8W A;  2FD3 A;  1F6M C;  1TRV A;  1M9B A;  3Q6O A;  1WE0 A;  1M99 A;  5H5Q A;  1G7O A;  2GTU A;  2JZR A;  2HNL A;  1T8E B;  3HDC A;  1J9B A;  2NBS A;  2B7K A;  3KJY A;  4NV2 A;  1DBY A;  2GGT A;  5D9W A;  2L5L A;  2GZP A;  1FOV A;  5GAN D;  5H5R A;  3APS A;  2H74 A;  3MWH A;  2H30 A;  1SL2 B;  1O73 A;  4TR3 A;  2GSQ A;  2MMA A;  2IMK A;  2HRN A;  1ZCP A;  1HNC A;  2GVP A;  12GS A;  3NOF A;  4MZB A;  2E2M A;  3KMN A;  4L5L A;  3UBK A;  2VL3 A;  4ID0 A;  1WPI A;  6GSX A;  1U6T A;  5CRG A;  2WGR A;  1LBK A;  1O81 A;  5DCH A;  2H6Y A;  3F4S A;  2XBQ A;  3EYT A;  2RLI A;  4TN8 A;  1Q98 A;  2K18 A;  2WS2 A;  4IW9 A;  4ZB9 A;  3O6T A;  4TR1 B;  4XHM A;  4JR6 A;  3G7J A;  2QKE A;  1TI3 A;  3CTF A;  2ZUP A;  2PVQ A;  1WWJ A;  3IK9 A;  3RPP A;  5ELG A;  4LMW A;  3O76 A;  2LJK A;  4AGS A;  1TJD A;  3DVW A;  2VUP A;  3EMX A;  4WF5 A;  1N8J A;  4IS0 A;  3CYN A;  1EGO A;  2DMM A;  2JZT A;  1K0D A;  4JRR A;  3TJG A;  3HJM A;  4Q5Q A;  2DJ1 A;  3NIV A;  1U3I A;  4ML6 A;  1FAA A;  2H72 A;  4KUN A;  3KXO A;  5ECI B;  1OE7 A;  2C1Y A;  4JU5 A;  4TXO A;  5DAL A;  2WFC A;  2K8S A;  3TKQ A;  4HQZ A;  3ZIJ A;  3P7X A;  1R7H A;  1TK8 B;  1VF1 A;  3DML A;  2OAC A;  1M9A A;  2GSR A;  1TDI A;  3TJB A;  1X9W B;  1XBS A;  2MMN A;  1A2L A;  3C1S A;  2PGT A;  5ID2 A;  5HFI A;  2H75 A;  4FYB A;  2L6D A;  1SD8 A;  2X8G A;  2FCH A;  3MAK A;  3OR5 A;  2IJY A;  1AAZ A;  3ERG A;  4DEJ A;  1FG4 A;  4ZBA A;  2L5O A;  1EP7 A;  1ZGN A;  4MPG A;  4I97 A;  4EKZ A;  5GST A;  1GWC A;  2DJJ A;  1K0O A;  3UAR A;  1B4Q A;  3I6A A;  1PL2 A;  4X43 A;  2I9H A;  9GSS A;  3EUR A;  1Z9H A;  4F2I A;  3ISO A;  1ZL9 A;  1Q4J A;  2ZNM A;  3LJR A;  3GV1 A;  2LJA A;  2LTK A;  4HOJ A;  5B6N A;  3RHC A;  1HNB A;  2LRT A;  4XS6 A;  4XCS A;  14GS A;  3WT1 A;  2AB6 A;  2M72 A;  4HJM A;  1MDK A;  1V2A A;  2CZ3 A;  2NDO A;  4IEL A;  3TKP A;  4N30 A;  5J3R A;  2K6V A;  4PQ1 A;  5JCG A;  5ELA A;  1R26 A;  1UVZ A;  4PXO A;  5DAK B;  4LLR A;  3UAP A;  1QMV A;  4HUA A;  2PU9 C;  3ME8 A;  2O8V B;  2VL2 A;  3M9J A;  3IAS 2;  1EP8 A;  3DGQ A;  1BQ7 A;  1SJ6 A;  2N5B A;  3UJ1 A;  1SYR A;  4IJ3 A;  1H4O A;  1OKT A;  3FR9 A;  2IME A;  1U3A A;  4AJ8 A;  5GAP D;  2VIM A;  4POM A;  3UVH A;  3CSI A;  3GKX A;  4HI7 A;  1XZO A;  22GS A;  4ILF A;  3ZVJ D;  1E6B A;  5HR0 A;  5IMV A;  2CT6 A;  2EIQ A;  1F2E A;  4HQS A;  5JCU A;  1PA3 A;  3GX8 A;  4IGJ A;  2H0I A;  2IFQ B;  4MZC A;  4CW9 A;  1T7P B;  3F0I A;  1NW2 A;  1XOA A;  2AV4 A;  2H1G A;  3U6V A;  4HU9 A;  5CP1 A;  3US3 A;  3UOM A;  1QUW A;  4K7O A;  1A0R P;  2GLR A;  3L9S A;  2F8A A;  1TU8 A;  3FZ4 A;  2VD1 A;  3LXZ A;  1XVW A;  2H19 A;  2M46 A;  5LD0 A;  1G6Y A;  1TRS A;  2P0G A;  2H01 A;  4PGT A;  1F9M A;  3D5J A;  3KH9 A;  5EY6 A;  5DQS A;  1ERT A;  3HY2 A;  1WRY A;  3A2X A;  1QQ2 A;  1ZYE A;  3LQ7 A;  2AHE A;  2GS3 A;  4OCF A;  4ECB A;  5B8A A;  2DJ2 A;  5JCW A;  3A5W A;  3BCK A;  5B8B A;  4V1A p;  2FWG A;  2H70 A;  1X9S B;  1TRU A;  4DVC A;  4PUR A;  3FK8 A;  4GXZ A;  4Q5R A;  4IN0 A;  2HI7 A;  4MH2 A;  4NWY A;  2KP2 A;  4OO4 A;  1RK4 A;  4LL4 B;  3VUR A;  2OE3 A;  3N5O A;  2R6K A;  2FGX A;  3KGK A;  3HXS A;  4MF6 A;  3KTL A;  3BBY A;  3SBC A;  1XPV A;  1HYU A;  1EWX A;  1OAZ A;  1SKS B;  4MZW A;  2PER A;  3E0U A;  2E2G A;  3F6D A;  1ZYQ B;  3FEU A;  3IPZ A;  3WD6 A;  1A8Y A;  3DYR A;  1TW9 A;  5G31 A;  3CTG A;  2L57 A;  5HQP A;  5CRD A;  4TRX A;  1JFU A;  5AIV A;  5EPF A;  1K3L A;  3FYG A;  2XBI A;  3EE2 A;  3ERW A;  4MJB A;  2H1B A;  2F8F A;  1GLQ A;  1SJI A;  3WT2 A;  2V32 A;  4XIH A;  4BWS A;  1XOB A;  2L6C A;  3E9J B;  3TJK A;  2LQO A;  2OE0 A;  3APQ A;  1SL1 B;  2E0Q A;  1K3O A;  2H71 A;  2DC5 A;  2V41 A;  3HVS A;  4OMV A;  4DSQ A;  3ZL5 A;  3TKR A;  3G7I A;  1T4Y A;  4O5R A;  4TR1 A;  3FZ9 A;  5FWG A;  2P31 A;  1FW1 A;  1SK1 A;  2H1D A;  2RII A;  4N0V A;  5CRE A;  1AUC A;  1HQO A;  4K0N A;  2HZF A;  2OA7 A;  2YN1 A;  2YWI A;  1BYE A;  3KTB A;  2V6K A;  2JSY A;  3EU3 A;  3GFK A;  4WBJ A;  2AAW A;  5C00 A;  4PQI A;  4ISD A;  2VLV A;  1FB6 A;  1F37 A;  2C4J A;  6GSS A;  4KDX A;  2WCI A;  1X5E A;  3QCP A;  5D9X A;  1ERV A;  3AY8 A;  1B8X A;  1ON4 A;  1B4P A;  2ES7 A;  3P90 A;  2PWJ A;  6GST A;  4F03 A;  3ZRD A;  5B6M A;  3VFI A;  4EL1 A;  1VF4 A;  2H0H A;  2LST A;  1EOG A;  2F3M A;  5DDL A;  3ZFL A;  4ZXG A;  2J23 A;  3KIJ A;  5F05 A;  5CO3 A;  3CXG A;  2OAD A;  2OE1 A;  4MF5 A;  5KN2 A;  1EGR A;  3LG6 A;  5J41 A;  3M3M A;  2XC2 A;  2D2Z A;  4POB A;  2JL4 A;  3LOR A;  