1FVJA

The 2.06 angstrom structure of the h32y mutant of the disulfide bond formation protein (dsba)
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
188
structure length
188
Chain Sequence
AQYEDGKQYTTLEKPVAGAPQVLEFFSFFCPYCYQFEEVLHISDNVKKKLPEGVKMTKYHVNFMGGDLGKDLTQAWAVAMALGVEDKVTVPLFEGVQKTQTIRSASDIRDVFINAGIKGEEYDAAWNSFVVKSLVAQQEKAAADVQLRGVPAMFVNGKYQLNPQGMDTSNMDVFVQQYADTVKYLSEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Disulfide oxidoreductase
molecule keywords DISULFIDE BOND FORMATION PROTEIN
publication title Structural analysis of three His32 mutants of DsbA: support for an electrostatic role of His32 in DsbA stability.
pubmed rcsb
source organism Escherichia coli
total genus 66
structure length 188
sequence length 188
chains with identical sequence B
ec nomenclature
pdb deposition date 1996-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01323 DSBA DSBA-like thioredoxin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1fvjA00
2LRCA 3M3MA 3H79A 4LMVA 2VAFA 1HNCA 5DAKA 2HRNA 4GQFA 2VLTA 3CSIA 3GX0A 1ABAA 3EMXA 3TJFA 1VF2A 3HJPA 4YQVA 3TJGA 4ZBDA 1OYJA 4WXTA 1WPIA 1G6WA 4IBPA 3US3A 4WBRD 5GAPD 1TDIA 1BQ7A 3H93A 5CRDA 4MABA 3FR6A 3HZ4A 1JLVA 2B5XA 2HZEB 5F05A 1Z5YE 1GULA 2VIMA 5KN2A 4KSOA 4KDUA 2YP6A 1Q4JA 5JWOB 3BJ5A 3TB2A 4F2IA 2CZ2A 2E7PA 16GSA 3DGQA 1S3AA 3TKSC 2DIYA 1TI3A 4KDYA 3DVXA 3ZMKA 3K8NA 2HSYA 2YPMA 4K9ZA 4Q5RA 3D5JA 1F3AA 1GSQA 5J9BA 2V41A 1ZYQB 3VWVA 5B6NA 1K0DA 3KTLA 3V1WA 1ACVA 3KTBA 1S3CA 4GSNA 4K0GA 4HZ4A 3WGXA 5IO0A 1FOVA 3WGDA 3R2QA 5JWQB 3GSTA 1J0FA 1LJRA 1J08A 5IMCA 4EDZA 3EC3A 1UA5A 2N5FA 1AC1A 4OFMA 1RK4A 2GDRA 1X5DA 20GSA 3GKNA 4J2FA 2WFCA 2PUKC 2E0QA 5A4VA 1SJIA 4RQRA 2R6KA 4BVXA 3CTFA 1GH2A 6GSYA 1Q98A 4HEA2 5E59A 2MMOA 5D9TA 5LCZA 3U6VA 2PWJA 5ELGA 1K0BA 5CYYA 2XBIA 1EOGA 4Q5NA 5GZZB 5ECQB 1MD4A 2FY6A 5AGYA 2DSAA 3IXRA 4NV2A 2DJ2A 4PGTA 3IE3A 4IQAA 2JU5A 3HCZA 2V6OA 2VL9A 3AY8A 5DQSA 4QL9A 4X0XA 1EV9A 1NHOA 2VM2A 3EURA 4MJCA 5F8BA 2NVLA 2K6VA 1SKWB 1YF1A 2H66A 3M1GA 3LG6A 2C4JA 2WDUA 5IPGA 4G9HA 1XZOA 3IC4A 1LBKA 1T7PB 3FZ4A 2BJXA 3F63A 2K18A 2GLRA 3HHVA 4KGIA 3ZIVA 4XRDA 1JZWA 1SYXA 2EC4A 2HRFA 3GV1A 1BG5A 4XIHA 4NXIA 2PVQA 4DEJA 4V1Ag 2C0EA 2KP1A 3HVSA 3TRXA 1NW2A 4I97A 1DE2A 2B6MA 2X8GA 5G2ZA 3PINA 2KUCA 2X99A 3DKSA 3DIEA 5INYA 2B5YA 4TXVA 1GSFA 2O7KA 1XW9A 1KBNA 3NOFA 5B6MA 2DJJA 3D4MA 1V40A 2E2MA 1XWAA 5DDLA 1SKSB 1JFUA 1A0RP 2DJ3A 4KUNA 4ZILA 2CV4A 4QQ7A 3IK9A 3ZLPA 3DYRA 4L8EA 1N2AA 2J23A 1MTCA 2CX4A 2H8LA 4PX1A 4KA0A 1YQ1A 3KH9A 3TJKA 4CHSA 1YEPA 4XCSA 4KB3A 3F0IA 3QD9A 5G30A 1OC3A 4POBA 3GTUB 1F3BA 1X5CA 2H71A 2YN1A 4I2UA 3ZYWA 4AF2A 5B8AA 2GTUA 3LFLA 3HYPA 6GSVA 5DALA 4WF5A 7GSSA 1TK8B 5G31A 1FHEA 3GH6A 3EE2A 2ZUPA 1WIKA 2IMFA 3A5WA 5D96A 1K0OA 3IRAA 3QCPA 4LL1B 5CP1A 1ERTA 3KIJA 2LRNA 1O7UA 4DSRA 1ON4A 3ZZXA 1Y6EA 2AUVA 2RUEA 4F0CA 3APOA 3DRNA 3CBUA 4HZ2A 5D8IA 19GSA 3UEMA 3EYTA 1K0NA 4KCAA 4NWYA 1Z6NA 5DBQA 1XFLA 4ECIA 2PGTA 2K8VA 3L0HA 4RUVA 2H6XA 2DLXA 2C3NA 1THXA 3FEUA 3M8NA 2FA4A 3IV4A 3RAZA 4E8EA 3HKRA 2P31A 3FR3A 2B1KA 2P5RA 2DBCA 3EU4A 5AIVA 1FG4A 2H73A 3FYGA 5IMZA 1GP1A 3G7IA 4N10A 3TKPA 3BCIA 4MK3A 1G7EA 3VK9A 3BBYA 4ML1A 2CQ9A 4O5RA 2G0FA 1XWCA 5HR2A 1ZL9A 3WD6A 2HI7A 4MF5A 2MBTA 2WULA 2LNSA 3ZTLA 4GCIA 4TKYA 5D9WA 5G5EA 3IBHA 2RIIA 4F82A 2MYGA 3ERWA 3KXOA 1C72A 5FHIA 3I6AA 2ZCTA 1OKTA 1IYHA 4NPBA 1JZDA 1TJDA 5ECIB 2LV3A 3D6IA 5D93A 2LJAA 2FUG2 3M0FA 4K1FA 2WRTA 2R4VA 2H70A 4GF0A 1U88A 3LEFA 2VCQA 2HFDA 3ZFBA 4Z7XA 5DJMA 2GSRA 4I6XA 5G1LA 2YWIA 5ECSA 4XS6A 2YWMA 5LD0A 5CRGA 5DJLA 5HFIA 5FT3A 2YZHA 2L4QA 4TR1A 1LU4A 3EWLA 1TW9A 2R3XA 1XXUA 2H0HA 3RHBA 2M72A 5ECKB 3C1SA 5COHA 3PR8A 2J9HA 2NTOA 2H30A 5H5SA 2RM5A 2DC5A 1B4PA 5CRWA 4I8BA 1AXDA 4KX4A 5B7CA 4PQIA 3KGKA 3L9SA 1A2MA 3W8SA 1GTIA 2P0GA 2YWNA 2VM1A 4X43A 2H76A 3IPZA 3ISOA 2CVBA 3HXSA 2CA8A 1AQWA 1A23A 3QMXA 3VI7A 3EVIA 2RM6A 3A2WA 1FW1A 4IQ1A 3I43A 3VWXA 1GSYA 2PU9C 4TRXA 2LQOA 4G2EA 3LYKA 1EZKA 3UARA 1TU7A 2BTOT 4HQSA 2FWHA 2P5QA 5KEJA 5DVBA 2HYXA 5DCHA 3JCML 3NZNA 1GUKA 3GYKA 2D2ZA 5ECRB 1VRSD 3C8EA 1SD9A 2XPDA 18GSA 4EC0A 3UVTA 5J5NA 5D9XA 3DXBA 2HSHA 4TVEA 1X5EA 1GRXA 3F3RA 2C1YA 4N11A 2CVDA 1EEJA 4L5OA 1ERUA 1Z7RA 2LEGA 4ISDA 4IELA 3QAWA 3F8UA 5HQPA 14GSA 4MH2A 1X9WB 3LXZA 3MWHA 2VUPA 3GKXA 3VWWA 3DVWA 2B5EA 2EIRA 3D22A 5ID2A 2LRTA 4PUFC 2B1LA 4D73A 2GT5A 3Q19A 1AW9A 3KMNA 3TRPA 2GGTA 5LNKe 2IFQA 1E6BA 2DJKA 1PKZA 4JE1A 3L4NA 12GSA 2JZRA 1K0CA 2HLSA 2RLIA 1W89A 5IOWA 4LL4B 1XWBA 2VO4A 13GSA 1FO5A 1XW5A 4JU5A 2YNXA 3EU3A 2IJYA 2HXKA 1E2YA 4GSSA 3RPPA 3Q18A 3TUEA 4AJ7A 2GZPA 4ZL9A 3MAKA 1R5PA 2VCVA 1T8EB 1KNGA 4CW9A 2O85A 4BA7A 3IHQA 1SU9A 4GXZA 3KP8A 3UMAA 3NIVA 3N9JA 2H19A 3J7Yk 4TW5A 2TRXA 2YV7A 2V6KA 4KE3A 2A2SA 3ME7A 6GSUA 2MMNA 4OFNA 3QDNA 5EVOA 4XS4B 3I69A 1B9YC 4MA9A 5KN3A 2LQQA 4K2DA 3N5OA 3TGZA 5AISA 3HZ8A 1VF1A 1A24A 3ZMLA 1R7HA 2VCZA 1PMTA 3U5RE 4BWQA 4FYBA 1T1VA 2PERA 3C7MA 4V1Ap 1SL1B 3LSZA 2YZUA 1F37A 2R2JA 4ECJA 2HZEA 3TKSA 2GZYA 4CDOA 1G6YA 1V58A 3HDCA 1X0RA 2OJLA 1BYEA 3GFKA 3TKRA 1NHYA 2VD0A 2I1UA 4V2LA 4DSSB 3OR5A 5IM9A 4K7OA 2DJ1A 1JLWA 1ERVA 1UC7A 3W6GA 3LJRA 3GIXA 1PA3A 2AB6A 2AYTA 1KTEA 3MNGA 2R37A 3GRXA 2H0GA 1PGTA 4EXJA 1M2DA 1WWJA 1M0UA 3WGEA 2L6CA 1XOBA 4MMMA 4O7HA 4JBBA 1MEKA 2K8SA 2MZCA 3IA1A 3ZRDA 1PX6A 2WGRA 1FB0A 4XS1A 1SL0B 3IAS2 1ZMAA 4ECCA 1A2LA 2RUFA 4TN8A 1XW6A 1O85A 1PN9A 2IMKA 1A0FA 3PGTA 2G2QA 4FYUA 3P7XA 2V32A 2A4VA 2VOCA 5D9VA 3D21A 4HS1A 2YJHA 1V2AA 4N0VA 1ZYEA 1SK1A 3GL3A 1GSEA 4DSQA 2OE0A 2AAWA 3GSSA 1AQVA 8GSSA 2GSSA 2GQKA 4NV5A 1TRSA 5GSTA 3FW2A 1USBA 4YQUA 4POKA 2H01A 4MP4A 5J9CA 5IOXA 2C8UA 3TKQA 2KOKA 1FVJA 3SWLA 2GQMA 4OMVA 3CSHA 3J7Yb 1PX7A 4YAPA 3IK7A 2NBSA 2H72A 5F06A 1EWXA 2CVKA 3M9KA 1EV4A 2YJ7A 3VPQA 1YKCA 4F9ZA 3KM6A 4MZWA 1A2JA 1YJ6A 2PPTA 2GS3A 4POMA 1Z6MA 4RQXA 4ZB9A 3CRUA 2YWOA 4AGSA 2IIYA 4JRRA 3CRTA 3G7JA 4EF0A 3E0UA 2IN3A 1EGRA 2ON7A 2PMTA 3L78A 1TU8A 1DSBA 5HR3A 2FLSA 5CRHA 4OO4A 2C0GA 2IPAA 3TOUA 2VLUA 4IP6A 4H86A 1WRYA 1RQMA 5F07A 4N0ZA 1EP7A 1W4VA 2OACA 2IL3A 3UJ1A 1DBYA 5KN0A 3TCOA 1U87A 3O3TA 3MSZA 5H5QA 2TIRA 1R26A 2ALBA 2XC2A 1H75A 3RPNA 4MPGA 4BPYA 4KDXA 3GX8A 3L9UA 3C1RA 4P3YB 4WBJA 1XVWA 2K9FA 2OBKA 1GSDA 3HJOA 3HJMA 2IMEA 2CX3A 2JSYA 4ZIJA 4XHMA 4TXOB 1URMA 4Q5FA 4ACSA 1F9MA 2LJKA 4JZQA 1G7OA 2FA8A 3IR4A 2MMAA 2C3QA 3GTUA 2MMZA 4EE0A 3BOAA 1YDKA 1GL8A 1TTZA 4PQ1A 3EMPA 4XTSA 1T4ZA 4ILFA 2KP2A 3H4KA 2HE3A 5EY6A 1HNBA 4K6XA 1PQNA 1GUMA 2YCDA 4TR3A 4IVFA 1AQXA 1ZZYA 3UAPA 1B4QA 1GSSA 2I4AA 3WT2A 5A4WA 5DAKB 4KH7A 3F4RA 4EUYA 1TRWA 1YKAA 1BEDA 3UL3A 1FAAA 1MDKA 4GSTA 1XPVA 2VLVA 1SK2A 1DUGA 2OADA 4KW6A 2NPBA 1I9DA 6GSWA 2N5BA 2HZFA 1M99A 4MDCA 3VFIA 1WE0A 4E8HA 4WR4A 4HOJA 2GVPA 1J9BA 17GSA 3GNJA 4PXOA 5IMVA 4X1UA 4GRFA 3DMLA 1WOUA 3KD0A 4QL7A 3HD5A 2C3TA 1EP8A 3UOMA 4WF4A 1V57A 2A2RA 3VI5A 3LQ7A 4KSMA 1WJKA 4PUAA 3A2VA 3APQA 2DIZA 2ON5A 2LUSA 4NHZA 1O6JA 1SJ6A 3Q6OA 1F2EA 3CSJA 2LSTA 4F0BA 5J41A 1SKRB 4IJ3A 4PNGA 4JR4A 4ZL7A 1YZXA 3FZ5A 3E3EA 1RW1A 5B8BA 4OCEA 2VD1A 1ZGNA 2PN8A 4JEDA 1HQOA 3F4TA 4PURA 1K3OA 1VF3A 1Z3EA 1UN2A 1JZRA 4IJIA 4MCUA 1PL2A 3GURA 3HVXA 2C0DA 2QGVA 5ECLB 4EDYA 2JACA 1B9XC 2H6YA 1B48A 1Z9HA 5JWRB 2REMA 3F6FA 1SD8A 2X8CA 2AHEA 2WS2A 4MPFA 4OWYA 1U3AA 4GTUA 9GSSA 2I9HA 4LMWA 4NMUA 4LLRA 3KP9A 1S3DA 4TR4A 5E4WA 3ZL5A 2DMLA 11GSA 2IMIA 3GH9A 5CO3A 2H1BA 2L4CA 3KEBA 2H0IA 3KCMA 1YF0A 3LWAA 4IHUA 4Q5QA 4WR5A 1AIUA 3GL5A 1EOHA 1R4WA 3RDWA 6GSXA 5KN1A 5HFKA 3TJJA 2JZTA 2R5GA 4ML6A 1ZOFA 1TK5B 2EIOA 2XPEA 3H1NA 1OKDA 22GSA 5CAXA 4XRAA 1ERWA 2JADA 5IMDA 4ID0A 1B8XA 2DJ0A 2GQLA 5JCGA 2OA7A 1FB6A 2WB9A 1OVNA 4G19A 3I9V2 2OBIA 3A3TA 1ML6A 3LXTA 5DCGA 3L9VA 4NHWA 2C0FA 3C71A 2IMDA 5ECHB 1MDJA 2XHFA 1T00A 4L0UA 1O81A 2I81A 1TKDB 2Z9SA 5HR0A 2YV9A 5ELAA 2H6ZA 3DD3A 2H74A 1T3BA 1GLPA 2VCTA 2H75A 4PQHA 1U6TA 3F9UA 4YQMA 1PSQA 2L57A 5A4UA 4HU7A 1O73A 5IPHA 2B3SA 2B7KA 1K3YA 1OC9B 3FKFA 5F0GA 1TI1A 3GA4A 1XOAA 2OKAA 3ED3A 2JSZA 2QC7A 3EINA 2L5OA 4ZL8A 1XBSA 1ST9A 4HDEA 2LJRA 1X9SB 2HT9A 5HFGA 4K7IA 2FWGA 4EO3A 1NM3A 3ERFA 1GNEA 2XBQA 2GSTA 1XCCA 2WZ9A 1GWCA 4ZXGA 3HA9A 1XWKA 2CAQA 1QXHA 4ULXA 1BX9A 1XVQA 4ZBBA 4K7NA 2H1DA 3GKKA 4HUAA 2O8VB 3FY7A 5JCWA 1O8XA 3QPMA 1M9BA 5H5RA 5DALB 4AJ8A 1PL1A 3RBTA 3KJYA 3QAVA 2M46A 1EEMA 1KEBA 1AAZA 1XIYA 3GMFA 4OD7A 4OFTA 1QFNA 4MH3A 1SYRA 2GT6A 1K3LA 2F51A 3QAGA 5ECMB 4BWSA 4HJ2A 3IDVA 1V9WA 3ZITA 3S9FA 1ILOA 1BAYA 1ZCPA 1QK8A 2TRCP 4N30A 2KHPA 4FO5A 3DWVA 3ZVJD 2ES7A 5C04A 1BJXA 2WCIA 2I3YA 4WEYA 5GAND 3C73A 4MF7A 2VCWA 1TP9A 1QGVA 2FCHA 1YEXA 3QFAC 5IQYA 5AN1A 1M2BA 1QUWA 2H1AA 4BL7A 5G5FA 6GSTA 1OE7A 4XS4A 3QFBC 2C80A 4F03A 1YY7A 2AV4A 3ME8A 4L0WA 3LYPA 2CAIA 3CYNA 1DE1A 2AJQB 5EL8A 1OC9A 3VLNA 3HVVA 3QR6A 3VURA 3GN3A 4WETA 4HI7A 4O92A 4K0NA 4MJAA 4ZB6A 1N8JA 1Y25A 3APSA 3FHKA 1I5GA 1V98A 1M2AA 2X64A 1HYUA 3UVHA 4RI6A 5ABRA 3KMOA 5J4UA 4MF6A 3DEXA 3IOSA 2F3MA 3D4TA 1GNWA 1GSUA 3FZAA 3D0ZA 10GSA 3VWUA 4DSSA 2H1GA 2KLXA 2NDOA 5HR1A 2N5AA 3ZVJA 1U3IA 3F6DA 3G9BA 4J57E 4MZCA 4YH2A 4ZBAA 2LTKA 4FIWA 1TXXA 2YOIA 4MJEA 2L5LA 2LS5A 3F3QA 4EKZA 3O6TA 3BD2A 1WMJA 4L5LA 4BVYA 4RI7A 5ECPB 3WYWA 4JR6A 3ZREA 2F8FA 4MLYA 2CZ3A 1T4YA 5GSSA 1AUCA 1G0TA 3Q74A 3UBKA 2B7JA 5D73A 4O32A 1OE8A 1TK0B 2DMMA 1SL2B 1GTBA 1GTAA 2FNOA 4OCFA 4KAEA 1K0AA 4ECBA 1Z7PA 4IP1A 4TR1B 1EGOA 2X8HA 2F8AA 5DQYA 1F6MC 1JHBA 2O87A 5EPFA 2L6DA 2VCXA 4ZB8A 3UBLA 4POLA 4GQCA 5IIZA 3TJBA 2YANA 1HNAA 4HQZA 1PKWA 3P90A 4I2TA 2FWFA 4J56E 3O76A 2VL2C 3A2XA 4YAVA 1K0MA 4IKHA 2FD3A 5A5KA 5IMAA 1MD3A 4IW9A 2PBJA 1OC8A 5J3RA 5FWGA 1FVKA 2EIQA 5IO2A 2ZNMA 5ECOB 4KNDA 2OE1A 2HNLA 3W8JA 3H8QA 1MDIA 4LA1A 3GUSA 3FRCA 3UIWA 3KH7A 5CNWA 2FHEA 2LKUA 4GWRA 1NSWA 1QQ2A 1SJZA 3TDGA 3SBCA 2IWTA 5G1KA 3HY2A 3RHCA 2QKEA 6GSSA 5JCUA 3BCKA 2FWEA 3QOUA 3TRQA 3KZQA 2FGXA 5C00A 2V1MA 3TOTA 1UVZA 2JL4A 2WJUA 1GTUA 4I5QA 4K8MA 2GZZA 2VL3A 4EL1A 4FYCA 3M9JA 2O89A 4OO5A 3GKMA 1THOA 5ECNB 3VPTA 2JZSA 4V2NA 4AJ6A 4KCEA 3CTGA 1O8WA 2MBSA 4GLTA 2F9SA 3FR9A 3G7YA 2L59A 1XWGA 1TOFA 1JZOA 4G10A 4MJBA 1X9MB 3MDKA 3LGCA 4MZBA 3P2AA 5AIXA 5CREA 4HU9A 1PD21 2VL2A 2E2GA 5IMFA 3WT1A 1R5AA 2CT6A 3CXGA 1IYIA 2BMXA 2PVOC 3FK8A 4IN0A 5ID2B 1VF4A 4V2MA 1TRUA 1PRXA 2QSIA 1SK0A 4D73B 3ZIJA 5L71A 1HD2A 2IFQB 2M80A 2LNTA 1CQHA 1QMVA 4EVMA 4TXOA 3IAM2 2GSQA 4HJMA 1VGLA 1SENA 4PNFA 3ZFLA 3CMIA 4FH8A 4IS0A 3TKSE 3F4SA 3E9JB 3PH9A 1CQGA 1H4OA 4IGJA 1M7TA 3P8WA 2OE3A 4NAXA 4DVCA 3ERGA 1OAZA 1M9AA 4TR0A 3GHAA 3LORA 4WKWA 1GLQA 1WP0A 5ENUA 1A8YA 3FZ9A 1TRVA 2V2GA 1A8LA 1GUHA 4TOPA
