1FVJA

The 2.06 angstrom structure of the h32y mutant of the disulfide bond formation protein (dsba)
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
188
structure length
188
Chain Sequence
AQYEDGKQYTTLEKPVAGAPQVLEFFSFFCPYCYQFEEVLHISDNVKKKLPEGVKMTKYHVNFMGGDLGKDLTQAWAVAMALGVEDKVTVPLFEGVQKTQTIRSASDIRDVFINAGIKGEEYDAAWNSFVVKSLVAQQEKAAADVQLRGVPAMFVNGKYQLNPQGMDTSNMDVFVQQYADTVKYLSEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DISULFIDE BOND FORMATION PROTEIN
publication title Structural analysis of three His32 mutants of DsbA: support for an electrostatic role of His32 in DsbA stability.
pubmed rcsb
source organism Escherichia coli
molecule tags Disulfide oxidoreductase
total genus 66
structure length 188
sequence length 188
chains with identical sequence B
ec nomenclature
pdb deposition date 1996-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01323 DSBA DSBA-like thioredoxin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1fvjA00
1FOVA 3ZFLA 4XCSA 1GP1A 2EIRA 2VIMA 5F0GA 3ZREA 5G5FA 1PKWA 4IHUA 3UIWA 3WGXA 2QC7A 2MBSA 2B6MA 3KXOA 3M9JA 1GSYA 4V1Ag 4J2FA 2VCVA 2H76A 5A4VA 1Z9HA 2C0EA 1R7HA 2WB9A 4N0ZA 1PMTA 4GSSA 3A3TA 2TRCP 1GNEA 2ZCTA 3DD3A 5ECHB 1OVNA 2PPTA 2FY6A 2WDUA 3SBCA 1ERVA 1XPVA 1GSUA 1K0CA 3FR9A 1EOHA 2KUCA 3GNJA 3TB2A 1EOGA 5ELAA 2OACA 1F6MC 4E8HA 1AW9A 2LQQA 3PINA 3EU3A 1SKWB 1XVQA 3J7Yk 4PQ1A 3RBTA 1M2AA 4D73B 5JCUA 4H86A 3GHAA 2GLRA 4AJ7A 1CQGA 2ALBA 4HZ2A 1TK5B 2G0FA 2HXKA 1XVWA 4EUYA 2LS5A 2O85A 4NXIA 3LGCA 17GSA 5ID2B 1BG5A 2GZZA 2C1YA 1JZDA 5E4WA 2CAQA 2FWGA 3Q18A 2M46A 4JZQA 5GSTA 1YQ1A 2PMTA 4F9ZA 3GUSA 2MBTA 3HJOA 3TKPA 1T00A 2HI7A 2B7JA 1E6BA 4PUAA 4POLA 2YWIA 1QUWA 5HR2A 2JL4A 4KNDA 1NSWA 5A4UA 3CBUA 3RPNA 4DSQA 1MD3A 3CSJA 4TW5A 1FAAA 4KSOA 1YZXA 3RPPA 2VLUA 4NV5A 4IJ3A 3LWAA 2XHFA 2HT9A 2PVQA 2YV7A 5CRGA 2NVLA 3GA4A 1M99A 3TOUA 1XIYA 3CRTA 1NM3A 3G7JA 2AAWA 2FA8A 2CVDA 2H70A 5CYYA 19GSA 4EKZA 4Z7XA 3KGKA 1IYHA 1RQMA 2FNOA 4QQ7A 1KBNA 2HRFA 2FGXA 3VI7A 2IMEA 1DSBA 2L57A 4IVFA 1F2EA 1K3OA 1AUCA 4HDEA 1GUMA 2YNXA 1BQ7A 1Z7RA 1X9SB 4XS6A 1VF2A 3QAWA 3FKFA 1GSEA 1SJ6A 4XRDA 3UMAA 2HNLA 1EWXA 2GT5A 2KP2A 4WKWA 1HD2A 1JZWA 3D0ZA 4GQCA 2OADA 2JADA 1K3YA 1TTZA 2HSHA 2ON7A 4WR5A 2L5LA 2HRNA 4LLRA 3A2WA 2BMXA 4MF6A 5GSSA 1EEJA 1XCCA 1GNWA 3HVVA 3IK7A 3VWUA 1OAZA 1HNAA 3LORA 1X9WB 2CVKA 1OKTA 3VWWA 1ACVA 2F8AA 2H1AA 1AIUA 2GS3A 1A0FA 2LV3A 4L5LA 3WT2A 2GSTA 3ZVJA 5DBQA 4WEYA 3VFIA 6GSUA 5IO2A 1AXDA 5HR3A 2HFDA 3F4TA 3QFBC 1A2JA 3TRQA 5J4UA 3R2QA 2VO4A 4K0GA 3UEMA 3ZL5A 2WULA 1JLWA 1ZMAA 1Y6EA 3LXTA 2GT6A 3KCMA 2AV4A 2XPDA 1WWJA 3UOMA 2LNTA 1GTAA 2JSZA 1ZOFA 3EINA 1Z3EA 3E3EA 4NAXA 5CO3A 2H6YA 2YPMA 1Z5YE 2YP6A 4GWRA 2PWJA 3F4SA 1F3BA 2HLSA 3L78A 3IPZA 1UN2A 11GSA 5DVBA 4TR4A 1K0OA 2D2ZA 1FB6A 5HQPA 2F3MA 4XRAA 3BOAA 3D6IA 1SU9A 3O6TA 4LL4B 9GSSA 2H74A 1A24A 1W89A 2V1MA 3LSZA 4L8EA 2DJ0A 1TU8A 1GTBA 3M9KA 4PX1A 1GTIA 3ZIVA 3LG6A 4TR1B 2IFQB 3O3TA 1T1VA 3C1RA 4TKYA 3C73A 2I81A 3VURA 1R4WA 2A2SA 2IMIA 4OCEA 1ZL9A 2H73A 3HXSA 6GSXA 4ZXGA 2K9FA 3EU4A 5G1KA 5FWGA 3P7XA 3OR5A 5EPFA 2DIZA 5DDLA 2DIYA 3KIJA 4D73A 4I8BA 1GTUA 4MF7A 1JLVA 2IPAA 4WBJA 1QMVA 3V1WA 1ST9A 1SK1A 4IW9A 2YN1A 2H71A 5ID2A 3VPTA 1AC1A 1JFUA 4ID0A 2H72A 2PN8A 2YZUA 2VLTA 4YH2A 2R5GA 2HE3A 4OWYA 5D9TA 3HY2A 1PD21 4TRXA 1T8EB 4K0NA 3GX0A 1AQXA 2OE0A 1MDKA 4HJMA 4MPGA 2I1UA 4F03A 5JCWA 4QL9A 4ZB9A 14GSA 2B5EA 2CZ2A 5ENUA 4ZL9A 3N9JA 1TKDB 3FZ9A 3DWVA 1I5GA 1FB0A 1XW9A 1IYIA 2K8SA 1USBA 2E2MA 2VCTA 3EC3A 1F3AA 3BBYA 1A8LA 4KDUA 2DSAA 1XWCA 2RM6A 4OFNA 2CT6A 3F9UA 4BWQA 3LYPA 1WPIA 4ZBBA 1PN9A 2B7KA 3DRNA 2HSYA 3UVTA 3F3QA 3APQA 4GCIA 4YAPA 3ISOA 4KW6A 3I6AA 4G10A 5D9WA 2X99A 3GYKA 4OCFA 3TRXA 3MDKA 3QDNA 4K7IA 2MMAA 5KN3A 1DE1A 4MABA 4N10A 1BAYA 1BYEA 1SYRA 4XS1A 3PH9A 3F6DA 4I6XA 5LCZA 2X8HA 2DLXA 2CAIA 1B9XC 2C8UA 1LU4A 4KDYA 3D21A 2WZ9A 3RDWA 3M3MA 3I43A 1SYXA 2HZEB 4IP1A 1U3IA 3VWVA 1HQOA 2E2GA 2YWNA 3ZYWA 16GSA 3WGDA 1X0RA 2DC5A 3FW2A 4OFTA 4Q5NA 4CW9A 4EVMA 3KH9A 1YEPA 3CYNA 3GMFA 7GSSA 1A0RP 4LL1B 1V2AA 3CTGA 5GAPD 4O32A 2QKEA 1XW5A 1LBKA 1VF4A 4K1FA 4CHSA 1Z6NA 5LNKe 3LEFA 4EDZA 1TXXA 5D73A 4IQAA 2C80A 1YF1A 4YQMA 1V98A 2V6OA 3QAGA 4ZIJA 2R6KA 3U5RE 2GGTA 3TJFA 2XC2A 3QR6A 2LSTA 1V40A 4K2DA 3ZRDA 3GIXA 2GQKA 5CP1A 1GULA 4EF0A 1FVJA 1QQ2A 2KLXA 2VL2A 1PA3A 1BX9A 1ZYEA 4ZBDA 1VGLA 5LD0A 3W6GA 3LFLA 1GSFA 4AGSA 3CTFA 2TRXA 2PBJA 5CRWA 4J56E 5EVOA 3CRUA 2EC4A 2IWTA 1X5CA 3ED3A 2YJHA 4IQ1A 3O76A 4LA1A 4X0XA 3NOFA 4GRFA 3TKSE 3BD2A 2M72A 3ZMKA 1TP9A 1WMJA 5CREA 4BWSA 5EL8A 4MMMA 3IHQA 3I9V2 1GLQA 3HKRA 2AB6A 3GKXA 1U88A 5G5EA 2HYXA 5H5SA 3D4TA 1SD9A 2CX4A 1UVZA 1THXA 1AAZA 3EYTA 3TKRA 4TXVA 3GTUB 4N30A 1O73A 4K9ZA 4KDXA 1TK0B 4K7NA 4KH7A 4MCUA 5H5QA 1XOAA 1TRVA 2CZ3A 1S3CA 2O89A 1EV9A 5IPGA 2H01A 4ISDA 3GL3A 3ZVJD 1HNBA 1N2AA 2EIOA 1MDIA 1W4VA 2G2QA 2L6DA 5HFGA 4ML1A 3DVWA 5AIVA 2EIQA 1T4ZA 4J57E 2H75A 4DSSA 2A2RA 1XBSA 1B8XA 1WOUA 5DQSA 4BA7A 4GQFA 4POKA 8GSSA 4TXOB 4MJEA 2ZUPA 2BJXA 2R2JA 4HQZA 3UBKA 5C04A 3WT1A 2KP1A 5C00A 3KMOA 5IMFA 1X5DA 2VCXA 2XBQA 1BEDA 3HD5A 3EURA 3CSIA 3GH9A 4V2MA 2LJKA 4ZL8A 3H79A 1OC8A 4BPYA 3MNGA 2CVBA 3GSTA 3ZZXA 2P0GA 2VUPA 2C3QA 1DE2A 5G2ZA 2OE3A 1WJKA 2GQLA 3KM6A 1XZOA 3A5WA 2X8GA 1PL1A 1OC9B 3FRCA 4ZILA 3LJRA 2F51A 2IMDA 3HJPA 4I2UA 3CSHA 2LRNA 1H4OA 4HI7A 5ECNB 3TKSA 1V58A 5F06A 1S3AA 2GSRA 1J0FA 2DJ3A 3GKMA 1R5AA 5HR0A 3L9UA 5B8AA 5D9XA 1TOFA 2PGTA 5ECMB 3DMLA 1YF0A 3E0UA 4FIWA 2FWHA 3MWHA 1N8JA 1G7OA 3TUEA 3IAM2 3C8EA 2K8VA 3D4MA 3GRXA 3IXRA 10GSA 2B3SA 4KCAA 2LRTA 2FWEA 2OKAA 5J9BA 2YCDA 2H0IA 4G9HA 3S9FA 3H93A 1TRWA 3IE3A 1TI1A 3IR4A 3QFAC 4JR6A 3TJJA 2HZEA 3ME8A 1QGVA 2V2GA 4HZ4A 2OBKA 3FZ4A 5AISA 5IM9A 2RUFA 1ABAA 3Q6OA 4HS1A 4KUNA 2Z9SA 5DCHA 5JWRB 3QAVA 3M0FA 2GDRA 1AQWA 3HYPA 4G19A 2B5YA 5J41A 3MSZA 4OO4A 2VOCA 3TJGA 2JZRA 3DKSA 4NV2A 1FW1A 4IN0A 3KTLA 4IBPA 4JBBA 4XTSA 2OE1A 6GSYA 22GSA 3A2VA 2YANA 3VLNA 1WE0A 1LJRA 2GZYA 1B48A 5ECLB 2JU5A 3F4RA 1TU7A 4RQXA 4X43A 4HOJA 3UJ1A 4HU7A 2AHEA 5IMZA 5B8BA 2VL3A 3IBHA 4YAVA 2YZHA 3GSSA 1SL2B 5IQYA 3UL3A 2IJYA 1O8XA 4YQVA 2A4VA 1KTEA 4EXJA 1G0TA 2RLIA 3HHVA 3FHKA 1O7UA 3F8UA 2CV4A 1U6TA 4TR3A 3DIEA 3M1GA 5E59A 1SJZA 1VF1A 1Y25A 4I97A 2YOIA 6GSWA 1EP8A 4RUVA 2IMFA 2L4CA 2VCZA 2C3TA 1M0UA 1FG4A 4EDYA 4IP6A 2B1KA 4L0UA 3TJBA 5ECSA 1SK0A 2FCHA 5DCGA 4POBA 1J08A 5IPHA 1TW9A 1NHOA 1EV4A 3G9BA 2B1LA 3QPMA 2IIYA 2VL9A 1GWCA 3TOTA 1CQHA 4MA9A 3FK8A 2REMA 2O87A 4G2EA 5F8BA 4AF2A 5FT3A 1M7TA 5G31A 1TK8B 5CAXA 4WBRD 2PUKC 3GTUA 2H1GA 1X9MB 4IS0A 4JR4A 5ECIB 1SL1B 3IK9A 4Q5QA 2CA8A 4HEA2 2CQ9A 2QGVA 4N11A 3VK9A 1YJ6A 3KJYA 2YWOA 1GUKA 3PGTA 3KP9A 3GX8A 1MD4A 2FLSA 3L9SA 5IMAA 1ZYQB 4MP4A 1JHBA 2E7PA 2JZTA 1MTCA 1Q98A 3U6VA 2L59A 4TXOA 4EE0A 3GN3A 2P5RA 3M8NA 4HU9A 3FY7A 3KTBA 2FUG2 2J23A 4FO5A 1SD8A 3TRPA 1T4YA 5ELGA 3KMNA 4L5OA 1M2BA 4MJBA 2VM1A 5FHIA 3Q19A 1ZZYA 4ECCA 4QL7A 2DJJA 2I9HA 2NPBA 4PNFA 4MDCA 2H30A 4KX4A 3KZQA 2AYTA 3P2AA 4HUAA 1WRYA 2GSSA 5J3RA 3C7MA 3EWLA 5ECOB 3MAKA 2XPEA 4GF0A 4RQRA 1TRSA 5D9VA 20GSA 1O85A 3BCKA 3ERFA 3TKQA 4V1Ap 3N5OA 3DEXA 2LNSA 5A4WA 1X5EA 1YKAA 2L5OA 2F8FA 4MH2A 3DYRA 1OC9A 3ERWA 3CMIA 3J7Yb 3GL5A 5HFKA 3LQ7A 2X64A 4MF5A 1GSSA 4RI7A 2MMOA 3E9JB 4K7OA 2GTUA 5J9CA 4IKHA 2IMKA 3HZ4A 3PR8A 2QSIA 2H0GA 1SL0B 3KP8A 5DAKB 4WR4A 4ZB6A 2GVPA 5IIZA 2R37A 3W8JA 1K0MA 1GSDA 1OE7A 1OYJA 4XS4B 4Q5FA 1O6JA 4GTUA 1PRXA 4DSRA 2RM5A 5IOXA 2C3NA 2N5FA 4PURA 1T3BA 1PQNA 2K6VA 5AIXA 1BJXA 4ACSA 2ON5A 1XWKA 4I5QA 5ECKB 3AY8A 3VI5A 3G7IA 3KH7A 4GXZA 4X1UA 2RUEA 3L9VA 4XIHA 1URMA 3APOA 5F07A 3A2XA 1GSQA 4WETA 1M9BA 4KA0A 5IMVA 4PQHA 1SKRB 2VCQA 4OFMA 4MZBA 3VWXA 3HA9A 5IMDA 1DBYA 1UA5A 4TR0A 3P8WA 2K18A 5DALB 3ME7A 2O7KA 4TN8A 1Q4JA 2IN3A 4FYCA 2V6KA 1ILOA 3Q74A 4V2LA 1TRUA 3IRAA 2L4QA 5CRDA 1FO5A 3P90A 3L4NA 3ZFBA 4E8EA 3K8NA 3IAS2 4EC0A 4EO3A 1GH2A 3IDVA 5F05A 5G1LA 4XHMA 2OBIA 3H4KA 3L0HA 1EEMA 5H5RA 3SWLA 1WIKA 3FEUA 4GSNA 1Z6MA 4KE3A 2WGRA 1O8WA 4JEDA 4GSTA 3IOSA 1MEKA 2VD1A 4TR1A 2IFQA 1Z7PA 3HVSA 1PX7A 1AQVA 5COHA 2WCIA 1K0BA 1YEXA 4K8MA 1PSQA 1XOBA 1V57A 5EY6A 1U3AA 3W8SA 2JSYA 5KN2A 5CRHA 2DBCA 3GKNA 2YJ7A 5B6MA 1V9WA 3BJ5A 3EE2A 4BVYA 2H6ZA 4OD7A 1KNGA 2NBSA 5A5KA 1K3LA 2VCWA 2MMNA 4OMVA 12GSA 2LQOA 3UARA 1J9BA 1SJIA 3HJMA 1XWBA 2C4JA 3KD0A 2GZPA 2VL2C 5GAND 4MJCA 2AJQB 2PERA 2DMLA 3KEBA 3H1NA 1PGTA 4JRRA 4RI6A 4F82A 1G6WA 2PU9C 1T7PB 1F37A 1QK8A 3QD9A 4FH8A 1U87A 1ZCPA 3FR6A 4P3YB 3LXZA 1FHEA 2H0HA 1EGOA 3WD6A 1A23A 2FHEA 2WRTA 3NZNA 2V41A 5J5NA 1M9AA 3GKKA 3ERGA 1A2LA 4TOPA 2GQMA 3DVXA 4NMUA 5D93A 4F2IA 2VD0A 1RW1A 3GV1A 1PKZA 1HNCA 3G7YA 4ZBAA 5IO0A 2NDOA 1YY7A 5G30A 5DJMA 3HVXA 1TI3A 1K0NA 5IMCA 4TVEA 4PXOA 2ES7A 2P5QA 5ECRB 3IA1A 2DJ2A 2E0QA 3EMXA 2LTKA 1DUGA 2FD3A 2MZCA 4EL1A 5DQYA 3ZLPA 2P31A 2FA4A 2BTOT 5AGYA 1FVKA 1JZOA 2JACA 2LUSA 2VM2A 4NHZA 2PVOC 1EGRA 2JZSA 1ON4A 3UBLA 1K0AA 1EP7A 3WGEA 3LYKA 3FYGA 4BL7A 2WJUA 5KEJA 1C72A 4ML6A 5GZZB 2IL3A 3F3RA 4L0WA 4ILFA 4KB3A 3FZAA 1K0DA 4MPFA 1PX6A 2DJKA 4AJ8A 3RHCA 1B4QA 4HJ2A 4LMWA 2HZFA 4NPBA 1TJDA 5DAKA 1R26A 2O8VB 2AUVA 4IGJA 1XFLA 4WF5A 2LRCA 1GRXA 4XS4A 1VF3A 4O92A 3C71A 5KN0A 4JE1A 5D8IA 3HZ8A 2LJAA 6GSTA 3WYWA 1GL8A 2F9SA 3NIVA 2J9HA 3GFKA 4I2TA 5JCGA 1GUHA 3FZ5A 2H19A 3F6FA 1ML6A 3TDGA 3D22A 4KGIA 3EMPA 4BVXA 3H8QA 18GSA 4YQUA 4LMVA 1GLPA 5ECQB 2LJRA 4KCEA 4MJAA 1KEBA 4PNGA 4MZCA 13GSA 1ERUA 2B5XA 1R5PA 3TKSC 2GSQA 3F0IA 4CDOA 3UAPA 5DALA 4POMA 3DXBA 2WFCA 1E2YA 3JCML 1H75A 2M80A 1NW2A 4PGTA 3HCZA 2H1DA 2R4VA 2KOKA 3FR3A 3GH6A 3US3A 2I3YA 3I69A 3DGQA 1A8YA 2YV9A 1EZKA 4DSSB 1UC7A 4ZL7A 2YWMA 4DVCA 3TCOA 6GSSA 4O5RA 4MK3A 1SENA 1ERTA 4KSMA 2VAFA 2RIIA 2N5AA 1F9MA 3TJKA 1OC3A 4N0VA 4IELA 5B7CA 2C0FA 4ECBA 1G6YA 3EVIA 4PUFC 1A2MA 1SKSB 1B9YC 1YKCA 3RHBA 3QMXA 5JWQB 1G7EA 2C0DA 2MYGA 1VRSD 4GLTA 1XWAA 1XW6A 3C1SA 1I9DA 5L71A 4F0CA 1HYUA 3F63A 2OJLA 2OA7A 2FWFA 2NTOA 5KN1A 4FYBA 2R3XA 3HDCA 5HR1A 4Q5RA 1JZRA 1QFNA 2H8LA 4MZWA 4ECJA 4MLYA 3QCPA 2ZNMA 2VLVA 5D96A 1RK4A 2WS2A 2V32A 4V2NA 2MMZA 5CNWA 5ABRA 3BCIA 4NWYA 1XXUA 1ZGNA 2H1BA 1WP0A 3TGZA 3UVHA 3IC4A 4KAEA 2H66A 4JU5A 1XWGA 1MDJA 3D5JA 4AJ6A 1ERWA 3APSA 2TIRA 5ECPB 5INYA 4NHWA 3RAZA 4FYUA 3ZMLA 4HQSA 1SK2A 5AN1A 5B6NA 2H6XA 2DJ1A 2DMMA 4O7HA 6GSVA 4ZB8A 4OO5A 2KHPA 4PQIA 3VPQA 5JWOB 4WXTA 3ZTLA 1NHYA 4K6XA 4F0BA 1QXHA 1OKDA 1B4PA 2X8CA 1S3DA 3QOUA 4WF4A 3ZITA 5IOWA 4ECIA 1YDKA 1PL2A 5HFIA 1THOA 3CXGA 4IJIA 3ZIJA 2LEGA 1M2DA 3IV4A 2XBIA 1O81A 1TDIA 3GURA 2LKUA 4ULXA 2C0GA 2N5BA 2I4AA 4MH3A 2L6CA 4DEJA 1OE8A 5DJLA 2CX3A
