3L9VA

Crystal structure of salmonella enterica serovar typhimurium srga
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
182
structure length
182
Chain Sequence
AEWESITPPVVDAPAVVEFFSFYCPPCYAFSQTMGVDQAIRHVLPQGSRMVKYHVSLLGPLGHELTRAWALAMVMKETDVIEKAFFTAGMVEKRLHSPDDVRRVFMSATGISRGEYDRSIKSPAVNDMVALQERLFKEYGVRGTPSVYVRGRYHINNAAFGAFSVENFRSRYAAVVRKLLAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative thiol-disulfide isomerase or thioredoxin
publication title Structural and functional characterization of three DsbA paralogues from Salmonella enterica serovar typhimurium
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Oxidoreductase
total genus 57
structure length 182
sequence length 182
chains with identical sequence B, C, D, E
ec nomenclature ec 5.3.4.1: Protein disulfide-isomerase.
pdb deposition date 2010-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01323 DSBA DSBA-like thioredoxin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3l9vA00
5F0GA 3ZFBA 1V98A 1K0AA 4GCIA 2PUKC 3QD9A 3FYGA 4K2DA 2E2GA 1TRVA 2JU5A 3W8JA 1A2JA 2X99A 2IWTA 4XCSA 1B4PA 1R5PA 1THOA 5D9TA 4NAXA 1XVWA 1HNAA 2VOCA 4Q5RA 2OADA 1SL1B 2HE3A 1T4ZA 5F8BA 4OO5A 2YNXA 16GSA 3D0ZA 5G2ZA 1TRWA 3TJJA 1XZOA 1SD8A 2GSQA 1X0RA 2C0DA 2R4VA 1T3BA 2WULA 3A5WA 2LRTA 4KE3A 2YZHA 3LJRA 3RHBA 4OCEA 1UN2A 5IMAA 4OWYA 3GKKA 1BJXA 3E0UA 2YANA 4EC0A 4MK3A 4WEYA 3I69A 2KOKA 3KGKA 4WKWA 5A4VA 2FHEA 2C0GA 3KH7A 2HSHA 3TRXA 5INYA 7GSSA 2H30A 1B9YC 4BVYA 4TW5A 1K0OA 2VM2A 3PH9A 1SENA 1W4VA 3QMXA 3ERGA 4NV5A 3BBYA 5H5RA 3FZ5A 2MMOA 1DUGA 1O6JA 2I81A 3JCML 1V58A 3SBCA 4EDZA 1VGLA 1TI1A 3D5JA 3GKXA 3GX8A 2C0FA 1FB0A 3QAGA 1TRSA 4IQ1A 4F0BA 3HVXA 1GH2A 4MH3A 1TXXA 5ID2A 5ECNB 4YAPA 1PL2A 3E3EA 1DE1A 3GYKA 4YQMA 2XPDA 5LCZA 1O8WA 4WR4A 2RIIA 1GULA 3IXRA 2E7PA 2IFQB 4GXZA 10GSA 3TGZA 3ZIJA 3NZNA 1EGRA 3DD3A 3FR6A 5JCGA 3CTGA 1GL8A 1TI3A 1F3AA 3I43A 4ID0A 1G7OA 3GTUB 1FAAA 3KIJA 2HRNA 1BX9A 1XPVA 4L0UA 4LL4B 1GNWA 2VLVA 3KXOA 3ZZXA 1EP8A 4I6XA 4OMVA 2DIYA 4D73B 3H1NA 4TRXA 2B7JA 5HR0A 3IHQA 3VK9A 3H93A 4RI7A 4MF6A 5DJLA 3TJKA 1PKZA 3GKMA 2WGRA 2YWIA 2DJ0A 6GSYA 2O7KA 5DALA 4DSSA 4LL1B 1KTEA 3Q74A 2F8AA 3D22A 3DRNA 2A2SA 5CO3A 5DQSA 1YEPA 3F4SA 2R37A 4NXIA 1OC3A 3O6TA 3ED3A 2V41A 2HSYA 2WZ9A 1VF2A 1B8XA 19GSA 3CTFA 4EXJA 2DJ1A 4CDOA 1R5AA 4KNDA 2FA4A 4NHZA 1GNEA 2B5EA 2L5LA 4TXOA 1BQ7A 4POMA 1AXDA 2AUVA 4N11A 1XVQA 1PKWA 1GSSA 2H19A 4F03A 1DBYA 1XIYA 3GV1A 1EP7A 5HFGA 1X9WB 1HNCA 2REMA 1K0CA 1SJIA 4G2EA 1SYRA 4NHWA 4PURA 3UIWA 1TRUA 1AQVA 3LG6A 3DXBA 3FZ4A 1EV9A 1BAYA 3GMFA 3UVTA 2H6XA 1AIUA 4K7OA 3BOAA 4KDYA 1GSUA 3GFKA 2OKAA 5G5EA 5DAKB 4N30A 2HYXA 3BD2A 4JBBA 4L5OA 1PSQA 2CAIA 2O89A 3ME7A 4LMWA 3L78A 3LORA 1AW9A 2VLTA 4JEDA 2H1BA 3A2WA 3CMIA 2HXKA 3VWWA 2R3XA 1QXHA 2GSRA 2M46A 2LV3A 4RUVA 1XOBA 1G0TA 4PQ1A 2WRTA 3ZVJD 2OBKA 3DWVA 1T00A 3P90A 3IE3A 2CVBA 3TJBA 5KN3A 1M2DA 1ACVA 2GQKA 1QMVA 1ZYEA 3LXZA 3KZQA 3KMOA 2I9HA 4XS4A 4ZIJA 5D9VA 5DCGA 3F3QA 3M0FA 5KN2A 5AIVA 3O3TA 1V40A 3ZITA 3GSSA 1PN9A 2NBSA 1S3AA 4NMUA 3GSTA 3M8NA 4IJ3A 1ZMAA 3QAWA 4K7NA 1OAZA 1KBNA 1GWCA 3D21A 6GSTA 2YWMA 3TKQA 1M0UA 3TB2A 3TKSE 1OC9B 4DEJA 3TUEA 3TOUA 3HHVA 2IMEA 4KA0A 1KEBA 2K18A 1A2MA 1TDIA 2F51A 1N8JA 1FVKA 5JWRB 3C73A 5CREA 4L5LA 1X9MB 1SJ6A 4KH7A 5G1KA 4HU9A 2GGTA 3RPNA 3DIEA 4MF5A 3IAM2 1A0RP 2OJLA 2PVOC 1OYJA 1JFUA 2TRXA 3MSZA 2CZ2A 2VLUA 2YV9A 1NSWA 2ZUPA 3TJFA 2LTKA 1Q4JA 4O32A 2JADA 2JZRA 2GT6A 1K3OA 2N5AA 4AJ8A 1F9MA 1Z6MA 3MNGA 4TOPA 3MWHA 3ZFLA 1GTAA 1Z9HA 4G10A 3FK8A 1X5CA 1OE8A 4WBRD 4E8EA 3F6DA 1SL0B 3KM6A 3VPTA 1R7HA 3M3MA 3FKFA 4IELA 3EURA 2KP1A 3FY7A 1Z3EA 1AUCA 2XC2A 1EV4A 3TKSC 3W6GA 4JR6A 3F63A 2K6VA 2FGXA 3V1WA 2C4JA 4HEA2 5L71A 4V2NA 3WGXA 1ZCPA 5IO0A 2BJXA 3FZAA 1JZOA 4KCAA 1PQNA 4ISDA 4KUNA 2R2JA 4Z7XA 3GL5A 2V1MA 2NVLA 2LJKA 3Q18A 3F3RA 2G0FA 8GSSA 4F2IA 2B7KA 3IK9A 4K0GA 4PQIA 5E4WA 2VUPA 4LLRA 2CA8A 1SK2A 2A2RA 3R2QA 2LKUA 3ZMKA 1TKDB 5F06A 3DVWA 4RQRA 2L6DA 2IJYA 2VL9A 2XPEA 4KDXA 4LMVA 2LJRA 2MMZA 4K0NA 4MJBA 5IPHA 4MF7A 4EF0A 1NHYA 1TK5B 2GS3A 4AF2A 3KTLA 4MPGA 3DYRA 1OVNA 5EVOA 2B5YA 2C3TA 1ZZYA 2VO4A 3HKRA 2IIYA 1TU7A 3GHAA 4WF5A 5G1LA 2H0GA 3A2XA 2YP6A 4MZBA 2DIZA 2ON5A 5CRGA 4IKHA 4OCFA 4EO3A 1OE7A 3LSZA 3M9JA 2RLIA 4GSNA 5IMCA 2YJ7A 2H0HA 2AJQB 2DC5A 2FWGA 3KMNA 2O85A 14GSA 1TK8B 1QK8A 3J7Yb 2I1UA 1EOHA 1Z5YE 4O5RA 1A2LA 5ID2B 2C1YA 1ZOFA 4DSQA 1S3DA 4TR3A 5ECLB 4IBPA 3IC4A 2V6OA 1U88A 2VCVA 2WFCA 3LFLA 4XRDA 5B6MA 2I4AA 3TDGA 5F05A 3QAVA 2R5GA 2K8SA 1USBA 2FWEA 5ECKB 4G9HA 1SKWB 2YWNA 4EDYA 1Z7PA 4F82A 1TK0B 1WMJA 2P5RA 5A5KA 4QL7A 1MTCA 3VI7A 3KJYA 1XW6A 1VF4A 1V2AA 4MPFA 4MP4A 1B9XC 4O7HA 2L4QA 2QSIA 3BCIA 3MAKA 2FWHA 4P3YB 1XWGA 2IL3A 2WS2A 2HZEA 5D96A 2H1AA 4AJ6A 1FW1A 4PUFC 3UJ1A 5DALB 4ECCA 4DSSB 1EEMA 1XWAA 2FCHA 1M2AA 3D4MA 3EMPA 4POKA 5CRWA 2BMXA 1U3IA 1FVJA 3TRQA 2LQOA 9GSSA 4HJ2A 4IHUA 1SKRB 2CT6A 3WT2A 1XFLA 5D73A 2WB9A 4MJEA 2BTOT 1MD3A 2KUCA 4HUAA 3ZIVA 2DJ3A 4GSSA 4TR1A 4HQZA 1RQMA 2CAQA 1GSYA 4MZWA 5IPGA 4TXOB 1V57A 2YV7A 2PGTA 3LYKA 2AAWA 2M72A 4WF4A 1VF3A 1DE2A 4WBJA 5AGYA 3KP8A 5GSTA 3S9FA 4FYCA 3C71A 3GH9A 1H4OA 1EWXA 5G5FA 2FUG2 4F0CA 3IR4A 2NPBA 1GP1A 3HA9A 1WOUA 3TKPA 1U6TA 1GUHA 5DJMA 2P31A 5CP1A 2IPAA 2H74A 3IRAA 3G9BA 1LJRA 5ECRB 4ACSA 3CRUA 2CVDA 2NTOA 4Q5FA 20GSA 2HLSA 2O8VB 3EMXA 4EUYA 3VI5A 5CYYA 1THXA 3GKNA 2WCIA 2OACA 4OFTA 3WGEA 4MJAA 1M9AA 2F3MA 2MBTA 3QCPA 4BL7A 4HZ2A 3LEFA 4HU7A 5IMZA 3EE2A 2MZCA 1GTBA 1CQHA 4K6XA 3I9V2 4RI6A 1UC7A 3D4TA 1U3AA 3QDNA 2NDOA 5A4WA 2FWFA 4IW9A 1AAZA 4HOJA 5KN1A 3HJPA 2L4CA 2H75A 5IMFA 3I6AA 4XS4B 4IP6A 4KCEA 4BWSA 2FD3A 2FY6A 3CXGA 5ECHB 5GZZB 1YDKA 3ZRDA 2VCWA 4HDEA 4BPYA 5ECSA 1FHEA 1VF1A 2LNSA 5FHIA 2RM5A 3VFIA 4KSOA 3GL3A 5IQYA 5CAXA 1EGOA 1S3CA 3L9UA 1Y25A 6GSSA 4PNGA 4WXTA 3O76A 4BA7A 5F07A 2WJUA 1GTIA 1O8XA 4K9ZA 1YKAA 2E2MA 3M1GA 1T4YA 2YPMA 1QGVA 2FA8A 2X8GA 4QQ7A 1U87A 3GA4A 2P0GA 4J2FA 1K3LA 3H4KA 1PA3A 4ECJA 3UVHA 2IMIA 3FRCA 1DSBA 4FO5A 3KCMA 3LYPA 3EU3A 1WE0A 3EC3A 3ZMLA 3EYTA 4OFNA 3RDWA 2OBIA 2TRCP 4L0WA 3FW2A 2D2ZA 4I5QA 4TVEA 4V2MA 2A4VA 4JR4A 4GQFA 4CW9A 3GUSA 4KAEA 2H66A 3CSIA 2AHEA 1LBKA 1SK0A 3WD6A 2IMFA 2LQQA 3LXTA 4KSMA 4EL1A 3HVVA 3KH9A 4POBA 3K8NA 6GSWA 2GVPA 1WPIA 2J23A 2RUEA 2PU9C 1M9BA 1BEDA 1E6BA 1JZDA 1PMTA 3KEBA 3Q19A 3OR5A 2V6KA 3LQ7A 3U5RE 4IQAA 5CRHA 3TRPA 5B8AA 1SD9A 1SL2B 1A8YA 5FT3A 3L9VA 4FIWA 4OFMA 2QC7A 3HJOA 1FG4A 1K0DA 2HFDA 4KDUA 4HQSA 3DEXA 1QFNA 2VL3A 5ECIB 1RK4A 2PMTA 3ZTLA 1ML6A 2JZSA 3KD0A 4NV2A 4TXVA 1XWBA 1H75A 2KHPA 3CYNA 4I2UA 12GSA 3GH6A 1OKDA 4V2LA 2OE1A 4IJIA 1MDKA 3APSA 4K8MA 1EEJA 2JL4A 3H8QA 1KNGA 2YCDA 4XHMA 1LU4A 1XOAA 3RBTA 1GRXA 1NW2A 2PWJA 2AYTA 2MYGA 4MZCA 2IN3A 4L8EA 5IMDA 4E8HA 3UBLA 1ZL9A 2B1LA 3W8SA 3FZ9A 1J08A 1IYHA 2XBIA 1YY7A 1XW9A 1YF0A 3LWAA 3GIXA 4IS0A 3WYWA 4ZB8A 2GQLA 3EU4A 2GZZA 4ECBA 5B7CA 1TP9A 1QQ2A 1WP0A 1GLPA 5CRDA 1O85A 4RQXA 2XBQA 1K0BA 1EOGA 4G19A 3VURA 2L59A 1FOVA 4ECIA 3L9SA 3F4TA 1K3YA 4N10A 1ZYQB 1ZGNA 3PGTA 4F9ZA 2CX4A 3TJGA 1A24A 4NPBA 2GLRA 1ST9A 2VD0A 1IYIA 1MD4A 3CBUA 1FO5A 2HT9A 1OC8A 1HNBA 2LJAA 2GQMA 3UBKA 2EIOA 4TR0A 3UOMA 3TKRA 2J9HA 1XWKA 5J9CA 2H1DA 3Q6OA 5HR3A 3VWUA 4XS1A 4MCUA 4TN8A 5HFIA 2DMMA 5EPFA 2OA7A 4TKYA 3DVXA 4WETA 17GSA 2YJHA 4HJMA 2CX3A 2HZEB 1AQXA 2C3NA 2I3YA 4KGIA 4PQHA 4MMMA 5D8IA 3MDKA 3UARA 2VL2A 2VIMA 2N5FA 1QUWA 2DBCA 2VCXA 1ILOA 2H72A 2ZCTA 3QFAC 2JACA 5J41A 1X5DA 2R6KA 1OKTA 3FHKA 1CQGA 5AN1A 3G7JA 3FR9A 4WR5A 1SYXA 1Z7RA 3NIVA 4TR1B 1FB6A 1GSFA 4X43A 2C8UA 4XRAA 2H73A 4YH2A 2H0IA 2LRNA 1GSEA 3EVIA 2IMDA 2Z9SA 4XTSA 1XW5A 4MA9A 2CV4A 2HNLA 3EWLA 2AB6A 1A23A 1SKSB 1SU9A 1YZXA 3HY2A 1SK1A 4OD7A 2GZPA 4DSRA 2JSZA 5GSSA 3ERFA 5FWGA 4ULXA 3D6IA 1GUKA 2OE3A 2DJKA 3ZYWA 4GLTA 1G6YA 1ERVA 4IGJA 2EIRA 5DQYA 3ERWA 3HCZA 5ECQB 1J0FA 1TJDA 3G7IA 4BVXA 3H79A 4MLYA 3A2VA 3NOFA 4AJ7A 2C3QA 3KTBA 2H76A 1NHOA 1TOFA 4JZQA 13GSA 3AY8A 3WT1A 2LSTA 5J3RA 3UEMA 4OO4A 4N0VA 1T8EB 3IPZA 4FYUA 4ILFA 3A3TA 4GRFA 3ZL5A 3IDVA 2ON7A 1HYUA 1YJ6A 1M7TA 1J9BA 2JZTA 1B4QA 4KW6A 1PX6A 3RPPA 3CRTA 1TTZA 3BCKA 3LGCA 2VCQA 3ISOA 3US3A 2B5XA 1Q98A 6GSVA 6GSUA 1E2YA 4ZB9A 1YEXA 4I8BA 2RM6A 1GTUA 1AC1A 1ERTA 1YQ1A 4J57E 2EIQA 2PBJA 5IO2A 4ZBDA 5ABRA 5AISA 1T1VA 2N5BA 2YWOA 5H5SA 1WWJA 2V32A 5G30A 5KN0A 3HZ8A 4LA1A 1TU8A 2GTUA 5EL8A 1PD21 3F6FA 2P5QA 2CVKA 3UL3A 1TW9A 5IMVA 4IVFA 4V1Ag 5ELAA 3F8UA 5E59A 1YKCA 1JZWA 3KP9A 2K8VA 2C80A 4GF0A 1N2AA 1HD2A 3CSHA 2EC4A 3L4NA 2DSAA 2H8LA 3FEUA 2GT5A 5HR2A 3HYPA 5JCWA 1K0NA 3GRXA 2H70A 4MDCA 2ALBA 3P8WA 22GSA 1HQOA 3E9JB 3IAS2 3VLNA 1R4WA 1PX7A 2TIRA 4ZBBA 3QR6A 11GSA 2IFQA 5LD0A 2RUFA 5J5NA 4XIHA 4PNFA 4PUAA 2ES7A 2VAFA 4XS6A 4POLA 5HQPA 2VD1A 3C1RA 2IMKA 3GTUA 5GAPD 2B6MA 5DDLA 4HI7A 1XCCA 4X0XA 3PINA 1G7EA 4D73A 4YAVA 4GWRA 3L0HA 1JZRA 4I97A 4YQVA 3F9UA 4V1Ap 4BWQA 1SJZA 1UA5A 4K7IA 5DCHA 3CSJA 1MDJA 4MJCA 2L6CA 3APOA 2DLXA 4FYBA 2GSTA 1RW1A 4GQCA 5IM9A 1K0MA 2F9SA 4I2TA 1I5GA 5ECPB 1ON4A 3DMLA 2H71A 5KEJA 3QOUA 2L5OA 3IA1A 2JSYA 5ECMB 3HXSA 1R26A 2E0QA 1F6MC 5HFKA 2DJ2A 2DJJA 3GX0A 3TOTA 5IOXA 3HJMA 5J9BA 4EKZA 5ECOB 4EVMA 1M2BA 1GUMA 5ELGA 3HZ4A 4PX1A 4KB3A 3F0IA 1PGTA 2C0EA 3RAZA 4MH2A 3TCOA 5EY6A 4AGSA 1GSQA 3APQA 4K1FA 1JHBA 4Q5NA 3DKSA 2KP2A 4HS1A 2B3SA 4PXOA 2WDUA 5B6NA 3GURA 1X5EA 5HR1A 3QPMA 3VWVA 2L57A 1M99A 4GTUA 3IK7A 2H1GA 2H6ZA 2X64A 2VCTA 1XBSA 3SWLA 4ZILA 4ZBAA 1ERWA 2LUSA 3QFBC 1O7UA 1C72A 5DAKA 5JWQB 5GAND 1GSDA 1I9DA 2QGVA 5DVBA 1ABAA 2O87A 5JWOB 3IBHA 3P2AA 3N5OA 4EE0A 2YZUA 5C04A 1MDIA 3GNJA 3M9KA 3C7MA 2V2GA 4Q5QA 2VM1A 3C8EA 4FH8A 1PRXA 2AV4A 1URMA 3WGDA 3ZVJA 1G6WA 1T7PB 2PVQA 4NWYA 1MEKA 2HZFA 3HDCA 4MABA 2MBSA 4H86A 2LS5A 4N0ZA 2CZ3A 4QL9A 5G31A 2K9FA 3ME8A 3HD5A 4ZL8A 1Y6EA 1VRSD 2LNTA 18GSA 1AQWA 2HI7A 4J56E 1O73A 3EINA 1W89A 1V9WA 2YOIA 3VWXA 2G2QA 3IV4A 5ENUA 3PR8A 3UMAA 1OC9A 3BJ5A 4JRRA 2F8FA 3ZREA 2M80A 1YF1A 1WIKA 1PL1A 5J4UA 5COHA 5IIZA 3DGQA 2H01A 3VPQA 2QKEA 2LRCA 5H5QA 1EZKA 1O81A 1Z6NA 2HRFA 3UAPA 2PPTA 2VL2C 2GSSA 2MMAA 1JLWA 4ZL9A 4KX4A 1XWCA 5A4UA 4X1UA 2KLXA 3HVSA 3U6VA 2X8CA 1GLQA 5CNWA 2CQ9A 1BG5A 3RHCA 2H6YA 5B8BA 3IOSA 4IN0A 3P7XA 2X8HA 3C1SA 5AIXA 5DBQA 3ZLPA 1X9SB 5C00A 4ML1A 1WJKA 2YN1A 6GSXA 2GZYA 3G7YA 4GSTA 4JU5A 4YQUA 5LNKe 1JLVA 1WRYA 1F2EA 1XXUA 1ERUA 5D9WA 2MMNA 2PN8A 1BYEA 1B48A 1NM3A 2XHFA 4ML6A 3F4RA 2PERA 3J7Yk 1F3BA 4ZXGA 1A8LA 2GDRA 2B1KA 2VCZA 3FR3A 3TKSA 3GN3A 2DMLA 1F37A 5IOWA 4PGTA 2ZNMA 4ZB6A 5JCUA 2OE0A 2LEGA 1UVZA 5D9XA 4TR4A 4DVCA 4O92A 1A0FA 2FNOA 5D93A 4ZL7A 3N9JA 4JE1A 2FLSA 4CHSA 4HZ4A 4IP1A
