3L9VA

Crystal structure of salmonella enterica serovar typhimurium srga
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
182
structure length
182
Chain Sequence
AEWESITPPVVDAPAVVEFFSFYCPPCYAFSQTMGVDQAIRHVLPQGSRMVKYHVSLLGPLGHELTRAWALAMVMKETDVIEKAFFTAGMVEKRLHSPDDVRRVFMSATGISRGEYDRSIKSPAVNDMVALQERLFKEYGVRGTPSVYVRGRYHINNAAFGAFSVENFRSRYAAVVRKLLAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative thiol-disulfide isomerase or thioredoxin
publication title Structural and functional characterization of three DsbA paralogues from Salmonella enterica serovar typhimurium
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Oxidoreductase
total genus 57
structure length 182
sequence length 182
chains with identical sequence B, C, D, E
ec nomenclature ec 5.3.4.1: Protein disulfide-isomerase.
pdb deposition date 2010-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01323 DSBA DSBA-like thioredoxin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3l9vA00
2H70A 3PR8A 1NW2A 1V2AA 4G9HA 4ZILA 2LQQA 4LL4B 2AJQB 3GURA 5ECHB 3HVSA 3W8JA 2YZUA 2VCZA 2PVQA 3D0ZA 2PGTA 1T8EB 3GSSA 4LA1A 4V2NA 2NTOA 3ZIVA 3CMIA 1JLWA 4RQXA 4BWQA 1ZYQB 2VL9A 5G1KA 3DIEA 1SKRB 3DVWA 3SWLA 1Z6NA 3IAM2 1HYUA 3ZTLA 1TDIA 1U88A 2GVPA 2LUSA 4F0CA 3TJBA 4TR0A 5F05A 5HR0A 2HT9A 1SU9A 5CNWA 4BWSA 3EU3A 1JLVA 3NIVA 5KN2A 2VD0A 4J56E 6GSUA 4V1Ap 3FR3A 1XCCA 1G6YA 18GSA 4HZ2A 1F9MA 4IQAA 1GTUA 4L0UA 1EOHA 3TJFA 1GNEA 3QAGA 4PQ1A 5F07A 5AISA 1GH2A 1FVKA 2ZNMA 3GH9A 1YKAA 5IMVA 3ZITA 2A2SA 4ID0A 1ZGNA 5IPGA 1O7UA 1SK0A 3EU4A 3M9KA 1K0DA 3WYWA 1IYIA 1B9YC 4IJ3A 3ME7A 8GSSA 1G7OA 1J9BA 1G7EA 3CTFA 2WCIA 2YZHA 1WJKA 2G2QA 4L0WA 4PQHA 2VM1A 1SL0B 3TKQA 3KP8A 5D8IA 4IVFA 2ES7A 10GSA 3HZ8A 3LXZA 3F3QA 4MZWA 2MYGA 1F37A 3KCMA 5HFGA 3A2VA 3A5WA 2PU9C 6GSVA 4XIHA 1TKDB 1X9SB 4IELA 3ZYWA 1B4QA 3VURA 3UL3A 3KP9A 2H1DA 3ZIJA 4EDYA 3A2XA 3WT1A 1JZDA 2P5QA 2G0FA 2O8VB 1VF1A 2KP2A 4FYBA 1GTAA 5ID2B 3IPZA 3ZFBA 4GQFA 2E2MA 4KDYA 20GSA 5A4UA 1OC8A 3UMAA 4ZL8A 3D22A 1T4ZA 4XS1A 6GSSA 4DSRA 1OKDA 4L5OA 1XW5A 3M8NA 1AQXA 5IMAA 1T3BA 2ZUPA 3D6IA 4MLYA 2HZEA 1JZRA 3EURA 3APSA 2LJKA 4EDZA 2LJRA 3HZ4A 5IM9A 1ZL9A 3KMNA 2FA4A 4MZBA 1XWGA 4EC0A 5B6MA 1XFLA 3TJGA 3UJ1A 3IC4A 2AHEA 5D96A 1YZXA 2QKEA 1Z5YE 3GA4A 1J0FA 3LGCA 3FYGA 1HNBA 1X9MB 3H93A 4EL1A 4PXOA 2MMAA 4GTUA 4G19A 2O89A 2WJUA 5DALA 4FYUA 2H6YA 5CRGA 1K0MA 4AF2A 1T7PB 1AQWA 5CYYA 1EP7A 2KHPA 3KEBA 4D73B 2I1UA 5GAND 2YNXA 3L9VA 5B8BA 1GUKA 2H01A 3PINA 2RM5A 4F2IA 4YQUA 5D73A 4X1UA 3RPPA 1XWBA 4KNDA 1I5GA 1GSUA 3RAZA 5D9WA 2M80A 4MH3A 1AC1A 1K3YA 5JWOB 4BA7A 3ERFA 1SJ6A 4HOJA 1BJXA 3TB2A 1GUMA 2FHEA 3H79A 3IK7A 2I81A 5C04A 2GGTA 5EVOA 3QCPA 1EGOA 3C7MA 1EGRA 1EV4A 6GSTA 2BJXA 2E2GA 3L78A 3EMPA 2CA8A 1HNCA 2JSYA 4ZB8A 4EUYA 4F9ZA 3H8QA 4WEYA 1M2DA 4EVMA 2MMNA 1SL2B 1EV9A 3UVHA 5B8AA 3VI7A 5GZZB 1SL1B 5DJLA 1R4WA 3M9JA 1MDJA 4LMVA 3N5OA 5D9XA 1PRXA 3A2WA 5ECIB 2DSAA 2DJ2A 3KJYA 1GSDA 2VL2C 3EINA 3CSHA 2LNSA 5DAKB 1A23A 1K3OA 4IN0A 4E8EA 4TW5A 5JCGA 4XS6A 3QR6A 3IA1A 4H86A 1TK0B 5D9TA 3KTBA 2N5AA 1BX9A 2R4VA 3HCZA 1T1VA 1ERVA 5HFKA 4GQCA 1Z3EA 3TJJA 5ECKB 4Z7XA 1T00A 2B5YA 2CAIA 2KLXA 3DMLA 3U5RE 3F63A 1UA5A 4WBRD 2VLVA 4MJBA 12GSA 1M9BA 2GSRA 2R2JA 3N9JA 3E3EA 4F82A 4ECJA 2FA8A 4GWRA 1KTEA 1WWJA 1BG5A 3DD3A 2VL3A 2X99A 1UC7A 1THXA 3GRXA 1EEJA 5D9VA 1XWKA 1QXHA 3FZ9A 4EKZA 2H0GA 5ECOB 1XVQA 3I43A 3LJRA 1PX6A 2K9FA 1XWAA 2XC2A 2GQKA 5KN0A 1YDKA 3GX0A 4BL7A 2WRTA 1PL2A 3TKSA 5CREA 3L9SA 4ISDA 3DKSA 2JSZA 3M3MA 3ME8A 2H19A 2YV9A 1T4YA 4EE0A 3I69A 1MDIA 1K0NA 1JFUA 4KH7A 4HEA2 5FT3A 3VWVA 3G7YA 2HXKA 5HR3A 2YOIA 2E0QA 1Z7PA 3Q18A 3NZNA 1R5AA 4O32A 5KEJA 3VFIA 2DJJA 5IOWA 4IQ1A 1K3LA 1V9WA 4TXOB 4N30A 1G0TA 3GTUB 5A4VA 1ZOFA 1BEDA 2YJ7A 4MZCA 4EXJA 5JCWA 4NHWA 4KGIA 1ILOA 2PUKC 3ZFLA 4MJEA 3F6FA 2V32A 1ZZYA 3TOUA 2DJ3A 2C0GA 2A4VA 4XRDA 4POMA 2JZRA 3TOTA 3EC3A 2GQMA 2TIRA 3TRQA 4HU7A 3VWXA 4TOPA 3ZL5A 1A24A 4AGSA 2CQ9A 3RPNA 5H5QA 2OACA 1ZCPA 4IP1A 1SD9A 2VLUA 3FEUA 1GLQA 4IW9A 3TCOA 3BCKA 3FZAA 3QDNA 4ZIJA 4WKWA 1EOGA 2WDUA 1DE1A 1B48A 2BTOT 4TR1B 2IMFA 22GSA 1XW9A 1K0OA 2BMXA 1AAZA 2HRFA 4ECBA 2VCTA 4DSSA 5IOXA 1A8LA 1B8XA 2O87A 3HJOA 1O8XA 3LQ7A 2VM2A 1XVWA 3KMOA 3IV4A 4GLTA 3WGDA 1XOAA 3VWUA 2LEGA 1EEMA 1NHYA 3WD6A 2H0HA 1ABAA 3ZZXA 4IBPA 3LG6A 2GTUA 2L6CA 6GSYA 1N2AA 4KA0A 2GDRA 1TOFA 1O73A 1S3DA 1YF0A 1O81A 2FWFA 2DJKA 1QQ2A 1M99A 1E6BA 5DDLA 2NPBA 2H66A 1GTBA 1RQMA 3QD9A 2K8SA 6GSXA 1NSWA 1BYEA 2F9SA 2IIYA 4MJAA 1HD2A 1DE2A 2V6KA 5FWGA 4KW6A 5DBQA 1IYHA 1O85A 3ZREA 3H4KA 4ZB6A 4Q5RA 3TKRA 2C0FA 2YV7A 3GX8A 1EZKA 5J3RA 4KAEA 4HUAA 3FZ4A 2CVDA 5HR1A 3TKSE 5F8BA 4RI7A 2HZFA 5G31A 1ML6A 2XPDA 3H1NA 4OD7A 3FY7A 2H71A 5LD0A 3F4TA 2MZCA 2HFDA 1FHEA 3D4MA 5LCZA 1X0RA 1TTZA 5G5EA 4F03A 3HJPA 3F0IA 5ABRA 1LBKA 2I9HA 1GSFA 4BPYA 3QFAC 4ZBAA 2NVLA 2H30A 3MNGA 2F3MA 2OE3A 3A3TA 1M7TA 3CRTA 2B5EA 4GSSA 2CAQA 1S3AA 3FKFA 3DXBA 4FO5A 4FIWA 3VPTA 2JU5A 2A2RA 5FHIA 2AV4A 2VOCA 1F2EA 2CZ2A 2LS5A 1THOA 3TDGA 1TK8B 4AJ7A 4X0XA 2REMA 5DQSA 4ML6A 4CHSA 1XPVA 4LL1B 3BOAA 3P2AA 2X64A 2RIIA 3K8NA 1AIUA 3BJ5A 4BVXA 1LJRA 4HS1A 4G2EA 2H72A 5IPHA 4YQVA 3ZMLA 4WF5A 2GT5A 4JE1A 3LYKA 5ECPB 2DMMA 2LRCA 2LRTA 3LFLA 5AIXA 3C1RA 3LSZA 3EYTA 2GZYA 3F9UA 2OADA 3EE2A 4ULXA 3US3A 5G30A 3MSZA 4OCEA 1X5EA 4JEDA 4ECIA 2J9HA 5J9CA 4XS4A 4TKYA 3F3RA 4HU9A 3HY2A 6GSWA 3APOA 7GSSA 1SK1A 2QGVA 2GT6A 3GL3A 3GH6A 3HVVA 4V1Ag 4HQSA 4PNGA 4XS4B 1YEXA 2OKAA 3GSTA 4K7IA 2HZEB 3AY8A 5GSTA 1SK2A 1VF4A 4K0NA 1DUGA 2PN8A 5AGYA 2FUG2 3GUSA 2X8HA 1GSEA 1R26A 5IO0A 1Z9HA 2YCDA 2XBQA 2D2ZA 2H6ZA 2L5OA 2H6XA 3CSIA 5J4UA 2QC7A 2FWGA 5JWQB 1TW9A 3KTLA 4PQIA 2JZSA 2H76A 17GSA 2EC4A 2PMTA 5HR2A 1YQ1A 1UVZA 4TN8A 3TKPA 3UIWA 4PURA 4YAVA 4DEJA 3IDVA 2H1BA 1J08A 5DCGA 4XCSA 5DALB 4WR5A 1B4PA 4OO4A 5JCUA 2CX3A 3WGEA 5B6NA 1H75A 1SD8A 5J41A 1WE0A 1FB6A 2AAWA 3MDKA 1URMA 2MBTA 3CSJA 3ZVJD 1YJ6A 4CW9A 1FAAA 3J7Yk 3FR9A 3FW2A 3WT2A 2B5XA 4ECCA 14GSA 4E8HA 3QPMA 4K9ZA 1OKTA 5KN3A 1WP0A 1TXXA 2L4QA 2GZPA 3C8EA 1A2MA 2K6VA 2RLIA 5CP1A 5COHA 3WGXA 4HZ4A 3L0HA 4KCEA 5CRWA 2IMKA 2NBSA 1AUCA 2C1YA 4NHZA 2JADA 2P31A 1C72A 4ML1A 2C0EA 2KUCA 1GUHA 1BQ7A 1F6MC 4KSOA 19GSA 1KBNA 3ED3A 2GSQA 3O76A 3ERWA 2C80A 1QGVA 3HDCA 3IR4A 2L5LA 3DWVA 3BD2A 1A0FA 1Z7RA 2L57A 3IAS2 4POBA 5CAXA 4QL7A 4J2FA 1Z6MA 2H75A 3JCML 3FK8A 1F3BA 2JACA 2TRCP 1TRSA 3VI5A 3W6GA 1ERUA 4N0VA 2HE3A 1WMJA 3KXOA 4K6XA 1XZOA 3C71A 5EY6A 1PX7A 5F0GA 1GL8A 3GKNA 4I8BA 2VAFA 1Y25A 4I5QA 3LXTA 3GHAA 2GS3A 2OA7A 4N10A 2WS2A 4MCUA 3ISOA 2EIRA 2WULA 1PQNA 1U3AA 3IE3A 2F8AA 2DJ0A 2IN3A 4POKA 2GLRA 1FOVA 4YAPA 1GP1A 3F8UA 1O8WA 4JR6A 4ZBBA 1JZWA 1XOBA 4GCIA 4XRAA 4IS0A 4OO5A 1NHOA 13GSA 4MDCA 2X8GA 4DSQA 2WFCA 1Y6EA 2VUPA 1NM3A 1JHBA 4KUNA 2RUEA 2M72A 4MMMA 4DVCA 4YQMA 4Q5QA 5A5KA 2VL2A 5ECLB 1A0RP 4JR4A 3HA9A 1MD3A 1SYRA 3Q74A 5IMCA 1AW9A 1FVJA 2P0GA 3F6DA 1K0CA 1TRWA 1PL1A 4WETA 3HXSA 4G10A 4V2LA 1ZYEA 3APQA 4HQZA 1TI1A 11GSA 3QMXA 4ZL7A 1LU4A 2CX4A 2C8UA 5E59A 4MA9A 5DJMA 2LKUA 2H0IA 1VRSD 4NXIA 4FYCA 2LNTA 5DVBA 3NOFA 2N5BA 2V1MA 2FY6A 3FRCA 4NWYA 1B9XC 5IQYA 1XWCA 2FCHA 3I9V2 3M1GA 1OE8A 3C1SA 4MPFA 4OFTA 3F4RA 1MTCA 3HYPA 2JL4A 4OCFA 3TRPA 1GTIA 2B7KA 4KDUA 3UAPA 2HLSA 2CVBA 1FG4A 1TK5B 4IP6A 1M9AA 4KE3A 3GIXA 3M0FA 1PKWA 4N0ZA 1HNAA 5HQPA 5ECQB 4O92A 5ELAA 2C3TA 4MP4A 4IKHA 2O85A 2AYTA 1TP9A 4DSSB 4OMVA 1PMTA 5AIVA 1EWXA 4WF4A 4BVYA 3GKMA 3SBCA 3QAWA 2DMLA 2B3SA 2CT6A 5E4WA 2IFQA 2YN1A 1SJZA 1GLPA 2XHFA 3HKRA 3HHVA 2IMEA 4Q5FA 3TJKA 2YPMA 2K18A 2IFQB 5G2ZA 1U87A 3L4NA 1XW6A 2M46A 3GKKA 1U3IA 1W4VA 1X9WB 4PUFC 4TVEA 3HD5A 5ECRB 2V2GA 3FHKA 4ZB9A 3EVIA 5IMFA 4JZQA 2IL3A 1YEPA 2FGXA 4J57E 4IGJA 3G7JA 4F0BA 1GRXA 4TRXA 1GULA 3IHQA 1X5DA 4KX4A 4N11A 1RW1A 1R5PA 2VCVA 3VK9A 1R7HA 1VF2A 5ECSA 2KP1A 2C3QA 3D5JA 3IRAA 3CBUA 1Q98A 1W89A 1K0AA 2WZ9A 1ERTA 3DEXA 1MD4A 1TI3A 5DQYA 3UVTA 2NDOA 1MDKA 3CYNA 3CTGA 3C73A 2YWOA 2KOKA 2RM6A 2HSYA 2R37A 5IMZA 1WPIA 3UARA 3G7IA 4K7OA 2WGRA 3CXGA 4WBJA 1PN9A 4EF0A 1GNWA 3HJMA 3EMXA 4L8EA 5KN1A 1TRVA 3QOUA 5INYA 5JWRB 3GN3A 5F06A 1K0BA 1VGLA 1GWCA 4LLRA 4O7HA 2I3YA 2CV4A 2B1LA 3Q19A 1MEKA 2XPEA 2AB6A 1UN2A 2VO4A 3EWLA 5CRHA 3KGKA 1OAZA 2DLXA 4ILFA 4HJ2A 1H4OA 3FZ5A 2H74A 4MPGA 1PGTA 1YY7A 4K1FA 2AUVA 4PX1A 5A4WA 4WXTA 5EL8A 2YJHA 3KD0A 4OWYA 1A2LA 2DBCA 1SKSB 5ID2A 4I6XA 2ALBA 3W8SA 4EO3A 1PKZA 3P7XA 3GL5A 2EIOA 4AJ6A 1M0UA 2QSIA 2R3XA 3LYPA 1S3CA 4HJMA 2N5FA 2B1KA 3O6TA 2ON5A 4K8MA 1ERWA 2DIYA 4NMUA 5G1LA 1AXDA 4YH2A 1WOUA 1V58A 3HVXA 3QFBC 2OJLA 1GSSA 3GFKA 5CO3A 4JU5A 3UBKA 5LNKe 2B7JA 5ENUA 3IBHA 4GF0A 3KM6A 2FWEA 4ZL9A 1M2AA 2FD3A 5GAPD 3UEMA 2F51A 4K2DA 1TU8A 5DCHA 4KCAA 3E9JB 3LEFA 3RDWA 4GSTA 3VWWA 4GXZA 2H73A 4MK3A 3RHBA 4FH8A 2TRXA 1N8JA 4MABA 1VF3A 3V1WA 5IO2A 2HI7A 4XHMA 1DBYA 1O6JA 1QMVA 5GSSA 2XBIA 1YKCA 1PSQA 3O3TA 3GNJA 2L59A 1PD21 2PVOC 4D73A 1HQOA 1ACVA 3J7Yb 5L71A 2DC5A 2K8VA 1SYXA 16GSA 5H5RA 4PGTA 2ON7A 3VLNA 2X8CA 3ZVJA 9GSSA 2LTKA 3LWAA 3P90A 4MF6A 2PBJA 4GSNA 5AN1A 1OVNA 2IJYA 2YWMA 2FNOA 1SJIA 5H5SA 3I6AA 4GRFA 5ECNB 4NV2A 1OC9A 2YWIA 2IMDA 2O7KA 2MMOA 5EPFA 1TU7A 4WR4A 2CVKA 1TJDA 1GSYA 1CQGA 1X5CA 5CRDA 2PWJA 1OC9B 1E2YA 1KEBA 1GSQA 1XIYA 2P5RA 1A2JA 4X43A 4ZXGA 2ZCTA 4OFNA 3TRXA 1OYJA 4JRRA 3DYRA 4CDOA 3GMFA 2GSSA 4HDEA 2I4AA 3KH7A 5D93A 2H1AA 2VCQA 2GZZA 3RHCA 2L6DA 3TKSC 2E7PA 2H1GA 5DAKA 4MH2A 3GV1A 2IPAA 3KIJA 2DIZA 5IMDA 3U6VA 3UBLA 3TUEA 1V57A 4TR4A 2Z9SA 1AQVA 4O5RA 4AJ8A 1EP8A 5HFIA 4I97A 2OBKA 3ZMKA 3DVXA 4RI6A 4RUVA 5ELGA 2J23A 1OE7A 1ON4A 4NPBA 4MF7A 1XBSA 3PGTA 3G9BA 3RBTA 3D4TA 2FWHA 4IHUA 2V6OA 2C3NA 4HI7A 4PNFA 2OBIA 5ECMB 1USBA 2EIQA 3E0UA 1OC3A 4K0GA 3CRUA 2V41A 1DSBA 2HNLA 5C00A 1QK8A 2OE0A 2H8LA 4KDXA 4OFMA 4ZBDA 2R5GA 3IK9A 4XTSA 3FR6A 5IIZA 4LMWA 2LQOA 3DGQA 2R6KA 1FW1A 3ZLPA 3DRNA 4KSMA 2HRNA 3IOSA 4KB3A 2C0DA 2CZ3A 1ST9A 2LJAA 4TR3A 5G5FA 2OE1A 2RUFA 1WRYA 2C4JA 2VCWA 4IJIA 3F4SA 2DJ1A 4POLA 3MAKA 3UOMA 4I2TA 1KNGA 4MF5A 3Q6OA 3IXRA 2FLSA 2LV3A 3L9UA 3LORA 4K7NA 2HYXA 2PPTA 2F8FA 3S9FA 2L4CA 3BBYA 1V98A 1BAYA 3R2QA 4TXOA 2GSTA 3ZRDA 1RK4A 2YP6A 1ZMAA 2LRNA 3P8WA 1YF1A 3GTUA 1WIKA 4JBBA 2YWNA 2VCXA 3KH9A 4Q5NA 4TXVA 1TRUA 1Q4JA 4PUAA 4MJCA 5B7CA 5J5NA 1U6TA 1QFNA 2IWTA 4I2UA 3OR5A 2YANA 1M2BA 2LSTA 2MBSA 1SKWB 3VPQA 1F3AA 2GQLA 4NAXA 3ERGA 3BCIA 4L5LA 1FB0A 3GKXA 4QQ7A 2WB9A 4RQRA 1A8YA 3MWHA 2VD1A 4V2MA 4P3YB 1CQHA 3KZQA 2MMZA 1SENA 3D21A 2VLTA 1QUWA 4TR1A 1I9DA 3TGZA 1G6WA 1JZOA 2IMIA 3PH9A 2JZTA 4NV5A 4ACSA 2HSHA 2PERA 3QAVA 2VIMA 3GYKA 1XXUA 1V40A 4QL9A 1FO5A 2B6MA 1PA3A 5J9BA