chains in the Genus database with same CATH superfamily
1FOVA 3ZFLA 4XCSA 1GP1A 2EIRA 2VIMA 5F0GA 3ZREA 5G5FA 1PKWA 4IHUA 3UIWA 3WGXA 2QC7A 2MBSA 2B6MA 3KXOA 3M9JA 1GSYA 4V1Ag 4J2FA 2VCVA 2H76A 5A4VA 1Z9HA 2C0EA 1R7HA 2WB9A 4N0ZA 1PMTA 4GSSA 3A3TA 2TRCP 2A2PA 1GNEA 2ZCTA 3DD3A 1XG8A 5ECHB 1OVNA 2PPTA 2FY6A 2WDUA 3SBCA 1ERVA 1XPVA 4X4JA 1GSUA 1K0CA 3FR9A 1EOHA 2KUCA 3GNJA 3TB2A 1EOGA 5ELAA 2OACA 1F6MC 4E8HA 1AW9A 2LQQA 3PINA 3EU3A 1SKWB 1XVQA 3J7Yk 4PQ1A 3RBTA 4USSA 1M2AA 4D73B 2DKIA 5JCUA 4H86A 3GHAA 2GLRA 4AJ7A 1CQGA 2ALBA 4HZ2A 4YKGA 1TK5B 2G0FA 2HXKA 1XVWA 4EUYA 2LS5A 2O85A 4NXIA 3LGCA 17GSA 5ID2B 1BG5A 2GZZA 2C1YA 1JZDA 5E4WA 2CAQA 2FWGA 3Q18A 2M46A 4JZQA 5GSTA 1YQ1A 2PMTA 4F9ZA 3GUSA 2MBTA 3HJOA 3TKPA 1T00A 2HI7A 2B7JA 1E6BA 4PUAA 4POLA 2YWIA 1QUWA 5HR2A 2JL4A 4FQUA 4KNDA 1NSWA 5A4UA 3CBUA 3RPNA 4DSQA 1MD3A 3CSJA 4TW5A 1FAAA 4KSOA 1YZXA 3RPPA 2VLUA 4NV5A 4IJ3A 3LWAA 2XHFA 2HT9A 2PVQA 2YV7A 5CRGA 2NVLA 3GA4A 1M99A 3TOUA 1XIYA 2R0PA 3CRTA 1NM3A 3G7JA 2AAWA 2FA8A 2CVDA 2H70A 4G0LA 5CYYA 19GSA 4EKZA 4Z7XA 3KGKA 1IYHA 1RQMA 2FNOA 4QQ7A 1KBNA 2HRFA 2FGXA 3VI7A 2IMEA 1DSBA 2L57A 4IVFA 1F2EA 1K3OA 2HSMA 1AUCA 4HDEA 1GUMA 2YNXA 1BQ7A 2X4AA 1Z7RA 1X9SB 4XS6A 1VF2A 3QAWA 3FKFA 1GSEA 1SJ6A 4XRDA 3UMAA 2HNLA 1EWXA 2GT5A 2KP2A 4WKWA 1HD2A 1JZWA 3D0ZA 4GQCA 2OADA 2JADA 1K3YA 1TTZA 2HSHA 2ON7A 4WR5A 2L5LA 2HRNA 4LLRA 3A2WA 2BMXA 4MF6A 5GSSA 1EEJA 1XCCA 1GNWA 3HVVA 3IK7A 3VWUA 1OAZA 1HNAA 3LORA 1X9WB 2CVKA 1OKTA 3VWWA 1ACVA 2F8AA 2H1AA 1AIUA 2GS3A 1A0FA 2LV3A 4L5LA 3WT2A 4EIQA 2GSTA 3MIXA 5DBQA 3ZVJA 4O5QA 4WEYA 3VFIA 6GSUA 5IO2A 1AXDA 5HR3A 2HFDA 3F4TA 3QFBC 1A2JA 3TRQA 2QA1A 5J4UA 3R2QA 2VO4A 4K0GA 3UEMA 3ZL5A 2WULA 1JLWA 1ZMAA 1Y6EA 3PPUA 3LXTA 2GT6A 3KCMA 2AV4A 4CY8A 2XPDA 1WWJA 3UOMA 2LNTA 1GTAA 2JSZA 1ZOFA 3EINA 1Z3EA 3E3EA 4NAXA 5CO3A 2H6YA 2YPMA 1Z5YE 2YP6A 4GWRA 2PWJA 3F4SA 1F3BA 2HLSA 3L78A 3IPZA 1UN2A 11GSA 5DVBA 4TR4A 1K0OA 2D2ZA 1FB6A 5HQPA 2F3MA 4XRAA 3BOAA 4PTSA 3D6IA 1SU9A 3O6TA 4LL4B 9GSSA 2H74A 1A24A 1W89A 2V1MA 3LSZA 4L8EA 2DJ0A 1TU8A 1GTBA 3M9KA 4PX1A 1GTIA 3ZIVA 3LG6A 4TR1B 2IFQB 3O3TA 1T1VA 3C1RA 4TKYA 4A5PA 3C73A 2I81A 3VURA 1R4WA 2A2SA 2IMIA 4OCEA 1ZL9A 2H73A 3HXSA 6GSXA 4ZXGA 2K9FA 3EU4A 5G1KA 5FWGA 3P7XA 3OR5A 5EPFA 2DIZA 2DIYA 3KIJA 5DDLA 4D73A 4I8BA 1GTUA 4MF7A 1JLVA 2IPAA 4WBJA 1QMVA 3V1WA 1ST9A 1SK1A 4IW9A 2YN1A 2H71A 5ID2A 3VPTA 4G0IA 1AC1A 1JFUA 4ID0A 2H72A 2PN8A 2YZUA 2VLTA 4YH2A 2R5GA 2HE3A 4OWYA 5D9TA 3HY2A 1PD21 4TRXA 1T8EB 4K0NA 3GX0A 1AQXA 2OE0A 1MDKA 4HJMA 4MPGA 2I1UA 4F03A 5JCWA 4QL9A 4ZB9A 14GSA 2B5EA 2CZ2A 5ENUA 4ZL9A 3N9JA 1TKDB 3FZ9A 3DWVA 1I5GA 1FB0A 1XW9A 1IYIA 2K8SA 1USBA 2E2MA 2VCTA 3EC3A 1F3AA 3BBYA 1A8LA 4KDUA 2DSAA 1XWCA 2RM6A 4OFNA 2CT6A 3F9UA 4BWQA 3LYPA 1WPIA 4ZBBA 1PN9A 2B7KA 3DRNA 2HSYA 3UVTA 3F3QA 3APQA 4GCIA 4YAPA 3ISOA 4KW6A 3I6AA 4G10A 5D9WA 2X99A 3GYKA 4OCFA 3TRXA 3MDKA 3QDNA 4K7IA 2MMAA 5KN3A 4KF9A 1DE1A 4MABA 4N10A 1BAYA 1BYEA 1SYRA 4XS1A 3PH9A 3F6DA 4I6XA 5LCZA 2X8HA 2DLXA 2CAIA 1B9XC 2C8UA 1LU4A 4KDYA 3D21A 2WZ9A 3RDWA 4K5RA 3M3MA 1ZYPA 3I43A 1SYXA 2HZEB 4IP1A 1U3IA 3VWVA 1HQOA 2E2GA 2YWNA 3ZYWA 16GSA 3WGDA 1X0RA 2A4HA 2DC5A 3FW2A 4OFTA 4Q5NA 4CW9A 4EVMA 3KH9A 1YEPA 3CYNA 3GMFA 7GSSA 1A0RP 4LL1B 1V2AA 3CTGA 5GAPD 4O32A 1ZYNA 2QKEA 1XW5A 1LBKA 1VF4A 4K1FA 4CHSA 1Z6NA 5LNKe 3LEFA 4EDZA 2QA2A 1TXXA 5D73A 4ICYA 4IQAA 2C80A 1YF1A 4YQMA 1V98A 2V6OA 3QAGA 4ZIJA 2R6KA 3U5RE 2GGTA 3TJFA 2XC2A 3QR6A 2LSTA 1V40A 4K2DA 3ZRDA 5BRTA 3GIXA 2GQKA 5CP1A 1GULA 4EF0A 1FVJA 1QQ2A 2KLXA 2VL2A 1PA3A 1BX9A 1ZYEA 1M3IA 4ZBDA 1VGLA 5LD0A 3W6GA 3LFLA 1GSFA 4AGSA 3CTFA 2TRXA 2PBJA 5CRWA 4J56E 5EVOA 3CRUA 2EC4A 2IWTA 1X5CA 3ED3A 2YJHA 4IQ1A 3O76A 4LA1A 4X0XA 3IC8A 3NOFA 4GRFA 3TKSE 3BD2A 2M72A 3ZMKA 1TP9A 1WMJA 5CREA 4BWSA 5EL8A 4MMMA 3IHQA 3I9V2 1GLQA 2R0CA 3HKRA 2AB6A 3GKXA 1U88A 5G5EA 2HYXA 5H5SA 3D4TA 1SD9A 2CX4A 1UVZA 1THXA 1AAZA 3EYTA 3TKRA 4TXVA 3GTUB 4N30A 1O73A 4K9ZA 4KDXA 1TK0B 4K7NA 4KH7A 4MCUA 5H5QA 1XOAA 1TRVA 2CZ3A 1S3CA 2O89A 1EV9A 5IPGA 3HVNA 2H01A 4ISDA 3GL3A 3ZVJD 1HNBA 1N2AA 2EIOA 1MDIA 1W4VA 2G2QA 2L6DA 5HFGA 4ML1A 3DVWA 5AIVA 2EIQA 1T4ZA 4J57E 2H75A 4DSSA 2A2RA 1XBSA 1B8XA 1PN0A 1WOUA 5DQSA 4BA7A 4GQFA 4POKA 8GSSA 4TXOB 4MJEA 2ZUPA 2BJXA 2R2JA 4HQZA 3UBKA 5C04A 3WT1A 2KP1A 5C00A 3KMOA 5IMFA 1X5DA 2VCXA 2XBQA 1BEDA 3HD5A 3EURA 3CSIA 3GH9A 4V2MA 2LJKA 4ZL8A 3H79A 1OC8A 4BPYA 3MNGA 2CVBA 3GSTA 3ZZXA 2P0GA 2VUPA 2C3QA 1DE2A 5G2ZA 2OE3A 1WJKA 2GQLA 3KM6A 1XZOA 3A5WA 2X8GA 1PL1A 1OC9B 3FRCA 4ZILA 3LJRA 1M3JA 2F51A 2HRKA 2IMDA 3HJPA 4I2UA 3CSHA 2LRNA 1H4OA 4HI7A 5ECNB 3TKSA 1V58A 4BIKA 5F06A 1S3AA 2GSRA 1J0FA 2DJ3A 3GKMA 1R5AA 5HR0A 3L9UA 5B8AA 5D9XA 1TOFA 2PGTA 5ECMB 3DMLA 1YF0A 3E0UA 4FIWA 2FWHA 3MWHA 1N8JA 1G7OA 3TUEA 3IAM2 3C8EA 2K8VA 3D4MA 3GRXA 3IXRA 10GSA 4K2XA 2B3SA 4KCAA 2LRTA 2FWEA 2OKAA 5J9BA 2YCDA 2H0IA 4G9HA 3S9FA 3H93A 1TRWA 3IE3A 1TI1A 3IR4A 3QFAC 4JR6A 3TJJA 2HZEA 3ME8A 1QGVA 3A5IA 2V2GA 4HZ4A 2OBKA 3FZ4A 5AISA 5IM9A 2RUFA 1ABAA 3Q6OA 4HS1A 4KUNA 2Z9SA 5DCHA 5JWRB 3QAVA 3M0FA 2GDRA 1AQWA 3HYPA 4G19A 2B5YA 5J41A 3MSZA 4OO4A 2VOCA 3TJGA 2JZRA 3DKSA 4NV2A 1FW1A 4IN0A 3KTLA 4IBPA 4JBBA 4XTSA 2OE1A 6GSYA 22GSA 3A2VA 2YANA 3VLNA 1WE0A 1LJRA 2GZYA 1B48A 5ECLB 2JU5A 3LW9A 3F4RA 1TU7A 4RQXA 4X43A 4HOJA 3UJ1A 4HU7A 2AHEA 5IMZA 5B8BA 2VL3A 3IBHA 4YAVA 2YZHA 3GSSA 1SL2B 5IQYA 3UL3A 2IJYA 1O8XA 4YQVA 2A4VA 1KTEA 4EXJA 1G0TA 2RLIA 3HHVA 3FHKA 1O7UA 3F8UA 2CV4A 1U6TA 4TR3A 3DIEA 3M1GA 5E59A 1SJZA 1VF1A 1Y25A 4I97A 2YOIA 6GSWA 1EP8A 4RUVA 2IMFA 2L4CA 2VCZA 2C3TA 1M0UA 1FG4A 4EDYA 4IP6A 2B1KA 4L0UA 3TJBA 5ECSA 1SK0A 2FCHA 4BVYB 5DCGA 4POBA 1J08A 5IPHA 1TW9A 1NHOA 1EV4A 3G9BA 2B1LA 3QPMA 2IIYA 2VL9A 1GWCA 3TOTA 1CQHA 4MA9A 3FK8A 2REMA 2O87A 4G2EA 5F8BA 5BMUA 4AF2A 5FT3A 1M7TA 5G31A 1TK8B 5CAXA 4WBRD 2PUKC 3GTUA 2H1GA 1X9MB 4IS0A 4JR4A 5ECIB 1SL1B 2X49A 3IK9A 4Q5QA 2CA8A 4HEA2 2CQ9A 2QGVA 4N11A 3VK9A 3EPTA 1YJ6A 3KJYA 2YWOA 1GUKA 3PGTA 3KP9A 3GX8A 1MD4A 2FLSA 3L9SA 5IMAA 1ZYQB 4MP4A 1JHBA 2E7PA 2JZTA 1MTCA 1Q98A 3U6VA 2L59A 4TXOA 4EE0A 3GN3A 2P5RA 3M8NA 4HU9A 3FY7A 3KTBA 2FUG2 2J23A 4FO5A 1SD8A 3TRPA 1T4YA 5ELGA 3KMNA 4L5OA 1M2BA 4MJBA 2VM1A 5FHIA 3Q19A 1ZZYA 4ECCA 4QL7A 2DJJA 2I9HA 2NPBA 4PNFA 4MDCA 2H30A 4KX4A 3KZQA 2AYTA 3P2AA 4HUAA 1WRYA 2GSSA 5J3RA 3C7MA 3EWLA 5ECOB 3MAKA 2XPEA 4GF0A 4RQRA 1TRSA 5D9VA 20GSA 1O85A 3BCKA 3ERFA 3TKQA 4BL7B 4V1Ap 3N5OA 3DEXA 2LNSA 5A4WA 1X5EA 1YKAA 2L5OA 2F8FA 4MH2A 3DYRA 1OC9A 3ERWA 3CMIA 3J7Yb 3GL5A 5HFKA 3LQ7A 2X64A 4MF5A 1GSSA 4RI7A 2MMOA 3E9JB 4K7OA 2GTUA 5J9CA 4IKHA 2IMKA 3HZ4A 3PR8A 2QSIA 4HSCX 2H0GA 1SL0B 3KP8A 5DAKB 4WR4A 4ZB6A 2GVPA 5IIZA 2R37A 3W8JA 1K0MA 1GSDA 1OE7A 1OYJA 2UZ8A 4XS4B 4Q5FA 1O6JA 4GTUA 1PRXA 4DSRA 2RM5A 4MNNA 2C3NA 5IOXA 2N5FA 4PURA 1T3BA 1PQNA 2K6VA 5AIXA 1BJXA 4ACSA 2ON5A 1XWKA 4I5QA 5ECKB 3AY8A 3VI5A 3G7IA 3KH7A 4GXZA 4X1UA 2RUEA 3L9VA 4XIHA 1URMA 4BVXB 3APOA 5F07A 3A2XA 1GSQA 4WETA 1M9BA 4KA0A 5IMVA 4PQHA 1SKRB 2VCQA 4OFMA 4MZBA 3VWXA 3FMWA 3HA9A 5IMDA 1DBYA 1UA5A 4TR0A 3P8WA 2K18A 5DALB 3ME7A 2O7KA 4G0KA 4TN8A 1Q4JA 2IN3A 3R3EA 4FYCA 2V6KA 1ILOA 3Q74A 4V2LA 1TRUA 3IRAA 2L4QA 5CRDA 1FO5A 3P90A 3L4NA 3ZFBA 4E8EA 3K8NA 3IAS2 4EC0A 4EO3A 1GH2A 3IDVA 5F05A 5G1LA 4XHMA 2OBIA 3H4KA 3L0HA 5KOXA 1EEMA 5H5RA 3SWLA 1WIKA 3FEUA 4GSNA 1Z6MA 4KE3A 2WGRA 1O8WA 4Z2UA 4JEDA 4GSTA 3IOSA 1MEKA 2VD1A 4TR1A 2IFQA 1Z7PA 3HVSA 1PX7A 1AQVA 5COHA 2WCIA 1K0BA 1YEXA 4K8MA 1PSQA 1XOBA 1V57A 5EY6A 1U3AA 3W8SA 2JSYA 5KN2A 5CRHA 2DBCA 3GKNA 2YJ7A 5B6MA 1V9WA 3BJ5A 3EE2A 4BVYA 2H6ZA 4OD7A 1KNGA 2NBSA 5A5KA 1K3LA 2VCWA 2MMNA 4OMVA 12GSA 2LQOA 3UARA 1J9BA 1SJIA 3HJMA 1XWBA 2C4JA 3KD0A 2GZPA 2VL2C 5GAND 4MJCA 2AJQB 2PERA 3MYDA 2DMLA 3KEBA 3H1NA 1PGTA 4JRRA 4RI6A 4F82A 1G6WA 2PU9C 1T7PB 1F37A 1QK8A 3QD9A 4FH8A 4K5SA 1U87A 1ZCPA 3FR6A 4P3YB 3LXZA 1FHEA 2H0HA 1EGOA 3WD6A 1A23A 2FHEA 2WRTA 3NZNA 2V41A 5J5NA 1M9AA 3GKKA 3ERGA 1A2LA 4TOPA 2GQMA 3DVXA 4NMUA 5D93A 4F2IA 2VD0A 1RW1A 3GV1A 1PKZA 1HNCA 3G7YA 4Z2RA 4ZBAA 5IO0A 2NDOA 1YY7A 5G30A 5DJMA 3HVXA 1TI3A 1K0NA 5IMCA 4TVEA 4PXOA 2ES7A 2P5QA 5ECRB 3IA1A 2DJ2A 2E0QA 3EMXA 2LTKA 1DUGA 2FD3A 2MZCA 4EL1A 5DQYA 