chains in the Genus database with same CATH superfamily
2LRCA 3M3MA 3H79A 4LMVA 2VAFA 1HNCA 5DAKA 2HRNA 4GQFA 2VLTA 3CSIA 3GX0A 1ABAA 3EMXA 3TJFA 1VF2A 3HJPA 4YQVA 3TJGA 4ZBDA 1OYJA 4WXTA 1WPIA 1G6WA 4IBPA 3US3A 4WBRD 5GAPD 1TDIA 1BQ7A 3H93A 5CRDA 4MABA 3FR6A 3HZ4A 1JLVA 2B5XA 2HZEB 5F05A 1Z5YE 1GULA 2VIMA 5KN2A 4KSOA 4KDUA 2YP6A 1Q4JA 5JWOB 3BJ5A 3TB2A 4F2IA 2CZ2A 2E7PA 16GSA 3DGQA 1S3AA 3TKSC 2DIYA 1TI3A 4KDYA 3DVXA 3ZMKA 3K8NA 2HSYA 2YPMA 4K9ZA 4Q5RA 3D5JA 1F3AA 1GSQA 5J9BA 1S3RA 2V41A 2QA1A 1ZYQB 3VWVA 5B6NA 1K0DA 3KTLA 3V1WA 1ACVA 3KTBA 1S3CA 4GSNA 4K0GA 4HZ4A 3WGXA 5IO0A 1FOVA 3WGDA 3R2QA 5JWQB 3GSTA 1J0FA 1LJRA 1J08A 5IMCA 4EDZA 3EC3A 1UA5A 2N5FA 1AC1A 4OFMA 1RK4A 2GDRA 1X5DA 20GSA 3GKNA 4J2FA 2WFCA 2PUKC 2E0QA 5A4VA 1SJIA 4RQRA 2R6KA 4BVXA 3CTFA 1GH2A 6GSYA 1Q98A 4HEA2 5E59A 2MMOA 3LW9A 5D9TA 5LCZA 3U6VA 2PWJA 5ELGA 1K0BA 5CYYA 2XBIA 1EOGA 4Q5NA 5GZZB 5ECQB 1MD4A 2FY6A 5AGYA 2DSAA 3IXRA 1PN0A 4NV2A 2DJ2A 4PGTA 3IE3A 4IQAA 2JU5A 3HCZA 2V6OA 2VL9A 3AY8A 5DQSA 4QL9A 4X0XA 1EV9A 1NHOA 2VM2A 3EURA 4MJCA 5F8BA 2NVLA 2K6VA 1SKWB 1YF1A 2H66A 3M1GA 3LG6A 2C4JA 2WDUA 5IPGA 4G9HA 1XZOA 3IC4A 4X4JA 1LBKA 1XG8A 1T7PB 3FZ4A 2BJXA 3F63A 1ZYNA 2K18A 2GLRA 3HHVA 2X49A 4KGIA 3ZIVA 4XRDA 1JZWA 1SYXA 2EC4A 2HRFA 3GV1A 1BG5A 4XIHA 4NXIA 2PVQA 4DEJA 4V1Ag 2C0EA 2KP1A 3HVSA 3TRXA 1NW2A 4I97A 1DE2A 2B6MA 2X8GA 5G2ZA 3PINA 2KUCA 2X99A 3DKSA 3DIEA 5INYA 2B5YA 4TXVA 1GSFA 2O7KA 1XW9A 1KBNA 3NOFA 5B6MA 2DJJA 3D4MA 1V40A 2E2MA 1XWAA 5DDLA 1SKSB 1JFUA 1A0RP 2DJ3A 4KUNA 4ZILA 2CV4A 4QQ7A 3IK9A 3ZLPA 3DYRA 4L8EA 1N2AA 2J23A 1MTCA 2CX4A 2H8LA 4PX1A 4KA0A 1YQ1A 3KH9A 3TJKA 4CHSA 1YEPA 4XCSA 4KB3A 3F0IA 3QD9A 5G30A 1OC3A 4POBA 3GTUB 1F3BA 1X5CA 2H71A 2YN1A 4I2UA 3ZYWA 4AF2A 5B8AA 2GTUA 3LFLA 3HYPA 6GSVA 5DALA 4WF5A 7GSSA 1TK8B 5G31A 1FHEA 3GH6A 3EE2A 2ZUPA 1WIKA 2IMFA 3A5WA 5D96A 1K0OA 3IRAA 3QCPA 4LL1B 5CP1A 1ERTA 3KIJA 2LRNA 1O7UA 4DSRA 1ON4A 3ZZXA 5KOXA 1Y6EA 2AUVA 2RUEA 4F0CA 3APOA 3DRNA 3CBUA 4HZ2A 5D8IA 19GSA 3UEMA 3EYTA 1K0NA 4KCAA 4NWYA 1Z6NA 5DBQA 3A5IA 1XFLA 4ECIA 2PGTA 2K8VA 4BIKA 3L0HA 4RUVA 2H6XA 2DLXA 2R0GA 2C3NA 1THXA 3FEUA 3M8NA 2FA4A 3IV4A 3RAZA 4E8EA 3HKRA 2P31A 2R0CA 3FR3A 2B1KA 2P5RA 2DBCA 3EU4A 5AIVA 1FG4A 2H73A 3FYGA 5IMZA 1GP1A 3G7IA 4N10A 3TKPA 3BCIA 4MK3A 1G7EA 3VK9A 3BBYA 4ML1A 2CQ9A 4O5RA 2G0FA 1XWCA 5HR2A 4YKGA 1ZL9A 3WD6A 2HI7A 4MF5A 2MBTA 4KF9A 2WULA 2LNSA 3ZTLA 4GCIA 4TKYA 5D9WA 5G5EA 3IBHA 2RIIA 4F82A 2MYGA 3ERWA 3KXOA 1C72A 5FHIA 3I6AA 2ZCTA 1OKTA 1IYHA 4NPBA 1JZDA 1TJDA 5ECIB 2LV3A 3D6IA 5D93A 2LJAA 2FUG2 3M0FA 4K1FA 2WRTA 2R4VA 2H70A 4GF0A 1U88A 3LEFA 2VCQA 2HFDA 3ZFBA 4Z7XA 5DJMA 2GSRA 4I6XA 5G1LA 2YWIA 5ECSA 4XS6A 2YWMA 5LD0A 5CRGA 5DJLA 5HFIA 5FT3A 2YZHA 2L4QA 4TR1A 1LU4A 3EWLA 1TW9A 2R3XA 1XXUA 2H0HA 3RHBA 2M72A 5ECKB 3C1SA 5COHA 3PR8A 3HVNA 2J9HA 2NTOA 2H30A 5H5SA 2RM5A 5KOWA 2DC5A 1B4PA 5CRWA 4I8BA 1AXDA 4KX4A 5B7CA 4PQIA 3KGKA 3L9SA 1A2MA 3W8SA 1GTIA 2P0GA 2YWNA 2VM1A 4X43A 2H76A 3IPZA 4G0LA 3ISOA 2CVBA 3HXSA 2CA8A 1AQWA 1A23A 3QMXA 3VI7A 3EVIA 2RM6A 3A2WA 1FW1A 4IQ1A 3I43A 3VWXA 1GSYA 2PU9C 4TRXA 2LQOA 4G2EA 3LYKA 1EZKA 3UARA 1TU7A 2BTOT 4HQSA 2FWHA 1M3JA 2P5QA 5KEJA 5DVBA 2HYXA 5DCHA 3JCML 3NZNA 1GUKA 3GYKA 4FQUA 2D2ZA 5ECRB 1VRSD 3C8EA 1SD9A 2XPDA 18GSA 4EC0A 3UVTA 5J5NA 5D9XA 3DXBA 2HSHA 4TVEA 1X5EA 1GRXA 3F3RA 2C1YA 4N11A 2CVDA 1EEJA 4L5OA 1ERUA 1Z7RA 2LEGA 4ISDA 4IELA 3QAWA 3F8UA 5HQPA 14GSA 4MH2A 1X9WB 3LXZA 3MWHA 2VUPA 3GKXA 3VWWA 3DVWA 2B5EA 2EIRA 3D22A 5ID2A 2LRTA 4PUFC 2B1LA 4D73A 2GT5A 3Q19A 1AW9A 3KMNA 3TRPA 2GGTA 4K5RA 5LNKe 2IFQA 1E6BA 2DJKA 1PKZA 4JE1A 3L4NA 12GSA 1PFOA 2JZRA 1K0CA 2HLSA 2RLIA 1W89A 5IOWA 4G0IA 4LL4B 1XWBA 2VO4A 13GSA 1FO5A 4K2XA 1XW5A 4JU5A 2YNXA 3EU3A 2IJYA 2HXKA 1E2YA 4GSSA 3RPPA 3Q18A 3TUEA 4AJ7A 2GZPA 4ZL9A 3MAKA 1R5PA 2VCVA 1T8EB 1KNGA 4CW9A 2O85A 4BA7A 3IHQA 1SU9A 4GXZA 3KP8A 3UMAA 3NIVA 5BRTA 3N9JA 2H19A 3J7Yk 4TW5A 2TRXA 2YV7A 2V6KA 4KE3A 2A2SA 3ME7A 4CY8A 6GSUA 2MMNA 4OFNA 4BL7B 3QDNA 5EVOA 4XS4B 3I69A 1B9YC 4MA9A 5KN3A 2LQQA 4K2DA 3N5OA 3TGZA 5AISA 3HZ8A 4G0KA 1VF1A 1A24A 3ZMLA 1R7HA 2VCZA 1PMTA 3U5RE 4BWQA 4FYBA 1T1VA 2PERA 3C7MA 4V1Ap 1SL1B 3LSZA 2YZUA 1F37A 2R2JA 4ECJA 2HZEA 3TKSA 2GZYA 4CDOA 1G6YA 1V58A 3HDCA 1X0RA 2OJLA 1BYEA 3GFKA 3TKRA 1NHYA 2VD0A 2I1UA 4V2LA 4DSSB 3OR5A 5IM9A 4YKFA 4K7OA 2DJ1A 1JLWA 1ERVA 1UC7A 3W6GA 3LJRA 3GIXA 1PA3A 2AB6A 2AYTA 1KTEA 3MNGA 2R37A 3GRXA 2H0GA 1PGTA 4EXJA 3IHGA 1M2DA 1WWJA 1M0UA 3WGEA 2L6CA 1XOBA 4MMMA 2UZ8A 4O7HA 4BVYB 4JBBA 1MEKA 2K8SA 2MZCA 3IA1A 3ZRDA 1PX6A 2WGRA 1FB0A 4HSCX 4XS1A 4MNNA 1SL0B 3IAS2 1ZMAA 4ECCA 1A2LA 2RUFA 4TN8A 1XW6A 1O85A 1PN9A 2IMKA 1A0FA 3PGTA 2G2QA 4FYUA 3P7XA 2V32A 2A4VA 2VOCA 5D9VA 3D21A 4HS1A 2YJHA 1V2AA 4N0VA 1ZYEA 1SK1A 3GL3A 1GSEA 4DSQA 2OE0A 2AAWA 4K5SA 3GSSA 1AQVA 4ICYA 8GSSA 2GSSA 2GQKA 4NV5A 1TRSA 5GSTA 3FW2A 1USBA 4YQUA 4POKA 3MIXA 2H01A 4MP4A 5J9CA 5IOXA 2C8UA 3TKQA 2KOKA 1FVJA 3SWLA 2GQMA 4OMVA 3CSHA 3J7Yb 1PX7A 4YAPA 2A4HA 3IK7A 4O5QA 2NBSA 2H72A 5F06A 1EWXA 2CVKA 3M9KA 1EV4A 2YJ7A 3VPQA 1YKCA 4F9ZA 3KM6A 4MZWA 1A2JA 1YJ6A 2PPTA 2GS3A 4POMA 1Z6MA 4RQXA 4ZB9A 3CRUA 2YWOA 4AGSA 2IIYA 2HRKA 4JRRA 3CRTA 3G7JA 4EF0A 3E0UA 2IN3A 1EGRA 2ON7A 2PMTA 3L78A 1TU8A 1DSBA 5HR3A 2FLSA 5CRHA 4OO4A 2C0GA 2IPAA 3TOUA 2VLUA 4IP6A 4H86A 1WRYA 1RQMA 5F07A 4N0ZA 1EP7A 1W4VA 2OACA 2IL3A 3UJ1A 1DBYA 5KN0A 3TCOA 1U87A 3O3TA 3MSZA 5H5QA 2TIRA 1R26A 2ALBA 2XC2A 1H75A 3RPNA 4MPGA 4BPYA 4KDXA 3GX8A 3L9UA 3C1RA 4P3YB 4WBJA 1XVWA 2K9FA 2OBKA 1GSDA 3HJOA 3HJMA 2IMEA 2CX3A 2JSYA 4ZIJA 1ZYPA 4XHMA 4TXOB 1URMA 4Q5FA 4ACSA 1F9MA 2LJKA 4JZQA 1G7OA 2FA8A 3IR4A 2MMAA 2C3QA 4CY6A 3GTUA 2MMZA 4EE0A 3BOAA 1YDKA 1GL8A 1TTZA 4PQ1A 3EMPA 4XTSA 1T4ZA 4ILFA 2KP2A 3H4KA 2HE3A 5EY6A 1HNBA 4K6XA 1PQNA 1GUMA 2YCDA 4TR3A 4IVFA 1AQXA 1ZZYA 3UAPA 1B4QA 1GSSA 2I4AA 3WT2A 5A4WA 4O5UA 5DAKB 4KH7A 3F4RA 3R3EA 4EUYA 1TRWA 1YKAA 1BEDA 3UL3A 1FAAA 1MDKA 4GSTA 1XPVA 2VLVA 1SK2A 1DUGA 4A5PA 2OADA 4KW6A 2NPBA 1I9DA 6GSWA 2N5BA 2HZFA 1M99A 4MDCA 3VFIA 1WE0A 4E8HA 4WR4A 4HOJA 2GVPA 1J9BA 17GSA 3GNJA 4PXOA 5IMVA 4X1UA 4GRFA 3DMLA 1WOUA 3KD0A 4QL7A 3HD5A 2C3TA 1EP8A 3UOMA 4WF4A 1V57A 2A2RA 3VI5A 3LQ7A 4KSMA 1WJKA 4PUAA 3A2VA 3APQA 3EPTA 2DIZA 2ON5A 2LUSA 4NHZA 1O6JA 1SJ6A 3Q6OA 1F2EA 3CSJA 2LSTA 4F0BA 5J41A 1SKRB 4IJ3A 4PNGA 4JR4A 4ZL7A 1YZXA 3FZ5A 3E3EA 1RW1A 5B8BA 4OCEA 2VD1A 1ZGNA 2PN8A 1FOHA 4JEDA 1HQOA 3F4TA 4PURA 1K3OA 1VF3A 1Z3EA 1UN2A 1JZRA 4IJIA 4MCUA 1PL2A 3GURA 3HVXA 2C0DA 2QGVA 5ECLB 4EDYA 2JACA 1B9XC 2H6YA 1B48A 1Z9HA 5JWRB 2REMA 5BMUA 3F6FA 1SD8A 2X8CA 2AHEA 2WS2A 4MPFA 4OWYA 4BVXB 1U3AA 4GTUA 9GSSA 2I9HA 4LMWA 4NMUA 4LLRA 3KP9A 1S3DA 4TR4A 5E4WA 3ZL5A 2DMLA 4EIQA 11GSA 2IMIA 3GH9A 5CO3A 2H1BA 2L4CA 3KEBA 2H0IA 3KCMA 1YF0A 3LWAA 4IHUA 4Q5QA 4WR5A 1AIUA 3GL5A 1EOHA 1R4WA 3RDWA 6GSXA 5KN1A 5HFKA 3TJJA 2JZTA 2R5GA 4ML6A 1ZOFA 1TK5B 2EIOA 2XPEA 3H1NA 1OKDA 22GSA 5CAXA 4XRAA 1ERWA 2JADA 5IMDA 4ID0A 1B8XA 2DJ0A 2GQLA 5JCGA 2OA7A 1FB6A 2WB9A 1OVNA 4Z2RA 4G19A 3I9V2 2OBIA 3A3TA 1ML6A 3FMWA 3LXTA 3CQFA 5DCGA 3L9VA 4NHWA 2C0FA 3C71A 2IMDA 5ECHB 1MDJA 2XHFA 1T00A 4L0UA 1O81A 2I81A 1TKDB 2Z9SA 5HR0A 2YV9A 5ELAA 2H6ZA 3DD3A 2H74A 1T3BA 1GLPA 2VCTA 2H75A 4PQHA 1U6TA 3F9UA 4YQMA 1PSQA 2L57A 5A4UA 4HU7A 1O73A 5IPHA 2B3SA 2B7KA 1K3YA 1OC9B 3FKFA 5F0GA 1TI1A 3GA4A 1XOAA 2OKAA 3ED3A 2JSZA 2QC7A 3EINA 2L5OA 4ZL8A 1XBSA 1ST9A 4HDEA 2LJRA 1X9SB 2HT9A 5HFGA 4K7IA 2FWGA 4EO3A 1NM3A 3ERFA 1GNEA 2XBQA 2GSTA 1XCCA 2WZ9A 1GWCA 4ZXGA 3HA9A 1XWKA 2CAQA 1QXHA 4ULXA 1BX9A 1XVQA 4ZBBA 4K7NA 2H1DA 3GKKA 4HUAA 2O8VB 3FY7A 5JCWA 1O8XA 3QPMA 1M9BA 5H5RA 5DALB 4AJ8A 1PL1A 3RBTA 3KJYA 3QAVA 2M46A 1EEMA 1KEBA 1AAZA 1XIYA 3GMFA 4OD7A 4OFTA 1QFNA 4MH3A 1SYRA 2GT6A 1K3LA 2F51A 3QAGA 5ECMB 4BWSA 4HJ2A 3IDVA 1V9WA 3ZITA 3S9FA 2R0PA 1ILOA 1BAYA 1ZCPA 1QK8A 2TRCP 2QA2A 4N30A 2KHPA 4FO5A 3DWVA 3ZVJD 2ES7A 5C04A 1BJXA 2WCIA 4WEYA 2I3YA 3PPUA 5GAND 3C73A 4MF7A 2VCWA 1TP9A 1QGVA 2FCHA 1YEXA 3QFAC 5IQYA 5AN1A 1M2BA 1QUWA 2H1AA 4BL7A 5G5FA 6GSTA 1OE7A 4XS4A 3QFBC 2C80A 4F03A 1YY7A 2AV4A 3ME8A 4L0WA 4Z2UA 3LYPA 2CAIA 3CYNA 1DE1A 2AJQB 5EL8A 1OC9A 3VLNA 3HVVA 3QR6A 3VURA 3GN3A 4WETA 4HI7A 