chains in the Genus database with same CATH superfamily
2H70A 3PR8A 1NW2A 1V2AA 4G9HA 4ZILA 2LQQA 4LL4B 2AJQB 3GURA 5ECHB 3HVSA 3W8JA 2YZUA 2VCZA 2PVQA 3D0ZA 2PGTA 1T8EB 3GSSA 4LA1A 4V2NA 2NTOA 3ZIVA 4Z2RA 3CMIA 1JLWA 4RQXA 4BWQA 1ZYQB 2VL9A 5G1KA 3DIEA 1SKRB 3DVWA 3SWLA 4BVYB 1Z6NA 3IAM2 1HYUA 3ZTLA 1TDIA 1U88A 4MNNA 2GVPA 2LUSA 4F0CA 3TJBA 4TR0A 5F05A 5HR0A 2HT9A 1SU9A 5CNWA 4BWSA 4YKGA 3EU3A 1JLVA 3NIVA 5KN2A 2VD0A 4J56E 6GSUA 4V1Ap 3FR3A 1XCCA 1G6YA 18GSA 4HZ2A 1F9MA 4IQAA 1GTUA 4L0UA 3R3EA 1EOHA 3TJFA 1GNEA 3QAGA 4PQ1A 5F07A 5AISA 1GH2A 1FVKA 2ZNMA 2R0PA 3GH9A 1YKAA 5IMVA 3ZITA 2A2SA 4ID0A 1ZGNA 5IPGA 1O7UA 1SK0A 3EU4A 3M9KA 1K0DA 3WYWA 1IYIA 1B9YC 4IJ3A 3ME7A 8GSSA 1G7OA 1J9BA 1G7EA 3CTFA 2WCIA 2YZHA 1WJKA 2G2QA 4L0WA 4PQHA 2VM1A 1SL0B 3TKQA 3KP8A 5D8IA 4IVFA 2ES7A 10GSA 3HZ8A 3LXZA 3F3QA 4MZWA 2MYGA 1F37A 3KCMA 5HFGA 3A2VA 3A5WA 2PU9C 6GSVA 4XIHA 1TKDB 1X9SB 4IELA 3ZYWA 1B4QA 3VURA 3UL3A 3KP9A 4ICYA 2H1DA 3ZIJA 4EDYA 3A2XA 3WT1A 1JZDA 2P5QA 2G0FA 2O8VB 1VF1A 2KP2A 4FYBA 1GTAA 5ID2B 3IPZA 3ZFBA 4GQFA 2E2MA 4KDYA 20GSA 5A4UA 1OC8A 3UMAA 4ZL8A 3D22A 1T4ZA 4XS1A 6GSSA 4DSRA 1OKDA 4L5OA 1XW5A 3M8NA 3FMWA 1AQXA 5IMAA 1T3BA 2UZ8A 2ZUPA 3D6IA 4MLYA 2HZEA 1JZRA 3EURA 3APSA 2LJKA 4EDZA 2LJRA 3HZ4A 5IM9A 1ZL9A 3KMNA 2FA4A 4MZBA 1XWGA 4EC0A 5B6MA 1XFLA 3TJGA 3UJ1A 3IC4A 4CY8A 2AHEA 5D96A 1YZXA 2QKEA 1Z5YE 3GA4A 1J0FA 3LGCA 3FYGA 1HNBA 1X9MB 3H93A 4EL1A 4PXOA 2HRAA 2MMAA 4GTUA 4G19A 2O89A 2WJUA 5DALA 4FYUA 2H6YA 5CRGA 1K0MA 4AF2A 1T7PB 1AQWA 5CYYA 1EP7A 2KHPA 3KEBA 4D73B 2I1UA 5GAND 2YNXA 3L9VA 5B8BA 1GUKA 2H01A 3PINA 2RM5A 4F2IA 4YQUA 5D73A 4X1UA 3RPPA 1XWBA 4KNDA 1I5GA 1GSUA 3RAZA 5D9WA 2M80A 4MH3A 1AC1A 4Z2TA 1K3YA 5JWOB 4BA7A 3ERFA 1SJ6A 4HOJA 1BJXA 3TB2A 1GUMA 2FHEA 3H79A 3IK7A 2I81A 5C04A 2GGTA 5EVOA 3QCPA 1EGOA 3C7MA 1EGRA 1EV4A 6GSTA 2BJXA 2E2GA 3L78A 3EMPA 2CA8A 1HNCA 2JSYA 4ZB8A 4EUYA 4F9ZA 3H8QA 1PFOA 4WEYA 1M2DA 4EVMA 2MMNA 1SL2B 1EV9A 3UVHA 5B8AA 3VI7A 5GZZB 1SL1B 5DJLA 1R4WA 3M9JA 1MDJA 4LMVA 3N5OA 5D9XA 1PRXA 3A2WA 5ECIB 4Z2UA 2DSAA 2DJ2A 3KJYA 1GSDA 2VL2C 3EINA 3CSHA 2LNSA 5DAKB 1A23A 1K3OA 4IN0A 4E8EA 4TW5A 5JCGA 4XS6A 3QR6A 3IA1A 4H86A 1TK0B 5D9TA 3KTBA 2N5AA 1BX9A 2R4VA 3HCZA 1T1VA 3LW9A 1ERVA 5HFKA 4GQCA 1Z3EA 3TJJA 5ECKB 4Z7XA 1T00A 2B5YA 2CAIA 2KLXA 3DMLA 4HSCX 3U5RE 3F63A 1UA5A 4WBRD 2VLVA 4MJBA 12GSA 1M9BA 2GSRA 2R2JA 3N9JA 3E3EA 4F82A 4ECJA 2FA8A 4GWRA 1KTEA 1WWJA 1BG5A 3DD3A 2VL3A 2X99A 1UC7A 1THXA 3GRXA 1EEJA 5D9VA 1XWKA 1QXHA 3FZ9A 4EKZA 2H0GA 5ECOB 1XVQA 3I43A 3LJRA 1PX6A 2K9FA 1XWAA 2XC2A 2GQKA 5KN0A 1YDKA 3GX0A 4BL7A 2WRTA 1PL2A 3TKSA 5CREA 3L9SA 4ISDA 3DKSA 2JSZA 3M3MA 3ME8A 2H19A 2YV9A 1T4YA 4EE0A 3I69A 1MDIA 1K0NA 1JFUA 4KH7A 4HEA2 5FT3A 3VWVA 3G7YA 2HXKA 5HR3A 2YOIA 2E0QA 1Z7PA 3Q18A 3NZNA 1R5AA 4O32A 5KEJA 3VFIA 2DJJA 5IOWA 2QA1A 4IQ1A 1K3LA 1V9WA 4TXOB 4N30A 1G0TA 3GTUB 5A4VA 1ZOFA 1BEDA 2YJ7A 4MZCA 4EXJA 5JCWA 4NHWA 4KGIA 1ILOA 2PUKC 3ZFLA 4MJEA 3F6FA 2V32A 1ZZYA 3TOUA 2DJ3A 2C0GA 2A4VA 4XRDA 4POMA 2JZRA 3TOTA 3EC3A 2GQMA 2TIRA 3TRQA 4HU7A 3VWXA 4TOPA 3ZL5A 1A24A 4AGSA 2CQ9A 3RPNA 5H5QA 2OACA 1ZCPA 4IP1A 1SD9A 2VLUA 3FEUA 1GLQA 4IW9A 3TCOA 3BCKA 3FZAA 3QDNA 4ZIJA 4WKWA 1EOGA 2WDUA 1DE1A 1B48A 2BTOT 4TR1B 2IMFA 22GSA 1XW9A 1K0OA 4G0IA 2BMXA 1AAZA 2HRFA 4ECBA 2VCTA 4DSSA 5IOXA 1A8LA 1B8XA 2O87A 3HJOA 1O8XA 3LQ7A 2VM2A 1XVWA 3KMOA 3IV4A 4GLTA 3WGDA 1XOAA 3VWUA 2LEGA 1EEMA 1NHYA 3WD6A 2H0HA 1ABAA 3ZZXA 1XG8A 4IBPA 3LG6A 2GTUA 2L6CA 6GSYA 1N2AA 4KA0A 2GDRA 1TOFA 1O73A 1S3DA 1YF0A 1O81A 2FWFA 2DJKA 1QQ2A 1M99A 1E6BA 5DDLA 2NPBA 2H66A 1GTBA 1RQMA 3QD9A 2K8SA 6GSXA 1NSWA 1BYEA 2F9SA 2IIYA 4MJAA 3IC8A 1HD2A 1DE2A 2V6KA 5FWGA 4KW6A 1ZYPA 5DBQA 1IYHA 1O85A 3ZREA 3H4KA 4ZB6A 4Q5RA 3TKRA 2C0FA 2YV7A 3GX8A 1EZKA 5J3RA 4KAEA 4HUAA 3FZ4A 2CVDA 5HR1A 3TKSE 5F8BA 4RI7A 2HZFA 5G31A 1ML6A 2XPDA 3H1NA 4OD7A 3FY7A 2H71A 5LD0A 3F4TA 2MZCA 2HFDA 1FHEA 3D4MA 5LCZA 1X0RA 1TTZA 5G5EA 4F03A 3HJPA 3F0IA 5ABRA 1LBKA 2I9HA 1GSFA 4BPYA 3QFAC 4ZBAA 2NVLA 2H30A 3MNGA 2F3MA 2OE3A 3A3TA 1M7TA 3CRTA 2B5EA 4GSSA 2CAQA 1S3AA 3FKFA 3DXBA 4FO5A 4FIWA 3VPTA 2JU5A 2A2RA 5FHIA 2AV4A 2VOCA 1F2EA 2CZ2A 2LS5A 1THOA 3TDGA 1TK8B 4AJ7A 4X0XA 2REMA 5DQSA 4ML6A 4CHSA 5KOWA 1XPVA 4LL1B 3BOAA 2HRKA 3P2AA 2X64A 2RIIA 3K8NA 1AIUA 3BJ5A 4BVXA 1LJRA 4HS1A 4G2EA 2H72A 5IPHA 4YQVA 3ZMLA 4WF5A 2GT5A 4JE1A 3LYKA 5ECPB 2DMMA 2LRCA 2LRTA 3LFLA 5AIXA 3C1RA 3LSZA 4K2XA 3EYTA 2GZYA 3F9UA 2OADA 3EE2A 4ULXA 3US3A 5G30A 3MSZA 4OCEA 1X5EA 4JEDA 4ECIA 2J9HA 5J9CA 4XS4A 4TKYA 3F3RA 4HU9A 3HY2A 6GSWA 3APOA 7GSSA 1SK1A 2QGVA 3CQFA 2GT6A 3GL3A 3GH6A 3HVVA 4V1Ag 4HQSA 4PNGA 4XS4B 1YEXA 2OKAA 3GSTA 4K7IA 2HZEB 3AY8A 5GSTA 1SK2A 1VF4A 4K0NA 1DUGA 2PN8A 5AGYA 2FUG2 3GUSA 2X8HA 1GSEA 1R26A 5IO0A 1Z9HA 2YCDA 2XBQA 2D2ZA 2H6ZA 2L5OA 2H6XA 3CSIA 5J4UA 2QC7A 2FWGA 5JWQB 1TW9A 3KTLA 4PQIA 2JZSA 2H76A 17GSA 2EC4A 2PMTA 5HR2A 1YQ1A 3IHGA 1UVZA 4TN8A 3TKPA 3UIWA 4PURA 4YAVA 4DEJA 3IDVA 2H1BA 1J08A 5DCGA 4XCSA 5DALB 4WR5A 1B4PA 4OO4A 5JCUA 2CX3A 3WGEA 5B6NA 1H75A 1SD8A 5J41A 1WE0A 1FB6A 2AAWA 3MDKA 1URMA 2MBTA 3CSJA 3ZVJD 1YJ6A 4CW9A 1FAAA 3J7Yk 3FR9A 3FW2A 3WT2A 2B5XA 4ECCA 4K5SA 14GSA 4E8HA 3QPMA 4K9ZA 1OKTA 5KN3A 1WP0A 1TXXA 2L4QA 2GZPA 3C8EA 4YKFA 1A2MA 2K6VA 2RLIA 5CP1A 5COHA 3WGXA 4HZ4A 3L0HA 4KCEA 5CRWA 2IMKA 2NBSA 1AUCA 2C1YA 4NHZA 2JADA 2P31A 1C72A 4ML1A 2C0EA 2KUCA 1GUHA 1BQ7A 1F6MC 4KSOA 19GSA 1KBNA 3ED3A 2GSQA 3O76A 3ERWA 2C80A 2A2PA 1QGVA 3HDCA 3IR4A 2L5LA 3DWVA 3BD2A 1A0FA 1Z7RA 2L57A 4CY6A 3IAS2 4POBA 5CAXA 4QL7A 4J2FA 1Z6MA 2H75A 3JCML 3FK8A 1F3BA 2JACA 2TRCP 1TRSA 3VI5A 3W6GA 1ERUA 4N0VA 2HE3A 1WMJA 3KXOA 4K6XA 1XZOA 3C71A 5EY6A 1PX7A 5F0GA 1GL8A 3GKNA 4I8BA 2VAFA 1Y25A 4I5QA 3LXTA 3GHAA 2GS3A 2OA7A 4N10A 2WS2A 4MCUA 3ISOA 2EIRA 2WULA 1PQNA 1U3AA 3IE3A 2F8AA 2DJ0A 2IN3A 4POKA 2GLRA 1FOVA 4YAPA 1GP1A 3F8UA 1O8WA 4JR6A 4ZBBA 1JZWA 1XOBA 4GCIA 4XRAA 4IS0A 4OO5A 1NHOA 13GSA 4MDCA 2X8GA 4DSQA 4O5UA 2WFCA 4BL7B 1Y6EA 2VUPA 1NM3A 1JHBA 4KUNA 3MYDA 2RUEA 2M72A 4MMMA 4DVCA 4YQMA 4Q5QA 5A5KA 2VL2A 5ECLB 1A0RP 4JR4A 3HA9A 1MD3A 1SYRA 3Q74A 5IMCA 1AW9A 1FVJA 2P0GA 5BRTA 3F6DA 1K0CA 3PPUA 1TRWA 1PL1A 4WETA 3HXSA 4G10A 4V2LA 1ZYEA 3APQA 2R0CA 4HQZA 1TI1A 11GSA 3QMXA 4ZL7A 4USSA 1LU4A 2CX4A 2C8UA 5E59A 4MA9A 5DJMA 2LKUA 2H0IA 1VRSD 4NXIA 4FYCA 2LNTA 5DVBA 3NOFA 2N5BA 2V1MA 2FY6A 3FRCA 4NWYA 1B9XC 5IQYA 1XWCA 2FCHA 3I9V2 3M1GA 1OE8A 3C1SA 4MPFA 4OFTA 3F4RA 1MTCA 3HYPA 2JL4A 4OCFA 3TRPA 1GTIA 2B7KA 4KDUA 3UAPA 2HLSA 2CVBA 3HVNA 1FG4A 1TK5B 4IP6A 4PTSA 1M9AA 4KE3A 3GIXA 3M0FA 1PKWA 4N0ZA 1HNAA 5HQPA 5ECQB 4O92A 5ELAA 2C3TA 4MP4A 4IKHA 2O85A 2AYTA 1TP9A 4DSSB 4OMVA 1PMTA 5AIVA 1EWXA 4WF4A 4BVYA 3GKMA 3SBCA 3QAWA 2DMLA 2B3SA 2CT6A 5E4WA 2IFQA 2YN1A 1SJZA 1GLPA 2XHFA 3HKRA 3HHVA 2IMEA 4Q5FA 3TJKA 2YPMA 2A4HA 2K18A 2IFQB 5G2ZA 1U87A 3L4NA 1XW6A 2M46A 3GKKA 1U3IA 1W4VA 1X9WB 4PUFC 4TVEA 3HD5A 5ECRB 2V2GA 3FHKA 2QA2A 4ZB9A 3EVIA 5IMFA 4JZQA 2IL3A 1YEPA 2FGXA 4J57E 4IGJA 3G7JA 4F0BA 1GRXA 4TRXA 1GULA 3IHQA 1X5DA 4KX4A 4N11A 1RW1A 1R5PA 2VCVA 3VK9A 1R7HA 1VF2A 5ECSA 2KP1A 1ZYNA 2C3QA 3D5JA 3IRAA 3CBUA 1Q98A 1W89A 1K0AA 2WZ9A 1ERTA 3DEXA 1MD4A 1TI3A 5DQYA 3UVTA 2NDOA 1MDKA 3CYNA 4EIQA 3CTGA 3C73A 2YWOA 2KOKA 3A5IA 2RM6A 2HSYA 2R37A 5IMZA 1WPIA 3UARA 3G7IA 4K7OA 2WGRA 3CXGA 4WBJA 1PN0A 1PN9A 4EF0A 1GNWA 3HJMA 3EMXA 4L8EA 5KN1A 1TRVA 3QOUA 5INYA 5JWRB 3GN3A 1K0BA 5F06A 1VGLA 1GWCA 4LLRA 4O7HA 4X4JA 2I3YA 2CV4A 2B1LA 3Q19A 1MEKA 2XPEA 2AB6A 1UN2A 4O5QA 2VO4A 3EWLA 5CRHA 3KGKA 1OAZA 2DLXA 4ILFA 4HJ2A 1H4OA 3FZ5A 2H74A 4MPGA 1PGTA 1YY7A 4K1FA 2AUVA 4PX1A 5A4WA 4WXTA 5EL8A 2YJHA 3KD0A 4OWYA 1A2LA 2DBCA 1SKSB 5ID2A 4I6XA 2ALBA 3W8SA 4EO3A 1PKZA 3P7XA 4BVXB 3GL5A 2EIOA 4AJ6A 1M0UA 2QSIA 2R3XA 3LYPA 1S3CA 4HJMA 2N5FA 2B1KA 3O6TA 2ON5A 4K8MA 1ERWA 2DIYA 4NMUA 5G1LA 1AXDA 4YH2A 1WOUA 1V58A 3HVXA 3QFBC 2OJLA 1GSSA 3GFKA 5CO3A 4JU5A 3UBKA 5LNKe 2B7JA 5ENUA 3IBHA 4GF0A 3KM6A 2FWEA 4ZL9A 1M2AA 2FD3A 5GAPD 3UEMA 5KOXA 4G0LA 1FOHA 2F51A 4K2DA 1TU8A 5DCHA 4KCAA 3E9JB 3LEFA 4BIKA 3RDWA 4GSTA 3VWWA 4GXZA 2H73A 4MK3A 3RHBA 4FH8A 2TRXA 1N8JA 4MABA 1VF3A 3V1WA 5IO2A 2HI7A 4XHMA 1DBYA 1O6JA 1QMVA 5GSSA 