3L9VA

Crystal structure of salmonella enterica serovar typhimurium srga
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
182
structure length
182
Chain Sequence
AEWESITPPVVDAPAVVEFFSFYCPPCYAFSQTMGVDQAIRHVLPQGSRMVKYHVSLLGPLGHELTRAWALAMVMKETDVIEKAFFTAGMVEKRLHSPDDVRRVFMSATGISRGEYDRSIKSPAVNDMVALQERLFKEYGVRGTPSVYVRGRYHINNAAFGAFSVENFRSRYAAVVRKLLAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Putative thiol-disulfide isomerase or thioredoxin
publication title Structural and functional characterization of three DsbA paralogues from Salmonella enterica serovar typhimurium
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
total genus 57
structure length 182
sequence length 182
chains with identical sequence B, C, D, E
ec nomenclature ec 5.3.4.1: Protein disulfide-isomerase.
pdb deposition date 2010-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01323 DSBA DSBA-like thioredoxin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3l9vA00
2H30A 1XOBA 2L5OA 3GURA 1F2EA 1Z6NA 1K0NA 3TKSC 1M7TA 1PSQA 2IFQB 3VWUA 5JCUA 1E6BA 4MH3A 2DSAA 2LS5A 1X0RA 3GMFA 4O32A 2MBSA 3QR6A 4LL1B 4WKWA 1FVJA 1N8JA 1QXHA 4YAPA 3F6DA 1JLWA 2CZ2A 1TRWA 1U6TA 2HRFA 3TGZA 4IP1A 2HZEB 1I9DA 1XW6A 4HOJA 2XBIA 4NV5A 3DWVA 4L0WA 1OKTA 1WE0A 4ZBBA 4HJ2A 4MLYA 1BJXA 4L0UA 19GSA 2WDUA 2VCZA 2GTUA 2IFQA 3IK7A 4K8MA 5DJMA 3BCIA 3APSA 1RW1A 3WGXA 1HNCA 2O87A 1A23A 3D4MA 1GSUA 1K0CA 2JSYA 4KH7A 2L4QA 4KGIA 1ACVA 2DJJA 1A2MA 2LRCA 2Z9SA 4N10A 1XXUA 3Q18A 3G9BA 1J08A 3EURA 2PMTA 3GN3A 4ILFA 4TR1B 1Z9HA 1XWBA 1YEPA 1FB0A 2DJ0A 2VOCA 3IHQA 4IS0A 1KTEA 4WR4A 1X5EA 2V6OA 4OO4A 3U6VA 3H79A 5IO0A 4DEJA 1EWXA 2VM1A 4BL7A 2X99A 1GNEA 3RBTA 5DQSA 3KGKA 2C0DA 3WGEA 3HJOA 1X5DA 3TUEA 1EOGA 2A4VA 3GH6A 1R5PA 4L5LA 1T7PB 2D2ZA 4EF0A 1WIKA 4KSMA 2H01A 1O8WA 4K1FA 1T4ZA 4EC0A 3GTUB 4TRXA 3DKSA 3EE2A 5ECMB 4AJ8A 4JE1A 3GX0A 5A4VA 4EDZA 2AYTA 4GSNA 4LMWA 3CBUA 4MA9A 1ON4A 1YQ1A 4X43A 2CVDA 2GSRA 3F4SA 2GZZA 3FR6A 4V2MA 4PUAA 3GL3A 1A24A 5JWOB 3TCOA 1SYRA 2FNOA 2LV3A 2YJHA 3LGCA 5CRWA 5HFKA 1O6JA 2L5LA 4I2TA 2AUVA 5IPHA 1ZOFA 1SK2A 4K2DA 1BYEA 1TKDB 1B8XA 1XVQA 2YANA 3DVXA 2B6MA 5E59A 3KTLA 4PUFC 2HE3A 5ELAA 1T1VA 1FHEA 1YF0A 3U5RE 1HNAA 3FZ9A 3WYWA 2H76A 4XRAA 2PBJA 3HY2A 2WULA 3I9V2 4ZILA 3UVTA 3F9UA 1F3AA 1K0MA 4FIWA 3GSTA 2LJKA 2VCWA 2JU5A 3V1WA 4KCAA 2IMFA 3MWHA 1VGLA 5D9WA 3AY8A 3CRUA 3P90A 2AAWA 2C0EA 1TRVA 5D93A 5ECIB 3ZITA 4QQ7A 2I3YA 4OO5A 2IWTA 3HA9A 4TR3A 3DIEA 1SJIA 4TXOB 2PVOC 2AHEA 5J9CA 4XS4B 2E0QA 1NHYA 2A2RA 3APQA 4HU9A 1AAZA 1THXA 1MDKA 1YY7A 3A2WA 1C72A 3RHBA 2YV9A 5GAND 5ECKB 2JL4A 1TP9A 2VLTA 2PVQA 4XS1A 1TW9A 4IQ1A 2WRTA 2KP1A 3VI5A 1U3AA 3H4KA 1PL1A 4MDCA 5H5QA 2YN1A 5ECHB 5EPFA 3TJKA 1TI1A 2M80A 2DMMA 5JWRB 1QK8A 3VLNA 5IOWA 1UN2A 2WGRA 1GUMA 1SK0A 3FK8A 3ZTLA 1ABAA 1R26A 22GSA 2RUEA 4HS1A 5JCGA 3TRXA 6GSYA 2VIMA 2H71A 1GSYA 4XS4A 3EU3A 1TDIA 4YQUA 1JLVA 4NXIA 4N30A 4DSRA 1G7OA 1YF1A 1V58A 3GA4A 4MP4A 1N2AA 2MMNA 4JEDA 2FD3A 1O73A 4GRFA 3SBCA 2RLIA 4NHWA 2REMA 1EOHA 4K7IA 3VWVA 3HJPA 4OFTA 3ZYWA 4HUAA 1AUCA 2NDOA 4KNDA 2P31A 3IPZA 4ULXA 2OADA 3M9KA 3ZLPA 3KD0A 5IMFA 2VAFA 4MCUA 2CV4A 1QGVA 1GTUA 5FHIA 1W89A 1BQ7A 2KOKA 2LQOA 2FHEA 1Y6EA 3M0FA 4NHZA 2ON7A 4PQHA 4GCIA 1G0TA 1Z5YE 3TKPA 4ML6A 4KCEA 3EINA 4JRRA 3UBLA 5D73A 4ACSA 2VLUA 2H75A 1JZOA 2C3QA 2GZYA 1XZOA 2FUG2 4KUNA 2LTKA 1QMVA 2X8HA 4MPFA 4NMUA 1S3CA 3FRCA 1TRSA 2YZUA 3IE3A 3ZVJA 5CO3A 2PERA 3P7XA 5J5NA 1K3YA 3C71A 1XPVA 4CDOA 2OE3A 3KH9A 3KP8A 4F0BA 5FT3A 16GSA 1USBA 2PUKC 5J41A 5KN0A 4GQCA 2K8SA 2DMLA 1G6YA 2IMIA 2I1UA 2YWMA 4DSQA 5A5KA 4HQSA 1WRYA 2QC7A 3CSHA 5F05A 5IPGA 1XWAA 5G5EA 5EL8A 2L59A 1JHBA 1F37A 2H0GA 1BEDA 2DJ1A 1DBYA 3GKMA 14GSA 2F8FA 5IO2A 3IK9A 1PKZA 1Z7PA 5A4WA 5DALB 3L9SA 3O6TA 1NW2A 2F9SA 1AQVA 3TJFA 1B48A 3WT2A 2YP6A 1SK1A 3IRAA 4OFMA 1UC7A 2C4JA 2L4CA 3P2AA 2GT6A 1XWGA 3F6FA 4WBRD 2JZTA 5DAKA 1KBNA 3O76A 1ST9A 3ERFA 2FGXA 3QAWA 1GUKA 2JADA 3CRTA 3QMXA 3C1SA 4JR6A 4Q5FA 4ZL7A 1K0BA 2CA8A 1Z3EA 2CAQA 2OA7A 5DALA 5IMAA 2HSYA 2HYXA 2R6KA 4E8HA 5IQYA 2OE1A 4HDEA 4J2FA 2E2MA 3ZZXA 2X8GA 2E7PA 3ME7A 1Q4JA 1T00A 2PU9C 2YWNA 3FR9A 4XS6A 3LXZA 2ON5A 3LFLA 1B4PA 4ZL8A 2FWHA 3C8EA 3N5OA 5IMZA 3A2XA 1Q98A 4I2UA 1SJZA 2J23A 3L78A 2LNTA 3FZAA 1SL0B 3WT1A 5J3RA 1TTZA 2AB6A 3UVHA 1NSWA 2LRTA 1ERTA 1PQNA 1H75A 1VF4A 3HD5A 1GLPA 1MDIA 2V6KA 3VPTA 4DVCA 4Q5RA 2OJLA 5LNKe 2CAIA 3EVIA 1EV9A 1M0UA 3TKSA 1DUGA 1MD3A 4RQXA 4PQIA 2LUSA 2R3XA 1AW9A 2M72A 5ECSA 4ECIA 1X9SB 4LA1A 1XOAA 2X64A 2VLVA 1PMTA 3GKNA 1FW1A 1OKDA 3QD9A 5CYYA 1GUHA 3EU4A 4TVEA 3FZ5A 2V32A 4IGJA 1YDKA 2B7JA 5ENUA 3L4NA 2VD0A 4IN0A 10GSA 1B9XC 3BBYA 1NM3A 5HQPA 3D6IA 3RHCA 4WF5A 1T4YA 3FYGA 4RQRA 4ZB8A 1TJDA 4G19A 5CREA 2VL2C 4KW6A 4RI6A 3L0HA 2HZEA 1SD8A 2G0FA 4YQVA 4Q5QA 4TKYA 1GWCA 2GZPA 2C0FA 2LKUA 5G5FA 2C1YA 1TRUA 3E3EA 2OACA 2ALBA 4TR4A 1I5GA 3DMLA 3P8WA 2V41A 3TJJA 4KAEA 1PX7A 2QGVA 4FO5A 4MPGA 1GSDA 3F63A 4KDUA 2ZUPA 1AXDA 1R5AA 2LJRA 1K0OA 2NPBA 2XC2A 1PD21 3ED3A 5G30A 3LSZA 2CX4A 4LLRA 5INYA 5ECLB 11GSA 3G7YA 3RPNA 1TU8A 3KEBA 4TR1A 4XRDA 1U87A 5HFIA 3QDNA 3E0UA 1X5CA 2YPMA 5ECRB 5KN3A 2B7KA 3HDCA 1KNGA 1U88A 4GQFA 3W6GA 3GSSA 2YOIA 1GTIA 1XBSA 4EKZA 5HR1A 4WBJA 1F3BA 1JZWA 2DJKA 5B8AA 3DXBA 1T8EB 6GSSA 2PN8A 1GULA 1FO5A 3CSIA 3LXTA 1GLQA 3I6AA 5CAXA 2GDRA 3LWAA 3GTUA 4G10A 3UAPA 2B1LA 1FB6A 2NBSA 3KJYA 1FVKA 3QAGA 4IW9A 4WEYA 3IA1A 3IDVA 2H72A 4BPYA 4YH2A 3KM6A 2BMXA 4MZCA 1V57A 4YQMA 1ZYEA 3IAM2 1HQOA 4GTUA 1TK5B 2H1AA 2P0GA 4JBBA 5J9BA 3TKQA 2KHPA 2NTOA 4V2LA 2GGTA 3J7Yk 3M1GA 5D9VA 1F9MA 2N5BA 4MF6A 1MEKA 3GL5A 1AC1A 2OBKA 1S3DA 1CQGA 3LYPA 9GSSA 2IIYA 2GQLA 3W8SA 4ISDA 4GSTA 4OFNA 3UJ1A 2DJ3A 3MNGA 5G1KA 2OKAA 2G2QA 3Q74A 3HXSA 2IN3A 1F6MC 3C7MA 5B7CA 2GVPA 3D0ZA 1QQ2A 2H19A 4WF4A 2VD1A 5DJLA 1IYIA 5ECPB 1JZDA 3IAS2 3KIJA 2L57A 1A8LA 3EC3A 4TXOA 3VK9A 2CVKA 4J56E 2QKEA 4V2NA 3HVSA 3FR3A 3KMNA 2H6XA 2VM2A 3CYNA 4ML1A 1Z7RA 5DQYA 1GSEA 1ERUA 2YNXA 4P3YB 1SL1B 1S3AA 2XBQA 1OAZA 4HEA2 13GSA 1XIYA 3UIWA 1YJ6A 2H66A 5HFGA 3UL3A 1GTAA 3I69A 1GSQA 3TKRA 1ERWA 2GSQA 1YZXA 3GKXA 4X0XA 1M9BA 5AIXA 1A2LA 1MDJA 3FY7A 4CHSA 5D9TA 1A8YA 3DEXA 5ELGA 3FW2A 3O3TA 4MF5A 3DD3A 3QCPA 4PGTA 3MAKA 4FYUA 2IMKA 3KCMA 6GSVA 3ZL5A 5COHA 1K3LA 4XCSA 4G2EA 4FH8A 1PA3A 4ZB9A 2ZNMA 5EY6A 2HT9A 5H5SA 3D21A 5DBQA 3ZREA 1M2AA 3TJGA 5IMVA 2EIQA 4MJCA 4FYBA 4HJMA 4ECJA 1HNBA 2TRXA 1KEBA 3M8NA 3KTBA 2IPAA 3FKFA 5L71A 3H1NA 3HVVA 4JU5A 5J4UA 2E2GA 2MBTA 3G7JA 2F51A 1SJ6A 1ZMAA 4BVYA 2VCQA 5HR2A 4O7HA 3SWLA 3UBKA 2DLXA 3TDGA 4EE0A 2DBCA 1O85A 2FA8A 3Q6OA 2DIZA 1VF3A 2IL3A 2VCXA 2B1KA 3ZFLA 2CZ3A 2H73A 5KEJA 1VF2A 4K7OA 4MABA 3E9JB 1PRXA 1SD9A 1MTCA 1J0FA 1B9YC 6GSUA 1H4OA 4HZ2A 5G1LA 5F06A 2HRNA 3BJ5A 2GLRA 2FWEA 4MJAA 4N0VA 5ECOB 1TK8B 1O7UA 2LEGA 5GSTA 2O85A 3F3QA 2JZSA 4F9ZA 4G9HA 2PWJA 4JR4A 2X8CA 4KE3A 5ID2B 1GH2A 3ERWA 12GSA 3GNJA 4KX4A 2R4VA 5IIZA 1HD2A 1T3BA 3JCML 2LSTA 1X9MB 1FAAA 5CRGA 1TU7A 4LL4B 4AJ7A 5AGYA 1HYUA 1K0DA 2GQKA 3EWLA 3K8NA 4WXTA 3F8UA 1EV4A 3UARA 5AN1A 2VO4A 4ECCA 4NV2A 3ME8A 3R2QA 3TJBA 4KA0A 2CQ9A 2IMEA 2OE0A 3TKSE 1XFLA 2YV7A 3HZ8A 4CW9A 2H0HA 2B3SA 3L9VA 3GYKA 2L6DA 1OC8A 2O7KA 4BWQA 2F3MA 2OBIA 3IR4A 2C3TA 3L9UA 4EDYA 1QUWA 2CVBA 2L6CA 1EP7A 1JFUA 5C00A 6GSWA 5ECQB 2GSSA 1RK4A 4LMVA 2B5EA 2MYGA 3VWXA 3I43A 2N5FA 1GP1A 2GQMA 1PL2A 7GSSA 1GRXA 2XHFA 4HU7A 2MMAA 5DCGA 1Z6MA 4POKA 5C04A 5HR3A 2LRNA 3KH7A 8GSSA 1K0AA 1UA5A 4MK3A 5KN2A 3NIVA 1SKWB 5IMCA 3RPPA 5CRHA 2HSHA 2WCIA 1BG5A 3EMPA 1OVNA 3Q19A 2AV4A 4IVFA 5GZZB 3D4TA 4IBPA 1A0FA 2J9HA 5CNWA 1OE8A 1XWKA 1GTBA 5ECNB 2NVLA 2H70A 4EO3A 3UEMA 1SENA 5HR0A 2P5RA 2RIIA 3GRXA 1YEXA 2C0GA 4RUVA 3FEUA 4HQZA 3WGDA 1TI3A 1UVZA 4MZBA 4K0NA 2YWIA 3DVWA 4OCEA 3HZ4A 2WZ9A 1SYXA 5IMDA 1XW9A 4OCFA 3HYPA 2I81A 4TR0A 4HI7A 4L8EA 3ZMKA 2DC5A 5LD0A 1OYJA 5B6NA 4POBA 4TN8A 4F2IA 2RUFA 3QOUA 1FOVA 1GSFA 5B6MA 3KXOA 2IJYA 1B4QA 3EYTA 2C8UA 2EIOA 4GF0A 2N5AA 5H5RA 3A5WA 4ID0A 3FZ4A 4ZXGA 3LEFA 1X9WB 4KDXA 1A0RP 2RM5A 4PNFA 1EZKA 2HFDA 2VCVA 3BOAA 3PH9A 5EVOA 1LU4A 1M2DA 4KB3A 4ZL9A 2VL2A 4IHUA 2FCHA 4AF2A 4K9ZA 2JSZA 2CX3A 2HLSA 4TW5A 2DIYA 2ES7A 3PGTA 1LJRA 2YCDA 2R2JA 5DDLA 3UOMA 1CQHA 5FWGA 4F0CA 2RM6A 4TOPA 4MJEA 5ABRA 3HVXA 4EVMA 2O89A 4J57E 1WP0A 1J9BA 2C80A 5G31A 4Z7XA 3VFIA 4EUYA 3MSZA 1M99A 3S9FA 2DJ2A 2H1BA 3C73A 5D9XA 2VUPA 1OC3A 5GSSA 4JZQA 3F0IA 3HJMA 3MDKA 3M9JA 4XTSA 2I9HA 4O92A 4WR5A 2C3NA 2I4AA 1THOA 2VL3A 4TXVA 1R4WA 2V2GA 5LCZA 3QPMA 3TRQA 1SKRB 1M9AA 3QFBC 3ERGA 2HI7A 4EL1A 3J7Yb 3N9JA 4GXZA 2B5XA 4MF7A 4POLA 3HHVA 4IJIA 3G7IA 1VRSD 4F82A 2A2SA 2K8VA 5F07A 3LYKA 3VURA 1OE7A 3CMIA 1ZL9A 1SKSB 4IKHA 3GH9A 3KZQA 1RQMA 2YWOA 2EC4A 5CRDA 1K3OA 2BTOT 2XPEA 3DGQA 3D22A 1TOFA 4RI7A 4QL9A 5G2ZA 1R7HA 5GAPD 5DVBA 1LBKA 3D5JA 3KMOA 5F0GA 2H1DA 2H6ZA 4WETA 3GIXA 1JZRA 2TIRA 3GUSA 1ZYQB 3M3MA 3PR8A 1SU9A 6GSXA 2TRCP 1M2BA 3CSJA 2O8VB 1ZGNA 1MD4A 3DYRA 4E8EA 2JACA 3TB2A 1WJKA 4O5RA 4GSSA 1EGRA 4H86A 4PNGA 3TOTA 1ILOA 2FLSA 2JZRA 4MZWA 5A4UA 1EGOA 4K7NA 3WD6A 3NOFA 6GSTA 1V40A 3CTFA 2WB9A 1TK0B 1PGTA 2KLXA 4FYCA 2EIRA 5CP1A 3F4RA 3TOUA 2KUCA 4I6XA 4BA7A 3F4TA 5B8BA 4PQ1A 2K18A 1DE2A 4KSOA 2LJAA 1G6WA 4NAXA 5DCHA 3GV1A 3F3RA 4XHMA 3CXGA 1A2JA 1AIUA 3ZRDA 5IM9A 4YAVA 1BX9A 3EMXA 1EP8A 4KDYA 4I8BA 3BD2A 5JCWA 2MMZA 3RAZA 3IC4A 2WJUA 4POMA 2WS2A 1ML6A 1QFNA 4AGSA 4PX1A 2K6VA 3HCZA 3IV4A 4NPBA 3DRNA 4PURA 1URMA 2AJQB 3ZIJA 4XIHA 4DSSB 4ZIJA 3ISOA 1WWJA 18GSA 2MZCA 4GLTA 4IJ3A 4IQAA 1SL2B 2ZCTA 1OC9B 4PXOA 5IOXA 4K0GA 3LORA 1V2AA 4Q5NA 1NHOA 3IBHA 4QL7A 4MMMA 1XWCA 4HZ4A 3VI7A 1V98A 1O81A 4AJ6A 3IOSA 4V1Ap 2PPTA 2IMDA 1ZCPA 2CT6A 4BVXA 2FWFA 4DSSA 4V1Ag 3C1RA 1ERVA 3ZIVA 2B5YA 4IP6A 4D73B 2YJ7A 2H8LA 1EEJA 1BAYA 1YKAA 2F8AA 1V9WA 1YKCA 1OC9A 2H0IA 3TRPA 1GL8A 2FWGA 3W8JA 5D96A 2QSIA 3ZVJD 4GWRA 2VL9A 1WOUA 2GSTA 1U3IA 3RDWA 5JWQB 1GSSA 3ZFBA 4BWSA 1WMJA 3ZMLA 2GS3A 2H74A 5DAKB 2M46A 3CTGA 1EEMA 3NZNA 3FHKA 4N11A 1VF1A 1Y25A 2GT5A 1TXXA 3LJRA 3LG6A 2LNSA 3UMAA 2FA4A 1PKWA 1G7EA 4D73A 3H93A 2KP2A 1PX6A 1XW5A 2PGTA 3QFAC 4I97A 2V1MA 3A2VA 1IYHA 3APOA 3BCKA 17GSA 2BJXA 3QAVA 5AISA 20GSA 3GKKA 4F03A 1DSBA 5KN1A 1DE1A 2WFCA 5F8BA 2HZFA 3KP9A 4IELA 1W4VA 4ECBA 1O8XA 2K9FA 1WPIA 3A3TA 5ID2A 3PINA 4L5OA 3IXRA 3VPQA 3LQ7A 2H1GA 2H6YA 3HKRA 3VWWA 4OWYA 1E2YA 2YZHA 2R5GA 2FY6A 4I5QA 1AQWA 3OR5A 1ZZYA 2R37A 5AIVA 4X1UA 1FG4A 4ZB6A 4ZBDA 5D8IA 2HXKA 2P5QA 3GHAA 1GNWA 2MMOA 2LQQA 2VCTA 4OMVA 1PN9A 1XCCA 4OD7A 4ZBAA 1XVWA 3H8QA 4MJBA 4EXJA 2XPDA 4N0ZA 3US3A 2HNLA 3GFKA 4MH2A 3GX8A 1AQXA 5E4WA 4K6XA 4NWYA