5IMF A;  2JAC A;  4LL1 B;  2PMT A;  4XRD A;  5A4W A;  4HU7 A;  2MYG A;  2WJU A;  4GTU A;  3EIN A;  3RPN A;  2P5R A;  1QFN A;  5DVB A;  3C1R A;  1R5A A;  4MMM A;  4V2M A;  4D73 B;  4NHW A;  4XS1 A;  3VWU A;  3GN3 A;  2VLU A;  2GDR A;  5KEJ A;  1FB0 A;  1YZX A;  4V1A g;  5B7C A;  2O87 A;  3JCM L;  3GIX A;  2H76 A;  4PNG A;  3CBU A;  2C8U A;  2HRF A;  1GUL A;  1YKC A;  5DAK A;  4CDO A;  2R2J A;  4Q5F A;  4LMV A;  2PPT A;  2TRX A;  4ECC A;  3M1G A;  6GSU A;  4NPB A;  3FKF A;  3CMI A;  3L4N A;  4PUA A;  3LYK A;  4KH7 A;  2VO4 A;  1C72 A;  4KB3 A;  3I43 A;  1YEP A;  4HDE A;  3UIW A;  3IC4 A;  2ZCT A;  3ZYW A;  2C0G A;  3VPQ A;  2H66 A;  1LJR A;  4J57 E;  1RW1 A;  2C0E A;  1JZO A;  4KSM A;  4ZL9 A;  2G0F A;  1GSY A;  5A4U A;  1AW9 A;  3L78 A;  2GQK A;  1VRS D;  4BA7 A;  2FWE A;  4TW5 A;  1KEB A;  3KD0 A;  2IFQ A;  1SL0 B;  3HZ4 A;  2DJ0 A;  4WR4 A;  4RQX A;  3V1W A;  3GTU B;  5G30 A;  1XW9 A;  4O92 A;  4BWQ A;  2CV4 A;  2A2R A;  2I81 A;  4K6X A;  2DSA A;  5G5F A;  1R5P A;  2OJL A;  3TB2 A;  1O85 A;  1SJZ A;  3ERF A;  1XWA A;  3ZIT A;  2HSH A;  2CQ9 A;  1S3C A;  1EEJ A;  3A2W A;  5CAX A;  1OYJ A;  4MJE A;  3NZN A;  2NPB A;  4EC0 A;  3IBH A;  3IXR A;  1PL1 A;  4V2L A;  1TRW A;  3H93 A;  3UL3 A;  1ERW A;  4CHS A;  1Y25 A;  4L0U A;  5KN0 A;  5DQY A;  5JWQ B;  5J5N A;  1KBN A;  4NAX A;  1QK8 A;  2GT6 A;  5G5E A;  1TOF A;  3H79 A;  1BG5 A;  2YJH A;  2KUC A;  3R2Q A;  1Y6E A;  3QD9 A;  1Z7R A;  3D4M A;  19GS A;  4MLY A;  3FHK A;  4TOP A;  5KN3 A;  1PX6 A;  1MTC A;  5EVO A;  3HVX A;  5CNW A;  3TOU A;  4N10 A;  1TK0 B;  5ECN B;  2DBC A;  1THO A;  2TRC P;  4K9Z A;  4YAV A;  3E3E A;  3ZFB A;  4KE3 A;  4JR4 A;  4HEA 2;  2FWF A;  3RBT A;  1SYX A;  4WEY A;  2WRT A;  3RHB A;  3C7M A;  1VGL A;  2H8L A;  4GST A;  3FR6 A;  2IPA A;  1B9Y C;  4GCI A;  1TKD B;  1T4Z A;  4G2E A;  2VLT A;  4IHU A;  2R5G A;  3GUS A; 
#chains in the Genus database with same CATH topology
 3G7Y A;  3CRU A;  3FW2 A;  4WBR D;  2CA8 A;  1XW6 A;  3PR8 A;  5F8B A;  4ZB6 A;  3ZRE A;  1PKW A;  5ECQ B;  1JHB A;  2KLX A;  4ZBD A;  3FZA A;  4ACS A;  1GP1 A;  2FHE A;  2GST A;  1WOU A;  2CAQ A;  2HT9 A;  3KMO A;  4RQR A;  3GH6 A;  1A2M A;  2R0G A;  3LXT A;  3FY7 A;  1U88 A;  1BJX A;  3H4K A;  4JBB A;  3W6G A;  4XTS A;  4IJI A;  1CQH A;  5HFK A;  4MJC A;  1JZR A;  5FHI A;  3GYK A;  1PMT A;  4GLT A;  2HE3 A;  3K8N A;  3W8S A;  4EF0 A;  3GKM A;  3DEX A;  4GSS A;  1BAY A;  3TRP A;  4XRA A;  1MD3 A;  2VOC A;  2XPD A;  4YQU A;  3FMW A;  4IP6 A;  3UVT A;  5ECR B;  3IHQ A;  1G0T A;  2CAI A;  4K2X A;  4AF2 A;  1ILO A;  5IOW A;  5J4U A;  1WIK A;  1TTZ A;  1G7E A;  4OCE A;  1THX A;  1GH2 A;  2A4H A;  2I3Y A;  4BL7 A;  1SKW B;  3ZVJ A;  2O89 A;  1WMJ A;  2REM A;  1PRX A;  3L9U A;  5G1K A;  1NSW A;  4G0L A;  5G2Z A;  2OKA A;  2YZU A;  3M0F A;  16GS A;  2H1A A;  1X5C A;  3L9V A;  5KN1 A;  3MDK A;  4ZL7 A;  1Z6M A;  1F3B A;  1Z7P A;  4POK A;  2ON5 A;  1GUM A;  1SK0 A;  2K8V A;  4K0G A;  2MBS A;  3ZMK A;  2IMI A;  2JAD A;  4NHZ A;  4FYC A;  2B3S A;  1M2D A;  3F3Q A;  2KHP A;  5AN1 A;  2VCT A;  5J9B A;  1TP9 A;  4EDY A;  1BX9 A;  2LV3 A;  1XWB A;  2DLX A;  5HR1 A;  1XW5 A;  4KAE A;  1WJK A;  1GSQ A;  4Z2U A;  3GNJ A;  3HCZ A;  5IIZ A;  2CX4 A;  4D73 A;  1JZW A;  4MCU A;  4BVY B;  1TXX A;  2VCX A;  2MMZ A;  4QL9 A;  5ABR A;  3HZ8 A;  1SU9 A;  4GSN A;  2HSY A;  3BOA A;  1VF3 A;  2WZ9 A;  6GSV A;  4FO5 A;  1OC8 A;  2OBI A;  1XXU A;  3VWX A;  1M2B A;  3A3T A;  1IYH A;  1SD9 A;  1FVK A;  1YKA A;  5IPH A;  2NTO A;  2C3N A;  3F63 A;  2KP1 A;  3TGZ A;  3QMX A;  1ZOF A;  3ZTL A;  2IMF A;  3M8N A;  1GUK A;  2H6Z A;  4ZL8 A;  2O85 A;  3IOS A;  4YH2 A;  4EDZ A;  3QOU A;  2MBT A;  3UMA A;  4QQ7 A;  4PNF A;  3PIN A;  3D4T A;  1GTB A;  2V2G A;  2C80 A;  3D0Z A;  4K7I A;  2LKU A;  4ML1 A;  4WR5 A;  1YF0 A;  3L0H A;  3ZZX A;  1KTE A;  2NVL A;  3F4T A;  1XWC A;  4CY6 A;  1GSF A;  2X49 A;  3GTU A;  2IIY A;  5F07 A;  3TJF A;  1XG8 A;  1W4V A;  5C04 A;  2VM1 A;  1B9X C;  2N5F A;  1GLP A;  2C0F A;  2G2Q A;  2L4C A;  3IHG A;  4MNN A;  2VD0 A;  4HZ4 A;  5IMA A;  4KDU A;  1J0F A;  2YJ7 A;  4OFM A;  5HR3 A;  4EUY A;  1UN2 A;  1EEM A;  2ALB A;  2B1K A;  3CSH A;  2WB9 A;  1PD2 1;  4N11 A;  1AQX A;  5LNK e;  3QAG A;  4MPF A;  3J7Y k;  2A2S A;  3GKN A;  3I69 A;  1YJ6 A;  3QPM A;  4GQF A;  3LGC A;  5HFG A;  3VI7 A;  4PUF C;  3HJO A;  2E7P A;  5CRW A;  2YWM A;  6GSW A;  1GSU A;  1PX7 A;  2YAN A;  5IPG A;  3KCM A;  1EV4 A;  4TR4 A;  4MK3 A;  3KP8 A;  2FUG 2;  