3ZLPA 2P31A 2FA4A 2BTOT 5AGYA 1FVKA 1JZOA 2JACA 2LUSA 2VM2A 4NHZA 2PVOC 1EGRA 2JZSA 1ON4A 3UBLA 1K0AA 1EP7A 3WGEA 3LYKA 3FYGA 4BL7A 2WJUA 4Z2TA 5KEJA 1C72A 4ML6A 5GZZB 3CQFA 2IL3A 3F3RA 2HRAA 4L0WA 4ILFA 4KB3A 3FZAA 1K0DA 5KOWA 4MPFA 1PX6A 2DJKA 4AJ8A 3RHCA 1B4QA 4HJ2A 4LMWA 2HZFA 4NPBA 1TJDA 5DAKA 1R26A 2O8VB 2AUVA 4IGJA 1XFLA 3IHGA 4WF5A 2LRCA 1GRXA 4XS4A 1VF3A 4O92A 3C71A 1S3RA 5KN0A 4JE1A 5D8IA 3HZ8A 4EIPA 2LJAA 6GSTA 3WYWA 1FOHA 1GL8A 2F9SA 3NIVA 2J9HA 3GFKA 4I2TA 5JCGA 1GUHA 3FZ5A 2H19A 3F6FA 1ML6A 4CY6A 3TDGA 3D22A 4KGIA 3EMPA 4BVXA 3H8QA 18GSA 4YQUA 4LMVA 1GLPA 5ECQB 2LJRA 4KCEA 4MJAA 1KEBA 4PNGA 4MZCA 13GSA 1ERUA 2B5XA 1R5PA 3TKSC 2GSQA 3F0IA 4CDOA 3UAPA 5DALA 4POMA 3DXBA 2WFCA 1E2YA 3JCML 1H75A 2M80A 1NW2A 4PGTA 3HCZA 2H1DA 2R4VA 2KOKA 3FR3A 3GH6A 3US3A 2I3YA 3I69A 3DGQA 4O5UA 1A8YA 2YV9A 1EZKA 4DSSB 1UC7A 4ZL7A 2YWMA 4DVCA 3TCOA 6GSSA 4O5RA 4MK3A 1SENA 1ERTA 4KSMA 2VAFA 1PFOA 2RIIA 2N5AA 1F9MA 3TJKA 1OC3A 4N0VA 4IELA 5B7CA 2C0FA 4ECBA 1G6YA 3EVIA 4PUFC 1A2MA 1SKSB 1B9YC 1YKCA 3RHBA 3QMXA 5JWQB 1G7EA 2C0DA 2MYGA 1VRSD 4GLTA 1XWAA 1XW6A 3C1SA 1I9DA 5L71A 4F0CA 1HYUA 3F63A 2OJLA 2OA7A 2FWFA 2NTOA 5KN1A 4FYBA 2R3XA 3HDCA 5HR1A 4Q5RA 1JZRA 1QFNA 2H8LA 4MZWA 4ECJA 4MLYA 3QCPA 2ZNMA 2VLVA 5D96A 1RK4A 2WS2A 2V32A 4V2NA 2MMZA 5CNWA 5ABRA 3BCIA 4NWYA 1XXUA 1ZGNA 2H1BA 1WP0A 3TGZA 3UVHA 3IC4A 4KAEA 2H66A 2DKHA 4YKFA 4JU5A 1XWGA 1MDJA 3D5JA 4AJ6A 1ERWA 3APSA 2TIRA 5ECPB 5INYA 4NHWA 3RAZA 4FYUA 3ZMLA 4HQSA 1SK2A 5AN1A 5B6NA 2H6XA 2DJ1A 2DMMA 4O7HA 6GSVA 4ZB8A 4OO5A 2KHPA 4PQIA 3VPQA 5JWOB 4WXTA 3ZTLA 1NHYA 4K6XA 4F0BA 1QXHA 1OKDA 1B4PA 2X8CA 1S3DA 3QOUA 4WF4A 3ZITA 5IOWA 4ECIA 1YDKA 1PL2A 5HFIA 1THOA 3CXGA 4IJIA 3ZIJA 2LEGA 1M2DA 3IV4A 2XBIA 1O81A 1TDIA 3GURA 2LKUA 4ULXA 2C0GA 2N5BA 2I4AA 4MH3A 2L6CA 2R0GA 4DEJA 1OE8A 5DJLA 2CX3A
chains in the Genus database with same CATH topology
1FOVA 3ZFLA 4XCSA 1GP1A 2EIRA 2VIMA 5F0GA 3ZREA 5G5FA 1PKWA 4IHUA 3UIWA 3WGXA 2QC7A 2MBSA 2B6MA 3KXOA 3M9JA 1GSYA 4V1Ag 4J2FA 2VCVA 2H76A 5A4VA 1Z9HA 2C0EA 1R7HA 2WB9A 4N0ZA 1PMTA 4GSSA 3A3TA 2TRCP 2A2PA 1GNEA 2ZCTA 3DD3A 5ECHB 1OVNA 2PPTA 2FY6A 2WDUA 3SBCA 1ERVA 1XPVA 4X4JA 1GSUA 1K0CA 3FR9A 1EOHA 2KUCA 3GNJA 3TB2A 1EOGA 5ELAA 2OACA 1F6MC 4E8HA 1AW9A 2LQQA 3PINA 3EU3A 1SKWB 1XVQA 3J7Yk 4PQ1A 3RBTA 4USSA 1M2AA 4D73B 2DKIA 5JCUA 4H86A 3GHAA 2GLRA 4AJ7A 1CQGA 2ALBA 4HZ2A 4YKGA 1TK5B 2G0FA 2HXKA 1XVWA 4EUYA 2LS5A 2O85A 4NXIA 3LGCA 17GSA 5ID2B 1BG5A 2GZZA 2C1YA 1JZDA 5E4WA 2CAQA 2FWGA 3Q18A 2M46A 4JZQA 5GSTA 1YQ1A 2PMTA 4F9ZA 3GUSA 2MBTA 3HJOA 3TKPA 1T00A 2HI7A 2B7JA 1E6BA 4PUAA 4POLA 2YWIA 1QUWA 5HR2A 2JL4A 4FQUA 4KNDA 1NSWA 5A4UA 3CBUA 3RPNA 4DSQA 1MD3A 3CSJA 4TW5A 1FAAA 4KSOA 1YZXA 3RPPA 2VLUA 4NV5A 4IJ3A 3LWAA 2XHFA 2HT9A 2PVQA 2YV7A 5CRGA 2NVLA 3GA4A 1M99A 3TOUA 1XIYA 2R0PA 3CRTA 1NM3A 3G7JA 2AAWA 2FA8A 2CVDA 2H70A 4G0LA 5CYYA 19GSA 4EKZA 4Z7XA 3KGKA 1IYHA 1RQMA 2FNOA 4QQ7A 1KBNA 2HRFA 2FGXA 3VI7A 2IMEA 1DSBA 2L57A 4IVFA 1F2EA 1K3OA 2HSMA 1AUCA 4HDEA 1GUMA 2YNXA 1BQ7A 2X4AA 1Z7RA 1X9SB 4XS6A 1VF2A 3QAWA 3FKFA 1GSEA 1SJ6A 4XRDA 3UMAA 2HNLA 1EWXA 2GT5A 2KP2A 4WKWA 1HD2A 1JZWA 3D0ZA 4GQCA 2OADA 2JADA 1K3YA 1TTZA 2HSHA 2ON7A 4WR5A 2L5LA 2HRNA 4LLRA 3A2WA 2BMXA 4MF6A 5GSSA 1EEJA 1XCCA 1GNWA 3HVVA 3IK7A 3VWUA 1OAZA 1HNAA 3LORA 1X9WB 2CVKA 1OKTA 3VWWA 1ACVA 2F8AA 2H1AA 1AIUA 2GS3A 1A0FA 2LV3A 4L5LA 3WT2A 4EIQA 2GSTA 3MIXA 5DBQA 3ZVJA 4O5QA 4WEYA 3VFIA 6GSUA 5IO2A 1AXDA 5HR3A 2HFDA 3F4TA 3QFBC 1A2JA 3TRQA 2QA1A 5J4UA 3R2QA 2VO4A 4K0GA 3UEMA 3ZL5A 2WULA 1JLWA 1ZMAA 1Y6EA 3PPUA 3LXTA 2GT6A 3KCMA 2AV4A 4CY8A 2XPDA 1WWJA 3UOMA 2LNTA 1GTAA 2JSZA 1ZOFA 3EINA 1Z3EA 3E3EA 4NAXA 5CO3A 2H6YA 2YPMA 1Z5YE 2YP6A 4GWRA 2PWJA 3F4SA 1F3BA 2HLSA 3L78A 3IPZA 1UN2A 11GSA 5DVBA 4TR4A 1K0OA 2D2ZA 1FB6A 5HQPA 2F3MA 4XRAA 3BOAA 4PTSA 3D6IA 1SU9A 3O6TA 4LL4B 9GSSA 2H74A 1A24A 1W89A 2V1MA 3LSZA 4L8EA 2DJ0A 1TU8A 1GTBA 3M9KA 4PX1A 1GTIA 3ZIVA 3LG6A 4TR1B 2IFQB 3O3TA 1T1VA 3C1RA 4TKYA 4A5PA 3C73A 2I81A 3VURA 1R4WA 2A2SA 2IMIA 4OCEA 1ZL9A 2H73A 3HXSA 6GSXA 4ZXGA 2K9FA 3EU4A 5G1KA 5FWGA 3P7XA 3OR5A 5EPFA 2DIZA 2DIYA 3KIJA 5DDLA 4D73A 4I8BA 1GTUA 4MF7A 1JLVA 2IPAA 4WBJA 1QMVA 3V1WA 1ST9A 1SK1A 4IW9A 2YN1A 2H71A 5ID2A 3VPTA 4G0IA 1AC1A 1JFUA 4ID0A 2H72A 2PN8A 2YZUA 2VLTA 4YH2A 2R5GA 2HE3A 4OWYA 5D9TA 3HY2A 1PD21 4TRXA 1T8EB 4K0NA 3GX0A 1AQXA 2OE0A 1MDKA 4HJMA 4MPGA 2I1UA 4F03A 5JCWA 4QL9A 4ZB9A 14GSA 2B5EA 2CZ2A 5ENUA 4ZL9A 3N9JA 1TKDB 3FZ9A 3DWVA 1I5GA 1FB0A 1XW9A 1IYIA 2K8SA 1USBA 2E2MA 2VCTA 3EC3A 1F3AA 3BBYA 1A8LA 4KDUA 2DSAA 1XWCA 2RM6A 4OFNA 2CT6A 3F9UA 4BWQA 3LYPA 1WPIA 4ZBBA 1PN9A 2B7KA 3DRNA 2HSYA 3UVTA 3F3QA 3APQA 4GCIA 4YAPA 3ISOA 4KW6A 3I6AA 4G10A 5D9WA 2X99A 3GYKA 4OCFA 3TRXA 3MDKA 3QDNA 4K7IA 2MMAA 5KN3A 4KF9A 1DE1A 4MABA 4N10A 1BAYA 1BYEA 1SYRA 4XS1A 3PH9A 3F6DA 4I6XA 5LCZA 2X8HA 2DLXA 2CAIA 1B9XC 2C8UA 1LU4A 4KDYA 3D21A 2WZ9A 3RDWA 4K5RA 3M3MA 1ZYPA 3I43A 1SYXA 2HZEB 4IP1A 1U3IA 3VWVA 1HQOA 2E2GA 2YWNA 3ZYWA 16GSA 3WGDA 1X0RA 2A4HA 2DC5A 3FW2A 4OFTA 4Q5NA 4CW9A 4EVMA 3KH9A 1YEPA 3CYNA 3GMFA 7GSSA 1A0RP 4LL1B 1V2AA 3CTGA 5GAPD 4O32A 1ZYNA 2QKEA 1XW5A 1LBKA 1VF4A 4K1FA 4CHSA 1Z6NA 5LNKe 3LEFA 4EDZA 2QA2A 1TXXA 5D73A 4ICYA 4IQAA 2C80A 1YF1A 4YQMA 1V98A 2V6OA 3QAGA 4ZIJA 2R6KA 3U5RE 2GGTA 3TJFA 2XC2A 3QR6A 2LSTA 1V40A 4K2DA 3ZRDA 5BRTA 3GIXA 2GQKA 5CP1A 1GULA 4EF0A 1FVJA 1QQ2A 2KLXA 2VL2A 1PA3A 1BX9A 1ZYEA 4ZBDA 1VGLA 5LD0A 3W6GA 3LFLA 1GSFA 4AGSA 3CTFA 2TRXA 2PBJA 5CRWA 4J56E 5EVOA 3CRUA 2EC4A 2IWTA 1X5CA 3ED3A 2YJHA 4IQ1A 3O76A 4LA1A 4X0XA 3IC8A 3NOFA 4GRFA 3TKSE 3BD2A 2M72A 3ZMKA 1TP9A 1WMJA 5CREA 4BWSA 5EL8A 4MMMA 3IHQA 3I9V2 1GLQA 2R0CA 3HKRA 2AB6A 3GKXA 1U88A 5G5EA 2HYXA 5H5SA 3D4TA 1SD9A 2CX4A 1UVZA 1THXA 1AAZA 3EYTA 3TKRA 4TXVA 3GTUB 4N30A 1O73A 4K9ZA 4KDXA 1TK0B 4K7NA 4KH7A 4MCUA 5H5QA 1XOAA 1TRVA 2CZ3A 1S3CA 2O89A 1EV9A 5IPGA 2H01A 4ISDA 3GL3A 3ZVJD 1HNBA 1N2AA 2EIOA 1MDIA 1W4VA 2G2QA 2L6DA 5HFGA 4ML1A 3DVWA 5AIVA 2EIQA 1T4ZA 4J57E 2H75A 4DSSA 2A2RA 1XBSA 1B8XA 1PN0A 1WOUA 5DQSA 4BA7A 4GQFA 4POKA 8GSSA 4TXOB 4MJEA 2ZUPA 2BJXA 2R2JA 4HQZA 3UBKA 5C04A 3WT1A 2KP1A 5C00A 3KMOA 5IMFA 1X5DA 2VCXA 2XBQA 1BEDA 3HD5A 3EURA 3CSIA 3GH9A 4V2MA 2LJKA 4ZL8A 3H79A 1OC8A 4BPYA 3MNGA 2CVBA 3GSTA 3ZZXA 2P0GA 2VUPA 2C3QA 1DE2A 5G2ZA 2OE3A 1WJKA 2GQLA 3KM6A 1XZOA 3A5WA 2X8GA 1PL1A 1OC9B 3FRCA 4ZILA 3LJRA 2F51A 2HRKA 2IMDA 3HJPA 4I2UA 3CSHA 2LRNA 1H4OA 4HI7A 5ECNB 3TKSA 1V58A 5F06A 1S3AA 2GSRA 1J0FA 2DJ3A 3GKMA 1R5AA 5HR0A 3L9UA 5B8AA 5D9XA 1TOFA 2PGTA 5ECMB 3DMLA 1YF0A 3E0UA 4FIWA 2FWHA 3MWHA 1N8JA 1G7OA 3TUEA 3IAM2 3C8EA 2K8VA 3D4MA 3GRXA 3IXRA 10GSA 4K2XA 2B3SA 4KCAA 2LRTA 2FWEA 2OKAA 5J9BA 2YCDA 2H0IA 4G9HA 3S9FA 3H93A 1TRWA 3IE3A 1TI1A 3IR4A 3QFAC 4JR6A 3TJJA 2HZEA 3ME8A 1QGVA 3A5IA 2V2GA 4HZ4A 2OBKA 3FZ4A 5AISA 5IM9A 2RUFA 1ABAA 3Q6OA 4HS1A 4KUNA 2Z9SA 5DCHA 5JWRB 3QAVA 3M0FA 2GDRA 1AQWA 3HYPA 4G19A 2B5YA 5J41A 3MSZA 4OO4A 2VOCA 3TJGA 2JZRA 3DKSA 4NV2A 1FW1A 4IN0A 3KTLA 4IBPA 4JBBA 4XTSA 2OE1A 6GSYA 22GSA 3A2VA 2YANA 3VLNA 1WE0A 1LJRA 2GZYA 1B48A 5ECLB 2JU5A 3LW9A 3F4RA 1TU7A 4RQXA 4X43A 4HOJA 3UJ1A 4HU7A 2AHEA 5IMZA 5B8BA 2VL3A 3IBHA 4YAVA 2YZHA 3GSSA 1SL2B 5IQYA 3UL3A 2IJYA 1O8XA 4YQVA 2A4VA 1KTEA 4EXJA 1G0TA 2RLIA 3HHVA 3FHKA 1O7UA 3F8UA 2CV4A 1U6TA 4TR3A 3DIEA 3M1GA 5E59A 1SJZA 1VF1A 1Y25A 4I97A 2YOIA 6GSWA 1EP8A 4RUVA 2IMFA 2L4CA 2VCZA 2C3TA 1M0UA 1FG4A 4EDYA 4IP6A 2B1KA 4L0UA 3TJBA 5ECSA 1SK0A 2FCHA 4BVYB 5DCGA 4POBA 1J08A 5IPHA 1TW9A 1NHOA 1EV4A 3G9BA 2B1LA 3QPMA 2IIYA 2VL9A 1GWCA 3TOTA 1CQHA 4MA9A 3FK8A 2REMA 2O87A 4G2EA 5F8BA 5BMUA 4AF2A 5FT3A 1M7TA 5G31A 1TK8B 5CAXA 4WBRD 2PUKC 3GTUA 2H1GA 1X9MB 4IS0A 4JR4A 5ECIB 1SL1B 2X49A 3IK9A 4Q5QA 2CA8A 4HEA2 2CQ9A 2QGVA 4N11A 3VK9A 3EPTA 1YJ6A 3KJYA 2YWOA 1GUKA 3PGTA 3KP9A 3GX8A 1MD4A 2FLSA 3L9SA 5IMAA 1ZYQB 4MP4A 1JHBA 2E7PA 2JZTA 1MTCA 1Q98A 3U6VA 2L59A 4TXOA 4EE0A 3GN3A 2P5RA 3M8NA 4HU9A 3FY7A 3KTBA 2FUG2 2J23A 4FO5A 1SD8A 3TRPA 1T4YA 5ELGA 3KMNA 4L5OA 1M2BA 4MJBA 2VM1A 5FHIA 3Q19A 1ZZYA 4ECCA 4QL7A 2DJJA 2I9HA 2NPBA 4PNFA 4MDCA 2H30A 4KX4A 3KZQA 2AYTA 3P2AA 4HUAA 1WRYA 2GSSA 5J3RA 3C7MA 3EWLA 5ECOB 3MAKA 2XPEA 4GF0A 4RQRA 1TRSA 5D9VA 20GSA 1O85A 3BCKA 3ERFA 3TKQA 4BL7B 4V1Ap 3N5OA 3DEXA 2LNSA 5A4WA 1X5EA 1YKAA 2L5OA 2F8FA 4MH2A 3DYRA 1OC9A 3ERWA 3CMIA 3J7Yb 3GL5A 5HFKA 3LQ7A 2X64A 4MF5A 1GSSA 4RI7A 2MMOA 3E9JB 4K7OA 2GTUA 5J9CA 4IKHA 2IMKA 3HZ4A 3PR8A 2QSIA 2H0GA 1SL0B 3KP8A 5DAKB 4WR4A 4ZB6A 2GVPA 5IIZA 2R37A 3W8JA 1K0MA 1GSDA 1OE7A 1OYJA 2UZ8A 4XS4B 4Q5FA 1O6JA 4GTUA 1PRXA 4DSRA 2RM5A 4MNNA 2C3NA 5IOXA 2N5FA 4PURA 1T3BA 1PQNA 2K6VA 5AIXA 1BJXA 4ACSA 2ON5A 1XWKA 4I5QA 5ECKB 3AY8A 3VI5A 3G7IA 3KH7A 4GXZA 4X1UA 2RUEA 3L9VA 4XIHA 1URMA 4BVXB 3APOA 5F07A 3A2XA 1GSQA 4WETA 1M9BA 4KA0A 5IMVA 4PQHA 1SKRB 2VCQA 4OFMA 4MZBA 3VWXA 3FMWA 3HA9A 5IMDA 1DBYA 1UA5A 4TR0A 3P8WA 2K18A 5DALB 3ME7A 2O7KA 4G0KA 4TN8A 1Q4JA 2IN3A 3R3EA 4FYCA 2V6KA 1ILOA 3Q74A 4V2LA 1TRUA 3IRAA 2L4QA 5CRDA 1FO5A 3P90A 3L4NA 3ZFBA 4E8EA 3K8NA 3IAS2 4EC0A 4EO3A 1GH2A 3IDVA 5F05A 5G1LA 4XHMA 2OBIA 3H4KA 3L0HA 5KOXA 1EEMA 5H5RA 3SWLA 1WIKA 3FEUA 4GSNA 1Z6MA 4KE3A 2WGRA 1O8WA 4Z2UA 4JEDA 4GSTA 3IOSA 1MEKA 2VD1A 4TR1A 2IFQA 1Z7PA 3HVSA 1PX7A 1AQVA 5COHA 2WCIA 1K0BA 1YEXA 4K8MA 1PSQA 1XOBA 1V57A 5EY6A 1U3AA 3W8SA 2JSYA 5KN2A 5CRHA 2DBCA 3GKNA 2YJ7A 5B6MA 1V9WA 3BJ5A 