chains in the Genus database with same CATH superfamily
2H30A 1XOBA 2UZ8A 2L5OA 3GURA 1F2EA 1Z6NA 1K0NA 3TKSC 1M7TA 1PSQA 2IFQB 3VWUA 5JCUA 1E6BA 4MH3A 2DSAA 2LS5A 2QA1A 1X0RA 3GMFA 4O32A 2MBSA 3QR6A 4LL1B 4WKWA 1FVJA 1N8JA 1QXHA 5KOXA 4YAPA 3F6DA 1JLWA 2CZ2A 1TRWA 1U6TA 2HRFA 3TGZA 4IP1A 2HZEB 1I9DA 1XW6A 4HOJA 2XBIA 4NV5A 3DWVA 4L0WA 2DKHA 1OKTA 1WE0A 4ZBBA 4HJ2A 4MLYA 1BJXA 4L0UA 19GSA 2WDUA 2VCZA 2GTUA 2IFQA 3IK7A 4K8MA 5DJMA 3BCIA 2HSMA 3APSA 1RW1A 3WGXA 1HNCA 2O87A 1A23A 3D4MA 1GSUA 1K0CA 2JSYA 4Z2UA 4KH7A 2L4QA 4KGIA 1ACVA 2DJJA 2HRAA 1A2MA 2LRCA 2Z9SA 4N10A 1XXUA 3Q18A 3G9BA 1J08A 3EURA 2PMTA 3GN3A 4ILFA 4TR1B 1Z9HA 1XWBA 1YEPA 1FB0A 2DJ0A 2VOCA 3IHQA 4IS0A 1KTEA 4WR4A 1X5EA 2V6OA 4OO4A 3U6VA 3H79A 5IO0A 4DEJA 1EWXA 2VM1A 4BL7A 2X99A 1GNEA 3RBTA 5DQSA 3KGKA 2A4HA 2C0DA 3WGEA 3HJOA 1X5DA 3TUEA 1EOGA 2A4VA 3GH6A 1R5PA 4L5LA 1T7PB 2D2ZA 4EF0A 1WIKA 4KSMA 2H01A 1O8WA 4K1FA 1T4ZA 4EC0A 3GTUB 4TRXA 3DKSA 3EE2A 4CY6A 5ECMB 4AJ8A 4JE1A 3GX0A 5A4VA 4EDZA 2AYTA 4GSNA 4LMWA 3CBUA 4MA9A 1ON4A 1YQ1A 4X43A 2CVDA 2GSRA 3F4SA 2GZZA 3FR6A 4V2MA 4PUAA 3GL3A 1A24A 5JWOB 3TCOA 1SYRA 2FNOA 2LV3A 2YJHA 3LGCA 5CRWA 5HFKA 1O6JA 2L5LA 4I2TA 2AUVA 5IPHA 1ZOFA 1SK2A 4K2DA 1BYEA 1TKDB 1B8XA 1XVQA 2YANA 3DVXA 2B6MA 5E59A 3KTLA 4PUFC 2HE3A 5ELAA 1T1VA 1FHEA 1YF0A 3U5RE 1HNAA 3FZ9A 3WYWA 2H76A 4XRAA 4BIKA 2PBJA 3HY2A 2WULA 3I9V2 4ZILA 3UVTA 3F9UA 1F3AA 1K0MA 4FIWA 3GSTA 2LJKA 2VCWA 2JU5A 3V1WA 4KCAA 2IMFA 3MWHA 3LW9A 1VGLA 5D9WA 3AY8A 3IC8A 3CRUA 3P90A 2AAWA 2C0EA 1TRVA 5D93A 5ECIB 3ZITA 4QQ7A 2I3YA 4OO5A 2IWTA 3HA9A 4TR3A 3DIEA 1SJIA 4TXOB 2PVOC 2AHEA 5J9CA 4XS4B 2E0QA 1NHYA 2A2RA 3APQA 4HU9A 1AAZA 1THXA 1MDKA 1YY7A 3A2WA 1C72A 3RHBA 2YV9A 5GAND 5ECKB 2JL4A 1TP9A 2VLTA 2PVQA 4XS1A 1TW9A 4IQ1A 2WRTA 2KP1A 3VI5A 1U3AA 3H4KA 1PL1A 4MDCA 5H5QA 2YN1A 5ECHB 5EPFA 3TJKA 1TI1A 2M80A 2DMMA 5JWRB 1QK8A 3VLNA 5IOWA 1UN2A 2WGRA 1GUMA 1SK0A 3FK8A 3ZTLA 1ABAA 1R26A 22GSA 2RUEA 4HS1A 5JCGA 3TRXA 6GSYA 2VIMA 2H71A 1GSYA 4XS4A 3EU3A 1TDIA 4YQUA 1XG8A 1JLVA 4NXIA 4N30A 4DSRA 1G7OA 1YF1A 1V58A 3GA4A 4MP4A 1N2AA 2MMNA 4JEDA 2FD3A 1O73A 4GRFA 3SBCA 2RLIA 4NHWA 2REMA 1EOHA 4K7IA 3VWVA 3HJPA 3HVNA 4OFTA 3ZYWA 4HUAA 1AUCA 2NDOA 4KNDA 2P31A 3IPZA 4ULXA 2OADA 3M9KA 3ZLPA 3KD0A 5IMFA 2VAFA 4MCUA 2CV4A 1QGVA 1GTUA 4BVYB 5FHIA 1W89A 1BQ7A 2KOKA 2LQOA 2FHEA 1Y6EA 4Z2RA 3M0FA 4NHZA 2ON7A 4PQHA 4GCIA 1G0TA 1Z5YE 3TKPA 4ML6A 4KCEA 3EINA 4JRRA 3UBLA 5D73A 4ACSA 2VLUA 2H75A 1JZOA 2C3QA 2GZYA 1XZOA 2FUG2 4KUNA 2LTKA 1QMVA 2X8HA 4MPFA 4NMUA 1S3CA 3FRCA 1TRSA 2YZUA 3IE3A 3ZVJA 5CO3A 2PERA 3P7XA 5J5NA 1K3YA 3C71A 1XPVA 4CDOA 2OE3A 3KH9A 3KP8A 4F0BA 5FT3A 16GSA 1USBA 2PUKC 5J41A 5KN0A 4GQCA 2K8SA 2DMLA 1G6YA 2IMIA 2I1UA 2YWMA 4DSQA 5A5KA 4HQSA 1WRYA 2QC7A 3CSHA 5F05A 5IPGA 1XWAA 5G5EA 5EL8A 2L59A 1JHBA 1F37A 2X4AA 2H0GA 4USSA 1BEDA 2DJ1A 1DBYA 3GKMA 14GSA 2F8FA 5IO2A 3IK9A 1PKZA 1Z7PA 5A4WA 5DALB 3L9SA 3O6TA 1NW2A 2F9SA 1AQVA 3TJFA 1B48A 3WT2A 2YP6A 1SK1A 3IRAA 4OFMA 1UC7A 2C4JA 2L4CA 3P2AA 2GT6A 1XWGA 3F6FA 4WBRD 2JZTA 5DAKA 4G0IA 1KBNA 3O76A 1ST9A 3ERFA 2FGXA 3QAWA 1GUKA 2JADA 3CRTA 3QMXA 3C1SA 4JR6A 4Q5FA 5BRTA 4ZL7A 1K0BA 2CA8A 1Z3EA 2CAQA 2OA7A 5DALA 5IMAA 2HSYA 2HYXA 2R6KA 4E8HA 1S3RA 5IQYA 2OE1A 4HDEA 4J2FA 2E2MA 3ZZXA 2X8GA 2E7PA 3ME7A 1Q4JA 1T00A 4G0LA 2PU9C 2YWNA 3FR9A 4XS6A 3LXZA 2ON5A 3LFLA 1B4PA 4ZL8A 2FWHA 3C8EA 3N5OA 5IMZA 3A2XA 1Q98A 4I2UA 1SJZA 2J23A 4HSCX 3L78A 2LNTA 3FZAA 1SL0B 3WT1A 5J3RA 1TTZA 2AB6A 3UVHA 1NSWA 2LRTA 1ERTA 1PQNA 1H75A 1VF4A 3HD5A 1GLPA 1MDIA 2V6KA 4O5UA 3VPTA 4DVCA 4Q5RA 2OJLA 5LNKe 2CAIA 3EVIA 4K5SA 1EV9A 1M0UA 3TKSA 1DUGA 1MD3A 4RQXA 4PQIA 2LUSA 4EIPA 2R3XA 1AW9A 2M72A 5ECSA 4ECIA 1X9SB 4LA1A 1XOAA 2X64A 2VLVA 1PMTA 3GKNA 1FW1A 4K5RA 1OKDA 3QD9A 4CY8A 5CYYA 1GUHA 3EU4A 4TVEA 3FZ5A 2V32A 4IGJA 1YDKA 2B7JA 5ENUA 3L4NA 2VD0A 4IN0A 10GSA 1B9XC 3BBYA 1NM3A 5HQPA 3D6IA 3RHCA 4WF5A 1T4YA 3FYGA 4RQRA 4ZB8A 1TJDA 4G19A 5CREA 2VL2C 4KW6A 4RI6A 3L0HA 2HZEA 1FOHA 1SD8A 2G0FA 4YQVA 4Q5QA 4TKYA 1GWCA 2GZPA 2C0FA 2LKUA 5G5FA 2C1YA 4YKFA 1TRUA 3E3EA 2OACA 2ALBA 4TR4A 1I5GA 3DMLA 3P8WA 2V41A 3TJJA 4KAEA 1PX7A 2QGVA 4FO5A 4MPGA 1GSDA 3F63A 4KDUA 2ZUPA 1AXDA 1R5AA 2LJRA 1K0OA 2NPBA 2XC2A 1PD21 3ED3A 5G30A 3LSZA 2CX4A 4LLRA 5INYA 5ECLB 3IHGA 11GSA 3G7YA 3RPNA 1TU8A 3KEBA 4TR1A 4XRDA 1U87A 5HFIA 3QDNA 3E0UA 1X5CA 2YPMA 5ECRB 5KN3A 2B7KA 3HDCA 1KNGA 1U88A 4GQFA 3W6GA 3GSSA 2YOIA 1GTIA 1XBSA 4EKZA 5HR1A 4WBJA 1F3BA 1JZWA 2DJKA 5B8AA 3DXBA 1T8EB 6GSSA 2PN8A 1GULA 1FO5A 3CSIA 3LXTA 4G0KA 1GLQA 3I6AA 5CAXA 2GDRA 3LWAA 2R0GA 3GTUA 4G10A 3UAPA 2B1LA 1FB6A 2NBSA 3KJYA 1FVKA 3QAGA 4IW9A 4WEYA 1PFOA 3IA1A 2QA2A 3IDVA 2H72A 4BPYA 4YH2A 3KM6A 2BMXA 2R0PA 4MZCA 1V57A 4YQMA 1ZYEA 3IAM2 1HQOA 4GTUA 1TK5B 2H1AA 2P0GA 4JBBA 5J9BA 3TKQA 2KHPA 2NTOA 4V2LA 2GGTA 3J7Yk 3M1GA 5D9VA 1F9MA 2N5BA 4MF6A 1MEKA 3GL5A 1AC1A 2OBKA 1S3DA 1CQGA 3LYPA 9GSSA 2IIYA 2GQLA 3W8SA 4ISDA 4GSTA 4OFNA 3UJ1A 2DJ3A 3MNGA 5G1KA 2OKAA 2G2QA 3Q74A 3HXSA 2IN3A 1F6MC 3C7MA 4K2XA 5B7CA 2GVPA 3D0ZA 1QQ2A 2H19A 4WF4A 3MIXA 2VD1A 5DJLA 1IYIA 5ECPB 1JZDA 3IAS2 3KIJA 2L57A 1A8LA 3EC3A 4TXOA 3VK9A 2CVKA 4J56E 2QKEA 4V2NA 3HVSA 3FR3A 3KMNA 2H6XA 2VM2A 3CYNA 4ICYA 4ML1A 1Z7RA 5DQYA 1GSEA 4EIQA 1ERUA 2YNXA 4P3YB 1SL1B 1S3AA 2XBQA 1OAZA 4HEA2 13GSA 1XIYA 3UIWA 1YJ6A 2H66A 5HFGA 3UL3A 1GTAA 3I69A 1GSQA 3TKRA 1ERWA 2GSQA 1YZXA 3GKXA 4X0XA 1M9BA 5AIXA 1A2LA 1MDJA 1ZYPA 3FY7A 4CHSA 5D9TA 1A8YA 3DEXA 5ELGA 3FW2A 3O3TA 4MF5A 3DD3A 3QCPA 4PGTA 3MAKA 4FYUA 2IMKA 3KCMA 6GSVA 3ZL5A 5COHA 4BVXB 1K3LA 4XCSA 4G2EA 4FH8A 1PA3A 4ZB9A 2ZNMA 5EY6A 2HT9A 5H5SA 3D21A 5DBQA 3ZREA 1M2AA 3TJGA 5IMVA 2R0CA 2EIQA 4MJCA 4FYBA 4HJMA 4ECJA 1HNBA 2TRXA 4O5QA 1KEBA 3M8NA 3KTBA 2IPAA 3FKFA 5L71A 3EPTA 3H1NA 3HVVA 4JU5A 5J4UA 2E2GA 2MBTA 3G7JA 2F51A 1SJ6A 1ZMAA 4BVYA 2VCQA 5HR2A 4O7HA 3SWLA 3UBKA 2DLXA 3TDGA 4EE0A 2DBCA 1O85A 2FA8A 3Q6OA 2DIZA 1VF3A 2IL3A 3MYDA 2VCXA 2B1KA 3ZFLA 2CZ3A 2H73A 5KEJA 1VF2A 4Z2TA 4K7OA 4MABA 3E9JB 1PRXA 1SD9A 1MTCA 1J0FA 1B9YC 6GSUA 1H4OA 4HZ2A 5G1LA 5F06A 2HRNA 3BJ5A 2GLRA 2FWEA 4MJAA 4N0VA 5ECOB 1TK8B 1O7UA 2LEGA 5GSTA 2O85A 3F3QA 2JZSA 4F9ZA 4G9HA 2PWJA 4JR4A 2X8CA 4KE3A 5ID2B 1GH2A 3ERWA 12GSA 3GNJA 4KX4A 2R4VA 5IIZA 1HD2A 1T3BA 3JCML 2LSTA 4KF9A 1FAAA 1X9MB 5CRGA 1TU7A 4LL4B 4AJ7A 5AGYA 1HYUA 1K0DA 2GQKA 3EWLA 3K8NA 4WXTA 3F8UA 1EV4A 3UARA 5AN1A 2VO4A 4ECCA 4NV2A 3ME8A 3R2QA 3TJBA 4KA0A 2CQ9A 2IMEA 2OE0A 3TKSE 1XFLA 2YV7A 3HZ8A 4CW9A 2H0HA 2B3SA 3L9VA 3GYKA 2L6DA 1OC8A 2O7KA 4BWQA 2F3MA 2OBIA 3IR4A 2C3TA 3L9UA 4EDYA 1QUWA 2CVBA 2L6CA 1EP7A 1JFUA 5C00A 6GSWA 5ECQB 2GSSA 1RK4A 4LMVA 2B5EA 2MYGA 3VWXA 3I43A 2N5FA 1GP1A 2GQMA 1PL2A 7GSSA 1GRXA 2XHFA 4HU7A 2MMAA 5DCGA 1Z6MA 4YKGA 4POKA 5C04A 5HR3A 2LRNA 3KH7A 8GSSA 1K0AA 1UA5A 4MK3A 5KN2A 3NIVA 1SKWB 5IMCA 3RPPA 5CRHA 2HSHA 2WCIA 1BG5A 3EMPA 1OVNA 3Q19A 2AV4A 4IVFA 5GZZB 3PPUA 3D4TA 4IBPA 1A0FA 2J9HA 5CNWA 1OE8A 1XWKA 1GTBA 5ECNB 2NVLA 2H70A 4EO3A 5KOWA 3UEMA 1SENA 5HR0A 2P5RA 2RIIA 3GRXA 1YEXA 2C0GA 4RUVA 3FEUA 4HQZA 3WGDA 1TI3A 1UVZA 4MZBA 4K0NA 2YWIA 3DVWA 4OCEA 3HZ4A 2WZ9A 1SYXA 5IMDA 1XW9A 4OCFA 3HYPA 2I81A 4TR0A 4HI7A 4L8EA 3ZMKA 2DC5A 5LD0A 1OYJA 5B6NA 4POBA 4TN8A 4F2IA 2RUFA 3QOUA 1FOVA 1GSFA 4BL7B 5B6MA 3KXOA 2IJYA 1B4QA 3EYTA 2C8UA 2EIOA 4GF0A 2N5AA 5H5RA 3A5WA 4ID0A 3FZ4A 4ZXGA 3LEFA 1X9WB 4KDXA 1A0RP 2RM5A 4PNFA 1EZKA 2HFDA 2VCVA 3BOAA 3PH9A 5EVOA 1LU4A 1M2DA 4KB3A 4ZL9A 2VL2A 4IHUA 2FCHA 4AF2A 4K9ZA 2JSZA 2CX3A 2HLSA 4TW5A 2DIYA 2ES7A 3PGTA 1LJRA 2YCDA 2R2JA 5DDLA 3UOMA 1CQHA 5FWGA 4F0CA 2RM6A 4TOPA 4MJEA 5ABRA 3HVXA 4EVMA 2O89A 4J57E 1WP0A 1J9BA 2C80A 5G31A 4Z7XA 3VFIA 4EUYA 3MSZA 1M99A 3S9FA 2DJ2A 2H1BA 3C73A 1M3IA 5D9XA 2VUPA 1OC3A 5GSSA 4JZQA 3F0IA 3HJMA 3MDKA 3M9JA 4XTSA 2I9HA 4O92A 4WR5A 2C3NA 2I4AA 1THOA 2VL3A 4TXVA 2DKIA 4X4JA 1R4WA 2V2GA 5LCZA 3QPMA 3TRQA 1SKRB 1M9AA 3QFBC 3ERGA 2HI7A 2HRKA 4EL1A 3J7Yb 3N9JA 4GXZA 2B5XA 4MF7A 4POLA 3HHVA 4IJIA 3G7IA 1VRSD 4F82A 2A2SA 2K8VA 5F07A 3LYKA 3VURA 1OE7A 3CMIA 1ZL9A 1SKSB 4IKHA 3GH9A 3KZQA 1RQMA 2YWOA 2EC4A 5CRDA 1K3OA 2BTOT 2XPEA 3DGQA 3D22A 1TOFA 4RI7A 4QL9A 5G2ZA 1R7HA 5GAPD 5DVBA 1LBKA 3D5JA 3KMOA 5F0GA 