3J7Y b;  2YNX A;  4A5P A;  2X64 A;  4ZBB A;  4BVX B;  1SKR B;  1V57 A;  1GTA A;  4Q5N A;  5FT3 A;  2AYT A;  1GL8 A;  2GZY A;  1MEK A;  1Z6N A;  1M3I A;  5ECK B;  2B5Y A;  2L4Q A;  5GSS A;  1OC9 B;  3IK7 A;  3HHV A;  2Z9S A;  3P2A A;  18GS A;  1NHY A;  2YWN A;  1EZK A;  3TRQ A;  4CY8 A;  5LCZ A;  1GSS A;  4NV5 A;  3TOT A;  5COH A;  2R37 A;  1A23 A;  1USB A;  1YDK A;  1FO5 A;  2WDU A;  1XIY A;  3MYD A;  1OKD A;  4EO3 A;  2QGV A;  5A4V A;  3HA9 A;  3VK9 A;  1V58 A;  3GMF A;  3QR6 A;  4HZ2 A;  1J08 A;  2JU5 A;  2RUF A;  2FLS A;  1GTU A;  4YKG A;  1ABA A;  1IYI A;  4OD7 A;  4XS4 B;  4YQV A;  4IKH A;  5AGY A;  2HSM A;  3CRT A;  4G9H A;  6GSY A;  3MSZ A;  4TXV A;  1I5G A;  4V2N A;  3HKR A;  4NXI A;  4EVM A;  5E59 A;  4L5O A;  2EC4 A;  1G6W A;  1GNE A;  4RUV A;  3C8E A;  1GRX A;  2WUL A;  3D6I A;  2BTO T;  1ML6 A;  3IE3 A;  2JZS A;  2LEG A;  5E4W A;  1AQW A;  1BED A;  3G9B A;  1AQV A;  2VCQ A;  2GQM A;  4GRF A;  1S3D A;  2YZH A;  2LJR A;  4IVF A;  3VI5 A;  3UBL A;  1T1V A;  1KNG A;  5D73 A;  3IA1 A;  1RQM A;  4OFN A;  2LNS A;  2V6O A;  2N5A A;  3A2V A;  4KND A;  4K8M A;  2DIY A;  4P3Y B;  1XCC A;  2LRN A;  3GL3 A;  5JWR B;  5KOX A;  2LS5 A;  4JE1 A;  3QFA C;  1FVJ A;  3F8U A;  1PSQ A;  1YEX A;  1EOH A;  2VCW A;  4K5S A;  2YV7 A;  4PX1 A;  3D22 A;  1URM A;  3PPU A;  1M7T A;  8GSS A;  3HVV A;  2IL3 A;  4F9Z A;  4QL7 A;  1K0C A;  1TU7 A;  3VPT A;  1R4W A;  1S3R A;  2I1U A;  2IN3 A;  3ZLP A;  4POL A;  2B6M A;  3ED3 A;  1O6J A;  4GWR A;  4PQH A;  4DSS B;  3DWV A;  4KCA A;  3FR3 A;  1X5D A;  1I9D A;  2VAF A;  1GSE A;  4IQ1 A;  1V9W A;  1AXD A;  1YF1 A;  2VL2 C;  3QDN A;  3TCO A;  20GS A;  4FH8 A;  3KP9 A;  5DCG A;  4IQA A;  2FA8 A;  3HD5 A;  4AJ6 A;  1QXH A;  3RAZ A;  2LNT A;  4HS1 A;  4LA1 A;  2CX3 A;  3GUR A;  2TIR A;  2DIZ A;  3KM6 A;  3APO A;  3F3R A;  3M9K A;  1MDJ A;  4MA9 A;  5AIS A;  4TR0 A;  4TVE A;  1F3A A;  5D93 A;  5ECO B;  3IR4 A;  1GNW A;  4HSC X;  2EIO A;  2HZE B;  4O5Q A;  4NMU A;  4ZIL A;  3W8J A;  4K2D A;  2OBK A;  2MMO A;  4G10 A;  3F9U A;  4Z7X A;  5IQY A;  2B5X A;  4O7H A;  3EC3 A;  1GSD A;  2IMD A;  4N0Z A;  2V1M A;  3U5R E;  3HJP A;  1K0A A;  5INY A;  4BVY A;  3DD3 A;  3IRA A;  4KX4 A;  1EV9 A;  1LU4 A;  3GKK A;  1JZD A;  5HR2 A;  4L8E A;  2DML A;  2PUK C;  2GQL A;  4KF9 A;  1XWG A;  5D8I A;  3I9V 2;  2L59 A;  4I8B A;  3F4R A;  4KCE A;  4FIW A;  4KGI A;  4E8E A;  1S3A A;  3LWA A;  1X0R A;  2RM5 A;  3DKS A;  4MP4 A;  3DIE A;  5F06 A;  5JWO B;  3LSZ A;  1JLW A;  3EU4 A;  1A2J A;  4MJA A;  3GHA A;  4J56 E;  2VCZ A;  3ZIV A;  4I5Q A;  1UC7 A;  3HYP A;  2C3Q A;  2C3T A;  2CZ2 A;  2R4V A;  4O32 A;  1DE1 A;  1K0N A;  2YCD A;  3H8Q A;  4EIQ A;  1A0F A;  2GZZ A;  3KZQ A;  1M0U A;  5ECS A;  1QGV A;  4F82 A;  3RDW A;  1GTI A;  3TKS C;  4KW6 A;  1AIU A;  3CSJ A;  2R3X A;  4G0K A;  1GUH A;  4G19 A;  2HFD A;  3GL5 A;  5IMZ A;  1A8L A;  3QAW A;  4X1U A;  1DSB A;  3ME7 A;  2X8H A;  4X0X A;  5ECP B;  4MF7 A;  2DJ3 A;  1MDI A;  1OVN A;  3DXB A;  4ULX A;  4ECI A;  4EE0 A;  5KOW A;  4IP1 A;  3Q74 A;  2YOI A;  4KDY A;  1T00 A;  5D9V A;  5IMC A;  1FHE A;  2VM2 A;  3IV4 A;  2GT5 A;  10GS A;  4AJ7 A;  1H75 A;  1VF2 A;  3FZ5 A;  4TXO B;  5DAL B;  2J9H A;  3UEM A;  3VWV A;  5AIX A;  4HJ2 A;  5A5K A;  2X99 A;  2I4A A;  3N9J A;  1OC3 A;  2KOK A;  3DRN A;  2H0G A;  3TKS E;  2GSS A;  1V98 A;  2DKI A;  2AUV A;  2FY6 A;  4ICY A;  5ID2 B;  4MAB A;  1B48 A;  2YPM A;  4TKY A;  5CYY A;  3O3T A;  4GF0 A;  3VLN A;  2F51 A;  5CRH A;  5DBQ A;  5ECL B;  7GSS A;  2F9S A;  1Z5Y E;  1TK5 B;  1XVQ A;  2EIR A;  2C0D A;  3P8W A;  3EVI A;  4RI6 A;  3EWL A;  2A4V A;  2FA4 A;  2CVK A;  4K7N A;  2CVB A;  3VWW A;  4BVX A;  5D96 A;  5IM9 A;  3BJ5 A;  4DSR A;  4H86 A;  2K9F A;  2B5E A;  3TKS A;  3Q19 A;  1WP0 A;  2VL9 A;  1PKZ A;  5IO0 A;  3QFB C;  1DUG A;  2VCV A;  1MD4 A;  1K3Y A;  1OC9 A;  4WXT A;  3ZML A;  3WGE A;  1SEN A;  3GX0 A;  2LQQ A;  2YWO A;  4F0C A;  3S9F A;  2PN8 A;  3GH9 A;  13GS A;  5ECM B;  3KH7 A;  4ECJ A;  2BMX A;  1JLV A;  3EPT A;  3LFL A;  3IDV A;  5D9T A;  1XFL A;  4OO5 A;  5IO2 A;  3QAV A;  1T3B A;  2XPE A;  3D21 A;  1CQG A;  4JED A;  4RI7 A;  3TDG A;  3PH9 A;  2R0C A;  1PN0 A;  1O7U A;  1ERU A;  1O8X A;  3F6F A;  5ENU A;  4XS4 A;  3PGT A;  1ACV A;  3FRC A;  5ECH B;  2HLS A;  4KSO A;  2HXK A;  2M80 A;  3C73 A;  1X9M B;  3KEB A;  4L0W A;  1E2Y A;  1Z3E A;  2LRC A;  1ST9 A;  4E8H A;  5G1L A;  5GZZ B;  3GA4 A;  2X8C A;  2JSZ A;  1PN9 A;  3TUE A;  17GS A;  2XHF A;  1M2A A;  