3EE2A 4BVYA 2H6ZA 4OD7A 1KNGA 2NBSA 5A5KA 1K3LA 2VCWA 2MMNA 4OMVA 12GSA 2LQOA 3UARA 1J9BA 1SJIA 3HJMA 1XWBA 2C4JA 3KD0A 2GZPA 2VL2C 5GAND 4MJCA 2AJQB 2PERA 3MYDA 2DMLA 3KEBA 3H1NA 1PGTA 4JRRA 4RI6A 4F82A 1G6WA 2PU9C 1T7PB 1F37A 1QK8A 3QD9A 4FH8A 4K5SA 1U87A 1ZCPA 3FR6A 4P3YB 3LXZA 1FHEA 2H0HA 1EGOA 3WD6A 1A23A 2FHEA 2WRTA 3NZNA 2V41A 5J5NA 1M9AA 3GKKA 3ERGA 1A2LA 4TOPA 2GQMA 3DVXA 4NMUA 5D93A 4F2IA 2VD0A 1RW1A 3GV1A 1PKZA 1HNCA 3G7YA 4Z2RA 4ZBAA 5IO0A 2NDOA 1YY7A 5G30A 5DJMA 3HVXA 1TI3A 1K0NA 5IMCA 4TVEA 4PXOA 2ES7A 2P5QA 5ECRB 3IA1A 2DJ2A 2E0QA 3EMXA 2LTKA 1DUGA 2FD3A 2MZCA 4EL1A 5DQYA 3ZLPA 2P31A 2FA4A 2BTOT 5AGYA 1FVKA 1JZOA 2JACA 2LUSA 2VM2A 4NHZA 2PVOC 1EGRA 2JZSA 1ON4A 3UBLA 1K0AA 1EP7A 3WGEA 3LYKA 3FYGA 4BL7A 2WJUA 4Z2TA 5KEJA 1C72A 4ML6A 5GZZB 2IL3A 3F3RA 2HRAA 4L0WA 4ILFA 4KB3A 3FZAA 1K0DA 5KOWA 4MPFA 1PX6A 2DJKA 4AJ8A 3RHCA 1B4QA 4HJ2A 4LMWA 2HZFA 4NPBA 1TJDA 5DAKA 1R26A 2O8VB 2AUVA 4IGJA 1XFLA 3IHGA 4WF5A 2LRCA 1GRXA 4XS4A 1VF3A 4O92A 3C71A 5KN0A 4JE1A 5D8IA 3HZ8A 4EIPA 2LJAA 6GSTA 3WYWA 1FOHA 1GL8A 2F9SA 3NIVA 2J9HA 3GFKA 4I2TA 5JCGA 1GUHA 3FZ5A 2H19A 3F6FA 1ML6A 4CY6A 3TDGA 3D22A 4KGIA 3EMPA 4BVXA 3H8QA 18GSA 4YQUA 4LMVA 1GLPA 5ECQB 2LJRA 4KCEA 4MJAA 1KEBA 4PNGA 4MZCA 13GSA 1ERUA 2B5XA 1R5PA 3TKSC 2GSQA 3F0IA 4CDOA 3UAPA 5DALA 4POMA 3DXBA 2WFCA 1E2YA 3JCML 1H75A 2M80A 1NW2A 4PGTA 3HCZA 2H1DA 2R4VA 2KOKA 3FR3A 3GH6A 3US3A 2I3YA 3I69A 3DGQA 4O5UA 1A8YA 2YV9A 1EZKA 4DSSB 1UC7A 4ZL7A 2YWMA 4DVCA 3TCOA 6GSSA 4O5RA 4MK3A 1SENA 1ERTA 4KSMA 2VAFA 2RIIA 2N5AA 1F9MA 3TJKA 1OC3A 4N0VA 4IELA 5B7CA 2C0FA 4ECBA 1G6YA 3EVIA 4PUFC 1A2MA 1SKSB 1B9YC 1YKCA 3RHBA 3QMXA 5JWQB 1G7EA 2C0DA 2MYGA 1VRSD 4GLTA 1XWAA 1XW6A 3C1SA 1I9DA 5L71A 4F0CA 1HYUA 3F63A 2OJLA 2OA7A 2FWFA 2NTOA 5KN1A 4FYBA 2R3XA 3HDCA 5HR1A 4Q5RA 1JZRA 1QFNA 2H8LA 4MZWA 4ECJA 4MLYA 3QCPA 2ZNMA 2VLVA 5D96A 1RK4A 2WS2A 2V32A 4V2NA 2MMZA 5CNWA 5ABRA 3BCIA 4NWYA 1XXUA 1ZGNA 2H1BA 1WP0A 3TGZA 3UVHA 3IC4A 4KAEA 2H66A 2DKHA 4YKFA 4JU5A 1XWGA 1MDJA 3D5JA 4AJ6A 1ERWA 3APSA 2TIRA 5ECPB 5INYA 4NHWA 3RAZA 4FYUA 3ZMLA 4HQSA 1SK2A 5AN1A 5B6NA 2H6XA 2DJ1A 2DMMA 4O7HA 6GSVA 4ZB8A 4OO5A 2KHPA 4PQIA 3VPQA 5JWOB 4WXTA 3ZTLA 1NHYA 4K6XA 4F0BA 1QXHA 1OKDA 1B4PA 2X8CA 1S3DA 3QOUA 4WF4A 3ZITA 5IOWA 4ECIA 1YDKA 1PL2A 5HFIA 1THOA 3CXGA 4IJIA 3ZIJA 2LEGA 1M2DA 3IV4A 2XBIA 1O81A 1TDIA 3GURA 2LKUA 4ULXA 2C0GA 2N5BA 2I4AA 4MH3A 2L6CA 2R0GA 4DEJA 1OE8A 5DJLA 2CX3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FOV A;  3ZFL A;  4XCS A;  1GP1 A;  2EIR A;  2VIM A;  5F0G A;  3ZRE A;  5G5F A;  1PKW A;  4IHU A;  3UIW A;  3WGX A;  2QC7 A;  2MBS A;  2B6M A;  3KXO A;  3M9J A;  1GSY A;  4V1A g;  4J2F A;  2VCV A;  2H76 A;  5A4V A;  1Z9H A;  2C0E A;  1R7H A;  2WB9 A;  4N0Z A;  1PMT A;  4GSS A;  3A3T A;  2TRC P;  1GNE A;  2ZCT A;  3DD3 A;  5ECH B;  1OVN A;  2PPT A;  2FY6 A;  2WDU A;  3SBC A;  1ERV A;  1XPV A;  1GSU A;  1K0C A;  3FR9 A;  1EOH A;  2KUC A;  3GNJ A;  3TB2 A;  1EOG A;  5ELA A;  2OAC A;  1F6M C;  4E8H A;  1AW9 A;  2LQQ A;  3PIN A;  3EU3 A;  1SKW B;  1XVQ A;  3J7Y k;  4PQ1 A;  3RBT A;  1M2A A;  4D73 B;  5JCU A;  4H86 A;  3GHA A;  2GLR A;  4AJ7 A;  1CQG A;  2ALB A;  4HZ2 A;  1TK5 B;  2G0F A;  2HXK A;  1XVW A;  4EUY A;  2LS5 A;  2O85 A;  4NXI A;  3LGC A;  17GS A;  5ID2 B;  1BG5 A;  2GZZ A;  2C1Y A;  1JZD A;  5E4W A;  2CAQ A;  2FWG A;  3Q18 A;  2M46 A;  4JZQ A;  5GST A;  1YQ1 A;  2PMT A;  4F9Z A;  3GUS A;  2MBT A;  3HJO A;  3TKP A;  1T00 A;  2HI7 A;  2B7J A;  1E6B A;  4PUA A;  4POL A;  2YWI A;  1QUW A;  5HR2 A;  2JL4 A;  4KND A;  1NSW A;  5A4U A;  3CBU A;  3RPN A;  4DSQ A;  1MD3 A;  3CSJ A;  4TW5 A;  1FAA A;  4KSO A;  1YZX A;  3RPP A;  2VLU A;  4NV5 A;  4IJ3 A;  3LWA A;  2XHF A;  2HT9 A;  2PVQ A;  2YV7 A;  5CRG A;  2NVL A;  3GA4 A;  1M99 A;  3TOU A;  1XIY A;  3CRT A;  1NM3 A;  3G7J A;  2AAW A;  2FA8 A;  2CVD A;  2H70 A;  5CYY A;  19GS A;  4EKZ A;  4Z7X A;  3KGK A;  1IYH A;  1RQM A;  2FNO A;  4QQ7 A;  1KBN A;  2HRF A;  2FGX A;  3VI7 A;  2IME A;  1DSB A;  2L57 A;  4IVF A;  1F2E A;  1K3O A;  1AUC A;  4HDE A;  1GUM A;  2YNX A;  1BQ7 A;  1Z7R A;  1X9S B;  4XS6 A;  1VF2 A;  3QAW A;  3FKF A;  1GSE A;  1SJ6 A;  4XRD A;  3UMA A;  2HNL A;  1EWX A;  2GT5 A;  2KP2 A;  4WKW A;  1HD2 A;  1JZW A;  3D0Z A;  4GQC A;  2OAD A;  2JAD A;  1K3Y A;  1TTZ A;  2HSH A;  2ON7 A;  4WR5 A;  2L5L A;  2HRN A;  4LLR A;  3A2W A;  2BMX A;  4MF6 A;  5GSS A;  1EEJ A;  1XCC A;  1GNW A;  3HVV A;  3IK7 A;  3VWU A;  1OAZ A;  1HNA A;  3LOR A;  1X9W B;  2CVK A;  1OKT A;  3VWW A;  1ACV A;  2F8A A;  2H1A A;  1AIU A;  2GS3 A;  1A0F A;  2LV3 A;  4L5L A;  3WT2 A;  2GST A;  3ZVJ A;  5DBQ A;  4WEY A;  3VFI A;  6GSU A;  5IO2 A;  1AXD A;  5HR3 A;  2HFD A;  3F4T A;  3QFB C;  1A2J A;  3TRQ A;  5J4U A;  3R2Q A;  2VO4 A;  4K0G A;  3UEM A;  3ZL5 A;  2WUL A;  1JLW A;  1ZMA A;  1Y6E A;  3LXT A;  2GT6 A;  3KCM A;  2AV4 A;  2XPD A;  1WWJ A;  3UOM A;  2LNT A;  1GTA A;  2JSZ A;  1ZOF A;  3EIN A;  1Z3E A;  3E3E A;  4NAX A;  5CO3 A;  2H6Y A;  2YPM A;  1Z5Y E;  2YP6 A;  4GWR A;  2PWJ A;  3F4S A;  1F3B A;  2HLS A;  3L78 A;  3IPZ A;  1UN2 A;  11GS A;  5DVB A;  4TR4 A;  1K0O A;  2D2Z A;  1FB6 A;  5HQP A;  2F3M A;  4XRA A;  3BOA A;  3D6I A;  1SU9 A;  3O6T A;  4LL4 B;  9GSS A;  2H74 A;  1A24 A;  1W89 A;  2V1M A;  3LSZ A;  4L8E A;  2DJ0 A;  1TU8 A;  1GTB A;  3M9K A;  4PX1 A;  1GTI A;  3ZIV A;  3LG6 A;  4TR1 B;  2IFQ B;  3O3T A;  1T1V A;  3C1R A;  4TKY A;  3C73 A;  2I81 A;  3VUR A;  1R4W A;  2A2S A;  2IMI A;  4OCE A;  1ZL9 A;  2H73 A;  3HXS A;  6GSX A;  4ZXG A;  2K9F A;  3EU4 A;  5G1K A;  5FWG A;  3P7X A;  3OR5 A;  5EPF A;  2DIZ A;  5DDL A;  2DIY A;  3KIJ A;  4D73 A;  4I8B A;  1GTU A;  4MF7 A;  1JLV A;  2IPA A;  4WBJ A;  1QMV A;  3V1W A;  1ST9 A;  1SK1 A;  4IW9 A;  2YN1 A;  2H71 A;  5ID2 A;  3VPT A;  1AC1 A;  1JFU A;  4ID0 A;  2H72 A;  2PN8 A;  2YZU A;  2VLT A;  4YH2 A;  2R5G A;  2HE3 A;  4OWY A;  5D9T A;  3HY2 A;  1PD2 1;  4TRX A;  1T8E B;  4K0N A;  3GX0 A;  1AQX A;  2OE0 A;  1MDK A;  4HJM A;  4MPG A;  2I1U A;  4F03 A;  5JCW A;  4QL9 A;  4ZB9 A;  14GS A;  2B5E A;  2CZ2 A;  5ENU A;  4ZL9 A;  3N9J A;  1TKD B;  3FZ9 A;  3DWV A;  1I5G A;  1FB0 A;  1XW9 A;  1IYI A;  2K8S A;  1USB A;  2E2M A;  2VCT A;  3EC3 A;  1F3A A;  3BBY A;  1A8L A;  4KDU A;  2DSA A;  1XWC A;  2RM6 A;  4OFN A;  2CT6 A;  3F9U A;  4BWQ A;  3LYP A;  1WPI A;  4ZBB A;  1PN9 A;  2B7K A;  3DRN A;  2HSY A;  3UVT A;  3F3Q A;  3APQ A;  4GCI A;  4YAP A;  3ISO A;  4KW6 A;  3I6A A;  4G10 A;  5D9W A;  2X99 A;  3GYK A;  4OCF A;  3TRX A;  3MDK A;  3QDN A;  4K7I A;  2MMA A;  5KN3 A;  1DE1 A;  4MAB A;  4N10 A;  1BAY A;  1BYE A;  1SYR A;  4XS1 A;  3PH9 A;  3F6D A;  4I6X A;  5LCZ A;  2X8H A;  2DLX A;  2CAI A;  1B9X C;  2C8U A;  1LU4 A;  4KDY A;  3D21 A;  2WZ9 A;  3RDW A;  3M3M A;  3I43 A;  1SYX A;  2HZE B;  4IP1 A;  1U3I A;  3VWV A;  1HQO A;  2E2G A;  2YWN A;  3ZYW A;  16GS A;  3WGD A;  1X0R A;  2DC5 A;  3FW2 A;  4OFT A;  4Q5N A;  4CW9 A;  4EVM A;  3KH9 A;  1YEP A;  3CYN A;  3GMF A;  7GSS A;  1A0R P;  4LL1 B;  1V2A A;  3CTG A;  5GAP D;  4O32 A;  2QKE A;  1XW5 A;  1LBK A;  1VF4 A;  4K1F A;  4CHS A;  1Z6N A;  5LNK e;  3LEF A;  4EDZ A;  1TXX A;  5D73 A;  4IQA A;  2C80 A;  1YF1 A;  4YQM A;  1V98 A;  2V6O A;  3QAG A;  4ZIJ A;  2R6K A;  3U5R E;  2GGT A;  3TJF A;  2XC2 A;  3QR6 A;  2LST A;  1V40 A;  4K2D A;  3ZRD A;  3GIX A;  2GQK A;  5CP1 A;  1GUL A;  4EF0 A;  1FVJ A;  1QQ2 A;  2KLX A;  2VL2 A;  1PA3 A;  1BX9 A;  1ZYE A;  4ZBD A;  1VGL A;  5LD0 A;  3W6G A;  3LFL A;  1GSF A;  4AGS A;  3CTF A;  2TRX A;  2PBJ A;  5CRW A;  4J56 E;  5EVO A;  3CRU A;  2EC4 A;  2IWT A;  1X5C A;  3ED3 A;  2YJH A;  4IQ1 A;  3O76 A;  4LA1 A;  4X0X A;  3NOF A;  4GRF A;  3TKS E;  3BD2 A;  2M72 A;  3ZMK A;  1TP9 A;  1WMJ A;  5CRE A;  4BWS A;  5EL8 A;  4MMM A;  3IHQ A;  3I9V 2;  1GLQ A;  3HKR A;  2AB6 A;  3GKX A;  1U88 A;  5G5E A;  2HYX A;  5H5S A;  3D4T A;  1SD9 A;  2CX4 A;  1UVZ A;  1THX A;  1AAZ A;  3EYT A;  3TKR A;  4TXV A;  3GTU B;  4N30 A;  1O73 A;  4K9Z A;  4KDX A;  1TK0 B;  4K7N A;  4KH7 A;  4MCU A;  5H5Q A;  1XOA A;  1TRV A;  2CZ3 A;  1S3C A;  2O89 A;  1EV9 A;  5IPG A;  2H01 A;  4ISD A;  3GL3 A;  3ZVJ D;  1HNB A;  1N2A A;  2EIO A;  1MDI A;  1W4V A;  2G2Q A;  2L6D A;  5HFG A;  4ML1 A;  3DVW A;  5AIV A;  2EIQ A;  1T4Z A;  4J57 E;  2H75 A;  4DSS A;  2A2R A;  1XBS A;  1B8X A;  1WOU A;  5DQS A;  4BA7 A;  4GQF A;  4POK A;  8GSS A;  4TXO B;  4MJE A;  2ZUP A;  2BJX A;  2R2J A;  4HQZ A;  3UBK A;  5C04 A;  3WT1 A;  2KP1 A;  5C00 A;  3KMO A;  5IMF A;  1X5D A;  2VCX A;  2XBQ A;  1BED A;  3HD5 A;  3EUR A;  3CSI A;  3GH9 A;  4V2M A;  2LJK A;  4ZL8 A;  3H79 A;  1OC8 A;  4BPY A;  3MNG A;  2CVB A;  3GST A;  3ZZX A;  2P0G A;  2VUP A;  2C3Q A;  1DE2 A;  5G2Z A;  2OE3 A;  1WJK A;  2GQL A;  3KM6 A;  1XZO A;  3A5W A;  2X8G A;  1PL1 A;  1OC9 B;  3FRC A;  4ZIL A;  3LJR A;  2F51 A;  2IMD A;  3HJP A;  4I2U A;  3CSH A;  2LRN A;  1H4O A;  4HI7 A;  5ECN B;  3TKS A;  1V58 A;  5F06 A;  1S3A A;  2GSR A;  1J0F A;  2DJ3 A;  3GKM A;  1R5A A;  5HR0 A;  3L9U A;  5B8A A;  5D9X A;  1TOF A;  2PGT A;  5ECM B;  3DML A;  1YF0 A;  3E0U A;  4FIW A;  2FWH A;  3MWH A;  1N8J A;  1G7O A;  3TUE A;  3IAM 2;  3C8E A;  2K8V A;  3D4M A;  3GRX A;  3IXR A;  10GS A;  2B3S A;  4KCA A;  2LRT A;  2FWE