2XBIA 1YKCA 1PSQA 3O3TA 2X49A 3GNJA 2L59A 2HSMA 1PD21 2PVOC 4D73A 2X4AA 1HQOA 1ACVA 3J7Yb 5L71A 2DC5A 2K8VA 1SYXA 16GSA 5H5RA 4PGTA 2ON7A 3VLNA 2X8CA 3ZVJA 9GSSA 2LTKA 4KF9A 3LWAA 3P90A 4MF6A 2PBJA 4GSNA 5AN1A 1OVNA 2IJYA 2YWMA 2FNOA 1SJIA 5H5SA 3I6AA 4GRFA 5ECNB 2DKHA 4NV2A 1OC9A 2YWIA 2IMDA 2O7KA 2MMOA 5EPFA 1TU7A 4WR4A 2CVKA 1TJDA 1GSYA 1CQGA 1X5CA 5CRDA 2PWJA 1OC9B 1E2YA 1KEBA 1GSQA 1XIYA 2P5RA 1A2JA 4X43A 4ZXGA 2ZCTA 4OFNA 3TRXA 1OYJA 4JRRA 3DYRA 4CDOA 3GMFA 2GSSA 4HDEA 2I4AA 3KH7A 5D93A 2H1AA 2VCQA 2GZZA 3RHCA 2L6DA 3TKSC 2E7PA 2H1GA 5DAKA 4MH2A 3GV1A 2IPAA 3KIJA 2DIZA 5IMDA 3U6VA 3UBLA 3TUEA 1M3JA 1V57A 4TR4A 2Z9SA 1AQVA 4O5RA 4AJ8A 1EP8A 5HFIA 4I97A 2OBKA 3ZMKA 3DVXA 4RI6A 4RUVA 5ELGA 2J23A 1OE7A 1ON4A 3MIXA 4NPBA 4MF7A 1XBSA 3PGTA 3G9BA 3RBTA 3D4TA 2FWHA 4IHUA 2V6OA 2C3NA 4HI7A 4PNFA 2OBIA 3EPTA 5ECMB 1USBA 2EIQA 3E0UA 1OC3A 4K0GA 3CRUA 2V41A 1DSBA 2HNLA 5C00A 4A5PA 1QK8A 2OE0A 2H8LA 4KDXA 4OFMA 4ZBDA 2R5GA 3IK9A 4XTSA 2DKIA 3FR6A 5IIZA 4LMWA 2LQOA 3DGQA 2R6KA 1FW1A 3ZLPA 3DRNA 4KSMA 2HRNA 3IOSA 4KB3A 2C0DA 2CZ3A 1ST9A 2LJAA 4TR3A 5G5FA 2OE1A 2RUFA 1WRYA 2C4JA 2VCWA 4IJIA 3F4SA 2DJ1A 4POLA 3MAKA 2R0GA 3UOMA 4I2TA 1KNGA 4MF5A 3Q6OA 3IXRA 2FLSA 2LV3A 3L9UA 3LORA 4K7NA 2HYXA 2PPTA 1S3RA 2F8FA 3S9FA 2L4CA 3BBYA 1V98A 1BAYA 3R2QA 4TXOA 2GSTA 3ZRDA 1RK4A 2YP6A 1ZMAA 2LRNA 3P8WA 1YF1A 3GTUA 1WIKA 4JBBA 2YWNA 4FQUA 2VCXA 3KH9A 4Q5NA 4TXVA 1TRUA 1Q4JA 4PUAA 4MJCA 5B7CA 5J5NA 1U6TA 1QFNA 2IWTA 4I2UA 3OR5A 1M3IA 2YANA 1M2BA 4G0KA 2LSTA 2MBSA 1SKWB 3VPQA 1F3AA 5BMUA 2GQLA 4K5RA 4NAXA 3ERGA 3BCIA 4L5LA 1FB0A 3GKXA 4QQ7A 2WB9A 4RQRA 1A8YA 3MWHA 2VD1A 4V2MA 4P3YB 1CQHA 3KZQA 2MMZA 1SENA 3D21A 2VLTA 1QUWA 4TR1A 1I9DA 4EIPA 3TGZA 1G6WA 1JZOA 2IMIA 3PH9A 2JZTA 4NV5A 4ACSA 2HSHA 2PERA 3QAVA 2VIMA 3GYKA 1XXUA 1V40A 4QL9A 1FO5A 2B6MA 1PA3A 5J9BA
chains in the Genus database with same CATH topology
2H70A 3PR8A 1NW2A 1V2AA 4G9HA 4ZILA 2LQQA 4LL4B 2AJQB 3GURA 5ECHB 3HVSA 3W8JA 2YZUA 2VCZA 2PVQA 3D0ZA 2PGTA 1T8EB 3GSSA 4LA1A 4V2NA 2NTOA 3ZIVA 4Z2RA 3CMIA 1JLWA 4RQXA 4BWQA 1ZYQB 2VL9A 5G1KA 3DIEA 1SKRB 3DVWA 3SWLA 4BVYB 1Z6NA 3IAM2 1HYUA 3ZTLA 1TDIA 1U88A 4MNNA 2GVPA 2LUSA 4F0CA 3TJBA 4TR0A 5F05A 5HR0A 2HT9A 1SU9A 5CNWA 4BWSA 4YKGA 3EU3A 1JLVA 3NIVA 5KN2A 2VD0A 4J56E 6GSUA 4V1Ap 3FR3A 1XCCA 1G6YA 18GSA 4HZ2A 1F9MA 4IQAA 1GTUA 4L0UA 3R3EA 1EOHA 3TJFA 1GNEA 3QAGA 4PQ1A 5F07A 5AISA 1GH2A 1FVKA 2ZNMA 2R0PA 3GH9A 1YKAA 5IMVA 3ZITA 2A2SA 4ID0A 1ZGNA 5IPGA 1O7UA 1SK0A 3EU4A 3M9KA 1K0DA 3WYWA 1IYIA 1B9YC 4IJ3A 3ME7A 8GSSA 1G7OA 1J9BA 1G7EA 3CTFA 2WCIA 2YZHA 1WJKA 2G2QA 4L0WA 4PQHA 2VM1A 1SL0B 3TKQA 3KP8A 5D8IA 4IVFA 2ES7A 10GSA 3HZ8A 3LXZA 3F3QA 4MZWA 2MYGA 1F37A 3KCMA 5HFGA 3A2VA 3A5WA 2PU9C 6GSVA 4XIHA 1TKDB 1X9SB 4IELA 3ZYWA 1B4QA 3VURA 3UL3A 3KP9A 4ICYA 2H1DA 3ZIJA 4EDYA 3A2XA 3WT1A 1JZDA 2P5QA 2G0FA 2O8VB 1VF1A 2KP2A 4FYBA 1GTAA 5ID2B 3IPZA 3ZFBA 4GQFA 2E2MA 4KDYA 20GSA 5A4UA 1OC8A 3UMAA 4ZL8A 3D22A 1T4ZA 4XS1A 6GSSA 4DSRA 1OKDA 4L5OA 1XW5A 3M8NA 3FMWA 1AQXA 5IMAA 1T3BA 2UZ8A 2ZUPA 3D6IA 4MLYA 2HZEA 1JZRA 3EURA 3APSA 2LJKA 4EDZA 2LJRA 3HZ4A 5IM9A 1ZL9A 3KMNA 2FA4A 4MZBA 1XWGA 4EC0A 5B6MA 1XFLA 3TJGA 3UJ1A 3IC4A 4CY8A 2AHEA 5D96A 1YZXA 2QKEA 1Z5YE 3GA4A 1J0FA 3LGCA 3FYGA 1HNBA 1X9MB 3H93A 4EL1A 4PXOA 2HRAA 2MMAA 4GTUA 4G19A 2O89A 2WJUA 5DALA 4FYUA 2H6YA 5CRGA 1K0MA 4AF2A 1T7PB 1AQWA 5CYYA 1EP7A 2KHPA 3KEBA 4D73B 2I1UA 5GAND 2YNXA 3L9VA 5B8BA 1GUKA 2H01A 3PINA 2RM5A 4F2IA 4YQUA 5D73A 4X1UA 3RPPA 1XWBA 4KNDA 1I5GA 1GSUA 3RAZA 5D9WA 2M80A 4MH3A 1AC1A 4Z2TA 1K3YA 5JWOB 4BA7A 3ERFA 1SJ6A 4HOJA 1BJXA 3TB2A 1GUMA 2FHEA 3H79A 3IK7A 2I81A 5C04A 2GGTA 5EVOA 3QCPA 1EGOA 3C7MA 1EGRA 1EV4A 6GSTA 2BJXA 2E2GA 3L78A 3EMPA 2CA8A 1HNCA 2JSYA 4ZB8A 4EUYA 4F9ZA 3H8QA 4WEYA 1M2DA 4EVMA 2MMNA 1SL2B 1EV9A 3UVHA 5B8AA 3VI7A 5GZZB 1SL1B 5DJLA 1R4WA 3M9JA 1MDJA 4LMVA 3N5OA 5D9XA 1PRXA 3A2WA 5ECIB 4Z2UA 2DSAA 2DJ2A 3KJYA 1GSDA 2VL2C 3EINA 3CSHA 2LNSA 5DAKB 1A23A 1K3OA 4IN0A 4E8EA 4TW5A 5JCGA 4XS6A 3QR6A 3IA1A 4H86A 1TK0B 5D9TA 3KTBA 2N5AA 1BX9A 2R4VA 3HCZA 1T1VA 3LW9A 1ERVA 5HFKA 4GQCA 1Z3EA 3TJJA 5ECKB 4Z7XA 1T00A 2B5YA 2CAIA 2KLXA 3DMLA 3U5RE 3F63A 1UA5A 4WBRD 2VLVA 4MJBA 12GSA 1M9BA 2GSRA 2R2JA 3N9JA 3E3EA 4F82A 4ECJA 2FA8A 4GWRA 1KTEA 1WWJA 1BG5A 3DD3A 2VL3A 2X99A 1UC7A 1THXA 3GRXA 1EEJA 5D9VA 1XWKA 1QXHA 3FZ9A 4EKZA 2H0GA 5ECOB 1XVQA 3I43A 3LJRA 1PX6A 2K9FA 1XWAA 2XC2A 2GQKA 5KN0A 1YDKA 3GX0A 4BL7A 2WRTA 1PL2A 3TKSA 5CREA 3L9SA 4ISDA 3DKSA 2JSZA 3M3MA 3ME8A 2H19A 2YV9A 1T4YA 4EE0A 3I69A 1MDIA 1K0NA 1JFUA 4KH7A 4HEA2 5FT3A 3VWVA 3G7YA 2HXKA 5HR3A 2YOIA 2E0QA 1Z7PA 3Q18A 3NZNA 1R5AA 4O32A 5KEJA 3VFIA 2DJJA 5IOWA 2QA1A 4IQ1A 1K3LA 1V9WA 4TXOB 4N30A 1G0TA 3GTUB 5A4VA 1ZOFA 1BEDA 2YJ7A 4MZCA 4EXJA 5JCWA 4NHWA 4KGIA 1ILOA 2PUKC 3ZFLA 4MJEA 3F6FA 2V32A 1ZZYA 3TOUA 2DJ3A 2C0GA 2A4VA 4XRDA 4POMA 2JZRA 3TOTA 3EC3A 2GQMA 2TIRA 3TRQA 4HU7A 3VWXA 4TOPA 3ZL5A 1A24A 4AGSA 2CQ9A 3RPNA 5H5QA 2OACA 1ZCPA 4IP1A 1SD9A 2VLUA 3FEUA 1GLQA 4IW9A 3TCOA 3BCKA 3FZAA 3QDNA 4ZIJA 4WKWA 1EOGA 2WDUA 1DE1A 1B48A 2BTOT 4TR1B 2IMFA 22GSA 1XW9A 1K0OA 4G0IA 2BMXA 1AAZA 2HRFA 4ECBA 2VCTA 4DSSA 5IOXA 1A8LA 1B8XA 2O87A 3HJOA 1O8XA 3LQ7A 2VM2A 1XVWA 3KMOA 3IV4A 4GLTA 3WGDA 1XOAA 3VWUA 2LEGA 1EEMA 1NHYA 3WD6A 2H0HA 1ABAA 3ZZXA 4IBPA 3LG6A 2GTUA 2L6CA 6GSYA 1N2AA 4KA0A 2GDRA 1TOFA 1O73A 1S3DA 1YF0A 1O81A 2FWFA 2DJKA 1QQ2A 1M99A 1E6BA 5DDLA 2NPBA 2H66A 1GTBA 1RQMA 3QD9A 2K8SA 6GSXA 1NSWA 1BYEA 2F9SA 2IIYA 4MJAA 3IC8A 1HD2A 1DE2A 2V6KA 5FWGA 4KW6A 1ZYPA 5DBQA 1IYHA 1O85A 3ZREA 3H4KA 4ZB6A 4Q5RA 3TKRA 2C0FA 2YV7A 3GX8A 1EZKA 5J3RA 4KAEA 4HUAA 3FZ4A 2CVDA 5HR1A 3TKSE 5F8BA 4RI7A 2HZFA 5G31A 1ML6A 2XPDA 3H1NA 4OD7A 3FY7A 2H71A 5LD0A 3F4TA 2MZCA 2HFDA 1FHEA 3D4MA 5LCZA 1X0RA 1TTZA 5G5EA 4F03A 3HJPA 3F0IA 5ABRA 1LBKA 2I9HA 1GSFA 4BPYA 3QFAC 4ZBAA 2NVLA 2H30A 3MNGA 2F3MA 2OE3A 3A3TA 1M7TA 3CRTA 2B5EA 4GSSA 2CAQA 1S3AA 3FKFA 3DXBA 4FO5A 4FIWA 3VPTA 2JU5A 2A2RA 5FHIA 2AV4A 2VOCA 1F2EA 2CZ2A 2LS5A 1THOA 3TDGA 1TK8B 4AJ7A 4X0XA 2REMA 5DQSA 4ML6A 4CHSA 5KOWA 1XPVA 4LL1B 3BOAA 2HRKA 3P2AA 2X64A 2RIIA 3K8NA 1AIUA 3BJ5A 4BVXA 1LJRA 4HS1A 4G2EA 2H72A 5IPHA 4YQVA 3ZMLA 4WF5A 2GT5A 4JE1A 3LYKA 5ECPB 2DMMA 2LRCA 2LRTA 3LFLA 5AIXA 3C1RA 3LSZA 4K2XA 3EYTA 2GZYA 3F9UA 2OADA 3EE2A 4ULXA 3US3A 5G30A 3MSZA 4OCEA 1X5EA 4JEDA 4ECIA 2J9HA 5J9CA 4XS4A 4TKYA 3F3RA 4HU9A 3HY2A 6GSWA 3APOA 7GSSA 1SK1A 2QGVA 2GT6A 3GL3A 3GH6A 3HVVA 4V1Ag 4HQSA 4PNGA 4XS4B 1YEXA 2OKAA 3GSTA 4K7IA 2HZEB 3AY8A 5GSTA 1SK2A 1VF4A 4K0NA 1DUGA 2PN8A 5AGYA 2FUG2 3GUSA 2X8HA 1GSEA 1R26A 5IO0A 1Z9HA 2YCDA 2XBQA 2D2ZA 2H6ZA 2L5OA 2H6XA 3CSIA 5J4UA 2QC7A 2FWGA 5JWQB 1TW9A 3KTLA 4PQIA 2JZSA 2H76A 17GSA 2EC4A 2PMTA 5HR2A 1YQ1A 3IHGA 1UVZA 4TN8A 3TKPA 3UIWA 4PURA 4YAVA 4DEJA 3IDVA 2H1BA 1J08A 5DCGA 4XCSA 5DALB 4WR5A 1B4PA 4OO4A 5JCUA 2CX3A 3WGEA 5B6NA 1H75A 1SD8A 5J41A 1WE0A 1FB6A 2AAWA 3MDKA 1URMA 2MBTA 3CSJA 3ZVJD 1YJ6A 4CW9A 1FAAA 3J7Yk 3FR9A 3FW2A 3WT2A 2B5XA 4ECCA 4K5SA 14GSA 4E8HA 3QPMA 4K9ZA 1OKTA 5KN3A 1WP0A 1TXXA 2L4QA 2GZPA 3C8EA 4YKFA 1A2MA 2K6VA 2RLIA 5CP1A 5COHA 3WGXA 4HZ4A 3L0HA 4KCEA 5CRWA 2IMKA 2NBSA 1AUCA 2C1YA 4NHZA 2JADA 2P31A 1C72A 4ML1A 2C0EA 2KUCA 1GUHA 1BQ7A 1F6MC 4KSOA 19GSA 1KBNA 3ED3A 2GSQA 3O76A 3ERWA 2C80A 2A2PA 1QGVA 3HDCA 3IR4A 2L5LA 3DWVA 3BD2A 1A0FA 1Z7RA 2L57A 4CY6A 3IAS2 4POBA 5CAXA 4QL7A 4J2FA 1Z6MA 2H75A 3JCML 3FK8A 1F3BA 2JACA 2TRCP 1TRSA 3VI5A 3W6GA 1ERUA 4N0VA 2HE3A 1WMJA 3KXOA 4K6XA 1XZOA 3C71A 5EY6A 1PX7A 5F0GA 1GL8A 3GKNA 4I8BA 2VAFA 1Y25A 4I5QA 3LXTA 3GHAA 2GS3A 2OA7A 4N10A 2WS2A 4MCUA 3ISOA 2EIRA 2WULA 1PQNA 1U3AA 3IE3A 2F8AA 2DJ0A 2IN3A 4POKA 2GLRA 1FOVA 4YAPA 1GP1A 3F8UA 1O8WA 4JR6A 4ZBBA 1JZWA 1XOBA 4GCIA 4XRAA 4IS0A 4OO5A 1NHOA 13GSA 4MDCA 2X8GA 4DSQA 4O5UA 2WFCA 4BL7B 1Y6EA 2VUPA 1NM3A 1JHBA 4KUNA 3MYDA 2RUEA 2M72A 4MMMA 4DVCA 4YQMA 4Q5QA 5A5KA 2VL2A 5ECLB 1A0RP 4JR4A 3HA9A 1MD3A 1SYRA 3Q74A 5IMCA 1AW9A 1FVJA 2P0GA 5BRTA 3F6DA 1K0CA 3PPUA 1TRWA 1PL1A 4WETA 3HXSA 4G10A 4V2LA 1ZYEA 3APQA 2R0CA 4HQZA 1TI1A 11GSA 3QMXA 4ZL7A 4USSA 1LU4A 2CX4A 2C8UA 5E59A 4MA9A 5DJMA 2LKUA 2H0IA 1VRSD 4NXIA 4FYCA 2LNTA 5DVBA 3NOFA 2N5BA 2V1MA 2FY6A 3FRCA 4NWYA 1B9XC 5IQYA 1XWCA 2FCHA 3I9V2 3M1GA 1OE8A 3C1SA 4MPFA 4OFTA 3F4RA 1MTCA 3HYPA 2JL4A 4OCFA 3TRPA 1GTIA 2B7KA 4KDUA 3UAPA 2HLSA 2CVBA 1FG4A 1TK5B 4IP6A 4PTSA 1M9AA 4KE3A 3GIXA 3M0FA 1PKWA 4N0ZA 1HNAA 5HQPA 5ECQB 4O92A 5ELAA 2C3TA 4MP4A 4IKHA 2O85A 2AYTA 1TP9A 4DSSB 4OMVA 1PMTA 5AIVA 1EWXA 4WF4A 4BVYA 3GKMA 3SBCA 3QAWA 2DMLA 2B3SA 2CT6A 5E4WA 2IFQA 2YN1A 1SJZA 1GLPA 2XHFA 3HKRA 3HHVA 2IMEA 4Q5FA 3TJKA 2YPMA 2A4HA 2K18A 2IFQB 5G2ZA 1U87A 3L4NA 1XW6A 2M46A 3GKKA 1U3IA 1W4VA 1X9WB 4PUFC 4TVEA 3HD5A 5ECRB 2V2GA 3FHKA 2QA2A 4ZB9A 3EVIA 5IMFA 4JZQA 2IL3A 1YEPA 2FGXA 4J57E 4IGJA 3G7JA 4F0BA 1GRXA 4TRXA 1GULA 3IHQA 1X5DA 4KX4A 4N11A 1RW1A 1R5PA 2VCVA 3VK9A 1R7HA 1VF2A 5ECSA 2KP1A 1ZYNA 2C3QA 3D5JA 3IRAA 3CBUA 1Q98A 1W89A 1K0AA 2WZ9A 1ERTA 3DEXA 1MD4A 1TI3A 5DQYA 3UVTA 2NDOA 1MDKA 3CYNA 4EIQA 3CTGA 3C73A 2YWOA 2KOKA 3A5IA 2RM6A 2HSYA 2R37A 5IMZA 1WPIA 3UARA 3G7IA 4K7OA 2WGRA 3CXGA 4WBJA 1PN0A 1PN9A 4EF0A 1GNWA 3HJMA 3EMXA 4L8EA 5KN1A 1TRVA 3QOUA 5INYA 5JWRB 3GN3A 1K0BA 5F06A 1VGLA 1GWCA 4LLRA 4O7HA 4X4JA 2I3YA 2CV4A 2B1LA 3Q19A 1MEKA 2XPEA 2AB6A 1UN2A 4O5QA 2VO4A 3EWLA 5CRHA 3KGKA 1OAZA 2DLXA 4ILFA 