4JZQ A;  3DVX A;  1K0B A;  2QSI A;  5F0G A;  4ZIJ A;  4EIP A;  5J9C A;  4X4J A;  2H6X A;  2YV9 A;  2QC7 A;  1PGT A;  4K1F A;  3BCI A;  4WF4 A;  5IOX A;  3GST A;  2IWT A;  1V40 A;  2BJX A;  4MDC A;  3GRX A;  1SK2 A;  5EL8 A;  4O5U A;  2FNO A;  4ZB8 A;  3WYW A;  4YAP A;  1W89 A;  3C71 A;  3TRX A;  1HD2 A;  4OFT A;  3MNG A;  1ZYN A;  5H5S A;  2DJK A;  1AC1 A;  1PFO A;  4I2U A;  4BPY A;  3SWL A;  2LUS A;  1U87 A;  4F0B A;  4BIK A;  1TI1 A;  5IMD A;  4IBP A;  4FYU A;  11GS A;  4WKW A;  4MH3 A;  4I6X A;  1NM3 A;  2ON7 A;  2HYX A;  1YQ1 A;  3WGX A;  2AJQ B;  4Z2R A;  1DE2 A;  3IAM 2;  4EXJ A;  4DSS A;  1UA5 A;  2YP6 A;  3Q18 A;  2CVD A;  3BD2 A;  2PVO C;  1OE8 A;  3CQF A;  1K0M A;  3H1N A;  3EMP A;  1HNA A;  1ZZY A;  1ZMA A;  1XWK A;  1NHO A;  3GSS A;  4YQM A;  4GQC A;  2B1L A;  4J2F A;  3LEF A;  5L71 A;  1PQN A;  2B7J A;  3LYP A;  3TJJ A;  3WGD A;  2RM6 A;  2PBJ A;  5DJM A;  2MZC A;  2RUE A;  5DJL A;  4I2T A;  4WET A;  1A24 A;  1N2A A;  1YY7 A;  2H73 A;  4KA0 A;  2O7K A;  2P5Q A;  2HZE A;  4OWY A;  2FWH A;  1O8W A;  2FD3 A;  4USS A;  1F6M C;  1TRV A;  1M9B A;  3Q6O A;  1WE0 A;  1M99 A;  5H5Q A;  1G7O A;  2GTU A;  2JZR A;  2HNL A;  1T8E B;  3HDC A;  1J9B A;  2NBS A;  2B7K A;  3KJY A;  4NV2 A;  1DBY A;  2GGT A;  5D9W A;  4YKF A;  2L5L A;  2GZP A;  1FOV A;  5GAN D;  5H5R A;  3APS A;  2H74 A;  3MWH A;  2H30 A;  1SL2 B;  1O73 A;  4TR3 A;  2GSQ A;  2MMA A;  2IMK A;  2HRN A;  1ZCP A;  1HNC A;  2GVP A;  12GS A;  3NOF A;  4MZB A;  2E2M A;  3KMN A;  4L5L A;  3UBK A;  2VL3 A;  2X4A A;  4ID0 A;  1WPI A;  6GSX A;  1U6T A;  5CRG A;  2WGR A;  1LBK A;  1O81 A;  5DCH A;  2H6Y A;  3F4S A;  2XBQ A;  3EYT A;  2RLI A;  4TN8 A;  1Q98 A;  2K18 A;  2WS2 A;  4IW9 A;  4ZB9 A;  3O6T A;  4TR1 B;  4XHM A;  4JR6 A;  4K5R A;  3G7J A;  2QKE A;  1TI3 A;  3CTF A;  2ZUP A;  2PVQ A;  1WWJ A;  3IK9 A;  3RPP A;  5ELG A;  4LMW A;  3O76 A;  2LJK A;  4AGS A;  1TJD A;  3DVW A;  2VUP A;  3EMX A;  4WF5 A;  1N8J A;  4IS0 A;  3CYN A;  1EGO A;  1FOH A;  2DMM A;  2JZT A;  1K0D A;  4JRR A;  3TJG A;  3HJM A;  4Q5Q A;  2DJ1 A;  3NIV A;  1U3I A;  4ML6 A;  1FAA A;  2H72 A;  4KUN A;  3KXO A;  5ECI B;  1OE7 A;  2C1Y A;  4JU5 A;  4TXO A;  5DAL A;  2WFC A;  2K8S A;  3TKQ A;  4HQZ A;  3ZIJ A;  3P7X A;  1R7H A;  1TK8 B;  1VF1 A;  3DML A;  2OAC A;  1M9A A;  2GSR A;  1TDI A;  3TJB A;  1X9W B;  1XBS A;  2MMN A;  1A2L A;  3C1S A;  2PGT A;  5ID2 A;  5HFI A;  2H75 A;  4FYB A;  2L6D A;  1SD8 A;  2X8G A;  2FCH A;  3MAK A;  3OR5 A;  2IJY A;  1AAZ A;  3ERG A;  4DEJ A;  1FG4 A;  2R0P A;  4ZBA A;  2L5O A;  1EP7 A;  1ZGN A;  4MPG A;  4I97 A;  4EKZ A;  2HRK A;  5GST A;  1GWC A;  2DJJ A;  1K0O A;  3UAR A;  1B4Q A;  3I6A A;  1PL2 A;  4X43 A;  2I9H A;  9GSS A;  3EUR A;  1Z9H A;  4F2I A;  3ISO A;  1ZL9 A;  1Q4J A;  2ZNM A;  3LJR A;  3GV1 A;  2LJA A;  2LTK A;  4HOJ A;  5B6N A;  3RHC A;  1HNB A;  2LRT A;  4XS6 A;  4XCS A;  14GS A;  3WT1 A;  2AB6 A;  2M72 A;  4HJM A;  1MDK A;  1V2A A;  2CZ3 A;  2NDO A;  4IEL A;  3TKP A;  4N30 A;  5J3R A;  2K6V A;  4PQ1 A;  5JCG A;  5ELA A;  5BRT A;  1R26 A;  1UVZ A;  4PXO A;  5DAK B;  4LLR A;  3UAP A;  1QMV A;  4HUA A;  2PU9 C;  3ME8 A;  2O8V B;  2VL2 A;  3M9J A;  3IAS 2;  1EP8 A;  3DGQ A;  1BQ7 A;  1SJ6 A;  2N5B A;  3UJ1 A;  1SYR A;  4IJ3 A;  1H4O A;  1OKT A;  3FR9 A;  2IME A;  1U3A A;  4AJ8 A;  5GAP D;  2VIM A;  4POM A;  3UVH A;  3CSI A;  3GKX A;  4HI7 A;  1XZO A;  22GS A;  4ILF A;  3ZVJ D;  1E6B A;  5HR0 A;  5IMV A;  2CT6 A;  2EIQ A;  1ZYP A;  1F2E A;  4HQS A;  5JCU A;  1PA3 A;  3GX8 A;  4IGJ A;  2H0I A;  2IFQ B;  4MZC A;  4CW9 A;  1T7P B;  3F0I A;  1NW2 A;  1XOA A;  2AV4 A;  2H1G A;  3U6V A;  4HU9 A;  5CP1 A;  3US3 A;  3UOM A;  1QUW A;  4K7O A;  1A0R P;  2GLR A;  3L9S A;  2F8A A;  1TU8 A;  3FZ4 A;  2VD1 A;  3LXZ A;  1XVW A;  2H19 A;  2M46 A;  5LD0 A;  1G6Y A;  1TRS A;  2P0G A;  2H01 A;  4PGT A;  1F9M A;  3D5J A;  3KH9 A;  5EY6 A;  5DQS A;  1ERT A;  3HY2 A;  1WRY A;  3A2X A;  1QQ2 A;  1ZYE A;  3LQ7 A;  2AHE A;  2GS3 A;  4OCF A;  4ECB A;  5B8A A;  2DJ2 A;  5JCW A;  3A5W A;  3BCK A;  5B8B A;  4V1A p;  2FWG A;  2H70 A;  1X9S B;  1TRU A;  4DVC A;  4PUR A;  3FK8 A;  4GXZ A;  4Q5R A;  4IN0 A;  2HI7 A;  4MH2 A;  4NWY A;  2KP2 A;  4OO4 A;  1RK4 A;  4LL4 B;  3VUR A;  2OE3 A;  3N5O A;  2R6K A;  2FGX A;  3KGK A;  3HXS A;  4MF6 A;  4G0I A;  3KTL A;  3BBY A;  3SBC A;  2QA1 A;  1XPV A;  1HYU A;  1EWX A;  1OAZ A;  1SKS B;  4MZW A;  2PER A;  3E0U A;  2E2G A;  3F6D A;  1ZYQ B;  3FEU A;  3IPZ A;  3WD6 A;  1A8Y A;  