A;  2OKA A;  5J9B A;  2YCD A;  2H0I A;  4G9H A;  3S9F A;  3H93 A;  1TRW A;  3IE3 A;  1TI1 A;  3IR4 A;  3QFA C;  4JR6 A;  3TJJ A;  2HZE A;  3ME8 A;  1QGV A;  2V2G A;  4HZ4 A;  2OBK A;  3FZ4 A;  5AIS A;  5IM9 A;  2RUF A;  1ABA A;  3Q6O A;  4HS1 A;  4KUN A;  2Z9S A;  5DCH A;  5JWR B;  3QAV A;  3M0F A;  2GDR A;  1AQW A;  3HYP A;  4G19 A;  2B5Y A;  5J41 A;  3MSZ A;  4OO4 A;  2VOC A;  3TJG A;  2JZR A;  3DKS A;  4NV2 A;  1FW1 A;  4IN0 A;  3KTL A;  4IBP A;  4JBB A;  4XTS A;  2OE1 A;  6GSY A;  22GS A;  3A2V A;  2YAN A;  3VLN A;  1WE0 A;  1LJR A;  2GZY A;  1B48 A;  5ECL B;  2JU5 A;  3F4R A;  1TU7 A;  4RQX A;  4X43 A;  4HOJ A;  3UJ1 A;  4HU7 A;  2AHE A;  5IMZ A;  5B8B A;  2VL3 A;  3IBH A;  4YAV A;  2YZH A;  3GSS A;  1SL2 B;  5IQY A;  3UL3 A;  2IJY A;  1O8X A;  4YQV A;  2A4V A;  1KTE A;  4EXJ A;  1G0T A;  2RLI A;  3HHV A;  3FHK A;  1O7U A;  3F8U A;  2CV4 A;  1U6T A;  4TR3 A;  3DIE A;  3M1G A;  5E59 A;  1SJZ A;  1VF1 A;  1Y25 A;  4I97 A;  2YOI A;  6GSW A;  1EP8 A;  4RUV A;  2IMF A;  2L4C A;  2VCZ A;  2C3T A;  1M0U A;  1FG4 A;  4EDY A;  4IP6 A;  2B1K A;  4L0U A;  3TJB A;  5ECS A;  1SK0 A;  2FCH A;  5DCG A;  4POB A;  1J08 A;  5IPH A;  1TW9 A;  1NHO A;  1EV4 A;  3G9B A;  2B1L A;  3QPM A;  2IIY A;  2VL9 A;  1GWC A;  3TOT A;  1CQH A;  4MA9 A;  3FK8 A;  2REM A;  2O87 A;  4G2E A;  5F8B A;  4AF2 A;  5FT3 A;  1M7T A;  5G31 A;  1TK8 B;  5CAX A;  4WBR D;  2PUK C;  3GTU A;  2H1G A;  1X9M B;  4IS0 A;  4JR4 A;  5ECI B;  1SL1 B;  3IK9 A;  4Q5Q A;  2CA8 A;  4HEA 2;  2CQ9 A;  2QGV A;  4N11 A;  3VK9 A;  1YJ6 A;  3KJY A;  2YWO A;  1GUK A;  3PGT A;  3KP9 A;  3GX8 A;  1MD4 A;  2FLS A;  3L9S A;  5IMA A;  1ZYQ B;  4MP4 A;  1JHB A;  2E7P A;  2JZT A;  1MTC A;  1Q98 A;  3U6V A;  2L59 A;  4TXO A;  4EE0 A;  3GN3 A;  2P5R A;  3M8N A;  4HU9 A;  3FY7 A;  3KTB A;  2FUG 2;  2J23 A;  4FO5 A;  1SD8 A;  3TRP A;  1T4Y A;  5ELG A;  3KMN A;  4L5O A;  1M2B A;  4MJB A;  2VM1 A;  5FHI A;  3Q19 A;  1ZZY A;  4ECC A;  4QL7 A;  2DJJ A;  2I9H A;  2NPB A;  4PNF A;  4MDC A;  2H30 A;  4KX4 A;  3KZQ A;  2AYT A;  3P2A A;  4HUA A;  1WRY A;  2GSS A;  5J3R A;  3C7M A;  3EWL A;  5ECO B;  3MAK A;  2XPE A;  4GF0 A;  4RQR A;  1TRS A;  5D9V A;  20GS A;  1O85 A;  3BCK A;  3ERF A;  3TKQ A;  4V1A p;  3N5O A;  3DEX A;  2LNS A;  5A4W A;  1X5E A;  1YKA A;  2L5O A;  2F8F A;  4MH2 A;  3DYR A;  1OC9 A;  3ERW A;  3CMI A;  3J7Y b;  3GL5 A;  5HFK A;  3LQ7 A;  2X64 A;  4MF5 A;  1GSS A;  4RI7 A;  2MMO A;  3E9J B;  4K7O A;  2GTU A;  5J9C A;  4IKH A;  2IMK A;  3HZ4 A;  3PR8 A;  2QSI A;  2H0G A;  1SL0 B;  3KP8 A;  5DAK B;  4WR4 A;  4ZB6 A;  2GVP A;  5IIZ A;  2R37 A;  3W8J A;  1K0M A;  1GSD A;  1OE7 A;  1OYJ A;  4XS4 B;  4Q5F A;  1O6J A;  4GTU A;  1PRX A;  4DSR A;  2RM5 A;  5IOX A;  2C3N A;  2N5F A;  4PUR A;  1T3B A;  1PQN A;  2K6V A;  5AIX A;  1BJX A;  4ACS A;  2ON5 A;  1XWK A;  4I5Q A;  5ECK B;  3AY8 A;  3VI5 A;  3G7I A;  3KH7 A;  4GXZ A;  4X1U A;  2RUE A;  3L9V A;  4XIH A;  1URM A;  3APO A;  5F07 A;  3A2X A;  1GSQ A;  4WET A;  1M9B A;  4KA0 A;  5IMV A;  4PQH A;  1SKR B;  2VCQ A;  4OFM A;  4MZB A;  3VWX A;  3HA9 A;  5IMD A;  1DBY A;  1UA5 A;  4TR0 A;  3P8W A;  2K18 A;  5DAL B;  3ME7 A;  2O7K A;  4TN8 A;  1Q4J A;  2IN3 A;  4FYC A;  2V6K A;  1ILO A;  3Q74 A;  4V2L A;  1TRU A;  3IRA A;  2L4Q A;  5CRD A;  1FO5 A;  3P90 A;  3L4N A;  3ZFB A;  4E8E A;  3K8N A;  3IAS 2;  4EC0 A;  4EO3 A;  1GH2 A;  3IDV A;  5F05 A;  5G1L A;  4XHM A;  2OBI A;  3H4K A;  3L0H A;  1EEM A;  5H5R A;  3SWL A;  1WIK A;  3FEU A;  4GSN A;  1Z6M A;  4KE3 A;  2WGR A;  1O8W A;  4JED A;  4GST A;  3IOS A;  1MEK A;  2VD1 A;  4TR1 A;  2IFQ A;  1Z7P A;  3HVS A;  1PX7 A;  1AQV A;  5COH A;  2WCI A;  1K0B A;  1YEX A;  4K8M A;  1PSQ A;  1XOB A;  1V57 A;  5EY6 A;  1U3A A;  3W8S A;  2JSY A;  5KN2 A;  5CRH A;  2DBC A;  3GKN A;  2YJ7 A;  5B6M A;  1V9W A;  3BJ5 A;  3EE2 A;  4BVY A;  2H6Z A;  4OD7 A;  1KNG A;  2NBS A;  5A5K A;  1K3L A;  2VCW A;  2MMN A;  4OMV A;  12GS A;  2LQO A;  3UAR A;  1J9B A;  1SJI A;  3HJM A;  1XWB A;  2C4J A;  3KD0 A;  2GZP A;  2VL2 C;  5GAN D;  4MJC A;  2AJQ B;  2PER A;  2DML A;  3KEB A;  3H1N A;  1PGT A;  4JRR A;  4RI6 A;  4F82 A;  1G6W A;  2PU9 C;  1T7P B;  1F37 A;  1QK8 A;  3QD9 A;  4FH8 A;  1U87 A;  1ZCP A;  3FR6 A;  4P3Y B;  3LXZ A;  1FHE A;  2H0H A;  1EGO A;  3WD6 A;  1A23 A;  2FHE A;  2WRT A;  3NZN A;  2V41 A;  5J5N A;  1M9A A;  3GKK A;  3ERG A;  1A2L A;  4TOP A;  2GQM A;  3DVX A;  4NMU A;  5D93 A;  4F2I A;  2VD0 A;  1RW1 A;  3GV1 A;  1PKZ A;  1HNC A;  3G7Y A;  4ZBA A;  5IO0 A;  2NDO A;  1YY7 A;  5G30 A;  5DJM A;  3HVX A;  1TI3 A;  1K0N A;  5IMC A;  4TVE A;  4PXO A;  2ES7 A;  2P5Q A;  5ECR B;  3IA1 A;  2DJ2 A;  2E0Q A;  3EMX A;  2LTK A;  1DUG A;  2FD3 A;  2MZC A;  4EL1 A;  5DQY A;  3ZLP A;  2P31 A;  2FA4 A;  2BTO T;  5AGY A;  1FVK A;  1JZO A;  2JAC A;  2LUS A;  2VM2 A;  4NHZ A;  2PVO C;  1EGR A;  2JZS A;  1ON4 A;  3UBL A;  1K0A A;  1EP7 A;  3WGE A;  3LYK A;  3FYG A;  4BL7 A;  2WJU A;  5KEJ A;  1C72 A;  4ML6 A;  5GZZ B;  2IL3 A;  3F3R A;  4L0W A;  4ILF A;  4KB3 A;  3FZA A;  1K0D A;  4MPF A;  1PX6 A;  2DJK A;  4AJ8 A;  3RHC A;  1B4Q A;  4HJ2 A;  4LMW A;  2HZF A;  4NPB A;  1TJD A;  5DAK A;  1R26 A;  2O8V B;  2AUV A;  4IGJ A;  1XFL A;  4WF5 A;  2LRC A;  1GRX A;  4XS4 A;  1VF3 A;  4O92 A;  3C71 A;  5KN0 A;  4JE1 A;  5D8I A;  3HZ8 A;  2LJA A;  6GST A;  3WYW A;  1GL8 A;  2F9S A;  3NIV A;  2J9H A;  3GFK A;  4I2T A;  5JCG A;  1GUH A;  3FZ5 A;  2H19 A;  3F6F A;  1ML6 A;  3TDG A;  3D22 A;  4KGI A;  3EMP A;  4BVX A;  3H8Q A;  18GS A;  4YQU A;  4LMV A;  1GLP A;  5ECQ B;  2LJR A;  4KCE A;  4MJA A;  1KEB A;  4PNG A;  4MZC A;  13GS A;  1ERU A;  2B5X A;  1R5P A;  3TKS C;  2GSQ A;  3F0I A;  4CDO A;  3UAP A;  5DAL A;  4POM A;  3DXB A;  2WFC A;  1E2Y A;  3JCM L;  1H75 A;  2M80 A;  1NW2 A;  4PGT A;  3HCZ A;  2H1D A;  2R4V A;  2KOK A;  3FR3 A;  3GH6 A;  3US3 A;  2I3Y A;  3I69 A;  3DGQ A;  1A8Y A;  2YV9 A;  1EZK A;  4DSS B;  1UC7 A;  4ZL7 A;  2YWM A;  4DVC A;  3TCO A;  6GSS A;  4O5R A;  4MK3 A;  1SEN A;  1ERT A;  4KSM A;  2VAF A;  2RII A;  2N5A A;  1F9M A;  3TJK A;  1OC3 A;  4N0V A;  4IEL A;  5B7C A;  2C0F A;  4ECB A;  1G6Y A;  3EVI A;  4PUF C;  1A2M A;  1SKS B;  1B9Y C;  1YKC A;  3RHB A;  3QMX A;  5JWQ B;  1G7E A;  2C0D A;  2MYG A;  1VRS D;  4GLT A;  1XWA A;  1XW6 A;  3C1S A;  1I9D A;  5L71 A;  4F0C A;  1HYU A;  3F63 A;  2OJL A;  2OA7 A;  2FWF A;  2NTO A;  5KN1 A;  4FYB A;  2R3X A;  3HDC A;  5HR1 A;  4Q5R A;  1JZR A;  1QFN A;  2H8L A;  4MZW A;  4ECJ A;  4MLY A;  3QCP A;  2ZNM A;  2VLV A;  5D96 A;  1RK4 A;  2WS2 A;  2V32 A;  4V2N A;  2MMZ A;  5CNW A;  5ABR A;  3BCI A;  4NWY A;  1XXU A;  1ZGN A;  2H1B A;  1WP0 A;  3TGZ A;  3UVH A;  3IC4 A;  4KAE A;  2H66 A;  4JU5 A;  1XWG A;  1MDJ A;  3D5J A;  4AJ6 A;  1ERW A;  3APS A;  2TIR A;  5ECP B;  5INY A;  4NHW A;  3RAZ A;  4FYU A;  3ZML A;  4HQS A;  1SK2 A;  5AN1 A;  5B6N A;  2H6X A;  2DJ1 A;  2DMM A;  4O7H A;  6GSV A;  4ZB8 A;  4OO5 A;  2KHP A;  4PQI A;  3VPQ A;  5JWO B;  4WXT A;  3ZTL A;  1NHY A;  4K6X A;  4F0B A;  1QXH A;  1OKD A;  1B4P A;  2X8C A;  1S3D A;  3QOU A;  4WF4 A;  3ZIT A;  5IOW A;  4ECI A;  1YDK A;  1PL2 A;  5HFI A;  1THO A;  3CXG A;  4IJI A;  3ZIJ A;  2LEG A;  1M2D A;  3IV4 A;  2XBI A;  1O81 A;  1TDI A;  3GUR A;  2LKU A;  4ULX A;  2C0G A;  2N5B A;  2I4A A;  4MH3 A;  2L6C A;  4DEJ A;  1OE8 A;  5DJL A;  2CX3 A; 
#chains in the Genus database with same CATH topology
 1FOV A;  3ZFL A;  4XCS A;  1GP1 A;  2EIR A;  2VIM A;  5F0G A;  3ZRE A;  5G5F A;  1PKW A;  4IHU A;  3UIW A;  3WGX A;  2QC7 A;  2MBS A;  2B6M A;  3KXO A;  3M9J A;  1GSY A;  4V1A g;  4J2F A;  2VCV A;  2H76 A;  5A4V A;  1Z9H A;  2C0E A;  1R7H A;  2WB9 A;  4N0Z A;  1PMT A;  4GSS A;  3A3T A;  2TRC P;  2A2P A;  1GNE A;  2ZCT A;  3DD3 A;  1XG8 A;  5ECH B;  1OVN A;  2PPT A;  2FY6 A;  2WDU A;  3SBC A;  1ERV A;  1XPV A;  4X4J A;  1GSU A;  1K0C A;  3FR9 A;  1EOH A;  2KUC A;  3GNJ A;  3TB2 A;  1EOG A;  5ELA A;  2OAC A;  1F6M C;  4E8H A;  1AW9 A;  2LQQ A;  3PIN A;  3EU3 A;  1SKW B;  1XVQ A;  3J7Y k;  4PQ1 A;  3RBT A;  4USS A;  1M2A A;  4D73 B;  2DKI A;  5JCU A;  4H86 A;  3GHA A;  2GLR A;  4AJ7 A;  1CQG A;  2ALB A;  4HZ2 A;  4YKG A;  1TK5 B;  2G0F A;  2HXK A;  1XVW A;  4EUY A;  2LS5 A;  2O85 A;  4NXI A;  3LGC A;  17GS A;  5ID2 B;  1BG5 A;  2GZZ A;  2C1Y A;  1JZD A;  5E4W A;  2CAQ A;  2FWG A;  3Q18 A;  2M46 A;  4JZQ A;  5GST A;  1YQ1 A;  2PMT A;  4F9Z A;  3GUS A;  2MBT A;  3HJO A;  3TKP A;  1T00 A;  2HI7 A;  2B7J A;  1E6B A;  4PUA A;  4POL A;  2YWI A;  1QUW A;  5HR2 A;  2JL4 A;  4FQU A;  4KND A;  1NSW A;  5A4U A;  3CBU A;  3RPN A;  4DSQ A;  1MD3 A;  3CSJ A;  4TW5 A;  1FAA A;  4KSO A;  1YZX A;  3RPP A;  2VLU A;  4NV5 A;  4IJ3 A;  3LWA A;  2XHF A;  2HT9 A;  2PVQ A;  2YV7 A;  5CRG A;  2NVL A;  3GA4 A;  1M99 A;  3TOU A;  1XIY A;  2R0P A;  3CRT A;  1NM3 A;  3G7J A;  2AAW A;  2FA8 A;  2CVD A;  2H70 A;  4G0L A;  5CYY A;  19GS A;  4EKZ A;  4Z7X A;  3KGK A;  1IYH A;  1RQM A;  2FNO A;  4QQ7 A;  1KBN A;  2HRF A;  2FGX A;  3VI7 A;  2IME A;  1DSB A;  2L57 A;  4IVF A;  1F2E A;  1K3O A;  2HSM A;  1AUC A;  4HDE A;  1GUM A;  2YNX A;  1BQ7 A;  2X4A A;  1Z7R A;  1X9S B;  4XS6 A;  1VF2 A;  3QAW A;  3FKF A;  1GSE A;  1SJ6 A;  4XRD A;  3UMA A;  2HNL A;  1EWX A;  2GT5 A;  