4HJ2A 1H4OA 3FZ5A 2H74A 4MPGA 1PGTA 1YY7A 4K1FA 2AUVA 4PX1A 5A4WA 4WXTA 5EL8A 2YJHA 3KD0A 4OWYA 1A2LA 2DBCA 1SKSB 5ID2A 4I6XA 2ALBA 3W8SA 4EO3A 1PKZA 3P7XA 4BVXB 3GL5A 2EIOA 4AJ6A 1M0UA 2QSIA 2R3XA 3LYPA 1S3CA 4HJMA 2N5FA 2B1KA 3O6TA 2ON5A 4K8MA 1ERWA 2DIYA 4NMUA 5G1LA 1AXDA 4YH2A 1WOUA 1V58A 3HVXA 3QFBC 2OJLA 1GSSA 3GFKA 5CO3A 4JU5A 3UBKA 5LNKe 2B7JA 5ENUA 3IBHA 4GF0A 3KM6A 2FWEA 4ZL9A 1M2AA 2FD3A 5GAPD 3UEMA 5KOXA 4G0LA 1FOHA 2F51A 4K2DA 1TU8A 5DCHA 4KCAA 3E9JB 3LEFA 3RDWA 4GSTA 3VWWA 4GXZA 2H73A 4MK3A 3RHBA 4FH8A 2TRXA 1N8JA 4MABA 1VF3A 3V1WA 5IO2A 2HI7A 4XHMA 1DBYA 1O6JA 1QMVA 5GSSA 2XBIA 1YKCA 1PSQA 3O3TA 2X49A 3GNJA 2L59A 2HSMA 1PD21 2PVOC 4D73A 2X4AA 1HQOA 1ACVA 3J7Yb 5L71A 2DC5A 2K8VA 1SYXA 16GSA 5H5RA 4PGTA 2ON7A 3VLNA 2X8CA 3ZVJA 9GSSA 2LTKA 4KF9A 3LWAA 3P90A 4MF6A 2PBJA 4GSNA 5AN1A 1OVNA 2IJYA 2YWMA 2FNOA 1SJIA 5H5SA 3I6AA 4GRFA 5ECNB 2DKHA 4NV2A 1OC9A 2YWIA 2IMDA 2O7KA 2MMOA 5EPFA 1TU7A 4WR4A 2CVKA 1TJDA 1GSYA 1CQGA 1X5CA 5CRDA 2PWJA 1OC9B 1E2YA 1KEBA 1GSQA 1XIYA 2P5RA 1A2JA 4X43A 4ZXGA 2ZCTA 4OFNA 3TRXA 1OYJA 4JRRA 3DYRA 4CDOA 3GMFA 2GSSA 4HDEA 2I4AA 3KH7A 5D93A 2H1AA 2VCQA 2GZZA 3RHCA 2L6DA 3TKSC 2E7PA 2H1GA 5DAKA 4MH2A 3GV1A 2IPAA 3KIJA 2DIZA 5IMDA 3U6VA 3UBLA 3TUEA 1V57A 4TR4A 2Z9SA 1AQVA 4O5RA 4AJ8A 1EP8A 5HFIA 4I97A 2OBKA 3ZMKA 3DVXA 4RI6A 4RUVA 5ELGA 2J23A 1OE7A 1ON4A 3MIXA 4NPBA 4MF7A 1XBSA 3PGTA 3G9BA 3RBTA 3D4TA 2FWHA 4IHUA 2V6OA 2C3NA 4HI7A 4PNFA 2OBIA 3EPTA 5ECMB 1USBA 2EIQA 3E0UA 1OC3A 4K0GA 3CRUA 2V41A 1DSBA 2HNLA 5C00A 4A5PA 1QK8A 2OE0A 2H8LA 4KDXA 4OFMA 4ZBDA 2R5GA 3IK9A 4XTSA 2DKIA 3FR6A 5IIZA 4LMWA 2LQOA 3DGQA 2R6KA 1FW1A 3ZLPA 3DRNA 4KSMA 2HRNA 3IOSA 4KB3A 2C0DA 2CZ3A 1ST9A 2LJAA 4TR3A 5G5FA 2OE1A 2RUFA 1WRYA 2C4JA 2VCWA 4IJIA 3F4SA 2DJ1A 4POLA 3MAKA 2R0GA 3UOMA 4I2TA 1KNGA 4MF5A 3Q6OA 3IXRA 2FLSA 2LV3A 3L9UA 3LORA 4K7NA 2HYXA 2PPTA 2F8FA 3S9FA 2L4CA 3BBYA 1V98A 1BAYA 3R2QA 4TXOA 2GSTA 3ZRDA 1RK4A 2YP6A 1ZMAA 2LRNA 3P8WA 1YF1A 3GTUA 1WIKA 4JBBA 2YWNA 4FQUA 2VCXA 3KH9A 4Q5NA 4TXVA 1TRUA 1Q4JA 4PUAA 4MJCA 5B7CA 5J5NA 1U6TA 1QFNA 2IWTA 4I2UA 3OR5A 2YANA 1M2BA 4G0KA 2LSTA 2MBSA 1SKWB 3VPQA 1F3AA 5BMUA 2GQLA 4K5RA 4NAXA 3ERGA 3BCIA 4L5LA 1FB0A 3GKXA 4QQ7A 2WB9A 4RQRA 1A8YA 3MWHA 2VD1A 4V2MA 4P3YB 1CQHA 3KZQA 2MMZA 1SENA 3D21A 2VLTA 1QUWA 4TR1A 1I9DA 4EIPA 3TGZA 1G6WA 1JZOA 2IMIA 3PH9A 2JZTA 4NV5A 4ACSA 2HSHA 2PERA 3QAVA 2VIMA 3GYKA 1XXUA 1V40A 4QL9A 1FO5A 2B6MA 1PA3A 5J9BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H70 A;  3PR8 A;  1NW2 A;  1V2A A;  4G9H A;  4ZIL A;  2LQQ A;  4LL4 B;  2AJQ B;  3GUR A;  5ECH B;  3HVS A;  3W8J A;  2YZU A;  2VCZ A;  2PVQ A;  3D0Z A;  2PGT A;  1T8E B;  3GSS A;  4LA1 A;  4V2N A;  2NTO A;  3ZIV A;  3CMI A;  1JLW A;  4RQX A;  4BWQ A;  1ZYQ B;  2VL9 A;  5G1K A;  3DIE A;  1SKR B;  3DVW A;  3SWL A;  1Z6N A;  3IAM 2;  1HYU A;  3ZTL A;  1TDI A;  1U88 A;  2GVP A;  2LUS A;  4F0C A;  3TJB A;  4TR0 A;  5F05 A;  5HR0 A;  2HT9 A;  1SU9 A;  5CNW A;  4BWS A;  3EU3 A;  1JLV A;  3NIV A;  5KN2 A;  2VD0 A;  4J56 E;  6GSU A;  4V1A p;  3FR3 A;  1XCC A;  1G6Y A;  18GS A;  4HZ2 A;  1F9M A;  4IQA A;  1GTU A;  4L0U A;  1EOH A;  3TJF A;  1GNE A;  3QAG A;  4PQ1 A;  5F07 A;  5AIS A;  1GH2 A;  1FVK A;  2ZNM A;  3GH9 A;  1YKA A;  5IMV A;  3ZIT A;  2A2S A;  4ID0 A;  1ZGN A;  5IPG A;  1O7U A;  1SK0 A;  3EU4 A;  3M9K A;  1K0D A;  3WYW A;  1IYI A;  1B9Y C;  4IJ3 A;  3ME7 A;  8GSS A;  1G7O A;  1J9B A;  1G7E A;  3CTF A;  2WCI A;  2YZH A;  1WJK A;  2G2Q A;  4L0W A;  4PQH A;  2VM1 A;  1SL0 B;  3TKQ A;  3KP8 A;  5D8I A;  4IVF A;  2ES7 A;  10GS A;  3HZ8 A;  3LXZ A;  3F3Q A;  4MZW A;  2MYG A;  1F37 A;  3KCM A;  5HFG A;  3A2V A;  3A5W A;  2PU9 C;  6GSV A;  4XIH A;  1TKD B;  1X9S B;  4IEL A;  3ZYW A;  1B4Q A;  3VUR A;  3UL3 A;  3KP9 A;  2H1D A;  3ZIJ A;  4EDY A;  3A2X A;  3WT1 A;  1JZD A;  2P5Q A;  2G0F A;  2O8V B;  1VF1 A;  2KP2 A;  4FYB A;  1GTA A;  5ID2 B;  3IPZ A;  3ZFB A;  4GQF A;  2E2M A;  4KDY A;  20GS A;  5A4U A;  1OC8 A;  3UMA A;  4ZL8 A;  3D22 A;  1T4Z A;  4XS1 A;  6GSS A;  4DSR A;  1OKD A;  4L5O A;  1XW5 A;  3M8N A;  1AQX A;  5IMA A;  1T3B A;  2ZUP A;  3D6I A;  4MLY A;  2HZE A;  1JZR A;  3EUR A;  3APS A;  2LJK A;  4EDZ A;  2LJR A;  3HZ4 A;  5IM9 A;  1ZL9 A;  3KMN A;  2FA4 A;  4MZB A;  1XWG A;  4EC0 A;  5B6M A;  1XFL A;  3TJG A;  3UJ1 A;  3IC4 A;  2AHE A;  5D96 A;  1YZX A;  2QKE A;  1Z5Y E;  3GA4 A;  1J0F A;  3LGC A;  3FYG A;  1HNB A;  1X9M B;  3H93 A;  4EL1 A;  4PXO A;  2MMA A;  4GTU A;  4G19 A;  2O89 A;  2WJU A;  5DAL A;  4FYU A;  2H6Y A;  5CRG A;  1K0M A;  4AF2 A;  1T7P B;  1AQW A;  5CYY A;  1EP7 A;  2KHP A;  3KEB A;  4D73 B;  2I1U A;  5GAN D;  2YNX A;  3L9V A;  5B8B A;  1GUK A;  2H01 A;  3PIN A;  2RM5 A;  4F2I A;  4YQU A;  5D73 A;  4X1U A;  3RPP A;  1XWB A;  4KND A;  1I5G A;  1GSU A;  3RAZ A;  5D9W A;  2M80 A;  4MH3 A;  1AC1 A;  1K3Y A;  5JWO B;  4BA7 A;  3ERF A;  1SJ6 A;  4HOJ A;  1BJX A;  3TB2 A;  1GUM A;  2FHE A;  3H79 A;  3IK7 A;  2I81 A;  5C04 A;  2GGT A;  5EVO A;  3QCP A;  1EGO A;  3C7M A;  1EGR A;  1EV4 A;  6GST A;  2BJX A;  2E2G A;  3L78 A;  3EMP A;  2CA8 A;  1HNC A;  2JSY A;  4ZB8 A;  4EUY A;  4F9Z A;  3H8Q A;  4WEY A;  1M2D A;  4EVM A;  2MMN A;  1SL2 B;  1EV9 A;  3UVH A;  5B8A A;  3VI7 A;  5GZZ B;  1SL1 B;  5DJL A;  1R4W A;  3M9J A;  1MDJ A;  4LMV A;  3N5O A;  5D9X A;  1PRX A;  3A2W A;  5ECI B;  2DSA A;  2DJ2 A;  3KJY A;  1GSD A;  2VL2 C;  3EIN A;  3CSH A;  2LNS A;  5DAK B;  1A23 A;  1K3O A;  4IN0 A;  4E8E A;  4TW5 A;  5JCG A;  4XS6 A;  3QR6 A;  3IA1 A;  4H86 A;  1TK0 B;  5D9T A;  3KTB A;  2N5A A;  1BX9 A;  2R4V A;  3HCZ A;  1T1V A;  1ERV A;  5HFK A;  4GQC A;  1Z3E A;  3TJJ A;  5ECK B;  4Z7X A;  1T00 A;  2B5Y A;  2CAI A;  2KLX A;  3DML A;  3U5R E;  3F63 A;  1UA5 A;  4WBR D;  2VLV A;  4MJB A;  12GS A;  1M9B A;  2GSR A;  2R2J A;  3N9J A;  3E3E A;  4F82 A;  4ECJ A;  2FA8 A;  4GWR A;  1KTE A;  1WWJ A;  1BG5 A;  3DD3 A;  2VL3 A;  2X99 A;  1UC7 A;  1THX A;  3GRX A;  1EEJ A;  5D9V A;  1XWK A;  1QXH A;  3FZ9 A;  4EKZ A;  2H0G A;  5ECO B;  1XVQ A;  3I43 A;  3LJR A;  1PX6 A;  2K9F A;  1XWA A;  2XC2 A;  2GQK A;  5KN0 A;  1YDK A;  3GX0 A;  4BL7 A;  2WRT A;  1PL2 A;  3TKS A;  5CRE A;  3L9S A;  4ISD A;  3DKS A;  2JSZ A;  3M3M A;  3ME8 A;  2H19 A;  2YV9 A;  1T4Y A;  4EE0 A;  3I69 A;  1MDI A;  1K0N A;  1JFU A;  4KH7 A;  4HEA 2;  5FT3 A;  3VWV A;  3G7Y A;  2HXK A;  5HR3 A;  2YOI A;  2E0Q A;  1Z7P A;  3Q18 A;  3NZN A;  1R5A A;  4O32 A;  5KEJ A;  3VFI A;  2DJJ A;  5IOW A;  4IQ1 A;  1K3L A;  1V9W A;  4TXO B;  4N30 A;  1G0T A;  3GTU B;  5A4V A;  1ZOF A;  1BED A;  2YJ7 A;  4MZC A;  4EXJ A;  5JCW A;  4NHW A;  4KGI A;  1ILO A;  2PUK C;  3ZFL A;  4MJE A;  3F6F A;  2V32 A;  1ZZY A;  3TOU A;  2DJ3 A;  2C0G A;  2A4V A;  4XRD A;  4POM A;  2JZR A;  3TOT A;  3EC3 A;  2GQM A;  2TIR A;  3TRQ A;  4HU7 A;  3VWX A;  4TOP A;  3ZL5 A;  1A24 A;  4AGS A;  2CQ9 A;  3RPN A;  5H5Q A;  2OAC A;  1ZCP A;  4IP1 A;  1SD9 A;  2VLU A;  3FEU A;  1GLQ A;  4IW9 A;  3TCO A;  3BCK A;  3FZA A;  3QDN A;  4ZIJ A;  4WKW A;  1EOG A;  2WDU A;  1DE1 A;  1B48 A;  2BTO T;  4TR1 B;  2IMF A;  22GS A;  1XW9 A;  1K0O A;  2BMX A;  1AAZ A;  2HRF A;  4ECB A;  2VCT A;  4DSS A;  5IOX A;  1A8L A;  1B8X A;  2O87 A;  3HJO A;  1O8X A;  3LQ7 A;  2VM2 A;  1XVW A;  3KMO A;  3IV4 A;  4GLT A;  3WGD A;  1XOA A;  3VWU A;  2LEG A;  1EEM A;  1NHY A;  3WD6 A;  2H0H A;  1ABA A;  3ZZX A;  4IBP A;  3LG6 A;  2GTU A;  2L6C A;  6GSY A;  1N2A A;  4KA0 A;  2GDR A;  1TOF A;  1O73 A;  1S3D A;  1YF0 A;  1O81 A;  2FWF A;  2DJK A;  1QQ2 A;  1M99 A;  1E6B A;  5DDL A;  2NPB A;  2H66 A;  1GTB A;  1RQM A;  3QD9 A;  2K8S A;  6GSX A;  1NSW A;  1BYE A;  2F9S A;  2IIY A;  4MJA A;  1HD2 A;  1DE2 A;  2V6K A;  5FWG A;  4KW6 A;  5DBQ A;  1IYH A;  1O85 A;  3ZRE A;  3H4K A;  4ZB6 A;  4Q5R A;  3TKR A;  2C0F A;  2YV7 A;  3GX8 A;  1EZK A;  5J3R A;  4KAE A;  4HUA A;  3FZ4 A;  2CVD A;  5HR1 A;  3TKS E;  5F8B A;  4RI7 A;  2HZF A;  5G31 A;  1ML6 A;  2XPD A;  3H1N A;  4OD7 A;  3FY7 A;  2H71 A;  5LD0 A;  3F4T A;  2MZC A;  2HFD A;  1FHE A;  3D4M A;  5LCZ A;  1X0R A;  1TTZ A;  5G5E A;  4F03 A;  3HJP A;  3F0I A;  5ABR A;  1LBK A;  2I9H A;  1GSF A;  4BPY A;  3QFA C;  4ZBA A;  2NVL A;  2H30 A;  3MNG A;  2F3M A;  2OE3 A;  3A3T A;  1M7T A;  3CRT A;  2B5E A;  4GSS A;  2CAQ A;  1S3A A;  3FKF A;  3DXB A;  4FO5 A;  4FIW A;  3VPT A;  2JU5 A;  2A2R A;  5FHI A;  2AV4 A;  2VOC A;  1F2E A;  2CZ2 A;  2LS5 A;  1THO A;  3TDG A;  1TK8 B;  4AJ7 A;  4X0X A;  2REM A;  5DQS A;  4ML6 A;  4CHS A;  1XPV A;  4LL1 B;  3BOA A;  3P2A A;  2X64 A;  2RII A;  3K8N A;  1AIU A;  3BJ5 A;  4BVX A;  1LJR A;  4HS1 A;  4G2E A;  2H72 A;  5IPH A;  4YQV A;  3ZML A;  4WF5 A;  2GT5 A;  4JE1 A;  3LYK A;  5ECP B;  2DMM A;  2LRC A;  2LRT A;  3LFL A;  5AIX A;  3C1R A;  3LSZ A;  3EYT A;  2GZY A;  3F9U A;  2OAD A;  3EE2 A;  4ULX A;  3US3 A;  5G30 A;  3MSZ A;  4OCE A;  1X5E A;  4JED A;  4ECI A;  2J9H A;  5J9C A;  4XS4 A;  4TKY A;  3F3R A;  4HU9 A;  3HY2 A;  6GSW A;  3APO A;  7GSS A;  1SK1 A;  2QGV A;  2GT6 A;  3GL3 A;  3GH6 A;  3HVV A;  4V1A g;  4HQS A;  4PNG A;  4XS4 B;  1YEX A;  2OKA A;  3GST A;  4K7I A;  2HZE B;  3AY8 A;  5GST A;  1SK2 A;  1VF4 A;  4K0N A;  1DUG A;  2PN8 A;  5AGY A;  2FUG 2;  3GUS A;  2X8H A;  1GSE A;  1R26 A;  5IO0 A;  1Z9H A;  