3DYR A;  1TW9 A;  5G31 A;  3CTG A;  3R3E A;  2L57 A;  5HQP A;  5CRD A;  4TRX A;  1JFU A;  5AIV A;  5EPF A;  1K3L A;  3FYG A;  2XBI A;  3EE2 A;  3ERW A;  4MJB A;  2H1B A;  2F8F A;  1GLQ A;  1SJI A;  3WT2 A;  2V32 A;  4XIH A;  4BWS A;  1XOB A;  2L6C A;  3E9J B;  3TJK A;  2LQO A;  2OE0 A;  3APQ A;  1SL1 B;  2E0Q A;  1K3O A;  2H71 A;  2DC5 A;  2V41 A;  3HVS A;  4OMV A;  4DSQ A;  3ZL5 A;  3TKR A;  3G7I A;  1T4Y A;  4O5R A;  4TR1 A;  3FZ9 A;  5FWG A;  2P31 A;  1FW1 A;  1SK1 A;  2DKH A;  2H1D A;  2RII A;  4N0V A;  5CRE A;  1AUC A;  1HQO A;  4K0N A;  2HZF A;  2OA7 A;  2YN1 A;  2YWI A;  1BYE A;  3KTB A;  2V6K A;  2JSY A;  3EU3 A;  3GFK A;  4WBJ A;  2AAW A;  5C00 A;  4PQI A;  4ISD A;  2VLV A;  1FB6 A;  1F37 A;  2C4J A;  6GSS A;  4KDX A;  2WCI A;  1X5E A;  3IC8 A;  3QCP A;  5D9X A;  1ERV A;  3AY8 A;  1B8X A;  1ON4 A;  1B4P A;  2ES7 A;  3P90 A;  2PWJ A;  6GST A;  4BL7 B;  4F03 A;  3ZRD A;  5B6M A;  3HVN A;  3VFI A;  4EL1 A;  1VF4 A;  2H0H A;  2LST A;  1EOG A;  2F3M A;  5DDL A;  3ZFL A;  4ZXG A;  3A5I A;  2J23 A;  3KIJ A;  5F05 A;  5CO3 A;  3CXG A;  2OAD A;  2OE1 A;  4MF5 A;  5KN2 A;  1EGR A;  3LG6 A;  1M3J A;  5J41 A;  3M3M A;  2XC2 A;  2D2Z A;  4POB A;  2JL4 A;  3LOR A;  5IMF A;  2JAC A;  4LL1 B;  2PMT A;  4XRD A;  5A4W A;  4HU7 A;  2MYG A;  2WJU A;  4GTU A;  3EIN A;  3RPN A;  2P5R A;  1QFN A;  5DVB A;  3C1R A;  1R5A A;  4MMM A;  4V2M A;  4D73 B;  4NHW A;  4XS1 A;  3VWU A;  3GN3 A;  2VLU A;  2GDR A;  4Z2T A;  5KEJ A;  1FB0 A;  1YZX A;  4V1A g;  5B7C A;  2O87 A;  3JCM L;  3GIX A;  2H76 A;  4PNG A;  3CBU A;  2A2P A;  2C8U A;  2HRF A;  1GUL A;  1YKC A;  5DAK A;  4CDO A;  2R2J A;  4Q5F A;  4LMV A;  2PPT A;  2TRX A;  4ECC A;  3M1G A;  6GSU A;  4NPB A;  3FKF A;  3CMI A;  3L4N A;  4PUA A;  3LYK A;  4KH7 A;  2VO4 A;  1C72 A;  4KB3 A;  3I43 A;  1YEP A;  4HDE A;  3UIW A;  3IC4 A;  2ZCT A;  3ZYW A;  2C0G A;  3VPQ A;  2UZ8 A;  2H66 A;  1LJR A;  4J57 E;  1RW1 A;  2C0E A;  1JZO A;  4FQU A;  4KSM A;  4ZL9 A;  2G0F A;  4PTS A;  1GSY A;  2QA2 A;  5A4U A;  1AW9 A;  3L78 A;  2GQK A;  1VRS D;  4BA7 A;  2FWE A;  4TW5 A;  1KEB A;  3KD0 A;  2IFQ A;  1SL0 B;  3HZ4 A;  2DJ0 A;  4WR4 A;  4RQX A;  3V1W A;  3GTU B;  5G30 A;  1XW9 A;  3LW9 A;  4O92 A;  4BWQ A;  2CV4 A;  5BMU A;  2A2R A;  2I81 A;  4K6X A;  2DSA A;  5G5F A;  3MIX A;  1R5P A;  2OJL A;  3TB2 A;  1O85 A;  1SJZ A;  3ERF A;  1XWA A;  3ZIT A;  2HSH A;  2CQ9 A;  1S3C A;  1EEJ A;  3A2W A;  5CAX A;  1OYJ A;  4MJE A;  3NZN A;  2NPB A;  4EC0 A;  3IBH A;  3IXR A;  1PL1 A;  4V2L A;  1TRW A;  3H93 A;  3UL3 A;  1ERW A;  4CHS A;  1Y25 A;  4L0U A;  5KN0 A;  5DQY A;  5JWQ B;  5J5N A;  1KBN A;  4NAX A;  1QK8 A;  2GT6 A;  5G5E A;  1TOF A;  3H79 A;  1BG5 A;  2YJH A;  2KUC A;  3R2Q A;  1Y6E A;  3QD9 A;  1Z7R A;  2HRA A;  3D4M A;  19GS A;  4MLY A;  3FHK A;  4TOP A;  5KN3 A;  1PX6 A;  1MTC A;  5EVO A;  3HVX A;  5CNW A;  3TOU A;  4N10 A;  1TK0 B;  5ECN B;  2DBC A;  1THO A;  2TRC P;  4K9Z A;  4YAV A;  3E3E A;  3ZFB A;  4KE3 A;  4JR4 A;  4HEA 2;  2FWF A;  3RBT A;  1SYX A;  4WEY A;  2WRT A;  3RHB A;  3C7M A;  1VGL A;  2H8L A;  4GST A;  3FR6 A;  2IPA A;  1B9Y C;  4GCI A;  1TKD B;  1T4Z A;  4G2E A;  2VLT A;  4IHU A;  2R5G A;  3GUS A; 
#chains in the Genus database with same CATH homology
 3G7Y A;  3CRU A;  3FW2 A;  4WBR D;  2CA8 A;  1XW6 A;  3PR8 A;  5F8B A;  4ZB6 A;  3ZRE A;  1PKW A;  5ECQ B;  1JHB A;  2KLX A;  4ZBD A;  3FZA A;  4ACS A;  1GP1 A;  2FHE A;  2GST A;  1WOU A;  2CAQ A;  2HT9 A;  3KMO A;  4RQR A;  3GH6 A;  1A2M A;  2R0G A;  3LXT A;  3FY7 A;  1U88 A;  1BJX A;  3H4K A;  4JBB A;  3W6G A;  4XTS A;  4IJI A;  1CQH A;  5HFK A;  4MJC A;  1JZR A;  5FHI A;  3GYK A;  1PMT A;  4GLT A;  2HE3 A;  3K8N A;  3W8S A;  4EF0 A;  3GKM A;  3DEX A;  4GSS A;  1BAY A;  3TRP A;  4XRA A;  1MD3 A;  2VOC A;  2XPD A;  4YQU A;  3FMW A;  4IP6 A;  3UVT A;  5ECR B;  3IHQ A;  1G0T A;  2CAI A;  4K2X A;  4AF2 A;  1ILO A;  5IOW A;  5J4U A;  1WIK A;  1TTZ A;  1G7E A;  4OCE A;  1THX A;  1GH2 A;  2A4H A;  2I3Y A;  4BL7 A;  1SKW B;  3ZVJ A;  2O89 A;  1WMJ A;  2REM A;  1PRX A;  3L9U A;  5G1K A;  1NSW A;  4G0L A;  5G2Z A;  2OKA A;  2YZU A;  3M0F A;  16GS A;  2H1A A;  1X5C A;  3L9V A;  5KN1 A;  3MDK A;  4ZL7 A;  1Z6M A;  1F3B A;  1Z7P A;  4POK A;  2ON5 A;  1GUM A;  1SK0 A;  2K8V A;  4K0G A;  2MBS A;  3ZMK A;  2IMI A;  2JAD A;  4NHZ A;  4FYC A;  2B3S A;  1M2D A;  3F3Q A;  2KHP A;  5AN1 A;  2VCT A;  5J9B A;  1TP9 A;  4EDY A;  1BX9 A;  2LV3 A;  1XWB A;  2DLX A;  5HR1 A;  1XW5 A;  4KAE A;  