2H1DA 4FQUA 3R3EA 2H6ZA 4WETA 3GIXA 1JZRA 2TIRA 3GUSA 1ZYQB 3M3MA 3PR8A 1SU9A 6GSXA 2TRCP 1M2BA 3CSJA 2O8VB 1ZGNA 1MD4A 3DYRA 4E8EA 2JACA 3TB2A 1WJKA 4O5RA 4GSSA 1EGRA 4H86A 4PNGA 3TOTA 1ILOA 2FLSA 2JZRA 3FMWA 4MZWA 5A4UA 1EGOA 4K7NA 3WD6A 3NOFA 6GSTA 1V40A 3CTFA 2WB9A 1TK0B 1PGTA 2KLXA 4A5PA 4FYCA 2EIRA 5CP1A 3F4RA 3TOUA 2KUCA 4I6XA 4BA7A 3F4TA 5B8BA 4PQ1A 2K18A 1DE2A 4KSOA 2LJAA 1G6WA 4NAXA 5DCHA 3GV1A 3F3RA 5BMUA 4XHMA 3CXGA 1A2JA 1AIUA 3ZRDA 5IM9A 4YAVA 1BX9A 3EMXA 1EP8A 4KDYA 4I8BA 3BD2A 5JCWA 2MMZA 3RAZA 3IC4A 2WJUA 4POMA 2WS2A 1ML6A 1QFNA 4AGSA 4PX1A 2K6VA 2A2PA 3HCZA 3IV4A 4NPBA 3DRNA 4PURA 1PN0A 1URMA 2AJQB 1M3JA 3ZIJA 4XIHA 4DSSB 4ZIJA 3ISOA 1WWJA 18GSA 2MZCA 4GLTA 4IJ3A 4IQAA 1SL2B 2ZCTA 1OC9B 4PXOA 5IOXA 4K0GA 3LORA 1V2AA 4Q5NA 1NHOA 3IBHA 4QL7A 4MMMA 1XWCA 4HZ4A 4MNNA 3VI7A 1V98A 1O81A 4AJ6A 3IOSA 4V1Ap 2PPTA 2IMDA 1ZCPA 2CT6A 4BVXA 2FWFA 2X49A 4DSSA 4V1Ag 3C1RA 1ERVA 3ZIVA 4PTSA 2B5YA 4IP6A 4D73B 2YJ7A 2H8LA 1ZYNA 1EEJA 1BAYA 1YKAA 2F8AA 1V9WA 1YKCA 1OC9A 2H0IA 3CQFA 3TRPA 1GL8A 2FWGA 3W8JA 5D96A 2QSIA 3ZVJD 4GWRA 2VL9A 1WOUA 2GSTA 1U3IA 3RDWA 5JWQB 1GSSA 3ZFBA 4BWSA 1WMJA 3ZMLA 2GS3A 2H74A 5DAKB 2M46A 3CTGA 1EEMA 3NZNA 3FHKA 4N11A 1VF1A 1Y25A 2GT5A 1TXXA 3LJRA 3LG6A 2LNSA 3UMAA 2FA4A 1PKWA 1G7EA 4D73A 3H93A 2KP2A 1PX6A 1XW5A 2PGTA 3QFAC 4I97A 2V1MA 3A2VA 3A5IA 1IYHA 3APOA 3BCKA 17GSA 2BJXA 3QAVA 5AISA 20GSA 3GKKA 4F03A 1DSBA 5KN1A 1DE1A 2WFCA 5F8BA 2HZFA 3KP9A 4IELA 1W4VA 4ECBA 1O8XA 2K9FA 1WPIA 3A3TA 5ID2A 3PINA 4L5OA 3IXRA 3VPQA 3LQ7A 2H1GA 2H6YA 3HKRA 3VWWA 4OWYA 1E2YA 2YZHA 2R5GA 2FY6A 4I5QA 1AQWA 3OR5A 1ZZYA 2R37A 5AIVA 4X1UA 1FG4A 4ZB6A 4ZBDA 5D8IA 2HXKA 2P5QA 3GHAA 1GNWA 2MMOA 2LQQA 2VCTA 4OMVA 1PN9A 1XCCA 4OD7A 4ZBAA 1XVWA 3H8QA 4MJBA 4EXJA 2XPDA 4N0ZA 3US3A 2HNLA 3GFKA 4MH2A 3GX8A 1AQXA 5E4WA 4K6XA 4NWYA
chains in the Genus database with same CATH topology
2H30A 1XOBA 2UZ8A 2L5OA 3GURA 1F2EA 1Z6NA 1K0NA 3TKSC 1M7TA 1PSQA 2IFQB 3VWUA 5JCUA 1E6BA 4MH3A 2DSAA 2LS5A 2QA1A 1X0RA 3GMFA 4O32A 2MBSA 3QR6A 4LL1B 4WKWA 1FVJA 1N8JA 1QXHA 5KOXA 4YAPA 3F6DA 1JLWA 2CZ2A 1TRWA 1U6TA 2HRFA 3TGZA 4IP1A 2HZEB 1I9DA 1XW6A 4HOJA 2XBIA 4NV5A 3DWVA 4L0WA 2DKHA 1OKTA 1WE0A 4ZBBA 4HJ2A 4MLYA 1BJXA 4L0UA 19GSA 2WDUA 2VCZA 2GTUA 2IFQA 3IK7A 4K8MA 5DJMA 3BCIA 2HSMA 3APSA 1RW1A 3WGXA 1HNCA 2O87A 1A23A 3D4MA 1GSUA 1K0CA 2JSYA 4Z2UA 4KH7A 2L4QA 4KGIA 1ACVA 2DJJA 2HRAA 1A2MA 2LRCA 2Z9SA 4N10A 1XXUA 3Q18A 3G9BA 1J08A 3EURA 2PMTA 3GN3A 4ILFA 4TR1B 1Z9HA 1XWBA 1YEPA 1FB0A 2DJ0A 2VOCA 3IHQA 4IS0A 1KTEA 4WR4A 1X5EA 2V6OA 4OO4A 3U6VA 3H79A 5IO0A 4DEJA 1EWXA 2VM1A 4BL7A 2X99A 1GNEA 3RBTA 5DQSA 3KGKA 2A4HA 2C0DA 3WGEA 3HJOA 1X5DA 3TUEA 1EOGA 2A4VA 3GH6A 1R5PA 4L5LA 1T7PB 2D2ZA 4EF0A 1WIKA 4KSMA 2H01A 1O8WA 4K1FA 1T4ZA 4EC0A 3GTUB 4TRXA 3DKSA 3EE2A 4CY6A 5ECMB 4AJ8A 4JE1A 3GX0A 5A4VA 4EDZA 2AYTA 4GSNA 4LMWA 3CBUA 4MA9A 1ON4A 1YQ1A 4X43A 2CVDA 2GSRA 3F4SA 2GZZA 3FR6A 4V2MA 4PUAA 3GL3A 1A24A 5JWOB 3TCOA 1SYRA 2FNOA 2LV3A 2YJHA 3LGCA 5CRWA 5HFKA 1O6JA 2L5LA 4I2TA 2AUVA 5IPHA 1ZOFA 1SK2A 4K2DA 1BYEA 1TKDB 1B8XA 1XVQA 2YANA 3DVXA 2B6MA 5E59A 3KTLA 4PUFC 2HE3A 5ELAA 1T1VA 1FHEA 1YF0A 3U5RE 1HNAA 3FZ9A 3WYWA 2H76A 4XRAA 2PBJA 3HY2A 2WULA 3I9V2 4ZILA 3UVTA 3F9UA 1F3AA 1K0MA 4FIWA 3GSTA 2LJKA 2VCWA 2JU5A 3V1WA 4KCAA 2IMFA 3MWHA 3LW9A 1VGLA 5D9WA 3AY8A 3IC8A 3CRUA 3P90A 2AAWA 2C0EA 1TRVA 5D93A 5ECIB 3ZITA 4QQ7A 2I3YA 4OO5A 2IWTA 3HA9A 4TR3A 3DIEA 1SJIA 4TXOB 2PVOC 2AHEA 5J9CA 4XS4B 2E0QA 1NHYA 2A2RA 3APQA 4HU9A 1AAZA 1THXA 1MDKA 1YY7A 3A2WA 1C72A 3RHBA 2YV9A 5GAND 5ECKB 2JL4A 1TP9A 2VLTA 2PVQA 4XS1A 1TW9A 4IQ1A 2WRTA 2KP1A 3VI5A 1U3AA 3H4KA 1PL1A 4MDCA 5H5QA 2YN1A 5ECHB 5EPFA 3TJKA 1TI1A 2M80A 2DMMA 5JWRB 1QK8A 3VLNA 5IOWA 1UN2A 2WGRA 1GUMA 1SK0A 3FK8A 3ZTLA 1ABAA 1R26A 22GSA 2RUEA 4HS1A 5JCGA 3TRXA 6GSYA 2VIMA 2H71A 1GSYA 4XS4A 3EU3A 1TDIA 4YQUA 1JLVA 4NXIA 4N30A 4DSRA 1G7OA 1YF1A 1V58A 3GA4A 4MP4A 1N2AA 2MMNA 4JEDA 2FD3A 1O73A 4GRFA 3SBCA 2RLIA 4NHWA 2REMA 1EOHA 4K7IA 3VWVA 3HJPA 4OFTA 3ZYWA 4HUAA 1AUCA 2NDOA 4KNDA 2P31A 3IPZA 4ULXA 2OADA 3M9KA 3ZLPA 3KD0A 5IMFA 2VAFA 4MCUA 2CV4A 1QGVA 1GTUA 4BVYB 5FHIA 1W89A 1BQ7A 2KOKA 2LQOA 2FHEA 1Y6EA 4Z2RA 3M0FA 4NHZA 2ON7A 4PQHA 4GCIA 1G0TA 1Z5YE 3TKPA 4ML6A 4KCEA 3EINA 4JRRA 3UBLA 5D73A 4ACSA 2VLUA 2H75A 1JZOA 2C3QA 2GZYA 1XZOA 2FUG2 4KUNA 2LTKA 1QMVA 2X8HA 4MPFA 4NMUA 1S3CA 3FRCA 1TRSA 2YZUA 3IE3A 3ZVJA 5CO3A 2PERA 3P7XA 5J5NA 1K3YA 3C71A 1XPVA 4CDOA 2OE3A 3KH9A 3KP8A 4F0BA 5FT3A 16GSA 1USBA 2PUKC 5J41A 5KN0A 4GQCA 2K8SA 2DMLA 1G6YA 2IMIA 2I1UA 2YWMA 4DSQA 5A5KA 4HQSA 1WRYA 2QC7A 3CSHA 5F05A 5IPGA 1XWAA 5G5EA 5EL8A 2L59A 1JHBA 1F37A 2X4AA 2H0GA 4USSA 1BEDA 2DJ1A 1DBYA 3GKMA 14GSA 2F8FA 5IO2A 3IK9A 1PKZA 1Z7PA 5A4WA 5DALB 3L9SA 3O6TA 1NW2A 2F9SA 1AQVA 3TJFA 1B48A 3WT2A 2YP6A 1SK1A 3IRAA 4OFMA 1UC7A 2C4JA 2L4CA 3P2AA 2GT6A 1XWGA 3F6FA 4WBRD 2JZTA 5DAKA 4G0IA 1KBNA 3O76A 1ST9A 3ERFA 2FGXA 3QAWA 1GUKA 2JADA 3CRTA 3QMXA 3C1SA 4JR6A 4Q5FA 5BRTA 4ZL7A 1K0BA 2CA8A 1Z3EA 2CAQA 2OA7A 5DALA 5IMAA 2HSYA 2HYXA 2R6KA 4E8HA 5IQYA 2OE1A 4HDEA 4J2FA 2E2MA 3ZZXA 2X8GA 2E7PA 3ME7A 1Q4JA 1T00A 4G0LA 2PU9C 2YWNA 3FR9A 4XS6A 3LXZA 2ON5A 3LFLA 1B4PA 4ZL8A 2FWHA 3C8EA 3N5OA 5IMZA 3A2XA 1Q98A 4I2UA 1SJZA 2J23A 3L78A 2LNTA 3FZAA 1SL0B 3WT1A 5J3RA 1TTZA 2AB6A 3UVHA 1NSWA 2LRTA 1ERTA 1PQNA 1H75A 1VF4A 3HD5A 1GLPA 1MDIA 2V6KA 4O5UA 3VPTA 4DVCA 4Q5RA 2OJLA 5LNKe 2CAIA 3EVIA 4K5SA 1EV9A 1M0UA 3TKSA 1DUGA 1MD3A 4RQXA 4PQIA 2LUSA 4EIPA 2R3XA 1AW9A 2M72A 5ECSA 4ECIA 1X9SB 4LA1A 1XOAA 2X64A 2VLVA 1PMTA 3GKNA 1FW1A 4K5RA 1OKDA 3QD9A 4CY8A 5CYYA 1GUHA 3EU4A 4TVEA 3FZ5A 2V32A 4IGJA 1YDKA 2B7JA 5ENUA 3L4NA 2VD0A 4IN0A 10GSA 1B9XC 3BBYA 1NM3A 5HQPA 3D6IA 3RHCA 4WF5A 1T4YA 3FYGA 4RQRA 4ZB8A 1TJDA 4G19A 5CREA 2VL2C 4KW6A 4RI6A 3L0HA 2HZEA 1FOHA 1SD8A 2G0FA 4YQVA 4Q5QA 4TKYA 1GWCA 2GZPA 2C0FA 2LKUA 5G5FA 2C1YA 4YKFA 1TRUA 3E3EA 2OACA 2ALBA 4TR4A 1I5GA 3DMLA 3P8WA 2V41A 3TJJA 4KAEA 1PX7A 2QGVA 4FO5A 4MPGA 1GSDA 3F63A 4KDUA 2ZUPA 1AXDA 1R5AA 2LJRA 1K0OA 2NPBA 2XC2A 1PD21 3ED3A 5G30A 3LSZA 2CX4A 4LLRA 5INYA 5ECLB 3IHGA 11GSA 3G7YA 3RPNA 1TU8A 3KEBA 4TR1A 4XRDA 1U87A 5HFIA 3QDNA 3E0UA 1X5CA 2YPMA 5ECRB 5KN3A 2B7KA 3HDCA 1KNGA 1U88A 4GQFA 3W6GA 3GSSA 2YOIA 1GTIA 1XBSA 4EKZA 5HR1A 4WBJA 1F3BA 1JZWA 2DJKA 5B8AA 3DXBA 1T8EB 6GSSA 2PN8A 1GULA 1FO5A 3CSIA 3LXTA 4G0KA 1GLQA 3I6AA 5CAXA 2GDRA 3LWAA 2R0GA 3GTUA 4G10A 3UAPA 2B1LA 1FB6A 2NBSA 3KJYA 1FVKA 3QAGA 4IW9A 4WEYA 3IA1A 2QA2A 3IDVA 2H72A 4BPYA 4YH2A 3KM6A 2BMXA 2R0PA 4MZCA 1V57A 4YQMA 1ZYEA 3IAM2 1HQOA 4GTUA 1TK5B 2H1AA 2P0GA 4JBBA 5J9BA 3TKQA 2KHPA 2NTOA 4V2LA 2GGTA 3J7Yk 3M1GA 5D9VA 1F9MA 2N5BA 4MF6A 1MEKA 3GL5A 1AC1A 2OBKA 1S3DA 1CQGA 3LYPA 9GSSA 2IIYA 2GQLA 3W8SA 4ISDA 4GSTA 4OFNA 3UJ1A 2DJ3A 3MNGA 5G1KA 2OKAA 2G2QA 3Q74A 3HXSA 2IN3A 1F6MC 3C7MA 4K2XA 5B7CA 2GVPA 3D0ZA 1QQ2A 2H19A 4WF4A 3MIXA 2VD1A 5DJLA 1IYIA 5ECPB 1JZDA 3IAS2 3KIJA 2L57A 1A8LA 3EC3A 4TXOA 3VK9A 2CVKA 4J56E 2QKEA 4V2NA 3HVSA 3FR3A 3KMNA 2H6XA 2VM2A 3CYNA 4ICYA 4ML1A 1Z7RA 5DQYA 1GSEA 4EIQA 1ERUA 2YNXA 4P3YB 1SL1B 1S3AA 2XBQA 1OAZA 4HEA2 13GSA 1XIYA 3UIWA 1YJ6A 2H66A 5HFGA 3UL3A 1GTAA 3I69A 1GSQA 3TKRA 1ERWA 2GSQA 1YZXA 3GKXA 4X0XA 1M9BA 5AIXA 1A2LA 1MDJA 1ZYPA 3FY7A 4CHSA 5D9TA 1A8YA 3DEXA 5ELGA 3FW2A 3O3TA 4MF5A 3DD3A 3QCPA 4PGTA 3MAKA 4FYUA 2IMKA 3KCMA 6GSVA 3ZL5A 5COHA 4BVXB 1K3LA 4XCSA 4G2EA 4FH8A 1PA3A 4ZB9A 2ZNMA 5EY6A 2HT9A 5H5SA 3D21A 5DBQA 3ZREA 1M2AA 3TJGA 5IMVA 2R0CA 2EIQA 4MJCA 4FYBA 4HJMA 4ECJA 1HNBA 2TRXA 4O5QA 1KEBA 3M8NA 3KTBA 2IPAA 3FKFA 5L71A 3EPTA 3H1NA 3HVVA 4JU5A 5J4UA 2E2GA 2MBTA 3G7JA 2F51A 1SJ6A 1ZMAA 4BVYA 2VCQA 5HR2A 4O7HA 3SWLA 3UBKA 2DLXA 3TDGA 4EE0A 2DBCA 1O85A 2FA8A 3Q6OA 2DIZA 1VF3A 2IL3A 3MYDA 2VCXA 2B1KA 3ZFLA 2CZ3A 2H73A 5KEJA 1VF2A 4Z2TA 4K7OA 4MABA 3E9JB 1PRXA 1SD9A 1MTCA 1J0FA 1B9YC 6GSUA 1H4OA 4HZ2A 5G1LA 5F06A 2HRNA 3BJ5A 2GLRA 2FWEA 4MJAA 4N0VA 5ECOB 1TK8B 1O7UA 2LEGA 5GSTA 2O85A 3F3QA 2JZSA 4F9ZA 4G9HA 2PWJA 4JR4A 2X8CA 4KE3A 5ID2B 1GH2A 3ERWA 12GSA 3GNJA 4KX4A 2R4VA 5IIZA 1HD2A 1T3BA 3JCML 2LSTA 4KF9A 1FAAA 1X9MB 5CRGA 1TU7A 4LL4B 4AJ7A 5AGYA 1HYUA 1K0DA 2GQKA 3EWLA 3K8NA 4WXTA 3F8UA 1EV4A 3UARA 5AN1A 2VO4A 4ECCA 4NV2A 3ME8A 3R2QA 3TJBA 4KA0A 2CQ9A 2IMEA 2OE0A 3TKSE 1XFLA 2YV7A 3HZ8A 4CW9A 2H0HA 2B3SA 3L9VA 3GYKA 2L6DA 1OC8A 2O7KA 4BWQA 2F3MA 2OBIA 3IR4A 2C3TA 3L9UA 4EDYA 1QUWA 2CVBA 2L6CA 1EP7A 1JFUA 5C00A 6GSWA 5ECQB 2GSSA 1RK4A 4LMVA 2B5EA 2MYGA 3VWXA 3I43A 2N5FA 1GP1A 2GQMA 1PL2A 7GSSA 1GRXA 2XHFA 4HU7A 2MMAA 5DCGA 1Z6MA 4YKGA 4POKA 5C04A 5HR3A 2LRNA 3KH7A 8GSSA 1K0AA 1UA5A 4MK3A 5KN2A 3NIVA 1SKWB 5IMCA 3RPPA 5CRHA 2HSHA 2WCIA 1BG5A 3EMPA 1OVNA 3Q19A 2AV4A 4IVFA 5GZZB 3PPUA 3D4TA 4IBPA 1A0FA 2J9HA 5CNWA 1OE8A 1XWKA 1GTBA 5ECNB 2NVLA 2H70A 4EO3A 5KOWA 3UEMA 1SENA 5HR0A 2P5RA 2RIIA 3GRXA 1YEXA 2C0GA 4RUVA 3FEUA 4HQZA 3WGDA 1TI3A 1UVZA 4MZBA 4K0NA 2YWIA 3DVWA 4OCEA 3HZ4A 2WZ9A 1SYXA 5IMDA 1XW9A 4OCFA 3HYPA 2I81A 4TR0A 4HI7A 4L8EA 3ZMKA 2DC5A 5LD0A 1OYJA 5B6NA 4POBA 4TN8A 4F2IA 2RUFA 3QOUA 1FOVA 1GSFA 4BL7B 5B6MA 3KXOA 2IJYA 1B4QA 3EYTA 2C8UA 2EIOA 4GF0A 2N5AA 5H5RA 3A5WA 4ID0A 3FZ4A 4ZXGA 3LEFA 1X9WB 4KDXA 1A0RP 2RM5A 4PNFA 1EZKA 2HFDA 2VCVA 3BOAA 3PH9A 5EVOA 1LU4A 1M2DA 4KB3A 4ZL9A 2VL2A 4IHUA 2FCHA 4AF2A 4K9ZA 2JSZA 2CX3A 2HLSA 4TW5A 2DIYA 2ES7A 3PGTA 1LJRA 2YCDA 2R2JA 5DDLA 3UOMA 1CQHA 