chains in the Genus database with same CATH superfamily
5F0GA 3ZFBA 1V98A 1K0AA 4GCIA 2PUKC 3QD9A 3FYGA 4K2DA 2E2GA 1TRVA 2JU5A 3W8JA 1A2JA 2X99A 2IWTA 4XCSA 1B4PA 1R5PA 1THOA 5D9TA 4NAXA 1XVWA 1HNAA 2VOCA 4Q5RA 2OADA 1SL1B 2HE3A 1T4ZA 2UZ8A 5F8BA 4OO5A 2YNXA 16GSA 3D0ZA 5G2ZA 1TRWA 3TJJA 1XZOA 1SD8A 2GSQA 1X0RA 2C0DA 2R4VA 1T3BA 2WULA 3A5WA 2LRTA 4KE3A 2YZHA 3LJRA 3RHBA 4OCEA 1UN2A 5IMAA 4OWYA 3GKKA 1BJXA 3E0UA 2YANA 4EC0A 4MK3A 4WEYA 3I69A 2KOKA 3KGKA 4YKGA 4WKWA 5A4VA 2FHEA 2C0GA 3KH7A 2HSHA 3TRXA 5INYA 7GSSA 2H30A 1B9YC 4BVYA 4TW5A 1K0OA 3IHGA 2VM2A 3PH9A 1SENA 1W4VA 3QMXA 3ERGA 4NV5A 3BBYA 5H5RA 3FZ5A 2MMOA 1DUGA 1O6JA 2I81A 3JCML 1V58A 3SBCA 4EDZA 1VGLA 1TI1A 3D5JA 3GKXA 3GX8A 2C0FA 1FB0A 3QAGA 4Z2TA 1TRSA 4IQ1A 4F0BA 3HVXA 1GH2A 4MH3A 1TXXA 5ID2A 5ECNB 4YAPA 1PL2A 3E3EA 1DE1A 3GYKA 4YQMA 2XPDA 5LCZA 1O8WA 4WR4A 2RIIA 1GULA 3IXRA 2E7PA 2IFQB 4GXZA 10GSA 3TGZA 3ZIJA 3NZNA 1EGRA 3DD3A 3FR6A 1M3JA 3CTGA 5JCGA 1GL8A 1TI3A 1F3AA 3I43A 4ID0A 1G7OA 3GTUB 1FAAA 3KIJA 2HRNA 1BX9A 1XPVA 4L0UA 4LL4B 1GNWA 2VLVA 3KXOA 3ZZXA 1EP8A 4I6XA 4OMVA 4YKFA 2DIYA 4D73B 3H1NA 4TRXA 2B7JA 5HR0A 3IHQA 3VK9A 3H93A 4RI7A 4MF6A 5DJLA 3TJKA 1PKZA 3GKMA 2WGRA 2YWIA 2DJ0A 6GSYA 2O7KA 5DALA 4DSSA 4LL1B 1KTEA 3Q74A 2F8AA 3D22A 3DRNA 2A2SA 5CO3A 5DQSA 1YEPA 3F4SA 2R37A 4NXIA 1OC3A 4Z2RA 3O6TA 3ED3A 4G0LA 2V41A 2HSYA 2WZ9A 1VF2A 1B8XA 19GSA 3CTFA 4EXJA 2DJ1A 4CDOA 1R5AA 4KNDA 2FA4A 4NHZA 1GNEA 2B5EA 2L5LA 4TXOA 1BQ7A 4POMA 1AXDA 2AUVA 4N11A 1XVQA 1PKWA 1GSSA 2H19A 4F03A 1DBYA 1XIYA 3GV1A 3R3EA 1EP7A 5HFGA 1X9WB 1HNCA 2X49A 2REMA 1K0CA 1SJIA 4G2EA 1SYRA 4NHWA 4PURA 3UIWA 1TRUA 1AQVA 3LG6A 3DXBA 3FZ4A 1EV9A 1BAYA 3GMFA 3UVTA 2H6XA 1AIUA 4K7OA 3BOAA 4KDYA 1GSUA 3GFKA 2OKAA 5G5EA 5DAKB 4N30A 2HYXA 3BD2A 4JBBA 4L5OA 1PSQA 2CAIA 2O89A 3ME7A 4LMWA 3L78A 3LORA 1AW9A 2VLTA 4JEDA 2H1BA 3A2WA 3CMIA 2HXKA 3VWWA 2R3XA 1QXHA 2GSRA 2M46A 2LV3A 4RUVA 1XOBA 1ZYNA 1G0TA 4PQ1A 2WRTA 3ZVJD 2OBKA 3DWVA 1T00A 3P90A 3IE3A 2CVBA 3TJBA 5KN3A 1M2DA 1ACVA 2GQKA 1QMVA 1ZYEA 3LXZA 3KZQA 3KMOA 2I9HA 4XS4A 4ZIJA 5D9VA 5DCGA 3F3QA 3M0FA 5KN2A 5AIVA 3O3TA 1V40A 3ZITA 3GSSA 1PN9A 2NBSA 1S3AA 4NMUA 3GSTA 3M8NA 4IJ3A 1ZMAA 3QAWA 4K7NA 1OAZA 1KBNA 1GWCA 3D21A 6GSTA 2YWMA 3TKQA 1M0UA 3TB2A 3TKSE 1OC9B 4DEJA 3TUEA 3TOUA 3HHVA 2IMEA 4KA0A 2QA1A 1KEBA 3FMWA 2K18A 1A2MA 1TDIA 2F51A 1N8JA 1FVKA 5JWRB 3C73A 5CREA 4L5LA 1X9MB 1SJ6A 4KH7A 5G1KA 4HU9A 2GGTA 3RPNA 3DIEA 4MF5A 3IAM2 1A0RP 2OJLA 2PVOC 1OYJA 1JFUA 2TRXA 3MSZA 2CZ2A 2VLUA 2YV9A 1NSWA 2X4AA 2ZUPA 3TJFA 2LTKA 1Q4JA 4O32A 2JADA 2JZRA 2GT6A 1K3OA 2N5AA 4AJ8A 1F9MA 1Z6MA 3MNGA 4TOPA 3MWHA 3ZFLA 1GTAA 1Z9HA 4G10A 3FK8A 1X5CA 1OE8A 4WBRD 4E8EA 3F6DA 1SL0B 3KM6A 3VPTA 1R7HA 3M3MA 3FKFA 4IELA 3EURA 2KP1A 3FY7A 3A5IA 1Z3EA 1AUCA 2XC2A 1EV4A 3TKSC 3W6GA 4JR6A 3F63A 2K6VA 2QA2A 2FGXA 3V1WA 2C4JA 4HEA2 5L71A 4V2NA 3WGXA 1ZCPA 5IO0A 2BJXA 3FZAA 1JZOA 4KCAA 1PQNA 4ISDA 4KUNA 2R2JA 4Z7XA 3GL5A 2V1MA 2NVLA 2LJKA 3Q18A 3F3RA 2G0FA 8GSSA 4F2IA 2B7KA 3IK9A 4K0GA 4PQIA 5E4WA 2VUPA 4LLRA 2CA8A 1SK2A 2A2RA 3R2QA 2LKUA 3ZMKA 1TKDB 5F06A 3DVWA 4RQRA 2L6DA 2IJYA 2VL9A 2XPEA 4KDXA 4LMVA 2LJRA 2MMZA 4K0NA 4MJBA 5IPHA 4MF7A 4EF0A 1NHYA 1TK5B 2GS3A 4AF2A 3KTLA 4MPGA 3DYRA 1OVNA 5EVOA 4USSA 2B5YA 2C3TA 1ZZYA 2VO4A 3HKRA 2IIYA 1TU7A 3GHAA 4WF5A 5G1LA 2H0GA 3A2XA 2YP6A 4MZBA 2DIZA 2ON5A 5CRGA 4IKHA 4OCFA 4EO3A 1OE7A 3LSZA 3M9JA 2RLIA 4GSNA 5IMCA 2YJ7A 2H0HA 2AJQB 2DC5A 2FWGA 3KMNA 2O85A 14GSA 1TK8B 1QK8A 3J7Yb 2I1UA 1EOHA 1Z5YE 4O5RA 1A2LA 5ID2B 2C1YA 1ZOFA 4DSQA 1S3DA 4TR3A 5ECLB 4IBPA 3IC4A 2V6OA 1U88A 2VCVA 2WFCA 3LFLA 4XRDA 5B6MA 2I4AA 3TDGA 5F05A 3QAVA 2R5GA 2K8SA 1USBA 2FWEA 5ECKB 4G9HA 4K5RA 1SKWB 2YWNA 4EDYA 1Z7PA 4F82A 1TK0B 1WMJA 1XG8A 2P5RA 5A5KA 4QL7A 1MTCA 3VI7A 3KJYA 1XW6A 1VF4A 1V2AA 4MPFA 4MP4A 1B9XC 4O7HA 2L4QA 4PTSA 2QSIA 3BCIA 3MAKA 2FWHA 4P3YB 1XWGA 2IL3A 2WS2A 2HZEA 5D96A 2H1AA 4AJ6A 1FW1A 4PUFC 3UJ1A 5DALB 4ECCA 4DSSB 1EEMA 1XWAA 2FCHA 1M2AA 3D4MA 3EMPA 4K2XA 4POKA 5CRWA 2BMXA 1U3IA 1FVJA 3TRQA 2LQOA 9GSSA 4FQUA 4HJ2A 4IHUA 1SKRB 2CT6A 3WT2A 1XFLA 5D73A 2WB9A 4MJEA 2BTOT 1MD3A 2KUCA 4HUAA 3ZIVA 2DJ3A 4GSSA 4TR1A 4HQZA 2A4HA 1RQMA 2CAQA 1GSYA 4MZWA 5IPGA 4TXOB 4CY8A 1V57A 2YV7A 2PGTA 3LYKA 2AAWA 2M72A 4WF4A 1VF3A 1DE2A 4WBJA 5AGYA 3KP8A 5GSTA 3S9FA 4FYCA 3C71A 3GH9A 1H4OA 3LW9A 1EWXA 5G5FA 2FUG2 4F0CA 3IR4A 2NPBA 1GP1A 3HA9A 1WOUA 3TKPA 1U6TA 1GUHA 5DJMA 2P31A 5CP1A 3HVNA 2IPAA 2H74A 3IRAA 3G9BA 1LJRA 5ECRB 4ACSA 3CRUA 2CVDA 2NTOA 4Q5FA 20GSA 2HLSA 2O8VB 3EMXA 4EUYA 3VI5A 5CYYA 1THXA 3GKNA 2WCIA 2OACA 4OFTA 3WGEA 4MJAA 1M9AA 2F3MA 2MBTA 3QCPA 4BL7A 4HZ2A 3LEFA 4HU7A 5IMZA 3EE2A 2MZCA 1GTBA 1CQHA 4K6XA 3I9V2 4RI6A 1UC7A 3D4TA 1U3AA 3QDNA 2NDOA 5A4WA 2FWFA 4IW9A 1AAZA 4HOJA 5KN1A 3HJPA 2L4CA 2H75A 5IMFA 3I6AA 4XS4B 4IP6A 4KCEA 4BWSA 2FD3A 2FY6A 3CXGA 5ECHB 1FOHA 5GZZB 1YDKA 4KF9A 2VCWA 4HDEA 3ZRDA 4BPYA 5ECSA 1FHEA 1VF1A 2LNSA 5FHIA 2RM5A 3VFIA 4KSOA 3GL3A 5IQYA 5CAXA 1EGOA 1S3CA 3L9UA 1Y25A 6GSSA 4PNGA 4WXTA 3O76A 3MYDA 4BA7A 5F07A 2WJUA 1GTIA 1O8XA 4G0KA 4K9ZA 1YKAA 2E2MA 3M1GA 1T4YA 2YPMA 1QGVA 2FA8A 2X8GA 4QQ7A 1U87A 3GA4A 2P0GA 4J2FA 1K3LA 3H4KA 4A5PA 1PA3A 4ECJA 3UVHA 2IMIA 3FRCA 1DSBA 4FO5A 3KCMA 3LYPA 3EU3A 1WE0A 3EC3A 3ZMLA 3EYTA 4OFNA 3RDWA 2OBIA 2TRCP 4L0WA 3FW2A 2D2ZA 4I5QA 4TVEA 4V2MA 2A4VA 4JR4A 4GQFA 4CW9A 3GUSA 4KAEA 2H66A 3CSIA 2AHEA 1LBKA 1SK0A 3WD6A 2IMFA 2LQQA 3LXTA 4KSMA 4EL1A 3HVVA 3KH9A 4POBA 3K8NA 6GSWA 2GVPA 1WPIA 2J23A 2RUEA 4HSCX 2PU9C 1M9BA 1BEDA 1E6BA 1JZDA 1PMTA 3KEBA 3Q19A 3OR5A 2V6KA 1S3RA 3LQ7A 3U5RE 4IQAA 5CRHA 3TRPA 5B8AA 1SD9A 1SL2B 1A8YA 5FT3A 3L9VA 4FIWA 4OFMA 2QC7A 3HJOA 1FG4A 1K0DA 2HFDA 4KDUA 4HQSA 3DEXA 1QFNA 2VL3A 5ECIB 1RK4A 2PMTA 3ZTLA 1ML6A 2JZSA 3KD0A 4NV2A 4TXVA 1XWBA 1H75A 2KHPA 3CYNA 4I2UA 12GSA 3GH6A 1OKDA 4V2LA 2OE1A 4IJIA 1MDKA 3APSA 4K8MA 3CQFA 1EEJA 2JL4A 3H8QA 1KNGA 2YCDA 4XHMA 1LU4A 4ICYA 1XOAA 3RBTA 1GRXA 1NW2A 2PWJA 2AYTA 2MYGA 4MZCA 2IN3A 4L8EA 5IMDA 4E8HA 3UBLA 1ZL9A 2B1LA 3W8SA 3FZ9A 1J08A 1IYHA 2XBIA 1YY7A 1XW9A 1YF0A 3LWAA 3GIXA 4IS0A 3WYWA 4ZB8A 2GQLA 3EU4A 2GZZA 4ECBA 5B7CA 1TP9A 1QQ2A 1WP0A 1GLPA 2R0PA 5CRDA 1O85A 4RQXA 2XBQA 1K0BA 1EOGA 4G19A 3VURA 2L59A 1FOVA 4ECIA 3L9SA 3F4TA 1K3YA 4N10A 1ZYQB 1ZGNA 3PGTA 4F9ZA 2CX4A 3TJGA 1A24A 4NPBA 2GLRA 1ST9A 2VD0A 1IYIA 1MD4A 3CBUA 1FO5A 2HT9A 1OC8A 1HNBA 2R0CA 2LJAA 2GQMA 3UBKA 2EIOA 4TR0A 3UOMA 3TKRA 2J9HA 1XWKA 5J9CA 2H1DA 3EPTA 4O5QA 3Q6OA 5HR3A 3VWUA 4XS1A 4MCUA 4TN8A 5HFIA 2DMMA 3MIXA 2R0GA 4O5UA 5EPFA 2OA7A 4TKYA 3DVXA 4WETA 17GSA 2YJHA 4HJMA 2CX3A 2HZEB 1AQXA 2C3NA 2I3YA 4KGIA 4PQHA 4MMMA 5D8IA 3MDKA 3UARA 2VL2A 2VIMA 2N5FA 1QUWA 2DBCA 2VCXA 1ILOA 2H72A 2ZCTA 3QFAC 2JACA 5J41A 1X5DA 2R6KA 5KOXA 1OKTA 3FHKA 1CQGA 5AN1A 3G7JA 3FR9A 4WR5A 1SYXA 1Z7RA 3NIVA 4TR1B 1FB6A 4Z2UA 1GSFA 4X43A 2C8UA 4XRAA 2H73A 4YH2A 2H0IA 2LRNA 1GSEA 3EVIA 2IMDA 2Z9SA 4XTSA 1XW5A 4MA9A 2CV4A 2HNLA 3EWLA 2AB6A 1A23A 1SKSB 1SU9A 1YZXA 1ZYPA 3HY2A 1SK1A 4K5SA 2GZPA 4OD7A 4DSRA 2JSZA 5GSSA 3ERFA 5FWGA 4ULXA 3D6IA 2A2PA 1GUKA 2OE3A 2DJKA 3ZYWA 4GLTA 1G6YA 1ERVA 4IGJA 2EIRA 5DQYA 3ERWA 4EIPA 3HCZA 5ECQB 1J0FA 1TJDA 3G7IA 4BVXA 3H79A 4MLYA 3A2VA 3NOFA 4AJ7A 2C3QA 3KTBA 2H76A 1NHOA 1TOFA 4BL7B 4JZQA 13GSA 3AY8A 3WT1A 2LSTA 5J3RA 3UEMA 4OO4A 4N0VA 1T8EB 3IPZA 4FYUA 4ILFA 3A3TA 4GRFA 3ZL5A 3IDVA 2ON7A 1HYUA 1YJ6A 1M7TA 1J9BA 2JZTA 1B4QA 4KW6A 1PX6A 3RPPA 3CRTA 1TTZA 2HRAA 3BCKA 3LGCA 2VCQA 3ISOA 3US3A 2B5XA 1PN0A 1Q98A 6GSVA 6GSUA 1E2YA 4ZB9A 1YEXA 4I8BA 2RM6A 1GTUA 1AC1A 1ERTA 1YQ1A 4J57E 2EIQA 2PBJA 5IO2A 4ZBDA 5ABRA 5AISA 1T1VA 2N5BA 2YWOA 5H5SA 1WWJA 4EIQA 2V32A 5G30A 5KN0A 3HZ8A 4LA1A 1TU8A 2GTUA 5EL8A 1PD21 3F6FA 2P5QA 2CVKA 3UL3A 1TW9A 5IMVA 4IVFA 4V1Ag 5ELAA 4X4JA 3F8UA 1PFOA 5E59A 1YKCA 5BRTA 1JZWA 3KP9A 2K8VA 2C80A 4GF0A 1N2AA 1HD2A 3CSHA 2EC4A 3L4NA 2DSAA 2H8LA 3FEUA 2GT5A 5HR2A 3HYPA 5JCWA 1K0NA 3GRXA 2H70A 4MDCA 2ALBA 3P8WA 22GSA 1HQOA 3E9JB 3IAS2 3VLNA 1R4WA 1PX7A 2TIRA 4ZBBA 3QR6A 11GSA 2IFQA 5LD0A 2RUFA 5J5NA 4XIHA 4PNFA 4PUAA 2ES7A 2VAFA 4XS6A 4POLA 5HQPA 2VD1A 3C1RA 2IMKA 3GTUA 5GAPD 2B6MA 5DDLA 4HI7A 1XCCA 4X0XA 3PINA 1G7EA 4D73A 4YAVA 4GWRA 