3HYPA

Crystal structure of bacteroides fragilis trxp_s105g mutant
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
117
structure length
117
Chain Sequence
GTIHLTRAEFLKKIADYENHSKEWKYLGDKPAIVDFYADWCGPCKMVAPILEELSKEYAGKIYIYKVNVDKEPELARDFGIQGIPTIWFVPMKGEPQVNMGALSKEQLKGYIDKVLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Thioredoxin
publication title In vivo oxidative protein folding can be facilitated by oxidation-reduction cycling
pubmed doi rcsb
source organism Bacteroides fragilis
total genus 25
structure length 117
sequence length 117
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3hypA01
4MPFA 1SU9A 3KGKA 4MJAA 2LRCA 2GZPA 4EC0A 2N5FA 3BJ5A 1OKDA 4EO3A 1USBA 3GTUB 1R4WA 2B5XA 2GQKA 3TGZA 2JSZA 1OC9A 4OFMA 3M9JA 1SYXA 3IBHA 4WF4A 4HJMA 2L4CA 4ILFA 1TDIA 1X9MB 4NAXA 5KN0A 4J56E 2L4QA 3LORA 3L9SA 1ZCPA 1Y25A 4IHUA 2GSSA 2N5BA 4OCEA 1GL8A 3GH6A 1NSWA 2YV7A 1CQHA 4N0ZA 5F0GA 2VLVA 4ZIJA 3WYWA 2IMEA 3FZ4A 2I1UA 1JLVA 2C1YA 3ME8A 2DSAA 4IQAA 3ZITA 2X99A 1TKDB 2VL2A 3ZIVA 1EEMA 3F4TA 1SENA 2DMLA 2HNLA 4I6XA 1WE0A 4POBA 4XCSA 1KEBA 2O8VB 3C1SA 4DVCA 3RAZA 2K8SA 1A8YA 4I8BA 1NM3A 3BBYA 5J41A 4TXOA 2HRNA 3IPZA 4EKZA 1E6BA 2CT6A 3J7Yb 4HZ4A 3HY2A 4IN0A 3KTLA 3VWXA 4NMUA 2X8HA 1X5CA 2YZHA 1F2EA 4GSNA 4ACSA 2B5YA 4XHMA 5CAXA 2MZCA 3UBLA 1SKSB 2YCDA 5ECRB 20GSA 4FIWA 2H1GA 3D21A 4TR3A 1A23A 4Q5RA 2LNTA 3G7YA 4GQCA 1PL1A 1GSDA 3GSSA 4GLTA 3A2WA 1FO5A 5D9TA 14GSA 8GSSA 4ZB9A 1TK5B 3TKSC 2FD3A 4ZB6A 2H74A 1A2JA 1R5AA 1PX7A 5G1LA 1SYRA 2E7PA 3L78A 1MDKA 5EL8A 5L71A 2DLXA 4EDZA 3A2XA 1SL2B 1XW9A 3ME7A 2PBJA 1A8LA 4GF0A 4PURA 1K0DA 2DMMA 4G19A 3WT2A 3WT1A 1SD8A 1KBNA 2QKEA 3LEFA 4DSRA 3TJFA 5ECNB 1TI3A 2TIRA 3CRTA 1PGTA 1V98A 2RM6A 3F3RA 4K7NA 1UN2A 5FWGA 3VLNA 2O87A 4PUAA 1M7TA 1ERTA 5JWOB 3G9BA 1ZGNA 1T4YA 1GNEA 4OFTA 2MBSA 2R4VA 5G1KA 1IYIA 1DE1A 1DUGA 1E2YA 4LLRA 3O3TA 1XZOA 2FWGA 4OMVA 1SJ6A 1TOFA 3ZMKA 2HLSA 2XC2A 3EVIA 2HYXA 4V2LA 1XOBA 4EVMA 1MDIA 4L5OA 1EEJA 5DVBA 1FAAA 1K0BA 3DYRA 3S9FA 3Q18A 2RLIA 9GSSA 1TRWA 4OWYA 2X64A 2FA4A 2ON7A 1K0OA 3FYGA 4HI7A 4XS4A 2E2MA 3FW2A 1URMA 6GSTA 5GSSA 4OO5A 4IJIA 2DJ0A 2VAFA 2OE1A 4ZXGA 4K0NA 3DVWA 4V2MA 4P3YB 3HVVA 2N5AA 2AHEA 1B48A 2CX3A 3GL3A 3GMFA 4F2IA 2QGVA 4NWYA 2VCZA 1X0RA 2VCTA 5CNWA 1EGRA 3D5JA 1OVNA 5LNKe 3DWVA 1XOAA 3GRXA 1ACVA 3DXBA 3I9V2 3TJBA 1XWGA 1XIYA 2H71A 1QMVA 3MAKA 1O81A 1Z6NA 2PUKC 3VURA 2IPAA 1X9SB 4LA1A 3L4NA 4E8HA 1BEDA 4WF5A 4X1UA 2R3XA 5AISA 3BD2A 4XRDA 1ZYQB 2C0GA 5H5QA 5GAND 3E9JB 1QFNA 3FK8A 2RIIA 4ML1A 1JZWA 4OFNA 3TKQA 5J4UA 1Q98A 1GUHA 1XCCA 1GRXA 2NTOA 5IPGA 3EU3A 2L5OA 3H93A 1TU8A 1K0CA 1UC7A 3TRPA 2AJQB 1BAYA 3GKKA 2C4JA 4TRXA 1Y6EA 4BPYA 4LL4B 1RQMA 4ZL7A 2C3QA 4ML6A 5DBQA 3H8QA 3F0IA 5G5FA 4ZILA 4F82A 1ZMAA 1O73A 5CP1A 3VK9A 5EVOA 1JHBA 4GWRA 1JZDA 3CTGA 4IJ3A 4F9ZA 4I2TA 2M80A 2M72A 3W6GA 3WGDA 1GSUA 2IN3A 4AJ6A 2H0IA 4K2DA 4ZBBA 4DSSA 2EIRA 5JCGA 1KTEA 4IP1A 4V1Ap 4ID0A 2JZTA 3HCZA 3UOMA 4POLA 2GSRA 4LMVA 2A4VA 1OC8A 1XFLA 2QC7A 5B6NA 1F3AA 4QL9A 1S3CA 3TCOA 3GUSA 4G10A 2YWIA 4I5QA 3KMOA 4JU5A 2WS2A 4KH7A 1A0FA 2OACA 4BA7A 2IWTA 1GNWA 1KNGA 2CVBA 2YNXA 2OJLA 1QK8A 5DALA 4GRFA 1K0MA 2D2ZA 3EC3A 2L6DA 2X8GA 3K8NA 3QAWA 4NPBA 3CXGA 5IO0A 2TRCP 1QQ2A 2AYTA 5KN1A 1B9XC 2E0QA 1DE2A 2KLXA 2PGTA 4TKYA 1M0UA 3UVTA 4HDEA 2HZEA 4GQFA 4F0CA 4EF0A 2RUFA 3HVSA 1Z7RA 3HHVA 4LMWA 3J7Yk 4I97A 2FWEA 2KP1A 4JR6A 3G7IA 1A0RP 3ZREA 2HT9A 1XWBA 5DJLA 3ZL5A 2P0GA 4MH3A 1RW1A 3BCIA 1YEXA 2GSQA 5DDLA 11GSA 1YJ6A 1SD9A 4FH8A 1XWKA 1T4ZA 4MF5A 2FGXA 1EV4A 2V2GA 3PR8A 4G9HA 1SK1A 5IO2A 2ON5A 1TK8B 3F8UA 3TB2A 4V1Ag 2AAWA 4WBJA 2GT6A 3WGEA 2OE0A 2OE3A 1G7EA 3M9KA 4CDOA 4KAEA 2DJJA 4MJBA 3KD0A 1GSEA 1VF3A 1O8WA 2MMNA 5B7CA 1GH2A 2YWOA 5DCGA 4EDYA 2IJYA 1JLWA 4JZQA 1LU4A 2BMXA 3P90A 1O7UA 4MCUA 2GVPA 1T8EB 4X0XA 1OYJA 13GSA 2A2RA 5ELAA 5LCZA 1IYHA 2IIYA 1NHOA 4PGTA 4K8MA 4NHZA 3F6FA 2C80A 5HFKA 3GX0A 2HZFA 2C0EA 4MDCA 3P8WA 3GN3A 3CTFA 1M9BA 5AN1A 3IAS2 3TRXA 4TXOB 1BJXA 1T3BA 1X5EA 2K6VA 2PVOC 2X8CA 3I43A 1B4PA 3TUEA 3U6VA 3UARA 3GTUA 3MNGA 1WWJA 5HR2A 5GZZB 4K1FA 1VGLA 4MZWA 3VWUA 4EUYA 17GSA 3HXSA 2I81A 4HS1A 2C0FA 4ZBDA 5F06A 4I2UA 2DJ2A 3TJGA 3QAGA 3C8EA 3ZRDA 2G2QA 4F0BA 1DBYA 1XVWA 1JFUA 3FEUA 2Z9SA 3NOFA 2WCIA 3E3EA 4PQIA 4D73B 3LQ7A 1N8JA 4TR1B 1GSFA 2H01A 4Q5QA 2XHFA 3M1GA 2ES7A 4KX4A 2YV9A 4N0VA 4YAPA 1S3AA 2TRXA 3CBUA 1FB6A 2KHPA 2LKUA 1HD2A 2H19A 4DEJA 1XW5A 2B1KA 5HR0A 4GTUA 1U87A 1V57A 2LJKA 1YKAA 2GDRA 1U3AA 5DQSA 1R7HA 2VO4A 2VM1A 5G31A 2WFCA 2B1LA 1B8XA 1TU7A 1BQ7A 2PPTA 2PWJA 3O76A 2NVLA 4K9ZA 3WGXA 3QCPA 4L5LA 4ECCA 1J08A 3D4MA 4FYBA 3VFIA 3QMXA 2FWHA 3HD5A 1Z7PA 3PINA 3CRUA 2H75A 3ERWA 1VRSD 4E8EA 2H1BA 2LTKA 4MLYA 4MZBA 3EINA 3LWAA 2VD0A 5FHIA 2IMIA 1GTUA 2VL3A 1W89A 5A4VA 4IKHA 4Q5NA 3VWWA 1A2MA 5ECQB 5ECMB 3EURA 1PKWA 1V9WA 2H76A 4KGIA 1ZYEA 1O8XA 2C0DA 3GL5A 5IM9A 1GUMA 3TJKA 2VL2C 1QUWA 1G7OA 