5FWGA 4F0CA 2RM6A 4TOPA 4MJEA 5ABRA 3HVXA 4EVMA 2O89A 4J57E 1WP0A 1J9BA 2C80A 5G31A 4Z7XA 3VFIA 4EUYA 3MSZA 1M99A 3S9FA 2DJ2A 2H1BA 3C73A 5D9XA 2VUPA 1OC3A 5GSSA 4JZQA 3F0IA 3HJMA 3MDKA 3M9JA 4XTSA 2I9HA 4O92A 4WR5A 2C3NA 2I4AA 1THOA 2VL3A 4TXVA 2DKIA 4X4JA 1R4WA 2V2GA 5LCZA 3QPMA 3TRQA 1SKRB 1M9AA 3QFBC 3ERGA 2HI7A 2HRKA 4EL1A 3J7Yb 3N9JA 4GXZA 2B5XA 4MF7A 4POLA 3HHVA 4IJIA 3G7IA 1VRSD 4F82A 2A2SA 2K8VA 5F07A 3LYKA 3VURA 1OE7A 3CMIA 1ZL9A 1SKSB 4IKHA 3GH9A 3KZQA 1RQMA 2YWOA 2EC4A 5CRDA 1K3OA 2BTOT 2XPEA 3DGQA 3D22A 1TOFA 4RI7A 4QL9A 5G2ZA 1R7HA 5GAPD 5DVBA 1LBKA 3D5JA 3KMOA 5F0GA 2H1DA 4FQUA 3R3EA 2H6ZA 4WETA 3GIXA 1JZRA 2TIRA 3GUSA 1ZYQB 3M3MA 3PR8A 1SU9A 6GSXA 2TRCP 1M2BA 3CSJA 2O8VB 1ZGNA 1MD4A 3DYRA 4E8EA 2JACA 3TB2A 1WJKA 4O5RA 4GSSA 1EGRA 4H86A 4PNGA 3TOTA 1ILOA 2FLSA 2JZRA 3FMWA 4MZWA 5A4UA 1EGOA 4K7NA 3WD6A 3NOFA 6GSTA 1V40A 3CTFA 2WB9A 1TK0B 1PGTA 2KLXA 4A5PA 4FYCA 2EIRA 5CP1A 3F4RA 3TOUA 2KUCA 4I6XA 4BA7A 3F4TA 5B8BA 4PQ1A 2K18A 1DE2A 4KSOA 2LJAA 1G6WA 4NAXA 5DCHA 3GV1A 3F3RA 5BMUA 4XHMA 3CXGA 1A2JA 1AIUA 3ZRDA 5IM9A 4YAVA 1BX9A 3EMXA 1EP8A 4KDYA 4I8BA 3BD2A 5JCWA 2MMZA 3RAZA 3IC4A 2WJUA 4POMA 2WS2A 1ML6A 1QFNA 4AGSA 4PX1A 2K6VA 2A2PA 3HCZA 3IV4A 4NPBA 3DRNA 4PURA 1PN0A 1URMA 2AJQB 3ZIJA 4XIHA 4DSSB 4ZIJA 3ISOA 1WWJA 18GSA 2MZCA 4GLTA 4IJ3A 4IQAA 1SL2B 2ZCTA 1OC9B 4PXOA 5IOXA 4K0GA 3LORA 1V2AA 4Q5NA 1NHOA 3IBHA 4QL7A 4MMMA 1XWCA 4HZ4A 4MNNA 3VI7A 1V98A 1O81A 4AJ6A 3IOSA 4V1Ap 2PPTA 2IMDA 1ZCPA 2CT6A 4BVXA 2FWFA 2X49A 4DSSA 4V1Ag 3C1RA 1ERVA 3ZIVA 4PTSA 2B5YA 4IP6A 4D73B 2YJ7A 2H8LA 1ZYNA 1EEJA 1BAYA 1YKAA 2F8AA 1V9WA 1YKCA 1OC9A 2H0IA 3TRPA 1GL8A 2FWGA 3W8JA 5D96A 2QSIA 3ZVJD 4GWRA 2VL9A 1WOUA 2GSTA 1U3IA 3RDWA 5JWQB 1GSSA 3ZFBA 4BWSA 1WMJA 3ZMLA 2GS3A 2H74A 5DAKB 2M46A 3CTGA 1EEMA 3NZNA 3FHKA 4N11A 1VF1A 1Y25A 2GT5A 1TXXA 3LJRA 3LG6A 2LNSA 3UMAA 2FA4A 1PKWA 1G7EA 4D73A 3H93A 2KP2A 1PX6A 1XW5A 2PGTA 3QFAC 4I97A 2V1MA 3A2VA 3A5IA 1IYHA 3APOA 3BCKA 17GSA 2BJXA 3QAVA 5AISA 20GSA 3GKKA 4F03A 1DSBA 5KN1A 1DE1A 2WFCA 5F8BA 2HZFA 3KP9A 4IELA 1W4VA 4ECBA 1O8XA 2K9FA 1WPIA 3A3TA 5ID2A 3PINA 4L5OA 3IXRA 3VPQA 3LQ7A 2H1GA 2H6YA 3HKRA 3VWWA 4OWYA 1E2YA 2YZHA 2R5GA 2FY6A 4I5QA 1AQWA 3OR5A 1ZZYA 2R37A 5AIVA 4X1UA 1FG4A 4ZB6A 4ZBDA 5D8IA 2HXKA 2P5QA 3GHAA 1GNWA 2MMOA 2LQQA 2VCTA 4OMVA 1PN9A 1XCCA 4OD7A 4ZBAA 1XVWA 3H8QA 4MJBA 4EXJA 2XPDA 4N0ZA 3US3A 2HNLA 3GFKA 4MH2A 3GX8A 1AQXA 5E4WA 4K6XA 4NWYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H30 A;  1XOB A;  2L5O A;  3GUR A;  1F2E A;  1Z6N A;  1K0N A;  3TKS C;  1M7T A;  1PSQ A;  2IFQ B;  3VWU A;  5JCU A;  1E6B A;  4MH3 A;  2DSA A;  2LS5 A;  1X0R A;  3GMF A;  4O32 A;  2MBS A;  3QR6 A;  4LL1 B;  4WKW A;  1FVJ A;  1N8J A;  1QXH A;  4YAP A;  3F6D A;  1JLW A;  2CZ2 A;  1TRW A;  1U6T A;  2HRF A;  3TGZ A;  4IP1 A;  2HZE B;  1I9D A;  1XW6 A;  4HOJ A;  2XBI A;  4NV5 A;  3DWV A;  4L0W A;  1OKT A;  1WE0 A;  4ZBB A;  4HJ2 A;  4MLY A;  1BJX A;  4L0U A;  19GS A;  2WDU A;  2VCZ A;  2GTU A;  2IFQ A;  3IK7 A;  4K8M A;  5DJM A;  3BCI A;  3APS A;  1RW1 A;  3WGX A;  1HNC A;  2O87 A;  1A23 A;  3D4M A;  1GSU A;  1K0C A;  2JSY A;  4KH7 A;  2L4Q A;  4KGI A;  1ACV A;  2DJJ A;  1A2M A;  2LRC A;  2Z9S A;  4N10 A;  1XXU A;  3Q18 A;  3G9B A;  1J08 A;  3EUR A;  2PMT A;  3GN3 A;  4ILF A;  4TR1 B;  1Z9H A;  1XWB A;  1YEP A;  1FB0 A;  2DJ0 A;  2VOC A;  3IHQ A;  4IS0 A;  1KTE A;  4WR4 A;  1X5E A;  2V6O A;  4OO4 A;  3U6V A;  3H79 A;  5IO0 A;  4DEJ A;  1EWX A;  2VM1 A;  4BL7 A;  2X99 A;  1GNE A;  3RBT A;  5DQS A;  3KGK A;  2C0D A;  3WGE A;  3HJO A;  1X5D A;  3TUE A;  1EOG A;  2A4V A;  3GH6 A;  1R5P A;  4L5L A;  1T7P B;  2D2Z A;  4EF0 A;  1WIK A;  4KSM A;  2H01 A;  1O8W A;  4K1F A;  1T4Z A;  4EC0 A;  3GTU B;  4TRX A;  3DKS A;  3EE2 A;  5ECM B;  4AJ8 A;  4JE1 A;  3GX0 A;  5A4V A;  4EDZ A;  2AYT A;  4GSN A;  4LMW A;  3CBU A;  4MA9 A;  1ON4 A;  1YQ1 A;  4X43 A;  2CVD A;  2GSR A;  3F4S A;  2GZZ A;  3FR6 A;  4V2M A;  4PUA A;  3GL3 A;  1A24 A;  5JWO B;  3TCO A;  1SYR A;  2FNO A;  2LV3 A;  2YJH A;  3LGC A;  5CRW A;  5HFK A;  1O6J A;  2L5L A;  4I2T A;  2AUV A;  5IPH A;  1ZOF A;  1SK2 A;  4K2D A;  1BYE A;  1TKD B;  1B8X A;  1XVQ A;  2YAN A;  3DVX A;  2B6M A;  5E59 A;  3KTL A;  4PUF C;  2HE3 A;  5ELA A;  1T1V A;  1FHE A;  1YF0 A;  3U5R E;  1HNA A;  3FZ9 A;  3WYW A;  2H76 A;  4XRA A;  2PBJ A;  3HY2 A;  2WUL A;  3I9V 2;  4ZIL A;  3UVT A;  3F9U A;  1F3A A;  1K0M A;  4FIW A;  3GST A;  2LJK A;  2VCW A;  2JU5 A;  3V1W A;  4KCA A;  2IMF A;  3MWH A;  1VGL A;  5D9W A;  3AY8 A;  3CRU A;  3P90 A;  2AAW A;  2C0E A;  1TRV A;  5D93 A;  5ECI B;  3ZIT A;  4QQ7 A;  2I3Y A;  4OO5 A;  2IWT A;  3HA9 A;  4TR3 A;  3DIE A;  1SJI A;  4TXO B;  2PVO C;  2AHE A;  5J9C A;  4XS4 B;  2E0Q A;  1NHY A;  2A2R A;  3APQ A;  4HU9 A;  1AAZ A;  1THX A;  1MDK A;  1YY7 A;  3A2W A;  1C72 A;  3RHB A;  2YV9 A;  5GAN D;  5ECK B;  2JL4 A;  1TP9 A;  2VLT A;  2PVQ A;  4XS1 A;  1TW9 A;  4IQ1 A;  2WRT A;  2KP1 A;  3VI5 A;  1U3A A;  3H4K A;  1PL1 A;  4MDC A;  5H5Q A;  2YN1 A;  5ECH B;  5EPF A;  3TJK A;  1TI1 A;  2M80 A;  2DMM A;  5JWR B;  1QK8 A;  3VLN A;  5IOW A;  1UN2 A;  2WGR A;  1GUM A;  1SK0 A;  3FK8 A;  3ZTL A;  1ABA A;  1R26 A;  22GS A;  2RUE A;  4HS1 A;  5JCG A;  3TRX A;  6GSY A;  2VIM A;  2H71 A;  1GSY A;  4XS4 A;  3EU3 A;  1TDI A;  4YQU A;  1JLV A;  4NXI A;  4N30 A;  4DSR A;  1G7O A;  1YF1 A;  1V58 A;  3GA4 A;  4MP4 A;  1N2A A;  2MMN A;  4JED A;  2FD3 A;  1O73 A;  4GRF A;  3SBC A;  2RLI A;  4NHW A;  2REM A;  1EOH A;  4K7I A;  3VWV A;  3HJP A;  4OFT A;  3ZYW A;  4HUA A;  1AUC A;  2NDO A;  4KND A;  2P31 A;  3IPZ A;  4ULX A;  2OAD A;  3M9K A;  3ZLP A;  3KD0 A;  5IMF A;  2VAF A;  4MCU A;  2CV4 A;  1QGV A;  1GTU A;  5FHI A;  1W89 A;  1BQ7 A;  2KOK A;  2LQO A;  2FHE A;  1Y6E A;  3M0F A;  4NHZ A;  2ON7 A;  4PQH A;  4GCI A;  1G0T A;  1Z5Y E;  3TKP A;  4ML6 A;  4KCE A;  3EIN A;  4JRR A;  3UBL A;  5D73 A;  4ACS A;  2VLU A;  2H75 A;  1JZO A;  2C3Q A;  2GZY A;  1XZO A;  2FUG 2;  4KUN A;  2LTK A;  1QMV A;  2X8H A;  4MPF A;  4NMU A;  1S3C A;  3FRC A;  1TRS A;  2YZU A;  3IE3 A;  3ZVJ A;  5CO3 A;  2PER A;  3P7X A;  5J5N A;  1K3Y A;  3C71 A;  1XPV A;  4CDO A;  2OE3 A;  3KH9 A;  3KP8 A;  4F0B A;  5FT3 A;  16GS A;  1USB A;  2PUK C;  5J41 A;  5KN0 A;  4GQC A;  2K8S A;  2DML A;  1G6Y A;  2IMI A;  2I1U A;  2YWM A;  4DSQ A;  5A5K A;  4HQS A;  1WRY A;  2QC7 A;  3CSH A;  5F05 A;  5IPG A;  1XWA A;  5G5E A;  5EL8 A;  2L59 A;  1JHB A;  1F37 A;  2H0G A;  1BED A;  2DJ1 A;  1DBY A;  3GKM A;  14GS A;  2F8F A;  5IO2 A;  3IK9 A;  1PKZ A;  1Z7P A;  5A4W A;  5DAL B;  3L9S A;  3O6T A;  1NW2 A;  2F9S A;  1AQV A;  3TJF A;  1B48 A;  3WT2 A;  2YP6 A;  1SK1 A;  3IRA A;  4OFM A;  1UC7 A;  2C4J A;  2L4C A;  3P2A A;  2GT6 A;  1XWG A;  3F6F A;  4WBR D;  2JZT A;  5DAK A;  1KBN A;  3O76 A;  1ST9 A;  3ERF A;  2FGX A;  3QAW A;  1GUK A;  2JAD A;  3CRT A;  3QMX A;  3C1S A;  4JR6 A;  4Q5F A;  4ZL7 A;  1K0B A;  2CA8 A;  1Z3E A;  2CAQ A;  2OA7 A;  5DAL A;  5IMA A;  2HSY A;  2HYX A;  2R6K A;  4E8H A;  5IQY A;  2OE1 A;  4HDE A;  4J2F A;  2E2M A;  3ZZX A;  2X8G A;  2E7P A;  3ME7 A;  1Q4J A;  1T00 A;  2PU9 C;  2YWN A;  3FR9 A;  4XS6 A;  3LXZ A;  2ON5 A;  3LFL A;  1B4P A;  4ZL8 A;  2FWH A;  3C8E A;  3N5O A;  5IMZ A;  3A2X A;  1Q98 A;  4I2U A;  1SJZ A;  2J23 A;  3L78 A;  2LNT A;  3FZA A;  1SL0 B;  3WT1 A;  5J3R A;  1TTZ A;  2AB6 A;  3UVH A;  1NSW A;  2LRT A;  1ERT A;  1PQN A;  1H75 A;  1VF4 A;  3HD5 A;  1GLP A;  1MDI A;  2V6K A;  3VPT A;  4DVC A;  4Q5R A;  2OJL A;  5LNK e;  2CAI A;  3EVI A;  1EV9 A;  1M0U A;  3TKS A;  1DUG A;  1MD3 A;  4RQX A;  4PQI A;  2LUS A;  2R3X A;  1AW9 A;  2M72 A;  5ECS A;  4ECI A;  1X9S B;  4LA1 A;  1XOA A;  2X64 A;  2VLV A;  1PMT A;  3GKN A;  1FW1 A;  1OKD A;  3QD9 A;  5CYY A;  1GUH A;  3EU4 A;  4TVE A;  3FZ5 A;  2V32 A;  4IGJ A;  1YDK A;  2B7J A;  5ENU A;  3L4N A;  2VD0 A;  4IN0 A;  10GS A;  1B9X C;  3BBY A;  1NM3 A;  5HQP A;  3D6I A;  3RHC A;  4WF5 A;  1T4Y A;  3FYG A;  4RQR A;  4ZB8 A;  1TJD A;  4G19 A;  5CRE A;  2VL2 C;  4KW6 A;  4RI6 A;  3L0H A;  2HZE A;  1SD8 A;  2G0F A;  4YQV A;  4Q5Q A;  4TKY A;  1GWC A;  2GZP A;  2C0F A;  2LKU A;  5G5F A;  2C1Y A;  1TRU A;  3E3E A;  2OAC A;  2ALB A;  4TR4 A;  1I5G A;  3DML A;  3P8W A;  2V41 A;  3TJJ A;  4KAE A;  1PX7 A;  2QGV A;  4FO5 A;  4MPG A;  1GSD A;  3F63 A;  4KDU A;  2ZUP A;  1AXD A;  1R5A A;  2LJR A;  1K0O A;  2NPB A;  2XC2 A;  1PD2 1;  3ED3 A;  5G30 A;  3LSZ A;  2CX4 A;  4LLR A;  5INY A;  5ECL B;  11GS A;  3G7Y A;  3RPN A;  1TU8 A;  3KEB A;  4TR1 A;  4XRD A;  1U87 A;  5HFI A;  3QDN A;  3E0U A;  1X5C A;  2YPM A;  5ECR B;  5KN3 A;  2B7K A;  3HDC A;  1KNG A;  1U88 A;  4GQF A;  3W6G A;  3GSS A;  2YOI A;  1GTI A;  1XBS A;  4EKZ A;  5HR1 A;  4WBJ A;  1F3B A;  1JZW A;  2DJK A;  5B8A A;  3DXB A;  1T8E B;  6GSS A;  2PN8 A;  1GUL A;  1FO5 A;  3CSI A;  3LXT A;  1GLQ A;  3I6A A;  5CAX A;  2GDR A;  3LWA A;  3GTU A;  4G10 A;  3UAP A;  2B1L A;  1FB6 A;  2NBS A;  3KJY A;  1FVK A;  3QAG A;  4IW9 A;  4WEY A;  3IA1 A;  3IDV A;  2H72 A;  4BPY A;  4YH2 A;  3KM6 A;  2BMX A;  4MZC A;  1V57 A;  4YQM A;  1ZYE A;  3IAM 2;  1HQO A;  4GTU A;  1TK5 B;  2H1A A;  2P0G A;  4JBB A;  5J9B A;  3TKQ A;  2KHP A;  2NTO A;  4V2L A;  2GGT A;  3J7Y k;  3M1G A;  5D9V A;  1F9M