2YCD A;  2XBQ A;  2D2Z A;  2H6Z A;  2L5O A;  2H6X A;  3CSI A;  5J4U A;  2QC7 A;  2FWG A;  5JWQ B;  1TW9 A;  3KTL A;  4PQI A;  2JZS A;  2H76 A;  17GS A;  2EC4 A;  2PMT A;  5HR2 A;  1YQ1 A;  1UVZ A;  4TN8 A;  3TKP A;  3UIW A;  4PUR A;  4YAV A;  4DEJ A;  3IDV A;  2H1B A;  1J08 A;  5DCG A;  4XCS A;  5DAL B;  4WR5 A;  1B4P A;  4OO4 A;  5JCU A;  2CX3 A;  3WGE A;  5B6N A;  1H75 A;  1SD8 A;  5J41 A;  1WE0 A;  1FB6 A;  2AAW A;  3MDK A;  1URM A;  2MBT A;  3CSJ A;  3ZVJ D;  1YJ6 A;  4CW9 A;  1FAA A;  3J7Y k;  3FR9 A;  3FW2 A;  3WT2 A;  2B5X A;  4ECC A;  14GS A;  4E8H A;  3QPM A;  4K9Z A;  1OKT A;  5KN3 A;  1WP0 A;  1TXX A;  2L4Q A;  2GZP A;  3C8E A;  1A2M A;  2K6V A;  2RLI A;  5CP1 A;  5COH A;  3WGX A;  4HZ4 A;  3L0H A;  4KCE A;  5CRW A;  2IMK A;  2NBS A;  1AUC A;  2C1Y A;  4NHZ A;  2JAD A;  2P31 A;  1C72 A;  4ML1 A;  2C0E A;  2KUC A;  1GUH A;  1BQ7 A;  1F6M C;  4KSO A;  19GS A;  1KBN A;  3ED3 A;  2GSQ A;  3O76 A;  3ERW A;  2C80 A;  1QGV A;  3HDC A;  3IR4 A;  2L5L A;  3DWV A;  3BD2 A;  1A0F A;  1Z7R A;  2L57 A;  3IAS 2;  4POB A;  5CAX A;  4QL7 A;  4J2F A;  1Z6M A;  2H75 A;  3JCM L;  3FK8 A;  1F3B A;  2JAC A;  2TRC P;  1TRS A;  3VI5 A;  3W6G A;  1ERU A;  4N0V A;  2HE3 A;  1WMJ A;  3KXO A;  4K6X A;  1XZO A;  3C71 A;  5EY6 A;  1PX7 A;  5F0G A;  1GL8 A;  3GKN A;  4I8B A;  2VAF A;  1Y25 A;  4I5Q A;  3LXT A;  3GHA A;  2GS3 A;  2OA7 A;  4N10 A;  2WS2 A;  4MCU A;  3ISO A;  2EIR A;  2WUL A;  1PQN A;  1U3A A;  3IE3 A;  2F8A A;  2DJ0 A;  2IN3 A;  4POK A;  2GLR A;  1FOV A;  4YAP A;  1GP1 A;  3F8U A;  1O8W A;  4JR6 A;  4ZBB A;  1JZW A;  1XOB A;  4GCI A;  4XRA A;  4IS0 A;  4OO5 A;  1NHO A;  13GS A;  4MDC A;  2X8G A;  4DSQ A;  2WFC A;  1Y6E A;  2VUP A;  1NM3 A;  1JHB A;  4KUN A;  2RUE A;  2M72 A;  4MMM A;  4DVC A;  4YQM A;  4Q5Q A;  5A5K A;  2VL2 A;  5ECL B;  1A0R P;  4JR4 A;  3HA9 A;  1MD3 A;  1SYR A;  3Q74 A;  5IMC A;  1AW9 A;  1FVJ A;  2P0G A;  3F6D A;  1K0C A;  1TRW A;  1PL1 A;  4WET A;  3HXS A;  4G10 A;  4V2L A;  1ZYE A;  3APQ A;  4HQZ A;  1TI1 A;  11GS A;  3QMX A;  4ZL7 A;  1LU4 A;  2CX4 A;  2C8U A;  5E59 A;  4MA9 A;  5DJM A;  2LKU A;  2H0I A;  1VRS D;  4NXI A;  4FYC A;  2LNT A;  5DVB A;  3NOF A;  2N5B A;  2V1M A;  2FY6 A;  3FRC A;  4NWY A;  1B9X C;  5IQY A;  1XWC A;  2FCH A;  3I9V 2;  3M1G A;  1OE8 A;  3C1S A;  4MPF A;  4OFT A;  3F4R A;  1MTC A;  3HYP A;  2JL4 A;  4OCF A;  3TRP A;  1GTI A;  2B7K A;  4KDU A;  3UAP A;  2HLS A;  2CVB A;  1FG4 A;  1TK5 B;  4IP6 A;  1M9A A;  4KE3 A;  3GIX A;  3M0F A;  1PKW A;  4N0Z A;  1HNA A;  5HQP A;  5ECQ B;  4O92 A;  5ELA A;  2C3T A;  4MP4 A;  4IKH A;  2O85 A;  2AYT A;  1TP9 A;  4DSS B;  4OMV A;  1PMT A;  5AIV A;  1EWX A;  4WF4 A;  4BVY A;  3GKM A;  3SBC A;  3QAW A;  2DML A;  2B3S A;  2CT6 A;  5E4W A;  2IFQ A;  2YN1 A;  1SJZ A;  1GLP A;  2XHF A;  3HKR A;  3HHV A;  2IME A;  4Q5F A;  3TJK A;  2YPM A;  2K18 A;  2IFQ B;  5G2Z A;  1U87 A;  3L4N A;  1XW6 A;  2M46 A;  3GKK A;  1U3I A;  1W4V A;  1X9W B;  4PUF C;  4TVE A;  3HD5 A;  5ECR B;  2V2G A;  3FHK A;  4ZB9 A;  3EVI A;  5IMF A;  4JZQ A;  2IL3 A;  1YEP A;  2FGX A;  4J57 E;  4IGJ A;  3G7J A;  4F0B A;  1GRX A;  4TRX A;  1GUL A;  3IHQ A;  1X5D A;  4KX4 A;  4N11 A;  1RW1 A;  1R5P A;  2VCV A;  3VK9 A;  1R7H A;  1VF2 A;  5ECS A;  2KP1 A;  2C3Q A;  3D5J A;  3IRA A;  3CBU A;  1Q98 A;  1W89 A;  1K0A A;  2WZ9 A;  1ERT A;  3DEX A;  1MD4 A;  1TI3 A;  5DQY A;  3UVT A;  2NDO A;  1MDK A;  3CYN A;  3CTG A;  3C73 A;  2YWO A;  2KOK A;  2RM6 A;  2HSY A;  2R37 A;  5IMZ A;  1WPI A;  3UAR A;  3G7I A;  4K7O A;  2WGR A;  3CXG A;  4WBJ A;  1PN9 A;  4EF0 A;  1GNW A;  3HJM A;  3EMX A;  4L8E A;  5KN1 A;  1TRV A;  3QOU A;  5INY A;  5JWR B;  3GN3 A;  5F06 A;  1K0B A;  1VGL A;  1GWC A;  4LLR A;  4O7H A;  2I3Y A;  2CV4 A;  2B1L A;  3Q19 A;  1MEK A;  2XPE A;  2AB6 A;  1UN2 A;  2VO4 A;  3EWL A;  5CRH A;  3KGK A;  1OAZ A;  2DLX A;  4ILF A;  4HJ2 A;  1H4O A;  3FZ5 A;  2H74 A;  4MPG A;  1PGT A;  1YY7 A;  4K1F A;  2AUV A;  4PX1 A;  5A4W A;  4WXT A;  5EL8 A;  2YJH A;  3KD0 A;  4OWY A;  1A2L A;  2DBC A;  1SKS B;  5ID2 A;  4I6X A;  2ALB A;  3W8S A;  4EO3 A;  1PKZ A;  3P7X A;  3GL5 A;  2EIO A;  4AJ6 A;  1M0U A;  2QSI A;  2R3X A;  3LYP A;  1S3C A;  4HJM A;  2N5F A;  2B1K A;  3O6T A;  2ON5 A;  4K8M A;  1ERW A;  2DIY A;  4NMU A;  5G1L A;  1AXD A;  4YH2 A;  1WOU A;  1V58 A;  3HVX A;  3QFB C;  2OJL A;  1GSS A;  3GFK A;  5CO3 A;  4JU5 A;  3UBK A;  5LNK e;  2B7J A;  5ENU A;  3IBH A;  4GF0 A;  3KM6 A;  2FWE A;  4ZL9 A;  1M2A A;  2FD3 A;  5GAP D;  3UEM A;  2F51 A;  4K2D A;  1TU8 A;  5DCH A;  4KCA A;  3E9J B;  3LEF A;  3RDW A;  4GST A;  3VWW A;  4GXZ A;  2H73 A;  4MK3 A;  3RHB A;  4FH8 A;  2TRX A;  1N8J A;  4MAB A;  1VF3 A;  3V1W A;  5IO2 A;  2HI7 A;  4XHM A;  1DBY A;  1O6J A;  1QMV A;  5GSS A;  2XBI A;  1YKC A;  1PSQ A;  3O3T A;  3GNJ A;  2L59 A;  1PD2 1;  2PVO C;  4D73 A;  1HQO A;  1ACV A;  3J7Y b;  5L71 A;  2DC5 A;  2K8V A;  1SYX A;  16GS A;  5H5R A;  4PGT A;  2ON7 A;  3VLN A;  2X8C A;  3ZVJ A;  9GSS A;  2LTK A;  3LWA A;  3P90 A;  4MF6 A;  2PBJ A;  4GSN A;  5AN1 A;  1OVN A;  2IJY A;  2YWM A;  2FNO A;  1SJI A;  5H5S A;  3I6A A;  4GRF A;  5ECN B;  4NV2 A;  1OC9 A;  2YWI A;  2IMD A;  2O7K A;  2MMO A;  5EPF A;  1TU7 A;  4WR4 A;  2CVK A;  1TJD A;  1GSY A;  1CQG A;  1X5C A;  5CRD A;  2PWJ A;  1OC9 B;  1E2Y A;  1KEB A;  1GSQ A;  1XIY A;  2P5R A;  1A2J A;  4X43 A;  4ZXG A;  2ZCT A;  4OFN A;  3TRX A;  1OYJ A;  4JRR A;  3DYR A;  4CDO A;  3GMF A;  2GSS A;  4HDE A;  2I4A A;  3KH7 A;  5D93 A;  2H1A A;  2VCQ A;  2GZZ A;  3RHC A;  2L6D A;  3TKS C;  2E7P A;  2H1G A;  5DAK A;  4MH2 A;  3GV1 A;  2IPA A;  3KIJ A;  2DIZ A;  5IMD A;  3U6V A;  3UBL A;  3TUE A;  1V57 A;  4TR4 A;  2Z9S A;  1AQV A;  4O5R A;  4AJ8 A;  1EP8 A;  5HFI A;  4I97 A;  2OBK A;  3ZMK A;  3DVX A;  4RI6 A;  4RUV A;  5ELG A;  2J23 A;  1OE7 A;  1ON4 A;  4NPB A;  4MF7 A;  1XBS A;  3PGT A;  3G9B A;  3RBT A;  3D4T A;  2FWH A;  4IHU A;  2V6O A;  2C3N A;  4HI7 A;  4PNF A;  2OBI A;  5ECM B;  1USB A;  2EIQ A;  3E0U A;  1OC3 A;  4K0G A;  3CRU A;  2V41 A;  1DSB A;  2HNL A;  5C00 A;  1QK8 A;  2OE0 A;  2H8L A;  4KDX A;  4OFM A;  4ZBD A;  2R5G A;  3IK9 A;  4XTS A;  3FR6 A;  5IIZ A;  4LMW A;  2LQO A;  3DGQ A;  2R6K A;  1FW1 A;  3ZLP A;  3DRN A;  4KSM A;  2HRN A;  3IOS A;  4KB3 A;  2C0D A;  2CZ3 A;  1ST9 A;  2LJA A;  4TR3 A;  5G5F A;  2OE1 A;  2RUF A;  1WRY A;  2C4J A;  2VCW A;  4IJI A;  3F4S A;  2DJ1 A;  4POL A;  3MAK A;  3UOM A;  4I2T A;  1KNG A;  4MF5 A;  3Q6O A;  3IXR A;  2FLS A;  2LV3 A;  3L9U A;  3LOR A;  4K7N A;  2HYX A;  2PPT A;  2F8F A;  3S9F A;  2L4C A;  3BBY A;  1V98 A;  1BAY A;  3R2Q A;  4TXO A;  2GST A;  3ZRD A;  1RK4 A;  2YP6 A;  1ZMA A;  2LRN A;  3P8W A;  1YF1 A;  3GTU A;  1WIK A;  4JBB A;  2YWN A;  2VCX A;  3KH9 A;  4Q5N A;  4TXV A;  1TRU A;  1Q4J A;  4PUA A;  4MJC A;  5B7C A;  5J5N A;  1U6T A;  1QFN A;  2IWT A;  4I2U A;  3OR5 A;  2YAN A;  1M2B A;  2LST A;  2MBS A;  1SKW B;  3VPQ A;  1F3A A;  2GQL A;  4NAX A;  3ERG A;  3BCI A;  4L5L A;  1FB0 A;  3GKX A;  4QQ7 A;  2WB9 A;  4RQR A;  1A8Y A;  3MWH A;  2VD1 A;  4V2M A;  4P3Y B;  1CQH A;  3KZQ A;  2MMZ A;  1SEN A;  3D21 A;  2VLT A;  1QUW A;  4TR1 A;  1I9D A;  3TGZ A;  1G6W A;  1JZO A;  2IMI A;  3PH9 A;  2JZT A;  4NV5 A;  4ACS A;  2HSH A;  2PER A;  3QAV A;  2VIM A;  3GYK A;  1XXU A;  1V40 A;  4QL9 A;  1FO5 A;  2B6M A;  1PA3 A;  5J9B A; 
#chains in the Genus database with same CATH topology
 2H70 A;  3PR8 A;  1NW2 A;  1V2A A;  4G9H A;  4ZIL A;  2LQQ A;  4LL4 B;  2AJQ B;  3GUR A;  5ECH B;  3HVS A;  3W8J A;  2YZU A;  2VCZ A;  2PVQ A;  3D0Z A;  2PGT A;  1T8E B;  3GSS A;  4LA1 A;  4V2N A;  2NTO A;  3ZIV A;  4Z2R A;  3CMI A;  1JLW A;  4RQX A;  4BWQ A;  1ZYQ B;  2VL9 A;  5G1K A;  3DIE A;  1SKR B;  3DVW A;  3SWL A;  4BVY B;  1Z6N A;  3IAM 2;  1HYU A;  3ZTL A;  1TDI A;  1U88 A;  4MNN A;  2GVP A;  2LUS A;  4F0C A;  3TJB A;  4TR0 A;  5F05 A;  5HR0 A;  2HT9 A;  1SU9 A;  5CNW A;  4BWS A;  4YKG A;  3EU3 A;  1JLV A;  3NIV A;  5KN2 A;  2VD0 A;  4J56 E;  6GSU A;  4V1A p;  3FR3 A;  1XCC A;  1G6Y A;  18GS A;  4HZ2 A;  1F9M A;  4IQA A;  1GTU A;  4L0U A;  3R3E A;  1EOH A;  3TJF A;  1GNE A;  3QAG A;  4PQ1 A;  5F07 A;  5AIS A;  1GH2 A;  1FVK A;  2ZNM A;  2R0P A;  3GH9 A;  1YKA A;  5IMV A;  3ZIT A;  2A2S A;  4ID0 A;  1ZGN A;  5IPG A;  1O7U A;  1SK0 A;  3EU4 A;  3M9K A;  1K0D A;  3WYW A;  1IYI A;  1B9Y C;  4IJ3 A;  3ME7 A;  8GSS A;  1G7O A;  1J9B A;  1G7E A;  3CTF A;  2WCI A;  2YZH A;  1WJK A;  2G2Q A;  4L0W A;  4PQH A;  2VM1 A;  1SL0 B;  3TKQ A;  3KP8 A;  5D8I A;  4IVF A;  2ES7 A;  10GS A;  3HZ8 A;  3LXZ A;  3F3Q A;  4MZW A;  2MYG A;  1F37 A;  3KCM A;  5HFG A;  3A2V A;  3A5W A;  2PU9 C;  6GSV A;  4XIH A;  1TKD B;  1X9S B;  4IEL A;  3ZYW A;  1B4Q A;  3VUR A;  3UL3 A;  3KP9 A;  4ICY A;  2H1D A;  3ZIJ A;  4EDY A;  3A2X A;  3WT1 A;  1JZD A;  2P5Q A;  2G0F A;  2O8V B;  1VF1 A;  2KP2 A;  4FYB A;  1GTA A;  5ID2 B;  3IPZ A;  3ZFB A;  4GQF A;  2E2M A;  4KDY A;  20GS A;  5A4U A;  1OC8 A;  3UMA A;  4ZL8 A;  3D22 A;  1T4Z A;  4XS1 A;  6GSS A;  4DSR A;  1OKD A;  4L5O A;  1XW5 A;  3M8N A;  3FMW A;  1AQX A;  5IMA A;  1T3B A;  2UZ8 A;  2ZUP A;  3D6I A;  4MLY A;  2HZE A;  1JZR A;  3EUR A;  3APS A;  2LJK A;  4EDZ A;  2LJR A;  3HZ4 A;  5IM9 A;  1ZL9 A;  3KMN