5JCWA 2I4AA 4FYUA 5HFIA 1AAZA 5HFGA 1Z5YE 4ULXA 3F9UA 4XS4B 2HXKA 6GSYA 3TKRA 3KP8A 3TRQA 2PMTA 2GZZA 2VCVA 3EMXA 4XS6A 4IW9A 5A4WA 3LYKA 2YWMA 2LNSA 3HJPA 1GWCA 1NHYA 3RHCA 1XBSA 5DCHA 3Q6OA 2LEGA 3ERGA 2H1AA 2NPBA 3FY7A 5D93A 3BOAA 2IL3A 5LD0A 5H5RA 2WZ9A 3HVXA 4K6XA 4Z7XA 1AIUA 2EIQA 2P5QA 3H79A 3EWLA 5IPHA 3JCML 2H70A 2GGTA 1OAZA 4EXJA 4EE0A 2KP2A 2VM2A 2CVDA 2VL9A 3MDKA 1ERWA 3LFLA 1F3BA 1WIKA 5ABRA 2HSYA 1M2DA 3ZFLA 5D9WA 3KEBA 4RI6A 5IIZA 3VWVA 2XPDA 3TDGA 3GKXA 1T00A 5CRDA 4CW9A 2LJRA 2R2JA 1PN9A 3OR5A 1TRVA 4KDUA 5GAPD 1G6WA 2K8VA 5ID2B 1EOGA 5F05A 2CQ9A 1K0AA 1C72A 18GSA 2VLUA 1THOA 2H30A 3ERFA 2FNOA 4L8EA 1H4OA 3UVHA 2IMDA 4JE1A 4GSTA 4MABA 5ECIB 4KW6A 2GSTA 1T7PB 1AUCA 4O5RA 4NHWA 3IV4A 4GSSA 4JBBA 1FHEA 5JCUA 3IC4A 3APSA 1GLQA 4POMA 3C1RA 3UBKA 4HJ2A 1T1VA 5DAKA 3VPQA 2H66A 2OBIA 3GFKA 2YWNA 4RQXA 5HR1A 4DSSB 2V41A 1ERVA 2LRTA 3Q19A 2CZ3A 2JZSA 4MA9A 4WEYA 1V40A 4H86A 1AXDA 4K0GA 4TOPA 2DBCA 1WPIA 5ECHB 3UMAA 2V6OA 3BCKA 1GSSA 1EP7A 1FW1A 5AIXA 2K18A 2GT5A 4HQZA 4AJ8A 6GSVA 4YAVA 1ZZYA 2PN8A 1AQXA 2QSIA 4AJ7A 4RI7A 4PX1A 1GTBA 5IOWA 3H1NA 3IK9A 2ZUPA 5HR3A 4OO4A 1EP8A 3N9JA 16GSA 4IBPA 1TXXA 4MZCA 1Z3EA 2VOCA 1U3IA 3M3MA 4WKWA 4PUFC 1EV9A 4G2EA 3I69A 1XXUA 2VLTA 3ZVJD 4YQMA 3CSJA 3QR6A 3QDNA 2WB9A 2L59A 3DEXA 3L0HA 3ISOA 2L6CA 2FUG2 4MH2A 2H6YA 1I5GA 5ECKB 3F6DA 3GNJA 3VI5A 4BVXA 4O7HA 4X43A 1ILOA 1G0TA 2V32A 3GV1A 5KEJA 2J9HA 5IMCA 3HYPA 1F9MA 5F07A 4IELA 3EE2A 4KUNA 3ZVJA 5DJMA 1U6TA 1JZOA 3QPMA 2E2GA 1XWAA 2FWFA 3KMNA 3UJ1A 4KE3A 1SJZA 2C3NA 2XPEA 4XIHA 5D96A 3F4RA 1AC1A 2R6KA 2RM5A 1TRSA 3IA1A 1XWCA 3DD3A 1QGVA 2FA8A 4HU7A 4LL1B 2YANA 4Q5FA 3NIVA 4MPGA 6GSXA 5G5EA 4HZ2A 1AQVA 1YF1A 5B8BA 2ZNMA 1HYUA 2BTOT 4HUAA 1M2AA 5IMZA 4HU9A 2C8UA 2HI7A 3DRNA 1H75A 2IFQA 4MF7A 1XVQA 2LJAA 5ECLB 5CYYA 3SBCA 2LSTA 4NXIA 4NV2A 3A2VA 5D9VA 4F03A 1K3OA 4TXVA 1YKCA 1WMJA 1OC9B 5E4WA 4RQRA 5EPFA 4TR0A 3D6IA 4XS1A 1GULA 2CV4A 4N30A 2VIMA 4FYCA 5A4UA 2BJXA 2JACA 1OE8A 5ENUA 1WOUA 3V1WA 3IE3A 5KN3A 4WR5A 1NW2A 1G6YA 4BWSA 1WP0A 1YY7A 2WJUA 3FZ5A 1FB0A 1BX9A 1O6JA 4WR4A 3CSIA 2P31A 3HJMA 2WGRA 3RBTA 3F63A 1UVZA 3P7XA 2XBQA 2H6ZA 1FVKA 3IOSA 3EMPA 3HJOA 3KXOA 5ECSA 3KP9A 3TOTA 2KOKA 1RK4A 4ZL8A 2CA8A 2HE3A 3UAPA 3TKSA 3KCMA 3MWHA 2C3TA 4JRRA 4KSMA 4KCEA 2L5LA 4IGJA 3IK7A 1WRYA 3F3QA 3US3A 3IAM2 1FOVA 2KUCA 3ZZXA 1TTZA 4TW5A 2YP6A 3W8JA 2JZRA 5IMDA 3A5WA 2O89A 3VPTA 4IS0A 5JWQB 12GSA 2B7KA 2F8FA 4FO5A 4PQHA 1VF1A 1UA5A 3HDCA 1V58A 3FZ9A 3GIXA 5CREA 1FG4A 4HQSA 1I9DA 2HFDA 3M8NA 6GSSA 3HZ4A 2O85A 4AGSA 2DIYA 2F8AA 1PRXA 3GYKA 1ZL9A 3RPPA 2JADA 3IDVA 3KIJA 1GLPA 2IMFA 3FKFA 3Q74A 3C7MA 2XBIA 2YJHA 4ZB8A 1BG5A 4N10A 3E0UA 3ZFBA 4TN8A 3PH9A 3FR9A 2MBTA 2LUSA 1SK0A 2YPMA 5D8IA 2H72A 2VUPA 1SL0B 2V6KA 3LSZA 3LYPA 22GSA 2O7KA 4OCFA 3U5RE 3ZTLA 3ZLPA 1MDJA 4AF2A 1PMTA 2PU9C 1PL2A 4MJEA 4ECJA 3KM6A 5IMVA 3I6AA 1Q4JA 3WD6A 2F3MA 3FR6A 3ZMLA 5FT3A 5CRWA 4PNFA 4IVFA 1THXA 1DSBA 1R26A 1X5DA 2F9SA 5IMAA 2LQOA 1X9WB 2GLRA 5CRGA 3O6TA 1BYEA 3FZAA 2LV3A 2ALBA 3GHAA 1M99A 3LXZA 5ELGA 3L9UA 2YN1A 3DIEA 3GA4A 1K0NA 1TI1A 1F37A 4K7OA 1EWXA 7GSSA 4BL7A 1MD4A 4PQ1A 4MMMA 1AW9A 4TVEA 1ABAA 1VF4A 3EYTA 3R2QA 4O92A 5J5NA 4N11A 2REMA 2A2SA 3ZYWA 4L0WA 1MD3A 5CO3A 3G7JA 1YF0A 2YOIA 3CYNA 4D73A 4TR1A 3ZIJA 2H1DA 4YQVA 1WJKA 3GX8A 1JZRA 3FR3A 4KSOA 4BWQA 2I3YA 1S3DA 5IQYA 1A24A 4MK3A 4JEDA 3N5OA 3VI7A 1OE7A 3FHKA 5HQPA 3KH9A 1AQWA 1O85A 2R5GA 1PQNA 2MMZA 2LQQA 3EU4A 1YEPA 1YZXA 3UL3A 3IHQA 2ZCTA 1U88A 1J9BA 3P2AA 2MMOA 4QL7A 2L57A 4YH2A 1HNBA 3KTBA 1OKTA 4XTSA 4KB3A 1XW6A 2DJ1A 1HNAA 2GZYA 4MJCA 1M2BA 1PSQA 1R5PA 1OC3A 1W4VA 1HNCA 3FRCA 5IOXA 3MSZA 5G2ZA 3CSHA 3LG6A 4PXOA 1GTAA 2V1MA 2WRTA 5KN2A 2CZ2A 2AUVA 1K3LA 1QXHA 3W8SA 2GQMA 4KDYA 4BVYA 2H8LA 3GH9A 2H0GA 3DKSA 1ERUA 3IRAA 4J57E 5IMFA 2B6MA 3APOA 4HEA2 3HA9A 4RUVA 4KNDA 3TJJA 2JSYA 4ECBA 1SJIA 2FLSA 3F4SA 2AB6A 2IMKA 3IR4A 1TW9A 1EZKA 4MP4A 3UIWA 4OD7A 4O32A 4J2FA 3AY8A 5E59A 4KCAA 2NDOA 2F51A 3L9VA 5DAKB 1FVJA 5ECPB 1TRUA 4ECIA 1MTCA 2B5EA 4WXTA 3LGCA 4L0UA 3D0ZA 3RDWA 1B4QA 5C04A 3DVXA 2H6XA 2H0HA 3TOUA 5DQYA 4XRAA 4POKA 3GSTA 2GQLA 3C71A 10GSA 5JWRB 3PGTA 1PX6A 2R37A 2M46A 2CAIA 1PA3A 2MMAA 2VD1A 1B9YC 3NZNA 4KDXA 4QQ7A 19GSA 4YQUA 1ZOFA 3ED3A 1ON4A 1TK0B 4ISDA 3QOUA 2HRFA 1J0FA 5GSTA 1K3YA 5ID2A 5C00A 2OADA 4ZBAA 4DSQA 3C73A 1MEKA 3TKPA 2PVQA 1SKWB 4TR4A 2B7JA 1TJDA 2H73A 3DGQA 5F8BA 1CQGA 2LRNA 3TKSE 2VCQA 2JL4A 3QFAC 5B8AA 3QD9A 4WETA 2DJKA 3RPNA 5ECOB 3HKRA 1SL1B 4HOJA 2WULA 5DALB 3UEMA 5J9BA 3LJRA 1Z9HA 2WDUA 2P5RA 2G0FA 3RHBA 6GSUA 4GXZA 1GUKA 1SKRB 4K7IA 3LXTA 2FY6A 5EY6A 4IP6A 1EGOA 2HZEB 5A5KA 1F6MC 3D4TA 1YQ1A 5J9CA 4KA0A 3IXRA 3GURA 3CMIA 4CHSA 2B3SA 4MF6A 2GS3A 3GKMA 2CVKA 3KJYA 2FCHA 3HZ8A 2YZUA 4NV5A 2OKAA 2NBSA 2IFQB 4PNGA 1XPVA 3QAVA 3M0FA 1VF2A 1SK2A 3GKNA 2JU5A 4JR4A 4GCIA 2OA7A 3KH7A 2YJ7A 2GTUA 4ZL9A 1M9AA 4V2NA 1PD21 5D73A 3H4KA 2K9FA 1GTIA 2DIZA 3KZQA 5B6MA 4EL1A 5D9XA 5G30A 2DC5A 2EC4A 5INYA 1LJRA 1Z6MA 2I9HA 2FHEA 5CRHA 3DMLA 5COHA 1A2LA 1GSYA 2CAQA 3SWLA 5AIVA 1ML6A 2VCWA 1ST9A 4WBRD 1EOHA 1GP1A 1TP9A 1HQOA 3QFBC 1PKZA 1GSQA 1N2AA 5H5SA 2DJ3A 2RUEA 2VCXA 4IQ1A 2AV4A 1YDKA 3APQA 5AGYA 1V2AA 2CX4A 2J23A 2EIOA 3D22A 2PERA 2LS5A 2MYGA 3A3TA 5J3RA 1LBKA 2OBKA 2HSHA 6GSWA