3L0HA 1JZRA 4I97A 4YQVA 3F9UA 4V1Ap 4BWQA 1SJZA 1UA5A 4K7IA 5DCHA 3CSJA 1MDJA 4MJCA 2L6CA 3APOA 2DLXA 4FYBA 2GSTA 1RW1A 4GQCA 5IM9A 1K0MA 2F9SA 4I2TA 1I5GA 5ECPB 5BMUA 1ON4A 3DMLA 2H71A 5KEJA 3QOUA 2L5OA 3IA1A 2JSYA 5ECMB 3HXSA 1R26A 5KOWA 2E0QA 1F6MC 5HFKA 2DJ2A 2DJJA 3GX0A 3TOTA 5IOXA 3HJMA 5J9BA 4EKZA 5ECOB 4EVMA 1M2BA 1GUMA 5ELGA 3HZ4A 4PX1A 4KB3A 3F0IA 1PGTA 2C0EA 3RAZA 4MH2A 3TCOA 5EY6A 4AGSA 1GSQA 3APQA 4K1FA 1JHBA 4Q5NA 3DKSA 2KP2A 3IC8A 4HS1A 2B3SA 4PXOA 2WDUA 3PPUA 5B6NA 3GURA 1X5EA 5HR1A 3QPMA 3VWVA 2L57A 1M99A 4GTUA 3IK7A 2H1GA 2H6ZA 2X64A 2VCTA 1XBSA 3SWLA 4CY6A 4ZILA 4ZBAA 1ERWA 2LUSA 3QFBC 1O7UA 1C72A 5DAKA 5JWQB 1M3IA 5GAND 1GSDA 1I9DA 2QGVA 5DVBA 1ABAA 2O87A 5JWOB 2HRKA 3IBHA 3P2AA 3N5OA 4EE0A 2YZUA 5C04A 1MDIA 3GNJA 2HSMA 3C7MA 3M9KA 2V2GA 4Q5QA 2VM1A 3C8EA 4FH8A 1PRXA 2AV4A 1URMA 3WGDA 3ZVJA 1G6WA 1T7PB 2PVQA 4NWYA 1MEKA 2HZFA 3HDCA 4MABA 2MBSA 4H86A 2LS5A 4N0ZA 2CZ3A 4QL9A 5G31A 2K9FA 3ME8A 3HD5A 4ZL8A 1Y6EA 1VRSD 2LNTA 18GSA 1AQWA 2HI7A 4MNNA 4J56E 1O73A 3EINA 1W89A 1V9WA 2YOIA 3VWXA 2G2QA 3IV4A 5ENUA 3PR8A 3UMAA 1OC9A 3BJ5A 4JRRA 2F8FA 3ZREA 2M80A 1YF1A 1WIKA 1PL1A 5J4UA 5COHA 5IIZA 3DGQA 2H01A 3VPQA 2QKEA 2LRCA 5H5QA 1EZKA 1O81A 1Z6NA 2HRFA 3UAPA 2PPTA 2VL2C 2GSSA 2MMAA 1JLWA 4ZL9A 4KX4A 1XWCA 5A4UA 4X1UA 2KLXA 3HVSA 3U6VA 2X8CA 1GLQA 5CNWA 2CQ9A 1BG5A 3RHCA 2H6YA 5B8BA 3IOSA 4IN0A 3P7XA 2X8HA 3C1SA 5AIXA 5DBQA 3ZLPA 1X9SB 5C00A 4ML1A 1WJKA 2YN1A 6GSXA 2GZYA 3G7YA 4GSTA 4JU5A 4YQUA 5LNKe 1JLVA 1WRYA 1F2EA 1XXUA 1ERUA 5D9WA 2MMNA 2PN8A 1BYEA 1B48A 1NM3A 2XHFA 4ML6A 3F4RA 2PERA 3J7Yk 1F3BA 4ZXGA 1A8LA 2GDRA 2B1KA 2VCZA 3FR3A 3TKSA 3GN3A 2DMLA 1F37A 5IOWA 4PGTA 2ZNMA 4ZB6A 2DKIA 5JCUA 2OE0A 2LEGA 4BIKA 1UVZA 5D9XA 4BVXB 4TR4A 2DKHA 4DVCA 4BVYB 4O92A 1A0FA 2FNOA 4G0IA 5D93A 4ZL7A 3N9JA 4JE1A 2FLSA 4CHSA 4HZ4A 4IP1A
chains in the Genus database with same CATH topology
5F0GA 3ZFBA 1V98A 1K0AA 4GCIA 2PUKC 3QD9A 3FYGA 4K2DA 2E2GA 1TRVA 2JU5A 3W8JA 1A2JA 2X99A 2IWTA 4XCSA 1B4PA 1R5PA 1THOA 5D9TA 4NAXA 1XVWA 1HNAA 2VOCA 4Q5RA 2OADA 1SL1B 2HE3A 1T4ZA 2UZ8A 5F8BA 4OO5A 2YNXA 16GSA 3D0ZA 5G2ZA 1TRWA 3TJJA 1XZOA 1SD8A 2GSQA 1X0RA 2C0DA 2R4VA 1T3BA 2WULA 3A5WA 2LRTA 4KE3A 2YZHA 3LJRA 3RHBA 4OCEA 1UN2A 5IMAA 4OWYA 3GKKA 1BJXA 3E0UA 2YANA 4EC0A 4MK3A 4WEYA 3I69A 2KOKA 3KGKA 4YKGA 4WKWA 5A4VA 2FHEA 2C0GA 3KH7A 2HSHA 3TRXA 5INYA 7GSSA 2H30A 1B9YC 4BVYA 4TW5A 1K0OA 3IHGA 2VM2A 3PH9A 1SENA 1W4VA 3QMXA 3ERGA 4NV5A 3BBYA 5H5RA 3FZ5A 2MMOA 1DUGA 1O6JA 2I81A 3JCML 1V58A 3SBCA 4EDZA 1VGLA 1TI1A 3D5JA 3GKXA 3GX8A 2C0FA 1FB0A 3QAGA 4Z2TA 1TRSA 4IQ1A 4F0BA 3HVXA 1GH2A 4MH3A 1TXXA 5ID2A 5ECNB 4YAPA 1PL2A 3E3EA 1DE1A 3GYKA 4YQMA 2XPDA 5LCZA 1O8WA 4WR4A 2RIIA 1GULA 3IXRA 2E7PA 2IFQB 4GXZA 10GSA 3TGZA 3ZIJA 3NZNA 1EGRA 3DD3A 3FR6A 5JCGA 3CTGA 1GL8A 1TI3A 1F3AA 3I43A 4ID0A 1G7OA 3GTUB 1FAAA 3KIJA 2HRNA 1BX9A 1XPVA 4L0UA 4LL4B 1GNWA 2VLVA 3KXOA 3ZZXA 1EP8A 4I6XA 4OMVA 4YKFA 2DIYA 4D73B 3H1NA 4TRXA 2B7JA 5HR0A 3IHQA 3VK9A 3H93A 4RI7A 4MF6A 5DJLA 3TJKA 1PKZA 3GKMA 2WGRA 2YWIA 2DJ0A 6GSYA 2O7KA 5DALA 4DSSA 4LL1B 1KTEA 3Q74A 2F8AA 3D22A 3DRNA 2A2SA 5CO3A 5DQSA 1YEPA 3F4SA 2R37A 4NXIA 1OC3A 4Z2RA 3O6TA 3ED3A 4G0LA 2V41A 2HSYA 2WZ9A 1VF2A 1B8XA 19GSA 3CTFA 4EXJA 2DJ1A 4CDOA 1R5AA 4KNDA 2FA4A 4NHZA 1GNEA 2B5EA 2L5LA 4TXOA 1BQ7A 4POMA 1AXDA 2AUVA 4N11A 1XVQA 1PKWA 1GSSA 2H19A 4F03A 1DBYA 1XIYA 3GV1A 3R3EA 1EP7A 5HFGA 1X9WB 1HNCA 2X49A 2REMA 1K0CA 1SJIA 4G2EA 1SYRA 4NHWA 4PURA 3UIWA 1TRUA 1AQVA 3LG6A 3DXBA 3FZ4A 1EV9A 1BAYA 3GMFA 3UVTA 2H6XA 1AIUA 4K7OA 3BOAA 4KDYA 1GSUA 3GFKA 2OKAA 5G5EA 5DAKB 4N30A 2HYXA 3BD2A 4JBBA 4L5OA 1PSQA 2CAIA 2O89A 3ME7A 4LMWA 3L78A 3LORA 1AW9A 2VLTA 4JEDA 2H1BA 3A2WA 3CMIA 2HXKA 3VWWA 2R3XA 1QXHA 2GSRA 2M46A 2LV3A 4RUVA 1XOBA 1ZYNA 1G0TA 4PQ1A 2WRTA 3ZVJD 2OBKA 3DWVA 1T00A 3P90A 3IE3A 2CVBA 3TJBA 5KN3A 1M2DA 1ACVA 2GQKA 1QMVA 1ZYEA 3LXZA 3KZQA 3KMOA 2I9HA 4XS4A 4ZIJA 5D9VA 5DCGA 3F3QA 3M0FA 5KN2A 5AIVA 3O3TA 1V40A 3ZITA 3GSSA 1PN9A 2NBSA 1S3AA 4NMUA 3GSTA 3M8NA 4IJ3A 1ZMAA 3QAWA 4K7NA 1OAZA 1KBNA 1GWCA 3D21A 6GSTA 2YWMA 3TKQA 1M0UA 3TB2A 3TKSE 1OC9B 4DEJA 3TUEA 3TOUA 3HHVA 2IMEA 4KA0A 2QA1A 1KEBA 3FMWA 2K18A 1A2MA 1TDIA 2F51A 1N8JA 1FVKA 5JWRB 3C73A 5CREA 4L5LA 1X9MB 1SJ6A 4KH7A 5G1KA 4HU9A 2GGTA 3RPNA 3DIEA 4MF5A 3IAM2 1A0RP 2OJLA 2PVOC 1OYJA 1JFUA 2TRXA 3MSZA 2CZ2A 2VLUA 2YV9A 1NSWA 2X4AA 2ZUPA 3TJFA 2LTKA 1Q4JA 4O32A 2JADA 2JZRA 2GT6A 1K3OA 2N5AA 4AJ8A 1F9MA 1Z6MA 3MNGA 4TOPA 3MWHA 3ZFLA 1GTAA 1Z9HA 4G10A 3FK8A 1X5CA 1OE8A 4WBRD 4E8EA 3F6DA 1SL0B 3KM6A 3VPTA 1R7HA 3M3MA 3FKFA 4IELA 3EURA 2KP1A 3FY7A 3A5IA 1Z3EA 1AUCA 2XC2A 1EV4A 3TKSC 3W6GA 4JR6A 3F63A 2K6VA 2QA2A 2FGXA 3V1WA 2C4JA 4HEA2 5L71A 4V2NA 3WGXA 1ZCPA 5IO0A 2BJXA 3FZAA 1JZOA 4KCAA 1PQNA 4ISDA 4KUNA 2R2JA 4Z7XA 3GL5A 2V1MA 2NVLA 2LJKA 3Q18A 3F3RA 2G0FA 8GSSA 4F2IA 2B7KA 3IK9A 4K0GA 4PQIA 5E4WA 2VUPA 4LLRA 2CA8A 1SK2A 2A2RA 3R2QA 2LKUA 3ZMKA 1TKDB 5F06A 3DVWA 4RQRA 2L6DA 2IJYA 2VL9A 2XPEA 4KDXA 4LMVA 2LJRA 2MMZA 4K0NA 4MJBA 5IPHA 4MF7A 4EF0A 1NHYA 1TK5B 2GS3A 4AF2A 3KTLA 4MPGA 3DYRA 1OVNA 5EVOA 4USSA 2B5YA 2C3TA 1ZZYA 2VO4A 3HKRA 2IIYA 1TU7A 3GHAA 4WF5A 5G1LA 2H0GA 3A2XA 2YP6A 4MZBA 2DIZA 2ON5A 5CRGA 4IKHA 4OCFA 4EO3A 1OE7A 3LSZA 3M9JA 2RLIA 4GSNA 5IMCA 2YJ7A 2H0HA 2AJQB 2DC5A 2FWGA 3KMNA 2O85A 14GSA 1TK8B 1QK8A 3J7Yb 2I1UA 1EOHA 1Z5YE 4O5RA 1A2LA 5ID2B 2C1YA 1ZOFA 4DSQA 1S3DA 4TR3A 5ECLB 4IBPA 3IC4A 2V6OA 1U88A 2VCVA 2WFCA 3LFLA 4XRDA 5B6MA 2I4AA 3TDGA 5F05A 3QAVA 2R5GA 2K8SA 1USBA 2FWEA 5ECKB 4G9HA 4K5RA 1SKWB 2YWNA 4EDYA 1Z7PA 4F82A 1TK0B 1WMJA 2P5RA 5A5KA 4QL7A 1MTCA 3VI7A 3KJYA 1XW6A 1VF4A 1V2AA 4MPFA 4MP4A 1B9XC 4O7HA 2L4QA 4PTSA 2QSIA 3BCIA 3MAKA 2FWHA 4P3YB 1XWGA 2IL3A 2WS2A 2HZEA 5D96A 2H1AA 4AJ6A 1FW1A 4PUFC 3UJ1A 5DALB 4ECCA 4DSSB 1EEMA 1XWAA 2FCHA 1M2AA 3D4MA 3EMPA 4K2XA 4POKA 5CRWA 2BMXA 1U3IA 1FVJA 3TRQA 2LQOA 9GSSA 4FQUA 4HJ2A 4IHUA 1SKRB 2CT6A 3WT2A 1XFLA 5D73A 2WB9A 4MJEA 2BTOT 1MD3A 2KUCA 4HUAA 3ZIVA 2DJ3A 4GSSA 4TR1A 4HQZA 2A4HA 1RQMA 2CAQA 1GSYA 4MZWA 5IPGA 4TXOB 4CY8A 1V57A 2YV7A 2PGTA 3LYKA 2AAWA 2M72A 4WF4A 1VF3A 1DE2A 4WBJA 5AGYA 3KP8A 5GSTA 3S9FA 4FYCA 3C71A 3GH9A 1H4OA 3LW9A 1EWXA 5G5FA 2FUG2 4F0CA 3IR4A 2NPBA 1GP1A 3HA9A 1WOUA 3TKPA 1U6TA 1GUHA 5DJMA 2P31A 5CP1A 2IPAA 2H74A 3IRAA 3G9BA 1LJRA 5ECRB 4ACSA 3CRUA 2CVDA 2NTOA 4Q5FA 20GSA 2HLSA 2O8VB 3EMXA 4EUYA 3VI5A 5CYYA 1THXA 3GKNA 2WCIA 2OACA 4OFTA 3WGEA 4MJAA 1M9AA 2F3MA 2MBTA 3QCPA 4BL7A 4HZ2A 3LEFA 4HU7A 5IMZA 3EE2A 2MZCA 1GTBA 1CQHA 4K6XA 3I9V2 4RI6A 1UC7A 3D4TA 1U3AA 3QDNA 2NDOA 5A4WA 2FWFA 4IW9A 1AAZA 4HOJA 5KN1A 3HJPA 2L4CA 2H75A 5IMFA 3I6AA 4XS4B 4IP6A 4KCEA 4BWSA 2FD3A 2FY6A 3CXGA 5ECHB 1FOHA 5GZZB 1YDKA 4KF9A 2VCWA 4HDEA 3ZRDA 4BPYA 5ECSA 1FHEA 1VF1A 2LNSA 5FHIA 2RM5A 3VFIA 4KSOA 3GL3A 5IQYA 5CAXA 1EGOA 1S3CA 3L9UA 1Y25A 6GSSA 4PNGA 4WXTA 3O76A 3MYDA 4BA7A 5F07A 2WJUA 1GTIA 1O8XA 4G0KA 4K9ZA 1YKAA 2E2MA 3M1GA 1T4YA 2YPMA 1QGVA 2FA8A 2X8GA 4QQ7A 1U87A 3GA4A 2P0GA 4J2FA 1K3LA 3H4KA 4A5PA 1PA3A 4ECJA 3UVHA 2IMIA 3FRCA 1DSBA 4FO5A 3KCMA 3LYPA 3EU3A 1WE0A 3EC3A 3ZMLA 3EYTA 4OFNA 3RDWA 2OBIA 2TRCP 4L0WA 3FW2A 2D2ZA 4I5QA 4TVEA 4V2MA 2A4VA 4JR4A 4GQFA 4CW9A 3GUSA 4KAEA 2H66A 3CSIA 2AHEA 1LBKA 1SK0A 3WD6A 2IMFA 2LQQA 3LXTA 4KSMA 4EL1A 3HVVA 3KH9A 4POBA 3K8NA 6GSWA 2GVPA 1WPIA 2J23A 2RUEA 2PU9C 1M9BA 1BEDA 1E6BA 1JZDA 1PMTA 3KEBA 3Q19A 3OR5A 2V6KA 3LQ7A 3U5RE 4IQAA 5CRHA 3TRPA 5B8AA 1SD9A 1SL2B 1A8YA 5FT3A 3L9VA 4FIWA 4OFMA 2QC7A 3HJOA 1FG4A 1K0DA 2HFDA 4KDUA 4HQSA 3DEXA 1QFNA 2VL3A 5ECIB 1RK4A 2PMTA 3ZTLA 1ML6A 2JZSA 3KD0A 4NV2A 4TXVA 1XWBA 1H75A 2KHPA 3CYNA 4I2UA 12GSA 3GH6A 1OKDA 4V2LA 2OE1A 4IJIA 1MDKA 3APSA 4K8MA 1EEJA 2JL4A 3H8QA 1KNGA 2YCDA 4XHMA 1LU4A 4ICYA 1XOAA 3RBTA 1GRXA 1NW2A 2PWJA 2AYTA 2MYGA 4MZCA 2IN3A 4L8EA 5IMDA 4E8HA 3UBLA 1ZL9A 2B1LA 3W8SA 3FZ9A 1J08A 1IYHA 2XBIA 1YY7A 1XW9A 1YF0A 3LWAA 3GIXA 4IS0A 3WYWA 4ZB8A 2GQLA 3EU4A 2GZZA 4ECBA 5B7CA 1TP9A 1QQ2A 1WP0A 1GLPA 2R0PA 5CRDA 1O85A 4RQXA 2XBQA 1K0BA 1EOGA 4G19A 3VURA 2L59A 1FOVA 4ECIA 3L9SA 3F4TA 1K3YA 4N10A 1ZYQB 1ZGNA 3PGTA 4F9ZA 2CX4A 3TJGA 1A24A 4NPBA 2GLRA 1ST9A 2VD0A 1IYIA 1MD4A 3CBUA 1FO5A 2HT9A 1OC8A 1HNBA 2R0CA 2LJAA 2GQMA 3UBKA 2EIOA 4TR0A 3UOMA 3TKRA 2J9HA 1XWKA 5J9CA 2H1DA 3EPTA 4O5QA 3Q6OA 5HR3A 3VWUA 4XS1A 4MCUA 4TN8A 5HFIA 2DMMA 3MIXA 2R0GA 4O5UA 5EPFA 2OA7A 4TKYA 3DVXA 4WETA 17GSA 2YJHA 4HJMA 2CX3A 2HZEB 1AQXA 2C3NA 2I3YA 4KGIA 4PQHA 4MMMA 5D8IA 3MDKA 3UARA 2VL2A 2VIMA 2N5FA 1QUWA 2DBCA 2VCXA 1ILOA 2H72A 2ZCTA 3QFAC 2JACA 5J41A 1X5DA 2R6KA 5KOXA 1OKTA 3FHKA 1CQGA 5AN1A 3G7JA 3FR9A 4WR5A 1SYXA 1Z7RA 3NIVA 4TR1B 1FB6A 4Z2UA 1GSFA 4X43A 2C8UA 4XRAA 2H73A 4YH2A 2H0IA 2LRNA 1GSEA 3EVIA 2IMDA 2Z9SA 4XTSA 1XW5A 4MA9A 2CV4A 2HNLA 3EWLA 2AB6A 1A23A 1SKSB 1SU9A 1YZXA 1ZYPA 3HY2A 1SK1A 4K5SA 2GZPA 4OD7A 4DSRA 2JSZA 5GSSA 3ERFA 5FWGA 4ULXA 3D6IA 2A2PA 1GUKA 2OE3A 2DJKA 3ZYWA 4GLTA 1G6YA 1ERVA 4IGJA 2EIRA 5DQYA 3ERWA 4EIPA 3HCZA 5ECQB 1J0FA 1TJDA 3G7IA 4BVXA 3H79A 4MLYA 3A2VA 3NOFA 4AJ7A 2C3QA 3KTBA 2H76A 1NHOA 1TOFA 4BL7B 4JZQA 13GSA 3AY8A 3WT1A 2LSTA 5J3RA 3UEMA 4OO4A 4N0VA 1T8EB 3IPZA 4FYUA 4ILFA 3A3TA 4GRFA 3ZL5A 3IDVA 2ON7A 1HYUA 1YJ6A 1M7TA 1J9BA 2JZTA 1B4QA 4KW6A 1PX6A 3RPPA 3CRTA 1TTZA 2HRAA 3BCKA 3LGCA 2VCQA 3ISOA 3US3A 2B5XA 1PN0A 1Q98A 6GSVA 6GSUA 1E2YA 4ZB9A 1YEXA 4I8BA 2RM6A 1GTUA 1AC1A 1ERTA 