1WJK A;  1GSQ A;  4Z2U A;  3GNJ A;  3HCZ A;  5IIZ A;  2CX4 A;  4D73 A;  1JZW A;  4MCU A;  4BVY B;  1TXX A;  2VCX A;  2MMZ A;  4QL9 A;  5ABR A;  3HZ8 A;  1SU9 A;  4GSN A;  2HSY A;  3BOA A;  1VF3 A;  2WZ9 A;  6GSV A;  4FO5 A;  1OC8 A;  2OBI A;  1XXU A;  3VWX A;  1M2B A;  3A3T A;  1IYH A;  1SD9 A;  1FVK A;  1YKA A;  5IPH A;  2NTO A;  2C3N A;  3F63 A;  2KP1 A;  3TGZ A;  3QMX A;  1ZOF A;  3ZTL A;  2IMF A;  3M8N A;  1GUK A;  2H6Z A;  4ZL8 A;  2O85 A;  3IOS A;  4YH2 A;  4EDZ A;  3QOU A;  2MBT A;  3UMA A;  4QQ7 A;  4PNF A;  3PIN A;  3D4T A;  1GTB A;  2V2G A;  2C80 A;  3D0Z A;  4K7I A;  2LKU A;  4ML1 A;  4WR5 A;  1YF0 A;  3L0H A;  3ZZX A;  1KTE A;  2NVL A;  3F4T A;  1XWC A;  4CY6 A;  1GSF A;  2X49 A;  3GTU A;  2IIY A;  5F07 A;  3TJF A;  1W4V A;  5C04 A;  2VM1 A;  1B9X C;  2N5F A;  1GLP A;  2C0F A;  2G2Q A;  2L4C A;  3IHG A;  4MNN A;  2VD0 A;  4HZ4 A;  5IMA A;  4KDU A;  1J0F A;  2YJ7 A;  4OFM A;  5HR3 A;  4EUY A;  1UN2 A;  1EEM A;  2ALB A;  2B1K A;  3CSH A;  2WB9 A;  1PD2 1;  4N11 A;  1AQX A;  5LNK e;  3QAG A;  4MPF A;  3J7Y k;  2A2S A;  3GKN A;  3I69 A;  1YJ6 A;  3QPM A;  4GQF A;  3LGC A;  5HFG A;  3VI7 A;  4PUF C;  3HJO A;  2E7P A;  5CRW A;  2YWM A;  6GSW A;  1GSU A;  1PX7 A;  2YAN A;  5IPG A;  3KCM A;  1EV4 A;  4TR4 A;  4MK3 A;  3KP8 A;  2FUG 2;  3J7Y b;  2YNX A;  4A5P A;  2X64 A;  4ZBB A;  4BVX B;  1SKR B;  1V57 A;  1GTA A;  4Q5N A;  5FT3 A;  2AYT A;  1GL8 A;  2GZY A;  1MEK A;  1Z6N A;  5ECK B;  2B5Y A;  2L4Q A;  5GSS A;  1OC9 B;  3IK7 A;  3HHV A;  2Z9S A;  3P2A A;  18GS A;  1NHY A;  2YWN A;  1EZK A;  3TRQ A;  4CY8 A;  5LCZ A;  1GSS A;  4NV5 A;  3TOT A;  5COH A;  2R37 A;  1A23 A;  1USB A;  1YDK A;  1FO5 A;  2WDU A;  1XIY A;  3MYD A;  1OKD A;  4EO3 A;  2QGV A;  5A4V A;  3HA9 A;  3VK9 A;  1V58 A;  3GMF A;  3QR6 A;  4HZ2 A;  1J08 A;  2JU5 A;  2RUF A;  2FLS A;  1GTU A;  4YKG A;  1ABA A;  1IYI A;  4OD7 A;  4XS4 B;  4YQV A;  4IKH A;  5AGY A;  2HSM A;  3CRT A;  4G9H A;  6GSY A;  3MSZ A;  4TXV A;  1I5G A;  4V2N A;  3HKR A;  4NXI A;  4EVM A;  5E59 A;  4L5O A;  2EC4 A;  1G6W A;  1GNE A;  4RUV A;  3C8E A;  1GRX A;  2WUL A;  3D6I A;  2BTO T;  1ML6 A;  3IE3 A;  2JZS A;  2LEG A;  5E4W A;  1AQW A;  1BED A;  3G9B A;  1AQV A;  2VCQ A;  2GQM A;  4GRF A;  1S3D A;  2YZH A;  2LJR A;  4IVF A;  3VI5 A;  3UBL A;  1T1V A;  1KNG A;  5D73 A;  3IA1 A;  1RQM A;  4OFN A;  2LNS A;  2V6O A;  2N5A A;  3A2V A;  4KND A;  4K8M A;  2DIY A;  4P3Y B;  1XCC A;  2LRN A;  3GL3 A;  5JWR B;  5KOX A;  2LS5 A;  4JE1 A;  3QFA C;  1FVJ A;  3F8U A;  1PSQ A;  1YEX A;  1EOH A;  2VCW A;  4K5S A;  2YV7 A;  4PX1 A;  3D22 A;  1URM A;  3PPU A;  1M7T A;  8GSS A;  3HVV A;  2IL3 A;  4F9Z A;  4QL7 A;  1K0C A;  1TU7 A;  3VPT A;  1R4W A;  2I1U A;  2IN3 A;  3ZLP A;  4POL A;  2B6M A;  3ED3 A;  1O6J A;  4GWR A;  4PQH A;  4DSS B;  3DWV A;  4KCA A;  3FR3 A;  1X5D A;  1I9D A;  2VAF A;  1GSE A;  4IQ1 A;  1V9W A;  1AXD A;  1YF1 A;  2VL2 C;  3QDN A;  3TCO A;  20GS A;  4FH8 A;  3KP9 A;  5DCG A;  4IQA A;  2FA8 A;  3HD5 A;  4AJ6 A;  1QXH A;  3RAZ A;  2LNT A;  4HS1 A;  4LA1 A;  2CX3 A;  3GUR A;  2TIR A;  2DIZ A;  3KM6 A;  3APO A;  3F3R A;  3M9K A;  1MDJ A;  4MA9 A;  5AIS A;  4TR0 A;  4TVE A;  1F3A A;  5D93 A;  5ECO B;  3IR4 A;  1GNW A;  2EIO A;  2HZE B;  4O5Q A;  4NMU A;  4ZIL A;  3W8J A;  4K2D A;  2OBK A;  2MMO A;  4G10 A;  3F9U A;  4Z7X A;  5IQY A;  2B5X A;  4O7H A;  3EC3 A;  1GSD A;  2IMD A;  4N0Z A;  2V1M A;  3U5R E;  3HJP A;  1K0A A;  5INY A;  4BVY A;  3DD3 A;  3IRA A;  4KX4 A;  1EV9 A;  1LU4 A;  3GKK A;  1JZD A;  5HR2 A;  4L8E A;  2DML A;  2PUK C;  2GQL A;  4KF9 A;  1XWG A;  5D8I A;  3I9V 2;  2L59 A;  4I8B A;  3F4R A;  4KCE A;  4FIW A;  4KGI A;  4E8E A;  1S3A A;  3LWA A;  1X0R A;  2RM5 A;  3DKS A;  4MP4 A;  3DIE A;  5F06 A;  5JWO B;  3LSZ A;  1JLW A;  3EU4 A;  1A2J A;  4MJA A;  3GHA A;  4J56 E;  2VCZ A;  3ZIV A;  4I5Q A;  1UC7 A;  3HYP A;  2C3Q A;  2C3T A;  2CZ2 A;  2R4V A;  4O32 A;  1DE1 A;  1K0N A;  2YCD A;  3H8Q A;  4EIQ A;  1A0F A;  2GZZ A;  3KZQ A;  1M0U A;  5ECS A;  1QGV A;  4F82 A;  3RDW A;  1GTI A;  3TKS C;  4KW6 A;  1AIU A;  3CSJ A;  2R3X A;  4G0K A;  1GUH A;  4G19 A;  2HFD A;  3GL5 A;  5IMZ A;  1A8L A;  3QAW A;  4X1U A;  1DSB A;  3ME7 A;  2X8H A;  4X0X A;  5ECP B;  4MF7 A;  2DJ3 A;  1MDI A;  1OVN A;  3DXB A;  4ULX A;  4ECI A;  4EE0 A;  5KOW A;  4IP1 A;  3Q74 A;  2YOI A;  4KDY A;  1T00 A;  5D9V A;  5IMC A;  1FHE A;  2VM2 A;  3IV4 A;  2GT5 A;  10GS A;  4AJ7 A;  1H75 A;  1VF2 A;  3FZ5 A;  4TXO B;  5DAL B;  2J9H