chains in the Genus database with same CATH superfamily
4MPFA 1SU9A 3KGKA 4MJAA 2LRCA 2GZPA 4EC0A 2N5FA 3BJ5A 1OKDA 4EO3A 1USBA 3GTUB 1R4WA 2B5XA 2GQKA 3TGZA 2JSZA 1OC9A 4OFMA 3M9JA 1SYXA 3IBHA 4WF4A 4HJMA 2L4CA 4ILFA 1TDIA 1X9MB 4NAXA 5KN0A 4J56E 2L4QA 3LORA 3L9SA 1ZCPA 1Y25A 4IHUA 2GSSA 2N5BA 4OCEA 1GL8A 3GH6A 1NSWA 2YV7A 1CQHA 4N0ZA 5F0GA 2VLVA 4ZIJA 3WYWA 2IMEA 3FZ4A 2I1UA 1JLVA 2C1YA 3ME8A 2DSAA 4EIQA 4IQAA 3ZITA 2X99A 1TKDB 4EIPA 2VL2A 3ZIVA 1EEMA 3F4TA 1SENA 2DMLA 2HNLA 4I6XA 1WE0A 5BMUA 4POBA 4XCSA 1KEBA 2O8VB 3C1SA 4DVCA 3RAZA 2K8SA 1A8YA 3MYDA 4I8BA 1NM3A 3BBYA 5J41A 4TXOA 2HRNA 3IPZA 4EKZA 1E6BA 2CT6A 3J7Yb 4HZ4A 3HY2A 4IN0A 3KTLA 3VWXA 4NMUA 2X8HA 1X5CA 2YZHA 1F2EA 4GSNA 4ACSA 2B5YA 4XHMA 5CAXA 2MZCA 3UBLA 1SKSB 2YCDA 5ECRB 20GSA 4FIWA 2H1GA 3D21A 4TR3A 1A23A 4Q5RA 2LNTA 3G7YA 4GQCA 1PL1A 1GSDA 3GSSA 1S3RA 4GLTA 3A2WA 1FO5A 5D9TA 14GSA 8GSSA 4ZB9A 1TK5B 3TKSC 2FD3A 4ZB6A 2H74A 1A2JA 1R5AA 1PX7A 5G1LA 1SYRA 2E7PA 3L78A 1MDKA 5EL8A 5L71A 4PTSA 2DLXA 4EDZA 3A2XA 1SL2B 1XW9A 3ME7A 2PBJA 1A8LA 4GF0A 4PURA 1K0DA 2DMMA 1ZYNA 4G19A 3WT2A 3WT1A 1SD8A 4G0KA 1KBNA 2QKEA 3LEFA 4DSRA 3TJFA 4CY6A 5ECNB 1TI3A 2TIRA 3CRTA 1PGTA 1V98A 2RM6A 3F3RA 4K7NA 1UN2A 5FWGA 3VLNA 2O87A 4PUAA 1M7TA 1ERTA 5JWOB 3G9BA 1ZGNA 2HSMA 1T4YA 1GNEA 4OFTA 2MBSA 2R4VA 5G1KA 1IYIA 1DE1A 1DUGA 1E2YA 4LLRA 3O3TA 1XZOA 2FWGA 4OMVA 1SJ6A 1TOFA 2DKHA 3ZMKA 2HLSA 2XC2A 3EVIA 2HYXA 4V2LA 1XOBA 4EVMA 1MDIA 4L5OA 1EEJA 5DVBA 1FAAA 1K0BA 5BRTA 3DYRA 3S9FA 3Q18A 2RLIA 9GSSA 1TRWA 4OWYA 2X64A 4CY8A 2FA4A 2ON7A 1K0OA 3FYGA 4HI7A 4XS4A 2E2MA 3FW2A 1URMA 6GSTA 5GSSA 4OO5A 4IJIA 2DJ0A 2VAFA 2OE1A 4ZXGA 4K0NA 3DVWA 4V2MA 4P3YB 3HVVA 2N5AA 2AHEA 1B48A 2CX3A 3GL3A 3GMFA 4F2IA 2QGVA 4NWYA 2VCZA 1X0RA 2VCTA 5CNWA 1EGRA 3D5JA 1PN0A 1OVNA 5LNKe 3DWVA 1XOAA 3GRXA 1ACVA 3DXBA 3I9V2 3TJBA 1XWGA 1XIYA 2H71A 1QMVA 3MAKA 1O81A 1Z6NA 2PUKC 3VURA 1M3JA 2IPAA 1X9SB 4LA1A 3L4NA 4E8HA 1BEDA 4WF5A 4X1UA 2R3XA 5AISA 3BD2A 4XRDA 1ZYQB 2C0GA 5H5QA 5GAND 3E9JB 1QFNA 3FK8A 2RIIA 4ML1A 1JZWA 4OFNA 3TKQA 5J4UA 1Q98A 1GUHA 1XCCA 1GRXA 2NTOA 5IPGA 3EU3A 2L5OA 3H93A 1TU8A 1K0CA 1UC7A 3TRPA 2AJQB 4X4JA 1BAYA 3GKKA 2C4JA 4TRXA 1Y6EA 4BPYA 4LL4B 1RQMA 4ZL7A 2C3QA 4ML6A 5DBQA 4BVXB 3H8QA 3F0IA 5G5FA 4ZILA 4F82A 1ZMAA 1O73A 5CP1A 3VK9A 2R0PA 5EVOA 1JHBA 4GWRA 4ICYA 1JZDA 3CTGA 4IJ3A 4F9ZA 4I2TA 2M80A 2M72A 3W6GA 3WGDA 1GSUA 2IN3A 4AJ6A 2H0IA 4K2DA 4ZBBA 4DSSA 2EIRA 5JCGA 1KTEA 4IP1A 4V1Ap 4ID0A 4MNNA 2JZTA 3HCZA 3UOMA 4POLA 2GSRA 4LMVA 2A4VA 1OC8A 2R0GA 1XFLA 2QC7A 5B6NA 1F3AA 4QL9A 1S3CA 3TCOA 3GUSA 4G10A 2YWIA 4I5QA 2QA2A 3KMOA 4JU5A 2WS2A 4KH7A 1A0FA 2OACA 4Z2UA 4BA7A 2IWTA 1GNWA 1KNGA 2CVBA 2YNXA 2OJLA 1QK8A 5DALA 4GRFA 1K0MA 2D2ZA 3CQFA 3EC3A 2L6DA 2X8GA 4KF9A 3K8NA 3QAWA 4NPBA 3CXGA 5IO0A 2TRCP 4HSCX 1QQ2A 2AYTA 5KN1A 1B9XC 2E0QA 1DE2A 2KLXA 2PGTA 4TKYA 1M0UA 3UVTA 4HDEA 2HZEA 4GQFA 4F0CA 4EF0A 2RUFA 3HVSA 1Z7RA 3HHVA 4LMWA 3J7Yk 4I97A 2FWEA 2KP1A 4JR6A 3G7IA 1A0RP 3ZREA 2HT9A 1XWBA 5DJLA 3ZL5A 2P0GA 4MH3A 1RW1A 3BCIA 1YEXA 3PPUA 2GSQA 5DDLA 11GSA 1YJ6A 1SD9A 4FH8A 1XWKA 1T4ZA 4MF5A 2FGXA 1EV4A 2V2GA 3PR8A 4G9HA 1SK1A 5IO2A 2ON5A 1TK8B 3F8UA 3TB2A 4V1Ag 2AAWA 4WBJA 2GT6A 3WGEA 2OE0A 2OE3A 1G7EA 3M9KA 4CDOA 4KAEA 2DJJA 4MJBA 3KD0A 1GSEA 1VF3A 1O8WA 2MMNA 5B7CA 1GH2A 2YWOA 5DCGA 4EDYA 2IJYA 3EPTA 1JLWA 4JZQA 1LU4A 2BMXA 3P90A 1O7UA 4MCUA 2GVPA 1T8EB 4X0XA 1OYJA 13GSA 2A2RA 5ELAA 5LCZA 1IYHA 2QA1A 2IIYA 1NHOA 4PGTA 4K8MA 4NHZA 3F6FA 2C80A 5HFKA 3GX0A 2HZFA 2C0EA 4MDCA 3P8WA 3GN3A 3CTFA 1M9BA 5AN1A 3IAS2 3TRXA 4TXOB 1BJXA 1T3BA 1X5EA 2K6VA 2PVOC 2X8CA 3I43A 1B4PA 3TUEA 4K5SA 3U6VA 3UARA 3GTUA 3MNGA 1WWJA 5HR2A 5GZZB 4K1FA 1VGLA 4MZWA 3VWUA 4EUYA 17GSA 3HXSA 2I81A 4HS1A 2C0FA 4BL7B 4ZBDA 5F06A 4I2UA 2DJ2A 3TJGA 3QAGA 3C8EA 3ZRDA 2G2QA 4F0BA 1DBYA 1XVWA 1JFUA 3FEUA 3HVNA 3LW9A 2Z9SA 3NOFA 2WCIA 3E3EA 4PQIA 2UZ8A 4D73B 3LQ7A 1N8JA 4TR1B 1GSFA 2H01A 4Q5QA 2XHFA 3M1GA 2ES7A 4KX4A 2YV9A 4N0VA 4YAPA 1S3AA 2TRXA 3CBUA 1FB6A 2KHPA 2LKUA 1HD2A 2H19A 4DEJA 1XW5A 2B1KA 5HR0A 4GTUA 1U87A 1V57A 2LJKA 1YKAA 2GDRA 1U3AA 5DQSA 1R7HA 2VO4A 2VM1A 5G31A 2WFCA 4K5RA 2B1LA 1B8XA 1TU7A 1BQ7A 2PPTA 2PWJA 3O76A 2NVLA 4K9ZA 3WGXA 3QCPA 4L5LA 4ECCA 1J08A 3D4MA 4FYBA 3VFIA 5KOXA 3QMXA 2FWHA 3HD5A 1Z7PA 3PINA 3CRUA 2H75A 3ERWA 1VRSD 4E8EA 4Z2RA 2H1BA 2LTKA 4MLYA 4MZBA 3EINA 3LWAA 2VD0A 5FHIA 2IMIA 1GTUA 2VL3A 1W89A 5A4VA 4IKHA 4Q5NA 3VWWA 1A2MA 5ECQB 5ECMB 3EURA 1PKWA 1V9WA 2H76A 4KGIA 1ZYEA 1O8XA 2C0DA 3GL5A 5IM9A 1GUMA 3TJKA 2VL2C 1QUWA 