1YQ1A 4J57E 2EIQA 2PBJA 5IO2A 4ZBDA 5ABRA 5AISA 1T1VA 2N5BA 2YWOA 5H5SA 1WWJA 4EIQA 2V32A 5G30A 5KN0A 3HZ8A 4LA1A 1TU8A 2GTUA 5EL8A 1PD21 3F6FA 2P5QA 2CVKA 3UL3A 1TW9A 5IMVA 4IVFA 4V1Ag 5ELAA 4X4JA 3F8UA 5E59A 1YKCA 5BRTA 1JZWA 3KP9A 2K8VA 2C80A 4GF0A 1N2AA 1HD2A 3CSHA 2EC4A 3L4NA 2DSAA 2H8LA 3FEUA 2GT5A 5HR2A 3HYPA 5JCWA 1K0NA 3GRXA 2H70A 4MDCA 2ALBA 3P8WA 22GSA 1HQOA 3E9JB 3IAS2 3VLNA 1R4WA 1PX7A 2TIRA 4ZBBA 3QR6A 11GSA 2IFQA 5LD0A 2RUFA 5J5NA 4XIHA 4PNFA 4PUAA 2ES7A 2VAFA 4XS6A 4POLA 5HQPA 2VD1A 3C1RA 2IMKA 3GTUA 5GAPD 2B6MA 5DDLA 4HI7A 1XCCA 4X0XA 3PINA 1G7EA 4D73A 4YAVA 4GWRA 3L0HA 1JZRA 4I97A 4YQVA 3F9UA 4V1Ap 4BWQA 1SJZA 1UA5A 4K7IA 5DCHA 3CSJA 1MDJA 4MJCA 2L6CA 3APOA 2DLXA 4FYBA 2GSTA 1RW1A 4GQCA 5IM9A 1K0MA 2F9SA 4I2TA 1I5GA 5ECPB 5BMUA 1ON4A 3DMLA 2H71A 5KEJA 3QOUA 2L5OA 3IA1A 2JSYA 5ECMB 3HXSA 1R26A 5KOWA 2E0QA 1F6MC 5HFKA 2DJ2A 2DJJA 3GX0A 3TOTA 5IOXA 3HJMA 5J9BA 4EKZA 5ECOB 4EVMA 1M2BA 1GUMA 5ELGA 3HZ4A 4PX1A 4KB3A 3F0IA 1PGTA 2C0EA 3RAZA 4MH2A 3TCOA 5EY6A 4AGSA 1GSQA 3APQA 4K1FA 1JHBA 4Q5NA 3DKSA 2KP2A 3IC8A 4HS1A 2B3SA 4PXOA 2WDUA 3PPUA 5B6NA 3GURA 1X5EA 5HR1A 3QPMA 3VWVA 2L57A 1M99A 4GTUA 3IK7A 2H1GA 2H6ZA 2X64A 2VCTA 1XBSA 3SWLA 4CY6A 4ZILA 4ZBAA 1ERWA 2LUSA 3QFBC 1O7UA 1C72A 5DAKA 5JWQB 5GAND 1GSDA 1I9DA 2QGVA 5DVBA 1ABAA 2O87A 5JWOB 2HRKA 3IBHA 3P2AA 3N5OA 4EE0A 2YZUA 5C04A 1MDIA 3GNJA 2HSMA 3C7MA 3M9KA 2V2GA 4Q5QA 2VM1A 3C8EA 4FH8A 1PRXA 2AV4A 1URMA 3WGDA 3ZVJA 1G6WA 1T7PB 2PVQA 4NWYA 1MEKA 2HZFA 3HDCA 4MABA 2MBSA 4H86A 2LS5A 4N0ZA 2CZ3A 4QL9A 5G31A 2K9FA 3ME8A 3HD5A 4ZL8A 1Y6EA 1VRSD 2LNTA 18GSA 1AQWA 2HI7A 4MNNA 4J56E 1O73A 3EINA 1W89A 1V9WA 2YOIA 3VWXA 2G2QA 3IV4A 5ENUA 3PR8A 3UMAA 1OC9A 3BJ5A 4JRRA 2F8FA 3ZREA 2M80A 1YF1A 1WIKA 1PL1A 5J4UA 5COHA 5IIZA 3DGQA 2H01A 3VPQA 2QKEA 2LRCA 5H5QA 1EZKA 1O81A 1Z6NA 2HRFA 3UAPA 2PPTA 2VL2C 2GSSA 2MMAA 1JLWA 4ZL9A 4KX4A 1XWCA 5A4UA 4X1UA 2KLXA 3HVSA 3U6VA 2X8CA 1GLQA 5CNWA 2CQ9A 1BG5A 3RHCA 2H6YA 5B8BA 3IOSA 4IN0A 3P7XA 2X8HA 3C1SA 5AIXA 5DBQA 3ZLPA 1X9SB 5C00A 4ML1A 1WJKA 2YN1A 6GSXA 2GZYA 3G7YA 4GSTA 4JU5A 4YQUA 5LNKe 1JLVA 1WRYA 1F2EA 1XXUA 1ERUA 5D9WA 2MMNA 2PN8A 1BYEA 1B48A 1NM3A 2XHFA 4ML6A 3F4RA 2PERA 3J7Yk 1F3BA 4ZXGA 1A8LA 2GDRA 2B1KA 2VCZA 3FR3A 3TKSA 3GN3A 2DMLA 1F37A 5IOWA 4PGTA 2ZNMA 4ZB6A 2DKIA 5JCUA 2OE0A 2LEGA 1UVZA 5D9XA 4BVXB 4TR4A 2DKHA 4DVCA 4BVYB 4O92A 1A0FA 2FNOA 4G0IA 5D93A 4ZL7A 3N9JA 4JE1A 2FLSA 4CHSA 4HZ4A 4IP1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F0G A;  3ZFB A;  1V98 A;  1K0A A;  4GCI A;  2PUK C;  3QD9 A;  3FYG A;  4K2D A;  2E2G A;  1TRV A;  2JU5 A;  3W8J A;  1A2J A;  2X99 A;  2IWT A;  4XCS A;  1B4P A;  1R5P A;  1THO A;  5D9T A;  4NAX A;  1XVW A;  1HNA A;  2VOC A;  4Q5R A;  2OAD A;  1SL1 B;  2HE3 A;  1T4Z A;  5F8B A;  4OO5 A;  2YNX A;  16GS A;  3D0Z A;  5G2Z A;  1TRW A;  3TJJ A;  1XZO A;  1SD8 A;  2GSQ A;  1X0R A;  2C0D A;  2R4V A;  1T3B A;  2WUL A;  3A5W A;  2LRT A;  4KE3 A;  2YZH A;  3LJR A;  3RHB A;  4OCE A;  1UN2 A;  5IMA A;  4OWY A;  3GKK A;  1BJX A;  3E0U A;  2YAN A;  4EC0 A;  4MK3 A;  4WEY A;  3I69 A;  2KOK A;  3KGK A;  4WKW A;  5A4V A;  2FHE A;  2C0G A;  3KH7 A;  2HSH A;  3TRX A;  5INY A;  7GSS A;  2H30 A;  1B9Y C;  4BVY A;  4TW5 A;  1K0O A;  2VM2 A;  3PH9 A;  1SEN A;  1W4V A;  3QMX A;  3ERG A;  4NV5 A;  3BBY A;  5H5R A;  3FZ5 A;  2MMO A;  1DUG A;  1O6J A;  2I81 A;  3JCM L;  1V58 A;  3SBC A;  4EDZ A;  1VGL A;  1TI1 A;  3D5J A;  3GKX A;  3GX8 A;  2C0F A;  1FB0 A;  3QAG A;  1TRS A;  4IQ1 A;  4F0B A;  3HVX A;  1GH2 A;  4MH3 A;  1TXX A;  5ID2 A;  5ECN B;  4YAP A;  1PL2 A;  3E3E A;  1DE1 A;  3GYK A;  4YQM A;  2XPD A;  5LCZ A;  1O8W A;  4WR4 A;  2RII A;  1GUL A;  3IXR A;  2E7P A;  2IFQ B;  4GXZ A;  10GS A;  3TGZ A;  3ZIJ A;  3NZN A;  1EGR A;  3DD3 A;  3FR6 A;  5JCG A;  3CTG A;  1GL8 A;  1TI3 A;  1F3A A;  3I43 A;  4ID0 A;  1G7O A;  3GTU B;  1FAA A;  3KIJ A;  2HRN A;  1BX9 A;  1XPV A;  4L0U A;  4LL4 B;  1GNW A;  2VLV A;  3KXO A;  3ZZX A;  1EP8 A;  4I6X A;  4OMV A;  2DIY A;  4D73 B;  3H1N A;  4TRX A;  2B7J A;  5HR0 A;  3IHQ A;  3VK9 A;  3H93 A;  4RI7 A;  4MF6 A;  5DJL A;  3TJK A;  1PKZ A;  3GKM A;  2WGR A;  2YWI A;  2DJ0 A;  6GSY A;  2O7K A;  5DAL A;  4DSS A;  4LL1 B;  1KTE A;  3Q74 A;  2F8A A;  3D22 A;  3DRN A;  2A2S A;  5CO3 A;  5DQS A;  1YEP A;  3F4S A;  2R37 A;  4NXI A;  1OC3 A;  3O6T A;  3ED3 A;  2V41 A;  2HSY A;  2WZ9 A;  1VF2 A;  1B8X A;  19GS A;  3CTF A;  4EXJ A;  2DJ1 A;  4CDO A;  1R5A A;  4KND A;  2FA4 A;  4NHZ A;  1GNE A;  2B5E A;  2L5L A;  4TXO A;  1BQ7 A;  4POM A;  1AXD A;  2AUV A;  4N11 A;  1XVQ A;  1PKW A;  1GSS A;  2H19 A;  4F03 A;  1DBY A;  1XIY A;  3GV1 A;  1EP7 A;  5HFG A;  1X9W B;  1HNC A;  2REM A;  1K0C A;  1SJI A;  4G2E A;  1SYR A;  4NHW A;  4PUR A;  3UIW A;  1TRU A;  1AQV A;  3LG6 A;  3DXB A;  3FZ4 A;  1EV9 A;  1BAY A;  3GMF A;  3UVT A;  2H6X A;  1AIU A;  4K7O A;  3BOA A;  4KDY A;  1GSU A;  3GFK A;  2OKA A;  5G5E A;  5DAK B;  4N30 A;  2HYX A;  3BD2 A;  4JBB A;  4L5O A;  1PSQ A;  2CAI A;  2O89 A;  3ME7 A;  4LMW A;  3L78 A;  3LOR A;  1AW9 A;  2VLT A;  4JED A;  2H1B A;  3A2W A;  3CMI A;  2HXK A;  3VWW A;  2R3X A;  1QXH A;  2GSR A;  2M46 A;  2LV3 A;  4RUV A;  1XOB A;  1G0T A;  4PQ1 A;  2WRT A;  3ZVJ D;  2OBK A;  3DWV A;  1T00 A;  3P90 A;  3IE3 A;  2CVB A;  3TJB A;  5KN3 A;  1M2D A;  1ACV A;  2GQK A;  1QMV A;  1ZYE A;  3LXZ A;  3KZQ A;  3KMO A;  2I9H A;  4XS4 A;  4ZIJ A;  5D9V A;  5DCG A;  3F3Q A;  3M0F A;  5KN2 A;  5AIV A;  3O3T A;  1V40 A;  3ZIT A;  3GSS A;  1PN9 A;  2NBS A;  1S3A A;  4NMU A;  3GST A;  3M8N A;  4IJ3 A;  1ZMA A;  3QAW A;  4K7N A;  1OAZ A;  1KBN A;  1GWC A;  3D21 A;  6GST A;  2YWM A;  3TKQ A;  1M0U A;  3TB2 A;  3TKS E;  1OC9 B;  4DEJ A;  3TUE A;  3TOU A;  3HHV A;  2IME A;  4KA0 A;  1KEB A;  2K18 A;  1A2M A;  1TDI A;  2F51 A;  1N8J A;  1FVK A;  5JWR B;  3C73 A;  5CRE A;  4L5L A;  1X9M B;  1SJ6 A;  4KH7 A;  5G1K A;  4HU9 A;  2GGT A;  3RPN A;  3DIE A;  4MF5 A;  3IAM 2;  1A0R P;  2OJL A;  2PVO C;  1OYJ A;  1JFU A;  2TRX A;  3MSZ A;  2CZ2 A;  2VLU A;  2YV9 A;  1NSW A;  2ZUP A;  3TJF A;  2LTK A;  1Q4J A;  4O32 A;  2JAD A;  2JZR A;  2GT6 A;  1K3O A;  2N5A A;  4AJ8 A;  1F9M A;  1Z6M A;  3MNG A;  4TOP A;  3MWH A;  3ZFL A;  1GTA A;  1Z9H A;  4G10 A;  3FK8 A;  1X5C A;  1OE8 A;  4WBR D;  4E8E A;  3F6D A;  1SL0 B;  3KM6 A;  3VPT A;  1R7H A;  3M3M A;  3FKF A;  4IEL A;  3EUR A;  2KP1 A;  3FY7 A;  1Z3E A;  1AUC A;  2XC2 A;  1EV4 A;  3TKS C;  3W6G A;  4JR6 A;  3F63 A;  2K6V A;  2FGX A;  3V1W A;  2C4J A;  4HEA 2;  5L71 A;  4V2N A;  3WGX A;  1ZCP A;  5IO0 A;  2BJX A;  3FZA A;  1JZO A;  4KCA A;  1PQN A;  4ISD A;  4KUN A;  2R2J A;  4Z7X A;  3GL5 A;  2V1M A;  2NVL A;  2LJK A;  3Q18 A;  3F3R A;  2G0F A;  8GSS A;  4F2I A;  2B7K A;  3IK9 A;  4K0G A;  4PQI A;  5E4W A;  2VUP A;  4LLR A;  2CA8 A;  1SK2 A;  2A2R A;  3R2Q A;  2LKU A;  3ZMK A;  1TKD B;  5F06 A;  3DVW A;  4RQR A;  2L6D A;  2IJY A;  2VL9 A;  2XPE A;  4KDX A;  4LMV A;  2LJR A;  2MMZ A;  4K0N A;  4MJB A;  5IPH A;  4MF7 A;  4EF0 A;  1NHY A;  1TK5 B;  2GS3 A;  4AF2 A;  3KTL A;  4MPG A;  3DYR A;  1OVN A;  5EVO A;  2B5Y A;  2C3T A;  1ZZY A;  2VO4 A;  3HKR A;  2IIY A;  1TU7 A;  3GHA A;  4WF5 A;  5G1L A;  2H0G A;  3A2X A;  2YP6 A;  4MZB A;  2DIZ A;  2ON5 A;  5CRG A;  4IKH A;  4OCF A;  4EO3 A;  1OE7 A;  3LSZ A;  3M9J A;  2RLI A;  4GSN A;  5IMC A;  2YJ7 A;  2H0H A;  2AJQ B;  2DC5 A;  2FWG A;  3KMN A;  2O85 A;  14GS A;  1TK8 B;  1QK8 A;  3J7Y b;  2I1U A;  1EOH A;  1Z5Y E;  4O5R A;  1A2L A;  5ID2 B;  2C1Y A;  1ZOF A;  4DSQ A;  1S3D A;  4TR3 A;  5ECL B;  4IBP A;  3IC4 A;  2V6O A;  1U88 A;  2VCV A;  2WFC A;  3LFL A;  4XRD A;  5B6M A;  2I4A A;  3TDG A;  5F05 A;  3QAV A;  2R5G A;  2K8S A;  1USB A;  2FWE A;  5ECK B;  4G9H A;  1SKW B;  2YWN A;  4EDY A;  1Z7P A;  4F82 A;  1TK0 B;  1WMJ A;  2P5R A;  5A5K A;  4QL7 A;  1MTC A;  3VI7 A;  3KJY A;  1XW6 A;  1VF4 A;  1V2A A;  4MPF A;  4MP4 A;  1B9X C;  4O7H A;  2L4Q A;  2QSI A;  3BCI A;  3MAK A;  2FWH A;  4P3Y B;  1XWG A;  2IL3 A;  2WS2 A;  2HZE A;  5D96 A;  2H1A A;  4AJ6 A;  1FW1 A;  4PUF C;  3UJ1 A;  5DAL B;  4ECC A;  4DSS B;  1EEM A;  1XWA A;  2FCH A;  1M2A A;  3D4M A;  3EMP A;  4POK A;  5CRW A;  2BMX A;  1U3I A;  1FVJ A;  3TRQ A;  2LQO A;  9GSS A;  4HJ2 A;  4IHU A;  1SKR B;  2CT6 A;  3WT2 A;  1XFL A;  5D73 A;  2WB9 A;  4MJE A;  2BTO T;  1MD3 A;  2KUC A;  4HUA A;  3ZIV A;  2DJ3 A;  4GSS A;  4TR1 A;  4HQZ A;  1RQM A;  2CAQ A;  1GSY A;  4MZW A;  5IPG A;  4TXO B;  1V57 A;  2YV7 A;  2PGT A;  3LYK A;  2AAW A;  2M72 A;  4WF4 A;  1VF3 A;  1DE2 A;  4WBJ A;  5AGY A;  3KP8 A;  5GST A;  3S9F A;  4FYC A;  3C71 A;  3GH9 A;  1H4O A;  1EWX A;  5G5F A;  2FUG 2;  4F0C A;  3IR4 A;  2NPB A;  1GP1 A;  3HA9 A;  1WOU A;  3TKP A;  1U6T A;  1GUH A;  5DJM A;  2P31 A;  5CP1 A;  2IPA A;  2H74 A;  3IRA A;  3G9B A;  1LJR A;  5ECR B;  4ACS A;  3CRU A;  2CVD A;  2NTO A;  4Q5F A;  20GS A;  2HLS A;  2O8V B;  3EMX A;  4EUY A;  3VI5 A;  5CYY A;  1THX A;  3GKN A;  2WCI A;  2OAC A;  4OFT A;  3WGE A;  4MJA A;  1M9A A;  2F3M A;  2MBT A;  3QCP A;  4BL7 A;  4HZ2 A;  3LEF A;  4HU7 A;  5IMZ A;  3EE2 A;  2MZC A;  1GTB A;  1CQH A;  4K6X A;  3I9V 2;  4RI6 A;  1UC7 A;  3D4T A;  1U3A A;  3QDN A;  2NDO A;  5A4W A;  2FWF A;  4IW9 A;  1AAZ A;  4HOJ A;  5KN1 A;  3HJP A;  