2KP2 A;  4WKW A;  1HD2 A;  1JZW A;  3D0Z A;  4GQC A;  2OAD A;  2JAD A;  1K3Y A;  1TTZ A;  2HSH A;  2ON7 A;  4WR5 A;  2L5L A;  2HRN A;  4LLR A;  3A2W A;  2BMX A;  4MF6 A;  5GSS A;  1EEJ A;  1XCC A;  1GNW A;  3HVV A;  3IK7 A;  3VWU A;  1OAZ A;  1HNA A;  3LOR A;  1X9W B;  2CVK A;  1OKT A;  3VWW A;  1ACV A;  2F8A A;  2H1A A;  1AIU A;  2GS3 A;  1A0F A;  2LV3 A;  4L5L A;  3WT2 A;  4EIQ A;  2GST A;  3MIX A;  5DBQ A;  3ZVJ A;  4O5Q A;  4WEY A;  3VFI A;  6GSU A;  5IO2 A;  1AXD A;  5HR3 A;  2HFD A;  3F4T A;  3QFB C;  1A2J A;  3TRQ A;  2QA1 A;  5J4U A;  3R2Q A;  2VO4 A;  4K0G A;  3UEM A;  3ZL5 A;  2WUL A;  1JLW A;  1ZMA A;  1Y6E A;  3PPU A;  3LXT A;  2GT6 A;  3KCM A;  2AV4 A;  4CY8 A;  2XPD A;  1WWJ A;  3UOM A;  2LNT A;  1GTA A;  2JSZ A;  1ZOF A;  3EIN A;  1Z3E A;  3E3E A;  4NAX A;  5CO3 A;  2H6Y A;  2YPM A;  1Z5Y E;  2YP6 A;  4GWR A;  2PWJ A;  3F4S A;  1F3B A;  2HLS A;  3L78 A;  3IPZ A;  1UN2 A;  11GS A;  5DVB A;  4TR4 A;  1K0O A;  2D2Z A;  1FB6 A;  5HQP A;  2F3M A;  4XRA A;  3BOA A;  4PTS A;  3D6I A;  1SU9 A;  3O6T A;  4LL4 B;  9GSS A;  2H74 A;  1A24 A;  1W89 A;  2V1M A;  3LSZ A;  4L8E A;  2DJ0 A;  1TU8 A;  1GTB A;  3M9K A;  4PX1 A;  1GTI A;  3ZIV A;  3LG6 A;  4TR1 B;  2IFQ B;  3O3T A;  1T1V A;  3C1R A;  4TKY A;  4A5P A;  3C73 A;  2I81 A;  3VUR A;  1R4W A;  2A2S A;  2IMI A;  4OCE A;  1ZL9 A;  2H73 A;  3HXS A;  6GSX A;  4ZXG A;  2K9F A;  3EU4 A;  5G1K A;  5FWG A;  3P7X A;  3OR5 A;  5EPF A;  2DIZ A;  2DIY A;  3KIJ A;  5DDL A;  4D73 A;  4I8B A;  1GTU A;  4MF7 A;  1JLV A;  2IPA A;  4WBJ A;  1QMV A;  3V1W A;  1ST9 A;  1SK1 A;  4IW9 A;  2YN1 A;  2H71 A;  5ID2 A;  3VPT A;  4G0I A;  1AC1 A;  1JFU A;  4ID0 A;  2H72 A;  2PN8 A;  2YZU A;  2VLT A;  4YH2 A;  2R5G A;  2HE3 A;  4OWY A;  5D9T A;  3HY2 A;  1PD2 1;  4TRX A;  1T8E B;  4K0N A;  3GX0 A;  1AQX A;  2OE0 A;  1MDK A;  4HJM A;  4MPG A;  2I1U A;  4F03 A;  5JCW A;  4QL9 A;  4ZB9 A;  14GS A;  2B5E A;  2CZ2 A;  5ENU A;  4ZL9 A;  3N9J A;  1TKD B;  3FZ9 A;  3DWV A;  1I5G A;  1FB0 A;  1XW9 A;  1IYI A;  2K8S A;  1USB A;  2E2M A;  2VCT A;  3EC3 A;  1F3A A;  3BBY A;  1A8L A;  4KDU A;  2DSA A;  1XWC A;  2RM6 A;  4OFN A;  2CT6 A;  3F9U A;  4BWQ A;  3LYP A;  1WPI A;  4ZBB A;  1PN9 A;  2B7K A;  3DRN A;  2HSY A;  3UVT A;  3F3Q A;  3APQ A;  4GCI A;  4YAP A;  3ISO A;  4KW6 A;  3I6A A;  4G10 A;  5D9W A;  2X99 A;  3GYK A;  4OCF A;  3TRX A;  3MDK A;  3QDN A;  4K7I A;  2MMA A;  5KN3 A;  4KF9 A;  1DE1 A;  4MAB A;  4N10 A;  1BAY A;  1BYE A;  1SYR A;  4XS1 A;  3PH9 A;  3F6D A;  4I6X A;  5LCZ A;  2X8H A;  2DLX A;  2CAI A;  1B9X C;  2C8U A;  1LU4 A;  4KDY A;  3D21 A;  2WZ9 A;  3RDW A;  4K5R A;  3M3M A;  1ZYP A;  3I43 A;  1SYX A;  2HZE B;  4IP1 A;  1U3I A;  3VWV A;  1HQO A;  2E2G A;  2YWN A;  3ZYW A;  16GS A;  3WGD A;  1X0R A;  2A4H A;  2DC5 A;  3FW2 A;  4OFT A;  4Q5N A;  4CW9 A;  4EVM A;  3KH9 A;  1YEP A;  3CYN A;  3GMF A;  7GSS A;  1A0R P;  4LL1 B;  1V2A A;  3CTG A;  5GAP D;  4O32 A;  1ZYN A;  2QKE A;  1XW5 A;  1LBK A;  1VF4 A;  4K1F A;  4CHS A;  1Z6N A;  5LNK e;  3LEF A;  4EDZ A;  2QA2 A;  1TXX A;  5D73 A;  4ICY A;  4IQA A;  2C80 A;  1YF1 A;  4YQM A;  1V98 A;  2V6O A;  3QAG A;  4ZIJ A;  2R6K A;  3U5R E;  2GGT A;  3TJF A;  2XC2 A;  3QR6 A;  2LST A;  1V40 A;  4K2D A;  3ZRD A;  5BRT A;  3GIX A;  2GQK A;  5CP1 A;  1GUL A;  4EF0 A;  1FVJ A;  1QQ2 A;  2KLX A;  2VL2 A;  1PA3 A;  1BX9 A;  1ZYE A;  1M3I A;  4ZBD A;  1VGL A;  5LD0 A;  3W6G A;  3LFL A;  1GSF A;  4AGS A;  3CTF A;  2TRX A;  2PBJ A;  5CRW A;  4J56 E;  5EVO A;  3CRU A;  2EC4 A;  2IWT A;  1X5C A;  3ED3 A;  2YJH A;  4IQ1 A;  3O76 A;  4LA1 A;  4X0X A;  3IC8 A;  3NOF A;  4GRF A;  3TKS E;  3BD2 A;  2M72 A;  3ZMK A;  1TP9 A;  1WMJ A;  5CRE A;  4BWS A;  5EL8 A;  4MMM A;  3IHQ A;  3I9V 2;  1GLQ A;  2R0C A;  3HKR A;  2AB6 A;  3GKX A;  1U88 A;  5G5E A;  2HYX A;  5H5S A;  3D4T A;  1SD9 A;  2CX4 A;  1UVZ A;  1THX A;  1AAZ A;  3EYT A;  3TKR A;  4TXV A;  3GTU B;  4N30 A;  1O73 A;  4K9Z A;  4KDX A;  1TK0 B;  4K7N A;  4KH7 A;  4MCU A;  5H5Q A;  1XOA A;  1TRV A;  2CZ3 A;  1S3C A;  2O89 A;  1EV9 A;  5IPG A;  3HVN A;  2H01 A;  4ISD A;  3GL3 A;  3ZVJ D;  1HNB A;  1N2A A;  2EIO A;  1MDI A;  1W4V A;  2G2Q A;  2L6D A;  5HFG A;  4ML1 A;  3DVW A;  5AIV A;  2EIQ A;  1T4Z A;  4J57 E;  2H75 A;  4DSS A;  2A2R A;  1XBS A;  1B8X A;  1PN0 A;  1WOU A;  5DQS A;  4BA7 A;  4GQF A;  4POK A;  8GSS A;  4TXO B;  4MJE A;  2ZUP A;  2BJX A;  2R2J A;  4HQZ A;  3UBK A;  5C04 A;  3WT1 A;  2KP1 A;  5C00 A;  3KMO A;  5IMF A;  1X5D A;  2VCX A;  2XBQ A;  1BED A;  3HD5 A;  3EUR A;  3CSI A;  3GH9 A;  4V2M A;  2LJK A;  4ZL8 A;  3H79 A;  1OC8 A;  4BPY A;  3MNG A;  2CVB A;  3GST A;  3ZZX A;  2P0G A;  2VUP A;  2C3Q A;  1DE2 A;  5G2Z A;  2OE3 A;  1WJK A;  2GQL A;  3KM6 A;  1XZO A;  3A5W A;  2X8G A;  1PL1 A;  1OC9 B;  3FRC A;  4ZIL A;  3LJR A;  1M3J A;  2F51 A;  2HRK A;  2IMD A;  3HJP A;  4I2U A;  3CSH A;  2LRN A;  1H4O A;  4HI7 A;  5ECN B;  3TKS A;  1V58 A;  4BIK A;  5F06 A;  1S3A A;  2GSR A;  1J0F A;  2DJ3 A;  3GKM A;  1R5A A;  5HR0 A;  3L9U A;  5B8A A;  5D9X A;  1TOF A;  2PGT A;  5ECM B;  3DML A;  1YF0 A;  3E0U A;  4FIW A;  2FWH A;  3MWH A;  1N8J A;  1G7O A;  3TUE A;  3IAM 2;  3C8E A;  2K8V A;  3D4M A;  3GRX A;  3IXR A;  10GS A;  4K2X A;  2B3S A;  4KCA A;  2LRT A;  2FWE A;  2OKA A;  5J9B A;  2YCD A;  2H0I A;  4G9H A;  3S9F A;  3H93 A;  1TRW A;  3IE3 A;  1TI1 A;  3IR4 A;  3QFA C;  4JR6 A;  3TJJ A;  2HZE A;  3ME8 A;  1QGV A;  3A5I A;  2V2G A;  4HZ4 A;  2OBK A;  3FZ4 A;  5AIS A;  5IM9 A;  2RUF A;  1ABA A;  3Q6O A;  4HS1 A;  4KUN A;  2Z9S A;  5DCH A;  5JWR B;  3QAV A;  3M0F A;  2GDR A;  1AQW A;  3HYP A;  4G19 A;  2B5Y A;  5J41 A;  3MSZ A;  4OO4 A;  2VOC A;  3TJG A;  2JZR A;  3DKS A;  4NV2 A;  1FW1 A;  4IN0 A;  3KTL A;  4IBP A;  4JBB A;  4XTS A;  2OE1 A;  6GSY A;  22GS A;  3A2V A;  2YAN A;  3VLN A;  1WE0 A;  1LJR A;  2GZY A;  1B48 A;  5ECL B;  2JU5 A;  3LW9 A;  3F4R A;  1TU7 A;  4RQX A;  4X43 A;  4HOJ A;  3UJ1 A;  4HU7 A;  2AHE A;  5IMZ A;  5B8B A;  2VL3 A;  3IBH A;  4YAV A;  2YZH A;  3GSS A;  1SL2 B;  5IQY A;  3UL3 A;  2IJY A;  1O8X A;  4YQV A;  2A4V A;  1KTE A;  4EXJ A;  1G0T A;  2RLI A;  3HHV A;  3FHK A;  1O7U A;  3F8U A;  2CV4 A;  1U6T A;  4TR3 A;  3DIE A;  3M1G A;  5E59 A;  1SJZ A;  1VF1 A;  1Y25 A;  4I97 A;  2YOI A;  6GSW A;  1EP8 A;  4RUV A;  2IMF A;  2L4C A;  2VCZ A;  2C3T A;  1M0U A;  1FG4 A;  4EDY A;  4IP6 A;  2B1K A;  4L0U A;  3TJB A;  5ECS A;  1SK0 A;  2FCH A;  4BVY B;  5DCG A;  4POB A;  1J08 A;  5IPH A;  1TW9 A;  1NHO A;  1EV4 A;  3G9B A;  2B1L A;  3QPM A;  2IIY A;  2VL9 A;  1GWC A;  3TOT A;  1CQH A;  4MA9 A;  3FK8 A;  2REM A;  2O87 A;  4G2E A;  5F8B A;  5BMU A;  4AF2 A;  5FT3 A;  1M7T A;  5G31 A;  1TK8 B;  5CAX A;  4WBR D;  2PUK C;  3GTU A;  2H1G A;  1X9M B;  4IS0 A;  4JR4 A;  5ECI B;  1SL1 B;  2X49 A;  3IK9 A;  4Q5Q A;  2CA8 A;  4HEA 2;  2CQ9 A;  2QGV A;  4N11 A;  3VK9 A;  3EPT A;  1YJ6 A;  3KJY A;  2YWO A;  1GUK A;  3PGT A;  3KP9 A;  3GX8 A;  1MD4 A;  2FLS A;  3L9S A;  5IMA A;  1ZYQ B;  4MP4 A;  1JHB A;  2E7P A;  2JZT A;  1MTC A;  1Q98 A;  3U6V A;  2L59 A;  4TXO A;  4EE0 A;  3GN3 A;  2P5R A;  3M8N A;  4HU9 A;  3FY7 A;  3KTB A;  2FUG 2;  2J23 A;  4FO5 A;  1SD8 A;  3TRP A;  1T4Y A;  5ELG A;  3KMN A;  4L5O A;  1M2B A;  4MJB A;  2VM1 A;  5FHI A;  3Q19 A;  1ZZY A;  4ECC A;  4QL7 A;  2DJJ A;  2I9H A;  2NPB A;  4PNF A;  4MDC A;  2H30 A;  4KX4 A;  3KZQ A;  2AYT A;  3P2A A;  4HUA A;  1WRY A;  2GSS A;  5J3R A;  3C7M A;  3EWL A;  5ECO B;  3MAK A;  2XPE A;  4GF0 A;  4RQR A;  1TRS A;  5D9V A;  20GS A;  1O85 A;  3BCK A;  3ERF A;  3TKQ A;  4BL7 B;  4V1A p;  3N5O A;  3DEX A;  2LNS A;  5A4W A;  1X5E A;  1YKA A;  2L5O A;  2F8F A;  4MH2 A;  3DYR A;  1OC9 A;  3ERW A;  3CMI A;  3J7Y b;  3GL5 A;  5HFK A;  3LQ7 A;  2X64 A;  4MF5 A;  1GSS A;  4RI7 A;  2MMO A;  3E9J B;  4K7O A;  2GTU A;  5J9C A;  4IKH A;  2IMK A;  3HZ4 A;  3PR8 A;  2QSI A;  4HSC X;  2H0G A;  1SL0 B;  3KP8 A;  5DAK B;  4WR4 A;  4ZB6 A;  2GVP A;  5IIZ A;  2R37 A;  3W8J A;  1K0M A;  1GSD A;  1OE7 A;  1OYJ A;  2UZ8 A;  4XS4 B;  4Q5F A;  1O6J A;  4GTU A;  1PRX A;  4DSR A;  2RM5 A;  4MNN A;  2C3N A;  5IOX A;  2N5F A;  4PUR A;  1T3B A;  1PQN A;  2K6V A;  5AIX A;  1BJX A;  4ACS A;  2ON5 A;  1XWK A;  4I5Q A;  5ECK B;  3AY8 A;  3VI5 A;  3G7I A;  3KH7 A;  4GXZ A;  4X1U A;  2RUE A;  3L9V A;  4XIH A;  1URM A;  4BVX B;  3APO A;  5F07 A;  3A2X A;  1GSQ A;  4WET A;  1M9B A;  4KA0 A;  5IMV A;  4PQH A;  1SKR B;  2VCQ A;  4OFM A;  4MZB A;  3VWX A;  3FMW A;  3HA9 A;  5IMD A;  1DBY A;  1UA5 A;  4TR0 A;  3P8W A;  2K18 A;  5DAL B;  3ME7 A;  2O7K A;  4G0K A;  4TN8 A;  1Q4J A;  2IN3 A;  3R3E A;  4FYC A;  2V6K A;  1ILO A;  3Q74 A;  4V2L A;  1TRU A;  3IRA A;  2L4Q A;  5CRD A;  1FO5 A;  3P90 A;  3L4N A;  3ZFB A;  4E8E A;  3K8N A;  3IAS 2;  4EC0 A;  4EO3 A;  1GH2 A;  3IDV A;  5F05 A;  5G1L A;  4XHM A;  2OBI A;  3H4K A;  3L0H A;  5KOX A;  1EEM A;  5H5R A;  3SWL A;  1WIK A;  3FEU A;  4GSN A;  1Z6M A;  4KE3 A;  2WGR A;  1O8W A;  4Z2U A;  4JED A;  4GST A;  3IOS A;  1MEK A;  2VD1 A;  4TR1 A;  2IFQ A;  1Z7P A;  3HVS A;  1PX7 A;  1AQV A;  5COH A;  2WCI A;  1K0B A;  1YEX A;  4K8M A;  1PSQ A;  1XOB A;  1V57 A;  5EY6 A;  1U3A A;  3W8S A;  2JSY A;  5KN2 A;  5CRH A;  2DBC A;  3GKN A;  2YJ7 A;  5B6M