1G7OA 5JCWA 2I4AA 4FYUA 5HFIA 1AAZA 5HFGA 4BVYB 1Z5YE 4ULXA 3F9UA 4XS4B 2HXKA 6GSYA 3TKRA 3KP8A 3TRQA 2PMTA 2GZZA 2VCVA 3EMXA 4XS6A 4IW9A 5A4WA 3LYKA 2YWMA 2LNSA 3HJPA 1GWCA 1NHYA 3RHCA 1XBSA 5DCHA 3Q6OA 2LEGA 3ERGA 2H1AA 2NPBA 3FY7A 5D93A 3BOAA 2IL3A 5LD0A 5H5RA 2WZ9A 3HVXA 4K6XA 4Z7XA 1AIUA 2EIQA 2P5QA 3H79A 3EWLA 5IPHA 3JCML 2H70A 2GGTA 1OAZA 4EXJA 4EE0A 2KP2A 2VM2A 2CVDA 2VL9A 3MDKA 1ERWA 3LFLA 1F3BA 1WIKA 5ABRA 2HSYA 1M2DA 3ZFLA 5D9WA 3KEBA 4RI6A 5IIZA 3VWVA 2XPDA 3TDGA 3GKXA 1T00A 5CRDA 4CW9A 2LJRA 4K2XA 2R2JA 1PN9A 3OR5A 1TRVA 4KDUA 5GAPD 1G6WA 2K8VA 5ID2B 4Z2TA 1EOGA 5F05A 2CQ9A 1K0AA 1C72A 18GSA 2VLUA 1THOA 2H30A 3ERFA 2FNOA 4L8EA 1H4OA 3UVHA 2IMDA 4JE1A 4GSTA 4MABA 5ECIB 4KW6A 2GSTA 1T7PB 1AUCA 4O5RA 4NHWA 3IV4A 4GSSA 4JBBA 1FHEA 5JCUA 3IC4A 3APSA 1GLQA 4POMA 3C1RA 3UBKA 4HJ2A 1T1VA 5DAKA 1FOHA 3VPQA 2H66A 2OBIA 3GFKA 2YWNA 2DKIA 4RQXA 5HR1A 4DSSB 2V41A 1ERVA 2LRTA 3Q19A 2CZ3A 2JZSA 4MA9A 4WEYA 1PFOA 1V40A 4H86A 1AXDA 4K0GA 4TOPA 2DBCA 1WPIA 5ECHB 3UMAA 2V6OA 3BCKA 1GSSA 1EP7A 1FW1A 5AIXA 2K18A 2GT5A 4HQZA 4AJ8A 6GSVA 4YAVA 1ZZYA 2PN8A 1AQXA 1XG8A 2QSIA 4AJ7A 4RI7A 4PX1A 1GTBA 5IOWA 3H1NA 3IK9A 2ZUPA 5HR3A 4OO4A 1EP8A 3N9JA 16GSA 4IBPA 1TXXA 4MZCA 1Z3EA 2VOCA 1U3IA 3M3MA 4WKWA 4PUFC 1EV9A 4G2EA 3I69A 1XXUA 2VLTA 3ZVJD 4YQMA 3CSJA 3QR6A 3QDNA 2WB9A 2L59A 3DEXA 3L0HA 3ISOA 2L6CA 2FUG2 4MH2A 2H6YA 1I5GA 5ECKB 3F6DA 3GNJA 3VI5A 4BVXA 4O7HA 5KOWA 4X43A 1ILOA 1G0TA 2V32A 3GV1A 5KEJA 2J9HA 5IMCA 1M3IA 3HYPA 1F9MA 5F07A 4IELA 3EE2A 4KUNA 3ZVJA 5DJMA 1U6TA 1JZOA 3QPMA 2E2GA 1XWAA 2FWFA 3KMNA 3UJ1A 4KE3A 1SJZA 2C3NA 2XPEA 4XIHA 5D96A 3F4RA 1AC1A 2R6KA 2RM5A 1TRSA 4YKFA 3IC8A 3IA1A 1XWCA 3DD3A 1QGVA 2FA8A 4HU7A 4LL1B 2YANA 4Q5FA 3NIVA 4MPGA 6GSXA 5G5EA 4HZ2A 1AQVA 1YF1A 5B8BA 2ZNMA 1HYUA 2BTOT 4HUAA 1M2AA 5IMZA 4HU9A 2C8UA 2HI7A 3DRNA 1H75A 2IFQA 4MF7A 1XVQA 2LJAA 5ECLB 5CYYA 3SBCA 2LSTA 4NXIA 4NV2A 3A2VA 5D9VA 4F03A 1K3OA 4TXVA 1YKCA 1WMJA 1OC9B 5E4WA 4RQRA 5EPFA 4TR0A 3D6IA 4XS1A 1GULA 2CV4A 4N30A 2VIMA 4FYCA 5A4UA 2BJXA 2JACA 1OE8A 5ENUA 1WOUA 3V1WA 3IE3A 5KN3A 4WR5A 1NW2A 1G6YA 4BWSA 1WP0A 1YY7A 2WJUA 3FZ5A 1FB0A 1BX9A 1O6JA 4WR4A 3CSIA 2P31A 3HJMA 2WGRA 3RBTA 3F63A 1UVZA 3P7XA 2XBQA 2H6ZA 1FVKA 3IOSA 3EMPA 3HJOA 3KXOA 5ECSA 3KP9A 3TOTA 2KOKA 1RK4A 4ZL8A 2CA8A 2HE3A 3UAPA 3TKSA 3KCMA 3MWHA 2C3TA 3IHGA 4JRRA 4KSMA 4KCEA 2L5LA 4IGJA 3IK7A 1WRYA 3F3QA 3US3A 3IAM2 1FOVA 2R0CA 2KUCA 3ZZXA 1TTZA 4TW5A 2YP6A 3W8JA 2JZRA 5IMDA 3A5WA 2O89A 3VPTA 4IS0A 5JWQB 12GSA 2B7KA 2F8FA 4FO5A 4PQHA 1VF1A 1UA5A 3HDCA 1V58A 3FZ9A 3GIXA 5CREA 1FG4A 4YKGA 4HQSA 1I9DA 2HFDA 3M8NA 6GSSA 3HZ4A 2O85A 4AGSA 2DIYA 2F8AA 1PRXA 3GYKA 1ZL9A 3RPPA 2JADA 3IDVA 3KIJA 1GLPA 2IMFA 3FKFA 3Q74A 3C7MA 2XBIA 2YJHA 4ZB8A 1BG5A 4N10A 3E0UA 3ZFBA 4TN8A 3PH9A 3FR9A 2MBTA 2LUSA 1SK0A 2YPMA 5D8IA 2H72A 2VUPA 1SL0B 2V6KA 3LSZA 2X4AA 3LYPA 22GSA 2O7KA 4OCFA 3U5RE 3ZTLA 3ZLPA 1MDJA 4AF2A 1PMTA 2PU9C 1PL2A 4MJEA 4ECJA 3KM6A 5IMVA 3I6AA 1Q4JA 3WD6A 2F3MA 3FR6A 3ZMLA 5FT3A 5CRWA 4PNFA 4IVFA 1THXA 1DSBA 1R26A 1X5DA 2F9SA 1ZYPA 5IMAA 2LQOA 1X9WB 2GLRA 5CRGA 3O6TA 1BYEA 3FZAA 2LV3A 2ALBA 3GHAA 1M99A 3LXZA 5ELGA 3L9UA 2YN1A 3DIEA 3GA4A 1K0NA 1TI1A 1F37A 4K7OA 1EWXA 7GSSA 4BL7A 1MD4A 4PQ1A 4MMMA 1AW9A 4TVEA 1ABAA 1VF4A 3EYTA 3R2QA 2A4HA 4O92A 5J5NA 4N11A 2REMA 2A2SA 3ZYWA 4L0WA 1MD3A 5CO3A 3G7JA 1YF0A 2YOIA 3CYNA 4D73A 4TR1A 3ZIJA 2H1DA 4YQVA 1WJKA 3GX8A 1JZRA 3FR3A 4KSOA 4BWQA 2I3YA 1S3DA 5IQYA 1A24A 4MK3A 4JEDA 3N5OA 3VI7A 1OE7A 4O5UA 3FHKA 5HQPA 3KH9A 1AQWA 1O85A 4BIKA 2R5GA 1PQNA 2MMZA 2LQQA 3EU4A 3R3EA 1YEPA 1YZXA 3UL3A 3IHQA 2ZCTA 1U88A 1J9BA 3P2AA 2MMOA 2X49A 2L57A 4QL7A 4YH2A 1HNBA 3KTBA 1OKTA 4XTSA 4KB3A 1XW6A 2DJ1A 1HNAA 2GZYA 4MJCA 1M2BA 1PSQA 1R5PA 1OC3A 1W4VA 1HNCA 3FRCA 5IOXA 3MSZA 5G2ZA 3CSHA 3LG6A 4PXOA 1GTAA 2V1MA 2WRTA 5KN2A 2CZ2A 2AUVA 1K3LA 1QXHA 3W8SA 2GQMA 4KDYA 4BVYA 2H8LA 3GH9A 2H0GA 3DKSA 1ERUA 3IRAA 4J57E 5IMFA 2B6MA 3APOA 4HEA2 3HA9A 4RUVA 4KNDA 3TJJA 2JSYA 4ECBA 1SJIA 2FLSA 3F4SA 2AB6A 2IMKA 3IR4A 1TW9A 1EZKA 4MP4A 3UIWA 4OD7A 4O32A 4J2FA 4G0IA 3AY8A 5E59A 4KCAA 2NDOA 2F51A 3L9VA 5DAKB 1FVJA 5ECPB 1TRUA 4ECIA 1MTCA 2B5EA 4O5QA 4WXTA 3LGCA 4L0UA 3D0ZA 3RDWA 1B4QA 5C04A 3DVXA 2H6XA 2H0HA 3TOUA 4A5PA 5DQYA 4XRAA 4POKA 3GSTA 4FQUA 2GQLA 3C71A 10GSA 5JWRB 3PGTA 1PX6A 2R37A 2M46A 2CAIA 1PA3A 2MMAA 2VD1A 1B9YC 3NZNA 4KDXA 4QQ7A 19GSA 4YQUA 1ZOFA 3ED3A 1ON4A 1TK0B 4ISDA 3QOUA 2HRFA 1J0FA 5GSTA 4USSA 1K3YA 5ID2A 5C00A 2OADA 4ZBAA 4DSQA 3C73A 1MEKA 3TKPA 2PVQA 1SKWB 4TR4A 2B7JA 1TJDA 2H73A 3DGQA 5F8BA 1CQGA 2LRNA 3TKSE 2VCQA 2JL4A 3QFAC 5B8AA 3QD9A 4WETA 2DJKA 3RPNA 5ECOB 3HKRA 3FMWA 1SL1B 3MIXA 4HOJA 2WULA 5DALB 3UEMA 5J9BA 3LJRA 1Z9HA 2WDUA 2P5RA 2G0FA 3RHBA 6GSUA 4GXZA 1GUKA 1SKRB 4K7IA 3LXTA 2FY6A 5EY6A 4G0LA 4IP6A 1EGOA 2HZEB 5A5KA 1F6MC 3D4TA 1YQ1A 5J9CA 4KA0A 3IXRA 3GURA 3CMIA 4CHSA 2B3SA 4MF6A 2GS3A 3GKMA 2CVKA 3KJYA 2FCHA 3HZ8A 2YZUA 4NV5A 2OKAA 2NBSA 2IFQB 4PNGA 1XPVA 3QAVA 3M0FA 1VF2A 1SK2A 3GKNA 2JU5A 4JR4A 4GCIA 2A2PA 2OA7A 3KH7A 2YJ7A 2GTUA 4ZL9A 1M9AA 4V2NA 1PD21 3A5IA 5D73A 3H4KA 2K9FA 1GTIA 2DIZA 3KZQA 5B6MA 4EL1A 5D9XA 5G30A 2DC5A 2EC4A 5INYA 1LJRA 1Z6MA 2I9HA 2FHEA 5CRHA 3DMLA 5COHA 1A2LA 1GSYA 2CAQA 3SWLA 5AIVA 1ML6A 2VCWA 1ST9A 4WBRD 1EOHA 1GP1A 2HRKA 1TP9A 1HQOA 3QFBC 1PKZA 1GSQA 1N2AA 5H5SA 2DJ3A 2RUEA 2VCXA 4IQ1A 2HRAA 2AV4A 1YDKA 3APQA 5AGYA 1V2AA 2CX4A 2J23A 2EIOA 3D22A 2PERA 2LS5A 2MYGA 3A3TA 5J3RA 1LBKA 2OBKA 2HSHA 6GSWA