2L4C A;  2H75 A;  5IMF A;  3I6A A;  4XS4 B;  4IP6 A;  4KCE A;  4BWS A;  2FD3 A;  2FY6 A;  3CXG A;  5ECH B;  5GZZ B;  1YDK A;  3ZRD A;  2VCW A;  4HDE A;  4BPY A;  5ECS A;  1FHE A;  1VF1 A;  2LNS A;  5FHI A;  2RM5 A;  3VFI A;  4KSO A;  3GL3 A;  5IQY A;  5CAX A;  1EGO A;  1S3C A;  3L9U A;  1Y25 A;  6GSS A;  4PNG A;  4WXT A;  3O76 A;  4BA7 A;  5F07 A;  2WJU A;  1GTI A;  1O8X A;  4K9Z A;  1YKA A;  2E2M A;  3M1G A;  1T4Y A;  2YPM A;  1QGV A;  2FA8 A;  2X8G A;  4QQ7 A;  1U87 A;  3GA4 A;  2P0G A;  4J2F A;  1K3L A;  3H4K A;  1PA3 A;  4ECJ A;  3UVH A;  2IMI A;  3FRC A;  1DSB A;  4FO5 A;  3KCM A;  3LYP A;  3EU3 A;  1WE0 A;  3EC3 A;  3ZML A;  3EYT A;  4OFN A;  3RDW A;  2OBI A;  2TRC P;  4L0W A;  3FW2 A;  2D2Z A;  4I5Q A;  4TVE A;  4V2M A;  2A4V A;  4JR4 A;  4GQF A;  4CW9 A;  3GUS A;  4KAE A;  2H66 A;  3CSI A;  2AHE A;  1LBK A;  1SK0 A;  3WD6 A;  2IMF A;  2LQQ A;  3LXT A;  4KSM A;  4EL1 A;  3HVV A;  3KH9 A;  4POB A;  3K8N A;  6GSW A;  2GVP A;  1WPI A;  2J23 A;  2RUE A;  2PU9 C;  1M9B A;  1BED A;  1E6B A;  1JZD A;  1PMT A;  3KEB A;  3Q19 A;  3OR5 A;  2V6K A;  3LQ7 A;  3U5R E;  4IQA A;  5CRH A;  3TRP A;  5B8A A;  1SD9 A;  1SL2 B;  1A8Y A;  5FT3 A;  3L9V A;  4FIW A;  4OFM A;  2QC7 A;  3HJO A;  1FG4 A;  1K0D A;  2HFD A;  4KDU A;  4HQS A;  3DEX A;  1QFN A;  2VL3 A;  5ECI B;  1RK4 A;  2PMT A;  3ZTL A;  1ML6 A;  2JZS A;  3KD0 A;  4NV2 A;  4TXV A;  1XWB A;  1H75 A;  2KHP A;  3CYN A;  4I2U A;  12GS A;  3GH6 A;  1OKD A;  4V2L A;  2OE1 A;  4IJI A;  1MDK A;  3APS A;  4K8M A;  1EEJ A;  2JL4 A;  3H8Q A;  1KNG A;  2YCD A;  4XHM A;  1LU4 A;  1XOA A;  3RBT A;  1GRX A;  1NW2 A;  2PWJ A;  2AYT A;  2MYG A;  4MZC A;  2IN3 A;  4L8E A;  5IMD A;  4E8H A;  3UBL A;  1ZL9 A;  2B1L A;  3W8S A;  3FZ9 A;  1J08 A;  1IYH A;  2XBI A;  1YY7 A;  1XW9 A;  1YF0 A;  3LWA A;  3GIX A;  4IS0 A;  3WYW A;  4ZB8 A;  2GQL A;  3EU4 A;  2GZZ A;  4ECB A;  5B7C A;  1TP9 A;  1QQ2 A;  1WP0 A;  1GLP A;  5CRD A;  1O85 A;  4RQX A;  2XBQ A;  1K0B A;  1EOG A;  4G19 A;  3VUR A;  2L59 A;  1FOV A;  4ECI A;  3L9S A;  3F4T A;  1K3Y A;  4N10 A;  1ZYQ B;  1ZGN A;  3PGT A;  4F9Z A;  2CX4 A;  3TJG A;  1A24 A;  4NPB A;  2GLR A;  1ST9 A;  2VD0 A;  1IYI A;  1MD4 A;  3CBU A;  1FO5 A;  2HT9 A;  1OC8 A;  1HNB A;  2LJA A;  2GQM A;  3UBK A;  2EIO A;  4TR0 A;  3UOM A;  3TKR A;  2J9H A;  1XWK A;  5J9C A;  2H1D A;  3Q6O A;  5HR3 A;  3VWU A;  4XS1 A;  4MCU A;  4TN8 A;  5HFI A;  2DMM A;  5EPF A;  2OA7 A;  4TKY A;  3DVX A;  4WET A;  17GS A;  2YJH A;  4HJM A;  2CX3 A;  2HZE B;  1AQX A;  2C3N A;  2I3Y A;  4KGI A;  4PQH A;  4MMM A;  5D8I A;  3MDK A;  3UAR A;  2VL2 A;  2VIM A;  2N5F A;  1QUW A;  2DBC A;  2VCX A;  1ILO A;  2H72 A;  2ZCT A;  3QFA C;  2JAC A;  5J41 A;  1X5D A;  2R6K A;  1OKT A;  3FHK A;  1CQG A;  5AN1 A;  3G7J A;  3FR9 A;  4WR5 A;  1SYX A;  1Z7R A;  3NIV A;  4TR1 B;  1FB6 A;  1GSF A;  4X43 A;  2C8U A;  4XRA A;  2H73 A;  4YH2 A;  2H0I A;  2LRN A;  1GSE A;  3EVI A;  2IMD A;  2Z9S A;  4XTS A;  1XW5 A;  4MA9 A;  2CV4 A;  2HNL A;  3EWL A;  2AB6 A;  1A23 A;  1SKS B;  1SU9 A;  1YZX A;  3HY2 A;  1SK1 A;  4OD7 A;  2GZP A;  4DSR A;  2JSZ A;  5GSS A;  3ERF A;  5FWG A;  4ULX A;  3D6I A;  1GUK A;  2OE3 A;  2DJK A;  3ZYW A;  4GLT A;  1G6Y A;  1ERV A;  4IGJ A;  2EIR A;  5DQY A;  3ERW A;  3HCZ A;  5ECQ B;  1J0F A;  1TJD A;  3G7I A;  4BVX A;  3H79 A;  4MLY A;  3A2V A;  3NOF A;  4AJ7 A;  2C3Q A;  3KTB A;  2H76 A;  1NHO A;  1TOF A;  4JZQ A;  13GS A;  3AY8 A;  3WT1 A;  2LST A;  5J3R A;  3UEM A;  4OO4 A;  4N0V A;  1T8E B;  3IPZ A;  4FYU A;  4ILF A;  3A3T A;  4GRF A;  3ZL5 A;  3IDV A;  2ON7 A;  1HYU A;  1YJ6 A;  1M7T A;  1J9B A;  2JZT A;  1B4Q A;  4KW6 A;  1PX6 A;  3RPP A;  3CRT A;  1TTZ A;  3BCK A;  3LGC A;  2VCQ A;  3ISO A;  3US3 A;  2B5X A;  1Q98 A;  6GSV A;  6GSU A;  1E2Y A;  4ZB9 A;  1YEX A;  4I8B A;  2RM6 A;  1GTU A;  1AC1 A;  1ERT A;  1YQ1 A;  4J57 E;  2EIQ A;  2PBJ A;  5IO2 A;  4ZBD A;  5ABR A;  5AIS A;  1T1V A;  2N5B A;  2YWO A;  5H5S A;  1WWJ A;  2V32 A;  5G30 A;  5KN0 A;  3HZ8 A;  4LA1 A;  1TU8 A;  2GTU A;  5EL8 A;  1PD2 1;  3F6F A;  2P5Q A;  2CVK A;  3UL3 A;  1TW9 A;  5IMV A;  4IVF A;  4V1A g;  5ELA A;  3F8U A;  5E59 A;  1YKC A;  1JZW A;  3KP9 A;  2K8V A;  2C80 A;  4GF0 A;  1N2A A;  1HD2 A;  3CSH A;  2EC4 A;  3L4N A;  2DSA A;  2H8L A;  3FEU A;  2GT5 A;  5HR2 A;  3HYP A;  5JCW A;  1K0N A;  3GRX A;  2H70 A;  4MDC A;  2ALB A;  3P8W A;  22GS A;  1HQO A;  3E9J B;  3IAS 2;  3VLN A;  1R4W A;  1PX7 A;  2TIR A;  4ZBB A;  3QR6 A;  11GS A;  2IFQ A;  5LD0 A;  2RUF A;  5J5N A;  4XIH A;  4PNF A;  4PUA A;  2ES7 A;  2VAF A;  4XS6 A;  4POL A;  5HQP A;  2VD1 A;  3C1R A;  2IMK A;  3GTU A;  5GAP D;  2B6M A;  5DDL A;  4HI7 A;  1XCC A;  4X0X A;  3PIN A;  1G7E A;  4D73 A;  4YAV A;  4GWR A;  3L0H A;  1JZR A;  4I97 A;  4YQV A;  3F9U A;  4V1A p;  4BWQ A;  1SJZ A;  1UA5 A;  4K7I A;  5DCH A;  3CSJ A;  1MDJ A;  4MJC A;  2L6C A;  3APO A;  2DLX A;  4FYB A;  2GST A;  1RW1 A;  4GQC A;  5IM9 A;  1K0M A;  2F9S A;  4I2T A;  1I5G A;  5ECP B;  1ON4 A;  3DML A;  2H71 A;  5KEJ A;  3QOU A;  2L5O A;  3IA1 A;  2JSY A;  5ECM B;  3HXS A;  1R26 A;  2E0Q A;  1F6M C;  5HFK A;  2DJ2 A;  2DJJ A;  3GX0 A;  3TOT A;  5IOX A;  3HJM A;  5J9B A;  4EKZ A;  5ECO B;  4EVM A;  1M2B A;  1GUM A;  5ELG A;  3HZ4 A;  4PX1 A;  4KB3 A;  3F0I A;  1PGT A;  2C0E A;  3RAZ A;  4MH2 A;  3TCO A;  5EY6 A;  4AGS A;  1GSQ A;  3APQ A;  4K1F A;  1JHB A;  4Q5N A;  3DKS A;  2KP2 A;  4HS1 A;  2B3S A;  4PXO A;  2WDU A;  5B6N A;  3GUR A;  1X5E A;  5HR1 A;  3QPM A;  3VWV A;  2L57 A;  1M99 A;  4GTU A;  3IK7 A;  2H1G A;  2H6Z A;  2X64 A;  2VCT A;  1XBS A;  3SWL A;  4ZIL A;  4ZBA A;  1ERW A;  2LUS A;  3QFB C;  1O7U A;  1C72 A;  5DAK A;  5JWQ B;  5GAN D;  1GSD A;  1I9D A;  2QGV A;  5DVB A;  1ABA A;  2O87 A;  5JWO B;  3IBH A;  3P2A A;  3N5O A;  4EE0 A;  2YZU A;  5C04 A;  1MDI A;  3GNJ A;  3M9K A;  3C7M A;  2V2G A;  4Q5Q A;  2VM1 A;  3C8E A;  4FH8 A;  1PRX A;  2AV4 A;  1URM A;  3WGD A;  3ZVJ A;  1G6W A;  1T7P B;  2PVQ A;  4NWY A;  1MEK A;  2HZF A;  3HDC A;  4MAB A;  2MBS A;  4H86 A;  2LS5 A;  4N0Z A;  2CZ3 A;  4QL9 A;  5G31 A;  2K9F A;  3ME8 A;  3HD5 A;  4ZL8 A;  1Y6E A;  1VRS D;  2LNT A;  18GS A;  1AQW A;  2HI7 A;  4J56 E;  1O73 A;  3EIN A;  1W89 A;  1V9W A;  2YOI A;  3VWX A;  2G2Q A;  3IV4 A;  5ENU A;  3PR8 A;  3UMA A;  1OC9 A;  3BJ5 A;  4JRR A;  2F8F A;  3ZRE A;  2M80 A;  1YF1 A;  1WIK A;  1PL1 A;  5J4U A;  5COH A;  5IIZ A;  3DGQ A;  2H01 A;  3VPQ A;  2QKE A;  2LRC A;  5H5Q A;  1EZK A;  1O81 A;  1Z6N A;  2HRF A;  3UAP A;  2PPT A;  2VL2 C;  2GSS A;  2MMA A;  1JLW A;  4ZL9 A;  4KX4 A;  1XWC A;  5A4U A;  4X1U A;  2KLX A;  3HVS A;  3U6V A;  2X8C A;  1GLQ A;  5CNW A;  2CQ9 A;  1BG5 A;  3RHC A;  2H6Y A;  5B8B A;  3IOS A;  4IN0 A;  3P7X A;  2X8H A;  3C1S A;  5AIX A;  5DBQ A;  3ZLP A;  1X9S B;  5C00 A;  4ML1 A;  1WJK A;  2YN1 A;  6GSX A;  2GZY A;  3G7Y A;  4GST A;  4JU5 A;  4YQU A;  5LNK e;  1JLV A;  1WRY A;  1F2E A;  1XXU A;  1ERU A;  5D9W A;  2MMN A;  2PN8 A;  1BYE A;  1B48 A;  1NM3 A;  2XHF A;  4ML6 A;  3F4R A;  2PER A;  3J7Y k;  1F3B A;  4ZXG A;  1A8L A;  2GDR A;  2B1K A;  2VCZ A;  3FR3 A;  3TKS A;  3GN3 A;  2DML A;  1F37 A;  5IOW A;  4PGT A;  2ZNM A;  4ZB6 A;  5JCU A;  2OE0 A;  2LEG A;  1UVZ A;  5D9X A;  4TR4 A;  4DVC A;  4O92 A;  1A0F A;  2FNO A;  5D93 A;  4ZL7 A;  3N9J A;  4JE1 A;  2FLS A;  4CHS A;  4HZ4 A;  4IP1 A; 
#chains in the Genus database with same CATH topology
 5F0G A;  3ZFB A;  1V98 A;  1K0A A;  4GCI A;  2PUK C;  3QD9 A;  3FYG A;  4K2D A;  2E2G A;  1TRV A;  2JU5 A;  3W8J A;  1A2J A;  2X99 A;  2IWT A;  4XCS A;  1B4P A;  1R5P A;  1THO A;  5D9T A;  4NAX A;  1XVW A;  1HNA A;  2VOC A;  4Q5R A;  2OAD A;  1SL1 B;  2HE3 A;  1T4Z A;  2UZ8 A;  5F8B A;  4OO5 A;  2YNX A;  16GS A;  3D0Z A;  5G2Z A;  1TRW A;  3TJJ A;  1XZO A;  1SD8 A;  2GSQ A;  1X0R A;  2C0D A;  2R4V A;  1T3B A;  2WUL A;  3A5W A;  2LRT A;  4KE3 A;  2YZH A;  3LJR A;  3RHB A;  4OCE A;  1UN2 A;  5IMA A;  4OWY A;  3GKK A;  1BJX A;  3E0U A;  2YAN A;  4EC0 A;  4MK3 A;  4WEY A;  3I69 A;  2KOK A;  3KGK A;  4YKG A;  4WKW A;  5A4V A;  2FHE A;  2C0G A;  3KH7 A;  2HSH A;  3TRX A;  5INY A;  7GSS A;  2H30 A;  1B9Y C;  4BVY A;  4TW5 A;  1K0O A;  3IHG A;  2VM2 A;  3PH9 A;  1SEN A;  1W4V A;  3QMX A;  3ERG A;  4NV5 A;  3BBY A;  5H5R A;  3FZ5 A;  2MMO A;  1DUG A;  1O6J A;  2I81 A;  3JCM L;  1V58 A;  3SBC A;  4EDZ A;  1VGL A;  1TI1 A;  3D5J A;  3GKX A;  3GX8 A;  2C0F A;  1FB0 A;  3QAG A;  4Z2T A;  1TRS A;  4IQ1 A;  4F0B A;  3HVX A;  1GH2 A;  4MH3 A;  1TXX A;  5ID2 A;  5ECN B;  4YAP A;  1PL2 A;  3E3E A;  1DE1 A;  3GYK A;  4YQM A;  2XPD A;  5LCZ A;  1O8W A;  4WR4 A;  2RII A;  1GUL A;  3IXR A;  2E7P A;  2IFQ B;  4GXZ A;  10GS A;  3TGZ A;  3ZIJ A;  3NZN A;  1EGR A;  3DD3 A;  3FR6 A;  1M3J A;  3CTG A;  5JCG A;  1GL8 A;  1TI3 A;  1F3A A;  3I43 A;  4ID0 A;  1G7O A;  3GTU B;  1FAA A;  3KIJ A;  2HRN A;  1BX9 A;  1XPV A;  4L0U A;  4LL4 B;  1GNW A;  2VLV A;  3KXO A;  3ZZX A;  1EP8 A;  4I6X A;  4OMV A;  4YKF A;  2DIY A;  4D73 B;  3H1N A;  4TRX A;  2B7J A;  5HR0 A;  3IHQ A;  3VK9 A;  3H93 A;  4RI7 A;  4MF6 A;  5DJL A;  3TJK A;  1PKZ A;  3GKM A;  2WGR A;  2YWI A;  2DJ0 A;  6GSY A;  2O7K A;  5DAL A;  4DSS A;  4LL1 B;  1KTE A;  3Q74 A;  2F8A A;  3D22 A;  3DRN A;  2A2S