4O92A 4K0NA 4MJAA 4ZB6A 4PTSA 1N8JA 1Y25A 3APSA 3FHKA 1I5GA 1V98A 1M2AA 2X64A 1HYUA 3UVHA 4RI6A 5ABRA 3KMOA 5J4UA 4MF6A 3DEXA 3IOSA 2F3MA 3D4TA 1GNWA 1GSUA 3FZAA 3D0ZA 10GSA 3VWUA 4DSSA 2H1GA 2KLXA 2NDOA 2A2PA 5HR1A 3IC8A 2N5AA 3ZVJA 1U3IA 3F6DA 4YH2A 3G9BA 4J57E 4MZCA 4ZBAA 2LTKA 4FIWA 1TXXA 2YOIA 4MJEA 4EIPA 2L5LA 2LS5A 3F3QA 4EKZA 3O6TA 3BD2A 1WMJA 4L5LA 4BVYA 4RI7A 5ECPB 3WYWA 4JR6A 3ZREA 2F8FA 4MLYA 2CZ3A 1T4YA 5GSSA 1AUCA 1G0TA 2X4AA 3Q74A 3UBKA 2B7JA 5D73A 4O32A 1OE8A 1TK0B 2DMMA 1SL2B 2DKHA 1GTBA 1GTAA 2FNOA 4OCFA 4KAEA 1K0AA 4ECBA 1Z7PA 4IP1A 4TR1B 1EGOA 2X8HA 2F8AA 5DQYA 1F6MC 1JHBA 2O87A 5EPFA 2L6DA 2VCXA 4ZB8A 3UBLA 4POLA 4GQCA 5IIZA 3TJBA 2YANA 1HNAA 4HQZA 1PKWA 3P90A 4I2TA 2FWFA 4J56E 3O76A 2VL2C 3A2XA 4YAVA 1K0MA 4IKHA 2FD3A 5A5KA 5IMAA 1MD3A 4IW9A 2PBJA 1OC8A 2DKIA 5J3RA 5FWGA 1FVKA 2EIQA 5IO2A 2ZNMA 5ECOB 4KNDA 2OE1A 2HNLA 3W8JA 3H8QA 1MDIA 4LA1A 3GUSA 3FRCA 3UIWA 4Z2TA 3KH7A 5CNWA 2FHEA 2LKUA 4GWRA 1NSWA 1QQ2A 1SJZA 3TDGA 3SBCA 2IWTA 5G1KA 3HY2A 3RHCA 2QKEA 6GSSA 5JCUA 3BCKA 2FWEA 3QOUA 3TRQA 3KZQA 2FGXA 5C00A 2V1MA 3TOTA 1UVZA 2JL4A 2WJUA 1GTUA 4I5QA 4K8MA 2GZZA 2VL3A 4EL1A 4FYCA 3M9JA 2O89A 4OO5A 3GKMA 1THOA 5ECNB 3VPTA 2JZSA 4V2NA 4AJ6A 4KCEA 3CTGA 1O8WA 2MBSA 4GLTA 2F9SA 3FR9A 3G7YA 2L59A 1XWGA 1TOFA 1JZOA 4G10A 4MJBA 1X9MB 3MDKA 3LGCA 4MZBA 3P2AA 5AIXA 5CREA 4HU9A 1PD21 2VL2A 2E2GA 5IMFA 3WT1A 1R5AA 2CT6A 3CXGA 1IYIA 2BMXA 2PVOC 3FK8A 4IN0A 5ID2B 1VF4A 4V2MA 3MYDA 1TRUA 1PRXA 2QSIA 1SK0A 4D73B 3ZIJA 5L71A 2HRAA 2HSMA 1HD2A 2IFQB 2M80A 2LNTA 1CQHA 1QMVA 4EVMA 4TXOA 3IAM2 2GSQA 4HJMA 1VGLA 1SENA 4PNFA 3ZFLA 3CMIA 4FH8A 4IS0A 3TKSE 3F4SA 3E9JB 3PH9A 1CQGA 1H4OA 4IGJA 1M7TA 3P8WA 2OE3A 4NAXA 4DVCA 3ERGA 1OAZA 1M9AA 4TR0A 3GHAA 3LORA 4WKWA 1GLQA 1M3IA 1WP0A 5ENUA 1A8YA 3FZ9A 4USSA 1TRVA 2V2GA 1A8LA 1GUHA 4TOPA
chains in the Genus database with same CATH topology
2LRCA 3M3MA 3H79A 4LMVA 2VAFA 1HNCA 5DAKA 2HRNA 4GQFA 2VLTA 3CSIA 3GX0A 1ABAA 3EMXA 3TJFA 1VF2A 3HJPA 4YQVA 3TJGA 4ZBDA 1OYJA 4WXTA 1WPIA 1G6WA 4IBPA 3US3A 4WBRD 5GAPD 1TDIA 1BQ7A 3H93A 5CRDA 4MABA 3FR6A 3HZ4A 1JLVA 2B5XA 2HZEB 5F05A 1Z5YE 1GULA 2VIMA 5KN2A 4KSOA 4KDUA 2YP6A 1Q4JA 5JWOB 3BJ5A 3TB2A 4F2IA 2CZ2A 2E7PA 16GSA 3DGQA 1S3AA 3TKSC 2DIYA 1TI3A 4KDYA 3DVXA 3ZMKA 3K8NA 2HSYA 2YPMA 4K9ZA 4Q5RA 3D5JA 1F3AA 1GSQA 5J9BA 2V41A 2QA1A 1ZYQB 3VWVA 5B6NA 1K0DA 3KTLA 3V1WA 1ACVA 3KTBA 1S3CA 4GSNA 4K0GA 4HZ4A 3WGXA 5IO0A 1FOVA 3WGDA 3R2QA 5JWQB 3GSTA 1J0FA 1LJRA 1J08A 5IMCA 4EDZA 3EC3A 1UA5A 2N5FA 1AC1A 4OFMA 1RK4A 2GDRA 1X5DA 20GSA 3GKNA 4J2FA 2WFCA 2PUKC 2E0QA 5A4VA 1SJIA 4RQRA 2R6KA 4BVXA 3CTFA 1GH2A 6GSYA 1Q98A 4HEA2 5E59A 2MMOA 3LW9A 5D9TA 5LCZA 3U6VA 2PWJA 5ELGA 1K0BA 5CYYA 2XBIA 1EOGA 4Q5NA 5GZZB 5ECQB 1MD4A 2FY6A 5AGYA 2DSAA 3IXRA 1PN0A 4NV2A 2DJ2A 4PGTA 3IE3A 4IQAA 2JU5A 3HCZA 2V6OA 2VL9A 3AY8A 5DQSA 4QL9A 4X0XA 1EV9A 1NHOA 2VM2A 3EURA 4MJCA 5F8BA 2NVLA 2K6VA 1SKWB 1YF1A 2H66A 3M1GA 3LG6A 2C4JA 2WDUA 5IPGA 4G9HA 1XZOA 3IC4A 4X4JA 1LBKA 1T7PB 3FZ4A 2BJXA 3F63A 1ZYNA 2K18A 2GLRA 3HHVA 2X49A 4KGIA 3ZIVA 4XRDA 1JZWA 1SYXA 2EC4A 2HRFA 3GV1A 1BG5A 4XIHA 4NXIA 2PVQA 4DEJA 4V1Ag 2C0EA 2KP1A 3HVSA 3TRXA 1NW2A 4I97A 1DE2A 2B6MA 2X8GA 5G2ZA 3PINA 2KUCA 2X99A 3DKSA 3DIEA 5INYA 2B5YA 4TXVA 1GSFA 2O7KA 1XW9A 1KBNA 3NOFA 5B6MA 2DJJA 3D4MA 1V40A 2E2MA 1XWAA 5DDLA 1SKSB 1JFUA 1A0RP 2DJ3A 4KUNA 4ZILA 2CV4A 4QQ7A 3IK9A 3ZLPA 3DYRA 4L8EA 1N2AA 2J23A 1MTCA 2CX4A 2H8LA 4PX1A 4KA0A 1YQ1A 3KH9A 3TJKA 4CHSA 1YEPA 4XCSA 4KB3A 3F0IA 3QD9A 5G30A 1OC3A 4POBA 3GTUB 1F3BA 1X5CA 2H71A 2YN1A 4I2UA 3ZYWA 4AF2A 5B8AA 2GTUA 3LFLA 3HYPA 6GSVA 5DALA 4WF5A 7GSSA 1TK8B 5G31A 1FHEA 3GH6A 3EE2A 2ZUPA 1WIKA 2IMFA 3A5WA 5D96A 1K0OA 3IRAA 3QCPA 4LL1B 5CP1A 1ERTA 3KIJA 2LRNA 1O7UA 4DSRA 1ON4A 3ZZXA 5KOXA 1Y6EA 2AUVA 2RUEA 4F0CA 3APOA 3DRNA 3CBUA 4HZ2A 5D8IA 19GSA 3UEMA 3EYTA 1K0NA 4KCAA 4NWYA 1Z6NA 5DBQA 3A5IA 1XFLA 4ECIA 2PGTA 2K8VA 3L0HA 4RUVA 2H6XA 2DLXA 2R0GA 2C3NA 1THXA 3FEUA 3M8NA 2FA4A 3IV4A 3RAZA 4E8EA 3HKRA 2P31A 2R0CA 3FR3A 2B1KA 2P5RA 2DBCA 3EU4A 5AIVA 1FG4A 2H73A 3FYGA 5IMZA 1GP1A 3G7IA 4N10A 3TKPA 3BCIA 4MK3A 1G7EA 3VK9A 3BBYA 4ML1A 2CQ9A 4O5RA 2G0FA 1XWCA 5HR2A 4YKGA 1ZL9A 3WD6A 2HI7A 4MF5A 2MBTA 4KF9A 2WULA 2LNSA 3ZTLA 4GCIA 4TKYA 5D9WA 5G5EA 3IBHA 2RIIA 4F82A 2MYGA 3ERWA 3KXOA 1C72A 5FHIA 3I6AA 2ZCTA 1OKTA 1IYHA 4NPBA 1JZDA 1TJDA 5ECIB 2LV3A 3D6IA 5D93A 2LJAA 2FUG2 3M0FA 4K1FA 2WRTA 2R4VA 2H70A 4GF0A 1U88A 3LEFA 2VCQA 2HFDA 3ZFBA 4Z7XA 5DJMA 2GSRA 4I6XA 5G1LA 2YWIA 5ECSA 4XS6A 2YWMA 5LD0A 5CRGA 5DJLA 5HFIA 5FT3A 2YZHA 2L4QA 4TR1A 1LU4A 3EWLA 1TW9A 2R3XA 1XXUA 2H0HA 3RHBA 2M72A 5ECKB 3C1SA 5COHA 3PR8A 2J9HA 2NTOA 2H30A 5H5SA 2RM5A 5KOWA 2DC5A 1B4PA 5CRWA 4I8BA 1AXDA 4KX4A 5B7CA 4PQIA 3KGKA 3L9SA 1A2MA 3W8SA 1GTIA 2P0GA 2YWNA 2VM1A 4X43A 2H76A 3IPZA 4G0LA 3ISOA 2CVBA 3HXSA 2CA8A 1AQWA 1A23A 3QMXA 3VI7A 3EVIA 2RM6A 3A2WA 1FW1A 4IQ1A 3I43A 3VWXA 1GSYA 2PU9C 4TRXA 2LQOA 4G2EA 3LYKA 1EZKA 3UARA 1TU7A 2BTOT 4HQSA 2FWHA 2P5QA 5KEJA 5DVBA 2HYXA 5DCHA 3JCML 3NZNA 1GUKA 3GYKA 4FQUA 2D2ZA 5ECRB 1VRSD 3C8EA 1SD9A 2XPDA 18GSA 4EC0A 3UVTA 5J5NA 5D9XA 3DXBA 2HSHA 4TVEA 1X5EA 1GRXA 3F3RA 2C1YA 4N11A 2CVDA 1EEJA 4L5OA 1ERUA 1Z7RA 2LEGA 4ISDA 4IELA 3QAWA 3F8UA 5HQPA 14GSA 4MH2A 1X9WB 3LXZA 3MWHA 2VUPA 3GKXA 3VWWA 3DVWA 2B5EA 2EIRA 3D22A 5ID2A 2LRTA 4PUFC 2B1LA 4D73A 2GT5A 3Q19A 1AW9A 3KMNA 3TRPA 2GGTA 4K5RA 5LNKe 2IFQA 1E6BA 2DJKA 1PKZA 4JE1A 3L4NA 12GSA 2JZRA 1K0CA 2HLSA 2RLIA 1W89A 5IOWA 4G0IA 4LL4B 1XWBA 2VO4A 13GSA 1FO5A 4K2XA 1XW5A 4JU5A 2YNXA 3EU3A 2IJYA 2HXKA 1E2YA 4GSSA 3RPPA 3Q18A 3TUEA 4AJ7A 2GZPA 4ZL9A 3MAKA 1R5PA 2VCVA 1T8EB 1KNGA 4CW9A 2O85A 4BA7A 3IHQA 1SU9A 4GXZA 3KP8A 3UMAA 3NIVA 5BRTA 3N9JA 2H19A 3J7Yk 4TW5A 2TRXA 2YV7A 2V6KA 4KE3A 2A2SA 3ME7A 4CY8A 6GSUA 2MMNA 4OFNA 4BL7B 3QDNA 5EVOA 4XS4B 3I69A 1B9YC 4MA9A 5KN3A 2LQQA 4K2DA 3N5OA 3TGZA 5AISA 3HZ8A 4G0KA 1VF1A 1A24A 3ZMLA 1R7HA 2VCZA 1PMTA 3U5RE 4BWQA 4FYBA 1T1VA 2PERA 3C7MA 4V1Ap 1SL1B 3LSZA 2YZUA 1F37A 2R2JA 4ECJA 2HZEA 3TKSA 2GZYA 4CDOA 1G6YA 1V58A 3HDCA 1X0RA 2OJLA 1BYEA 3GFKA 3TKRA 1NHYA 2VD0A 2I1UA 4V2LA 4DSSB 3OR5A 5IM9A 4YKFA 4K7OA 2DJ1A 1JLWA 1ERVA 1UC7A 3W6GA 3LJRA 3GIXA 1PA3A 2AB6A 2AYTA 1KTEA 3MNGA 2R37A 3GRXA 2H0GA 1PGTA 4EXJA 3IHGA 1M2DA 1WWJA 1M0UA 3WGEA 2L6CA 1XOBA 4MMMA 2UZ8A 4O7HA 4BVYB 4JBBA 1MEKA 2K8SA 2MZCA 3IA1A 3ZRDA 1PX6A 2WGRA 1FB0A 4XS1A 1SL0B 4MNNA 3IAS2 1ZMAA 4ECCA 1A2LA 2RUFA 4TN8A 1XW6A 1O85A 1PN9A 2IMKA 1A0FA 3PGTA 2G2QA 4FYUA 3P7XA 2V32A 2A4VA 2VOCA 5D9VA 3D21A 4HS1A 2YJHA 1V2AA 4N0VA 1ZYEA 1SK1A 3GL3A 1GSEA 4DSQA 2OE0A 2AAWA 4K5SA 3GSSA 1AQVA 4ICYA 8GSSA 2GSSA 2GQKA 4NV5A 1TRSA 5GSTA 3FW2A 1USBA 4YQUA 4POKA 3MIXA 2H01A 4MP4A 5J9CA 5IOXA 2C8UA 3TKQA 2KOKA 1FVJA 3SWLA 2GQMA 4OMVA 3CSHA 3J7Yb 1PX7A 4YAPA 2A4HA 3IK7A 4O5QA 2NBSA 2H72A 5F06A 1EWXA 2CVKA 3M9KA 1EV4A 2YJ7A 3VPQA 1YKCA 4F9ZA 3KM6A 4MZWA 1A2JA 1YJ6A 2PPTA 2GS3A 4POMA 1Z6MA 4RQXA 4ZB9A 3CRUA 2YWOA 4AGSA 2IIYA 2HRKA 4JRRA 3CRTA 3G7JA 4EF0A 3E0UA 2IN3A 1EGRA 2ON7A 2PMTA 3L78A 1TU8A 1DSBA 5HR3A 2FLSA 5CRHA 4OO4A 2C0GA 2IPAA 3TOUA 2VLUA 4IP6A 4H86A 1WRYA 1RQMA 5F07A 4N0ZA 1EP7A 1W4VA 2OACA 2IL3A 3UJ1A 1DBYA 5KN0A 3TCOA 1U87A 3O3TA 3MSZA 5H5QA 2TIRA 1R26A 2ALBA 2XC2A 1H75A 3RPNA 4MPGA 4BPYA 4KDXA 3GX8A 3L9UA 3C1RA 4P3YB 4WBJA 1XVWA 2K9FA 2OBKA 1GSDA 3HJOA 3HJMA 2IMEA 2CX3A 2JSYA 4ZIJA 1ZYPA 4XHMA 4TXOB 1URMA 4Q5FA 4ACSA 1F9MA 2LJKA 4JZQA 1G7OA 2FA8A 3IR4A 2MMAA 2C3QA 4CY6A 3GTUA 2MMZA 4EE0A 3BOAA 1YDKA 1GL8A 1TTZA 4PQ1A 3EMPA 4XTSA 1T4ZA 4ILFA 2KP2A 3H4KA 2HE3A 5EY6A 1HNBA 4K6XA 1PQNA 1GUMA 2YCDA 4TR3A 4IVFA 1AQXA 1ZZYA 3UAPA 1B4QA 1GSSA 2I4AA 3WT2A 5A4WA 4O5UA 5DAKB 4KH7A 3F4RA 3R3EA 4EUYA 1TRWA 1YKAA 1BEDA 3UL3A 1FAAA 1MDKA 4GSTA 1XPVA 2VLVA 1SK2A 1DUGA 4A5PA 2OADA 4KW6A 2NPBA 1I9DA 6GSWA 2N5BA 2HZFA 1M99A 4MDCA 3VFIA 1WE0A 4E8HA 4WR4A 4HOJA 2GVPA 1J9BA 17GSA 3GNJA 4PXOA 5IMVA 4X1UA 4GRFA 3DMLA 1WOUA 3KD0A 4QL7A 3HD5A 2C3TA 1EP8A 3UOMA 4WF4A 1V57A 2A2RA 3VI5A 3LQ7A 4KSMA 1WJKA 4PUAA 3A2VA 3APQA 3EPTA 2DIZA 2ON5A 2LUSA 4NHZA 1O6JA 1SJ6A 3Q6OA 1F2EA 3CSJA 2LSTA 4F0BA 5J41A 1SKRB 4IJ3A 4PNGA 4JR4A 4ZL7A 1YZXA 3FZ5A 3E3EA 1RW1A 5B8BA 4OCEA 2VD1A 1ZGNA 2PN8A 1FOHA 4JEDA 1HQOA 3F4TA 4PURA 1K3OA 1VF3A 1Z3EA 1UN2A 1JZRA 4IJIA 4MCUA 1PL2A 3GURA 3HVXA 2C0DA 2QGVA 5ECLB 4EDYA 2JACA 1B9XC 2H6YA 1B48A 1Z9HA 5JWRB 2REMA 5BMUA 3F6FA 1SD8A 2X8CA 2AHEA 2WS2A 4MPFA 4OWYA 4BVXB 1U3AA 4GTUA 9GSSA 2I9HA 4LMWA 4NMUA 4LLRA 3KP9A 1S3DA 4TR4A 5E4WA 3ZL5A 2DMLA 4EIQA 11GSA 2IMIA 3GH9A 5CO3A 2H1BA 2L4CA 3KEBA 2H0IA 3KCMA 1YF0A 3LWAA 4IHUA 4Q5QA 4WR5A 1AIUA 3GL5A 1EOHA 1R4WA 3RDWA 6GSXA 5KN1A 5HFKA 3TJJA 2JZTA 2R5GA 4ML6A 1ZOFA 1TK5B 2EIOA 2XPEA 3H1NA 1OKDA 22GSA 5CAXA 4XRAA 1ERWA 2JADA 5IMDA 4ID0A 1B8XA 2DJ0A 2GQLA 5JCGA 2OA7A 1FB6A 2WB9A 1OVNA 4Z2RA 4G19A 3I9V2 2OBIA 3A3TA 1ML6A 3FMWA 3LXTA 5DCGA 3L9VA 4NHWA 2C0FA 3C71A 2IMDA 5ECHB 1MDJA 2XHFA 1T00A 4L0UA 1O81A 2I81A 1TKDB 2Z9SA 5HR0A 2YV9A 5ELAA 2H6ZA 3DD3A 2H74A 1T3BA 1GLPA 2VCTA 2H75A 4PQHA 1U6TA 3F9UA 4YQMA 1PSQA 2L57A 5A4UA 4HU7A 1O73A 5IPHA 2B3SA 2B7KA 1K3YA 1OC9B 3FKFA 5F0GA 1TI1A 3GA4A 1XOAA 2OKAA 3ED3A 2JSZA 2QC7A 3EINA 2L5OA 4ZL8A 1XBSA 1ST9A 4HDEA 2LJRA 1X9SB 2HT9A 5HFGA 4K7IA 2FWGA 4EO3A 1NM3A 3ERFA 1GNEA 2XBQA 2GSTA 1XCCA 2WZ9A 1GWCA 4ZXGA 3HA9A 1XWKA 2CAQA 1QXHA 4ULXA 1BX9A 1XVQA 4ZBBA 4K7NA 