A;  2N5B A;  4MF6 A;  1MEK A;  3GL5 A;  1AC1 A;  2OBK A;  1S3D A;  1CQG A;  3LYP A;  9GSS A;  2IIY A;  2GQL A;  3W8S A;  4ISD A;  4GST A;  4OFN A;  3UJ1 A;  2DJ3 A;  3MNG A;  5G1K A;  2OKA A;  2G2Q A;  3Q74 A;  3HXS A;  2IN3 A;  1F6M C;  3C7M A;  5B7C A;  2GVP A;  3D0Z A;  1QQ2 A;  2H19 A;  4WF4 A;  2VD1 A;  5DJL A;  1IYI A;  5ECP B;  1JZD A;  3IAS 2;  3KIJ A;  2L57 A;  1A8L A;  3EC3 A;  4TXO A;  3VK9 A;  2CVK A;  4J56 E;  2QKE A;  4V2N A;  3HVS A;  3FR3 A;  3KMN A;  2H6X A;  2VM2 A;  3CYN A;  4ML1 A;  1Z7R A;  5DQY A;  1GSE A;  1ERU A;  2YNX A;  4P3Y B;  1SL1 B;  1S3A A;  2XBQ A;  1OAZ A;  4HEA 2;  13GS A;  1XIY A;  3UIW A;  1YJ6 A;  2H66 A;  5HFG A;  3UL3 A;  1GTA A;  3I69 A;  1GSQ A;  3TKR A;  1ERW A;  2GSQ A;  1YZX A;  3GKX A;  4X0X A;  1M9B A;  5AIX A;  1A2L A;  1MDJ A;  3FY7 A;  4CHS A;  5D9T A;  1A8Y A;  3DEX A;  5ELG A;  3FW2 A;  3O3T A;  4MF5 A;  3DD3 A;  3QCP A;  4PGT A;  3MAK A;  4FYU A;  2IMK A;  3KCM A;  6GSV A;  3ZL5 A;  5COH A;  1K3L A;  4XCS A;  4G2E A;  4FH8 A;  1PA3 A;  4ZB9 A;  2ZNM A;  5EY6 A;  2HT9 A;  5H5S A;  3D21 A;  5DBQ A;  3ZRE A;  1M2A A;  3TJG A;  5IMV A;  2EIQ A;  4MJC A;  4FYB A;  4HJM A;  4ECJ A;  1HNB A;  2TRX A;  1KEB A;  3M8N A;  3KTB A;  2IPA A;  3FKF A;  5L71 A;  3H1N A;  3HVV A;  4JU5 A;  5J4U A;  2E2G A;  2MBT A;  3G7J A;  2F51 A;  1SJ6 A;  1ZMA A;  4BVY A;  2VCQ A;  5HR2 A;  4O7H A;  3SWL A;  3UBK A;  2DLX A;  3TDG A;  4EE0 A;  2DBC A;  1O85 A;  2FA8 A;  3Q6O A;  2DIZ A;  1VF3 A;  2IL3 A;  2VCX A;  2B1K A;  3ZFL A;  2CZ3 A;  2H73 A;  5KEJ A;  1VF2 A;  4K7O A;  4MAB A;  3E9J B;  1PRX A;  1SD9 A;  1MTC A;  1J0F A;  1B9Y C;  6GSU A;  1H4O A;  4HZ2 A;  5G1L A;  5F06 A;  2HRN A;  3BJ5 A;  2GLR A;  2FWE A;  4MJA A;  4N0V A;  5ECO B;  1TK8 B;  1O7U A;  2LEG A;  5GST A;  2O85 A;  3F3Q A;  2JZS A;  4F9Z A;  4G9H A;  2PWJ A;  4JR4 A;  2X8C A;  4KE3 A;  5ID2 B;  1GH2 A;  3ERW A;  12GS A;  3GNJ A;  4KX4 A;  2R4V A;  5IIZ A;  1HD2 A;  1T3B A;  3JCM L;  2LST A;  1X9M B;  1FAA A;  5CRG A;  1TU7 A;  4LL4 B;  4AJ7 A;  5AGY A;  1HYU A;  1K0D A;  2GQK A;  3EWL A;  3K8N A;  4WXT A;  3F8U A;  1EV4 A;  3UAR A;  5AN1 A;  2VO4 A;  4ECC A;  4NV2 A;  3ME8 A;  3R2Q A;  3TJB A;  4KA0 A;  2CQ9 A;  2IME A;  2OE0 A;  3TKS E;  1XFL A;  2YV7 A;  3HZ8 A;  4CW9 A;  2H0H A;  2B3S A;  3L9V A;  3GYK A;  2L6D A;  1OC8 A;  2O7K A;  4BWQ A;  2F3M A;  2OBI A;  3IR4 A;  2C3T A;  3L9U A;  4EDY A;  1QUW A;  2CVB A;  2L6C A;  1EP7 A;  1JFU A;  5C00 A;  6GSW A;  5ECQ B;  2GSS A;  1RK4 A;  4LMV A;  2B5E A;  2MYG A;  3VWX A;  3I43 A;  2N5F A;  1GP1 A;  2GQM A;  1PL2 A;  7GSS A;  1GRX A;  2XHF A;  4HU7 A;  2MMA A;  5DCG A;  1Z6M A;  4POK A;  5C04 A;  5HR3 A;  2LRN A;  3KH7 A;  8GSS A;  1K0A A;  1UA5 A;  4MK3 A;  5KN2 A;  3NIV A;  1SKW B;  5IMC A;  3RPP A;  5CRH A;  2HSH A;  2WCI A;  1BG5 A;  3EMP A;  1OVN A;  3Q19 A;  2AV4 A;  4IVF A;  5GZZ B;  3D4T A;  4IBP A;  1A0F A;  2J9H A;  5CNW A;  1OE8 A;  1XWK A;  1GTB A;  5ECN B;  2NVL A;  2H70 A;  4EO3 A;  3UEM A;  1SEN A;  5HR0 A;  2P5R A;  2RII A;  3GRX A;  1YEX A;  2C0G A;  4RUV A;  3FEU A;  4HQZ A;  3WGD A;  1TI3 A;  1UVZ A;  4MZB A;  4K0N A;  2YWI A;  3DVW A;  4OCE A;  3HZ4 A;  2WZ9 A;  1SYX A;  5IMD A;  1XW9 A;  4OCF A;  3HYP A;  2I81 A;  4TR0 A;  4HI7 A;  4L8E A;  3ZMK A;  2DC5 A;  5LD0 A;  1OYJ A;  5B6N A;  4POB A;  4TN8 A;  4F2I A;  2RUF A;  3QOU A;  1FOV A;  1GSF A;  5B6M A;  3KXO A;  2IJY A;  1B4Q A;  3EYT A;  2C8U A;  2EIO A;  4GF0 A;  2N5A A;  5H5R A;  3A5W A;  4ID0 A;  3FZ4 A;  4ZXG A;  3LEF A;  1X9W B;  4KDX A;  1A0R P;  2RM5 A;  4PNF A;  1EZK A;  2HFD A;  2VCV A;  3BOA A;  3PH9 A;  5EVO A;  1LU4 A;  1M2D A;  4KB3 A;  4ZL9 A;  2VL2 A;  4IHU A;  2FCH A;  4AF2 A;  4K9Z A;  2JSZ A;  2CX3 A;  2HLS A;  4TW5 A;  2DIY A;  2ES7 A;  3PGT A;  1LJR A;  2YCD A;  2R2J A;  5DDL A;  3UOM A;  1CQH A;  5FWG A;  4F0C A;  2RM6 A;  4TOP A;  4MJE A;  5ABR A;  3HVX A;  4EVM A;  2O89 A;  4J57 E;  1WP0 A;  1J9B A;  2C80 A;  5G31 A;  4Z7X A;  3VFI A;  4EUY A;  3MSZ A;  1M99 A;  3S9F A;  2DJ2 A;  2H1B A;  3C73 A;  5D9X A;  2VUP A;  1OC3 A;  5GSS A;  4JZQ A;  3F0I A;  3HJM A;  3MDK A;  3M9J A;  4XTS A;  2I9H A;  4O92 A;  4WR5 A;  2C3N A;  2I4A A;  1THO A;  2VL3 A;  4TXV A;  1R4W A;  2V2G A;  5LCZ A;  3QPM A;  3TRQ A;  1SKR B;  1M9A A;  3QFB C;  3ERG A;  2HI7 A;  4EL1 A;  3J7Y b;  3N9J A;  4GXZ A;  2B5X A;  4MF7 A;  4POL A;  3HHV A;  4IJI A;  3G7I A;  1VRS D;  4F82 A;  2A2S A;  2K8V A;  5F07 A;  3LYK A;  3VUR A;  1OE7 A;  3CMI A;  1ZL9 A;  1SKS B;  4IKH A;  3GH9 A;  3KZQ A;  1RQM A;  2YWO A;  2EC4 A;  5CRD A;  1K3O A;  2BTO T;  2XPE A;  3DGQ A;  3D22 A;  1TOF A;  4RI7 A;  4QL9 A;  5G2Z A;  1R7H A;  5GAP D;  5DVB A;  1LBK A;  3D5J A;  3KMO A;  5F0G A;  2H1D A;  2H6Z A;  4WET A;  3GIX A;  1JZR A;  2TIR A;  3GUS A;  1ZYQ B;  3M3M A;  3PR8 A;  1SU9 A;  6GSX A;  2TRC P;  1M2B A;  3CSJ A;  2O8V B;  1ZGN A;  1MD4 A;  3DYR A;  4E8E A;  2JAC A;  3TB2 A;  1WJK A;  4O5R A;  4GSS A;  1EGR A;  4H86 A;  4PNG A;  3TOT A;  1ILO A;  2FLS A;  2JZR A;  4MZW A;  5A4U A;  1EGO A;  4K7N A;  3WD6 A;  3NOF A;  6GST A;  1V40 A;  3CTF A;  2WB9 A;  1TK0 B;  1PGT A;  2KLX A;  4FYC A;  2EIR A;  5CP1 A;  3F4R A;  3TOU A;  2KUC A;  4I6X A;  4BA7 A;  3F4T A;  5B8B A;  4PQ1 A;  2K18 A;  1DE2 A;  4KSO A;  2LJA A;  1G6W A;  4NAX A;  5DCH A;  3GV1 A;  3F3R A;  4XHM A;  3CXG A;  1A2J A;  1AIU A;  3ZRD A;  5IM9 A;  4YAV A;  1BX9 A;  3EMX A;  1EP8 A;  4KDY A;  4I8B A;  3BD2 A;  5JCW A;  2MMZ A;  3RAZ A;  3IC4 A;  2WJU A;  4POM A;  2WS2 A;  1ML6 A;  1QFN A;  4AGS A;  4PX1 A;  2K6V A;  3HCZ A;  3IV4 A;  4NPB A;  3DRN A;  4PUR A;  1URM A;  2AJQ B;  3ZIJ A;  4XIH A;  4DSS B;  4ZIJ A;  3ISO A;  1WWJ A;  18GS A;  2MZC A;  4GLT A;  4IJ3 A;  4IQA A;  1SL2 B;  2ZCT A;  1OC9 B;  4PXO A;  5IOX A;  4K0G A;  3LOR A;  1V2A A;  4Q5N A;  1NHO A;  3IBH A;  4QL7 A;  4MMM A;  1XWC A;  4HZ4 A;  3VI7 A;  1V98 A;  1O81 A;  4AJ6 A;  3IOS A;  4V1A p;  2PPT A;  2IMD A;  1ZCP A;  2CT6 A;  4BVX A;  2FWF A;  4DSS A;  4V1A g;  3C1R A;  1ERV A;  3ZIV A;  2B5Y A;  4IP6 A;  4D73 B;  2YJ7 A;  2H8L A;  1EEJ A;  1BAY A;  1YKA A;  2F8A A;  1V9W A;  1YKC A;  1OC9 A;  2H0I A;  3TRP A;  1GL8 A;  2FWG A;  3W8J A;  5D96 A;  2QSI A;  3ZVJ D;  4GWR A;  2VL9 A;  1WOU A;  2GST A;  1U3I A;  3RDW A;  5JWQ B;  1GSS A;  3ZFB A;  4BWS A;  1WMJ A;  3ZML A;  2GS3 A;  2H74 A;  5DAK B;  2M46 A;  3CTG A;  1EEM A;  3NZN A;  3FHK A;  4N11 A;  1VF1 A;  1Y25 A;  2GT5 A;  1TXX A;  3LJR A;  3LG6 A;  2LNS A;  3UMA A;  2FA4 A;  1PKW A;  1G7E A;  4D73 A;  3H93 A;  2KP2 A;  1PX6 A;  1XW5 A;  2PGT A;  3QFA C;  4I97 A;  2V1M A;  3A2V A;  1IYH A;  3APO A;  3BCK A;  17GS A;  2BJX A;  3QAV A;  5AIS A;  20GS A;  3GKK A;  4F03 A;  1DSB A;  5KN1 A;  1DE1 A;  2WFC A;  5F8B A;  2HZF A;  3KP9 A;  4IEL A;  1W4V A;  4ECB A;  1O8X A;  2K9F A;  1WPI A;  3A3T A;  5ID2 A;  3PIN A;  4L5O A;  3IXR A;  3VPQ A;  3LQ7 A;  2H1G A;  2H6Y A;  3HKR A;  3VWW A;  4OWY A;  1E2Y A;  2YZH A;  2R5G A;  2FY6 A;  4I5Q A;  1AQW A;  3OR5 A;  1ZZY A;  2R37 A;  5AIV A;  4X1U A;  1FG4 A;  4ZB6 A;  4ZBD A;  5D8I A;  2HXK A;  2P5Q A;  3GHA A;  1GNW A;  2MMO A;  2LQQ A;  2VCT A;  4OMV A;  1PN9 A;  1XCC A;  4OD7 A;  4ZBA A;  1XVW A;  3H8Q A;  4MJB A;  4EXJ A;  2XPD A;  4N0Z A;  3US3 A;  2HNL A;  3GFK A;  4MH2 A;  3GX8 A;  1AQX A;  5E4W A;  4K6X A;  4NWY A; 
#chains in the Genus database with same CATH topology
 2H30 A;  1XOB A;  2UZ8 A;  2L5O A;  3GUR A;  1F2E A;  1Z6N A;  1K0N A;  3TKS C;  1M7T A;  1PSQ A;  2IFQ B;  3VWU A;  5JCU A;  1E6B A;  4MH3 A;  2DSA A;  2LS5 A;  2QA1 A;  1X0R A;  3GMF A;  4O32 A;  2MBS A;  3QR6 A;  4LL1 B;  4WKW A;  1FVJ A;  1N8J A;  1QXH A;  5KOX A;  4YAP A;  3F6D A;  1JLW A;  2CZ2 A;  1TRW A;  1U6T A;  2HRF A;  3TGZ A;  4IP1 A;  2HZE B;  1I9D A;  1XW6 A;  4HOJ A;  2XBI A;  4NV5 A;  3DWV A;  4L0W A;  2DKH A;  1OKT A;  1WE0 A;  4ZBB A;  4HJ2 A;  4MLY A;  1BJX A;  4L0U A;  19GS A;  2WDU A;  2VCZ A;  2GTU A;  2IFQ A;  3IK7 A;  4K8M A;  5DJM A;  3BCI A;  2HSM A;  3APS A;  1RW1 A;  3WGX A;  1HNC A;  2O87 A;  1A23 A;  3D4M A;  1GSU A;  1K0C A;  2JSY A;  4Z2U A;  4KH7 A;  2L4Q A;  4KGI A;  1ACV A;  2DJJ A;  2HRA A;  1A2M A;  2LRC A;  2Z9S A;  4N10 A;  1XXU A;  3Q18 A;  3G9B A;  1J08 A;  3EUR A;  2PMT A;  3GN3 A;  4ILF A;  4TR1 B;  1Z9H A;  1XWB A;  1YEP A;  1FB0 A;  2DJ0 A;  2VOC A;  3IHQ A;  4IS0 A;  1KTE A;  4WR4 A;  1X5E A;  2V6O A;  4OO4 A;  3U6V A;  3H79 A;  5IO0 A;  4DEJ A;  1EWX A;  2VM1 A;  4BL7 A;  2X99 A;  1GNE A;  3RBT A;  5DQS A;  3KGK A;  2A4H A;  2C0D A;  3WGE A;  3HJO A;  1X5D A;  3TUE A;  1EOG A;  2A4V A;  3GH6 A;  1R5P A;  4L5L A;  1T7P B;  2D2Z A;  4EF0 A;  1WIK A;  4KSM A;  2H01 A;  1O8W A;  4K1F A;  1T4Z A;  4EC0 A;  3GTU B;  4TRX A;  3DKS A;  3EE2 A;  4CY6 A;  5ECM B;  4AJ8 A;  4JE1 A;  3GX0 A;  5A4V A;  4EDZ A;  2AYT A;  4GSN A;  4LMW A;  3CBU A;  4MA9 A;  1ON4 A;  1YQ1 A;  4X43 A;  2CVD A;  2GSR A;  3F4S A;  2GZZ A;  3FR6 A;  4V2M A;  4PUA A;  3GL3 A;  1A24 A;  5JWO B;  3TCO A;  1SYR A;  2FNO A;  2LV3 A;  2YJH A;  3LGC A;  5CRW A;  5HFK A;  1O6J A;  2L5L A;  4I2T A;  2AUV A;  5IPH A;  1ZOF A;  1SK2 A;  4K2D A;  1BYE A;  1TKD B;  1B8X A;  1XVQ A;  2YAN A;  3DVX A;  2B6M A;  5E59 A;  3KTL A;  4PUF C;  