A;  2FA4 A;  4MZB A;  1XWG A;  4EC0 A;  5B6M A;  1XFL A;  3TJG A;  3UJ1 A;  3IC4 A;  4CY8 A;  2AHE A;  5D96 A;  1YZX A;  2QKE A;  1Z5Y E;  3GA4 A;  1J0F A;  3LGC A;  3FYG A;  1HNB A;  1X9M B;  3H93 A;  4EL1 A;  4PXO A;  2HRA A;  2MMA A;  4GTU A;  4G19 A;  2O89 A;  2WJU A;  5DAL A;  4FYU A;  2H6Y A;  5CRG A;  1K0M A;  4AF2 A;  1T7P B;  1AQW A;  5CYY A;  1EP7 A;  2KHP A;  3KEB A;  4D73 B;  2I1U A;  5GAN D;  2YNX A;  3L9V A;  5B8B A;  1GUK A;  2H01 A;  3PIN A;  2RM5 A;  4F2I A;  4YQU A;  5D73 A;  4X1U A;  3RPP A;  1XWB A;  4KND A;  1I5G A;  1GSU A;  3RAZ A;  5D9W A;  2M80 A;  4MH3 A;  1AC1 A;  4Z2T A;  1K3Y A;  5JWO B;  4BA7 A;  3ERF A;  1SJ6 A;  4HOJ A;  1BJX A;  3TB2 A;  1GUM A;  2FHE A;  3H79 A;  3IK7 A;  2I81 A;  5C04 A;  2GGT A;  5EVO A;  3QCP A;  1EGO A;  3C7M A;  1EGR A;  1EV4 A;  6GST A;  2BJX A;  2E2G A;  3L78 A;  3EMP A;  2CA8 A;  1HNC A;  2JSY A;  4ZB8 A;  4EUY A;  4F9Z A;  3H8Q A;  1PFO A;  4WEY A;  1M2D A;  4EVM A;  2MMN A;  1SL2 B;  1EV9 A;  3UVH A;  5B8A A;  3VI7 A;  5GZZ B;  1SL1 B;  5DJL A;  1R4W A;  3M9J A;  1MDJ A;  4LMV A;  3N5O A;  5D9X A;  1PRX A;  3A2W A;  5ECI B;  4Z2U A;  2DSA A;  2DJ2 A;  3KJY A;  1GSD A;  2VL2 C;  3EIN A;  3CSH A;  2LNS A;  5DAK B;  1A23 A;  1K3O A;  4IN0 A;  4E8E A;  4TW5 A;  5JCG A;  4XS6 A;  3QR6 A;  3IA1 A;  4H86 A;  1TK0 B;  5D9T A;  3KTB A;  2N5A A;  1BX9 A;  2R4V A;  3HCZ A;  1T1V A;  3LW9 A;  1ERV A;  5HFK A;  4GQC A;  1Z3E A;  3TJJ A;  5ECK B;  4Z7X A;  1T00 A;  2B5Y A;  2CAI A;  2KLX A;  3DML A;  4HSC X;  3U5R E;  3F63 A;  1UA5 A;  4WBR D;  2VLV A;  4MJB A;  12GS A;  1M9B A;  2GSR A;  2R2J A;  3N9J A;  3E3E A;  4F82 A;  4ECJ A;  2FA8 A;  4GWR A;  1KTE A;  1WWJ A;  1BG5 A;  3DD3 A;  2VL3 A;  2X99 A;  1UC7 A;  1THX A;  3GRX A;  1EEJ A;  5D9V A;  1XWK A;  1QXH A;  3FZ9 A;  4EKZ A;  2H0G A;  5ECO B;  1XVQ A;  3I43 A;  3LJR A;  1PX6 A;  2K9F A;  1XWA A;  2XC2 A;  2GQK A;  5KN0 A;  1YDK A;  3GX0 A;  4BL7 A;  2WRT A;  1PL2 A;  3TKS A;  5CRE A;  3L9S A;  4ISD A;  3DKS A;  2JSZ A;  3M3M A;  3ME8 A;  2H19 A;  2YV9 A;  1T4Y A;  4EE0 A;  3I69 A;  1MDI A;  1K0N A;  1JFU A;  4KH7 A;  4HEA 2;  5FT3 A;  3VWV A;  3G7Y A;  2HXK A;  5HR3 A;  2YOI A;  2E0Q A;  1Z7P A;  3Q18 A;  3NZN A;  1R5A A;  4O32 A;  5KEJ A;  3VFI A;  2DJJ A;  5IOW A;  2QA1 A;  4IQ1 A;  1K3L A;  1V9W A;  4TXO B;  4N30 A;  1G0T A;  3GTU B;  5A4V A;  1ZOF A;  1BED A;  2YJ7 A;  4MZC A;  4EXJ A;  5JCW A;  4NHW A;  4KGI A;  1ILO A;  2PUK C;  3ZFL A;  4MJE A;  3F6F A;  2V32 A;  1ZZY A;  3TOU A;  2DJ3 A;  2C0G A;  2A4V A;  4XRD A;  4POM A;  2JZR A;  3TOT A;  3EC3 A;  2GQM A;  2TIR A;  3TRQ A;  4HU7 A;  3VWX A;  4TOP A;  3ZL5 A;  1A24 A;  4AGS A;  2CQ9 A;  3RPN A;  5H5Q A;  2OAC A;  1ZCP A;  4IP1 A;  1SD9 A;  2VLU A;  3FEU A;  1GLQ A;  4IW9 A;  3TCO A;  3BCK A;  3FZA A;  3QDN A;  4ZIJ A;  4WKW A;  1EOG A;  2WDU A;  1DE1 A;  1B48 A;  2BTO T;  4TR1 B;  2IMF A;  22GS A;  1XW9 A;  1K0O A;  4G0I A;  2BMX A;  1AAZ A;  2HRF A;  4ECB A;  2VCT A;  4DSS A;  5IOX A;  1A8L A;  1B8X A;  2O87 A;  3HJO A;  1O8X A;  3LQ7 A;  2VM2 A;  1XVW A;  3KMO A;  3IV4 A;  4GLT A;  3WGD A;  1XOA A;  3VWU A;  2LEG A;  1EEM A;  1NHY A;  3WD6 A;  2H0H A;  1ABA A;  3ZZX A;  1XG8 A;  4IBP A;  3LG6 A;  2GTU A;  2L6C A;  6GSY A;  1N2A A;  4KA0 A;  2GDR A;  1TOF A;  1O73 A;  1S3D A;  1YF0 A;  1O81 A;  2FWF A;  2DJK A;  1QQ2 A;  1M99 A;  1E6B A;  5DDL A;  2NPB A;  2H66 A;  1GTB A;  1RQM A;  3QD9 A;  2K8S A;  6GSX A;  1NSW A;  1BYE A;  2F9S A;  2IIY A;  4MJA A;  3IC8 A;  1HD2 A;  1DE2 A;  2V6K A;  5FWG A;  4KW6 A;  1ZYP A;  5DBQ A;  1IYH A;  1O85 A;  3ZRE A;  3H4K A;  4ZB6 A;  4Q5R A;  3TKR A;  2C0F A;  2YV7 A;  3GX8 A;  1EZK A;  5J3R A;  4KAE A;  4HUA A;  3FZ4 A;  2CVD A;  5HR1 A;  3TKS E;  5F8B A;  4RI7 A;  2HZF A;  5G31 A;  1ML6 A;  2XPD A;  3H1N A;  4OD7 A;  3FY7 A;  2H71 A;  5LD0 A;  3F4T A;  2MZC A;  2HFD A;  1FHE A;  3D4M A;  5LCZ A;  1X0R A;  1TTZ A;  5G5E A;  4F03 A;  3HJP A;  3F0I A;  5ABR A;  1LBK A;  2I9H A;  1GSF A;  4BPY A;  3QFA C;  4ZBA A;  2NVL A;  2H30 A;  3MNG A;  2F3M A;  2OE3 A;  3A3T A;  1M7T A;  3CRT A;  2B5E A;  4GSS A;  2CAQ A;  1S3A A;  3FKF A;  3DXB A;  4FO5 A;  4FIW A;  3VPT A;  2JU5 A;  2A2R A;  5FHI A;  2AV4 A;  2VOC A;  1F2E A;  2CZ2 A;  2LS5 A;  1THO A;  3TDG A;  1TK8 B;  4AJ7 A;  4X0X A;  2REM A;  5DQS A;  4ML6 A;  4CHS A;  5KOW A;  1XPV A;  4LL1 B;  3BOA A;  2HRK A;  3P2A A;  2X64 A;  2RII A;  3K8N A;  1AIU A;  3BJ5 A;  4BVX A;  1LJR A;  4HS1 A;  4G2E A;  2H72 A;  5IPH A;  4YQV A;  3ZML A;  4WF5 A;  2GT5 A;  4JE1 A;  3LYK A;  5ECP B;  2DMM A;  2LRC A;  2LRT A;  3LFL A;  5AIX A;  3C1R A;  3LSZ A;  4K2X A;  3EYT A;  2GZY A;  3F9U A;  2OAD A;  3EE2 A;  4ULX A;  3US3 A;  5G30 A;  3MSZ A;  4OCE A;  1X5E A;  4JED A;  4ECI A;  2J9H A;  5J9C A;  4XS4 A;  4TKY A;  3F3R A;  4HU9 A;  3HY2 A;  6GSW A;  3APO A;  7GSS A;  1SK1 A;  2QGV A;  3CQF A;  2GT6 A;  3GL3 A;  3GH6 A;  3HVV A;  4V1A g;  4HQS A;  4PNG A;  4XS4 B;  1YEX A;  2OKA A;  3GST A;  4K7I A;  2HZE B;  3AY8 A;  5GST A;  1SK2 A;  1VF4 A;  4K0N A;  1DUG A;  2PN8 A;  5AGY A;  2FUG 2;  3GUS A;  2X8H A;  1GSE A;  1R26 A;  5IO0 A;  1Z9H A;  2YCD A;  2XBQ A;  2D2Z A;  2H6Z A;  2L5O A;  2H6X A;  3CSI A;  5J4U A;  2QC7 A;  2FWG A;  5JWQ B;  1TW9 A;  3KTL A;  4PQI A;  2JZS A;  2H76 A;  17GS A;  2EC4 A;  2PMT A;  5HR2 A;  1YQ1 A;  3IHG A;  1UVZ A;  4TN8 A;  3TKP A;  3UIW A;  4PUR A;  4YAV A;  4DEJ A;  3IDV A;  2H1B A;  1J08 A;  5DCG A;  4XCS A;  5DAL B;  4WR5 A;  1B4P A;  4OO4 A;  5JCU A;  2CX3 A;  3WGE A;  5B6N A;  1H75 A;  1SD8 A;  5J41 A;  1WE0 A;  1FB6 A;  2AAW A;  3MDK A;  1URM A;  2MBT A;  3CSJ A;  3ZVJ D;  1YJ6 A;  4CW9 A;  1FAA A;  3J7Y k;  3FR9 A;  3FW2 A;  3WT2 A;  2B5X A;  4ECC A;  4K5S A;  14GS A;  4E8H A;  3QPM A;  4K9Z A;  1OKT A;  5KN3 A;  1WP0 A;  1TXX A;  2L4Q A;  2GZP A;  3C8E A;  4YKF A;  1A2M A;  2K6V A;  2RLI A;  5CP1 A;  5COH A;  3WGX A;  4HZ4 A;  3L0H A;  4KCE A;  5CRW A;  2IMK A;  2NBS A;  1AUC A;  2C1Y A;  4NHZ A;  2JAD A;  2P31 A;  1C72 A;  4ML1 A;  2C0E A;  2KUC A;  1GUH A;  1BQ7 A;  1F6M C;  4KSO A;  19GS A;  1KBN A;  3ED3 A;  2GSQ A;  3O76 A;  3ERW A;  2C80 A;  2A2P A;  1QGV A;  3HDC A;  3IR4 A;  2L5L A;  3DWV A;  3BD2 A;  1A0F A;  1Z7R A;  2L57 A;  4CY6 A;  3IAS 2;  4POB A;  5CAX A;  4QL7 A;  4J2F A;  1Z6M A;  2H75 A;  3JCM L;  3FK8 A;  1F3B A;  2JAC A;  2TRC P;  1TRS A;  3VI5 A;  3W6G A;  1ERU A;  4N0V A;  2HE3 A;  1WMJ A;  3KXO A;  4K6X A;  1XZO A;  3C71 A;  5EY6 A;  1PX7 A;  5F0G A;  1GL8 A;  3GKN A;  4I8B A;  2VAF A;  1Y25 A;  4I5Q A;  3LXT A;  3GHA A;  2GS3 A;  2OA7 A;  4N10 A;  2WS2 A;  4MCU A;  3ISO A;  2EIR A;  2WUL A;  1PQN A;  1U3A A;  3IE3 A;  2F8A A;  2DJ0 A;  2IN3 A;  4POK A;  2GLR A;  1FOV A;  4YAP A;  1GP1 A;  3F8U A;  1O8W A;  4JR6 A;  4ZBB A;  1JZW A;  1XOB A;  4GCI A;  4XRA A;  4IS0 A;  4OO5 A;  1NHO A;  13GS A;  4MDC A;  2X8G A;  4DSQ A;  4O5U A;  2WFC A;  4BL7 B;  1Y6E A;  2VUP A;  1NM3 A;  1JHB A;  4KUN A;  3MYD A;  2RUE A;  2M72 A;  4MMM A;  4DVC A;  4YQM A;  4Q5Q A;  5A5K A;  2VL2 A;  5ECL B;  1A0R P;  4JR4 A;  3HA9 A;  1MD3 A;  1SYR A;  3Q74 A;  5IMC A;  1AW9 A;  1FVJ A;  2P0G A;  5BRT A;  3F6D A;  1K0C A;  3PPU A;  1TRW A;  1PL1 A;  4WET A;  3HXS A;  4G10 A;  4V2L A;  1ZYE A;  3APQ A;  2R0C A;  4HQZ A;  1TI1 A;  11GS A;  3QMX A;  4ZL7 A;  4USS A;  1LU4 A;  2CX4 A;  2C8U A;  5E59 A;  4MA9 A;  5DJM A;  2LKU A;  2H0I A;  1VRS D;  4NXI A;  4FYC A;  2LNT A;  5DVB A;  3NOF A;  2N5B A;  2V1M A;  2FY6 A;  3FRC A;  4NWY A;  1B9X C;  5IQY A;  1XWC A;  2FCH A;  3I9V 2;  3M1G A;  1OE8 A;  3C1S A;  4MPF A;  4OFT A;  3F4R A;  1MTC A;  3HYP A;  2JL4 A;  4OCF A;  3TRP A;  1GTI A;  2B7K A;  4KDU A;  3UAP A;  2HLS A;  2CVB A;  3HVN A;  1FG4 A;  1TK5 B;  4IP6 A;  4PTS A;  1M9A A;  4KE3 A;  3GIX A;  3M0F A;  1PKW A;  4N0Z A;  1HNA A;  5HQP A;  5ECQ B;  4O92 A;  5ELA A;  2C3T A;  4MP4 A;  4IKH A;  2O85 A;  2AYT A;  1TP9 A;  4DSS B;  4OMV A;  1PMT A;  5AIV A;  1EWX A;  4WF4 A;  4BVY A;  3GKM A;  3SBC A;  3QAW A;  2DML A;  2B3S A;  2CT6 A;  5E4W A;  2IFQ A;  2YN1 A;  1SJZ A;  1GLP A;  2XHF A;  3HKR A;  3HHV A;  2IME A;  4Q5F A;  3TJK A;  2YPM A;  2A4H A;  2K18 A;  2IFQ B;  5G2Z A;  1U87 A;  3L4N A;  1XW6 A;  2M46 A;  3GKK A;  1U3I A;  1W4V A;  1X9W B;  4PUF C;  4TVE A;  3HD5 A;  5ECR B;  2V2G A;  3FHK A;  2QA2 A;  4ZB9 A;  3EVI A;  5IMF A;  4JZQ A;  2IL3 A;  1YEP A;  2FGX A;  4J57 E;  4IGJ A;  3G7J A;  4F0B A;  1GRX A;  4TRX A;  1GUL A;  3IHQ A;  1X5D A;  4KX4 A;  4N11 A;  1RW1 A;  1R5P A;  2VCV A;  3VK9 A;  1R7H A;  1VF2 A;  5ECS A;  2KP1 A;  1ZYN A;  2C3Q A;  3D5J A;  3IRA A;  3CBU A;  1Q98 A;  1W89 A;  1K0A A;  2WZ9 A;  1ERT A;  3DEX A;  1MD4 A;  1TI3 A;  5DQY A;  3UVT A;  2NDO A;  1MDK A;  3CYN A;  4EIQ A;  3CTG A;  3C73 A;  2YWO A;  2KOK A;  3A5I A;  2RM6 A;  2HSY A;  2R37 A;  5IMZ A;  1WPI A;  3UAR A;  3G7I A;  4K7O A;  2WGR A;  3CXG A;  4WBJ A;  1PN0 A;  1PN9 A;  4EF0 A;  1GNW A;  3HJM A;  3EMX A;  4L8E A;  5KN1 A;  1TRV A;  3QOU A;  5INY A;  5JWR B;  3GN3 A;  1K0B A;  5F06 A;  1VGL A;  1GWC A;  4LLR A;  4O7H A;  4X4J A;  2I3Y A;  2CV4 A;  2B1L A;  3Q19 A;  1MEK A;  2XPE A;  2AB6 A;  1UN2 A;  4O5Q A;  2VO4 A;  3EWL A;  5CRH A;  3KGK A;  1OAZ A;  2DLX A;  