chains in the Genus database with same CATH topology
4MPFA 1SU9A 3KGKA 4MJAA 2LRCA 2GZPA 4EC0A 2N5FA 3BJ5A 1OKDA 4EO3A 1USBA 3GTUB 1R4WA 2B5XA 2GQKA 3TGZA 2JSZA 1OC9A 4OFMA 3M9JA 1SYXA 3IBHA 4WF4A 4HJMA 2L4CA 4ILFA 1TDIA 1X9MB 4NAXA 5KN0A 4J56E 2L4QA 3LORA 3L9SA 1ZCPA 1Y25A 4IHUA 2GSSA 2N5BA 4OCEA 1GL8A 3GH6A 1NSWA 2YV7A 1CQHA 4N0ZA 5F0GA 2VLVA 4ZIJA 3WYWA 2IMEA 3FZ4A 2I1UA 1JLVA 2C1YA 3ME8A 2DSAA 4EIQA 4IQAA 3ZITA 2X99A 1TKDB 4EIPA 2VL2A 3ZIVA 1EEMA 3F4TA 1SENA 2DMLA 2HNLA 4I6XA 1WE0A 5BMUA 4POBA 4XCSA 1KEBA 2O8VB 3C1SA 4DVCA 3RAZA 2K8SA 1A8YA 3MYDA 4I8BA 1NM3A 3BBYA 5J41A 4TXOA 2HRNA 3IPZA 4EKZA 1E6BA 2CT6A 3J7Yb 4HZ4A 3HY2A 4IN0A 3KTLA 3VWXA 4NMUA 2X8HA 1X5CA 2YZHA 1F2EA 4GSNA 4ACSA 2B5YA 4XHMA 5CAXA 2MZCA 3UBLA 1SKSB 2YCDA 5ECRB 20GSA 4FIWA 2H1GA 3D21A 4TR3A 1A23A 4Q5RA 2LNTA 3G7YA 4GQCA 1PL1A 1GSDA 3GSSA 4GLTA 3A2WA 1FO5A 5D9TA 14GSA 8GSSA 4ZB9A 1TK5B 3TKSC 2FD3A 4ZB6A 2H74A 1A2JA 1R5AA 1PX7A 5G1LA 1SYRA 2E7PA 3L78A 1MDKA 5EL8A 5L71A 4PTSA 2DLXA 4EDZA 3A2XA 1SL2B 1XW9A 3ME7A 2PBJA 1A8LA 4GF0A 4PURA 1K0DA 2DMMA 1ZYNA 4G19A 3WT2A 3WT1A 1SD8A 4G0KA 1KBNA 2QKEA 3LEFA 4DSRA 3TJFA 4CY6A 5ECNB 1TI3A 2TIRA 3CRTA 1PGTA 1V98A 2RM6A 3F3RA 4K7NA 1UN2A 5FWGA 3VLNA 2O87A 4PUAA 1M7TA 1ERTA 5JWOB 3G9BA 1ZGNA 2HSMA 1T4YA 1GNEA 4OFTA 2MBSA 2R4VA 5G1KA 1IYIA 1DE1A 1DUGA 1E2YA 4LLRA 3O3TA 1XZOA 2FWGA 4OMVA 1SJ6A 1TOFA 2DKHA 3ZMKA 2HLSA 2XC2A 3EVIA 2HYXA 4V2LA 1XOBA 4EVMA 1MDIA 4L5OA 1EEJA 5DVBA 1FAAA 1K0BA 5BRTA 3DYRA 3S9FA 3Q18A 2RLIA 9GSSA 1TRWA 4OWYA 2X64A 4CY8A 2FA4A 2ON7A 1K0OA 3FYGA 4HI7A 4XS4A 2E2MA 3FW2A 1URMA 6GSTA 5GSSA 4OO5A 4IJIA 2DJ0A 2VAFA 2OE1A 4ZXGA 4K0NA 3DVWA 4V2MA 4P3YB 3HVVA 2N5AA 2AHEA 1B48A 2CX3A 3GL3A 3GMFA 4F2IA 2QGVA 4NWYA 2VCZA 1X0RA 2VCTA 5CNWA 1EGRA 3D5JA 1PN0A 1OVNA 5LNKe 3DWVA 1XOAA 3GRXA 1ACVA 3DXBA 3I9V2 3TJBA 1XWGA 1XIYA 2H71A 1QMVA 3MAKA 1O81A 1Z6NA 2PUKC 3VURA 2IPAA 1X9SB 4LA1A 3L4NA 4E8HA 1BEDA 4WF5A 4X1UA 2R3XA 5AISA 3BD2A 4XRDA 1ZYQB 2C0GA 5H5QA 5GAND 3E9JB 1QFNA 3FK8A 2RIIA 4ML1A 1JZWA 4OFNA 3TKQA 5J4UA 1Q98A 1GUHA 1XCCA 1GRXA 2NTOA 5IPGA 3EU3A 2L5OA 3H93A 1TU8A 1K0CA 1UC7A 3TRPA 2AJQB 4X4JA 1BAYA 3GKKA 2C4JA 4TRXA 1Y6EA 4BPYA 4LL4B 1RQMA 4ZL7A 2C3QA 4ML6A 5DBQA 4BVXB 3H8QA 3F0IA 5G5FA 4ZILA 4F82A 1ZMAA 1O73A 5CP1A 3VK9A 2R0PA 5EVOA 1JHBA 4GWRA 4ICYA 1JZDA 3CTGA 4IJ3A 4F9ZA 4I2TA 2M80A 2M72A 3W6GA 3WGDA 1GSUA 2IN3A 4AJ6A 2H0IA 4K2DA 4ZBBA 4DSSA 2EIRA 5JCGA 1KTEA 4IP1A 4V1Ap 4ID0A 4MNNA 2JZTA 3HCZA 3UOMA 4POLA 2GSRA 4LMVA 2A4VA 1OC8A 2R0GA 1XFLA 2QC7A 5B6NA 1F3AA 4QL9A 1S3CA 3TCOA 3GUSA 4G10A 2YWIA 4I5QA 2QA2A 3KMOA 4JU5A 2WS2A 4KH7A 1A0FA 2OACA 4Z2UA 4BA7A 2IWTA 1GNWA 1KNGA 2CVBA 2YNXA 2OJLA 1QK8A 5DALA 4GRFA 1K0MA 2D2ZA 3EC3A 2L6DA 2X8GA 4KF9A 3K8NA 3QAWA 4NPBA 3CXGA 5IO0A 2TRCP 1QQ2A 2AYTA 5KN1A 1B9XC 2E0QA 1DE2A 2KLXA 2PGTA 4TKYA 1M0UA 3UVTA 4HDEA 2HZEA 4GQFA 4F0CA 4EF0A 2RUFA 3HVSA 1Z7RA 3HHVA 4LMWA 3J7Yk 4I97A 2FWEA 2KP1A 4JR6A 3G7IA 1A0RP 3ZREA 2HT9A 1XWBA 5DJLA 3ZL5A 2P0GA 4MH3A 1RW1A 3BCIA 1YEXA 3PPUA 2GSQA 5DDLA 11GSA 1YJ6A 1SD9A 4FH8A 1XWKA 1T4ZA 4MF5A 2FGXA 1EV4A 2V2GA 3PR8A 4G9HA 1SK1A 5IO2A 2ON5A 1TK8B 3F8UA 3TB2A 4V1Ag 2AAWA 4WBJA 2GT6A 3WGEA 2OE0A 2OE3A 1G7EA 3M9KA 4CDOA 4KAEA 2DJJA 4MJBA 3KD0A 1GSEA 1VF3A 1O8WA 2MMNA 5B7CA 1GH2A 2YWOA 5DCGA 4EDYA 2IJYA 3EPTA 1JLWA 4JZQA 1LU4A 2BMXA 3P90A 1O7UA 4MCUA 2GVPA 1T8EB 4X0XA 1OYJA 13GSA 2A2RA 5ELAA 5LCZA 1IYHA 2QA1A 2IIYA 1NHOA 4PGTA 4K8MA 4NHZA 3F6FA 2C80A 5HFKA 3GX0A 2HZFA 2C0EA 4MDCA 3P8WA 3GN3A 3CTFA 1M9BA 5AN1A 3IAS2 3TRXA 4TXOB 1BJXA 1T3BA 1X5EA 2K6VA 2PVOC 2X8CA 3I43A 1B4PA 3TUEA 4K5SA 3U6VA 3UARA 3GTUA 3MNGA 1WWJA 5HR2A 5GZZB 4K1FA 1VGLA 4MZWA 3VWUA 4EUYA 17GSA 3HXSA 2I81A 4HS1A 2C0FA 4BL7B 4ZBDA 5F06A 4I2UA 2DJ2A 3TJGA 3QAGA 3C8EA 3ZRDA 2G2QA 4F0BA 1DBYA 1XVWA 1JFUA 3FEUA 3LW9A 2Z9SA 3NOFA 2WCIA 3E3EA 4PQIA 2UZ8A 4D73B 3LQ7A 1N8JA 4TR1B 1GSFA 2H01A 4Q5QA 2XHFA 3M1GA 2ES7A 4KX4A 2YV9A 4N0VA 4YAPA 1S3AA 2TRXA 3CBUA 1FB6A 2KHPA 2LKUA 1HD2A 2H19A 4DEJA 1XW5A 2B1KA 5HR0A 4GTUA 1U87A 1V57A 2LJKA 1YKAA 2GDRA 1U3AA 5DQSA 1R7HA 2VO4A 2VM1A 5G31A 2WFCA 4K5RA 2B1LA 1B8XA 1TU7A 1BQ7A 2PPTA 2PWJA 3O76A 2NVLA 4K9ZA 3WGXA 3QCPA 4L5LA 4ECCA 1J08A 3D4MA 4FYBA 3VFIA 5KOXA 3QMXA 2FWHA 3HD5A 1Z7PA 3PINA 3CRUA 2H75A 3ERWA 1VRSD 4E8EA 4Z2RA 2H1BA 2LTKA 4MLYA 4MZBA 