A;  1V9W A;  3BJ5 A;  3EE2 A;  4BVY A;  2H6Z A;  4OD7 A;  1KNG A;  2NBS A;  5A5K A;  1K3L A;  2VCW A;  2MMN A;  4OMV A;  12GS A;  2LQO A;  3UAR A;  1J9B A;  1SJI A;  3HJM A;  1XWB A;  2C4J A;  3KD0 A;  2GZP A;  2VL2 C;  5GAN D;  4MJC A;  2AJQ B;  2PER A;  3MYD A;  2DML A;  3KEB A;  3H1N A;  1PGT A;  4JRR A;  4RI6 A;  4F82 A;  1G6W A;  2PU9 C;  1T7P B;  1F37 A;  1QK8 A;  3QD9 A;  4FH8 A;  4K5S A;  1U87 A;  1ZCP A;  3FR6 A;  4P3Y B;  3LXZ A;  1FHE A;  2H0H A;  1EGO A;  3WD6 A;  1A23 A;  2FHE A;  2WRT A;  3NZN A;  2V41 A;  5J5N A;  1M9A A;  3GKK A;  3ERG A;  1A2L A;  4TOP A;  2GQM A;  3DVX A;  4NMU A;  5D93 A;  4F2I A;  2VD0 A;  1RW1 A;  3GV1 A;  1PKZ A;  1HNC A;  3G7Y A;  4Z2R A;  4ZBA A;  5IO0 A;  2NDO A;  1YY7 A;  5G30 A;  5DJM A;  3HVX A;  1TI3 A;  1K0N A;  5IMC A;  4TVE A;  4PXO A;  2ES7 A;  2P5Q A;  5ECR B;  3IA1 A;  2DJ2 A;  2E0Q A;  3EMX A;  2LTK A;  1DUG A;  2FD3 A;  2MZC A;  4EL1 A;  5DQY A;  3ZLP A;  2P31 A;  2FA4 A;  2BTO T;  5AGY A;  1FVK A;  1JZO A;  2JAC A;  2LUS A;  2VM2 A;  4NHZ A;  2PVO C;  1EGR A;  2JZS A;  1ON4 A;  3UBL A;  1K0A A;  1EP7 A;  3WGE A;  3LYK A;  3FYG A;  4BL7 A;  2WJU A;  4Z2T A;  5KEJ A;  1C72 A;  4ML6 A;  5GZZ B;  3CQF A;  2IL3 A;  3F3R A;  2HRA A;  4L0W A;  4ILF A;  4KB3 A;  3FZA A;  1K0D A;  5KOW A;  4MPF A;  1PX6 A;  2DJK A;  4AJ8 A;  3RHC A;  1B4Q A;  4HJ2 A;  4LMW A;  2HZF A;  4NPB A;  1TJD A;  5DAK A;  1R26 A;  2O8V B;  2AUV A;  4IGJ A;  1XFL A;  3IHG A;  4WF5 A;  2LRC A;  1GRX A;  4XS4 A;  1VF3 A;  4O92 A;  3C71 A;  1S3R A;  5KN0 A;  4JE1 A;  5D8I A;  3HZ8 A;  4EIP A;  2LJA A;  6GST A;  3WYW A;  1FOH A;  1GL8 A;  2F9S A;  3NIV A;  2J9H A;  3GFK A;  4I2T A;  5JCG A;  1GUH A;  3FZ5 A;  2H19 A;  3F6F A;  1ML6 A;  4CY6 A;  3TDG A;  3D22 A;  4KGI A;  3EMP A;  4BVX A;  3H8Q A;  18GS A;  4YQU A;  4LMV A;  1GLP A;  5ECQ B;  2LJR A;  4KCE A;  4MJA A;  1KEB A;  4PNG A;  4MZC A;  13GS A;  1ERU A;  2B5X A;  1R5P A;  3TKS C;  2GSQ A;  3F0I A;  4CDO A;  3UAP A;  5DAL A;  4POM A;  3DXB A;  2WFC A;  1E2Y A;  3JCM L;  1H75 A;  2M80 A;  1NW2 A;  4PGT A;  3HCZ A;  2H1D A;  2R4V A;  2KOK A;  3FR3 A;  3GH6 A;  3US3 A;  2I3Y A;  3I69 A;  3DGQ A;  4O5U A;  1A8Y A;  2YV9 A;  1EZK A;  4DSS B;  1UC7 A;  4ZL7 A;  2YWM A;  4DVC A;  3TCO A;  6GSS A;  4O5R A;  4MK3 A;  1SEN A;  1ERT A;  4KSM A;  2VAF A;  1PFO A;  2RII A;  2N5A A;  1F9M A;  3TJK A;  1OC3 A;  4N0V A;  4IEL A;  5B7C A;  2C0F A;  4ECB A;  1G6Y A;  3EVI A;  4PUF C;  1A2M A;  1SKS B;  1B9Y C;  1YKC A;  3RHB A;  3QMX A;  5JWQ B;  1G7E A;  2C0D A;  2MYG A;  1VRS D;  4GLT A;  1XWA A;  1XW6 A;  3C1S A;  1I9D A;  5L71 A;  4F0C A;  1HYU A;  3F63 A;  2OJL A;  2OA7 A;  2FWF A;  2NTO A;  5KN1 A;  4FYB A;  2R3X A;  3HDC A;  5HR1 A;  4Q5R A;  1JZR A;  1QFN A;  2H8L A;  4MZW A;  4ECJ A;  4MLY A;  3QCP A;  2ZNM A;  2VLV A;  5D96 A;  1RK4 A;  2WS2 A;  2V32 A;  4V2N A;  2MMZ A;  5CNW A;  5ABR A;  3BCI A;  4NWY A;  1XXU A;  1ZGN A;  2H1B A;  1WP0 A;  3TGZ A;  3UVH A;  3IC4 A;  4KAE A;  2H66 A;  2DKH A;  4YKF A;  4JU5 A;  1XWG A;  1MDJ A;  3D5J A;  4AJ6 A;  1ERW A;  3APS A;  2TIR A;  5ECP B;  5INY A;  4NHW A;  3RAZ A;  4FYU A;  3ZML A;  4HQS A;  1SK2 A;  5AN1 A;  5B6N A;  2H6X A;  2DJ1 A;  2DMM A;  4O7H A;  6GSV A;  4ZB8 A;  4OO5 A;  2KHP A;  4PQI A;  3VPQ A;  5JWO B;  4WXT A;  3ZTL A;  1NHY A;  4K6X A;  4F0B A;  1QXH A;  1OKD A;  1B4P A;  2X8C A;  1S3D A;  3QOU A;  4WF4 A;  3ZIT A;  5IOW A;  4ECI A;  1YDK A;  1PL2 A;  5HFI A;  1THO A;  3CXG A;  4IJI A;  3ZIJ A;  2LEG A;  1M2D A;  3IV4 A;  2XBI A;  1O81 A;  1TDI A;  3GUR A;  2LKU A;  4ULX A;  2C0G A;  2N5B A;  2I4A A;  4MH3 A;  2L6C A;  2R0G A;  4DEJ A;  1OE8 A;  5DJL A;  2CX3 A; 
#chains in the Genus database with same CATH homology
 1FOV A;  3ZFL A;  4XCS A;  1GP1 A;  2EIR A;  2VIM A;  5F0G A;  3ZRE A;  5G5F A;  1PKW A;  4IHU A;  3UIW A;  3WGX A;  2QC7 A;  2MBS A;  2B6M A;  3KXO A;  3M9J A;  1GSY A;  4V1A g;  4J2F A;  2VCV A;  2H76 A;  5A4V A;  1Z9H A;  2C0E A;  1R7H A;  2WB9 A;  4N0Z A;  1PMT A;  4GSS A;  3A3T A;  2TRC P;  2A2P A;  1GNE A;  2ZCT A;  3DD3 A;  5ECH B;  1OVN A;  2PPT A;  2FY6 A;  2WDU A;  3SBC A;  1ERV A;  1XPV A;  4X4J A;  1GSU A;  1K0C A;  3FR9 A;  1EOH A;  2KUC A;  3GNJ A;  3TB2 A;  1EOG A;  5ELA A;  2OAC A;  1F6M C;  4E8H A;  1AW9 A;  2LQQ A;  3PIN A;  3EU3 A;  1SKW B;  1XVQ A;  3J7Y k;  4PQ1 A;  3RBT A;  4USS A;  1M2A A;  4D73 B;  2DKI A;  5JCU A;  4H86 A;  3GHA A;  2GLR A;  4AJ7 A;  1CQG A;  2ALB A;  4HZ2 A;  4YKG A;  1TK5 B;  2G0F A;  2HXK A;  1XVW A;  4EUY A;  2LS5 A;  2O85 A;  4NXI A;  3LGC A;  17GS A;  5ID2 B;  1BG5 A;  2GZZ A;  2C1Y A;  1JZD A;  5E4W A;  2CAQ A;  2FWG A;  3Q18 A;  2M46 A;  4JZQ A;  5GST A;  1YQ1 A;  2PMT A;  4F9Z A;  3GUS A;  2MBT A;  3HJO A;  3TKP A;  1T00 A;  2HI7 A;  2B7J A;  1E6B A;  4PUA A;  4POL A;  2YWI A;  1QUW A;  5HR2 A;  2JL4 A;  4FQU A;  4KND A;  1NSW A;  5A4U A;  3CBU A;  3RPN A;  4DSQ A;  1MD3 A;  3CSJ A;  4TW5 A;  1FAA A;  4KSO A;  1YZX A;  3RPP A;  2VLU A;  4NV5 A;  4IJ3 A;  3LWA A;  2XHF A;  2HT9 A;  2PVQ A;  2YV7 A;  5CRG A;  2NVL A;  3GA4 A;  1M99 A;  3TOU A;  1XIY A;  2R0P A;  3CRT A;  1NM3 A;  3G7J A;  2AAW A;  2FA8 A;  2CVD A;  2H70 A;  4G0L A;  5CYY A;  19GS A;  4EKZ A;  4Z7X A;  3KGK A;  1IYH A;  1RQM A;  2FNO A;  4QQ7 A;  1KBN A;  2HRF A;  2FGX A;  3VI7 A;  2IME A;  1DSB A;  2L57 A;  4IVF A;  1F2E A;  1K3O A;  2HSM A;  1AUC A;  4HDE A;  1GUM A;  2YNX A;  1BQ7 A;  2X4A A;  1Z7R A;  1X9S B;  4XS6 A;  1VF2 A;  3QAW A;  3FKF A;  1GSE A;  1SJ6 A;  4XRD A;  3UMA A;  2HNL A;  1EWX A;  2GT5 A;  2KP2 A;  4WKW A;  1HD2 A;  1JZW A;  3D0Z A;  4GQC A;  2OAD A;  2JAD A;  1K3Y A;  1TTZ A;  2HSH A;  2ON7 A;  4WR5 A;  2L5L A;  2HRN A;  4LLR A;  3A2W A;  2BMX A;  4MF6 A;  5GSS A;  1EEJ A;  1XCC A;  1GNW A;  3HVV A;  3IK7 A;  3VWU A;  1OAZ A;  1HNA A;  3LOR A;  1X9W B;  2CVK A;  1OKT A;  3VWW A;  1ACV A;  2F8A A;  2H1A A;  1AIU A;  2GS3 A;  1A0F A;  2LV3 A;  4L5L A;  3WT2 A;  4EIQ A;  2GST A;  3MIX A;  5DBQ A;  3ZVJ A;  4O5Q A;  4WEY A;  3VFI A;  6GSU A;  5IO2 A;  1AXD A;  5HR3 A;  2HFD A;  3F4T A;  3QFB C;  1A2J A;  3TRQ A;  2QA1 A;  5J4U A;  3R2Q A;  2VO4 A;  4K0G A;  3UEM A;  3ZL5 A;  2WUL A;  1JLW A;  1ZMA A;  1Y6E A;  3PPU A;  3LXT A;  2GT6 A;  3KCM A;  2AV4 A;  4CY8 A;  2XPD A;  1WWJ A;  3UOM A;  2LNT A;  1GTA A;  2JSZ A;  1ZOF A;  3EIN A;  1Z3E A;  3E3E A;  4NAX A;  5CO3 A;  2H6Y A;  2YPM A;  1Z5Y E;  2YP6 A;  4GWR A;  2PWJ A;  3F4S A;  1F3B A;  2HLS A;  3L78 A;  3IPZ A;  1UN2 A;  11GS A;  5DVB A;  4TR4 A;  1K0O A;  2D2Z A;  1FB6 A;  5HQP A;  2F3M A;  4XRA A;  3BOA A;  4PTS A;  3D6I A;  1SU9 A;  3O6T A;  4LL4 B;  9GSS A;  2H74 A;  1A24 A;  1W89 A;  2V1M A;  3LSZ A;  4L8E A;  2DJ0 A;  1TU8 A;  1GTB A;  3M9K A;  4PX1 A;  1GTI A;  3ZIV A;  3LG6 A;  4TR1 B;  2IFQ B;  3O3T A;  1T1V A;  3C1R A;  4TKY A;  4A5P A;  3C73 A;  2I81 A;  3VUR A;  1R4W A;  2A2S A;  2IMI A;  4OCE A;  1ZL9 A;  2H73 A;  3HXS A;  6GSX A;  4ZXG A;  2K9F A;  3EU4 A;  5G1K A;  5FWG A;  3P7X A;  3OR5 A;  5EPF A;  2DIZ A;  2DIY A;  3KIJ A;  5DDL A;  4D73 A;  4I8B A;  1GTU A;  4MF7 A;  1JLV A;  2IPA A;  4WBJ A;  1QMV A;  3V1W A;  1ST9 A;  1SK1 A;  4IW9 A;  2YN1 A;  2H71 A;  5ID2 A;  3VPT A;  4G0I A;  1AC1 A;  1JFU A;  4ID0 A;  2H72 A;  2PN8 A;  2YZU A;  2VLT A;  4YH2 A;  2R5G A;  2HE3 A;  4OWY A;  5D9T A;  3HY2 A;  1PD2 1;  4TRX A;  1T8E B;  4K0N A;  3GX0 A;  1AQX A;  2OE0 A;  1MDK A;  4HJM A;  4MPG A;  2I1U A;  4F03 A;  5JCW A;  4QL9 A;  4ZB9 A;  14GS A;  2B5E A;  2CZ2 A;  5ENU A;  4ZL9 A;  3N9J A;  1TKD B;  3FZ9 A;  3DWV A;  1I5G A;  1FB0 A;  1XW9 A;  1IYI A;  2K8S A;  1USB A;  2E2M A;  2VCT A;  3EC3 A;  1F3A A;  3BBY A;  1A8L A;  4KDU A;  2DSA A;  1XWC A;  2RM6 A;  4OFN A;  2CT6 A;  3F9U A;  4BWQ A;  3LYP A;  1WPI A;  4ZBB A;  1PN9 A;  2B7K A;  3DRN A;  2HSY A;  3UVT A;  3F3Q A;  3APQ A;  4GCI A;  4YAP A;  3ISO A;  4KW6 A;  3I6A A;  4G10 A;  5D9W A;  2X99 A;  3GYK A;  4OCF A;  3TRX A;  3MDK A;  3QDN A;  4K7I A;  2MMA A;  5KN3 A;  4KF9 A;  1DE1 A;  4MAB A;  4N10 A;  1BAY A;  1BYE A;  1SYR A;  4XS1 A;  3PH9 A;  3F6D A;  4I6X A;  5LCZ A;  2X8H A;  2DLX A;  2CAI A;  1B9X C;  2C8U A;  1LU4 A;  4KDY A;  3D21 A;  2WZ9 A;  3RDW A;  4K5R A;  3M3M A;  1ZYP A;  3I43 A;  1SYX A;  2HZE B;  4IP1 A;  1U3I A;  3VWV A;  1HQO A;  2E2G A;  2YWN A;  3ZYW A;  16GS A;  3WGD A;  1X0R A;  2A4H A;  2DC5 A;  3FW2 A;  4OFT A;  4Q5N A;  4CW9 A;  4EVM A;  3KH9 A;  1YEP A;  3CYN A;  3GMF A;  7GSS A;  1A0R P;  4LL1 B;  1V2A A;  3CTG A;  5GAP D;  4O32 A;  1ZYN A;  2QKE A;  1XW5 A;  1LBK A;  1VF4 A;  4K1F A;  4CHS A;  1Z6N A;  5LNK e;  3LEF A;  4EDZ A;  2QA2 A;  1TXX A;  5D73 A;  4ICY A;  4IQA A;  2C80 A;  1YF1 A;  4YQM A;  1V98 A;  2V6O A;  3QAG A;  4ZIJ A;  2R6K A;  3U5R E;  2GGT A;  3TJF A;  2XC2 A;  3QR6 A;  2LST A;  1V40 A;  4K2D A;  3ZRD A;  5BRT A;  3GIX A;  2GQK A;  5CP1 A;  1GUL A;  4EF0 A;  1FVJ A;  1QQ2 A;  2KLX A;  2VL2 A;  1PA3 A;  1BX9 A;  1ZYE A;  4ZBD A;  1VGL A;  5LD0 A;  3W6G A;  3LFL A;  1GSF A;  4AGS A;  3CTF A;  2TRX A;  2PBJ A;  5CRW A;  4J56 E;  5EVO A;  3CRU A;  2EC4 A;  2IWT A;  1X5C A;  3ED3 A;  2YJH A;  4IQ1 A;  3O76 A;  4LA1 A;  4X0X A;  3IC8 A;  3NOF A;  4GRF A;  3TKS E;  3BD2 A;  2M72 A;  3ZMK A;  