4ILF A;  4HJ2 A;  1H4O A;  3FZ5 A;  2H74 A;  4MPG A;  1PGT A;  1YY7 A;  4K1F A;  2AUV A;  4PX1 A;  5A4W A;  4WXT A;  5EL8 A;  2YJH A;  3KD0 A;  4OWY A;  1A2L A;  2DBC A;  1SKS B;  5ID2 A;  4I6X A;  2ALB A;  3W8S A;  4EO3 A;  1PKZ A;  3P7X A;  4BVX B;  3GL5 A;  2EIO A;  4AJ6 A;  1M0U A;  2QSI A;  2R3X A;  3LYP A;  1S3C A;  4HJM A;  2N5F A;  2B1K A;  3O6T A;  2ON5 A;  4K8M A;  1ERW A;  2DIY A;  4NMU A;  5G1L A;  1AXD A;  4YH2 A;  1WOU A;  1V58 A;  3HVX A;  3QFB C;  2OJL A;  1GSS A;  3GFK A;  5CO3 A;  4JU5 A;  3UBK A;  5LNK e;  2B7J A;  5ENU A;  3IBH A;  4GF0 A;  3KM6 A;  2FWE A;  4ZL9 A;  1M2A A;  2FD3 A;  5GAP D;  3UEM A;  5KOX A;  4G0L A;  1FOH A;  2F51 A;  4K2D A;  1TU8 A;  5DCH A;  4KCA A;  3E9J B;  3LEF A;  4BIK A;  3RDW A;  4GST A;  3VWW A;  4GXZ A;  2H73 A;  4MK3 A;  3RHB A;  4FH8 A;  2TRX A;  1N8J A;  4MAB A;  1VF3 A;  3V1W A;  5IO2 A;  2HI7 A;  4XHM A;  1DBY A;  1O6J A;  1QMV A;  5GSS A;  2XBI A;  1YKC A;  1PSQ A;  3O3T A;  2X49 A;  3GNJ A;  2L59 A;  2HSM A;  1PD2 1;  2PVO C;  4D73 A;  2X4A A;  1HQO A;  1ACV A;  3J7Y b;  5L71 A;  2DC5 A;  2K8V A;  1SYX A;  16GS A;  5H5R A;  4PGT A;  2ON7 A;  3VLN A;  2X8C A;  3ZVJ A;  9GSS A;  2LTK A;  4KF9 A;  3LWA A;  3P90 A;  4MF6 A;  2PBJ A;  4GSN A;  5AN1 A;  1OVN A;  2IJY A;  2YWM A;  2FNO A;  1SJI A;  5H5S A;  3I6A A;  4GRF A;  5ECN B;  2DKH A;  4NV2 A;  1OC9 A;  2YWI A;  2IMD A;  2O7K A;  2MMO A;  5EPF A;  1TU7 A;  4WR4 A;  2CVK A;  1TJD A;  1GSY A;  1CQG A;  1X5C A;  5CRD A;  2PWJ A;  1OC9 B;  1E2Y A;  1KEB A;  1GSQ A;  1XIY A;  2P5R A;  1A2J A;  4X43 A;  4ZXG A;  2ZCT A;  4OFN A;  3TRX A;  1OYJ A;  4JRR A;  3DYR A;  4CDO A;  3GMF A;  2GSS A;  4HDE A;  2I4A A;  3KH7 A;  5D93 A;  2H1A A;  2VCQ A;  2GZZ A;  3RHC A;  2L6D A;  3TKS C;  2E7P A;  2H1G A;  5DAK A;  4MH2 A;  3GV1 A;  2IPA A;  3KIJ A;  2DIZ A;  5IMD A;  3U6V A;  3UBL A;  3TUE A;  1M3J A;  1V57 A;  4TR4 A;  2Z9S A;  1AQV A;  4O5R A;  4AJ8 A;  1EP8 A;  5HFI A;  4I97 A;  2OBK A;  3ZMK A;  3DVX A;  4RI6 A;  4RUV A;  5ELG A;  2J23 A;  1OE7 A;  1ON4 A;  3MIX A;  4NPB A;  4MF7 A;  1XBS A;  3PGT A;  3G9B A;  3RBT A;  3D4T A;  2FWH A;  4IHU A;  2V6O A;  2C3N A;  4HI7 A;  4PNF A;  2OBI A;  3EPT A;  5ECM B;  1USB A;  2EIQ A;  3E0U A;  1OC3 A;  4K0G A;  3CRU A;  2V41 A;  1DSB A;  2HNL A;  5C00 A;  4A5P A;  1QK8 A;  2OE0 A;  2H8L A;  4KDX A;  4OFM A;  4ZBD A;  2R5G A;  3IK9 A;  4XTS A;  2DKI A;  3FR6 A;  5IIZ A;  4LMW A;  2LQO A;  3DGQ A;  2R6K A;  1FW1 A;  3ZLP A;  3DRN A;  4KSM A;  2HRN A;  3IOS A;  4KB3 A;  2C0D A;  2CZ3 A;  1ST9 A;  2LJA A;  4TR3 A;  5G5F A;  2OE1 A;  2RUF A;  1WRY A;  2C4J A;  2VCW A;  4IJI A;  3F4S A;  2DJ1 A;  4POL A;  3MAK A;  2R0G A;  3UOM A;  4I2T A;  1KNG A;  4MF5 A;  3Q6O A;  3IXR A;  2FLS A;  2LV3 A;  3L9U A;  3LOR A;  4K7N A;  2HYX A;  2PPT A;  1S3R A;  2F8F A;  3S9F A;  2L4C A;  3BBY A;  1V98 A;  1BAY A;  3R2Q A;  4TXO A;  2GST A;  3ZRD A;  1RK4 A;  2YP6 A;  1ZMA A;  2LRN A;  3P8W A;  1YF1 A;  3GTU A;  1WIK A;  4JBB A;  2YWN A;  4FQU A;  2VCX A;  3KH9 A;  4Q5N A;  4TXV A;  1TRU A;  1Q4J A;  4PUA A;  4MJC A;  5B7C A;  5J5N A;  1U6T A;  1QFN A;  2IWT A;  4I2U A;  3OR5 A;  1M3I A;  2YAN A;  1M2B A;  4G0K A;  2LST A;  2MBS A;  1SKW B;  3VPQ A;  1F3A A;  5BMU A;  2GQL A;  4K5R A;  4NAX A;  3ERG A;  3BCI A;  4L5L A;  1FB0 A;  3GKX A;  4QQ7 A;  2WB9 A;  4RQR A;  1A8Y A;  3MWH A;  2VD1 A;  4V2M A;  4P3Y B;  1CQH A;  3KZQ A;  2MMZ A;  1SEN A;  3D21 A;  2VLT A;  1QUW A;  4TR1 A;  1I9D A;  4EIP A;  3TGZ A;  1G6W A;  1JZO A;  2IMI A;  3PH9 A;  2JZT A;  4NV5 A;  4ACS A;  2HSH A;  2PER A;  3QAV A;  2VIM A;  3GYK A;  1XXU A;  1V40 A;  4QL9 A;  1FO5 A;  2B6M A;  1PA3 A;  5J9B A; 
#chains in the Genus database with same CATH homology
 2H70 A;  3PR8 A;  1NW2 A;  1V2A A;  4G9H A;  4ZIL A;  2LQQ A;  4LL4 B;  2AJQ B;  3GUR A;  5ECH B;  3HVS A;  3W8J A;  2YZU A;  2VCZ A;  2PVQ A;  3D0Z A;  2PGT A;  1T8E B;  3GSS A;  4LA1 A;  4V2N A;  2NTO A;  3ZIV A;  4Z2R A;  3CMI A;  1JLW A;  4RQX A;  4BWQ A;  1ZYQ B;  2VL9 A;  5G1K A;  3DIE A;  1SKR B;  3DVW A;  3SWL A;  4BVY B;  1Z6N A;  3IAM 2;  1HYU A;  3ZTL A;  1TDI A;  1U88 A;  4MNN A;  2GVP A;  2LUS A;  4F0C A;  3TJB A;  4TR0 A;  5F05 A;  5HR0 A;  2HT9 A;  1SU9 A;  5CNW A;  4BWS A;  4YKG A;  3EU3 A;  1JLV A;  3NIV A;  5KN2 A;  2VD0 A;  4J56 E;  6GSU A;  4V1A p;  3FR3 A;  1XCC A;  1G6Y A;  18GS A;  4HZ2 A;  1F9M A;  4IQA A;  1GTU A;  4L0U A;  3R3E A;  1EOH A;  3TJF A;  1GNE A;  3QAG A;  4PQ1 A;  5F07 A;  5AIS A;  1GH2 A;  1FVK A;  2ZNM A;  2R0P A;  3GH9 A;  1YKA A;  5IMV A;  3ZIT A;  2A2S A;  4ID0 A;  1ZGN A;  5IPG A;  1O7U A;  1SK0 A;  3EU4 A;  3M9K A;  1K0D A;  3WYW A;  1IYI A;  1B9Y C;  4IJ3 A;  3ME7 A;  8GSS A;  1G7O A;  1J9B A;  1G7E A;  3CTF A;  2WCI A;  2YZH A;  1WJK A;  2G2Q A;  4L0W A;  4PQH A;  2VM1 A;  1SL0 B;  3TKQ A;  3KP8 A;  5D8I A;  4IVF A;  2ES7 A;  10GS A;  3HZ8 A;  3LXZ A;  3F3Q A;  4MZW A;  2MYG A;  1F37 A;  3KCM A;  5HFG A;  3A2V A;  3A5W A;  2PU9 C;  6GSV A;  4XIH A;  1TKD B;  1X9S B;  4IEL A;  3ZYW A;  1B4Q A;  3VUR A;  3UL3 A;  3KP9 A;  4ICY A;  2H1D A;  3ZIJ A;  4EDY A;  3A2X A;  3WT1 A;  1JZD A;  2P5Q A;  2G0F A;  2O8V B;  1VF1 A;  2KP2 A;  4FYB A;  1GTA A;  5ID2 B;  3IPZ A;  3ZFB A;  4GQF A;  2E2M A;  4KDY A;  20GS A;  5A4U A;  1OC8 A;  3UMA A;  4ZL8 A;  3D22 A;  1T4Z A;  4XS1 A;  6GSS A;  4DSR A;  1OKD A;  4L5O A;  1XW5 A;  3M8N A;  3FMW A;  1AQX A;  5IMA A;  1T3B A;  2UZ8 A;  2ZUP A;  3D6I A;  4MLY A;  2HZE A;  1JZR A;  3EUR A;  3APS A;  2LJK A;  4EDZ A;  2LJR A;  3HZ4 A;  5IM9 A;  1ZL9 A;  3KMN A;  2FA4 A;  4MZB A;  1XWG A;  4EC0 A;  5B6M A;  1XFL A;  3TJG A;  3UJ1 A;  3IC4 A;  4CY8 A;  2AHE A;  5D96 A;  1YZX A;  2QKE A;  1Z5Y E;  3GA4 A;  1J0F A;  3LGC A;  3FYG A;  1HNB A;  1X9M B;  3H93 A;  4EL1 A;  4PXO A;  2HRA A;  2MMA A;  4GTU A;  4G19 A;  2O89 A;  2WJU A;  5DAL A;  4FYU A;  2H6Y A;  5CRG A;  1K0M A;  4AF2 A;  1T7P B;  1AQW A;  5CYY A;  1EP7 A;  2KHP A;  3KEB A;  4D73 B;  2I1U A;  5GAN D;  2YNX A;  3L9V A;  5B8B A;  1GUK A;  2H01 A;  3PIN A;  2RM5 A;  4F2I A;  4YQU A;  5D73 A;  4X1U A;  3RPP A;  1XWB A;  4KND A;  1I5G A;  1GSU A;  3RAZ A;  5D9W A;  2M80 A;  4MH3 A;  1AC1 A;  4Z2T A;  1K3Y A;  5JWO B;  4BA7 A;  3ERF A;  1SJ6 A;  4HOJ A;  1BJX A;  3TB2 A;  1GUM A;  2FHE A;  3H79 A;  3IK7 A;  2I81 A;  5C04 A;  2GGT A;  5EVO A;  3QCP A;  1EGO A;  3C7M A;  1EGR A;  1EV4 A;  6GST A;  2BJX A;  2E2G A;  3L78 A;  3EMP A;  2CA8 A;  1HNC A;  2JSY A;  4ZB8 A;  4EUY A;  4F9Z A;  3H8Q A;  4WEY A;  1M2D A;  4EVM A;  2MMN A;  1SL2 B;  1EV9 A;  3UVH A;  5B8A A;  3VI7 A;  5GZZ B;  1SL1 B;  5DJL A;  1R4W A;  3M9J A;  1MDJ A;  4LMV A;  3N5O A;  5D9X A;  1PRX A;  3A2W A;  5ECI B;  4Z2U A;  2DSA A;  2DJ2 A;  3KJY A;  1GSD A;  2VL2 C;  3EIN A;  3CSH A;  2LNS A;  5DAK B;  1A23 A;  1K3O A;  4IN0 A;  4E8E A;  4TW5 A;  5JCG A;  4XS6 A;  3QR6 A;  3IA1 A;  4H86 A;  1TK0 B;  5D9T A;  3KTB A;  2N5A A;  1BX9 A;  2R4V A;  3HCZ A;  1T1V A;  3LW9 A;  1ERV A;  5HFK A;  4GQC A;  1Z3E A;  3TJJ A;  5ECK B;  4Z7X A;  1T00 A;  2B5Y A;  2CAI A;  2KLX A;  3DML A;  3U5R E;  3F63 A;  1UA5 A;  4WBR D;  2VLV A;  4MJB A;  12GS A;  1M9B A;  2GSR A;  2R2J A;  3N9J A;  3E3E A;  4F82 A;  4ECJ A;  2FA8 A;  4GWR A;  1KTE A;  1WWJ A;  1BG5 A;  3DD3 A;  2VL3 A;  2X99 A;  1UC7 A;  1THX A;  3GRX A;  1EEJ A;  5D9V A;  1XWK A;  1QXH A;  3FZ9 A;  4EKZ A;  2H0G A;  5ECO B;  1XVQ A;  3I43 A;  3LJR A;  1PX6 A;  2K9F A;  1XWA A;  2XC2 A;  2GQK A;  5KN0 A;  1YDK A;  3GX0 A;  4BL7 A;  2WRT A;  1PL2 A;  3TKS A;  5CRE A;  3L9S A;  4ISD A;  3DKS A;  2JSZ A;  3M3M A;  3ME8 A;  2H19 A;  2YV9 A;  1T4Y A;  4EE0 A;  3I69 A;  1MDI A;  1K0N A;  1JFU A;  4KH7 A;  4HEA 2;  5FT3 A;  3VWV A;  3G7Y A;  2HXK A;  5HR3 A;  2YOI A;  2E0Q A;  1Z7P A;  3Q18 A;  3NZN A;  1R5A A;  4O32 A;  5KEJ A;  3VFI A;  2DJJ A;  5IOW A;  2QA1 A;  4IQ1 A;  1K3L A;  1V9W A;  4TXO B;  4N30 A;  1G0T A;  3GTU B;  5A4V A;  1ZOF A;  1BED A;  2YJ7 A;  4MZC A;  4EXJ A;  5JCW A;  4NHW A;  4KGI A;  1ILO A;  2PUK C;  3ZFL A;  4MJE A;  3F6F A;  2V32 A;  1ZZY A;  3TOU A;  2DJ3 A;  2C0G A;  2A4V A;  4XRD A;  4POM A;  2JZR A;  3TOT A;  3EC3 A;  2GQM A;  2TIR A;  3TRQ A;  4HU7 A;  3VWX A;  4TOP A;  3ZL5 A;  1A24 A;  4AGS A;  2CQ9 A;  3RPN A;  5H5Q A;  2OAC A;  1ZCP A;  4IP1 A;  1SD9 A;  2VLU A;  3FEU A;  1GLQ A;  4IW9 A;  3TCO A;  3BCK A;  3FZA A;  3QDN A;  4ZIJ A;  4WKW A;  1EOG A;  2WDU A;  1DE1 A;  1B48 A;  2BTO T;  4TR1 B;  2IMF A;  22GS A;  1XW9 A;  1K0O A;  4G0I A;  2BMX A;  1AAZ A;  2HRF A;  4ECB A;  2VCT A;  4DSS A;  5IOX A;  1A8L A;  1B8X A;  2O87 A;  3HJO A;  1O8X A;  3LQ7 A;  2VM2 A;  1XVW A;  3KMO A;  3IV4 A;  4GLT A;  3WGD A;  1XOA A;  3VWU A;  2LEG A;  1EEM A;  1NHY A;  3WD6 A;  2H0H A;  1ABA A;  3ZZX A;  4IBP A;  3LG6 A;  2GTU A;  2L6C A;  6GSY A;  1N2A A;  4KA0 A;  2GDR A;  1TOF A;  1O73 A;  1S3D A;  1YF0 A;  1O81 A;  2FWF A;  2DJK A;  1QQ2 A;  1M99 A;  1E6B A;  5DDL A;  2NPB A;  2H66 A;  1GTB A;  1RQM A;  3QD9 A;  2K8S A;  6GSX A;  1NSW A;  1BYE A;  2F9S A;  2IIY A;  4MJA A;  3IC8 A;  1HD2 A;  1DE2 A;  2V6K A;  5FWG A;  4KW6 A;  1ZYP A;  5DBQ A;  1IYH A;  1O85 A;  3ZRE A;  3H4K A;  4ZB6 A;  4Q5R A;  3TKR A;  2C0F A;  2YV7 A;  3GX8 A;  1EZK A;  