2HE3 A;  5ELA A;  1T1V A;  1FHE A;  1YF0 A;  3U5R E;  1HNA A;  3FZ9 A;  3WYW A;  2H76 A;  4XRA A;  4BIK A;  2PBJ A;  3HY2 A;  2WUL A;  3I9V 2;  4ZIL A;  3UVT A;  3F9U A;  1F3A A;  1K0M A;  4FIW A;  3GST A;  2LJK A;  2VCW A;  2JU5 A;  3V1W A;  4KCA A;  2IMF A;  3MWH A;  3LW9 A;  1VGL A;  5D9W A;  3AY8 A;  3IC8 A;  3CRU A;  3P90 A;  2AAW A;  2C0E A;  1TRV A;  5D93 A;  5ECI B;  3ZIT A;  4QQ7 A;  2I3Y A;  4OO5 A;  2IWT A;  3HA9 A;  4TR3 A;  3DIE A;  1SJI A;  4TXO B;  2PVO C;  2AHE A;  5J9C A;  4XS4 B;  2E0Q A;  1NHY A;  2A2R A;  3APQ A;  4HU9 A;  1AAZ A;  1THX A;  1MDK A;  1YY7 A;  3A2W A;  1C72 A;  3RHB A;  2YV9 A;  5GAN D;  5ECK B;  2JL4 A;  1TP9 A;  2VLT A;  2PVQ A;  4XS1 A;  1TW9 A;  4IQ1 A;  2WRT A;  2KP1 A;  3VI5 A;  1U3A A;  3H4K A;  1PL1 A;  4MDC A;  5H5Q A;  2YN1 A;  5ECH B;  5EPF A;  3TJK A;  1TI1 A;  2M80 A;  2DMM A;  5JWR B;  1QK8 A;  3VLN A;  5IOW A;  1UN2 A;  2WGR A;  1GUM A;  1SK0 A;  3FK8 A;  3ZTL A;  1ABA A;  1R26 A;  22GS A;  2RUE A;  4HS1 A;  5JCG A;  3TRX A;  6GSY A;  2VIM A;  2H71 A;  1GSY A;  4XS4 A;  3EU3 A;  1TDI A;  4YQU A;  1XG8 A;  1JLV A;  4NXI A;  4N30 A;  4DSR A;  1G7O A;  1YF1 A;  1V58 A;  3GA4 A;  4MP4 A;  1N2A A;  2MMN A;  4JED A;  2FD3 A;  1O73 A;  4GRF A;  3SBC A;  2RLI A;  4NHW A;  2REM A;  1EOH A;  4K7I A;  3VWV A;  3HJP A;  3HVN A;  4OFT A;  3ZYW A;  4HUA A;  1AUC A;  2NDO A;  4KND A;  2P31 A;  3IPZ A;  4ULX A;  2OAD A;  3M9K A;  3ZLP A;  3KD0 A;  5IMF A;  2VAF A;  4MCU A;  2CV4 A;  1QGV A;  1GTU A;  4BVY B;  5FHI A;  1W89 A;  1BQ7 A;  2KOK A;  2LQO A;  2FHE A;  1Y6E A;  4Z2R A;  3M0F A;  4NHZ A;  2ON7 A;  4PQH A;  4GCI A;  1G0T A;  1Z5Y E;  3TKP A;  4ML6 A;  4KCE A;  3EIN A;  4JRR A;  3UBL A;  5D73 A;  4ACS A;  2VLU A;  2H75 A;  1JZO A;  2C3Q A;  2GZY A;  1XZO A;  2FUG 2;  4KUN A;  2LTK A;  1QMV A;  2X8H A;  4MPF A;  4NMU A;  1S3C A;  3FRC A;  1TRS A;  2YZU A;  3IE3 A;  3ZVJ A;  5CO3 A;  2PER A;  3P7X A;  5J5N A;  1K3Y A;  3C71 A;  1XPV A;  4CDO A;  2OE3 A;  3KH9 A;  3KP8 A;  4F0B A;  5FT3 A;  16GS A;  1USB A;  2PUK C;  5J41 A;  5KN0 A;  4GQC A;  2K8S A;  2DML A;  1G6Y A;  2IMI A;  2I1U A;  2YWM A;  4DSQ A;  5A5K A;  4HQS A;  1WRY A;  2QC7 A;  3CSH A;  5F05 A;  5IPG A;  1XWA A;  5G5E A;  5EL8 A;  2L59 A;  1JHB A;  1F37 A;  2X4A A;  2H0G A;  4USS A;  1BED A;  2DJ1 A;  1DBY A;  3GKM A;  14GS A;  2F8F A;  5IO2 A;  3IK9 A;  1PKZ A;  1Z7P A;  5A4W A;  5DAL B;  3L9S A;  3O6T A;  1NW2 A;  2F9S A;  1AQV A;  3TJF A;  1B48 A;  3WT2 A;  2YP6 A;  1SK1 A;  3IRA A;  4OFM A;  1UC7 A;  2C4J A;  2L4C A;  3P2A A;  2GT6 A;  1XWG A;  3F6F A;  4WBR D;  2JZT A;  5DAK A;  4G0I A;  1KBN A;  3O76 A;  1ST9 A;  3ERF A;  2FGX A;  3QAW A;  1GUK A;  2JAD A;  3CRT A;  3QMX A;  3C1S A;  4JR6 A;  4Q5F A;  5BRT A;  4ZL7 A;  1K0B A;  2CA8 A;  1Z3E A;  2CAQ A;  2OA7 A;  5DAL A;  5IMA A;  2HSY A;  2HYX A;  2R6K A;  4E8H A;  1S3R A;  5IQY A;  2OE1 A;  4HDE A;  4J2F A;  2E2M A;  3ZZX A;  2X8G A;  2E7P A;  3ME7 A;  1Q4J A;  1T00 A;  4G0L A;  2PU9 C;  2YWN A;  3FR9 A;  4XS6 A;  3LXZ A;  2ON5 A;  3LFL A;  1B4P A;  4ZL8 A;  2FWH A;  3C8E A;  3N5O A;  5IMZ A;  3A2X A;  1Q98 A;  4I2U A;  1SJZ A;  2J23 A;  4HSC X;  3L78 A;  2LNT A;  3FZA A;  1SL0 B;  3WT1 A;  5J3R A;  1TTZ A;  2AB6 A;  3UVH A;  1NSW A;  2LRT A;  1ERT A;  1PQN A;  1H75 A;  1VF4 A;  3HD5 A;  1GLP A;  1MDI A;  2V6K A;  4O5U A;  3VPT A;  4DVC A;  4Q5R A;  2OJL A;  5LNK e;  2CAI A;  3EVI A;  4K5S A;  1EV9 A;  1M0U A;  3TKS A;  1DUG A;  1MD3 A;  4RQX A;  4PQI A;  2LUS A;  4EIP A;  2R3X A;  1AW9 A;  2M72 A;  5ECS A;  4ECI A;  1X9S B;  4LA1 A;  1XOA A;  2X64 A;  2VLV A;  1PMT A;  3GKN A;  1FW1 A;  4K5R A;  1OKD A;  3QD9 A;  4CY8 A;  5CYY A;  1GUH A;  3EU4 A;  4TVE A;  3FZ5 A;  2V32 A;  4IGJ A;  1YDK A;  2B7J A;  5ENU A;  3L4N A;  2VD0 A;  4IN0 A;  10GS A;  1B9X C;  3BBY A;  1NM3 A;  5HQP A;  3D6I A;  3RHC A;  4WF5 A;  1T4Y A;  3FYG A;  4RQR A;  4ZB8 A;  1TJD A;  4G19 A;  5CRE A;  2VL2 C;  4KW6 A;  4RI6 A;  3L0H A;  2HZE A;  1FOH A;  1SD8 A;  2G0F A;  4YQV A;  4Q5Q A;  4TKY A;  1GWC A;  2GZP A;  2C0F A;  2LKU A;  5G5F A;  2C1Y A;  4YKF A;  1TRU A;  3E3E A;  2OAC A;  2ALB A;  4TR4 A;  1I5G A;  3DML A;  3P8W A;  2V41 A;  3TJJ A;  4KAE A;  1PX7 A;  2QGV A;  4FO5 A;  4MPG A;  1GSD A;  3F63 A;  4KDU A;  2ZUP A;  1AXD A;  1R5A A;  2LJR A;  1K0O A;  2NPB A;  2XC2 A;  1PD2 1;  3ED3 A;  5G30 A;  3LSZ A;  2CX4 A;  4LLR A;  5INY A;  5ECL B;  3IHG A;  11GS A;  3G7Y A;  3RPN A;  1TU8 A;  3KEB A;  4TR1 A;  4XRD A;  1U87 A;  5HFI A;  3QDN A;  3E0U A;  1X5C A;  2YPM A;  5ECR B;  5KN3 A;  2B7K A;  3HDC A;  1KNG A;  1U88 A;  4GQF A;  3W6G A;  3GSS A;  2YOI A;  1GTI A;  1XBS A;  4EKZ A;  5HR1 A;  4WBJ A;  1F3B A;  1JZW A;  2DJK A;  5B8A A;  3DXB A;  1T8E B;  6GSS A;  2PN8 A;  1GUL A;  1FO5 A;  3CSI A;  3LXT A;  4G0K A;  1GLQ A;  3I6A A;  5CAX A;  2GDR A;  3LWA A;  2R0G A;  3GTU A;  4G10 A;  3UAP A;  2B1L A;  1FB6 A;  2NBS A;  3KJY A;  1FVK A;  3QAG A;  4IW9 A;  4WEY A;  1PFO A;  3IA1 A;  2QA2 A;  3IDV A;  2H72 A;  4BPY A;  4YH2 A;  3KM6 A;  2BMX A;  2R0P A;  4MZC A;  1V57 A;  4YQM A;  1ZYE A;  3IAM 2;  1HQO A;  4GTU A;  1TK5 B;  2H1A A;  2P0G A;  4JBB A;  5J9B A;  3TKQ A;  2KHP A;  2NTO A;  4V2L A;  2GGT A;  3J7Y k;  3M1G A;  5D9V A;  1F9M A;  2N5B A;  4MF6 A;  1MEK A;  3GL5 A;  1AC1 A;  2OBK A;  1S3D A;  1CQG A;  3LYP A;  9GSS A;  2IIY A;  2GQL A;  3W8S A;  4ISD A;  4GST A;  4OFN A;  3UJ1 A;  2DJ3 A;  3MNG A;  5G1K A;  2OKA A;  2G2Q A;  3Q74 A;  3HXS A;  2IN3 A;  1F6M C;  3C7M A;  4K2X A;  5B7C A;  2GVP A;  3D0Z A;  1QQ2 A;  2H19 A;  4WF4 A;  3MIX A;  2VD1 A;  5DJL A;  1IYI A;  5ECP B;  1JZD A;  3IAS 2;  3KIJ A;  2L57 A;  1A8L A;  3EC3 A;  4TXO A;  3VK9 A;  2CVK A;  4J56 E;  2QKE A;  4V2N A;  3HVS A;  3FR3 A;  3KMN A;  2H6X A;  2VM2 A;  3CYN A;  4ICY A;  4ML1 A;  1Z7R A;  5DQY A;  1GSE A;  4EIQ A;  1ERU A;  2YNX A;  4P3Y B;  1SL1 B;  1S3A A;  2XBQ A;  1OAZ A;  4HEA 2;  13GS A;  1XIY A;  3UIW A;  1YJ6 A;  2H66 A;  5HFG A;  3UL3 A;  1GTA A;  3I69 A;  1GSQ A;  3TKR A;  1ERW A;  2GSQ A;  1YZX A;  3GKX A;  4X0X A;  1M9B A;  5AIX A;  1A2L A;  1MDJ A;  1ZYP A;  3FY7 A;  4CHS A;  5D9T A;  1A8Y A;  3DEX A;  5ELG A;  3FW2 A;  3O3T A;  4MF5 A;  3DD3 A;  3QCP A;  4PGT A;  3MAK A;  4FYU A;  2IMK A;  3KCM A;  6GSV A;  3ZL5 A;  5COH A;  4BVX B;  1K3L A;  4XCS A;  4G2E A;  4FH8 A;  1PA3 A;  4ZB9 A;  2ZNM A;  5EY6 A;  2HT9 A;  5H5S A;  3D21 A;  5DBQ A;  3ZRE A;  1M2A A;  3TJG A;  5IMV A;  2R0C A;  2EIQ A;  4MJC A;  4FYB A;  4HJM A;  4ECJ A;  1HNB A;  2TRX A;  4O5Q A;  1KEB A;  3M8N A;  3KTB A;  2IPA A;  3FKF A;  5L71 A;  3EPT A;  3H1N A;  3HVV A;  4JU5 A;  5J4U A;  2E2G A;  2MBT A;  3G7J A;  2F51 A;  1SJ6 A;  1ZMA A;  4BVY A;  2VCQ A;  5HR2 A;  4O7H A;  3SWL A;  3UBK A;  2DLX A;  3TDG A;  4EE0 A;  2DBC A;  1O85 A;  2FA8 A;  3Q6O A;  2DIZ A;  1VF3 A;  2IL3 A;  3MYD A;  2VCX A;  2B1K A;  3ZFL A;  2CZ3 A;  2H73 A;  5KEJ A;  1VF2 A;  4Z2T A;  4K7O A;  4MAB A;  3E9J B;  1PRX A;  1SD9 A;  1MTC A;  1J0F A;  1B9Y C;  6GSU A;  1H4O A;  4HZ2 A;  5G1L A;  5F06 A;  2HRN A;  3BJ5 A;  2GLR A;  2FWE A;  4MJA A;  4N0V A;  5ECO B;  1TK8 B;  1O7U A;  2LEG A;  5GST A;  2O85 A;  3F3Q A;  2JZS A;  4F9Z A;  4G9H A;  2PWJ A;  4JR4 A;  2X8C A;  4KE3 A;  5ID2 B;  1GH2 A;  3ERW A;  12GS A;  3GNJ A;  4KX4 A;  2R4V A;  5IIZ A;  1HD2 A;  1T3B A;  3JCM L;  2LST A;  4KF9 A;  1FAA A;  1X9M B;  5CRG A;  1TU7 A;  4LL4 B;  4AJ7 A;  5AGY A;  1HYU A;  1K0D A;  2GQK A;  3EWL A;  3K8N A;  4WXT A;  3F8U A;  1EV4 A;  3UAR A;  5AN1 A;  2VO4 A;  4ECC A;  4NV2 A;  3ME8 A;  3R2Q A;  3TJB A;  4KA0 A;  2CQ9 A;  2IME A;  2OE0 A;  3TKS E;  1XFL A;  2YV7 A;  3HZ8 A;  4CW9 A;  2H0H A;  2B3S A;  3L9V A;  3GYK A;  2L6D A;  1OC8 A;  2O7K A;  4BWQ A;  2F3M A;  2OBI A;  3IR4 A;  2C3T A;  3L9U A;  4EDY A;  1QUW A;  2CVB A;  2L6C A;  1EP7 A;  1JFU A;  5C00 A;  6GSW A;  5ECQ B;  2GSS A;  1RK4 A;  4LMV A;  2B5E A;  2MYG A;  3VWX A;  3I43 A;  2N5F A;  1GP1 A;  2GQM A;  1PL2 A;  7GSS A;  1GRX A;  2XHF A;  4HU7 A;  2MMA A;  5DCG A;  1Z6M A;  4YKG A;  4POK A;  5C04 A;  5HR3 A;  2LRN A;  3KH7 A;  8GSS A;  1K0A A;  1UA5 A;  4MK3 A;  5KN2 A;  3NIV A;  1SKW B;  5IMC A;  3RPP A;  5CRH A;  2HSH A;  2WCI A;  1BG5 A;  3EMP A;  1OVN A;  3Q19 A;  2AV4 A;  4IVF A;  5GZZ B;  3PPU A;  3D4T A;  4IBP A;  1A0F A;  2J9H A;  5CNW A;  1OE8 A;  1XWK A;  1GTB A;  5ECN B;  2NVL A;  2H70 A;  4EO3 A;  5KOW A;  3UEM A;  1SEN A;  5HR0 A;  2P5R A;  2RII A;  3GRX A;  1YEX A;  2C0G A;  4RUV A;  3FEU A;  4HQZ A;  3WGD A;  1TI3 A;  1UVZ A;  4MZB A;  4K0N A;  2YWI A;  3DVW A;  4OCE A;  3HZ4 A;  2WZ9 A;  1SYX A;  5IMD A;  1XW9 A;  4OCF A;  3HYP A;  2I81 A;  4TR0 A;  4HI7 A;  4L8E A;  3ZMK A;  2DC5 A;  5LD0 A;  1OYJ A;  5B6N A;  4POB A;  4TN8 A;  4F2I A;  2RUF A;  3QOU A;  1FOV A;  1GSF A;  4BL7 B;  5B6M A;  3KXO A;  2IJY A;  1B4Q A;  3EYT A;  2C8U A;  2EIO A;  4GF0 A;  2N5A A;  5H5R A;  3A5W A;  4ID0 A;  3FZ4 A;  4ZXG A;  3LEF A;  1X9W B;  4KDX A;  1A0R P;  2RM5 A;  4PNF A;  1EZK A;  2HFD A;  2VCV A;  3BOA A;  3PH9 A;  5EVO A;  1LU4 A;  1M2D A;  4KB3 A;  4ZL9 A;  2VL2 A;  4IHU A;  2FCH A;  4AF2 A;  4K9Z A;  2JSZ A;  2CX3 A;  2HLS A;  4TW5 A;  2DIY A;  2ES7 A;  3PGT A;  1LJR A;  2YCD A;  2R2J A;  5DDL