A;  5CO3 A;  5DQS A;  1YEP A;  3F4S A;  2R37 A;  4NXI A;  1OC3 A;  4Z2R A;  3O6T A;  3ED3 A;  4G0L A;  2V41 A;  2HSY A;  2WZ9 A;  1VF2 A;  1B8X A;  19GS A;  3CTF A;  4EXJ A;  2DJ1 A;  4CDO A;  1R5A A;  4KND A;  2FA4 A;  4NHZ A;  1GNE A;  2B5E A;  2L5L A;  4TXO A;  1BQ7 A;  4POM A;  1AXD A;  2AUV A;  4N11 A;  1XVQ A;  1PKW A;  1GSS A;  2H19 A;  4F03 A;  1DBY A;  1XIY A;  3GV1 A;  3R3E A;  1EP7 A;  5HFG A;  1X9W B;  1HNC A;  2X49 A;  2REM A;  1K0C A;  1SJI A;  4G2E A;  1SYR A;  4NHW A;  4PUR A;  3UIW A;  1TRU A;  1AQV A;  3LG6 A;  3DXB A;  3FZ4 A;  1EV9 A;  1BAY A;  3GMF A;  3UVT A;  2H6X A;  1AIU A;  4K7O A;  3BOA A;  4KDY A;  1GSU A;  3GFK A;  2OKA A;  5G5E A;  5DAK B;  4N30 A;  2HYX A;  3BD2 A;  4JBB A;  4L5O A;  1PSQ A;  2CAI A;  2O89 A;  3ME7 A;  4LMW A;  3L78 A;  3LOR A;  1AW9 A;  2VLT A;  4JED A;  2H1B A;  3A2W A;  3CMI A;  2HXK A;  3VWW A;  2R3X A;  1QXH A;  2GSR A;  2M46 A;  2LV3 A;  4RUV A;  1XOB A;  1ZYN A;  1G0T A;  4PQ1 A;  2WRT A;  3ZVJ D;  2OBK A;  3DWV A;  1T00 A;  3P90 A;  3IE3 A;  2CVB A;  3TJB A;  5KN3 A;  1M2D A;  1ACV A;  2GQK A;  1QMV A;  1ZYE A;  3LXZ A;  3KZQ A;  3KMO A;  2I9H A;  4XS4 A;  4ZIJ A;  5D9V A;  5DCG A;  3F3Q A;  3M0F A;  5KN2 A;  5AIV A;  3O3T A;  1V40 A;  3ZIT A;  3GSS A;  1PN9 A;  2NBS A;  1S3A A;  4NMU A;  3GST A;  3M8N A;  4IJ3 A;  1ZMA A;  3QAW A;  4K7N A;  1OAZ A;  1KBN A;  1GWC A;  3D21 A;  6GST A;  2YWM A;  3TKQ A;  1M0U A;  3TB2 A;  3TKS E;  1OC9 B;  4DEJ A;  3TUE A;  3TOU A;  3HHV A;  2IME A;  4KA0 A;  2QA1 A;  1KEB A;  3FMW A;  2K18 A;  1A2M A;  1TDI A;  2F51 A;  1N8J A;  1FVK A;  5JWR B;  3C73 A;  5CRE A;  4L5L A;  1X9M B;  1SJ6 A;  4KH7 A;  5G1K A;  4HU9 A;  2GGT A;  3RPN A;  3DIE A;  4MF5 A;  3IAM 2;  1A0R P;  2OJL A;  2PVO C;  1OYJ A;  1JFU A;  2TRX A;  3MSZ A;  2CZ2 A;  2VLU A;  2YV9 A;  1NSW A;  2X4A A;  2ZUP A;  3TJF A;  2LTK A;  1Q4J A;  4O32 A;  2JAD A;  2JZR A;  2GT6 A;  1K3O A;  2N5A A;  4AJ8 A;  1F9M A;  1Z6M A;  3MNG A;  4TOP A;  3MWH A;  3ZFL A;  1GTA A;  1Z9H A;  4G10 A;  3FK8 A;  1X5C A;  1OE8 A;  4WBR D;  4E8E A;  3F6D A;  1SL0 B;  3KM6 A;  3VPT A;  1R7H A;  3M3M A;  3FKF A;  4IEL A;  3EUR A;  2KP1 A;  3FY7 A;  3A5I A;  1Z3E A;  1AUC A;  2XC2 A;  1EV4 A;  3TKS C;  3W6G A;  4JR6 A;  3F63 A;  2K6V A;  2QA2 A;  2FGX A;  3V1W A;  2C4J A;  4HEA 2;  5L71 A;  4V2N A;  3WGX A;  1ZCP A;  5IO0 A;  2BJX A;  3FZA A;  1JZO A;  4KCA A;  1PQN A;  4ISD A;  4KUN A;  2R2J A;  4Z7X A;  3GL5 A;  2V1M A;  2NVL A;  2LJK A;  3Q18 A;  3F3R A;  2G0F A;  8GSS A;  4F2I A;  2B7K A;  3IK9 A;  4K0G A;  4PQI A;  5E4W A;  2VUP A;  4LLR A;  2CA8 A;  1SK2 A;  2A2R A;  3R2Q A;  2LKU A;  3ZMK A;  1TKD B;  5F06 A;  3DVW A;  4RQR A;  2L6D A;  2IJY A;  2VL9 A;  2XPE A;  4KDX A;  4LMV A;  2LJR A;  2MMZ A;  4K0N A;  4MJB A;  5IPH A;  4MF7 A;  4EF0 A;  1NHY A;  1TK5 B;  2GS3 A;  4AF2 A;  3KTL A;  4MPG A;  3DYR A;  1OVN A;  5EVO A;  4USS A;  2B5Y A;  2C3T A;  1ZZY A;  2VO4 A;  3HKR A;  2IIY A;  1TU7 A;  3GHA A;  4WF5 A;  5G1L A;  2H0G A;  3A2X A;  2YP6 A;  4MZB A;  2DIZ A;  2ON5 A;  5CRG A;  4IKH A;  4OCF A;  4EO3 A;  1OE7 A;  3LSZ A;  3M9J A;  2RLI A;  4GSN A;  5IMC A;  2YJ7 A;  2H0H A;  2AJQ B;  2DC5 A;  2FWG A;  3KMN A;  2O85 A;  14GS A;  1TK8 B;  1QK8 A;  3J7Y b;  2I1U A;  1EOH A;  1Z5Y E;  4O5R A;  1A2L A;  5ID2 B;  2C1Y A;  1ZOF A;  4DSQ A;  1S3D A;  4TR3 A;  5ECL B;  4IBP A;  3IC4 A;  2V6O A;  1U88 A;  2VCV A;  2WFC A;  3LFL A;  4XRD A;  5B6M A;  2I4A A;  3TDG A;  5F05 A;  3QAV A;  2R5G A;  2K8S A;  1USB A;  2FWE A;  5ECK B;  4G9H A;  4K5R A;  1SKW B;  2YWN A;  4EDY A;  1Z7P A;  4F82 A;  1TK0 B;  1WMJ A;  1XG8 A;  2P5R A;  5A5K A;  4QL7 A;  1MTC A;  3VI7 A;  3KJY A;  1XW6 A;  1VF4 A;  1V2A A;  4MPF A;  4MP4 A;  1B9X C;  4O7H A;  2L4Q A;  4PTS A;  2QSI A;  3BCI A;  3MAK A;  2FWH A;  4P3Y B;  1XWG A;  2IL3 A;  2WS2 A;  2HZE A;  5D96 A;  2H1A A;  4AJ6 A;  1FW1 A;  4PUF C;  3UJ1 A;  5DAL B;  4ECC A;  4DSS B;  1EEM A;  1XWA A;  2FCH A;  1M2A A;  3D4M A;  3EMP A;  4K2X A;  4POK A;  5CRW A;  2BMX A;  1U3I A;  1FVJ A;  3TRQ A;  2LQO A;  9GSS A;  4FQU A;  4HJ2 A;  4IHU A;  1SKR B;  2CT6 A;  3WT2 A;  1XFL A;  5D73 A;  2WB9 A;  4MJE A;  2BTO T;  1MD3 A;  2KUC A;  4HUA A;  3ZIV A;  2DJ3 A;  4GSS A;  4TR1 A;  4HQZ A;  2A4H A;  1RQM A;  2CAQ A;  1GSY A;  4MZW A;  5IPG A;  4TXO B;  4CY8 A;  1V57 A;  2YV7 A;  2PGT A;  3LYK A;  2AAW A;  2M72 A;  4WF4 A;  1VF3 A;  1DE2 A;  4WBJ A;  5AGY A;  3KP8 A;  5GST A;  3S9F A;  4FYC A;  3C71 A;  3GH9 A;  1H4O A;  3LW9 A;  1EWX A;  5G5F A;  2FUG 2;  4F0C A;  3IR4 A;  2NPB A;  1GP1 A;  3HA9 A;  1WOU A;  3TKP A;  1U6T A;  1GUH A;  5DJM A;  2P31 A;  5CP1 A;  3HVN A;  2IPA A;  2H74 A;  3IRA A;  3G9B A;  1LJR A;  5ECR B;  4ACS A;  3CRU A;  2CVD A;  2NTO A;  4Q5F A;  20GS A;  2HLS A;  2O8V B;  3EMX A;  4EUY A;  3VI5 A;  5CYY A;  1THX A;  3GKN A;  2WCI A;  2OAC A;  4OFT A;  3WGE A;  4MJA A;  1M9A A;  2F3M A;  2MBT A;  3QCP A;  4BL7 A;  4HZ2 A;  3LEF A;  4HU7 A;  5IMZ A;  3EE2 A;  2MZC A;  1GTB A;  1CQH A;  4K6X A;  3I9V 2;  4RI6 A;  1UC7 A;  3D4T A;  1U3A A;  3QDN A;  2NDO A;  5A4W A;  2FWF A;  4IW9 A;  1AAZ A;  4HOJ A;  5KN1 A;  3HJP A;  2L4C A;  2H75 A;  5IMF A;  3I6A A;  4XS4 B;  4IP6 A;  4KCE A;  4BWS A;  2FD3 A;  2FY6 A;  3CXG A;  5ECH B;  1FOH A;  5GZZ B;  1YDK A;  4KF9 A;  2VCW A;  4HDE A;  3ZRD A;  4BPY A;  5ECS A;  1FHE A;  1VF1 A;  2LNS A;  5FHI A;  2RM5 A;  3VFI A;  4KSO A;  3GL3 A;  5IQY A;  5CAX A;  1EGO A;  1S3C A;  3L9U A;  1Y25 A;  6GSS A;  4PNG A;  4WXT A;  3O76 A;  3MYD A;  4BA7 A;  5F07 A;  2WJU A;  1GTI A;  1O8X A;  4G0K A;  4K9Z A;  1YKA A;  2E2M A;  3M1G A;  1T4Y A;  2YPM A;  1QGV A;  2FA8 A;  2X8G A;  4QQ7 A;  1U87 A;  3GA4 A;  2P0G A;  4J2F A;  1K3L A;  3H4K A;  4A5P A;  1PA3 A;  4ECJ A;  3UVH A;  2IMI A;  3FRC A;  1DSB A;  4FO5 A;  3KCM A;  3LYP A;  3EU3 A;  1WE0 A;  3EC3 A;  3ZML A;  3EYT A;  4OFN A;  3RDW A;  2OBI A;  2TRC P;  4L0W A;  3FW2 A;  2D2Z A;  4I5Q A;  4TVE A;  4V2M A;  2A4V A;  4JR4 A;  4GQF A;  4CW9 A;  3GUS A;  4KAE A;  2H66 A;  3CSI A;  2AHE A;  1LBK A;  1SK0 A;  3WD6 A;  2IMF A;  2LQQ A;  3LXT A;  4KSM A;  4EL1 A;  3HVV A;  3KH9 A;  4POB A;  3K8N A;  6GSW A;  2GVP A;  1WPI A;  2J23 A;  2RUE A;  4HSC X;  2PU9 C;  1M9B A;  1BED A;  1E6B A;  1JZD A;  1PMT A;  3KEB A;  3Q19 A;  3OR5 A;  2V6K A;  1S3R A;  3LQ7 A;  3U5R E;  4IQA A;  5CRH A;  3TRP A;  5B8A A;  1SD9 A;  1SL2 B;  1A8Y A;  5FT3 A;  3L9V A;  4FIW A;  4OFM A;  2QC7 A;  3HJO A;  1FG4 A;  1K0D A;  2HFD A;  4KDU A;  4HQS A;  3DEX A;  1QFN A;  2VL3 A;  5ECI B;  1RK4 A;  2PMT A;  3ZTL A;  1ML6 A;  2JZS A;  3KD0 A;  4NV2 A;  4TXV A;  1XWB A;  1H75 A;  2KHP A;  3CYN A;  4I2U A;  12GS A;  3GH6 A;  1OKD A;  4V2L A;  2OE1 A;  4IJI A;  1MDK A;  3APS A;  4K8M A;  3CQF A;  1EEJ A;  2JL4 A;  3H8Q A;  1KNG A;  2YCD A;  4XHM A;  1LU4 A;  4ICY A;  1XOA A;  3RBT A;  1GRX A;  1NW2 A;  2PWJ A;  2AYT A;  2MYG A;  4MZC A;  2IN3 A;  4L8E A;  5IMD A;  4E8H A;  3UBL A;  1ZL9 A;  2B1L A;  3W8S A;  3FZ9 A;  1J08 A;  1IYH A;  2XBI A;  1YY7 A;  1XW9 A;  1YF0 A;  3LWA A;  3GIX A;  4IS0 A;  3WYW A;  4ZB8 A;  2GQL A;  3EU4 A;  2GZZ A;  4ECB A;  5B7C A;  1TP9 A;  1QQ2 A;  1WP0 A;  1GLP A;  2R0P A;  5CRD A;  1O85 A;  4RQX A;  2XBQ A;  1K0B A;  1EOG A;  4G19 A;  3VUR A;  2L59 A;  1FOV A;  4ECI A;  3L9S A;  3F4T A;  1K3Y A;  4N10 A;  1ZYQ B;  1ZGN A;  3PGT A;  4F9Z A;  2CX4 A;  3TJG A;  1A24 A;  4NPB A;  2GLR A;  1ST9 A;  2VD0 A;  1IYI A;  1MD4 A;  3CBU A;  1FO5 A;  2HT9 A;  1OC8 A;  1HNB A;  2R0C A;  2LJA A;  2GQM A;  3UBK A;  2EIO A;  4TR0 A;  3UOM A;  3TKR A;  2J9H A;  1XWK A;  5J9C A;  2H1D A;  3EPT A;  4O5Q A;  3Q6O A;  5HR3 A;  3VWU A;  4XS1 A;  4MCU A;  4TN8 A;  5HFI A;  2DMM A;  3MIX A;  2R0G A;  4O5U A;  5EPF A;  2OA7 A;  4TKY A;  3DVX A;  4WET A;  17GS A;  2YJH A;  4HJM A;  2CX3 A;  2HZE B;  1AQX A;  2C3N A;  2I3Y A;  4KGI A;  4PQH A;  4MMM A;  5D8I A;  3MDK A;  3UAR A;  2VL2 A;  2VIM A;  2N5F A;  1QUW A;  2DBC A;  2VCX A;  1ILO A;  2H72 A;  2ZCT A;  3QFA C;  2JAC A;  5J41 A;  1X5D A;  2R6K A;  5KOX A;  1OKT A;  3FHK A;  1CQG A;  5AN1 A;  3G7J A;  3FR9 A;  4WR5 A;  1SYX A;  1Z7R A;  3NIV A;  4TR1 B;  1FB6 A;  4Z2U A;  1GSF A;  4X43 A;  2C8U A;  4XRA A;  2H73 A;  4YH2 A;  2H0I A;  2LRN A;  1GSE A;  3EVI A;  2IMD A;  2Z9S A;  4XTS A;  1XW5 A;  4MA9 A;  2CV4 A;  2HNL A;  3EWL A;  2AB6 A;  1A23 A;  1SKS B;  1SU9 A;  1YZX A;  1ZYP A;  3HY2 A;  1SK1 A;  4K5S A;  2GZP A;  4OD7 A;  4DSR A;  2JSZ A;  5GSS A;  3ERF A;  5FWG A;  4ULX A;  3D6I A;  2A2P A;  1GUK A;  2OE3 A;  2DJK A;  3ZYW A;  4GLT A;  1G6Y A;  1ERV A;  4IGJ A;  2EIR A;  5DQY A;  3ERW A;  4EIP A;  3HCZ A;  5ECQ B;  1J0F A;  1TJD A;  3G7I A;  4BVX A;  3H79 A;  4MLY A;  3A2V A;  3NOF A;  4AJ7 A;  2C3Q A;  3KTB A;  2H76 A;  1NHO A;  1TOF A;  4BL7 B;  4JZQ A;  13GS A;  3AY8 A;  3WT1 A;  2LST A;  5J3R A;  3UEM A;  4OO4 A;  4N0V A;  1T8E B;  3IPZ A;  4FYU A;  4ILF A;  3A3T A;  4GRF A;  3ZL5 A;  3IDV A;  2ON7 A;  1HYU A;  1YJ6 A;  1M7T A;  1J9B A;  2JZT A;  1B4Q A;  4KW6 A;  1PX6 A;  3RPP A;  3CRT A;  1TTZ A;  2HRA A;  3BCK A;  3LGC A;  2VCQ A;  3ISO A;  3US3 A;  2B5X A;  1PN0 A;  1Q98 A;  6GSV A;  6GSU A;  1E2Y A;  4ZB9 A;  1YEX A;  4I8B A;  2RM6 A;  1GTU A;  