2H1DA 3GKKA 4HUAA 2O8VB 3FY7A 5JCWA 1O8XA 3QPMA 1M9BA 5H5RA 5DALB 4AJ8A 1PL1A 3RBTA 3KJYA 3QAVA 2M46A 1EEMA 1KEBA 1AAZA 1XIYA 3GMFA 4OD7A 4OFTA 1QFNA 4MH3A 1SYRA 2GT6A 1K3LA 2F51A 3QAGA 5ECMB 4BWSA 4HJ2A 3IDVA 1V9WA 3ZITA 3S9FA 2R0PA 1ILOA 1BAYA 1ZCPA 1QK8A 2TRCP 2QA2A 4N30A 2KHPA 4FO5A 3DWVA 3ZVJD 2ES7A 5C04A 1BJXA 2WCIA 4WEYA 2I3YA 3PPUA 5GAND 3C73A 4MF7A 2VCWA 1TP9A 1QGVA 2FCHA 1YEXA 3QFAC 5IQYA 5AN1A 1M2BA 1QUWA 2H1AA 4BL7A 5G5FA 6GSTA 1OE7A 4XS4A 3QFBC 2C80A 4F03A 1YY7A 2AV4A 3ME8A 4L0WA 4Z2UA 3LYPA 2CAIA 3CYNA 1DE1A 2AJQB 5EL8A 1OC9A 3VLNA 3HVVA 3QR6A 3VURA 3GN3A 4WETA 4HI7A 4O92A 4K0NA 4MJAA 4ZB6A 4PTSA 1N8JA 1Y25A 3APSA 3FHKA 1I5GA 1V98A 1M2AA 2X64A 1HYUA 3UVHA 4RI6A 5ABRA 3KMOA 5J4UA 4MF6A 3DEXA 3IOSA 2F3MA 3D4TA 1GNWA 1GSUA 3FZAA 3D0ZA 10GSA 3VWUA 4DSSA 2H1GA 2KLXA 2NDOA 2A2PA 5HR1A 3IC8A 2N5AA 3ZVJA 1U3IA 3F6DA 4YH2A 3G9BA 4J57E 4MZCA 4ZBAA 2LTKA 4FIWA 1TXXA 2YOIA 4MJEA 4EIPA 2L5LA 2LS5A 3F3QA 4EKZA 3O6TA 3BD2A 1WMJA 4L5LA 4BVYA 4RI7A 5ECPB 3WYWA 4JR6A 3ZREA 2F8FA 4MLYA 2CZ3A 1T4YA 5GSSA 1AUCA 1G0TA 2X4AA 3Q74A 3UBKA 2B7JA 5D73A 4O32A 1OE8A 1TK0B 2DMMA 1SL2B 2DKHA 1GTBA 1GTAA 2FNOA 4OCFA 4KAEA 1K0AA 4ECBA 1Z7PA 4IP1A 4TR1B 1EGOA 2X8HA 2F8AA 5DQYA 1F6MC 1JHBA 2O87A 5EPFA 2L6DA 2VCXA 4ZB8A 3UBLA 4POLA 4GQCA 5IIZA 3TJBA 2YANA 1HNAA 4HQZA 1PKWA 3P90A 4I2TA 2FWFA 4J56E 3O76A 2VL2C 3A2XA 4YAVA 1K0MA 4IKHA 2FD3A 5A5KA 5IMAA 1MD3A 4IW9A 2PBJA 1OC8A 2DKIA 5J3RA 5FWGA 1FVKA 2EIQA 5IO2A 2ZNMA 5ECOB 4KNDA 2OE1A 2HNLA 3W8JA 3H8QA 1MDIA 4LA1A 3GUSA 3FRCA 3UIWA 4Z2TA 3KH7A 5CNWA 2FHEA 2LKUA 4GWRA 1NSWA 1QQ2A 1SJZA 3TDGA 3SBCA 2IWTA 5G1KA 3HY2A 3RHCA 2QKEA 6GSSA 5JCUA 3BCKA 2FWEA 3QOUA 3TRQA 3KZQA 2FGXA 5C00A 2V1MA 3TOTA 1UVZA 2JL4A 2WJUA 1GTUA 4I5QA 4K8MA 2GZZA 2VL3A 4EL1A 4FYCA 3M9JA 2O89A 4OO5A 3GKMA 1THOA 5ECNB 3VPTA 2JZSA 4V2NA 4AJ6A 4KCEA 3CTGA 1O8WA 2MBSA 4GLTA 2F9SA 3FR9A 3G7YA 2L59A 1XWGA 1TOFA 1JZOA 4G10A 4MJBA 1X9MB 3MDKA 3LGCA 4MZBA 3P2AA 5AIXA 5CREA 4HU9A 1PD21 2VL2A 2E2GA 5IMFA 3WT1A 1R5AA 2CT6A 3CXGA 1IYIA 2BMXA 2PVOC 3FK8A 4IN0A 5ID2B 1VF4A 4V2MA 3MYDA 1TRUA 1PRXA 2QSIA 1SK0A 4D73B 3ZIJA 5L71A 2HRAA 2HSMA 1HD2A 2IFQB 2M80A 2LNTA 1CQHA 1QMVA 4EVMA 4TXOA 3IAM2 2GSQA 4HJMA 1VGLA 1SENA 4PNFA 3ZFLA 3CMIA 4FH8A 4IS0A 3TKSE 3F4SA 3E9JB 3PH9A 1CQGA 1H4OA 4IGJA 1M7TA 3P8WA 2OE3A 4NAXA 4DVCA 3ERGA 1OAZA 1M9AA 4TR0A 3GHAA 3LORA 4WKWA 1GLQA 1WP0A 5ENUA 1A8YA 3FZ9A 4USSA 1TRVA 2V2GA 1A8LA 1GUHA 4TOPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LRC A;  3M3M A;  3H79 A;  4LMV A;  2VAF A;  1HNC A;  5DAK A;  2HRN A;  4GQF A;  2VLT A;  3CSI A;  3GX0 A;  1ABA A;  3EMX A;  3TJF A;  1VF2 A;  3HJP A;  4YQV A;  3TJG A;  4ZBD A;  1OYJ A;  4WXT A;  1WPI A;  1G6W A;  4IBP A;  3US3 A;  4WBR D;  5GAP D;  1TDI A;  1BQ7 A;  3H93 A;  5CRD A;  4MAB A;  3FR6 A;  3HZ4 A;  1JLV A;  2B5X A;  2HZE B;  5F05 A;  1Z5Y E;  1GUL A;  2VIM A;  5KN2 A;  4KSO A;  4KDU A;  2YP6 A;  1Q4J A;  5JWO B;  3BJ5 A;  3TB2 A;  4F2I A;  2CZ2 A;  2E7P A;  16GS A;  3DGQ A;  1S3A A;  3TKS C;  2DIY A;  1TI3 A;  4KDY A;  3DVX A;  3ZMK A;  3K8N A;  2HSY A;  2YPM A;  4K9Z A;  4Q5R A;  3D5J A;  1F3A A;  1GSQ A;  5J9B A;  2V41 A;  1ZYQ B;  3VWV A;  5B6N A;  1K0D A;  3KTL A;  3V1W A;  1ACV A;  3KTB A;  1S3C A;  4GSN A;  4K0G A;  4HZ4 A;  3WGX A;  5IO0 A;  1FOV A;  3WGD A;  3R2Q A;  5JWQ B;  3GST A;  1J0F A;  1LJR A;  1J08 A;  5IMC A;  4EDZ A;  3EC3 A;  1UA5 A;  2N5F A;  1AC1 A;  4OFM A;  1RK4 A;  2GDR A;  1X5D A;  20GS A;  3GKN A;  4J2F A;  2WFC A;  2PUK C;  2E0Q A;  5A4V A;  1SJI A;  4RQR A;  2R6K A;  4BVX A;  3CTF A;  1GH2 A;  6GSY A;  1Q98 A;  4HEA 2;  5E59 A;  2MMO A;  5D9T A;  5LCZ A;  3U6V A;  2PWJ A;  5ELG A;  1K0B A;  5CYY A;  2XBI A;  1EOG A;  4Q5N A;  5GZZ B;  5ECQ B;  1MD4 A;  2FY6 A;  5AGY A;  2DSA A;  3IXR A;  4NV2 A;  2DJ2 A;  4PGT A;  3IE3 A;  4IQA A;  2JU5 A;  3HCZ A;  2V6O A;  2VL9 A;  3AY8 A;  5DQS A;  4QL9 A;  4X0X A;  1EV9 A;  1NHO A;  2VM2 A;  3EUR A;  4MJC A;  5F8B A;  2NVL A;  2K6V A;  1SKW B;  1YF1 A;  2H66 A;  3M1G A;  3LG6 A;  2C4J A;  2WDU A;  5IPG A;  4G9H A;  1XZO A;  3IC4 A;  1LBK A;  1T7P B;  3FZ4 A;  2BJX A;  3F63 A;  2K18 A;  2GLR A;  3HHV A;  4KGI A;  3ZIV A;  4XRD A;  1JZW A;  1SYX A;  2EC4 A;  2HRF A;  3GV1 A;  1BG5 A;  4XIH A;  4NXI A;  2PVQ A;  4DEJ A;  4V1A g;  2C0E A;  2KP1 A;  3HVS A;  3TRX A;  1NW2 A;  4I97 A;  1DE2 A;  2B6M A;  2X8G A;  5G2Z A;  3PIN A;  2KUC A;  2X99 A;  3DKS A;  3DIE A;  5INY A;  2B5Y A;  4TXV A;  1GSF A;  2O7K A;  1XW9 A;  1KBN A;  3NOF A;  5B6M A;  2DJJ A;  3D4M A;  1V40 A;  2E2M A;  1XWA A;  5DDL A;  1SKS B;  1JFU A;  1A0R P;  2DJ3 A;  4KUN A;  4ZIL A;  2CV4 A;  4QQ7 A;  3IK9 A;  3ZLP A;  3DYR A;  4L8E A;  1N2A A;  2J23 A;  1MTC A;  2CX4 A;  2H8L A;  4PX1 A;  4KA0 A;  1YQ1 A;  3KH9 A;  3TJK A;  4CHS A;  1YEP A;  4XCS A;  4KB3 A;  3F0I A;  3QD9 A;  5G30 A;  1OC3 A;  4POB A;  3GTU B;  1F3B A;  1X5C A;  2H71 A;  2YN1 A;  4I2U A;  3ZYW A;  4AF2 A;  5B8A A;  2GTU A;  3LFL A;  3HYP A;  6GSV A;  5DAL A;  4WF5 A;  7GSS A;  1TK8 B;  5G31 A;  1FHE A;  3GH6 A;  3EE2 A;  2ZUP A;  1WIK A;  2IMF A;  3A5W A;  5D96 A;  1K0O A;  3IRA A;  3QCP A;  4LL1 B;  5CP1 A;  1ERT A;  3KIJ A;  2LRN A;  1O7U A;  4DSR A;  1ON4 A;  3ZZX A;  1Y6E A;  2AUV A;  2RUE A;  4F0C A;  3APO A;  3DRN A;  3CBU A;  4HZ2 A;  5D8I A;  19GS A;  3UEM A;  3EYT A;  1K0N A;  4KCA A;  4NWY A;  1Z6N A;  5DBQ A;  1XFL A;  4ECI A;  2PGT A;  2K8V A;  3L0H A;  4RUV A;  2H6X A;  2DLX A;  2C3N A;  1THX A;  3FEU A;  3M8N A;  2FA4 A;  3IV4 A;  3RAZ A;  4E8E A;  3HKR A;  2P31 A;  3FR3 A;  2B1K A;  2P5R A;  2DBC A;  3EU4 A;  5AIV A;  1FG4 A;  2H73 A;  3FYG A;  5IMZ A;  1GP1 A;  3G7I A;  4N10 A;  3TKP A;  3BCI A;  4MK3 A;  1G7E A;  3VK9 A;  3BBY A;  4ML1 A;  2CQ9 A;  4O5R A;  2G0F A;  1XWC A;  5HR2 A;  1ZL9 A;  3WD6 A;  2HI7 A;  4MF5 A;  2MBT A;  2WUL A;  2LNS A;  3ZTL A;  4GCI A;  4TKY A;  5D9W A;  5G5E A;  3IBH A;  2RII A;  4F82 A;  2MYG A;  3ERW A;  3KXO A;  1C72 A;  5FHI A;  3I6A A;  2ZCT A;  1OKT A;  1IYH A;  4NPB A;  1JZD A;  1TJD A;  5ECI B;  2LV3 A;  3D6I A;  5D93 A;  2LJA A;  2FUG 2;  3M0F A;  4K1F A;  2WRT A;  2R4V A;  2H70 A;  4GF0 A;  1U88 A;  3LEF A;  2VCQ A;  2HFD A;  3ZFB A;  4Z7X A;  5DJM A;  2GSR A;  4I6X A;  5G1L A;  2YWI A;  5ECS A;  4XS6 A;  2YWM A;  5LD0 A;  5CRG A;  5DJL A;  5HFI A;  5FT3 A;  2YZH A;  2L4Q A;  4TR1 A;  1LU4 A;  3EWL A;  1TW9 A;  2R3X A;  1XXU A;  2H0H A;  3RHB A;  2M72 A;  5ECK B;  3C1S A;  5COH A;  3PR8 A;  2J9H A;  2NTO A;  2H30 A;  5H5S A;  2RM5 A;  2DC5 A;  1B4P A;  5CRW A;  4I8B A;  1AXD A;  4KX4 A;  5B7C A;  4PQI A;  3KGK A;  3L9S A;  1A2M A;  3W8S A;  1GTI A;  2P0G A;  2YWN A;  2VM1 A;  4X43 A;  2H76 A;  3IPZ A;  3ISO A;  2CVB A;  3HXS A;  2CA8 A;  1AQW A;  1A23 A;  3QMX A;  3VI7 A;  3EVI A;  2RM6 A;  3A2W A;  1FW1 A;  4IQ1 A;  3I43 A;  3VWX A;  1GSY A;  2PU9 C;  4TRX A;  2LQO A;  4G2E A;  3LYK A;  1EZK A;  3UAR A;  1TU7 A;  2BTO T;  4HQS A;  2FWH A;  2P5Q A;  5KEJ A;  5DVB A;  2HYX A;  5DCH A;  3JCM L;  3NZN A;  1GUK A;  3GYK A;  2D2Z A;  5ECR B;  1VRS D;  3C8E A;  1SD9 A;  2XPD A;  18GS A;  4EC0 A;  3UVT A;  5J5N A;  5D9X A;  3DXB A;  2HSH A;  4TVE A;  1X5E A;  1GRX A;  3F3R A;  2C1Y A;  4N11 A;  2CVD A;  1EEJ A;  4L5O A;  1ERU A;  1Z7R A;  2LEG A;  4ISD A;  4IEL A;  3QAW A;  3F8U A;  5HQP A;  14GS A;  4MH2 A;  1X9W B;  3LXZ A;  3MWH A;  2VUP A;  3GKX A;  3VWW A;  3DVW A;  2B5E A;  2EIR A;  3D22 A;  5ID2 A;  2LRT A;  4PUF C;  2B1L A;  4D73 A;  2GT5 A;  3Q19 A;  1AW9 A;  3KMN A;  3TRP A;  2GGT A;  5LNK e;  2IFQ A;  1E6B A;  2DJK A;  1PKZ A;  4JE1 A;  3L4N A;  12GS A;  2JZR A;  1K0C A;  2HLS A;  2RLI A;  1W89 A;  5IOW A;  4LL4 B;  1XWB A;  2VO4 A;  13GS A;  1FO5 A;  1XW5 A;  4JU5 A;  2YNX A;  3EU3 A;  2IJY A;  2HXK A;  1E2Y A;  4GSS A;  3RPP A;  3Q18 A;  3TUE A;  4AJ7 A;  2GZP A;  4ZL9 A;  3MAK A;  1R5P A;  2VCV A;  1T8E B;  1KNG A;  4CW9 A;  2O85 A;  4BA7 A;  3IHQ A;  1SU9 A;  4GXZ A;  3KP8 A;  3UMA A;  3NIV A;  3N9J A;  2H19 A;  3J7Y k;  4TW5 A;  2TRX A;  2YV7 A;  2V6K A;  4KE3 A;  2A2S A;  3ME7 A;  6GSU A;  2MMN A;  4OFN A;  3QDN A;  5EVO A;  4XS4 B;  3I69 A;  1B9Y C;  4MA9 A;  5KN3 A;  2LQQ A;  4K2D A;  3N5O A;  3TGZ A;  5AIS A;  3HZ8 A;  1VF1 A;  1A24 A;  3ZML A;  1R7H A;  2VCZ A;  1PMT A;  3U5R E;  4BWQ A;  4FYB A;  1T1V A;  2PER A;  3C7M A;  4V1A p;  1SL1 B;  3LSZ A;  2YZU A;  1F37 A;  2R2J A;  4ECJ A;  2HZE A;  3TKS A;  2GZY A;  4CDO A;  1G6Y A;  1V58 A;  3HDC A;  1X0R A;  2OJL A;  1BYE A;  3GFK A;  3TKR A;  1NHY A;  2VD0 A;  2I1U A;  4V2L A;  4DSS B;  3OR5 A;  5IM9 A;  4K7O A;  2DJ1 A;  1JLW A;  1ERV A;  1UC7 A;  3W6G A;  3LJR A;  3GIX A;  1PA3 A;  2AB6 A;  2AYT A;  1KTE A;  3MNG A;  2R37 A;  3GRX A;  2H0G A;  1PGT A;  4EXJ A;  1M2D A;  1WWJ A;  1M0U A;  3WGE A;  2L6C A;  1XOB A;  4MMM A;  4O7H A;  4JBB A;  1MEK A;  2K8S A;  2MZC A;  3IA1 A;  3ZRD A;  1PX6 A;  2WGR A;  1FB0 A;  4XS1 A;  1SL0 B;  3IAS 2;  1ZMA A;  4ECC A;  1A2L A;  2RUF A;  4TN8 A;  1XW6 A;  1O85 A;  1PN9 A;  2IMK A;  1A0F A;  3PGT A;  2G2Q A;  4FYU A;  3P7X A;  2V32 A;  2A4V A;  2VOC A;  5D9V A;  3D21 A;  4HS1 A;  2YJH A;  1V2A A;  4N0V A;  1ZYE A;  1SK1 A;  3GL3 A;  1GSE A;  4DSQ A;  2OE0 A;  2AAW A;  3GSS A;  1AQV A;  8GSS A;  2GSS A;  2GQK A;  4NV5 