A;  3UOM A;  1CQH A;  5FWG A;  4F0C A;  2RM6 A;  4TOP A;  4MJE A;  5ABR A;  3HVX A;  4EVM A;  2O89 A;  4J57 E;  1WP0 A;  1J9B A;  2C80 A;  5G31 A;  4Z7X A;  3VFI A;  4EUY A;  3MSZ A;  1M99 A;  3S9F A;  2DJ2 A;  2H1B A;  3C73 A;  1M3I A;  5D9X A;  2VUP A;  1OC3 A;  5GSS A;  4JZQ A;  3F0I A;  3HJM A;  3MDK A;  3M9J A;  4XTS A;  2I9H A;  4O92 A;  4WR5 A;  2C3N A;  2I4A A;  1THO A;  2VL3 A;  4TXV A;  2DKI A;  4X4J A;  1R4W A;  2V2G A;  5LCZ A;  3QPM A;  3TRQ A;  1SKR B;  1M9A A;  3QFB C;  3ERG A;  2HI7 A;  2HRK A;  4EL1 A;  3J7Y b;  3N9J A;  4GXZ A;  2B5X A;  4MF7 A;  4POL A;  3HHV A;  4IJI A;  3G7I A;  1VRS D;  4F82 A;  2A2S A;  2K8V A;  5F07 A;  3LYK A;  3VUR A;  1OE7 A;  3CMI A;  1ZL9 A;  1SKS B;  4IKH A;  3GH9 A;  3KZQ A;  1RQM A;  2YWO A;  2EC4 A;  5CRD A;  1K3O A;  2BTO T;  2XPE A;  3DGQ A;  3D22 A;  1TOF A;  4RI7 A;  4QL9 A;  5G2Z A;  1R7H A;  5GAP D;  5DVB A;  1LBK A;  3D5J A;  3KMO A;  5F0G A;  2H1D A;  4FQU A;  3R3E A;  2H6Z A;  4WET A;  3GIX A;  1JZR A;  2TIR A;  3GUS A;  1ZYQ B;  3M3M A;  3PR8 A;  1SU9 A;  6GSX A;  2TRC P;  1M2B A;  3CSJ A;  2O8V B;  1ZGN A;  1MD4 A;  3DYR A;  4E8E A;  2JAC A;  3TB2 A;  1WJK A;  4O5R A;  4GSS A;  1EGR A;  4H86 A;  4PNG A;  3TOT A;  1ILO A;  2FLS A;  2JZR A;  3FMW A;  4MZW A;  5A4U A;  1EGO A;  4K7N A;  3WD6 A;  3NOF A;  6GST A;  1V40 A;  3CTF A;  2WB9 A;  1TK0 B;  1PGT A;  2KLX A;  4A5P A;  4FYC A;  2EIR A;  5CP1 A;  3F4R A;  3TOU A;  2KUC A;  4I6X A;  4BA7 A;  3F4T A;  5B8B A;  4PQ1 A;  2K18 A;  1DE2 A;  4KSO A;  2LJA A;  1G6W A;  4NAX A;  5DCH A;  3GV1 A;  3F3R A;  5BMU A;  4XHM A;  3CXG A;  1A2J A;  1AIU A;  3ZRD A;  5IM9 A;  4YAV A;  1BX9 A;  3EMX A;  1EP8 A;  4KDY A;  4I8B A;  3BD2 A;  5JCW A;  2MMZ A;  3RAZ A;  3IC4 A;  2WJU A;  4POM A;  2WS2 A;  1ML6 A;  1QFN A;  4AGS A;  4PX1 A;  2K6V A;  2A2P A;  3HCZ A;  3IV4 A;  4NPB A;  3DRN A;  4PUR A;  1PN0 A;  1URM A;  2AJQ B;  1M3J A;  3ZIJ A;  4XIH A;  4DSS B;  4ZIJ A;  3ISO A;  1WWJ A;  18GS A;  2MZC A;  4GLT A;  4IJ3 A;  4IQA A;  1SL2 B;  2ZCT A;  1OC9 B;  4PXO A;  5IOX A;  4K0G A;  3LOR A;  1V2A A;  4Q5N A;  1NHO A;  3IBH A;  4QL7 A;  4MMM A;  1XWC A;  4HZ4 A;  4MNN A;  3VI7 A;  1V98 A;  1O81 A;  4AJ6 A;  3IOS A;  4V1A p;  2PPT A;  2IMD A;  1ZCP A;  2CT6 A;  4BVX A;  2FWF A;  2X49 A;  4DSS A;  4V1A g;  3C1R A;  1ERV A;  3ZIV A;  4PTS A;  2B5Y A;  4IP6 A;  4D73 B;  2YJ7 A;  2H8L A;  1ZYN A;  1EEJ A;  1BAY A;  1YKA A;  2F8A A;  1V9W A;  1YKC A;  1OC9 A;  2H0I A;  3CQF A;  3TRP A;  1GL8 A;  2FWG A;  3W8J A;  5D96 A;  2QSI A;  3ZVJ D;  4GWR A;  2VL9 A;  1WOU A;  2GST A;  1U3I A;  3RDW A;  5JWQ B;  1GSS A;  3ZFB A;  4BWS A;  1WMJ A;  3ZML A;  2GS3 A;  2H74 A;  5DAK B;  2M46 A;  3CTG A;  1EEM A;  3NZN A;  3FHK A;  4N11 A;  1VF1 A;  1Y25 A;  2GT5 A;  1TXX A;  3LJR A;  3LG6 A;  2LNS A;  3UMA A;  2FA4 A;  1PKW A;  1G7E A;  4D73 A;  3H93 A;  2KP2 A;  1PX6 A;  1XW5 A;  2PGT A;  3QFA C;  4I97 A;  2V1M A;  3A2V A;  3A5I A;  1IYH A;  3APO A;  3BCK A;  17GS A;  2BJX A;  3QAV A;  5AIS A;  20GS A;  3GKK A;  4F03 A;  1DSB A;  5KN1 A;  1DE1 A;  2WFC A;  5F8B A;  2HZF A;  3KP9 A;  4IEL A;  1W4V A;  4ECB A;  1O8X A;  2K9F A;  1WPI A;  3A3T A;  5ID2 A;  3PIN A;  4L5O A;  3IXR A;  3VPQ A;  3LQ7 A;  2H1G A;  2H6Y A;  3HKR A;  3VWW A;  4OWY A;  1E2Y A;  2YZH A;  2R5G A;  2FY6 A;  4I5Q A;  1AQW A;  3OR5 A;  1ZZY A;  2R37 A;  5AIV A;  4X1U A;  1FG4 A;  4ZB6 A;  4ZBD A;  5D8I A;  2HXK A;  2P5Q A;  3GHA A;  1GNW A;  2MMO A;  2LQQ A;  2VCT A;  4OMV A;  1PN9 A;  1XCC A;  4OD7 A;  4ZBA A;  1XVW A;  3H8Q A;  4MJB A;  4EXJ A;  2XPD A;  4N0Z A;  3US3 A;  2HNL A;  3GFK A;  4MH2 A;  3GX8 A;  1AQX A;  5E4W A;  4K6X A;  4NWY A; 
#chains in the Genus database with same CATH homology
 2H30 A;  1XOB A;  2UZ8 A;  2L5O A;  3GUR A;  1F2E A;  1Z6N A;  1K0N A;  3TKS C;  1M7T A;  1PSQ A;  2IFQ B;  3VWU A;  5JCU A;  1E6B A;  4MH3 A;  2DSA A;  2LS5 A;  2QA1 A;  1X0R A;  3GMF A;  4O32 A;  2MBS A;  3QR6 A;  4LL1 B;  4WKW A;  1FVJ A;  1N8J A;  1QXH A;  5KOX A;  4YAP A;  3F6D A;  1JLW A;  2CZ2 A;  1TRW A;  1U6T A;  2HRF A;  3TGZ A;  4IP1 A;  2HZE B;  1I9D A;  1XW6 A;  4HOJ A;  2XBI A;  4NV5 A;  3DWV A;  4L0W A;  2DKH A;  1OKT A;  1WE0 A;  4ZBB A;  4HJ2 A;  4MLY A;  1BJX A;  4L0U A;  19GS A;  2WDU A;  2VCZ A;  2GTU A;  2IFQ A;  3IK7 A;  4K8M A;  5DJM A;  3BCI A;  2HSM A;  3APS A;  1RW1 A;  3WGX A;  1HNC A;  2O87 A;  1A23 A;  3D4M A;  1GSU A;  1K0C A;  2JSY A;  4Z2U A;  4KH7 A;  2L4Q A;  4KGI A;  1ACV A;  2DJJ A;  2HRA A;  1A2M A;  2LRC A;  2Z9S A;  4N10 A;  1XXU A;  3Q18 A;  3G9B A;  1J08 A;  3EUR A;  2PMT A;  3GN3 A;  4ILF A;  4TR1 B;  1Z9H A;  1XWB A;  1YEP A;  1FB0 A;  2DJ0 A;  2VOC A;  3IHQ A;  4IS0 A;  1KTE A;  4WR4 A;  1X5E A;  2V6O A;  4OO4 A;  3U6V A;  3H79 A;  5IO0 A;  4DEJ A;  1EWX A;  2VM1 A;  4BL7 A;  2X99 A;  1GNE A;  3RBT A;  5DQS A;  3KGK A;  2A4H A;  2C0D A;  3WGE A;  3HJO A;  1X5D A;  3TUE A;  1EOG A;  2A4V A;  3GH6 A;  1R5P A;  4L5L A;  1T7P B;  2D2Z A;  4EF0 A;  1WIK A;  4KSM A;  2H01 A;  1O8W A;  4K1F A;  1T4Z A;  4EC0 A;  3GTU B;  4TRX A;  3DKS A;  3EE2 A;  4CY6 A;  5ECM B;  4AJ8 A;  4JE1 A;  3GX0 A;  5A4V A;  4EDZ A;  2AYT A;  4GSN A;  4LMW A;  3CBU A;  4MA9 A;  1ON4 A;  1YQ1 A;  4X43 A;  2CVD A;  2GSR A;  3F4S A;  2GZZ A;  3FR6 A;  4V2M A;  4PUA A;  3GL3 A;  1A24 A;  5JWO B;  3TCO A;  1SYR A;  2FNO A;  2LV3 A;  2YJH A;  3LGC A;  5CRW A;  5HFK A;  1O6J A;  2L5L A;  4I2T A;  2AUV A;  5IPH A;  1ZOF A;  1SK2 A;  4K2D A;  1BYE A;  1TKD B;  1B8X A;  1XVQ A;  2YAN A;  3DVX A;  2B6M A;  5E59 A;  3KTL A;  4PUF C;  2HE3 A;  5ELA A;  1T1V A;  1FHE A;  1YF0 A;  3U5R E;  1HNA A;  3FZ9 A;  3WYW A;  2H76 A;  4XRA A;  2PBJ A;  3HY2 A;  2WUL A;  3I9V 2;  4ZIL A;  3UVT A;  3F9U A;  1F3A A;  1K0M A;  4FIW A;  3GST A;  2LJK A;  2VCW A;  2JU5 A;  3V1W A;  4KCA A;  2IMF A;  3MWH A;  3LW9 A;  1VGL A;  5D9W A;  3AY8 A;  3IC8 A;  3CRU A;  3P90 A;  2AAW A;  2C0E A;  1TRV A;  5D93 A;  5ECI B;  3ZIT A;  4QQ7 A;  2I3Y A;  4OO5 A;  2IWT A;  3HA9 A;  4TR3 A;  3DIE A;  1SJI A;  4TXO B;  2PVO C;  2AHE A;  5J9C A;  4XS4 B;  2E0Q A;  1NHY A;  2A2R A;  3APQ A;  4HU9 A;  1AAZ A;  1THX A;  1MDK A;  1YY7 A;  3A2W A;  1C72 A;  3RHB A;  2YV9 A;  5GAN D;  5ECK B;  2JL4 A;  1TP9 A;  2VLT A;  2PVQ A;  4XS1 A;  1TW9 A;  4IQ1 A;  2WRT A;  2KP1 A;  3VI5 A;  1U3A A;  3H4K A;  1PL1 A;  4MDC A;  5H5Q A;  2YN1 A;  5ECH B;  5EPF A;  3TJK A;  1TI1 A;  2M80 A;  2DMM A;  5JWR B;  1QK8 A;  3VLN A;  5IOW A;  1UN2 A;  2WGR A;  1GUM A;  1SK0 A;  3FK8 A;  3ZTL A;  1ABA A;  1R26 A;  22GS A;  2RUE A;  4HS1 A;  5JCG A;  3TRX A;  6GSY A;  2VIM A;  2H71 A;  1GSY A;  4XS4 A;  3EU3 A;  1TDI A;  4YQU A;  1JLV A;  4NXI A;  4N30 A;  4DSR A;  1G7O A;  1YF1 A;  1V58 A;  3GA4 A;  4MP4 A;  1N2A A;  2MMN A;  4JED A;  2FD3 A;  1O73 A;  4GRF A;  3SBC A;  2RLI A;  4NHW A;  2REM A;  1EOH A;  4K7I A;  3VWV A;  3HJP A;  4OFT A;  3ZYW A;  4HUA A;  1AUC A;  2NDO A;  4KND A;  2P31 A;  3IPZ A;  4ULX A;  2OAD A;  3M9K A;  3ZLP A;  3KD0 A;  5IMF A;  2VAF A;  4MCU A;  2CV4 A;  1QGV A;  1GTU A;  4BVY B;  5FHI A;  1W89 A;  1BQ7 A;  2KOK A;  2LQO A;  2FHE A;  1Y6E A;  4Z2R A;  3M0F A;  4NHZ A;  2ON7 A;  4PQH A;  4GCI A;  1G0T A;  1Z5Y E;  3TKP A;  4ML6 A;  4KCE A;  3EIN A;  4JRR A;  3UBL A;  5D73 A;  4ACS A;  2VLU A;  2H75 A;  1JZO A;  2C3Q A;  2GZY A;  1XZO A;  2FUG 2;  4KUN A;  2LTK A;  1QMV A;  2X8H A;  4MPF A;  4NMU A;  1S3C A;  3FRC A;  1TRS A;  2YZU A;  3IE3 A;  3ZVJ A;  5CO3 A;  2PER A;  3P7X A;  5J5N A;  1K3Y A;  3C71 A;  1XPV A;  4CDO A;  2OE3 A;  3KH9 A;  3KP8 A;  4F0B A;  5FT3 A;  16GS A;  1USB A;  2PUK C;  5J41 A;  5KN0 A;  4GQC A;  2K8S A;  2DML A;  1G6Y A;  2IMI A;  2I1U A;  2YWM A;  4DSQ A;  5A5K A;  4HQS A;  1WRY A;  2QC7 A;  3CSH A;  5F05 A;  5IPG A;  1XWA A;  5G5E A;  5EL8 A;  2L59 A;  1JHB A;  1F37 A;  2X4A A;  2H0G A;  4USS A;  1BED A;  2DJ1 A;  1DBY A;  3GKM A;  14GS A;  2F8F A;  5IO2 A;  3IK9 A;  1PKZ A;  1Z7P A;  5A4W A;  5DAL B;  3L9S A;  3O6T A;  1NW2 A;  2F9S A;  1AQV A;  3TJF A;  1B48 A;  3WT2 A;  2YP6 A;  1SK1 A;  3IRA A;  4OFM A;  1UC7 A;  2C4J A;  2L4C A;  3P2A A;  2GT6 A;  1XWG A;  3F6F A;  4WBR D;  2JZT A;  5DAK A;  4G0I A;  1KBN A;  3O76 A;  1ST9 A;  3ERF A;  2FGX A;  3QAW A;  1GUK A;  2JAD A;  3CRT A;  3QMX A;  3C1S A;  4JR6 A;  4Q5F A;  5BRT A;  4ZL7 A;  1K0B A;  2CA8 A;  1Z3E A;  2CAQ A;  2OA7 A;  5DAL A;  5IMA A;  2HSY A;  2HYX A;  2R6K A;  4E8H A;  5IQY A;  2OE1 A;  4HDE A;  4J2F A;  2E2M A;  3ZZX A;  2X8G A;  2E7P A;  3ME7 A;  1Q4J A;  1T00 A;  4G0L A;  2PU9 C;  2YWN A;  3FR9 A;  4XS6 A;  3LXZ A;  2ON5 A;  3LFL A;  1B4P A;  4ZL8 A;  2FWH A;  3C8E A;  3N5O A;  5IMZ A;  3A2X A;  1Q98 A;  4I2U A;  1SJZ A;  2J23 A;  3L78 A;  2LNT A;  3FZA A;  1SL0 B;  3WT1 A;  5J3R A;  1TTZ A;  2AB6 A;  3UVH A;  1NSW A;  2LRT A;  1ERT A;  1PQN A;  1H75 A;  1VF4 A;  3HD5 A;  1GLP A;  1MDI A;  2V6K A;  4O5U A;  3VPT A;  4DVC A;  4Q5R A;  2OJL A;  5LNK e;  2CAI A;  3EVI A;  4K5S A;  1EV9 A;  1M0U A;  3TKS A;  1DUG A;  1MD3 A;  4RQX A;  4PQI A;  2LUS A;  4EIP A;  2R3X A;  1AW9 A;  2M72 A;  5ECS A;  4ECI A;  1X9S B;  4LA1 A;  1XOA A;  2X64 A;  2VLV A;  1PMT A;  3GKN A;  1FW1 A;  4K5R A;  1OKD A;  3QD9 A;  4CY8 A;  5CYY A;  1GUH A;  