1AC1 A;  1ERT A;  1YQ1 A;  4J57 E;  2EIQ A;  2PBJ A;  5IO2 A;  4ZBD A;  5ABR A;  5AIS A;  1T1V A;  2N5B A;  2YWO A;  5H5S A;  1WWJ A;  4EIQ A;  2V32 A;  5G30 A;  5KN0 A;  3HZ8 A;  4LA1 A;  1TU8 A;  2GTU A;  5EL8 A;  1PD2 1;  3F6F A;  2P5Q A;  2CVK A;  3UL3 A;  1TW9 A;  5IMV A;  4IVF A;  4V1A g;  5ELA A;  4X4J A;  3F8U A;  1PFO A;  5E59 A;  1YKC A;  5BRT A;  1JZW A;  3KP9 A;  2K8V A;  2C80 A;  4GF0 A;  1N2A A;  1HD2 A;  3CSH A;  2EC4 A;  3L4N A;  2DSA A;  2H8L A;  3FEU A;  2GT5 A;  5HR2 A;  3HYP A;  5JCW A;  1K0N A;  3GRX A;  2H70 A;  4MDC A;  2ALB A;  3P8W A;  22GS A;  1HQO A;  3E9J B;  3IAS 2;  3VLN A;  1R4W A;  1PX7 A;  2TIR A;  4ZBB A;  3QR6 A;  11GS A;  2IFQ A;  5LD0 A;  2RUF A;  5J5N A;  4XIH A;  4PNF A;  4PUA A;  2ES7 A;  2VAF A;  4XS6 A;  4POL A;  5HQP A;  2VD1 A;  3C1R A;  2IMK A;  3GTU A;  5GAP D;  2B6M A;  5DDL A;  4HI7 A;  1XCC A;  4X0X A;  3PIN A;  1G7E A;  4D73 A;  4YAV A;  4GWR A;  3L0H A;  1JZR A;  4I97 A;  4YQV A;  3F9U A;  4V1A p;  4BWQ A;  1SJZ A;  1UA5 A;  4K7I A;  5DCH A;  3CSJ A;  1MDJ A;  4MJC A;  2L6C A;  3APO A;  2DLX A;  4FYB A;  2GST A;  1RW1 A;  4GQC A;  5IM9 A;  1K0M A;  2F9S A;  4I2T A;  1I5G A;  5ECP B;  5BMU A;  1ON4 A;  3DML A;  2H71 A;  5KEJ A;  3QOU A;  2L5O A;  3IA1 A;  2JSY A;  5ECM B;  3HXS A;  1R26 A;  5KOW A;  2E0Q A;  1F6M C;  5HFK A;  2DJ2 A;  2DJJ A;  3GX0 A;  3TOT A;  5IOX A;  3HJM A;  5J9B A;  4EKZ A;  5ECO B;  4EVM A;  1M2B A;  1GUM A;  5ELG A;  3HZ4 A;  4PX1 A;  4KB3 A;  3F0I A;  1PGT A;  2C0E A;  3RAZ A;  4MH2 A;  3TCO A;  5EY6 A;  4AGS A;  1GSQ A;  3APQ A;  4K1F A;  1JHB A;  4Q5N A;  3DKS A;  2KP2 A;  3IC8 A;  4HS1 A;  2B3S A;  4PXO A;  2WDU A;  3PPU A;  5B6N A;  3GUR A;  1X5E A;  5HR1 A;  3QPM A;  3VWV A;  2L57 A;  1M99 A;  4GTU A;  3IK7 A;  2H1G A;  2H6Z A;  2X64 A;  2VCT A;  1XBS A;  3SWL A;  4CY6 A;  4ZIL A;  4ZBA A;  1ERW A;  2LUS A;  3QFB C;  1O7U A;  1C72 A;  5DAK A;  5JWQ B;  1M3I A;  5GAN D;  1GSD A;  1I9D A;  2QGV A;  5DVB A;  1ABA A;  2O87 A;  5JWO B;  2HRK A;  3IBH A;  3P2A A;  3N5O A;  4EE0 A;  2YZU A;  5C04 A;  1MDI A;  3GNJ A;  2HSM A;  3C7M A;  3M9K A;  2V2G A;  4Q5Q A;  2VM1 A;  3C8E A;  4FH8 A;  1PRX A;  2AV4 A;  1URM A;  3WGD A;  3ZVJ A;  1G6W A;  1T7P B;  2PVQ A;  4NWY A;  1MEK A;  2HZF A;  3HDC A;  4MAB A;  2MBS A;  4H86 A;  2LS5 A;  4N0Z A;  2CZ3 A;  4QL9 A;  5G31 A;  2K9F A;  3ME8 A;  3HD5 A;  4ZL8 A;  1Y6E A;  1VRS D;  2LNT A;  18GS A;  1AQW A;  2HI7 A;  4MNN A;  4J56 E;  1O73 A;  3EIN A;  1W89 A;  1V9W A;  2YOI A;  3VWX A;  2G2Q A;  3IV4 A;  5ENU A;  3PR8 A;  3UMA A;  1OC9 A;  3BJ5 A;  4JRR A;  2F8F A;  3ZRE A;  2M80 A;  1YF1 A;  1WIK A;  1PL1 A;  5J4U A;  5COH A;  5IIZ A;  3DGQ A;  2H01 A;  3VPQ A;  2QKE A;  2LRC A;  5H5Q A;  1EZK A;  1O81 A;  1Z6N A;  2HRF A;  3UAP A;  2PPT A;  2VL2 C;  2GSS A;  2MMA A;  1JLW A;  4ZL9 A;  4KX4 A;  1XWC A;  5A4U A;  4X1U A;  2KLX A;  3HVS A;  3U6V A;  2X8C A;  1GLQ A;  5CNW A;  2CQ9 A;  1BG5 A;  3RHC A;  2H6Y A;  5B8B A;  3IOS A;  4IN0 A;  3P7X A;  2X8H A;  3C1S A;  5AIX A;  5DBQ A;  3ZLP A;  1X9S B;  5C00 A;  4ML1 A;  1WJK A;  2YN1 A;  6GSX A;  2GZY A;  3G7Y A;  4GST A;  4JU5 A;  4YQU A;  5LNK e;  1JLV A;  1WRY A;  1F2E A;  1XXU A;  1ERU A;  5D9W A;  2MMN A;  2PN8 A;  1BYE A;  1B48 A;  1NM3 A;  2XHF A;  4ML6 A;  3F4R A;  2PER A;  3J7Y k;  1F3B A;  4ZXG A;  1A8L A;  2GDR A;  2B1K A;  2VCZ A;  3FR3 A;  3TKS A;  3GN3 A;  2DML A;  1F37 A;  5IOW A;  4PGT A;  2ZNM A;  4ZB6 A;  2DKI A;  5JCU A;  2OE0 A;  2LEG A;  4BIK A;  1UVZ A;  5D9X A;  4BVX B;  4TR4 A;  2DKH A;  4DVC A;  4BVY B;  4O92 A;  1A0F A;  2FNO A;  4G0I A;  5D93 A;  4ZL7 A;  3N9J A;  4JE1 A;  2FLS A;  4CHS A;  4HZ4 A;  4IP1 A; 
#chains in the Genus database with same CATH homology
 5F0G A;  3ZFB A;  1V98 A;  1K0A A;  4GCI A;  2PUK C;  3QD9 A;  3FYG A;  4K2D A;  2E2G A;  1TRV A;  2JU5 A;  3W8J A;  1A2J A;  2X99 A;  2IWT A;  4XCS A;  1B4P A;  1R5P A;  1THO A;  5D9T A;  4NAX A;  1XVW A;  1HNA A;  2VOC A;  4Q5R A;  2OAD A;  1SL1 B;  2HE3 A;  1T4Z A;  2UZ8 A;  5F8B A;  4OO5 A;  2YNX A;  16GS A;  3D0Z A;  5G2Z A;  1TRW A;  3TJJ A;  1XZO A;  1SD8 A;  2GSQ A;  1X0R A;  2C0D A;  2R4V A;  1T3B A;  2WUL A;  3A5W A;  2LRT A;  4KE3 A;  2YZH A;  3LJR A;  3RHB A;  4OCE A;  1UN2 A;  5IMA A;  4OWY A;  3GKK A;  1BJX A;  3E0U A;  2YAN A;  4EC0 A;  4MK3 A;  4WEY A;  3I69 A;  2KOK A;  3KGK A;  4YKG A;  4WKW A;  5A4V A;  2FHE A;  2C0G A;  3KH7 A;  2HSH A;  3TRX A;  5INY A;  7GSS A;  2H30 A;  1B9Y C;  4BVY A;  4TW5 A;  1K0O A;  3IHG A;  2VM2 A;  3PH9 A;  1SEN A;  1W4V A;  3QMX A;  3ERG A;  4NV5 A;  3BBY A;  5H5R A;  3FZ5 A;  2MMO A;  1DUG A;  1O6J A;  2I81 A;  3JCM L;  1V58 A;  3SBC A;  4EDZ A;  1VGL A;  1TI1 A;  3D5J A;  3GKX A;  3GX8 A;  2C0F A;  1FB0 A;  3QAG A;  4Z2T A;  1TRS A;  4IQ1 A;  4F0B A;  3HVX A;  1GH2 A;  4MH3 A;  1TXX A;  5ID2 A;  5ECN B;  4YAP A;  1PL2 A;  3E3E A;  1DE1 A;  3GYK A;  4YQM A;  2XPD A;  5LCZ A;  1O8W A;  4WR4 A;  2RII A;  1GUL A;  3IXR A;  2E7P A;  2IFQ B;  4GXZ A;  10GS A;  3TGZ A;  3ZIJ A;  3NZN A;  1EGR A;  3DD3 A;  3FR6 A;  5JCG A;  3CTG A;  1GL8 A;  1TI3 A;  1F3A A;  3I43 A;  4ID0 A;  1G7O A;  3GTU B;  1FAA A;  3KIJ A;  2HRN A;  1BX9 A;  1XPV A;  4L0U A;  4LL4 B;  1GNW A;  2VLV A;  3KXO A;  3ZZX A;  1EP8 A;  4I6X A;  4OMV A;  4YKF A;  2DIY A;  4D73 B;  3H1N A;  4TRX A;  2B7J A;  5HR0 A;  3IHQ A;  3VK9 A;  3H93 A;  4RI7 A;  4MF6 A;  5DJL A;  3TJK A;  1PKZ A;  3GKM A;  2WGR A;  2YWI A;  2DJ0 A;  6GSY A;  2O7K A;  5DAL A;  4DSS A;  4LL1 B;  1KTE A;  3Q74 A;  2F8A A;  3D22 A;  3DRN A;  2A2S A;  5CO3 A;  5DQS A;  1YEP A;  3F4S A;  2R37 A;  4NXI A;  1OC3 A;  4Z2R A;  3O6T A;  3ED3 A;  4G0L A;  2V41 A;  2HSY A;  2WZ9 A;  1VF2 A;  1B8X A;  19GS A;  3CTF A;  4EXJ A;  2DJ1 A;  4CDO A;  1R5A A;  4KND A;  2FA4 A;  4NHZ A;  1GNE A;  2B5E A;  2L5L A;  4TXO A;  1BQ7 A;  4POM A;  1AXD A;  2AUV A;  4N11 A;  1XVQ A;  1PKW A;  1GSS A;  2H19 A;  4F03 A;  1DBY A;  1XIY A;  3GV1 A;  3R3E A;  1EP7 A;  5HFG A;  1X9W B;  1HNC A;  2X49 A;  2REM A;  1K0C A;  1SJI A;  4G2E A;  1SYR A;  4NHW A;  4PUR A;  3UIW A;  1TRU A;  1AQV A;  3LG6 A;  3DXB A;  3FZ4 A;  1EV9 A;  1BAY A;  3GMF A;  3UVT A;  2H6X A;  1AIU A;  4K7O A;  3BOA A;  4KDY A;  1GSU A;  3GFK A;  2OKA A;  5G5E A;  5DAK B;  4N30 A;  2HYX A;  3BD2 A;  4JBB A;  4L5O A;  1PSQ A;  2CAI A;  2O89 A;  3ME7 A;  4LMW A;  3L78 A;  3LOR A;  1AW9 A;  2VLT A;  4JED A;  2H1B A;  3A2W A;  3CMI A;  2HXK A;  3VWW A;  2R3X A;  1QXH A;  2GSR A;  2M46 A;  2LV3 A;  4RUV A;  1XOB A;  1ZYN A;  1G0T A;  4PQ1 A;  2WRT A;  3ZVJ D;  2OBK A;  3DWV A;  1T00 A;  3P90 A;  3IE3 A;  2CVB A;  3TJB A;  5KN3 A;  1M2D A;  1ACV A;  2GQK A;  1QMV A;  1ZYE A;  3LXZ A;  3KZQ A;  3KMO A;  2I9H A;  4XS4 A;  4ZIJ A;  5D9V A;  5DCG A;  3F3Q A;  3M0F A;  5KN2 A;  5AIV A;  3O3T A;  1V40 A;  3ZIT A;  3GSS A;  1PN9 A;  2NBS A;  1S3A A;  4NMU A;  3GST A;  3M8N A;  4IJ3 A;  1ZMA A;  3QAW A;  4K7N A;  1OAZ A;  1KBN A;  1GWC A;  3D21 A;  6GST A;  2YWM A;  3TKQ A;  1M0U A;  3TB2 A;  3TKS E;  1OC9 B;  4DEJ A;  3TUE A;  3TOU A;  3HHV A;  2IME A;  4KA0 A;  2QA1 A;  1KEB A;  3FMW A;  2K18 A;  1A2M A;  1TDI A;  2F51 A;  1N8J A;  1FVK A;  5JWR B;  3C73 A;  5CRE A;  4L5L A;  1X9M B;  1SJ6 A;  4KH7 A;  5G1K A;  4HU9 A;  2GGT A;  3RPN A;  3DIE A;  4MF5 A;  3IAM 2;  1A0R P;  2OJL A;  2PVO C;  1OYJ A;  1JFU A;  2TRX A;  3MSZ A;  2CZ2 A;  2VLU A;  2YV9 A;  1NSW A;  2X4A A;  2ZUP A;  3TJF A;  2LTK A;  1Q4J A;  4O32 A;  2JAD A;  2JZR A;  2GT6 A;  1K3O A;  2N5A A;  4AJ8 A;  1F9M A;  1Z6M A;  3MNG A;  4TOP A;  3MWH A;  3ZFL A;  1GTA A;  1Z9H A;  4G10 A;  3FK8 A;  1X5C A;  1OE8 A;  4WBR D;  4E8E A;  3F6D A;  1SL0 B;  3KM6 A;  3VPT A;  1R7H A;  3M3M A;  3FKF A;  4IEL A;  3EUR A;  2KP1 A;  3FY7 A;  3A5I A;  1Z3E A;  1AUC A;  2XC2 A;  1EV4 A;  3TKS C;  3W6G A;  4JR6 A;  3F63 A;  2K6V A;  2QA2 A;  2FGX A;  3V1W A;  2C4J A;  4HEA 2;  5L71 A;  4V2N A;  3WGX A;  1ZCP A;  5IO0 A;  2BJX A;  3FZA A;  1JZO A;  4KCA A;  1PQN A;  4ISD A;  4KUN A;  2R2J A;  4Z7X A;  3GL5 A;  2V1M A;  2NVL A;  2LJK A;  3Q18 A;  3F3R A;  2G0F A;  8GSS A;  4F2I A;  2B7K A;  3IK9 A;  4K0G A;  4PQI A;  5E4W A;  2VUP A;  4LLR A;  2CA8 A;  1SK2 A;  2A2R A;  3R2Q A;  2LKU A;  3ZMK A;  1TKD B;  5F06 A;  3DVW A;  4RQR A;  2L6D A;  2IJY A;  2VL9 A;  2XPE A;  4KDX A;  4LMV A;  2LJR A;  2MMZ A;  4K0N A;  4MJB A;  5IPH A;  4MF7 A;  4EF0 A;  1NHY A;  1TK5 B;  2GS3 A;  4AF2 A;  3KTL A;  4MPG A;  3DYR A;  1OVN A;  5EVO A;  4USS A;  2B5Y A;  2C3T A;  1ZZY A;  2VO4 A;  3HKR A;  2IIY A;  1TU7 A;  3GHA A;  4WF5 A;  5G1L A;  2H0G A;  3A2X A;  2YP6 A;  4MZB A;  2DIZ A;  2ON5 A;  5CRG A;  4IKH A;  4OCF A;  4EO3 A;  1OE7 A;  3LSZ A;  3M9J A;  2RLI A;  4GSN A;  5IMC A;  2YJ7 A;  2H0H A;  2AJQ B;  2DC5 A;  2FWG A;  3KMN A;  2O85 A;  14GS A;  1TK8 B;  1QK8 A;  3J7Y b;  2I1U A;  1EOH A;  1Z5Y E;  4O5R A;  1A2L A;  5ID2 B;  2C1Y A;  1ZOF A;  4DSQ A;  1S3D A;  4TR3 A;  5ECL B;  4IBP A;  3IC4 A;  2V6O A;  1U88 A;  2VCV A;  2WFC A;  3LFL A;  4XRD A;  5B6M A;  2I4A A;  3TDG A;  5F05 A;  3QAV A;  2R5G A;  2K8S A;  1USB A;  2FWE A;  5ECK B;  4G9H A;  4K5R A;  1SKW B;  2YWN A;  4EDY A;  1Z7P A;  4F82 A;  1TK0 B;  1WMJ A;  2P5R A;  5A5K A;  4QL7 A;  1MTC A;  