A;  1TRS A;  5GST A;  3FW2 A;  1USB A;  4YQU A;  4POK A;  2H01 A;  4MP4 A;  5J9C A;  5IOX A;  2C8U A;  3TKQ A;  2KOK A;  1FVJ A;  3SWL A;  2GQM A;  4OMV A;  3CSH A;  3J7Y b;  1PX7 A;  4YAP A;  3IK7 A;  2NBS A;  2H72 A;  5F06 A;  1EWX A;  2CVK A;  3M9K A;  1EV4 A;  2YJ7 A;  3VPQ A;  1YKC A;  4F9Z A;  3KM6 A;  4MZW A;  1A2J A;  1YJ6 A;  2PPT A;  2GS3 A;  4POM A;  1Z6M A;  4RQX A;  4ZB9 A;  3CRU A;  2YWO A;  4AGS A;  2IIY A;  4JRR A;  3CRT A;  3G7J A;  4EF0 A;  3E0U A;  2IN3 A;  1EGR A;  2ON7 A;  2PMT A;  3L78 A;  1TU8 A;  1DSB A;  5HR3 A;  2FLS A;  5CRH A;  4OO4 A;  2C0G A;  2IPA A;  3TOU A;  2VLU A;  4IP6 A;  4H86 A;  1WRY A;  1RQM A;  5F07 A;  4N0Z A;  1EP7 A;  1W4V A;  2OAC A;  2IL3 A;  3UJ1 A;  1DBY A;  5KN0 A;  3TCO A;  1U87 A;  3O3T A;  3MSZ A;  5H5Q A;  2TIR A;  1R26 A;  2ALB A;  2XC2 A;  1H75 A;  3RPN A;  4MPG A;  4BPY A;  4KDX A;  3GX8 A;  3L9U A;  3C1R A;  4P3Y B;  4WBJ A;  1XVW A;  2K9F A;  2OBK A;  1GSD A;  3HJO A;  3HJM A;  2IME A;  2CX3 A;  2JSY A;  4ZIJ A;  4XHM A;  4TXO B;  1URM A;  4Q5F A;  4ACS A;  1F9M A;  2LJK A;  4JZQ A;  1G7O A;  2FA8 A;  3IR4 A;  2MMA A;  2C3Q A;  3GTU A;  2MMZ A;  4EE0 A;  3BOA A;  1YDK A;  1GL8 A;  1TTZ A;  4PQ1 A;  3EMP A;  4XTS A;  1T4Z A;  4ILF A;  2KP2 A;  3H4K A;  2HE3 A;  5EY6 A;  1HNB A;  4K6X A;  1PQN A;  1GUM A;  2YCD A;  4TR3 A;  4IVF A;  1AQX A;  1ZZY A;  3UAP A;  1B4Q A;  1GSS A;  2I4A A;  3WT2 A;  5A4W A;  5DAK B;  4KH7 A;  3F4R A;  4EUY A;  1TRW A;  1YKA A;  1BED A;  3UL3 A;  1FAA A;  1MDK A;  4GST A;  1XPV A;  2VLV A;  1SK2 A;  1DUG A;  2OAD A;  4KW6 A;  2NPB A;  1I9D A;  6GSW A;  2N5B A;  2HZF A;  1M99 A;  4MDC A;  3VFI A;  1WE0 A;  4E8H A;  4WR4 A;  4HOJ A;  2GVP A;  1J9B A;  17GS A;  3GNJ A;  4PXO A;  5IMV A;  4X1U A;  4GRF A;  3DML A;  1WOU A;  3KD0 A;  4QL7 A;  3HD5 A;  2C3T A;  1EP8 A;  3UOM A;  4WF4 A;  1V57 A;  2A2R A;  3VI5 A;  3LQ7 A;  4KSM A;  1WJK A;  4PUA A;  3A2V A;  3APQ A;  2DIZ A;  2ON5 A;  2LUS A;  4NHZ A;  1O6J A;  1SJ6 A;  3Q6O A;  1F2E A;  3CSJ A;  2LST A;  4F0B A;  5J41 A;  1SKR B;  4IJ3 A;  4PNG A;  4JR4 A;  4ZL7 A;  1YZX A;  3FZ5 A;  3E3E A;  1RW1 A;  5B8B A;  4OCE A;  2VD1 A;  1ZGN A;  2PN8 A;  4JED A;  1HQO A;  3F4T A;  4PUR A;  1K3O A;  1VF3 A;  1Z3E A;  1UN2 A;  1JZR A;  4IJI A;  4MCU A;  1PL2 A;  3GUR A;  3HVX A;  2C0D A;  2QGV A;  5ECL B;  4EDY A;  2JAC A;  1B9X C;  2H6Y A;  1B48 A;  1Z9H A;  5JWR B;  2REM A;  3F6F A;  1SD8 A;  2X8C A;  2AHE A;  2WS2 A;  4MPF A;  4OWY A;  1U3A A;  4GTU A;  9GSS A;  2I9H A;  4LMW A;  4NMU A;  4LLR A;  3KP9 A;  1S3D A;  4TR4 A;  5E4W A;  3ZL5 A;  2DML A;  11GS A;  2IMI A;  3GH9 A;  5CO3 A;  2H1B A;  2L4C A;  3KEB A;  2H0I A;  3KCM A;  1YF0 A;  3LWA A;  4IHU A;  4Q5Q A;  4WR5 A;  1AIU A;  3GL5 A;  1EOH A;  1R4W A;  3RDW A;  6GSX A;  5KN1 A;  5HFK A;  3TJJ A;  2JZT A;  2R5G A;  4ML6 A;  1ZOF A;  1TK5 B;  2EIO A;  2XPE A;  3H1N A;  1OKD A;  22GS A;  5CAX A;  4XRA A;  1ERW A;  2JAD A;  5IMD A;  4ID0 A;  1B8X A;  2DJ0 A;  2GQL A;  5JCG A;  2OA7 A;  1FB6 A;  2WB9 A;  1OVN A;  4G19 A;  3I9V 2;  2OBI A;  3A3T A;  1ML6 A;  3LXT A;  5DCG A;  3L9V A;  4NHW A;  2C0F A;  3C71 A;  2IMD A;  5ECH B;  1MDJ A;  2XHF A;  1T00 A;  4L0U A;  1O81 A;  2I81 A;  1TKD B;  2Z9S A;  5HR0 A;  2YV9 A;  5ELA A;  2H6Z A;  3DD3 A;  2H74 A;  1T3B A;  1GLP A;  2VCT A;  2H75 A;  4PQH A;  1U6T A;  3F9U A;  4YQM A;  1PSQ A;  2L57 A;  5A4U A;  4HU7 A;  1O73 A;  5IPH A;  2B3S A;  2B7K A;  1K3Y A;  1OC9 B;  3FKF A;  5F0G A;  1TI1 A;  3GA4 A;  1XOA A;  2OKA A;  3ED3 A;  2JSZ A;  2QC7 A;  3EIN A;  2L5O A;  4ZL8 A;  1XBS A;  1ST9 A;  4HDE A;  2LJR A;  1X9S B;  2HT9 A;  5HFG A;  4K7I A;  2FWG A;  4EO3 A;  1NM3 A;  3ERF A;  1GNE A;  2XBQ A;  2GST A;  1XCC A;  2WZ9 A;  1GWC A;  4ZXG A;  3HA9 A;  1XWK A;  2CAQ A;  1QXH A;  4ULX A;  1BX9 A;  1XVQ A;  4ZBB A;  4K7N A;  2H1D A;  3GKK A;  4HUA A;  2O8V B;  3FY7 A;  5JCW A;  1O8X A;  3QPM A;  1M9B A;  5H5R A;  5DAL B;  4AJ8 A;  1PL1 A;  3RBT A;  3KJY A;  3QAV A;  2M46 A;  1EEM A;  1KEB A;  1AAZ A;  1XIY A;  3GMF A;  4OD7 A;  4OFT A;  1QFN A;  4MH3 A;  1SYR A;  2GT6 A;  1K3L A;  2F51 A;  3QAG A;  5ECM B;  4BWS A;  4HJ2 A;  3IDV A;  1V9W A;  3ZIT A;  3S9F A;  1ILO A;  1BAY A;  1ZCP A;  1QK8 A;  2TRC P;  4N30 A;  2KHP A;  4FO5 A;  3DWV A;  3ZVJ D;  2ES7 A;  5C04 A;  1BJX A;  2WCI A;  2I3Y A;  4WEY A;  5GAN D;  3C73 A;  4MF7 A;  2VCW A;  1TP9 A;  1QGV A;  2FCH A;  1YEX A;  3QFA C;  5IQY A;  5AN1 A;  1M2B A;  1QUW A;  2H1A A;  4BL7 A;  5G5F A;  6GST A;  1OE7 A;  4XS4 A;  3QFB C;  2C80 A;  4F03 A;  1YY7 A;  2AV4 A;  3ME8 A;  4L0W A;  3LYP A;  2CAI A;  3CYN A;  1DE1 A;  2AJQ B;  5EL8 A;  1OC9 A;  3VLN A;  3HVV A;  3QR6 A;  3VUR A;  3GN3 A;  4WET A;  4HI7 A;  4O92 A;  4K0N A;  4MJA A;  4ZB6 A;  1N8J A;  1Y25 A;  3APS A;  3FHK A;  1I5G A;  1V98 A;  1M2A A;  2X64 A;  1HYU A;  3UVH A;  4RI6 A;  5ABR A;  3KMO A;  5J4U A;  4MF6 A;  3DEX A;  3IOS A;  2F3M A;  3D4T A;  1GNW A;  1GSU A;  3FZA A;  3D0Z A;  10GS A;  3VWU A;  4DSS A;  2H1G A;  2KLX A;  2NDO A;  5HR1 A;  2N5A A;  3ZVJ A;  1U3I A;  3F6D A;  3G9B A;  4J57 E;  4MZC A;  4YH2 A;  4ZBA A;  2LTK A;  4FIW A;  1TXX A;  2YOI A;  4MJE A;  2L5L A;  2LS5 A;  3F3Q A;  4EKZ A;  3O6T A;  3BD2 A;  1WMJ A;  4L5L A;  4BVY A;  4RI7 A;  5ECP B;  3WYW A;  4JR6 A;  3ZRE A;  2F8F A;  4MLY A;  2CZ3 A;  1T4Y A;  5GSS A;  1AUC A;  1G0T A;  3Q74 A;  3UBK A;  2B7J A;  5D73 A;  4O32 A;  1OE8 A;  1TK0 B;  2DMM A;  1SL2 B;  1GTB A;  1GTA A;  2FNO A;  4OCF A;  4KAE A;  1K0A A;  4ECB A;  1Z7P A;  4IP1 A;  4TR1 B;  1EGO A;  2X8H A;  2F8A A;  5DQY A;  1F6M C;  1JHB A;  2O87 A;  5EPF A;  2L6D A;  2VCX A;  4ZB8 A;  3UBL A;  4POL A;  4GQC A;  5IIZ A;  3TJB A;  2YAN A;  1HNA A;  4HQZ A;  1PKW A;  3P90 A;  4I2T A;  2FWF A;  4J56 E;  3O76 A;  2VL2 C;  3A2X A;  4YAV A;  1K0M A;  4IKH A;  2FD3 A;  5A5K A;  5IMA A;  1MD3 A;  4IW9 A;  2PBJ A;  1OC8 A;  5J3R A;  5FWG A;  1FVK A;  2EIQ A;  5IO2 A;  2ZNM A;  5ECO B;  4KND A;  2OE1 A;  2HNL A;  3W8J A;  3H8Q A;  1MDI A;  4LA1 A;  3GUS A;  3FRC A;  3UIW A;  3KH7 A;  5CNW A;  2FHE A;  2LKU A;  4GWR A;  1NSW A;  1QQ2 A;  1SJZ A;  3TDG A;  3SBC A;  2IWT A;  5G1K A;  3HY2 A;  3RHC A;  2QKE A;  6GSS A;  5JCU A;  3BCK A;  2FWE A;  3QOU A;  3TRQ A;  3KZQ A;  2FGX A;  5C00 A;  2V1M A;  3TOT A;  1UVZ A;  2JL4 A;  2WJU A;  1GTU A;  4I5Q A;  4K8M A;  2GZZ A;  2VL3 A;  4EL1 A;  4FYC A;  3M9J A;  2O89 A;  4OO5 A;  3GKM A;  1THO A;  5ECN B;  3VPT A;  2JZS A;  4V2N A;  4AJ6 A;  4KCE A;  3CTG A;  1O8W A;  2MBS A;  4GLT A;  2F9S A;  3FR9 A;  3G7Y A;  2L59 A;  1XWG A;  1TOF A;  1JZO A;  4G10 A;  4MJB A;  1X9M B;  3MDK A;  3LGC A;  4MZB A;  3P2A A;  5AIX A;  5CRE A;  4HU9 A;  1PD2 1;  2VL2 A;  2E2G A;  5IMF A;  3WT1 A;  1R5A A;  2CT6 A;  3CXG A;  1IYI A;  2BMX A;  2PVO C;  3FK8 A;  4IN0 A;  5ID2 B;  1VF4 A;  4V2M A;  1TRU A;  1PRX A;  2QSI A;  1SK0 A;  4D73 B;  3ZIJ A;  5L71 A;  1HD2 A;  2IFQ B;  2M80 A;  2LNT A;  1CQH A;  1QMV A;  4EVM A;  4TXO A;  3IAM 2;  2GSQ A;  4HJM A;  1VGL A;  1SEN A;  4PNF A;  3ZFL A;  3CMI A;  4FH8 A;  4IS0 A;  3TKS E;  3F4S A;  3E9J B;  3PH9 A;  1CQG A;  1H4O A;  4IGJ A;  1M7T A;  3P8W A;  2OE3 A;  4NAX A;  4DVC A;  3ERG A;  1OAZ A;  1M9A A;  4TR0 A;  3GHA A;  3LOR A;  4WKW A;  1GLQ A;  1WP0 A;  5ENU A;  1A8Y A;  3FZ9 A;  1TRV A;  2V2G A;  1A8L A;  1GUH A;  4TOP A; 
#chains in the Genus database with same CATH topology
 2LRC A;  3M3M A;  3H79 A;  4LMV A;  2VAF A;  1HNC A;  5DAK A;  2HRN A;  4GQF A;  2VLT A;  3CSI A;  3GX0 A;  1ABA A;  3EMX A;  3TJF A;  1VF2 A;  3HJP A;  4YQV A;  3TJG A;  4ZBD A;  1OYJ A;  4WXT A;  1WPI A;  1G6W A;  4IBP A;  3US3 A;  4WBR D;  5GAP D;  1TDI A;  1BQ7 A;  3H93 A;  5CRD A;  4MAB A;  3FR6 A;  3HZ4 A;  1JLV A;  2B5X A;  2HZE B;  5F05 A;  1Z5Y E;  1GUL A;  2VIM A;  5KN2 A;  4KSO A;  4KDU A;  2YP6 A;  1Q4J A;  5JWO B;  3BJ5 A;  3TB2 A;  4F2I A;  2CZ2 A;  2E7P A;  16GS A;  3DGQ A;  1S3A A;  3TKS C;  2DIY A;  1TI3 A;  4KDY A;  3DVX A;  3ZMK A;  3K8N A;  2HSY A;  2YPM A;  4K9Z A;  4Q5R A;  3D5J A;  1F3A A;  1GSQ A;  5J9B A;  1S3R A;  2V41 A;  2QA1 A;  1ZYQ B;  3VWV A;  5B6N A;  1K0D A;  3KTL A;  3V1W A;  1ACV A;  3KTB A;  1S3C A;  4GSN A;  4K0G A;  4HZ4 A;  3WGX A;  5IO0 A;  1FOV A;  3WGD A;  3R2Q A;  5JWQ B;  3GST A;  1J0F A;  1LJR A;  1J08 A;  5IMC A;  4EDZ A;  3EC3 A;  1UA5 A;  2N5F A;  1AC1 A;  4OFM A;  1RK4 A;  2GDR A;  1X5D A;  20GS A;  3GKN A;  4J2F A;  2WFC A;  2PUK C;  2E0Q A;  5A4V A;  1SJI A;  4RQR A;  2R6K A;  4BVX A;  3CTF A;  1GH2 A;  6GSY A;  1Q98 A;  4HEA 2;  5E59 A;  2MMO A;  3LW9 A;  5D9T A;  5LCZ A;  3U6V A;  2PWJ A;  5ELG A;  1K0B A;  5CYY A;  2XBI A;  1EOG A;  4Q5N A;  5GZZ B;  5ECQ B;  1MD4 A;  2FY6 A;  5AGY A;  2DSA A;  3IXR A;  1PN0 A;  4NV2 A;  2DJ2 A;  4PGT A;  3IE3 A;  4IQA A;  2JU5 A;  3HCZ A;  2V6O A;  2VL9 A;  3AY8 A;  5DQS A;  4QL9 A;  4X0X A;  1EV9 A;  1NHO A;  2VM2 A;  3EUR A;  4MJC A;  5F8B A;  2NVL A;  2K6V A;  1SKW B;  1YF1 A;  2H66 A;  3M1G A;  3LG6 A;  2C4J A;  2WDU A;  5IPG A;  4G9H A;  1XZO A;  3IC4 A;  4X4J A;  1LBK A;  1XG8 A;  1T7P B;  3FZ4 A;  2BJX A;  3F63 A;  1ZYN A;  2K18 A;  2GLR A;  3HHV A;  2X49 A;  4KGI A;  3ZIV A;  4XRD A;  1JZW A;  1SYX A;  2EC4 A;  2HRF A;  3GV1 A;  1BG5 A;  