3EINA 3LWAA 2VD0A 5FHIA 2IMIA 1GTUA 2VL3A 1W89A 5A4VA 4IKHA 4Q5NA 3VWWA 1A2MA 5ECQB 5ECMB 3EURA 1PKWA 1V9WA 2H76A 4KGIA 1ZYEA 1O8XA 2C0DA 3GL5A 5IM9A 1GUMA 3TJKA 2VL2C 1QUWA 1G7OA 5JCWA 2I4AA 4FYUA 5HFIA 1AAZA 5HFGA 4BVYB 1Z5YE 4ULXA 3F9UA 4XS4B 2HXKA 6GSYA 3TKRA 3KP8A 3TRQA 2PMTA 2GZZA 2VCVA 3EMXA 4XS6A 4IW9A 5A4WA 3LYKA 2YWMA 2LNSA 3HJPA 1GWCA 1NHYA 3RHCA 1XBSA 5DCHA 3Q6OA 2LEGA 3ERGA 2H1AA 2NPBA 3FY7A 5D93A 3BOAA 2IL3A 5LD0A 5H5RA 2WZ9A 3HVXA 4K6XA 4Z7XA 1AIUA 2EIQA 2P5QA 3H79A 3EWLA 5IPHA 3JCML 2H70A 2GGTA 1OAZA 4EXJA 4EE0A 2KP2A 2VM2A 2CVDA 2VL9A 3MDKA 1ERWA 3LFLA 1F3BA 1WIKA 5ABRA 2HSYA 1M2DA 3ZFLA 5D9WA 3KEBA 4RI6A 5IIZA 3VWVA 2XPDA 3TDGA 3GKXA 1T00A 5CRDA 4CW9A 2LJRA 4K2XA 2R2JA 1PN9A 3OR5A 1TRVA 4KDUA 5GAPD 1G6WA 2K8VA 5ID2B 4Z2TA 1EOGA 5F05A 2CQ9A 1K0AA 1C72A 18GSA 2VLUA 1THOA 2H30A 3ERFA 2FNOA 4L8EA 1H4OA 3UVHA 2IMDA 4JE1A 4GSTA 4MABA 5ECIB 4KW6A 2GSTA 1T7PB 1AUCA 4O5RA 4NHWA 3IV4A 4GSSA 4JBBA 1FHEA 5JCUA 3IC4A 3APSA 1GLQA 4POMA 3C1RA 3UBKA 4HJ2A 1T1VA 5DAKA 1FOHA 3VPQA 2H66A 2OBIA 3GFKA 2YWNA 2DKIA 4RQXA 5HR1A 4DSSB 2V41A 1ERVA 2LRTA 3Q19A 2CZ3A 2JZSA 4MA9A 4WEYA 1V40A 4H86A 1AXDA 4K0GA 4TOPA 2DBCA 1WPIA 5ECHB 3UMAA 2V6OA 3BCKA 1GSSA 1EP7A 1FW1A 5AIXA 2K18A 2GT5A 4HQZA 4AJ8A 6GSVA 4YAVA 1ZZYA 2PN8A 1AQXA 2QSIA 4AJ7A 4RI7A 4PX1A 1GTBA 5IOWA 3H1NA 3IK9A 2ZUPA 5HR3A 4OO4A 1EP8A 3N9JA 16GSA 4IBPA 1TXXA 4MZCA 1Z3EA 2VOCA 1U3IA 3M3MA 4WKWA 4PUFC 1EV9A 4G2EA 3I69A 1XXUA 2VLTA 3ZVJD 4YQMA 3CSJA 3QR6A 3QDNA 2WB9A 2L59A 3DEXA 3L0HA 3ISOA 2L6CA 2FUG2 4MH2A 2H6YA 1I5GA 5ECKB 3F6DA 3GNJA 3VI5A 4BVXA 4O7HA 5KOWA 4X43A 1ILOA 1G0TA 2V32A 3GV1A 5KEJA 2J9HA 5IMCA 3HYPA 1F9MA 5F07A 4IELA 3EE2A 4KUNA 3ZVJA 5DJMA 1U6TA 1JZOA 3QPMA 2E2GA 1XWAA 2FWFA 3KMNA 3UJ1A 4KE3A 1SJZA 2C3NA 2XPEA 4XIHA 5D96A 3F4RA 1AC1A 2R6KA 2RM5A 1TRSA 4YKFA 3IC8A 3IA1A 1XWCA 3DD3A 1QGVA 2FA8A 4HU7A 4LL1B 2YANA 4Q5FA 3NIVA 4MPGA 6GSXA 5G5EA 4HZ2A 1AQVA 1YF1A 5B8BA 2ZNMA 1HYUA 2BTOT 4HUAA 1M2AA 5IMZA 4HU9A 2C8UA 2HI7A 3DRNA 1H75A 2IFQA 4MF7A 1XVQA 2LJAA 5ECLB 5CYYA 3SBCA 2LSTA 4NXIA 4NV2A 3A2VA 5D9VA 4F03A 1K3OA 4TXVA 1YKCA 1WMJA 1OC9B 5E4WA 4RQRA 5EPFA 4TR0A 3D6IA 4XS1A 1GULA 2CV4A 4N30A 2VIMA 4FYCA 5A4UA 2BJXA 2JACA 1OE8A 5ENUA 1WOUA 3V1WA 3IE3A 5KN3A 4WR5A 1NW2A 1G6YA 4BWSA 1WP0A 1YY7A 2WJUA 3FZ5A 1FB0A 1BX9A 1O6JA 4WR4A 3CSIA 2P31A 3HJMA 2WGRA 3RBTA 3F63A 1UVZA 3P7XA 2XBQA 2H6ZA 1FVKA 3IOSA 3EMPA 3HJOA 3KXOA 5ECSA 3KP9A 3TOTA 2KOKA 1RK4A 4ZL8A 2CA8A 2HE3A 3UAPA 3TKSA 3KCMA 3MWHA 2C3TA 3IHGA 4JRRA 4KSMA 4KCEA 2L5LA 4IGJA 3IK7A 1WRYA 3F3QA 3US3A 3IAM2 1FOVA 2R0CA 2KUCA 3ZZXA 1TTZA 4TW5A 2YP6A 3W8JA 2JZRA 5IMDA 3A5WA 2O89A 3VPTA 4IS0A 5JWQB 12GSA 2B7KA 2F8FA 4FO5A 4PQHA 1VF1A 1UA5A 3HDCA 1V58A 3FZ9A 3GIXA 5CREA 1FG4A 4YKGA 4HQSA 1I9DA 2HFDA 3M8NA 6GSSA 3HZ4A 2O85A 4AGSA 2DIYA 2F8AA 1PRXA 3GYKA 1ZL9A 3RPPA 2JADA 3IDVA 3KIJA 1GLPA 2IMFA 3FKFA 3Q74A 3C7MA 2XBIA 2YJHA 4ZB8A 1BG5A 4N10A 3E0UA 3ZFBA 4TN8A 3PH9A 3FR9A 2MBTA 2LUSA 1SK0A 2YPMA 5D8IA 2H72A 2VUPA 1SL0B 2V6KA 3LSZA 2X4AA 3LYPA 22GSA 2O7KA 4OCFA 3U5RE 3ZTLA 3ZLPA 1MDJA 4AF2A 1PMTA 2PU9C 1PL2A 4MJEA 4ECJA 3KM6A 5IMVA 3I6AA 1Q4JA 3WD6A 2F3MA 3FR6A 3ZMLA 5FT3A 5CRWA 4PNFA 4IVFA 1THXA 1DSBA 1R26A 1X5DA 2F9SA 1ZYPA 5IMAA 2LQOA 1X9WB 2GLRA 5CRGA 3O6TA 1BYEA 3FZAA 2LV3A 2ALBA 3GHAA 1M99A 3LXZA 5ELGA 3L9UA 2YN1A 3DIEA 3GA4A 1K0NA 1TI1A 1F37A 4K7OA 1EWXA 7GSSA 4BL7A 1MD4A 4PQ1A 4MMMA 1AW9A 4TVEA 1ABAA 1VF4A 3EYTA 3R2QA 2A4HA 4O92A 5J5NA 4N11A 2REMA 2A2SA 3ZYWA 4L0WA 1MD3A 5CO3A 3G7JA 1YF0A 2YOIA 3CYNA 4D73A 4TR1A 3ZIJA 2H1DA 4YQVA 1WJKA 3GX8A 1JZRA 3FR3A 4KSOA 4BWQA 2I3YA 1S3DA 5IQYA 1A24A 4MK3A 4JEDA 3N5OA 3VI7A 1OE7A 4O5UA 3FHKA 5HQPA 3KH9A 1AQWA 1O85A 2R5GA 1PQNA 2MMZA 2LQQA 3EU4A 3R3EA 1YEPA 1YZXA 3UL3A 3IHQA 2ZCTA 1U88A 1J9BA 3P2AA 2MMOA 2X49A 2L57A 4QL7A 4YH2A 1HNBA 3KTBA 1OKTA 4XTSA 4KB3A 1XW6A 2DJ1A 1HNAA 2GZYA 4MJCA 1M2BA 1PSQA 1R5PA 1OC3A 1W4VA 1HNCA 3FRCA 5IOXA 3MSZA 5G2ZA 3CSHA 3LG6A 4PXOA 1GTAA 2V1MA 2WRTA 5KN2A 2CZ2A 2AUVA 1K3LA 1QXHA 3W8SA 2GQMA 4KDYA 4BVYA 2H8LA 3GH9A 2H0GA 3DKSA 1ERUA 3IRAA 4J57E 5IMFA 2B6MA 3APOA 4HEA2 3HA9A 4RUVA 4KNDA 3TJJA 2JSYA 4ECBA 1SJIA 2FLSA 3F4SA 2AB6A 2IMKA 3IR4A 1TW9A 1EZKA 4MP4A 3UIWA 4OD7A 4O32A 4J2FA 4G0IA 3AY8A 5E59A 4KCAA 2NDOA 2F51A 3L9VA 5DAKB 1FVJA 5ECPB 1TRUA 4ECIA 1MTCA 2B5EA 4O5QA 4WXTA 3LGCA 4L0UA 3D0ZA 3RDWA 1B4QA 5C04A 3DVXA 2H6XA 2H0HA 3TOUA 4A5PA 5DQYA 4XRAA 4POKA 3GSTA 4FQUA 2GQLA 3C71A 10GSA 5JWRB 3PGTA 1PX6A 2R37A 2M46A 2CAIA 1PA3A 2MMAA 2VD1A 1B9YC 3NZNA 4KDXA 4QQ7A 19GSA 4YQUA 1ZOFA 3ED3A 1ON4A 1TK0B 4ISDA 3QOUA 2HRFA 1J0FA 5GSTA 4USSA 1K3YA 5ID2A 5C00A 2OADA 4ZBAA 4DSQA 3C73A 1MEKA 3TKPA 2PVQA 1SKWB 4TR4A 2B7JA 1TJDA 2H73A 3DGQA 5F8BA 1CQGA 2LRNA 3TKSE 2VCQA 2JL4A 3QFAC 5B8AA 3QD9A 4WETA 2DJKA 3RPNA 5ECOB 3HKRA 3FMWA 1SL1B 3MIXA 4HOJA 2WULA 5DALB 3UEMA 5J9BA 3LJRA 1Z9HA 2WDUA 2P5RA 2G0FA 3RHBA 