3VI7 A;  3KJY A;  1XW6 A;  1VF4 A;  1V2A A;  4MPF A;  4MP4 A;  1B9X C;  4O7H A;  2L4Q A;  4PTS A;  2QSI A;  3BCI A;  3MAK A;  2FWH A;  4P3Y B;  1XWG A;  2IL3 A;  2WS2 A;  2HZE A;  5D96 A;  2H1A A;  4AJ6 A;  1FW1 A;  4PUF C;  3UJ1 A;  5DAL B;  4ECC A;  4DSS B;  1EEM A;  1XWA A;  2FCH A;  1M2A A;  3D4M A;  3EMP A;  4K2X A;  4POK A;  5CRW A;  2BMX A;  1U3I A;  1FVJ A;  3TRQ A;  2LQO A;  9GSS A;  4FQU A;  4HJ2 A;  4IHU A;  1SKR B;  2CT6 A;  3WT2 A;  1XFL A;  5D73 A;  2WB9 A;  4MJE A;  2BTO T;  1MD3 A;  2KUC A;  4HUA A;  3ZIV A;  2DJ3 A;  4GSS A;  4TR1 A;  4HQZ A;  2A4H A;  1RQM A;  2CAQ A;  1GSY A;  4MZW A;  5IPG A;  4TXO B;  4CY8 A;  1V57 A;  2YV7 A;  2PGT A;  3LYK A;  2AAW A;  2M72 A;  4WF4 A;  1VF3 A;  1DE2 A;  4WBJ A;  5AGY A;  3KP8 A;  5GST A;  3S9F A;  4FYC A;  3C71 A;  3GH9 A;  1H4O A;  3LW9 A;  1EWX A;  5G5F A;  2FUG 2;  4F0C A;  3IR4 A;  2NPB A;  1GP1 A;  3HA9 A;  1WOU A;  3TKP A;  1U6T A;  1GUH A;  5DJM A;  2P31 A;  5CP1 A;  2IPA A;  2H74 A;  3IRA A;  3G9B A;  1LJR A;  5ECR B;  4ACS A;  3CRU A;  2CVD A;  2NTO A;  4Q5F A;  20GS A;  2HLS A;  2O8V B;  3EMX A;  4EUY A;  3VI5 A;  5CYY A;  1THX A;  3GKN A;  2WCI A;  2OAC A;  4OFT A;  3WGE A;  4MJA A;  1M9A A;  2F3M A;  2MBT A;  3QCP A;  4BL7 A;  4HZ2 A;  3LEF A;  4HU7 A;  5IMZ A;  3EE2 A;  2MZC A;  1GTB A;  1CQH A;  4K6X A;  3I9V 2;  4RI6 A;  1UC7 A;  3D4T A;  1U3A A;  3QDN A;  2NDO A;  5A4W A;  2FWF A;  4IW9 A;  1AAZ A;  4HOJ A;  5KN1 A;  3HJP A;  2L4C A;  2H75 A;  5IMF A;  3I6A A;  4XS4 B;  4IP6 A;  4KCE A;  4BWS A;  2FD3 A;  2FY6 A;  3CXG A;  5ECH B;  1FOH A;  5GZZ B;  1YDK A;  4KF9 A;  2VCW A;  4HDE A;  3ZRD A;  4BPY A;  5ECS A;  1FHE A;  1VF1 A;  2LNS A;  5FHI A;  2RM5 A;  3VFI A;  4KSO A;  3GL3 A;  5IQY A;  5CAX A;  1EGO A;  1S3C A;  3L9U A;  1Y25 A;  6GSS A;  4PNG A;  4WXT A;  3O76 A;  3MYD A;  4BA7 A;  5F07 A;  2WJU A;  1GTI A;  1O8X A;  4G0K A;  4K9Z A;  1YKA A;  2E2M A;  3M1G A;  1T4Y A;  2YPM A;  1QGV A;  2FA8 A;  2X8G A;  4QQ7 A;  1U87 A;  3GA4 A;  2P0G A;  4J2F A;  1K3L A;  3H4K A;  4A5P A;  1PA3 A;  4ECJ A;  3UVH A;  2IMI A;  3FRC A;  1DSB A;  4FO5 A;  3KCM A;  3LYP A;  3EU3 A;  1WE0 A;  3EC3 A;  3ZML A;  3EYT A;  4OFN A;  3RDW A;  2OBI A;  2TRC P;  4L0W A;  3FW2 A;  2D2Z A;  4I5Q A;  4TVE A;  4V2M A;  2A4V A;  4JR4 A;  4GQF A;  4CW9 A;  3GUS A;  4KAE A;  2H66 A;  3CSI A;  2AHE A;  1LBK A;  1SK0 A;  3WD6 A;  2IMF A;  2LQQ A;  3LXT A;  4KSM A;  4EL1 A;  3HVV A;  3KH9 A;  4POB A;  3K8N A;  6GSW A;  2GVP A;  1WPI A;  2J23 A;  2RUE A;  2PU9 C;  1M9B A;  1BED A;  1E6B A;  1JZD A;  1PMT A;  3KEB A;  3Q19 A;  3OR5 A;  2V6K A;  3LQ7 A;  3U5R E;  4IQA A;  5CRH A;  3TRP A;  5B8A A;  1SD9 A;  1SL2 B;  1A8Y A;  5FT3 A;  3L9V A;  4FIW A;  4OFM A;  2QC7 A;  3HJO A;  1FG4 A;  1K0D A;  2HFD A;  4KDU A;  4HQS A;  3DEX A;  1QFN A;  2VL3 A;  5ECI B;  1RK4 A;  2PMT A;  3ZTL A;  1ML6 A;  2JZS A;  3KD0 A;  4NV2 A;  4TXV A;  1XWB A;  1H75 A;  2KHP A;  3CYN A;  4I2U A;  12GS A;  3GH6 A;  1OKD A;  4V2L A;  2OE1 A;  4IJI A;  1MDK A;  3APS A;  4K8M A;  1EEJ A;  2JL4 A;  3H8Q A;  1KNG A;  2YCD A;  4XHM A;  1LU4 A;  4ICY A;  1XOA A;  3RBT A;  1GRX A;  1NW2 A;  2PWJ A;  2AYT A;  2MYG A;  4MZC A;  2IN3 A;  4L8E A;  5IMD A;  4E8H A;  3UBL A;  1ZL9 A;  2B1L A;  3W8S A;  3FZ9 A;  1J08 A;  1IYH A;  2XBI A;  1YY7 A;  1XW9 A;  1YF0 A;  3LWA A;  3GIX A;  4IS0 A;  3WYW A;  4ZB8 A;  2GQL A;  3EU4 A;  2GZZ A;  4ECB A;  5B7C A;  1TP9 A;  1QQ2 A;  1WP0 A;  1GLP A;  2R0P A;  5CRD A;  1O85 A;  4RQX A;  2XBQ A;  1K0B A;  1EOG A;  4G19 A;  3VUR A;  2L59 A;  1FOV A;  4ECI A;  3L9S A;  3F4T A;  1K3Y A;  4N10 A;  1ZYQ B;  1ZGN A;  3PGT A;  4F9Z A;  2CX4 A;  3TJG A;  1A24 A;  4NPB A;  2GLR A;  1ST9 A;  2VD0 A;  1IYI A;  1MD4 A;  3CBU A;  1FO5 A;  2HT9 A;  1OC8 A;  1HNB A;  2R0C A;  2LJA A;  2GQM A;  3UBK A;  2EIO A;  4TR0 A;  3UOM A;  3TKR A;  2J9H A;  1XWK A;  5J9C A;  2H1D A;  3EPT A;  4O5Q A;  3Q6O A;  5HR3 A;  3VWU A;  4XS1 A;  4MCU A;  4TN8 A;  5HFI A;  2DMM A;  3MIX A;  2R0G A;  4O5U A;  5EPF A;  2OA7 A;  4TKY A;  3DVX A;  4WET A;  17GS A;  2YJH A;  4HJM A;  2CX3 A;  2HZE B;  1AQX A;  2C3N A;  2I3Y A;  4KGI A;  4PQH A;  4MMM A;  5D8I A;  3MDK A;  3UAR A;  2VL2 A;  2VIM A;  2N5F A;  1QUW A;  2DBC A;  2VCX A;  1ILO A;  2H72 A;  2ZCT A;  3QFA C;  2JAC A;  5J41 A;  1X5D A;  2R6K A;  5KOX A;  1OKT A;  3FHK A;  1CQG A;  5AN1 A;  3G7J A;  3FR9 A;  4WR5 A;  1SYX A;  1Z7R A;  3NIV A;  4TR1 B;  1FB6 A;  4Z2U A;  1GSF A;  4X43 A;  2C8U A;  4XRA A;  2H73 A;  4YH2 A;  2H0I A;  2LRN A;  1GSE A;  3EVI A;  2IMD A;  2Z9S A;  4XTS A;  1XW5 A;  4MA9 A;  2CV4 A;  2HNL A;  3EWL A;  2AB6 A;  1A23 A;  1SKS B;  1SU9 A;  1YZX A;  1ZYP A;  3HY2 A;  1SK1 A;  4K5S A;  2GZP A;  4OD7 A;  4DSR A;  2JSZ A;  5GSS A;  3ERF A;  5FWG A;  4ULX A;  3D6I A;  2A2P A;  1GUK A;  2OE3 A;  2DJK A;  3ZYW A;  4GLT A;  1G6Y A;  1ERV A;  4IGJ A;  2EIR A;  5DQY A;  3ERW A;  4EIP A;  3HCZ A;  5ECQ B;  1J0F A;  1TJD A;  3G7I A;  4BVX A;  3H79 A;  4MLY A;  3A2V A;  3NOF A;  4AJ7 A;  2C3Q A;  3KTB A;  2H76 A;  1NHO A;  1TOF A;  4BL7 B;  4JZQ A;  13GS A;  3AY8 A;  3WT1 A;  2LST A;  5J3R A;  3UEM A;  4OO4 A;  4N0V A;  1T8E B;  3IPZ A;  4FYU A;  4ILF A;  3A3T A;  4GRF A;  3ZL5 A;  3IDV A;  2ON7 A;  1HYU A;  1YJ6 A;  1M7T A;  1J9B A;  2JZT A;  1B4Q A;  4KW6 A;  1PX6 A;  3RPP A;  3CRT A;  1TTZ A;  2HRA A;  3BCK A;  3LGC A;  2VCQ A;  3ISO A;  3US3 A;  2B5X A;  1PN0 A;  1Q98 A;  6GSV A;  6GSU A;  1E2Y A;  4ZB9 A;  1YEX A;  4I8B A;  2RM6 A;  1GTU A;  1AC1 A;  1ERT A;  1YQ1 A;  4J57 E;  2EIQ A;  2PBJ A;  5IO2 A;  4ZBD A;  5ABR A;  5AIS A;  1T1V A;  2N5B A;  2YWO A;  5H5S A;  1WWJ A;  4EIQ A;  2V32 A;  5G30 A;  5KN0 A;  3HZ8 A;  4LA1 A;  1TU8 A;  2GTU A;  5EL8 A;  1PD2 1;  3F6F A;  2P5Q A;  2CVK A;  3UL3 A;  1TW9 A;  5IMV A;  4IVF A;  4V1A g;  5ELA A;  4X4J A;  3F8U A;  5E59 A;  1YKC A;  5BRT A;  1JZW A;  3KP9 A;  2K8V A;  2C80 A;  4GF0 A;  1N2A A;  1HD2 A;  3CSH A;  2EC4 A;  3L4N A;  2DSA A;  2H8L A;  3FEU A;  2GT5 A;  5HR2 A;  3HYP A;  5JCW A;  1K0N A;  3GRX A;  2H70 A;  4MDC A;  2ALB A;  3P8W A;  22GS A;  1HQO A;  3E9J B;  3IAS 2;  3VLN A;  1R4W A;  1PX7 A;  2TIR A;  4ZBB A;  3QR6 A;  11GS A;  2IFQ A;  5LD0 A;  2RUF A;  5J5N A;  4XIH A;  4PNF A;  4PUA A;  2ES7 A;  2VAF A;  4XS6 A;  4POL A;  5HQP A;  2VD1 A;  3C1R A;  2IMK A;  3GTU A;  5GAP D;  2B6M A;  5DDL A;  4HI7 A;  1XCC A;  4X0X A;  3PIN A;  1G7E A;  4D73 A;  4YAV A;  4GWR A;  3L0H A;  1JZR A;  4I97 A;  4YQV A;  3F9U A;  4V1A p;  4BWQ A;  1SJZ A;  1UA5 A;  4K7I A;  5DCH A;  3CSJ A;  1MDJ A;  4MJC A;  2L6C A;  3APO A;  2DLX A;  4FYB A;  2GST A;  1RW1 A;  4GQC A;  5IM9 A;  1K0M A;  2F9S A;  4I2T A;  1I5G A;  5ECP B;  5BMU A;  1ON4 A;  3DML A;  2H71 A;  5KEJ A;  3QOU A;  2L5O A;  3IA1 A;  2JSY A;  5ECM B;  3HXS A;  1R26 A;  5KOW A;  2E0Q A;  1F6M C;  5HFK A;  2DJ2 A;  2DJJ A;  3GX0 A;  3TOT A;  5IOX A;  3HJM A;  5J9B A;  4EKZ A;  5ECO B;  4EVM A;  1M2B A;  1GUM A;  5ELG A;  3HZ4 A;  4PX1 A;  4KB3 A;  3F0I A;  1PGT A;  2C0E A;  3RAZ A;  4MH2 A;  3TCO A;  5EY6 A;  4AGS A;  1GSQ A;  3APQ A;  4K1F A;  1JHB A;  4Q5N A;  3DKS A;  2KP2 A;  3IC8 A;  4HS1 A;  2B3S A;  4PXO A;  2WDU A;  3PPU A;  5B6N A;  3GUR A;  1X5E A;  5HR1 A;  3QPM A;  3VWV A;  2L57 A;  1M99 A;  4GTU A;  3IK7 A;  2H1G A;  2H6Z A;  2X64 A;  2VCT A;  1XBS A;  3SWL A;  4CY6 A;  4ZIL A;  4ZBA A;  1ERW A;  2LUS A;  3QFB C;  1O7U A;  1C72 A;  5DAK A;  5JWQ B;  5GAN D;  1GSD A;  1I9D A;  2QGV A;  5DVB A;  1ABA A;  2O87 A;  5JWO B;  2HRK A;  3IBH A;  3P2A A;  3N5O A;  4EE0 A;  2YZU A;  5C04 A;  1MDI A;  3GNJ A;  2HSM A;  3C7M A;  3M9K A;  2V2G A;  4Q5Q A;  2VM1 A;  3C8E A;  4FH8 A;  1PRX A;  2AV4 A;  1URM A;  3WGD A;  3ZVJ A;  1G6W A;  1T7P B;  2PVQ A;  4NWY A;  1MEK A;  2HZF A;  3HDC A;  4MAB A;  2MBS A;  4H86 A;  2LS5 A;  4N0Z A;  2CZ3 A;  4QL9 A;  5G31 A;  2K9F A;  3ME8 A;  3HD5 A;  4ZL8 A;  1Y6E A;  1VRS D;  2LNT A;  18GS A;  1AQW A;  2HI7 A;  4MNN A;  4J56 E;  1O73 A;  3EIN A;  1W89 A;  1V9W A;  2YOI A;  3VWX A;  2G2Q A;  3IV4 A;  5ENU A;  3PR8 A;  3UMA A;  1OC9 A;  3BJ5 A;  4JRR A;  2F8F A;  3ZRE A;  2M80 A;  1YF1 A;  1WIK A;  1PL1 A;  5J4U A;  5COH A;  5IIZ A;  3DGQ A;  2H01 A;  3VPQ A;  2QKE A;  2LRC A;  5H5Q A;  1EZK A;  1O81 A;  1Z6N A;  2HRF A;  3UAP A;  2PPT A;  2VL2 C;  2GSS A;  2MMA A;  1JLW A;  4ZL9 A;  4KX4 A;  1XWC A;  5A4U A;  4X1U A;  2KLX A;  3HVS A;  3U6V A;  2X8C A;  1GLQ A;  5CNW A;  2CQ9 A;  1BG5 A;  3RHC A;  2H6Y A;  5B8B A;  3IOS A;  4IN0 A;  3P7X A;  2X8H A;  3C1S A;  5AIX A;  5DBQ A;  3ZLP A;  1X9S B;  5C00 A;  4ML1 A;  1WJK A;  2YN1 A;  6GSX A;  2GZY A;  3G7Y A;  4GST A;  4JU5 A;  4YQU A;  5LNK e;  1JLV A;  1WRY A;  1F2E A;  1XXU A;  1ERU A;  5D9W A;  2MMN A;  2PN8 A;  1BYE A;  1B48 A;  1NM3 A;  2XHF A;  4ML6 A;  3F4R A;  2PER A;  3J7Y k;  1F3B A;  4ZXG A;  1A8L A;  2GDR A;  2B1K A;  2VCZ A;  3FR3 A;  3TKS A;  3GN3 A;  2DML A;  1F37 A;  5IOW A;  4PGT A;  2ZNM A;  4ZB6 A;  2DKI A;  5JCU A;  2OE0 A;  2LEG A;  1UVZ A;  5D9X A;  4BVX B;  4TR4 A;  2DKH A;  4DVC A;  4BVY B;  4O92 A;  1A0F A;  2FNO A;  4G0I A;  5D93 A;  4ZL7 A;  3N9J A;  4JE1 A;  2FLS A;  4CHS A;  4HZ4 A;  4IP1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...