4XIH A;  4NXI A;  2PVQ A;  4DEJ A;  4V1A g;  2C0E A;  2KP1 A;  3HVS A;  3TRX A;  1NW2 A;  4I97 A;  1DE2 A;  2B6M A;  2X8G A;  5G2Z A;  3PIN A;  2KUC A;  2X99 A;  3DKS A;  3DIE A;  5INY A;  2B5Y A;  4TXV A;  1GSF A;  2O7K A;  1XW9 A;  1KBN A;  3NOF A;  5B6M A;  2DJJ A;  3D4M A;  1V40 A;  2E2M A;  1XWA A;  5DDL A;  1SKS B;  1JFU A;  1A0R P;  2DJ3 A;  4KUN A;  4ZIL A;  2CV4 A;  4QQ7 A;  3IK9 A;  3ZLP A;  3DYR A;  4L8E A;  1N2A A;  2J23 A;  1MTC A;  2CX4 A;  2H8L A;  4PX1 A;  4KA0 A;  1YQ1 A;  3KH9 A;  3TJK A;  4CHS A;  1YEP A;  4XCS A;  4KB3 A;  3F0I A;  3QD9 A;  5G30 A;  1OC3 A;  4POB A;  3GTU B;  1F3B A;  1X5C A;  2H71 A;  2YN1 A;  4I2U A;  3ZYW A;  4AF2 A;  5B8A A;  2GTU A;  3LFL A;  3HYP A;  6GSV A;  5DAL A;  4WF5 A;  7GSS A;  1TK8 B;  5G31 A;  1FHE A;  3GH6 A;  3EE2 A;  2ZUP A;  1WIK A;  2IMF A;  3A5W A;  5D96 A;  1K0O A;  3IRA A;  3QCP A;  4LL1 B;  5CP1 A;  1ERT A;  3KIJ A;  2LRN A;  1O7U A;  4DSR A;  1ON4 A;  3ZZX A;  5KOX A;  1Y6E A;  2AUV A;  2RUE A;  4F0C A;  3APO A;  3DRN A;  3CBU A;  4HZ2 A;  5D8I A;  19GS A;  3UEM A;  3EYT A;  1K0N A;  4KCA A;  4NWY A;  1Z6N A;  5DBQ A;  3A5I A;  1XFL A;  4ECI A;  2PGT A;  2K8V A;  4BIK A;  3L0H A;  4RUV A;  2H6X A;  2DLX A;  2R0G A;  2C3N A;  1THX A;  3FEU A;  3M8N A;  2FA4 A;  3IV4 A;  3RAZ A;  4E8E A;  3HKR A;  2P31 A;  2R0C A;  3FR3 A;  2B1K A;  2P5R A;  2DBC A;  3EU4 A;  5AIV A;  1FG4 A;  2H73 A;  3FYG A;  5IMZ A;  1GP1 A;  3G7I A;  4N10 A;  3TKP A;  3BCI A;  4MK3 A;  1G7E A;  3VK9 A;  3BBY A;  4ML1 A;  2CQ9 A;  4O5R A;  2G0F A;  1XWC A;  5HR2 A;  4YKG A;  1ZL9 A;  3WD6 A;  2HI7 A;  4MF5 A;  2MBT A;  4KF9 A;  2WUL A;  2LNS A;  3ZTL A;  4GCI A;  4TKY A;  5D9W A;  5G5E A;  3IBH A;  2RII A;  4F82 A;  2MYG A;  3ERW A;  3KXO A;  1C72 A;  5FHI A;  3I6A A;  2ZCT A;  1OKT A;  1IYH A;  4NPB A;  1JZD A;  1TJD A;  5ECI B;  2LV3 A;  3D6I A;  5D93 A;  2LJA A;  2FUG 2;  3M0F A;  4K1F A;  2WRT A;  2R4V A;  2H70 A;  4GF0 A;  1U88 A;  3LEF A;  2VCQ A;  2HFD A;  3ZFB A;  4Z7X A;  5DJM A;  2GSR A;  4I6X A;  5G1L A;  2YWI A;  5ECS A;  4XS6 A;  2YWM A;  5LD0 A;  5CRG A;  5DJL A;  5HFI A;  5FT3 A;  2YZH A;  2L4Q A;  4TR1 A;  1LU4 A;  3EWL A;  1TW9 A;  2R3X A;  1XXU A;  2H0H A;  3RHB A;  2M72 A;  5ECK B;  3C1S A;  5COH A;  3PR8 A;  3HVN A;  2J9H A;  2NTO A;  2H30 A;  5H5S A;  2RM5 A;  5KOW A;  2DC5 A;  1B4P A;  5CRW A;  4I8B A;  1AXD A;  4KX4 A;  5B7C A;  4PQI A;  3KGK A;  3L9S A;  1A2M A;  3W8S A;  1GTI A;  2P0G A;  2YWN A;  2VM1 A;  4X43 A;  2H76 A;  3IPZ A;  4G0L A;  3ISO A;  2CVB A;  3HXS A;  2CA8 A;  1AQW A;  1A23 A;  3QMX A;  3VI7 A;  3EVI A;  2RM6 A;  3A2W A;  1FW1 A;  4IQ1 A;  3I43 A;  3VWX A;  1GSY A;  2PU9 C;  4TRX A;  2LQO A;  4G2E A;  3LYK A;  1EZK A;  3UAR A;  1TU7 A;  2BTO T;  4HQS A;  2FWH A;  1M3J A;  2P5Q A;  5KEJ A;  5DVB A;  2HYX A;  5DCH A;  3JCM L;  3NZN A;  1GUK A;  3GYK A;  4FQU A;  2D2Z A;  5ECR B;  1VRS D;  3C8E A;  1SD9 A;  2XPD A;  18GS A;  4EC0 A;  3UVT A;  5J5N A;  5D9X A;  3DXB A;  2HSH A;  4TVE A;  1X5E A;  1GRX A;  3F3R A;  2C1Y A;  4N11 A;  2CVD A;  1EEJ A;  4L5O A;  1ERU A;  1Z7R A;  2LEG A;  4ISD A;  4IEL A;  3QAW A;  3F8U A;  5HQP A;  14GS A;  4MH2 A;  1X9W B;  3LXZ A;  3MWH A;  2VUP A;  3GKX A;  3VWW A;  3DVW A;  2B5E A;  2EIR A;  3D22 A;  5ID2 A;  2LRT A;  4PUF C;  2B1L A;  4D73 A;  2GT5 A;  3Q19 A;  1AW9 A;  3KMN A;  3TRP A;  2GGT A;  4K5R A;  5LNK e;  2IFQ A;  1E6B A;  2DJK A;  1PKZ A;  4JE1 A;  3L4N A;  12GS A;  1PFO A;  2JZR A;  1K0C A;  2HLS A;  2RLI A;  1W89 A;  5IOW A;  4G0I A;  4LL4 B;  1XWB A;  2VO4 A;  13GS A;  1FO5 A;  4K2X A;  1XW5 A;  4JU5 A;  2YNX A;  3EU3 A;  2IJY A;  2HXK A;  1E2Y A;  4GSS A;  3RPP A;  3Q18 A;  3TUE A;  4AJ7 A;  2GZP A;  4ZL9 A;  3MAK A;  1R5P A;  2VCV A;  1T8E B;  1KNG A;  4CW9 A;  2O85 A;  4BA7 A;  3IHQ A;  1SU9 A;  4GXZ A;  3KP8 A;  3UMA A;  3NIV A;  5BRT A;  3N9J A;  2H19 A;  3J7Y k;  4TW5 A;  2TRX A;  2YV7 A;  2V6K A;  4KE3 A;  2A2S A;  3ME7 A;  4CY8 A;  6GSU A;  2MMN A;  4OFN A;  4BL7 B;  3QDN A;  5EVO A;  4XS4 B;  3I69 A;  1B9Y C;  4MA9 A;  5KN3 A;  2LQQ A;  4K2D A;  3N5O A;  3TGZ A;  5AIS A;  3HZ8 A;  4G0K A;  1VF1 A;  1A24 A;  3ZML A;  1R7H A;  2VCZ A;  1PMT A;  3U5R E;  4BWQ A;  4FYB A;  1T1V A;  2PER A;  3C7M A;  4V1A p;  1SL1 B;  3LSZ A;  2YZU A;  1F37 A;  2R2J A;  4ECJ A;  2HZE A;  3TKS A;  2GZY A;  4CDO A;  1G6Y A;  1V58 A;  3HDC A;  1X0R A;  2OJL A;  1BYE A;  3GFK A;  3TKR A;  1NHY A;  2VD0 A;  2I1U A;  4V2L A;  4DSS B;  3OR5 A;  5IM9 A;  4YKF A;  4K7O A;  2DJ1 A;  1JLW A;  1ERV A;  1UC7 A;  3W6G A;  3LJR A;  3GIX A;  1PA3 A;  2AB6 A;  2AYT A;  1KTE A;  3MNG A;  2R37 A;  3GRX A;  2H0G A;  1PGT A;  4EXJ A;  3IHG A;  1M2D A;  1WWJ A;  1M0U A;  3WGE A;  2L6C A;  1XOB A;  4MMM A;  2UZ8 A;  4O7H A;  4BVY B;  4JBB A;  1MEK A;  2K8S A;  2MZC A;  3IA1 A;  3ZRD A;  1PX6 A;  2WGR A;  1FB0 A;  4HSC X;  4XS1 A;  4MNN A;  1SL0 B;  3IAS 2;  1ZMA A;  4ECC A;  1A2L A;  2RUF A;  4TN8 A;  1XW6 A;  1O85 A;  1PN9 A;  2IMK A;  1A0F A;  3PGT A;  2G2Q A;  4FYU A;  3P7X A;  2V32 A;  2A4V A;  2VOC A;  5D9V A;  3D21 A;  4HS1 A;  2YJH A;  1V2A A;  4N0V A;  1ZYE A;  1SK1 A;  3GL3 A;  1GSE A;  4DSQ A;  2OE0 A;  2AAW A;  4K5S A;  3GSS A;  1AQV A;  4ICY A;  8GSS A;  2GSS A;  2GQK A;  4NV5 A;  1TRS A;  5GST A;  3FW2 A;  1USB A;  4YQU A;  4POK A;  3MIX A;  2H01 A;  4MP4 A;  5J9C A;  5IOX A;  2C8U A;  3TKQ A;  2KOK A;  1FVJ A;  3SWL A;  2GQM A;  4OMV A;  3CSH A;  3J7Y b;  1PX7 A;  4YAP A;  2A4H A;  3IK7 A;  4O5Q A;  2NBS A;  2H72 A;  5F06 A;  1EWX A;  2CVK A;  3M9K A;  1EV4 A;  2YJ7 A;  3VPQ A;  1YKC A;  4F9Z A;  3KM6 A;  4MZW A;  1A2J A;  1YJ6 A;  2PPT A;  2GS3 A;  4POM A;  1Z6M A;  4RQX A;  4ZB9 A;  3CRU A;  2YWO A;  4AGS A;  2IIY A;  2HRK A;  4JRR A;  3CRT A;  3G7J A;  4EF0 A;  3E0U A;  2IN3 A;  1EGR A;  2ON7 A;  2PMT A;  3L78 A;  1TU8 A;  1DSB A;  5HR3 A;  2FLS A;  5CRH A;  4OO4 A;  2C0G A;  2IPA A;  3TOU A;  2VLU A;  4IP6 A;  4H86 A;  1WRY A;  1RQM A;  5F07 A;  4N0Z A;  1EP7 A;  1W4V A;  2OAC A;  2IL3 A;  3UJ1 A;  1DBY A;  5KN0 A;  3TCO A;  1U87 A;  3O3T A;  3MSZ A;  5H5Q A;  2TIR A;  1R26 A;  2ALB A;  2XC2 A;  1H75 A;  3RPN A;  4MPG A;  4BPY A;  4KDX A;  3GX8 A;  3L9U A;  3C1R A;  4P3Y B;  4WBJ A;  1XVW A;  2K9F A;  2OBK A;  1GSD A;  3HJO A;  3HJM A;  2IME A;  2CX3 A;  2JSY A;  4ZIJ A;  1ZYP A;  4XHM A;  4TXO B;  1URM A;  4Q5F A;  4ACS A;  1F9M A;  2LJK A;  4JZQ A;  1G7O A;  2FA8 A;  3IR4 A;  2MMA A;  2C3Q A;  4CY6 A;  3GTU A;  2MMZ A;  4EE0 A;  3BOA A;  1YDK A;  1GL8 A;  1TTZ A;  4PQ1 A;  3EMP A;  4XTS A;  1T4Z A;  4ILF A;  2KP2 A;  3H4K A;  2HE3 A;  5EY6 A;  1HNB A;  4K6X A;  1PQN A;  1GUM A;  2YCD A;  4TR3 A;  4IVF A;  1AQX A;  1ZZY A;  3UAP A;  1B4Q A;  1GSS A;  2I4A A;  3WT2 A;  5A4W A;  4O5U A;  5DAK B;  4KH7 A;  3F4R A;  3R3E A;  4EUY A;  1TRW A;  1YKA A;  1BED A;  3UL3 A;  1FAA A;  1MDK A;  4GST A;  1XPV A;  2VLV A;  1SK2 A;  1DUG A;  4A5P A;  2OAD A;  4KW6 A;  2NPB A;  1I9D A;  6GSW A;  2N5B A;  2HZF A;  1M99 A;  4MDC A;  3VFI A;  1WE0 A;  4E8H A;  4WR4 A;  4HOJ A;  2GVP A;  1J9B A;  17GS A;  3GNJ A;  4PXO A;  5IMV A;  4X1U A;  4GRF A;  3DML A;  1WOU A;  3KD0 A;  4QL7 A;  3HD5 A;  2C3T A;  1EP8 A;  3UOM A;  4WF4 A;  1V57 A;  2A2R A;  3VI5 A;  3LQ7 A;  4KSM A;  1WJK A;  4PUA A;  3A2V A;  3APQ A;  3EPT A;  2DIZ A;  2ON5 A;  2LUS A;  4NHZ A;  1O6J A;  1SJ6 A;  3Q6O A;  1F2E A;  3CSJ A;  2LST A;  4F0B A;  5J41 A;  1SKR B;  4IJ3 A;  4PNG A;  4JR4 A;  4ZL7 A;  1YZX A;  3FZ5 A;  3E3E A;  1RW1 A;  5B8B A;  4OCE A;  2VD1 A;  1ZGN A;  2PN8 A;  1FOH A;  4JED A;  1HQO A;  3F4T A;  4PUR A;  1K3O A;  1VF3 A;  1Z3E A;  1UN2 A;  1JZR A;  4IJI A;  4MCU A;  1PL2 A;  3GUR A;  3HVX A;  2C0D A;  2QGV A;  5ECL B;  4EDY A;  2JAC A;  1B9X C;  2H6Y A;  1B48 A;  1Z9H A;  5JWR B;  2REM A;  5BMU A;  3F6F A;  1SD8 A;  2X8C A;  2AHE A;  2WS2 A;  4MPF A;  4OWY A;  4BVX B;  1U3A A;  4GTU A;  9GSS A;  2I9H A;  4LMW A;  4NMU A;  4LLR A;  3KP9 A;  1S3D A;  4TR4 A;  5E4W A;  3ZL5 A;  2DML A;  4EIQ A;  11GS A;  2IMI A;  3GH9 A;  5CO3 A;  2H1B A;  2L4C A;  3KEB A;  2H0I A;  3KCM A;  1YF0 A;  3LWA A;  4IHU A;  4Q5Q A;  4WR5 A;  1AIU A;  3GL5 A;  1EOH A;  1R4W A;  3RDW A;  6GSX A;  5KN1 A;  5HFK A;  3TJJ A;  2JZT A;  2R5G A;  4ML6 A;  1ZOF A;  1TK5 B;  2EIO A;  2XPE A;  3H1N A;  1OKD A;  22GS A;  5CAX A;  4XRA A;  1ERW A;  2JAD A;  5IMD A;  4ID0 A;  1B8X A;  2DJ0 A;  2GQL A;  5JCG A;  2OA7 A;  1FB6 A;  2WB9 A;  1OVN A;  4Z2R A;  4G19 A;  3I9V 2;  2OBI A;  3A3T A;  1ML6 A;  3FMW A;  3LXT A;  3CQF A;  5DCG A;  3L9V A;  4NHW A;  2C0F A;  3C71 A;  2IMD A;  5ECH B;  1MDJ A;  2XHF A;  1T00 A;  4L0U A;  1O81 A;  2I81 A;  1TKD B;  2Z9S A;  5HR0 A;  2YV9 A;  5ELA A;  2H6Z A;  3DD3 A;  2H74 A;  1T3B A;  1GLP A;  2VCT A;  2H75 A;  4PQH A;  1U6T A;  3F9U A;  4YQM A;  1PSQ A;  2L57 A;  5A4U A;  4HU7 A;  1O73 A;  5IPH A;  2B3S A;  2B7K A;  1K3Y A;  1OC9 B;  3FKF A;  5F0G A;  1TI1 A;  3GA4 A;  1XOA A;  2OKA A;  3ED3 A;  2JSZ A;  2QC7 A;  3EIN A;  2L5O A;  4ZL8 A;  1XBS A;  1ST9 A;  4HDE A;  2LJR A;  1X9S B;  2HT9 A;  5HFG A;  4K7I A;  2FWG A;  4EO3 A;  1NM3 A;  3ERF A;  1GNE A;  2XBQ A;  2GST A;  1XCC A;  2WZ9 A;  1GWC A;  4ZXG A;  3HA9 A;  1XWK A;  2CAQ A;  1QXH A;  4ULX A;  1BX9 