6GSUA 4GXZA 1GUKA 1SKRB 4K7IA 3LXTA 2FY6A 5EY6A 4G0LA 4IP6A 1EGOA 2HZEB 5A5KA 1F6MC 3D4TA 1YQ1A 5J9CA 4KA0A 3IXRA 3GURA 3CMIA 4CHSA 2B3SA 4MF6A 2GS3A 3GKMA 2CVKA 3KJYA 2FCHA 3HZ8A 2YZUA 4NV5A 2OKAA 2NBSA 2IFQB 4PNGA 1XPVA 3QAVA 3M0FA 1VF2A 1SK2A 3GKNA 2JU5A 4JR4A 4GCIA 2A2PA 2OA7A 3KH7A 2YJ7A 2GTUA 4ZL9A 1M9AA 4V2NA 1PD21 3A5IA 5D73A 3H4KA 2K9FA 1GTIA 2DIZA 3KZQA 5B6MA 4EL1A 5D9XA 5G30A 2DC5A 2EC4A 5INYA 1LJRA 1Z6MA 2I9HA 2FHEA 5CRHA 3DMLA 5COHA 1A2LA 1GSYA 2CAQA 3SWLA 5AIVA 1ML6A 2VCWA 1ST9A 4WBRD 1EOHA 1GP1A 2HRKA 1TP9A 1HQOA 3QFBC 1PKZA 1GSQA 1N2AA 5H5SA 2DJ3A 2RUEA 2VCXA 4IQ1A 2HRAA 2AV4A 1YDKA 3APQA 5AGYA 1V2AA 2CX4A 2J23A 2EIOA 3D22A 2PERA 2LS5A 2MYGA 3A3TA 5J3RA 1LBKA 2OBKA 2HSHA 6GSWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MPF A;  1SU9 A;  3KGK A;  4MJA A;  2LRC A;  2GZP A;  4EC0 A;  2N5F A;  3BJ5 A;  1OKD A;  4EO3 A;  1USB A;  3GTU B;  1R4W A;  2B5X A;  2GQK A;  3TGZ A;  2JSZ A;  1OC9 A;  4OFM A;  3M9J A;  1SYX A;  3IBH A;  4WF4 A;  4HJM A;  2L4C A;  4ILF A;  1TDI A;  1X9M B;  4NAX A;  5KN0 A;  4J56 E;  2L4Q A;  3LOR A;  3L9S A;  1ZCP A;  1Y25 A;  4IHU A;  2GSS A;  2N5B A;  4OCE A;  1GL8 A;  3GH6 A;  1NSW A;  2YV7 A;  1CQH A;  4N0Z A;  5F0G A;  2VLV A;  4ZIJ A;  3WYW A;  2IME A;  3FZ4 A;  2I1U A;  1JLV A;  2C1Y A;  3ME8 A;  2DSA A;  4IQA A;  3ZIT A;  2X99 A;  1TKD B;  2VL2 A;  3ZIV A;  1EEM A;  3F4T A;  1SEN A;  2DML A;  2HNL A;  4I6X A;  1WE0 A;  4POB A;  4XCS A;  1KEB A;  2O8V B;  3C1S A;  4DVC A;  3RAZ A;  2K8S A;  1A8Y A;  4I8B A;  1NM3 A;  3BBY A;  5J41 A;  4TXO A;  2HRN A;  3IPZ A;  4EKZ A;  1E6B A;  2CT6 A;  3J7Y b;  4HZ4 A;  3HY2 A;  4IN0 A;  3KTL A;  3VWX A;  4NMU A;  2X8H A;  1X5C A;  2YZH A;  1F2E A;  4GSN A;  4ACS A;  2B5Y A;  4XHM A;  5CAX A;  2MZC A;  3UBL A;  1SKS B;  2YCD A;  5ECR B;  20GS A;  4FIW A;  2H1G A;  3D21 A;  4TR3 A;  1A23 A;  4Q5R A;  2LNT A;  3G7Y A;  4GQC A;  1PL1 A;  1GSD A;  3GSS A;  4GLT A;  3A2W A;  1FO5 A;  5D9T A;  14GS A;  8GSS A;  4ZB9 A;  1TK5 B;  3TKS C;  2FD3 A;  4ZB6 A;  2H74 A;  1A2J A;  1R5A A;  1PX7 A;  5G1L A;  1SYR A;  2E7P A;  3L78 A;  1MDK A;  5EL8 A;  5L71 A;  2DLX A;  4EDZ A;  3A2X A;  1SL2 B;  1XW9 A;  3ME7 A;  2PBJ A;  1A8L A;  4GF0 A;  4PUR A;  1K0D A;  2DMM A;  4G19 A;  3WT2 A;  3WT1 A;  1SD8 A;  1KBN A;  2QKE A;  3LEF A;  4DSR A;  3TJF A;  5ECN B;  1TI3 A;  2TIR A;  3CRT A;  1PGT A;  1V98 A;  2RM6 A;  3F3R A;  4K7N A;  1UN2 A;  5FWG A;  3VLN A;  2O87 A;  4PUA A;  1M7T A;  1ERT A;  5JWO B;  3G9B A;  1ZGN A;  1T4Y A;  1GNE A;  4OFT A;  2MBS A;  2R4V A;  5G1K A;  1IYI A;  1DE1 A;  1DUG A;  1E2Y A;  4LLR A;  3O3T A;  1XZO A;  2FWG A;  4OMV A;  1SJ6 A;  1TOF A;  3ZMK A;  2HLS A;  2XC2 A;  3EVI A;  2HYX A;  4V2L A;  1XOB A;  4EVM A;  1MDI A;  4L5O A;  1EEJ A;  5DVB A;  1FAA A;  1K0B A;  3DYR A;  3S9F A;  3Q18 A;  2RLI A;  9GSS A;  1TRW A;  4OWY A;  2X64 A;  2FA4 A;  2ON7 A;  1K0O A;  3FYG A;  4HI7 A;  4XS4 A;  2E2M A;  3FW2 A;  1URM A;  6GST A;  5GSS A;  4OO5 A;  4IJI A;  2DJ0 A;  2VAF A;  2OE1 A;  4ZXG A;  4K0N A;  3DVW A;  4V2M A;  4P3Y B;  3HVV A;  2N5A A;  2AHE A;  1B48 A;  2CX3 A;  3GL3 A;  3GMF A;  4F2I A;  2QGV A;  4NWY A;  2VCZ A;  1X0R A;  2VCT A;  5CNW A;  1EGR A;  3D5J A;  1OVN A;  5LNK e;  3DWV A;  1XOA A;  3GRX A;  1ACV A;  3DXB A;  3I9V 2;  3TJB A;  1XWG A;  1XIY A;  2H71 A;  1QMV A;  3MAK A;  1O81 A;  1Z6N A;  2PUK C;  3VUR A;  2IPA A;  1X9S B;  4LA1 A;  3L4N A;  4E8H A;  1BED A;  4WF5 A;  4X1U A;  2R3X A;  5AIS A;  3BD2 A;  4XRD A;  1ZYQ B;  2C0G A;  5H5Q A;  5GAN D;  3E9J B;  1QFN A;  3FK8 A;  2RII A;  4ML1 A;  1JZW A;  4OFN A;  3TKQ A;  5J4U A;  1Q98 A;  1GUH A;  1XCC A;  1GRX A;  2NTO A;  5IPG A;  3EU3 A;  2L5O A;  3H93 A;  1TU8 A;  1K0C A;  1UC7 A;  3TRP A;  2AJQ B;  1BAY A;  3GKK A;  2C4J A;  4TRX A;  1Y6E A;  4BPY A;  4LL4 B;  1RQM A;  4ZL7 A;  2C3Q A;  4ML6 A;  5DBQ A;  3H8Q A;  3F0I A;  5G5F A;  4ZIL A;  4F82 A;  1ZMA A;  1O73 A;  5CP1 A;  3VK9 A;  5EVO A;  1JHB A;  4GWR A;  1JZD A;  3CTG A;  4IJ3 A;  4F9Z A;  4I2T A;  2M80 A;  2M72 A;  3W6G A;  3WGD A;  1GSU A;  2IN3 A;  4AJ6 A;  2H0I A;  4K2D A;  4ZBB A;  4DSS A;  2EIR A;  5JCG A;  1KTE A;  4IP1 A;  4V1A p;  4ID0 A;  2JZT A;  3HCZ A;  3UOM A;  4POL A;  2GSR A;  4LMV A;  2A4V A;  1OC8 A;  1XFL A;  2QC7 A;  5B6N A;  1F3A A;  4QL9 A;  1S3C A;  3TCO A;  3GUS A;  4G10 A;  2YWI A;  4I5Q A;  3KMO A;  4JU5 A;  2WS2 A;  4KH7 A;  1A0F A;  2OAC A;  4BA7 A;  2IWT A;  1GNW A;  1KNG A;  2CVB A;  2YNX A;  2OJL A;  1QK8 A;  5DAL A;  4GRF A;  1K0M A;  2D2Z A;  3EC3 A;  2L6D A;  2X8G A;  3K8N A;  3QAW A;  4NPB A;  3CXG A;  5IO0 A;  2TRC P;  1QQ2 A;  2AYT A;  5KN1 A;  1B9X C;  2E0Q A;  1DE2 A;  2KLX A;  2PGT A;  4TKY A;  1M0U A;  3UVT A;  4HDE A;  2HZE A;  4GQF A;  4F0C A;  4EF0 A;  2RUF A;  3HVS A;  1Z7R A;  3HHV A;  4LMW A;  3J7Y k;  4I97 A;  2FWE