5J3R A;  4KAE A;  4HUA A;  3FZ4 A;  2CVD A;  5HR1 A;  3TKS E;  5F8B A;  4RI7 A;  2HZF A;  5G31 A;  1ML6 A;  2XPD A;  3H1N A;  4OD7 A;  3FY7 A;  2H71 A;  5LD0 A;  3F4T A;  2MZC A;  2HFD A;  1FHE A;  3D4M A;  5LCZ A;  1X0R A;  1TTZ A;  5G5E A;  4F03 A;  3HJP A;  3F0I A;  5ABR A;  1LBK A;  2I9H A;  1GSF A;  4BPY A;  3QFA C;  4ZBA A;  2NVL A;  2H30 A;  3MNG A;  2F3M A;  2OE3 A;  3A3T A;  1M7T A;  3CRT A;  2B5E A;  4GSS A;  2CAQ A;  1S3A A;  3FKF A;  3DXB A;  4FO5 A;  4FIW A;  3VPT A;  2JU5 A;  2A2R A;  5FHI A;  2AV4 A;  2VOC A;  1F2E A;  2CZ2 A;  2LS5 A;  1THO A;  3TDG A;  1TK8 B;  4AJ7 A;  4X0X A;  2REM A;  5DQS A;  4ML6 A;  4CHS A;  5KOW A;  1XPV A;  4LL1 B;  3BOA A;  2HRK A;  3P2A A;  2X64 A;  2RII A;  3K8N A;  1AIU A;  3BJ5 A;  4BVX A;  1LJR A;  4HS1 A;  4G2E A;  2H72 A;  5IPH A;  4YQV A;  3ZML A;  4WF5 A;  2GT5 A;  4JE1 A;  3LYK A;  5ECP B;  2DMM A;  2LRC A;  2LRT A;  3LFL A;  5AIX A;  3C1R A;  3LSZ A;  4K2X A;  3EYT A;  2GZY A;  3F9U A;  2OAD A;  3EE2 A;  4ULX A;  3US3 A;  5G30 A;  3MSZ A;  4OCE A;  1X5E A;  4JED A;  4ECI A;  2J9H A;  5J9C A;  4XS4 A;  4TKY A;  3F3R A;  4HU9 A;  3HY2 A;  6GSW A;  3APO A;  7GSS A;  1SK1 A;  2QGV A;  2GT6 A;  3GL3 A;  3GH6 A;  3HVV A;  4V1A g;  4HQS A;  4PNG A;  4XS4 B;  1YEX A;  2OKA A;  3GST A;  4K7I A;  2HZE B;  3AY8 A;  5GST A;  1SK2 A;  1VF4 A;  4K0N A;  1DUG A;  2PN8 A;  5AGY A;  2FUG 2;  3GUS A;  2X8H A;  1GSE A;  1R26 A;  5IO0 A;  1Z9H A;  2YCD A;  2XBQ A;  2D2Z A;  2H6Z A;  2L5O A;  2H6X A;  3CSI A;  5J4U A;  2QC7 A;  2FWG A;  5JWQ B;  1TW9 A;  3KTL A;  4PQI A;  2JZS A;  2H76 A;  17GS A;  2EC4 A;  2PMT A;  5HR2 A;  1YQ1 A;  3IHG A;  1UVZ A;  4TN8 A;  3TKP A;  3UIW A;  4PUR A;  4YAV A;  4DEJ A;  3IDV A;  2H1B A;  1J08 A;  5DCG A;  4XCS A;  5DAL B;  4WR5 A;  1B4P A;  4OO4 A;  5JCU A;  2CX3 A;  3WGE A;  5B6N A;  1H75 A;  1SD8 A;  5J41 A;  1WE0 A;  1FB6 A;  2AAW A;  3MDK A;  1URM A;  2MBT A;  3CSJ A;  3ZVJ D;  1YJ6 A;  4CW9 A;  1FAA A;  3J7Y k;  3FR9 A;  3FW2 A;  3WT2 A;  2B5X A;  4ECC A;  4K5S A;  14GS A;  4E8H A;  3QPM A;  4K9Z A;  1OKT A;  5KN3 A;  1WP0 A;  1TXX A;  2L4Q A;  2GZP A;  3C8E A;  4YKF A;  1A2M A;  2K6V A;  2RLI A;  5CP1 A;  5COH A;  3WGX A;  4HZ4 A;  3L0H A;  4KCE A;  5CRW A;  2IMK A;  2NBS A;  1AUC A;  2C1Y A;  4NHZ A;  2JAD A;  2P31 A;  1C72 A;  4ML1 A;  2C0E A;  2KUC A;  1GUH A;  1BQ7 A;  1F6M C;  4KSO A;  19GS A;  1KBN A;  3ED3 A;  2GSQ A;  3O76 A;  3ERW A;  2C80 A;  2A2P A;  1QGV A;  3HDC A;  3IR4 A;  2L5L A;  3DWV A;  3BD2 A;  1A0F A;  1Z7R A;  2L57 A;  4CY6 A;  3IAS 2;  4POB A;  5CAX A;  4QL7 A;  4J2F A;  1Z6M A;  2H75 A;  3JCM L;  3FK8 A;  1F3B A;  2JAC A;  2TRC P;  1TRS A;  3VI5 A;  3W6G A;  1ERU A;  4N0V A;  2HE3 A;  1WMJ A;  3KXO A;  4K6X A;  1XZO A;  3C71 A;  5EY6 A;  1PX7 A;  5F0G A;  1GL8 A;  3GKN A;  4I8B A;  2VAF A;  1Y25 A;  4I5Q A;  3LXT A;  3GHA A;  2GS3 A;  2OA7 A;  4N10 A;  2WS2 A;  4MCU A;  3ISO A;  2EIR A;  2WUL A;  1PQN A;  1U3A A;  3IE3 A;  2F8A A;  2DJ0 A;  2IN3 A;  4POK A;  2GLR A;  1FOV A;  4YAP A;  1GP1 A;  3F8U A;  1O8W A;  4JR6 A;  4ZBB A;  1JZW A;  1XOB A;  4GCI A;  4XRA A;  4IS0 A;  4OO5 A;  1NHO A;  13GS A;  4MDC A;  2X8G A;  4DSQ A;  4O5U A;  2WFC A;  4BL7 B;  1Y6E A;  2VUP A;  1NM3 A;  1JHB A;  4KUN A;  3MYD A;  2RUE A;  2M72 A;  4MMM A;  4DVC A;  4YQM A;  4Q5Q A;  5A5K A;  2VL2 A;  5ECL B;  1A0R P;  4JR4 A;  3HA9 A;  1MD3 A;  1SYR A;  3Q74 A;  5IMC A;  1AW9 A;  1FVJ A;  2P0G A;  5BRT A;  3F6D A;  1K0C A;  3PPU A;  1TRW A;  1PL1 A;  4WET A;  3HXS A;  4G10 A;  4V2L A;  1ZYE A;  3APQ A;  2R0C A;  4HQZ A;  1TI1 A;  11GS A;  3QMX A;  4ZL7 A;  4USS A;  1LU4 A;  2CX4 A;  2C8U A;  5E59 A;  4MA9 A;  5DJM A;  2LKU A;  2H0I A;  1VRS D;  4NXI A;  4FYC A;  2LNT A;  5DVB A;  3NOF A;  2N5B A;  2V1M A;  2FY6 A;  3FRC A;  4NWY A;  1B9X C;  5IQY A;  1XWC A;  2FCH A;  3I9V 2;  3M1G A;  1OE8 A;  3C1S A;  4MPF A;  4OFT A;  3F4R A;  1MTC A;  3HYP A;  2JL4 A;  4OCF A;  3TRP A;  1GTI A;  2B7K A;  4KDU A;  3UAP A;  2HLS A;  2CVB A;  1FG4 A;  1TK5 B;  4IP6 A;  4PTS A;  1M9A A;  4KE3 A;  3GIX A;  3M0F A;  1PKW A;  4N0Z A;  1HNA A;  5HQP A;  5ECQ B;  4O92 A;  5ELA A;  2C3T A;  4MP4 A;  4IKH A;  2O85 A;  2AYT A;  1TP9 A;  4DSS B;  4OMV A;  1PMT A;  5AIV A;  1EWX A;  4WF4 A;  4BVY A;  3GKM A;  3SBC A;  3QAW A;  2DML A;  2B3S A;  2CT6 A;  5E4W A;  2IFQ A;  2YN1 A;  1SJZ A;  1GLP A;  2XHF A;  3HKR A;  3HHV A;  2IME A;  4Q5F A;  3TJK A;  2YPM A;  2A4H A;  2K18 A;  2IFQ B;  5G2Z A;  1U87 A;  3L4N A;  1XW6 A;  2M46 A;  3GKK A;  1U3I A;  1W4V A;  1X9W B;  4PUF C;  4TVE A;  3HD5 A;  5ECR B;  2V2G A;  3FHK A;  2QA2 A;  4ZB9 A;  3EVI A;  5IMF A;  4JZQ A;  2IL3 A;  1YEP A;  2FGX A;  4J57 E;  4IGJ A;  3G7J A;  4F0B A;  1GRX A;  4TRX A;  1GUL A;  3IHQ A;  1X5D A;  4KX4 A;  4N11 A;  1RW1 A;  1R5P A;  2VCV A;  3VK9 A;  1R7H A;  1VF2 A;  5ECS A;  2KP1 A;  1ZYN A;  2C3Q A;  3D5J A;  3IRA A;  3CBU A;  1Q98 A;  1W89 A;  1K0A A;  2WZ9 A;  1ERT A;  3DEX A;  1MD4 A;  1TI3 A;  5DQY A;  3UVT A;  2NDO A;  1MDK A;  3CYN A;  4EIQ A;  3CTG A;  3C73 A;  2YWO A;  2KOK A;  3A5I A;  2RM6 A;  2HSY A;  2R37 A;  5IMZ A;  1WPI A;  3UAR A;  3G7I A;  4K7O A;  2WGR A;  3CXG A;  4WBJ A;  1PN0 A;  1PN9 A;  4EF0 A;  1GNW A;  3HJM A;  3EMX A;  4L8E A;  5KN1 A;  1TRV A;  3QOU A;  5INY A;  5JWR B;  3GN3 A;  1K0B A;  5F06 A;  1VGL A;  1GWC A;  4LLR A;  4O7H A;  4X4J A;  2I3Y A;  2CV4 A;  2B1L A;  3Q19 A;  1MEK A;  2XPE A;  2AB6 A;  1UN2 A;  4O5Q A;  2VO4 A;  3EWL A;  5CRH A;  3KGK A;  1OAZ A;  2DLX A;  4ILF A;  4HJ2 A;  1H4O A;  3FZ5 A;  2H74 A;  4MPG A;  1PGT A;  1YY7 A;  4K1F A;  2AUV A;  4PX1 A;  5A4W A;  4WXT A;  5EL8 A;  2YJH A;  3KD0 A;  4OWY A;  1A2L A;  2DBC A;  1SKS B;  5ID2 A;  4I6X A;  2ALB A;  3W8S A;  4EO3 A;  1PKZ A;  3P7X A;  4BVX B;  3GL5 A;  2EIO A;  4AJ6 A;  1M0U A;  2QSI A;  2R3X A;  3LYP A;  1S3C A;  4HJM A;  2N5F A;  2B1K A;  3O6T A;  2ON5 A;  4K8M A;  1ERW A;  2DIY A;  4NMU A;  5G1L A;  1AXD A;  4YH2 A;  1WOU A;  1V58 A;  3HVX A;  3QFB C;  2OJL A;  1GSS A;  3GFK A;  5CO3 A;  4JU5 A;  3UBK A;  5LNK e;  2B7J A;  5ENU A;  3IBH A;  4GF0 A;  3KM6 A;  2FWE A;  4ZL9 A;  1M2A A;  2FD3 A;  5GAP D;  3UEM A;  5KOX A;  4G0L A;  1FOH A;  2F51 A;  4K2D A;  1TU8 A;  5DCH A;  4KCA A;  3E9J B;  3LEF A;  3RDW A;  4GST A;  3VWW A;  4GXZ A;  2H73 A;  4MK3 A;  3RHB A;  4FH8 A;  2TRX A;  1N8J A;  4MAB A;  1VF3 A;  3V1W A;  5IO2 A;  2HI7 A;  4XHM A;  1DBY A;  1O6J A;  1QMV A;  5GSS A;  2XBI A;  1YKC A;  1PSQ A;  3O3T A;  2X49 A;  3GNJ A;  2L59 A;  2HSM A;  1PD2 1;  2PVO C;  4D73 A;  2X4A A;  1HQO A;  1ACV A;  3J7Y b;  5L71 A;  2DC5 A;  2K8V A;  1SYX A;  16GS A;  5H5R A;  4PGT A;  2ON7 A;  3VLN A;  2X8C A;  3ZVJ A;  9GSS A;  2LTK A;  4KF9 A;  3LWA A;  3P90 A;  4MF6 A;  2PBJ A;  4GSN A;  5AN1 A;  1OVN A;  2IJY A;  2YWM A;  2FNO A;  1SJI A;  5H5S A;  3I6A A;  4GRF A;  5ECN B;  2DKH A;  4NV2 A;  1OC9 A;  2YWI A;  2IMD A;  2O7K A;  2MMO A;  5EPF A;  1TU7 A;  4WR4 A;  2CVK A;  1TJD A;  1GSY A;  1CQG A;  1X5C A;  5CRD A;  2PWJ A;  1OC9 B;  1E2Y A;  1KEB A;  1GSQ A;  1XIY A;  2P5R A;  1A2J A;  4X43 A;  4ZXG A;  2ZCT A;  4OFN A;  3TRX A;  1OYJ A;  4JRR A;  3DYR A;  4CDO A;  3GMF A;  2GSS A;  4HDE A;  2I4A A;  3KH7 A;  5D93 A;  2H1A A;  2VCQ A;  2GZZ A;  3RHC A;  2L6D A;  3TKS C;  2E7P A;  2H1G A;  5DAK A;  4MH2 A;  3GV1 A;  2IPA A;  3KIJ A;  2DIZ A;  5IMD A;  3U6V A;  3UBL A;  3TUE A;  1V57 A;  4TR4 A;  2Z9S A;  1AQV A;  4O5R A;  4AJ8 A;  1EP8 A;  5HFI A;  4I97 A;  2OBK A;  3ZMK A;  3DVX A;  4RI6 A;  4RUV A;  5ELG A;  2J23 A;  1OE7 A;  1ON4 A;  3MIX A;  4NPB A;  4MF7 A;  1XBS A;  3PGT A;  3G9B A;  3RBT A;  3D4T A;  2FWH A;  4IHU A;  2V6O A;  2C3N A;  4HI7 A;  4PNF A;  2OBI A;  3EPT A;  5ECM B;  1USB A;  2EIQ A;  3E0U A;  1OC3 A;  4K0G A;  3CRU A;  2V41 A;  1DSB A;  2HNL A;  5C00 A;  4A5P A;  1QK8 A;  2OE0 A;  2H8L A;  4KDX A;  4OFM A;  4ZBD A;  2R5G A;  3IK9 A;  4XTS A;  2DKI A;  3FR6 A;  5IIZ A;  4LMW A;  2LQO A;  3DGQ A;  2R6K A;  1FW1 A;  3ZLP A;  3DRN A;  4KSM A;  2HRN A;  3IOS A;  4KB3 A;  2C0D A;  2CZ3 A;  1ST9 A;  2LJA A;  4TR3 A;  5G5F A;  2OE1 A;  2RUF A;  1WRY A;  2C4J A;  2VCW A;  4IJI A;  3F4S A;  2DJ1 A;  4POL A;  3MAK A;  2R0G A;  3UOM A;  4I2T A;  1KNG A;  4MF5 A;  3Q6O A;  3IXR A;  2FLS A;  2LV3 A;  3L9U A;  3LOR A;  4K7N A;  2HYX A;  2PPT A;  2F8F A;  3S9F A;  2L4C A;  3BBY A;  1V98 A;  1BAY A;  3R2Q A;  4TXO A;  2GST A;  3ZRD A;  1RK4 A;  2YP6 A;  1ZMA A;  2LRN A;  3P8W A;  1YF1 A;  3GTU A;  1WIK A;  4JBB A;  2YWN A;  4FQU A;  2VCX A;  3KH9 A;  4Q5N A;  4TXV A;  1TRU A;  1Q4J A;  4PUA A;  4MJC A;  5B7C A;  5J5N A;  1U6T A;  1QFN A;  2IWT A;  4I2U A;  3OR5 A;  2YAN A;  1M2B A;  4G0K A;  2LST A;  2MBS A;  1SKW B;  3VPQ A;  1F3A A;  5BMU A;  2GQL A;  4K5R A;  4NAX A;  3ERG A;  3BCI A;  4L5L A;  1FB0 A;  3GKX A;  4QQ7 A;  2WB9 A;  4RQR A;  1A8Y A;  3MWH A;  2VD1 A;  4V2M A;  4P3Y B;  1CQH A;  3KZQ A;  2MMZ A;  1SEN A;  3D21 A;  2VLT A;  1QUW A;  4TR1 A;  1I9D A;  4EIP A;  3TGZ A;  1G6W A;  1JZO A;  2IMI A;  3PH9 A;  2JZT A;  4NV5 A;  4ACS A;  2HSH A;  2PER A;  3QAV A;  2VIM A;  3GYK A;  1XXU A;  1V40 A;  4QL9 A;  1FO5 A;  2B6M A;  1PA3 A;  5J9B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...