A;  1XVQ A;  4ZBB A;  4K7N A;  2H1D A;  3GKK A;  4HUA A;  2O8V B;  3FY7 A;  5JCW A;  1O8X A;  3QPM A;  1M9B A;  5H5R A;  5DAL B;  4AJ8 A;  1PL1 A;  3RBT A;  3KJY A;  3QAV A;  2M46 A;  1EEM A;  1KEB A;  1AAZ A;  1XIY A;  3GMF A;  4OD7 A;  4OFT A;  1QFN A;  4MH3 A;  1SYR A;  2GT6 A;  1K3L A;  2F51 A;  3QAG A;  5ECM B;  4BWS A;  4HJ2 A;  3IDV A;  1V9W A;  3ZIT A;  3S9F A;  2R0P A;  1ILO A;  1BAY A;  1ZCP A;  1QK8 A;  2TRC P;  2QA2 A;  4N30 A;  2KHP A;  4FO5 A;  3DWV A;  3ZVJ D;  2ES7 A;  5C04 A;  1BJX A;  2WCI A;  4WEY A;  2I3Y A;  3PPU A;  5GAN D;  3C73 A;  4MF7 A;  2VCW A;  1TP9 A;  1QGV A;  2FCH A;  1YEX A;  3QFA C;  5IQY A;  5AN1 A;  1M2B A;  1QUW A;  2H1A A;  4BL7 A;  5G5F A;  6GST A;  1OE7 A;  4XS4 A;  3QFB C;  2C80 A;  4F03 A;  1YY7 A;  2AV4 A;  3ME8 A;  4L0W A;  4Z2U A;  3LYP A;  2CAI A;  3CYN A;  1DE1 A;  2AJQ B;  5EL8 A;  1OC9 A;  3VLN A;  3HVV A;  3QR6 A;  3VUR A;  3GN3 A;  4WET A;  4HI7 A;  4O92 A;  4K0N A;  4MJA A;  4ZB6 A;  4PTS A;  1N8J A;  1Y25 A;  3APS A;  3FHK A;  1I5G A;  1V98 A;  1M2A A;  2X64 A;  1HYU A;  3UVH A;  4RI6 A;  5ABR A;  3KMO A;  5J4U A;  4MF6 A;  3DEX A;  3IOS A;  2F3M A;  3D4T A;  1GNW A;  1GSU A;  3FZA A;  3D0Z A;  10GS A;  3VWU A;  4DSS A;  2H1G A;  2KLX A;  2NDO A;  2A2P A;  5HR1 A;  3IC8 A;  2N5A A;  3ZVJ A;  1U3I A;  3F6D A;  4YH2 A;  3G9B A;  4J57 E;  4MZC A;  4ZBA A;  2LTK A;  4FIW A;  1TXX A;  2YOI A;  4MJE A;  4EIP A;  2L5L A;  2LS5 A;  3F3Q A;  4EKZ A;  3O6T A;  3BD2 A;  1WMJ A;  4L5L A;  4BVY A;  4RI7 A;  5ECP B;  3WYW A;  4JR6 A;  3ZRE A;  2F8F A;  4MLY A;  2CZ3 A;  1T4Y A;  5GSS A;  1AUC A;  1G0T A;  2X4A A;  3Q74 A;  3UBK A;  2B7J A;  5D73 A;  4O32 A;  1OE8 A;  1TK0 B;  2DMM A;  1SL2 B;  2DKH A;  1GTB A;  1GTA A;  2FNO A;  4OCF A;  4KAE A;  1K0A A;  4ECB A;  1Z7P A;  4IP1 A;  4TR1 B;  1EGO A;  2X8H A;  2F8A A;  5DQY A;  1F6M C;  1JHB A;  2O87 A;  5EPF A;  2L6D A;  2VCX A;  4ZB8 A;  3UBL A;  4POL A;  4GQC A;  5IIZ A;  3TJB A;  2YAN A;  1HNA A;  4HQZ A;  1PKW A;  3P90 A;  4I2T A;  2FWF A;  4J56 E;  3O76 A;  2VL2 C;  3A2X A;  4YAV A;  1K0M A;  4IKH A;  2FD3 A;  5A5K A;  5IMA A;  1MD3 A;  4IW9 A;  2PBJ A;  1OC8 A;  2DKI A;  5J3R A;  5FWG A;  1FVK A;  2EIQ A;  5IO2 A;  2ZNM A;  5ECO B;  4KND A;  2OE1 A;  2HNL A;  3W8J A;  3H8Q A;  1MDI A;  4LA1 A;  3GUS A;  3FRC A;  3UIW A;  4Z2T A;  3KH7 A;  5CNW A;  2FHE A;  2LKU A;  4GWR A;  1NSW A;  1QQ2 A;  1SJZ A;  3TDG A;  3SBC A;  2IWT A;  5G1K A;  3HY2 A;  3RHC A;  2QKE A;  6GSS A;  5JCU A;  3BCK A;  2FWE A;  3QOU A;  3TRQ A;  3KZQ A;  2FGX A;  5C00 A;  2V1M A;  3TOT A;  1UVZ A;  2JL4 A;  2WJU A;  1GTU A;  4I5Q A;  4K8M A;  2GZZ A;  2VL3 A;  4EL1 A;  4FYC A;  3M9J A;  2O89 A;  4OO5 A;  3GKM A;  1THO A;  5ECN B;  3VPT A;  2JZS A;  4V2N A;  4AJ6 A;  4KCE A;  3CTG A;  1O8W A;  2MBS A;  4GLT A;  2F9S A;  3FR9 A;  3G7Y A;  2L59 A;  1XWG A;  1TOF A;  1JZO A;  4G10 A;  4MJB A;  1X9M B;  3MDK A;  3LGC A;  4MZB A;  3P2A A;  5AIX A;  5CRE A;  4HU9 A;  1PD2 1;  2VL2 A;  2E2G A;  5IMF A;  3WT1 A;  1R5A A;  2CT6 A;  3CXG A;  1IYI A;  2BMX A;  2PVO C;  3FK8 A;  4IN0 A;  5ID2 B;  1VF4 A;  4V2M A;  3MYD A;  1TRU A;  1PRX A;  2QSI A;  1SK0 A;  4D73 B;  3ZIJ A;  5L71 A;  2HRA A;  2HSM A;  1HD2 A;  2IFQ B;  2M80 A;  2LNT A;  1CQH A;  1QMV A;  4EVM A;  4TXO A;  3IAM 2;  2GSQ A;  4HJM A;  1VGL A;  1SEN A;  4PNF A;  3ZFL A;  3CMI A;  4FH8 A;  4IS0 A;  3TKS E;  3F4S A;  3E9J B;  3PH9 A;  1CQG A;  1H4O A;  4IGJ A;  1M7T A;  3P8W A;  2OE3 A;  4NAX A;  4DVC A;  3ERG A;  1OAZ A;  1M9A A;  4TR0 A;  3GHA A;  3LOR A;  4WKW A;  1GLQ A;  1M3I A;  1WP0 A;  5ENU A;  1A8Y A;  3FZ9 A;  4USS A;  1TRV A;  2V2G A;  1A8L A;  1GUH A;  4TOP A; 
#chains in the Genus database with same CATH homology
 2LRC A;  3M3M A;  3H79 A;  4LMV A;  2VAF A;  1HNC A;  5DAK A;  2HRN A;  4GQF A;  2VLT A;  3CSI A;  3GX0 A;  1ABA A;  3EMX A;  3TJF A;  1VF2 A;  3HJP A;  4YQV A;  3TJG A;  4ZBD A;  1OYJ A;  4WXT A;  1WPI A;  1G6W A;  4IBP A;  3US3 A;  4WBR D;  5GAP D;  1TDI A;  1BQ7 A;  3H93 A;  5CRD A;  4MAB A;  3FR6 A;  3HZ4 A;  1JLV A;  2B5X A;  2HZE B;  5F05 A;  1Z5Y E;  1GUL A;  2VIM A;  5KN2 A;  4KSO A;  4KDU A;  2YP6 A;  1Q4J A;  5JWO B;  3BJ5 A;  3TB2 A;  4F2I A;  2CZ2 A;  2E7P A;  16GS A;  3DGQ A;  1S3A A;  3TKS C;  2DIY A;  1TI3 A;  4KDY A;  3DVX A;  3ZMK A;  3K8N A;  2HSY A;  2YPM A;  4K9Z A;  4Q5R A;  3D5J A;  1F3A A;  1GSQ A;  5J9B A;  2V41 A;  2QA1 A;  1ZYQ B;  3VWV A;  5B6N A;  1K0D A;  3KTL A;  3V1W A;  1ACV A;  3KTB A;  1S3C A;  4GSN A;  4K0G A;  4HZ4 A;  3WGX A;  5IO0 A;  1FOV A;  3WGD A;  3R2Q A;  5JWQ B;  3GST A;  1J0F A;  1LJR A;  1J08 A;  5IMC A;  4EDZ A;  3EC3 A;  1UA5 A;  2N5F A;  1AC1 A;  4OFM A;  1RK4 A;  2GDR A;  1X5D A;  20GS A;  3GKN A;  4J2F A;  2WFC A;  2PUK C;  2E0Q A;  5A4V A;  1SJI A;  4RQR A;  2R6K A;  4BVX A;  3CTF A;  1GH2 A;  6GSY A;  1Q98 A;  4HEA 2;  5E59 A;  2MMO A;  3LW9 A;  5D9T A;  5LCZ A;  3U6V A;  2PWJ A;  5ELG A;  1K0B A;  5CYY A;  2XBI A;  1EOG A;  4Q5N A;  5GZZ B;  5ECQ B;  1MD4 A;  2FY6 A;  5AGY A;  2DSA A;  3IXR A;  1PN0 A;  4NV2 A;  2DJ2 A;  4PGT A;  3IE3 A;  4IQA A;  2JU5 A;  3HCZ A;  2V6O A;  2VL9 A;  3AY8 A;  5DQS A;  4QL9 A;  4X0X A;  1EV9 A;  1NHO A;  2VM2 A;  3EUR A;  4MJC A;  5F8B A;  2NVL A;  2K6V A;  1SKW B;  1YF1 A;  2H66 A;  3M1G A;  3LG6 A;  2C4J A;  2WDU A;  5IPG A;  4G9H A;  1XZO A;  3IC4 A;  4X4J A;  1LBK A;  1T7P B;  3FZ4 A;  2BJX A;  3F63 A;  1ZYN A;  2K18 A;  2GLR A;  3HHV A;  2X49 A;  4KGI A;  3ZIV A;  4XRD A;  1JZW A;  1SYX A;  2EC4 A;  2HRF A;  3GV1 A;  1BG5 A;  4XIH A;  4NXI A;  2PVQ A;  4DEJ A;  4V1A g;  2C0E A;  2KP1 A;  3HVS A;  3TRX A;  1NW2 A;  4I97 A;  1DE2 A;  2B6M A;  2X8G A;  5G2Z A;  3PIN A;  2KUC A;  2X99 A;  3DKS A;  3DIE A;  5INY A;  2B5Y A;  4TXV A;  1GSF A;  2O7K A;  1XW9 A;  1KBN A;  3NOF A;  5B6M A;  2DJJ A;  3D4M A;  1V40 A;  2E2M A;  1XWA A;  5DDL A;  1SKS B;  1JFU A;  1A0R P;  2DJ3 A;  4KUN A;  4ZIL A;  2CV4 A;  4QQ7 A;  3IK9 A;  3ZLP A;  3DYR A;  4L8E A;  1N2A A;  2J23 A;  1MTC A;  2CX4 A;  2H8L A;  4PX1 A;  4KA0 A;  1YQ1 A;  3KH9 A;  3TJK A;  4CHS A;  1YEP A;  4XCS A;  4KB3 A;  3F0I A;  3QD9 A;  5G30 A;  1OC3 A;  4POB A;  3GTU B;  1F3B A;  1X5C A;  2H71 A;  2YN1 A;  4I2U A;  3ZYW A;  4AF2 A;  5B8A A;  2GTU A;  3LFL A;  3HYP A;  6GSV A;  5DAL A;  4WF5 A;  7GSS A;  1TK8 B;  5G31 A;  1FHE A;  3GH6 A;  3EE2 A;  2ZUP A;  1WIK A;  2IMF A;  3A5W A;  5D96 A;  1K0O A;  3IRA A;  3QCP A;  4LL1 B;  5CP1 A;  1ERT A;  3KIJ A;  2LRN A;  1O7U A;  4DSR A;  1ON4 A;  3ZZX A;  5KOX A;  1Y6E A;  2AUV A;  2RUE A;  4F0C A;  3APO A;  3DRN A;  3CBU A;  4HZ2 A;  5D8I A;  19GS A;  3UEM A;  3EYT A;  1K0N A;  4KCA A;  4NWY A;  1Z6N A;  5DBQ A;  3A5I A;  1XFL A;  4ECI A;  2PGT A;  2K8V A;  3L0H A;  4RUV A;  2H6X A;  2DLX A;  2R0G A;  2C3N A;  1THX A;  3FEU A;  3M8N A;  2FA4 A;  3IV4 A;  3RAZ A;  4E8E A;  3HKR A;  2P31 A;  2R0C A;  3FR3 A;  2B1K A;  2P5R A;  2DBC A;  3EU4 A;  5AIV A;  1FG4 A;  2H73 A;  3FYG A;  5IMZ A;  1GP1 A;  3G7I A;  4N10 A;  3TKP A;  3BCI A;  4MK3 A;  1G7E A;  3VK9 A;  3BBY A;  4ML1 A;  2CQ9 A;  4O5R A;  2G0F A;  1XWC A;  5HR2 A;  4YKG A;  1ZL9 A;  3WD6 A;  2HI7 A;  4MF5 A;  2MBT A;  4KF9 A;  2WUL A;  2LNS A;  3ZTL A;  4GCI A;  4TKY A;  5D9W A;  5G5E A;  3IBH A;  2RII A;  4F82 A;  2MYG A;  3ERW A;  3KXO A;  1C72 A;  5FHI A;  3I6A A;  2ZCT A;  1OKT A;  1IYH A;  4NPB A;  1JZD A;  1TJD A;  5ECI B;  2LV3 A;  3D6I A;  5D93 A;  2LJA A;  2FUG 2;  3M0F A;  4K1F A;  2WRT A;  2R4V A;  2H70 A;  4GF0 A;  1U88 A;  3LEF A;  2VCQ A;  2HFD A;  3ZFB A;  4Z7X A;  5DJM A;  2GSR A;  4I6X A;  5G1L A;  2YWI A;  5ECS A;  4XS6 A;  2YWM A;  5LD0 A;  5CRG A;  5DJL A;  5HFI A;  5FT3 A;  2YZH A;  2L4Q A;  4TR1 A;  1LU4 A;  3EWL A;  1TW9 A;  2R3X A;  1XXU A;  2H0H A;  3RHB A;  2M72 A;  5ECK B;  3C1S A;  5COH A;  3PR8 A;  2J9H A;  2NTO A;  2H30 A;  5H5S A;  2RM5 A;  5KOW A;  2DC5 A;  1B4P A;  5CRW A;  4I8B A;  1AXD A;  4KX4 A;  5B7C A;  4PQI A;  3KGK A;  3L9S A;  1A2M A;  3W8S A;  1GTI A;  2P0G A;  2YWN A;  2VM1 A;  4X43 A;  2H76 A;  3IPZ A;  4G0L A;  3ISO A;  2CVB A;  3HXS A;  2CA8 A;  1AQW A;  1A23 A;  3QMX A;  3VI7 A;  3EVI A;  2RM6 A;  3A2W A;  1FW1 A;  4IQ1 A;  3I43 A;  3VWX A;  1GSY A;  2PU9 C;  4TRX A;  2LQO A;  4G2E A;  3LYK A;  1EZK A;  3UAR A;  1TU7 A;  2BTO T;  4HQS A;  2FWH A;  2P5Q A;  5KEJ A;  5DVB A;  2HYX A;  5DCH A;  3JCM L;  3NZN A;  1GUK A;  3GYK A;  4FQU A;  2D2Z A;  5ECR B;  1VRS D;  3C8E A;  1SD9 A;  2XPD A;  18GS A;  4EC0 A;  3UVT A;  5J5N A;  5D9X A;  3DXB A;  2HSH A;  4TVE A;  1X5E A;  1GRX A;  3F3R A;  2C1Y A;  4N11 A;  2CVD A;  1EEJ A;  4L5O A;  1ERU A;  1Z7R A;  2LEG A;  4ISD A;  4IEL A;  3QAW A;  3F8U A;  5HQP A;  14GS A;  4MH2 A;  1X9W B;  3LXZ A;  3MWH A;  2VUP A;  3GKX A;  3VWW A;  3DVW A;  2B5E A;  2EIR A;  3D22 A;  5ID2 A;  2LRT A;  4PUF C;  2B1L A;  4D73 A;  2GT5 A;  3Q19 A;  1AW9 A;  3KMN A;  3TRP A;  2GGT A;  4K5R A;  5LNK e;  2IFQ A;  1E6B A;  2DJK A;  1PKZ A;  4JE1 A;  3L4N A;  12GS A;  2JZR A;  1K0C A;  2HLS A;  2RLI A;  1W89 A;  5IOW A;  4G0I A;  4LL4 B;  1XWB A;  2VO4 A;  13GS A;  1FO5 A;  4K2X A;  1XW5 A;  4JU5 A;  2YNX A;  3EU3 A;  2IJY A;  2HXK A;  1E2Y A;  4GSS A;  3RPP A;  3Q18 A;  3TUE A;  4AJ7 A;  