3EU4 A;  4TVE A;  3FZ5 A;  2V32 A;  4IGJ A;  1YDK A;  2B7J A;  5ENU A;  3L4N A;  2VD0 A;  4IN0 A;  10GS A;  1B9X C;  3BBY A;  1NM3 A;  5HQP A;  3D6I A;  3RHC A;  4WF5 A;  1T4Y A;  3FYG A;  4RQR A;  4ZB8 A;  1TJD A;  4G19 A;  5CRE A;  2VL2 C;  4KW6 A;  4RI6 A;  3L0H A;  2HZE A;  1FOH A;  1SD8 A;  2G0F A;  4YQV A;  4Q5Q A;  4TKY A;  1GWC A;  2GZP A;  2C0F A;  2LKU A;  5G5F A;  2C1Y A;  4YKF A;  1TRU A;  3E3E A;  2OAC A;  2ALB A;  4TR4 A;  1I5G A;  3DML A;  3P8W A;  2V41 A;  3TJJ A;  4KAE A;  1PX7 A;  2QGV A;  4FO5 A;  4MPG A;  1GSD A;  3F63 A;  4KDU A;  2ZUP A;  1AXD A;  1R5A A;  2LJR A;  1K0O A;  2NPB A;  2XC2 A;  1PD2 1;  3ED3 A;  5G30 A;  3LSZ A;  2CX4 A;  4LLR A;  5INY A;  5ECL B;  3IHG A;  11GS A;  3G7Y A;  3RPN A;  1TU8 A;  3KEB A;  4TR1 A;  4XRD A;  1U87 A;  5HFI A;  3QDN A;  3E0U A;  1X5C A;  2YPM A;  5ECR B;  5KN3 A;  2B7K A;  3HDC A;  1KNG A;  1U88 A;  4GQF A;  3W6G A;  3GSS A;  2YOI A;  1GTI A;  1XBS A;  4EKZ A;  5HR1 A;  4WBJ A;  1F3B A;  1JZW A;  2DJK A;  5B8A A;  3DXB A;  1T8E B;  6GSS A;  2PN8 A;  1GUL A;  1FO5 A;  3CSI A;  3LXT A;  4G0K A;  1GLQ A;  3I6A A;  5CAX A;  2GDR A;  3LWA A;  2R0G A;  3GTU A;  4G10 A;  3UAP A;  2B1L A;  1FB6 A;  2NBS A;  3KJY A;  1FVK A;  3QAG A;  4IW9 A;  4WEY A;  3IA1 A;  2QA2 A;  3IDV A;  2H72 A;  4BPY A;  4YH2 A;  3KM6 A;  2BMX A;  2R0P A;  4MZC A;  1V57 A;  4YQM A;  1ZYE A;  3IAM 2;  1HQO A;  4GTU A;  1TK5 B;  2H1A A;  2P0G A;  4JBB A;  5J9B A;  3TKQ A;  2KHP A;  2NTO A;  4V2L A;  2GGT A;  3J7Y k;  3M1G A;  5D9V A;  1F9M A;  2N5B A;  4MF6 A;  1MEK A;  3GL5 A;  1AC1 A;  2OBK A;  1S3D A;  1CQG A;  3LYP A;  9GSS A;  2IIY A;  2GQL A;  3W8S A;  4ISD A;  4GST A;  4OFN A;  3UJ1 A;  2DJ3 A;  3MNG A;  5G1K A;  2OKA A;  2G2Q A;  3Q74 A;  3HXS A;  2IN3 A;  1F6M C;  3C7M A;  4K2X A;  5B7C A;  2GVP A;  3D0Z A;  1QQ2 A;  2H19 A;  4WF4 A;  3MIX A;  2VD1 A;  5DJL A;  1IYI A;  5ECP B;  1JZD A;  3IAS 2;  3KIJ A;  2L57 A;  1A8L A;  3EC3 A;  4TXO A;  3VK9 A;  2CVK A;  4J56 E;  2QKE A;  4V2N A;  3HVS A;  3FR3 A;  3KMN A;  2H6X A;  2VM2 A;  3CYN A;  4ICY A;  4ML1 A;  1Z7R A;  5DQY A;  1GSE A;  4EIQ A;  1ERU A;  2YNX A;  4P3Y B;  1SL1 B;  1S3A A;  2XBQ A;  1OAZ A;  4HEA 2;  13GS A;  1XIY A;  3UIW A;  1YJ6 A;  2H66 A;  5HFG A;  3UL3 A;  1GTA A;  3I69 A;  1GSQ A;  3TKR A;  1ERW A;  2GSQ A;  1YZX A;  3GKX A;  4X0X A;  1M9B A;  5AIX A;  1A2L A;  1MDJ A;  1ZYP A;  3FY7 A;  4CHS A;  5D9T A;  1A8Y A;  3DEX A;  5ELG A;  3FW2 A;  3O3T A;  4MF5 A;  3DD3 A;  3QCP A;  4PGT A;  3MAK A;  4FYU A;  2IMK A;  3KCM A;  6GSV A;  3ZL5 A;  5COH A;  4BVX B;  1K3L A;  4XCS A;  4G2E A;  4FH8 A;  1PA3 A;  4ZB9 A;  2ZNM A;  5EY6 A;  2HT9 A;  5H5S A;  3D21 A;  5DBQ A;  3ZRE A;  1M2A A;  3TJG A;  5IMV A;  2R0C A;  2EIQ A;  4MJC A;  4FYB A;  4HJM A;  4ECJ A;  1HNB A;  2TRX A;  4O5Q A;  1KEB A;  3M8N A;  3KTB A;  2IPA A;  3FKF A;  5L71 A;  3EPT A;  3H1N A;  3HVV A;  4JU5 A;  5J4U A;  2E2G A;  2MBT A;  3G7J A;  2F51 A;  1SJ6 A;  1ZMA A;  4BVY A;  2VCQ A;  5HR2 A;  4O7H A;  3SWL A;  3UBK A;  2DLX A;  3TDG A;  4EE0 A;  2DBC A;  1O85 A;  2FA8 A;  3Q6O A;  2DIZ A;  1VF3 A;  2IL3 A;  3MYD A;  2VCX A;  2B1K A;  3ZFL A;  2CZ3 A;  2H73 A;  5KEJ A;  1VF2 A;  4Z2T A;  4K7O A;  4MAB A;  3E9J B;  1PRX A;  1SD9 A;  1MTC A;  1J0F A;  1B9Y C;  6GSU A;  1H4O A;  4HZ2 A;  5G1L A;  5F06 A;  2HRN A;  3BJ5 A;  2GLR A;  2FWE A;  4MJA A;  4N0V A;  5ECO B;  1TK8 B;  1O7U A;  2LEG A;  5GST A;  2O85 A;  3F3Q A;  2JZS A;  4F9Z A;  4G9H A;  2PWJ A;  4JR4 A;  2X8C A;  4KE3 A;  5ID2 B;  1GH2 A;  3ERW A;  12GS A;  3GNJ A;  4KX4 A;  2R4V A;  5IIZ A;  1HD2 A;  1T3B A;  3JCM L;  2LST A;  4KF9 A;  1FAA A;  1X9M B;  5CRG A;  1TU7 A;  4LL4 B;  4AJ7 A;  5AGY A;  1HYU A;  1K0D A;  2GQK A;  3EWL A;  3K8N A;  4WXT A;  3F8U A;  1EV4 A;  3UAR A;  5AN1 A;  2VO4 A;  4ECC A;  4NV2 A;  3ME8 A;  3R2Q A;  3TJB A;  4KA0 A;  2CQ9 A;  2IME A;  2OE0 A;  3TKS E;  1XFL A;  2YV7 A;  3HZ8 A;  4CW9 A;  2H0H A;  2B3S A;  3L9V A;  3GYK A;  2L6D A;  1OC8 A;  2O7K A;  4BWQ A;  2F3M A;  2OBI A;  3IR4 A;  2C3T A;  3L9U A;  4EDY A;  1QUW A;  2CVB A;  2L6C A;  1EP7 A;  1JFU A;  5C00 A;  6GSW A;  5ECQ B;  2GSS A;  1RK4 A;  4LMV A;  2B5E A;  2MYG A;  3VWX A;  3I43 A;  2N5F A;  1GP1 A;  2GQM A;  1PL2 A;  7GSS A;  1GRX A;  2XHF A;  4HU7 A;  2MMA A;  5DCG A;  1Z6M A;  4YKG A;  4POK A;  5C04 A;  5HR3 A;  2LRN A;  3KH7 A;  8GSS A;  1K0A A;  1UA5 A;  4MK3 A;  5KN2 A;  3NIV A;  1SKW B;  5IMC A;  3RPP A;  5CRH A;  2HSH A;  2WCI A;  1BG5 A;  3EMP A;  1OVN A;  3Q19 A;  2AV4 A;  4IVF A;  5GZZ B;  3PPU A;  3D4T A;  4IBP A;  1A0F A;  2J9H A;  5CNW A;  1OE8 A;  1XWK A;  1GTB A;  5ECN B;  2NVL A;  2H70 A;  4EO3 A;  5KOW A;  3UEM A;  1SEN A;  5HR0 A;  2P5R A;  2RII A;  3GRX A;  1YEX A;  2C0G A;  4RUV A;  3FEU A;  4HQZ A;  3WGD A;  1TI3 A;  1UVZ A;  4MZB A;  4K0N A;  2YWI A;  3DVW A;  4OCE A;  3HZ4 A;  2WZ9 A;  1SYX A;  5IMD A;  1XW9 A;  4OCF A;  3HYP A;  2I81 A;  4TR0 A;  4HI7 A;  4L8E A;  3ZMK A;  2DC5 A;  5LD0 A;  1OYJ A;  5B6N A;  4POB A;  4TN8 A;  4F2I A;  2RUF A;  3QOU A;  1FOV A;  1GSF A;  4BL7 B;  5B6M A;  3KXO A;  2IJY A;  1B4Q A;  3EYT A;  2C8U A;  2EIO A;  4GF0 A;  2N5A A;  5H5R A;  3A5W A;  4ID0 A;  3FZ4 A;  4ZXG A;  3LEF A;  1X9W B;  4KDX A;  1A0R P;  2RM5 A;  4PNF A;  1EZK A;  2HFD A;  2VCV A;  3BOA A;  3PH9 A;  5EVO A;  1LU4 A;  1M2D A;  4KB3 A;  4ZL9 A;  2VL2 A;  4IHU A;  2FCH A;  4AF2 A;  4K9Z A;  2JSZ A;  2CX3 A;  2HLS A;  4TW5 A;  2DIY A;  2ES7 A;  3PGT A;  1LJR A;  2YCD A;  2R2J A;  5DDL A;  3UOM A;  1CQH A;  5FWG A;  4F0C A;  2RM6 A;  4TOP A;  4MJE A;  5ABR A;  3HVX A;  4EVM A;  2O89 A;  4J57 E;  1WP0 A;  1J9B A;  2C80 A;  5G31 A;  4Z7X A;  3VFI A;  4EUY A;  3MSZ A;  1M99 A;  3S9F A;  2DJ2 A;  2H1B A;  3C73 A;  5D9X A;  2VUP A;  1OC3 A;  5GSS A;  4JZQ A;  3F0I A;  3HJM A;  3MDK A;  3M9J A;  4XTS A;  2I9H A;  4O92 A;  4WR5 A;  2C3N A;  2I4A A;  1THO A;  2VL3 A;  4TXV A;  2DKI A;  4X4J A;  1R4W A;  2V2G A;  5LCZ A;  3QPM A;  3TRQ A;  1SKR B;  1M9A A;  3QFB C;  3ERG A;  2HI7 A;  2HRK A;  4EL1 A;  3J7Y b;  3N9J A;  4GXZ A;  2B5X A;  4MF7 A;  4POL A;  3HHV A;  4IJI A;  3G7I A;  1VRS D;  4F82 A;  2A2S A;  2K8V A;  5F07 A;  3LYK A;  3VUR A;  1OE7 A;  3CMI A;  1ZL9 A;  1SKS B;  4IKH A;  3GH9 A;  3KZQ A;  1RQM A;  2YWO A;  2EC4 A;  5CRD A;  1K3O A;  2BTO T;  2XPE A;  3DGQ A;  3D22 A;  1TOF A;  4RI7 A;  4QL9 A;  5G2Z A;  1R7H A;  5GAP D;  5DVB A;  1LBK A;  3D5J A;  3KMO A;  5F0G A;  2H1D A;  4FQU A;  3R3E A;  2H6Z A;  4WET A;  3GIX A;  1JZR A;  2TIR A;  3GUS A;  1ZYQ B;  3M3M A;  3PR8 A;  1SU9 A;  6GSX A;  2TRC P;  1M2B A;  3CSJ A;  2O8V B;  1ZGN A;  1MD4 A;  3DYR A;  4E8E A;  2JAC A;  3TB2 A;  1WJK A;  4O5R A;  4GSS A;  1EGR A;  4H86 A;  4PNG A;  3TOT A;  1ILO A;  2FLS A;  2JZR A;  3FMW A;  4MZW A;  5A4U A;  1EGO A;  4K7N A;  3WD6 A;  3NOF A;  6GST A;  1V40 A;  3CTF A;  2WB9 A;  1TK0 B;  1PGT A;  2KLX A;  4A5P A;  4FYC A;  2EIR A;  5CP1 A;  3F4R A;  3TOU A;  2KUC A;  4I6X A;  4BA7 A;  3F4T A;  5B8B A;  4PQ1 A;  2K18 A;  1DE2 A;  4KSO A;  2LJA A;  1G6W A;  4NAX A;  5DCH A;  3GV1 A;  3F3R A;  5BMU A;  4XHM A;  3CXG A;  1A2J A;  1AIU A;  3ZRD A;  5IM9 A;  4YAV A;  1BX9 A;  3EMX A;  1EP8 A;  4KDY A;  4I8B A;  3BD2 A;  5JCW A;  2MMZ A;  3RAZ A;  3IC4 A;  2WJU A;  4POM A;  2WS2 A;  1ML6 A;  1QFN A;  4AGS A;  4PX1 A;  2K6V A;  2A2P A;  3HCZ A;  3IV4 A;  4NPB A;  3DRN A;  4PUR A;  1PN0 A;  1URM A;  2AJQ B;  3ZIJ A;  4XIH A;  4DSS B;  4ZIJ A;  3ISO A;  1WWJ A;  18GS A;  2MZC A;  4GLT A;  4IJ3 A;  4IQA A;  1SL2 B;  2ZCT A;  1OC9 B;  4PXO A;  5IOX A;  4K0G A;  3LOR A;  1V2A A;  4Q5N A;  1NHO A;  3IBH A;  4QL7 A;  4MMM A;  1XWC A;  4HZ4 A;  4MNN A;  3VI7 A;  1V98 A;  1O81 A;  4AJ6 A;  3IOS A;  4V1A p;  2PPT A;  2IMD A;  1ZCP A;  2CT6 A;  4BVX A;  2FWF A;  2X49 A;  4DSS A;  4V1A g;  3C1R A;  1ERV A;  3ZIV A;  4PTS A;  2B5Y A;  4IP6 A;  4D73 B;  2YJ7 A;  2H8L A;  1ZYN A;  1EEJ A;  1BAY A;  1YKA A;  2F8A A;  1V9W A;  1YKC A;  1OC9 A;  2H0I A;  3TRP A;  1GL8 A;  2FWG A;  3W8J A;  5D96 A;  2QSI A;  3ZVJ D;  4GWR A;  2VL9 A;  1WOU A;  2GST A;  1U3I A;  3RDW A;  5JWQ B;  1GSS A;  3ZFB A;  4BWS A;  1WMJ A;  3ZML A;  2GS3 A;  2H74 A;  5DAK B;  2M46 A;  3CTG A;  1EEM A;  3NZN A;  3FHK A;  4N11 A;  1VF1 A;  1Y25 A;  2GT5 A;  1TXX A;  3LJR A;  3LG6 A;  2LNS A;  3UMA A;  2FA4 A;  1PKW A;  1G7E A;  4D73 A;  3H93 A;  2KP2 A;  1PX6 A;  1XW5 A;  2PGT A;  3QFA C;  4I97 A;  2V1M A;  3A2V A;  3A5I A;  1IYH A;  3APO A;  3BCK A;  17GS A;  2BJX A;  3QAV A;  5AIS A;  20GS A;  3GKK A;  4F03 A;  1DSB A;  5KN1 A;  1DE1 A;  2WFC A;  5F8B A;  2HZF A;  3KP9 A;  4IEL A;  1W4V A;  4ECB A;  1O8X A;  2K9F A;  1WPI A;  3A3T A;  5ID2 A;  3PIN A;  4L5O A;  3IXR A;  3VPQ A;  3LQ7 A;  2H1G A;  2H6Y A;  3HKR A;  3VWW A;  4OWY A;  1E2Y A;  2YZH A;  2R5G A;  2FY6 A;  4I5Q A;  1AQW A;  3OR5 A;  1ZZY A;  2R37 A;  5AIV A;  4X1U A;  1FG4 A;  4ZB6 A;  4ZBD A;  5D8I A;  2HXK A;  2P5Q A;  3GHA A;  1GNW A;  2MMO A;  2LQQ A;  2VCT A;  4OMV A;  1PN9 A;  1XCC A;  4OD7 A;  4ZBA A;  1XVW A;  3H8Q A;  4MJB A;  4EXJ A;  2XPD A;  4N0Z A;  3US3 A;  2HNL A;  3GFK A;  4MH2 A;  3GX8 A;  1AQX A;  5E4W A;  4K6X A;  4NWY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...