1TP9 A;  1WMJ A;  5CRE A;  4BWS A;  5EL8 A;  4MMM A;  3IHQ A;  3I9V 2;  1GLQ A;  2R0C A;  3HKR A;  2AB6 A;  3GKX A;  1U88 A;  5G5E A;  2HYX A;  5H5S A;  3D4T A;  1SD9 A;  2CX4 A;  1UVZ A;  1THX A;  1AAZ A;  3EYT A;  3TKR A;  4TXV A;  3GTU B;  4N30 A;  1O73 A;  4K9Z A;  4KDX A;  1TK0 B;  4K7N A;  4KH7 A;  4MCU A;  5H5Q A;  1XOA A;  1TRV A;  2CZ3 A;  1S3C A;  2O89 A;  1EV9 A;  5IPG A;  2H01 A;  4ISD A;  3GL3 A;  3ZVJ D;  1HNB A;  1N2A A;  2EIO A;  1MDI A;  1W4V A;  2G2Q A;  2L6D A;  5HFG A;  4ML1 A;  3DVW A;  5AIV A;  2EIQ A;  1T4Z A;  4J57 E;  2H75 A;  4DSS A;  2A2R A;  1XBS A;  1B8X A;  1PN0 A;  1WOU A;  5DQS A;  4BA7 A;  4GQF A;  4POK A;  8GSS A;  4TXO B;  4MJE A;  2ZUP A;  2BJX A;  2R2J A;  4HQZ A;  3UBK A;  5C04 A;  3WT1 A;  2KP1 A;  5C00 A;  3KMO A;  5IMF A;  1X5D A;  2VCX A;  2XBQ A;  1BED A;  3HD5 A;  3EUR A;  3CSI A;  3GH9 A;  4V2M A;  2LJK A;  4ZL8 A;  3H79 A;  1OC8 A;  4BPY A;  3MNG A;  2CVB A;  3GST A;  3ZZX A;  2P0G A;  2VUP A;  2C3Q A;  1DE2 A;  5G2Z A;  2OE3 A;  1WJK A;  2GQL A;  3KM6 A;  1XZO A;  3A5W A;  2X8G A;  1PL1 A;  1OC9 B;  3FRC A;  4ZIL A;  3LJR A;  2F51 A;  2HRK A;  2IMD A;  3HJP A;  4I2U A;  3CSH A;  2LRN A;  1H4O A;  4HI7 A;  5ECN B;  3TKS A;  1V58 A;  5F06 A;  1S3A A;  2GSR A;  1J0F A;  2DJ3 A;  3GKM A;  1R5A A;  5HR0 A;  3L9U A;  5B8A A;  5D9X A;  1TOF A;  2PGT A;  5ECM B;  3DML A;  1YF0 A;  3E0U A;  4FIW A;  2FWH A;  3MWH A;  1N8J A;  1G7O A;  3TUE A;  3IAM 2;  3C8E A;  2K8V A;  3D4M A;  3GRX A;  3IXR A;  10GS A;  4K2X A;  2B3S A;  4KCA A;  2LRT A;  2FWE A;  2OKA A;  5J9B A;  2YCD A;  2H0I A;  4G9H A;  3S9F A;  3H93 A;  1TRW A;  3IE3 A;  1TI1 A;  3IR4 A;  3QFA C;  4JR6 A;  3TJJ A;  2HZE A;  3ME8 A;  1QGV A;  3A5I A;  2V2G A;  4HZ4 A;  2OBK A;  3FZ4 A;  5AIS A;  5IM9 A;  2RUF A;  1ABA A;  3Q6O A;  4HS1 A;  4KUN A;  2Z9S A;  5DCH A;  5JWR B;  3QAV A;  3M0F A;  2GDR A;  1AQW A;  3HYP A;  4G19 A;  2B5Y A;  5J41 A;  3MSZ A;  4OO4 A;  2VOC A;  3TJG A;  2JZR A;  3DKS A;  4NV2 A;  1FW1 A;  4IN0 A;  3KTL A;  4IBP A;  4JBB A;  4XTS A;  2OE1 A;  6GSY A;  22GS A;  3A2V A;  2YAN A;  3VLN A;  1WE0 A;  1LJR A;  2GZY A;  1B48 A;  5ECL B;  2JU5 A;  3LW9 A;  3F4R A;  1TU7 A;  4RQX A;  4X43 A;  4HOJ A;  3UJ1 A;  4HU7 A;  2AHE A;  5IMZ A;  5B8B A;  2VL3 A;  3IBH A;  4YAV A;  2YZH A;  3GSS A;  1SL2 B;  5IQY A;  3UL3 A;  2IJY A;  1O8X A;  4YQV A;  2A4V A;  1KTE A;  4EXJ A;  1G0T A;  2RLI A;  3HHV A;  3FHK A;  1O7U A;  3F8U A;  2CV4 A;  1U6T A;  4TR3 A;  3DIE A;  3M1G A;  5E59 A;  1SJZ A;  1VF1 A;  1Y25 A;  4I97 A;  2YOI A;  6GSW A;  1EP8 A;  4RUV A;  2IMF A;  2L4C A;  2VCZ A;  2C3T A;  1M0U A;  1FG4 A;  4EDY A;  4IP6 A;  2B1K A;  4L0U A;  3TJB A;  5ECS A;  1SK0 A;  2FCH A;  4BVY B;  5DCG A;  4POB A;  1J08 A;  5IPH A;  1TW9 A;  1NHO A;  1EV4 A;  3G9B A;  2B1L A;  3QPM A;  2IIY A;  2VL9 A;  1GWC A;  3TOT A;  1CQH A;  4MA9 A;  3FK8 A;  2REM A;  2O87 A;  4G2E A;  5F8B A;  5BMU A;  4AF2 A;  5FT3 A;  1M7T A;  5G31 A;  1TK8 B;  5CAX A;  4WBR D;  2PUK C;  3GTU A;  2H1G A;  1X9M B;  4IS0 A;  4JR4 A;  5ECI B;  1SL1 B;  2X49 A;  3IK9 A;  4Q5Q A;  2CA8 A;  4HEA 2;  2CQ9 A;  2QGV A;  4N11 A;  3VK9 A;  3EPT A;  1YJ6 A;  3KJY A;  2YWO A;  1GUK A;  3PGT A;  3KP9 A;  3GX8 A;  1MD4 A;  2FLS A;  3L9S A;  5IMA A;  1ZYQ B;  4MP4 A;  1JHB A;  2E7P A;  2JZT A;  1MTC A;  1Q98 A;  3U6V A;  2L59 A;  4TXO A;  4EE0 A;  3GN3 A;  2P5R A;  3M8N A;  4HU9 A;  3FY7 A;  3KTB A;  2FUG 2;  2J23 A;  4FO5 A;  1SD8 A;  3TRP A;  1T4Y A;  5ELG A;  3KMN A;  4L5O A;  1M2B A;  4MJB A;  2VM1 A;  5FHI A;  3Q19 A;  1ZZY A;  4ECC A;  4QL7 A;  2DJJ A;  2I9H A;  2NPB A;  4PNF A;  4MDC A;  2H30 A;  4KX4 A;  3KZQ A;  2AYT A;  3P2A A;  4HUA A;  1WRY A;  2GSS A;  5J3R A;  3C7M A;  3EWL A;  5ECO B;  3MAK A;  2XPE A;  4GF0 A;  4RQR A;  1TRS A;  5D9V A;  20GS A;  1O85 A;  3BCK A;  3ERF A;  3TKQ A;  4BL7 B;  4V1A p;  3N5O A;  3DEX A;  2LNS A;  5A4W A;  1X5E A;  1YKA A;  2L5O A;  2F8F A;  4MH2 A;  3DYR A;  1OC9 A;  3ERW A;  3CMI A;  3J7Y b;  3GL5 A;  5HFK A;  3LQ7 A;  2X64 A;  4MF5 A;  1GSS A;  4RI7 A;  2MMO A;  3E9J B;  4K7O A;  2GTU A;  5J9C A;  4IKH A;  2IMK A;  3HZ4 A;  3PR8 A;  2QSI A;  2H0G A;  1SL0 B;  3KP8 A;  5DAK B;  4WR4 A;  4ZB6 A;  2GVP A;  5IIZ A;  2R37 A;  3W8J A;  1K0M A;  1GSD A;  1OE7 A;  1OYJ A;  2UZ8 A;  4XS4 B;  4Q5F A;  1O6J A;  4GTU A;  1PRX A;  4DSR A;  2RM5 A;  4MNN A;  2C3N A;  5IOX A;  2N5F A;  4PUR A;  1T3B A;  1PQN A;  2K6V A;  5AIX A;  1BJX A;  4ACS A;  2ON5 A;  1XWK A;  4I5Q A;  5ECK B;  3AY8 A;  3VI5 A;  3G7I A;  3KH7 A;  4GXZ A;  4X1U A;  2RUE A;  3L9V A;  4XIH A;  1URM A;  4BVX B;  3APO A;  5F07 A;  3A2X A;  1GSQ A;  4WET A;  1M9B A;  4KA0 A;  5IMV A;  4PQH A;  1SKR B;  2VCQ A;  4OFM A;  4MZB A;  3VWX A;  3FMW A;  3HA9 A;  5IMD A;  1DBY A;  1UA5 A;  4TR0 A;  3P8W A;  2K18 A;  5DAL B;  3ME7 A;  2O7K A;  4G0K A;  4TN8 A;  1Q4J A;  2IN3 A;  3R3E A;  4FYC A;  2V6K A;  1ILO A;  3Q74 A;  4V2L A;  1TRU A;  3IRA A;  2L4Q A;  5CRD A;  1FO5 A;  3P90 A;  3L4N A;  3ZFB A;  4E8E A;  3K8N A;  3IAS 2;  4EC0 A;  4EO3 A;  1GH2 A;  3IDV A;  5F05 A;  5G1L A;  4XHM A;  2OBI A;  3H4K A;  3L0H A;  5KOX A;  1EEM A;  5H5R A;  3SWL A;  1WIK A;  3FEU A;  4GSN A;  1Z6M A;  4KE3 A;  2WGR A;  1O8W A;  4Z2U A;  4JED A;  4GST A;  3IOS A;  1MEK A;  2VD1 A;  4TR1 A;  2IFQ A;  1Z7P A;  3HVS A;  1PX7 A;  1AQV A;  5COH A;  2WCI A;  1K0B A;  1YEX A;  4K8M A;  1PSQ A;  1XOB A;  1V57 A;  5EY6 A;  1U3A A;  3W8S A;  2JSY A;  5KN2 A;  5CRH A;  2DBC A;  3GKN A;  2YJ7 A;  5B6M A;  1V9W A;  3BJ5 A;  3EE2 A;  4BVY A;  2H6Z A;  4OD7 A;  1KNG A;  2NBS A;  5A5K A;  1K3L A;  2VCW A;  2MMN A;  4OMV A;  12GS A;  2LQO A;  3UAR A;  1J9B A;  1SJI A;  3HJM A;  1XWB A;  2C4J A;  3KD0 A;  2GZP A;  2VL2 C;  5GAN D;  4MJC A;  2AJQ B;  2PER A;  3MYD A;  2DML A;  3KEB A;  3H1N A;  1PGT A;  4JRR A;  4RI6 A;  4F82 A;  1G6W A;  2PU9 C;  1T7P B;  1F37 A;  1QK8 A;  3QD9 A;  4FH8 A;  4K5S A;  1U87 A;  1ZCP A;  3FR6 A;  4P3Y B;  3LXZ A;  1FHE A;  2H0H A;  1EGO A;  3WD6 A;  1A23 A;  2FHE A;  2WRT A;  3NZN A;  2V41 A;  5J5N A;  1M9A A;  3GKK A;  3ERG A;  1A2L A;  4TOP A;  2GQM A;  3DVX A;  4NMU A;  5D93 A;  4F2I A;  2VD0 A;  1RW1 A;  3GV1 A;  1PKZ A;  1HNC A;  3G7Y A;  4Z2R A;  4ZBA A;  5IO0 A;  2NDO A;  1YY7 A;  5G30 A;  5DJM A;  3HVX A;  1TI3 A;  1K0N A;  5IMC A;  4TVE A;  4PXO A;  2ES7 A;  2P5Q A;  5ECR B;  3IA1 A;  2DJ2 A;  2E0Q A;  3EMX A;  2LTK A;  1DUG A;  2FD3 A;  2MZC A;  4EL1 A;  5DQY A;  3ZLP A;  2P31 A;  2FA4 A;  2BTO T;  5AGY A;  1FVK A;  1JZO A;  2JAC A;  2LUS A;  2VM2 A;  4NHZ A;  2PVO C;  1EGR A;  2JZS A;  1ON4 A;  3UBL A;  1K0A A;  1EP7 A;  3WGE A;  3LYK A;  3FYG A;  4BL7 A;  2WJU A;  4Z2T A;  5KEJ A;  1C72 A;  4ML6 A;  5GZZ B;  2IL3 A;  3F3R A;  2HRA A;  4L0W A;  4ILF A;  4KB3 A;  3FZA A;  1K0D A;  5KOW A;  4MPF A;  1PX6 A;  2DJK A;  4AJ8 A;  3RHC A;  1B4Q A;  4HJ2 A;  4LMW A;  2HZF A;  4NPB A;  1TJD A;  5DAK A;  1R26 A;  2O8V B;  2AUV A;  4IGJ A;  1XFL A;  3IHG A;  4WF5 A;  2LRC A;  1GRX A;  4XS4 A;  1VF3 A;  4O92 A;  3C71 A;  5KN0 A;  4JE1 A;  5D8I A;  3HZ8 A;  4EIP A;  2LJA A;  6GST A;  3WYW A;  1FOH A;  1GL8 A;  2F9S A;  3NIV A;  2J9H A;  3GFK A;  4I2T A;  5JCG A;  1GUH A;  3FZ5 A;  2H19 A;  3F6F A;  1ML6 A;  4CY6 A;  3TDG A;  3D22 A;  4KGI A;  3EMP A;  4BVX A;  3H8Q A;  18GS A;  4YQU A;  4LMV A;  1GLP A;  5ECQ B;  2LJR A;  4KCE A;  4MJA A;  1KEB A;  4PNG A;  4MZC A;  13GS A;  1ERU A;  2B5X A;  1R5P A;  3TKS C;  2GSQ A;  3F0I A;  4CDO A;  3UAP A;  5DAL A;  4POM A;  3DXB A;  2WFC A;  1E2Y A;  3JCM L;  1H75 A;  2M80 A;  1NW2 A;  4PGT A;  3HCZ A;  2H1D A;  2R4V A;  2KOK A;  3FR3 A;  3GH6 A;  3US3 A;  2I3Y A;  3I69 A;  3DGQ A;  4O5U A;  1A8Y A;  2YV9 A;  1EZK A;  4DSS B;  1UC7 A;  4ZL7 A;  2YWM A;  4DVC A;  3TCO A;  6GSS A;  4O5R A;  4MK3 A;  1SEN A;  1ERT A;  4KSM A;  2VAF A;  2RII A;  2N5A A;  1F9M A;  3TJK A;  1OC3 A;  4N0V A;  4IEL A;  5B7C A;  2C0F A;  4ECB A;  1G6Y A;  3EVI A;  4PUF C;  1A2M A;  1SKS B;  1B9Y C;  1YKC A;  3RHB A;  3QMX A;  5JWQ B;  1G7E A;  2C0D A;  2MYG A;  1VRS D;  4GLT A;  1XWA A;  1XW6 A;  3C1S A;  1I9D A;  5L71 A;  4F0C A;  1HYU A;  3F63 A;  2OJL A;  2OA7 A;  2FWF A;  2NTO A;  5KN1 A;  4FYB A;  2R3X A;  3HDC A;  5HR1 A;  4Q5R A;  1JZR A;  1QFN A;  2H8L A;  4MZW A;  4ECJ A;  4MLY A;  3QCP A;  2ZNM A;  2VLV A;  5D96 A;  1RK4 A;  2WS2 A;  2V32 A;  4V2N A;  2MMZ A;  5CNW A;  5ABR A;  3BCI A;  4NWY A;  1XXU A;  1ZGN A;  2H1B A;  1WP0 A;  3TGZ A;  3UVH A;  3IC4 A;  4KAE A;  2H66 A;  2DKH A;  4YKF A;  4JU5 A;  1XWG A;  1MDJ A;  3D5J A;  4AJ6 A;  1ERW A;  3APS A;  2TIR A;  5ECP B;  5INY A;  4NHW A;  3RAZ A;  4FYU A;  3ZML A;  4HQS A;  1SK2 A;  5AN1 A;  5B6N A;  2H6X A;  2DJ1 A;  2DMM A;  4O7H A;  6GSV A;  4ZB8 A;  4OO5 A;  2KHP A;  4PQI A;  3VPQ A;  5JWO B;  4WXT A;  3ZTL A;  1NHY A;  4K6X A;  4F0B A;  1QXH A;  1OKD A;  1B4P A;  2X8C A;  1S3D A;  3QOU A;  4WF4 A;  3ZIT A;  5IOW A;  4ECI A;  1YDK A;  1PL2 A;  5HFI A;  1THO A;  3CXG A;  4IJI A;  3ZIJ A;  2LEG A;  1M2D A;  3IV4 A;  2XBI A;  1O81 A;  1TDI A;  3GUR A;  2LKU A;  4ULX A;  2C0G A;  2N5B A;  2I4A A;  4MH3 A;  2L6C A;  2R0G A;  4DEJ A;  1OE8 A;  5DJL A;  2CX3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...