2GZP A;  4ZL9 A;  3MAK A;  1R5P A;  2VCV A;  1T8E B;  1KNG A;  4CW9 A;  2O85 A;  4BA7 A;  3IHQ A;  1SU9 A;  4GXZ A;  3KP8 A;  3UMA A;  3NIV A;  5BRT A;  3N9J A;  2H19 A;  3J7Y k;  4TW5 A;  2TRX A;  2YV7 A;  2V6K A;  4KE3 A;  2A2S A;  3ME7 A;  4CY8 A;  6GSU A;  2MMN A;  4OFN A;  4BL7 B;  3QDN A;  5EVO A;  4XS4 B;  3I69 A;  1B9Y C;  4MA9 A;  5KN3 A;  2LQQ A;  4K2D A;  3N5O A;  3TGZ A;  5AIS A;  3HZ8 A;  4G0K A;  1VF1 A;  1A24 A;  3ZML A;  1R7H A;  2VCZ A;  1PMT A;  3U5R E;  4BWQ A;  4FYB A;  1T1V A;  2PER A;  3C7M A;  4V1A p;  1SL1 B;  3LSZ A;  2YZU A;  1F37 A;  2R2J A;  4ECJ A;  2HZE A;  3TKS A;  2GZY A;  4CDO A;  1G6Y A;  1V58 A;  3HDC A;  1X0R A;  2OJL A;  1BYE A;  3GFK A;  3TKR A;  1NHY A;  2VD0 A;  2I1U A;  4V2L A;  4DSS B;  3OR5 A;  5IM9 A;  4YKF A;  4K7O A;  2DJ1 A;  1JLW A;  1ERV A;  1UC7 A;  3W6G A;  3LJR A;  3GIX A;  1PA3 A;  2AB6 A;  2AYT A;  1KTE A;  3MNG A;  2R37 A;  3GRX A;  2H0G A;  1PGT A;  4EXJ A;  3IHG A;  1M2D A;  1WWJ A;  1M0U A;  3WGE A;  2L6C A;  1XOB A;  4MMM A;  2UZ8 A;  4O7H A;  4BVY B;  4JBB A;  1MEK A;  2K8S A;  2MZC A;  3IA1 A;  3ZRD A;  1PX6 A;  2WGR A;  1FB0 A;  4XS1 A;  1SL0 B;  4MNN A;  3IAS 2;  1ZMA A;  4ECC A;  1A2L A;  2RUF A;  4TN8 A;  1XW6 A;  1O85 A;  1PN9 A;  2IMK A;  1A0F A;  3PGT A;  2G2Q A;  4FYU A;  3P7X A;  2V32 A;  2A4V A;  2VOC A;  5D9V A;  3D21 A;  4HS1 A;  2YJH A;  1V2A A;  4N0V A;  1ZYE A;  1SK1 A;  3GL3 A;  1GSE A;  4DSQ A;  2OE0 A;  2AAW A;  4K5S A;  3GSS A;  1AQV A;  4ICY A;  8GSS A;  2GSS A;  2GQK A;  4NV5 A;  1TRS A;  5GST A;  3FW2 A;  1USB A;  4YQU A;  4POK A;  3MIX A;  2H01 A;  4MP4 A;  5J9C A;  5IOX A;  2C8U A;  3TKQ A;  2KOK A;  1FVJ A;  3SWL A;  2GQM A;  4OMV A;  3CSH A;  3J7Y b;  1PX7 A;  4YAP A;  2A4H A;  3IK7 A;  4O5Q A;  2NBS A;  2H72 A;  5F06 A;  1EWX A;  2CVK A;  3M9K A;  1EV4 A;  2YJ7 A;  3VPQ A;  1YKC A;  4F9Z A;  3KM6 A;  4MZW A;  1A2J A;  1YJ6 A;  2PPT A;  2GS3 A;  4POM A;  1Z6M A;  4RQX A;  4ZB9 A;  3CRU A;  2YWO A;  4AGS A;  2IIY A;  2HRK A;  4JRR A;  3CRT A;  3G7J A;  4EF0 A;  3E0U A;  2IN3 A;  1EGR A;  2ON7 A;  2PMT A;  3L78 A;  1TU8 A;  1DSB A;  5HR3 A;  2FLS A;  5CRH A;  4OO4 A;  2C0G A;  2IPA A;  3TOU A;  2VLU A;  4IP6 A;  4H86 A;  1WRY A;  1RQM A;  5F07 A;  4N0Z A;  1EP7 A;  1W4V A;  2OAC A;  2IL3 A;  3UJ1 A;  1DBY A;  5KN0 A;  3TCO A;  1U87 A;  3O3T A;  3MSZ A;  5H5Q A;  2TIR A;  1R26 A;  2ALB A;  2XC2 A;  1H75 A;  3RPN A;  4MPG A;  4BPY A;  4KDX A;  3GX8 A;  3L9U A;  3C1R A;  4P3Y B;  4WBJ A;  1XVW A;  2K9F A;  2OBK A;  1GSD A;  3HJO A;  3HJM A;  2IME A;  2CX3 A;  2JSY A;  4ZIJ A;  1ZYP A;  4XHM A;  4TXO B;  1URM A;  4Q5F A;  4ACS A;  1F9M A;  2LJK A;  4JZQ A;  1G7O A;  2FA8 A;  3IR4 A;  2MMA A;  2C3Q A;  4CY6 A;  3GTU A;  2MMZ A;  4EE0 A;  3BOA A;  1YDK A;  1GL8 A;  1TTZ A;  4PQ1 A;  3EMP A;  4XTS A;  1T4Z A;  4ILF A;  2KP2 A;  3H4K A;  2HE3 A;  5EY6 A;  1HNB A;  4K6X A;  1PQN A;  1GUM A;  2YCD A;  4TR3 A;  4IVF A;  1AQX A;  1ZZY A;  3UAP A;  1B4Q A;  1GSS A;  2I4A A;  3WT2 A;  5A4W A;  4O5U A;  5DAK B;  4KH7 A;  3F4R A;  3R3E A;  4EUY A;  1TRW A;  1YKA A;  1BED A;  3UL3 A;  1FAA A;  1MDK A;  4GST A;  1XPV A;  2VLV A;  1SK2 A;  1DUG A;  4A5P A;  2OAD A;  4KW6 A;  2NPB A;  1I9D A;  6GSW A;  2N5B A;  2HZF A;  1M99 A;  4MDC A;  3VFI A;  1WE0 A;  4E8H A;  4WR4 A;  4HOJ A;  2GVP A;  1J9B A;  17GS A;  3GNJ A;  4PXO A;  5IMV A;  4X1U A;  4GRF A;  3DML A;  1WOU A;  3KD0 A;  4QL7 A;  3HD5 A;  2C3T A;  1EP8 A;  3UOM A;  4WF4 A;  1V57 A;  2A2R A;  3VI5 A;  3LQ7 A;  4KSM A;  1WJK A;  4PUA A;  3A2V A;  3APQ A;  3EPT A;  2DIZ A;  2ON5 A;  2LUS A;  4NHZ A;  1O6J A;  1SJ6 A;  3Q6O A;  1F2E A;  3CSJ A;  2LST A;  4F0B A;  5J41 A;  1SKR B;  4IJ3 A;  4PNG A;  4JR4 A;  4ZL7 A;  1YZX A;  3FZ5 A;  3E3E A;  1RW1 A;  5B8B A;  4OCE A;  2VD1 A;  1ZGN A;  2PN8 A;  1FOH A;  4JED A;  1HQO A;  3F4T A;  4PUR A;  1K3O A;  1VF3 A;  1Z3E A;  1UN2 A;  1JZR A;  4IJI A;  4MCU A;  1PL2 A;  3GUR A;  3HVX A;  2C0D A;  2QGV A;  5ECL B;  4EDY A;  2JAC A;  1B9X C;  2H6Y A;  1B48 A;  1Z9H A;  5JWR B;  2REM A;  5BMU A;  3F6F A;  1SD8 A;  2X8C A;  2AHE A;  2WS2 A;  4MPF A;  4OWY A;  4BVX B;  1U3A A;  4GTU A;  9GSS A;  2I9H A;  4LMW A;  4NMU A;  4LLR A;  3KP9 A;  1S3D A;  4TR4 A;  5E4W A;  3ZL5 A;  2DML A;  4EIQ A;  11GS A;  2IMI A;  3GH9 A;  5CO3 A;  2H1B A;  2L4C A;  3KEB A;  2H0I A;  3KCM A;  1YF0 A;  3LWA A;  4IHU A;  4Q5Q A;  4WR5 A;  1AIU A;  3GL5 A;  1EOH A;  1R4W A;  3RDW A;  6GSX A;  5KN1 A;  5HFK A;  3TJJ A;  2JZT A;  2R5G A;  4ML6 A;  1ZOF A;  1TK5 B;  2EIO A;  2XPE A;  3H1N A;  1OKD A;  22GS A;  5CAX A;  4XRA A;  1ERW A;  2JAD A;  5IMD A;  4ID0 A;  1B8X A;  2DJ0 A;  2GQL A;  5JCG A;  2OA7 A;  1FB6 A;  2WB9 A;  1OVN A;  4Z2R A;  4G19 A;  3I9V 2;  2OBI A;  3A3T A;  1ML6 A;  3FMW A;  3LXT A;  5DCG A;  3L9V A;  4NHW A;  2C0F A;  3C71 A;  2IMD A;  5ECH B;  1MDJ A;  2XHF A;  1T00 A;  4L0U A;  1O81 A;  2I81 A;  1TKD B;  2Z9S A;  5HR0 A;  2YV9 A;  5ELA A;  2H6Z A;  3DD3 A;  2H74 A;  1T3B A;  1GLP A;  2VCT A;  2H75 A;  4PQH A;  1U6T A;  3F9U A;  4YQM A;  1PSQ A;  2L57 A;  5A4U A;  4HU7 A;  1O73 A;  5IPH A;  2B3S A;  2B7K A;  1K3Y A;  1OC9 B;  3FKF A;  5F0G A;  1TI1 A;  3GA4 A;  1XOA A;  2OKA A;  3ED3 A;  2JSZ A;  2QC7 A;  3EIN A;  2L5O A;  4ZL8 A;  1XBS A;  1ST9 A;  4HDE A;  2LJR A;  1X9S B;  2HT9 A;  5HFG A;  4K7I A;  2FWG A;  4EO3 A;  1NM3 A;  3ERF A;  1GNE A;  2XBQ A;  2GST A;  1XCC A;  2WZ9 A;  1GWC A;  4ZXG A;  3HA9 A;  1XWK A;  2CAQ A;  1QXH A;  4ULX A;  1BX9 A;  1XVQ A;  4ZBB A;  4K7N A;  2H1D A;  3GKK A;  4HUA A;  2O8V B;  3FY7 A;  5JCW A;  1O8X A;  3QPM A;  1M9B A;  5H5R A;  5DAL B;  4AJ8 A;  1PL1 A;  3RBT A;  3KJY A;  3QAV A;  2M46 A;  1EEM A;  1KEB A;  1AAZ A;  1XIY A;  3GMF A;  4OD7 A;  4OFT A;  1QFN A;  4MH3 A;  1SYR A;  2GT6 A;  1K3L A;  2F51 A;  3QAG A;  5ECM B;  4BWS A;  4HJ2 A;  3IDV A;  1V9W A;  3ZIT A;  3S9F A;  2R0P A;  1ILO A;  1BAY A;  1ZCP A;  1QK8 A;  2TRC P;  2QA2 A;  4N30 A;  2KHP A;  4FO5 A;  3DWV A;  3ZVJ D;  2ES7 A;  5C04 A;  1BJX A;  2WCI A;  4WEY A;  2I3Y A;  3PPU A;  5GAN D;  3C73 A;  4MF7 A;  2VCW A;  1TP9 A;  1QGV A;  2FCH A;  1YEX A;  3QFA C;  5IQY A;  5AN1 A;  1M2B A;  1QUW A;  2H1A A;  4BL7 A;  5G5F A;  6GST A;  1OE7 A;  4XS4 A;  3QFB C;  2C80 A;  4F03 A;  1YY7 A;  2AV4 A;  3ME8 A;  4L0W A;  4Z2U A;  3LYP A;  2CAI A;  3CYN A;  1DE1 A;  2AJQ B;  5EL8 A;  1OC9 A;  3VLN A;  3HVV A;  3QR6 A;  3VUR A;  3GN3 A;  4WET A;  4HI7 A;  4O92 A;  4K0N A;  4MJA A;  4ZB6 A;  4PTS A;  1N8J A;  1Y25 A;  3APS A;  3FHK A;  1I5G A;  1V98 A;  1M2A A;  2X64 A;  1HYU A;  3UVH A;  4RI6 A;  5ABR A;  3KMO A;  5J4U A;  4MF6 A;  3DEX A;  3IOS A;  2F3M A;  3D4T A;  1GNW A;  1GSU A;  3FZA A;  3D0Z A;  10GS A;  3VWU A;  4DSS A;  2H1G A;  2KLX A;  2NDO A;  2A2P A;  5HR1 A;  3IC8 A;  2N5A A;  3ZVJ A;  1U3I A;  3F6D A;  4YH2 A;  3G9B A;  4J57 E;  4MZC A;  4ZBA A;  2LTK A;  4FIW A;  1TXX A;  2YOI A;  4MJE A;  4EIP A;  2L5L A;  2LS5 A;  3F3Q A;  4EKZ A;  3O6T A;  3BD2 A;  1WMJ A;  4L5L A;  4BVY A;  4RI7 A;  5ECP B;  3WYW A;  4JR6 A;  3ZRE A;  2F8F A;  4MLY A;  2CZ3 A;  1T4Y A;  5GSS A;  1AUC A;  1G0T A;  2X4A A;  3Q74 A;  3UBK A;  2B7J A;  5D73 A;  4O32 A;  1OE8 A;  1TK0 B;  2DMM A;  1SL2 B;  2DKH A;  1GTB A;  1GTA A;  2FNO A;  4OCF A;  4KAE A;  1K0A A;  4ECB A;  1Z7P A;  4IP1 A;  4TR1 B;  1EGO A;  2X8H A;  2F8A A;  5DQY A;  1F6M C;  1JHB A;  2O87 A;  5EPF A;  2L6D A;  2VCX A;  4ZB8 A;  3UBL A;  4POL A;  4GQC A;  5IIZ A;  3TJB A;  2YAN A;  1HNA A;  4HQZ A;  1PKW A;  3P90 A;  4I2T A;  2FWF A;  4J56 E;  3O76 A;  2VL2 C;  3A2X A;  4YAV A;  1K0M A;  4IKH A;  2FD3 A;  5A5K A;  5IMA A;  1MD3 A;  4IW9 A;  2PBJ A;  1OC8 A;  2DKI A;  5J3R A;  5FWG A;  1FVK A;  2EIQ A;  5IO2 A;  2ZNM A;  5ECO B;  4KND A;  2OE1 A;  2HNL A;  3W8J A;  3H8Q A;  1MDI A;  4LA1 A;  3GUS A;  3FRC A;  3UIW A;  4Z2T A;  3KH7 A;  5CNW A;  2FHE A;  2LKU A;  4GWR A;  1NSW A;  1QQ2 A;  1SJZ A;  3TDG A;  3SBC A;  2IWT A;  5G1K A;  3HY2 A;  3RHC A;  2QKE A;  6GSS A;  5JCU A;  3BCK A;  2FWE A;  3QOU A;  3TRQ A;  3KZQ A;  2FGX A;  5C00 A;  2V1M A;  3TOT A;  1UVZ A;  2JL4 A;  2WJU A;  1GTU A;  4I5Q A;  4K8M A;  2GZZ A;  2VL3 A;  4EL1 A;  4FYC A;  3M9J A;  2O89 A;  4OO5 A;  3GKM A;  1THO A;  5ECN B;  3VPT A;  2JZS A;  4V2N A;  4AJ6 A;  4KCE A;  3CTG A;  1O8W A;  2MBS A;  4GLT A;  2F9S A;  3FR9 A;  3G7Y A;  2L59 A;  1XWG A;  1TOF A;  1JZO A;  4G10 A;  4MJB A;  1X9M B;  3MDK A;  3LGC A;  4MZB A;  3P2A A;  5AIX A;  5CRE A;  4HU9 A;  1PD2 1;  2VL2 A;  2E2G A;  5IMF A;  3WT1 A;  1R5A A;  2CT6 A;  3CXG A;  1IYI A;  2BMX A;  2PVO C;  3FK8 A;  4IN0 A;  5ID2 B;  1VF4 A;  4V2M A;  3MYD A;  1TRU A;  1PRX A;  2QSI A;  1SK0 A;  4D73 B;  3ZIJ A;  5L71 A;  2HRA A;  2HSM A;  1HD2 A;  2IFQ B;  2M80 A;  2LNT A;  1CQH A;  1QMV A;  4EVM A;  4TXO A;  3IAM 2;  2GSQ A;  4HJM A;  1VGL A;  1SEN A;  4PNF A;  3ZFL A;  3CMI A;  4FH8 A;  4IS0 A;  3TKS E;  3F4S A;  3E9J B;  3PH9 A;  1CQG A;  1H4O A;  4IGJ A;  1M7T A;  3P8W A;  2OE3 A;  4NAX A;  4DVC A;  3ERG A;  1OAZ A;  1M9A A;  4TR0 A;  3GHA A;  3LOR A;  4WKW A;  1GLQ A;  1WP0 A;  5ENU A;  1A8Y A;  3FZ9 A;  4USS A;  1TRV A;  2V2G A;  1A8L A;  1GUH A;  4TOP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...