A;  3UEM A;  3VWV A;  5AIX A;  4HJ2 A;  5A5K A;  2X99 A;  2I4A A;  3N9J A;  1OC3 A;  2KOK A;  3DRN A;  2H0G A;  3TKS E;  2GSS A;  1V98 A;  2DKI A;  2AUV A;  2FY6 A;  4ICY A;  5ID2 B;  4MAB A;  1B48 A;  2YPM A;  4TKY A;  5CYY A;  3O3T A;  4GF0 A;  3VLN A;  2F51 A;  5CRH A;  5DBQ A;  5ECL B;  7GSS A;  2F9S A;  1Z5Y E;  1TK5 B;  1XVQ A;  2EIR A;  2C0D A;  3P8W A;  3EVI A;  4RI6 A;  3EWL A;  2A4V A;  2FA4 A;  2CVK A;  4K7N A;  2CVB A;  3VWW A;  4BVX A;  5D96 A;  5IM9 A;  3BJ5 A;  4DSR A;  4H86 A;  2K9F A;  2B5E A;  3TKS A;  3Q19 A;  1WP0 A;  2VL9 A;  1PKZ A;  5IO0 A;  3QFB C;  1DUG A;  2VCV A;  1MD4 A;  1K3Y A;  1OC9 A;  4WXT A;  3ZML A;  3WGE A;  1SEN A;  3GX0 A;  2LQQ A;  2YWO A;  4F0C A;  3S9F A;  2PN8 A;  3GH9 A;  13GS A;  5ECM B;  3KH7 A;  4ECJ A;  2BMX A;  1JLV A;  3EPT A;  3LFL A;  3IDV A;  5D9T A;  1XFL A;  4OO5 A;  5IO2 A;  3QAV A;  1T3B A;  2XPE A;  3D21 A;  1CQG A;  4JED A;  4RI7 A;  3TDG A;  3PH9 A;  2R0C A;  1PN0 A;  1O7U A;  1ERU A;  1O8X A;  3F6F A;  5ENU A;  4XS4 A;  3PGT A;  1ACV A;  3FRC A;  5ECH B;  2HLS A;  4KSO A;  2HXK A;  2M80 A;  3C73 A;  1X9M B;  3KEB A;  4L0W A;  1E2Y A;  1Z3E A;  2LRC A;  1ST9 A;  4E8H A;  5G1L A;  5GZZ B;  3GA4 A;  2X8C A;  2JSZ A;  1PN9 A;  3TUE A;  17GS A;  2XHF A;  1M2A A;  4JZQ A;  3DVX A;  1K0B A;  2QSI A;  5F0G A;  4ZIJ A;  4EIP A;  5J9C A;  4X4J A;  2H6X A;  2YV9 A;  2QC7 A;  1PGT A;  4K1F A;  3BCI A;  4WF4 A;  5IOX A;  3GST A;  2IWT A;  1V40 A;  2BJX A;  4MDC A;  3GRX A;  1SK2 A;  5EL8 A;  4O5U A;  2FNO A;  4ZB8 A;  3WYW A;  4YAP A;  1W89 A;  3C71 A;  3TRX A;  1HD2 A;  4OFT A;  3MNG A;  1ZYN A;  5H5S A;  2DJK A;  1AC1 A;  4I2U A;  4BPY A;  3SWL A;  2LUS A;  1U87 A;  4F0B A;  1TI1 A;  5IMD A;  4IBP A;  4FYU A;  11GS A;  4WKW A;  4MH3 A;  4I6X A;  1NM3 A;  2ON7 A;  2HYX A;  1YQ1 A;  3WGX A;  2AJQ B;  4Z2R A;  1DE2 A;  3IAM 2;  4EXJ A;  4DSS A;  1UA5 A;  2YP6 A;  3Q18 A;  2CVD A;  3BD2 A;  2PVO C;  1OE8 A;  1K0M A;  3H1N A;  3EMP A;  1HNA A;  1ZZY A;  1ZMA A;  1XWK A;  1NHO A;  3GSS A;  4YQM A;  4GQC A;  2B1L A;  4J2F A;  3LEF A;  5L71 A;  1PQN A;  2B7J A;  3LYP A;  3TJJ A;  3WGD A;  2RM6 A;  2PBJ A;  5DJM A;  2MZC A;  2RUE A;  5DJL A;  4I2T A;  4WET A;  1A24 A;  1N2A A;  1YY7 A;  2H73 A;  4KA0 A;  2O7K A;  2P5Q A;  2HZE A;  4OWY A;  2FWH A;  1O8W A;  2FD3 A;  4USS A;  1F6M C;  1TRV A;  1M9B A;  3Q6O A;  1WE0 A;  1M99 A;  5H5Q A;  1G7O A;  2GTU A;  2JZR A;  2HNL A;  1T8E B;  3HDC A;  1J9B A;  2NBS A;  2B7K A;  3KJY A;  4NV2 A;  1DBY A;  2GGT A;  5D9W A;  4YKF A;  2L5L A;  2GZP A;  1FOV A;  5GAN D;  5H5R A;  3APS A;  2H74 A;  3MWH A;  2H30 A;  1SL2 B;  1O73 A;  4TR3 A;  2GSQ A;  2MMA A;  2IMK A;  2HRN A;  1ZCP A;  1HNC A;  2GVP A;  12GS A;  3NOF A;  4MZB A;  2E2M A;  3KMN A;  4L5L A;  3UBK A;  2VL3 A;  2X4A A;  4ID0 A;  1WPI A;  6GSX A;  1U6T A;  5CRG A;  2WGR A;  1LBK A;  1O81 A;  5DCH A;  2H6Y A;  3F4S A;  2XBQ A;  3EYT A;  2RLI A;  4TN8 A;  1Q98 A;  2K18 A;  2WS2 A;  4IW9 A;  4ZB9 A;  3O6T A;  4TR1 B;  4XHM A;  4JR6 A;  4K5R A;  3G7J A;  2QKE A;  1TI3 A;  3CTF A;  2ZUP A;  2PVQ A;  1WWJ A;  3IK9 A;  3RPP A;  5ELG A;  4LMW A;  3O76 A;  2LJK A;  4AGS A;  1TJD A;  3DVW A;  2VUP A;  3EMX A;  4WF5 A;  1N8J A;  4IS0 A;  3CYN A;  1EGO A;  1FOH A;  2DMM A;  2JZT A;  1K0D A;  4JRR A;  3TJG A;  3HJM A;  4Q5Q A;  2DJ1 A;  3NIV A;  1U3I A;  4ML6 A;  1FAA A;  2H72 A;  4KUN A;  3KXO A;  5ECI B;  1OE7 A;  2C1Y A;  4JU5 A;  4TXO A;  5DAL A;  2WFC A;  2K8S A;  3TKQ A;  4HQZ A;  3ZIJ A;  3P7X A;  1R7H A;  1TK8 B;  1VF1 A;  3DML A;  2OAC A;  1M9A A;  2GSR A;  1TDI A;  3TJB A;  1X9W B;  1XBS A;  2MMN A;  1A2L A;  3C1S A;  2PGT A;  5ID2 A;  5HFI A;  2H75 A;  4FYB A;  2L6D A;  1SD8 A;  2X8G A;  2FCH A;  3MAK A;  3OR5 A;  2IJY A;  1AAZ A;  3ERG A;  4DEJ A;  1FG4 A;  2R0P A;  4ZBA A;  2L5O A;  1EP7 A;  1ZGN A;  4MPG A;  4I97 A;  4EKZ A;  2HRK A;  5GST A;  1GWC A;  2DJJ A;  1K0O A;  3UAR A;  1B4Q A;  3I6A A;  1PL2 A;  4X43 A;  2I9H A;  9GSS A;  3EUR A;  1Z9H A;  4F2I A;  3ISO A;  1ZL9 A;  1Q4J A;  2ZNM A;  3LJR A;  3GV1 A;  2LJA A;  2LTK A;  4HOJ A;  5B6N A;  3RHC A;  1HNB A;  2LRT A;  4XS6 A;  4XCS A;  14GS A;  3WT1 A;  2AB6 A;  2M72 A;  4HJM A;  1MDK A;  1V2A A;  2CZ3 A;  2NDO A;  4IEL A;  3TKP A;  4N30 A;  5J3R A;  2K6V A;  4PQ1 A;  5JCG A;  5ELA A;  5BRT A;  1R26 A;  1UVZ A;  4PXO A;  5DAK B;  4LLR A;  3UAP A;  1QMV A;  4HUA A;  2PU9 C;  3ME8 A;  2O8V B;  2VL2 A;  3M9J A;  3IAS 2;  1EP8 A;  3DGQ A;  1BQ7 A;  1SJ6 A;  2N5B A;  3UJ1 A;  1SYR A;  4IJ3 A;  1H4O A;  1OKT A;  3FR9 A;  2IME A;  1U3A A;  4AJ8 A;  5GAP D;  2VIM A;  4POM A;  3UVH A;  3CSI A;  3GKX A;  4HI7 A;  1XZO A;  22GS A;  4ILF A;  3ZVJ D;  1E6B A;  5HR0 A;  5IMV A;  2CT6 A;  2EIQ A;  1ZYP A;  1F2E A;  4HQS A;  5JCU A;  1PA3 A;  3GX8 A;  4IGJ A;  2H0I A;  2IFQ B;  4MZC A;  4CW9 A;  1T7P B;  3F0I A;  1NW2 A;  1XOA A;  2AV4 A;  2H1G A;  3U6V A;  4HU9 A;  5CP1 A;  3US3 A;  3UOM A;  1QUW A;  4K7O A;  1A0R P;  2GLR A;  3L9S A;  2F8A A;  1TU8 A;  3FZ4 A;  2VD1 A;  3LXZ A;  1XVW A;  2H19 A;  2M46 A;  5LD0 A;  1G6Y A;  1TRS A;  2P0G A;  2H01 A;  4PGT A;  1F9M A;  3D5J A;  3KH9 A;  5EY6 A;  5DQS A;  1ERT A;  3HY2 A;  1WRY A;  3A2X A;  1QQ2 A;  1ZYE A;  3LQ7 A;  2AHE A;  2GS3 A;  4OCF A;  4ECB A;  5B8A A;  2DJ2 A;  5JCW A;  3A5W A;  3BCK A;  5B8B A;  4V1A p;  2FWG A;  2H70 A;  1X9S B;  1TRU A;  4DVC A;  4PUR A;  3FK8 A;  4GXZ A;  4Q5R A;  4IN0 A;  2HI7 A;  4MH2 A;  4NWY A;  2KP2 A;  4OO4 A;  1RK4 A;  4LL4 B;  3VUR A;  2OE3 A;  3N5O A;  2R6K A;  2FGX A;  3KGK A;  3HXS A;  4MF6 A;  4G0I A;  3KTL A;  3BBY A;  3SBC A;  2QA1 A;  1XPV A;  1HYU A;  1EWX A;  1OAZ A;  1SKS B;  4MZW A;  2PER A;  3E0U A;  2E2G A;  3F6D A;  1ZYQ B;  3FEU A;  3IPZ A;  3WD6 A;  1A8Y A;  3DYR A;  1TW9 A;  5G31 A;  3CTG A;  3R3E A;  2L57 A;  5HQP A;  5CRD A;  4TRX A;  1JFU A;  5AIV A;  5EPF A;  1K3L A;  3FYG A;  2XBI A;  3EE2 A;  3ERW A;  4MJB A;  2H1B A;  2F8F A;  1GLQ A;  1SJI A;  3WT2 A;  2V32 A;  4XIH A;  4BWS A;  1XOB A;  2L6C A;  3E9J B;  3TJK A;  2LQO A;  2OE0 A;  3APQ A;  1SL1 B;  2E0Q A;  1K3O A;  2H71 A;  2DC5 A;  2V41 A;  3HVS A;  4OMV A;  4DSQ A;  3ZL5 A;  3TKR A;  3G7I A;  1T4Y A;  4O5R A;  4TR1 A;  3FZ9 A;  5FWG A;  2P31 A;  1FW1 A;  1SK1 A;  2DKH A;  2H1D A;  2RII A;  4N0V A;  5CRE A;  1AUC A;  1HQO A;  4K0N A;  2HZF A;  2OA7 A;  2YN1 A;  2YWI A;  1BYE A;  3KTB A;  2V6K A;  2JSY A;  3EU3 A;  3GFK A;  4WBJ A;  2AAW A;  5C00 A;  4PQI A;  4ISD A;  2VLV A;  1FB6 A;  1F37 A;  2C4J A;  6GSS A;  4KDX A;  2WCI A;  1X5E A;  3IC8 A;  3QCP A;  5D9X A;  1ERV A;  3AY8 A;  1B8X A;  1ON4 A;  1B4P A;  2ES7 A;  3P90 A;  2PWJ A;  6GST A;  4BL7 B;  4F03 A;  3ZRD A;  5B6M A;  3VFI A;  4EL1 A;  1VF4 A;  2H0H A;  2LST A;  1EOG A;  2F3M A;  5DDL A;  3ZFL A;  4ZXG A;  3A5I A;  2J23 A;  3KIJ A;  5F05 A;  5CO3 A;  3CXG A;  2OAD A;  2OE1 A;  4MF5 A;  5KN2 A;  1EGR A;  3LG6 A;  5J41 A;  3M3M A;  2XC2 A;  2D2Z A;  4POB A;  2JL4 A;  3LOR A;  5IMF A;  2JAC A;  4LL1 B;  2PMT A;  4XRD A;  5A4W A;  4HU7 A;  2MYG A;  2WJU A;  4GTU A;  3EIN A;  3RPN A;  2P5R A;  1QFN A;  5DVB A;  3C1R A;  1R5A A;  4MMM A;  4V2M A;  4D73 B;  4NHW A;  4XS1 A;  3VWU A;  3GN3 A;  2VLU A;  2GDR A;  4Z2T A;  5KEJ A;  1FB0 A;  1YZX A;  4V1A g;  5B7C A;  2O87 A;  3JCM L;  3GIX A;  2H76 A;  4PNG A;  3CBU A;  2A2P A;  2C8U A;  2HRF A;  1GUL A;  1YKC A;  5DAK A;  4CDO A;  2R2J A;  4Q5F A;  4LMV A;  2PPT A;  2TRX A;  4ECC A;  3M1G A;  6GSU A;  4NPB A;  3FKF A;  3CMI A;  3L4N A;  4PUA A;  3LYK A;  4KH7 A;  2VO4 A;  1C72 A;  4KB3 A;  3I43 A;  1YEP A;  4HDE A;  3UIW A;  3IC4 A;  2ZCT A;  3ZYW A;  2C0G A;  3VPQ A;  2UZ8 A;  2H66 A;  1LJR A;  4J57 E;  1RW1 A;  2C0E A;  1JZO A;  4FQU A;  4KSM A;  4ZL9 A;  2G0F A;  4PTS A;  1GSY A;  2QA2 A;  5A4U A;  1AW9 A;  3L78 A;  2GQK A;  1VRS D;  4BA7 A;  2FWE A;  4TW5 A;  1KEB A;  3KD0 A;  2IFQ A;  1SL0 B;  3HZ4 A;  2DJ0 A;  4WR4 A;  4RQX A;  3V1W A;  3GTU B;  5G30 A;  1XW9 A;  3LW9 A;  4O92 A;  4BWQ A;  2CV4 A;  5BMU A;  2A2R A;  2I81 A;  4K6X A;  2DSA A;  5G5F A;  3MIX A;  1R5P A;  2OJL A;  3TB2 A;  1O85 A;  1SJZ A;  3ERF A;  1XWA A;  3ZIT A;  2HSH A;  2CQ9 A;  1S3C A;  1EEJ A;  3A2W A;  5CAX A;  1OYJ A;  4MJE A;  3NZN A;  2NPB A;  4EC0 A;  3IBH A;  3IXR A;  1PL1 A;  4V2L A;  1TRW A;  3H93 A;  3UL3 A;  1ERW A;  4CHS A;  1Y25 A;  4L0U A;  5KN0 A;  5DQY A;  5JWQ B;  5J5N A;  1KBN A;  4NAX A;  1QK8 A;  2GT6 A;  5G5E A;  1TOF A;  3H79 A;  1BG5 A;  2YJH A;  2KUC A;  3R2Q A;  1Y6E A;  3QD9 A;  1Z7R A;  2HRA A;  3D4M A;  19GS A;  4MLY A;  3FHK A;  4TOP A;  5KN3 A;  1PX6 A;  1MTC A;  5EVO A;  3HVX A;  5CNW A;  3TOU A;  4N10 A;  1TK0 B;  5ECN B;  2DBC A;  1THO A;  2TRC P;  4K9Z A;  4YAV A;  3E3E A;  3ZFB A;  4KE3 A;  4JR4 A;  4HEA 2;  2FWF A;  3RBT A;  1SYX A;  4WEY A;  2WRT A;  3RHB A;  3C7M A;  1VGL A;  2H8L A;  4GST A;  3FR6 A;  2IPA A;  1B9Y C;  4GCI A;  1TKD B;  1T4Z A;  4G2E A;  2VLT A;  4IHU A;  2R5G A;  3GUS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...