A;  2KP1 A;  4JR6 A;  3G7I A;  1A0R P;  3ZRE A;  2HT9 A;  1XWB A;  5DJL A;  3ZL5 A;  2P0G A;  4MH3 A;  1RW1 A;  3BCI A;  1YEX A;  2GSQ A;  5DDL A;  11GS A;  1YJ6 A;  1SD9 A;  4FH8 A;  1XWK A;  1T4Z A;  4MF5 A;  2FGX A;  1EV4 A;  2V2G A;  3PR8 A;  4G9H A;  1SK1 A;  5IO2 A;  2ON5 A;  1TK8 B;  3F8U A;  3TB2 A;  4V1A g;  2AAW A;  4WBJ A;  2GT6 A;  3WGE A;  2OE0 A;  2OE3 A;  1G7E A;  3M9K A;  4CDO A;  4KAE A;  2DJJ A;  4MJB A;  3KD0 A;  1GSE A;  1VF3 A;  1O8W A;  2MMN A;  5B7C A;  1GH2 A;  2YWO A;  5DCG A;  4EDY A;  2IJY A;  1JLW A;  4JZQ A;  1LU4 A;  2BMX A;  3P90 A;  1O7U A;  4MCU A;  2GVP A;  1T8E B;  4X0X A;  1OYJ A;  13GS A;  2A2R A;  5ELA A;  5LCZ A;  1IYH A;  2IIY A;  1NHO A;  4PGT A;  4K8M A;  4NHZ A;  3F6F A;  2C80 A;  5HFK A;  3GX0 A;  2HZF A;  2C0E A;  4MDC A;  3P8W A;  3GN3 A;  3CTF A;  1M9B A;  5AN1 A;  3IAS 2;  3TRX A;  4TXO B;  1BJX A;  1T3B A;  1X5E A;  2K6V A;  2PVO C;  2X8C A;  3I43 A;  1B4P A;  3TUE A;  3U6V A;  3UAR A;  3GTU A;  3MNG A;  1WWJ A;  5HR2 A;  5GZZ B;  4K1F A;  1VGL A;  4MZW A;  3VWU A;  4EUY A;  17GS A;  3HXS A;  2I81 A;  4HS1 A;  2C0F A;  4ZBD A;  5F06 A;  4I2U A;  2DJ2 A;  3TJG A;  3QAG A;  3C8E A;  3ZRD A;  2G2Q A;  4F0B A;  1DBY A;  1XVW A;  1JFU A;  3FEU A;  2Z9S A;  3NOF A;  2WCI A;  3E3E A;  4PQI A;  4D73 B;  3LQ7 A;  1N8J A;  4TR1 B;  1GSF A;  2H01 A;  4Q5Q A;  2XHF A;  3M1G A;  2ES7 A;  4KX4 A;  2YV9 A;  4N0V A;  4YAP A;  1S3A A;  2TRX A;  3CBU A;  1FB6 A;  2KHP A;  2LKU A;  1HD2 A;  2H19 A;  4DEJ A;  1XW5 A;  2B1K A;  5HR0 A;  4GTU A;  1U87 A;  1V57 A;  2LJK A;  1YKA A;  2GDR A;  1U3A A;  5DQS A;  1R7H A;  2VO4 A;  2VM1 A;  5G31 A;  2WFC A;  2B1L A;  1B8X A;  1TU7 A;  1BQ7 A;  2PPT A;  2PWJ A;  3O76 A;  2NVL A;  4K9Z A;  3WGX A;  3QCP A;  4L5L A;  4ECC A;  1J08 A;  3D4M A;  4FYB A;  3VFI A;  3QMX A;  2FWH A;  3HD5 A;  1Z7P A;  3PIN A;  3CRU A;  2H75 A;  3ERW A;  1VRS D;  4E8E A;  2H1B A;  2LTK A;  4MLY A;  4MZB A;  3EIN A;  3LWA A;  2VD0 A;  5FHI A;  2IMI A;  1GTU A;  2VL3 A;  1W89 A;  5A4V A;  4IKH A;  4Q5N A;  3VWW A;  1A2M A;  5ECQ B;  5ECM B;  3EUR A;  1PKW A;  1V9W A;  2H76 A;  4KGI A;  1ZYE A;  1O8X A;  2C0D A;  3GL5 A;  5IM9 A;  1GUM A;  3TJK A;  2VL2 C;  1QUW A;  1G7O A;  5JCW A;  2I4A A;  4FYU A;  5HFI A;  1AAZ A;  5HFG A;  1Z5Y E;  4ULX A;  3F9U A;  4XS4 B;  2HXK A;  6GSY A;  3TKR A;  3KP8 A;  3TRQ A;  2PMT A;  2GZZ A;  2VCV A;  3EMX A;  4XS6 A;  4IW9 A;  5A4W A;  3LYK A;  2YWM A;  2LNS A;  3HJP A;  1GWC A;  1NHY A;  3RHC A;  1XBS A;  5DCH A;  3Q6O A;  2LEG A;  3ERG A;  2H1A A;  2NPB A;  3FY7 A;  5D93 A;  3BOA A;  2IL3 A;  5LD0 A;  5H5R A;  2WZ9 A;  3HVX A;  4K6X A;  4Z7X A;  1AIU A;  2EIQ A;  2P5Q A;  3H79 A;  3EWL A;  5IPH A;  3JCM L;  2H70 A;  2GGT A;  1OAZ A;  4EXJ A;  4EE0 A;  2KP2 A;  2VM2 A;  2CVD A;  2VL9 A;  3MDK A;  1ERW A;  3LFL A;  1F3B A;  1WIK A;  5ABR A;  2HSY A;  1M2D A;  3ZFL A;  5D9W A;  3KEB A;  4RI6 A;  5IIZ A;  3VWV A;  2XPD A;  3TDG A;  3GKX A;  1T00 A;  5CRD A;  4CW9 A;  2LJR A;  2R2J A;  1PN9 A;  3OR5 A;  1TRV A;  4KDU A;  5GAP D;  1G6W A;  2K8V A;  5ID2 B;  1EOG A;  5F05 A;  2CQ9 A;  1K0A A;  1C72 A;  18GS A;  2VLU A;  1THO A;  2H30 A;  3ERF A;  2FNO A;  4L8E A;  1H4O A;  3UVH A;  2IMD A;  4JE1 A;  4GST A;  4MAB A;  5ECI B;  4KW6 A;  2GST A;  1T7P B;  1AUC A;  4O5R A;  4NHW A;  3IV4 A;  4GSS A;  4JBB A;  1FHE A;  5JCU A;  3IC4 A;  3APS A;  1GLQ A;  4POM A;  3C1R A;  3UBK A;  4HJ2 A;  1T1V A;  5DAK A;  3VPQ A;  2H66 A;  2OBI A;  3GFK A;  2YWN A;  4RQX A;  5HR1 A;  4DSS B;  2V41 A;  1ERV A;  2LRT A;  3Q19 A;  2CZ3 A;  2JZS A;  4MA9 A;  4WEY A;  1V40 A;  4H86 A;  1AXD A;  4K0G A;  4TOP A;  2DBC A;  1WPI A;  5ECH B;  3UMA A;  2V6O A;  3BCK A;  1GSS A;  1EP7 A;  1FW1 A;  5AIX A;  2K18 A;  2GT5 A;  4HQZ A;  4AJ8 A;  6GSV A;  4YAV A;  1ZZY A;  2PN8 A;  1AQX A;  2QSI A;  4AJ7 A;  4RI7 A;  4PX1 A;  1GTB A;  5IOW A;  3H1N A;  3IK9 A;  2ZUP A;  5HR3 A;  4OO4 A;  1EP8 A;  3N9J A;  16GS A;  4IBP A;  1TXX A;  4MZC A;  1Z3E A;  2VOC A;  1U3I A;  3M3M A;  4WKW A;  4PUF C;  1EV9 A;  4G2E A;  3I69 A;  1XXU A;  2VLT A;  3ZVJ D;  4YQM A;  3CSJ A;  3QR6 A;  3QDN A;  2WB9 A;  2L59 A;  3DEX A;  3L0H A;  3ISO A;  2L6C A;  2FUG 2;  4MH2 A;  2H6Y A;  1I5G A;  5ECK B;  3F6D A;  3GNJ A;  3VI5 A;  4BVX A;  4O7H A;  4X43 A;  1ILO A;  1G0T A;  2V32 A;  3GV1 A;  5KEJ A;  2J9H A;  5IMC A;  3HYP A;  1F9M A;  5F07 A;  4IEL A;  3EE2 A;  4KUN A;  3ZVJ A;  5DJM A;  1U6T A;  1JZO A;  3QPM A;  2E2G A;  1XWA A;  2FWF A;  3KMN A;  3UJ1 A;  4KE3 A;  1SJZ A;  2C3N A;  2XPE A;  4XIH A;  5D96 A;  3F4R A;  1AC1 A;  2R6K A;  2RM5 A;  1TRS A;  3IA1 A;  1XWC A;  3DD3 A;  1QGV A;  2FA8 A;  4HU7 A;  4LL1 B;  2YAN A;  4Q5F A;  3NIV A;  4MPG A;  6GSX A;  5G5E A;  4HZ2 A;  1AQV A;  1YF1 A;  5B8B A;  2ZNM A;  1HYU A;  2BTO T;  4HUA A;  1M2A A;  5IMZ A;  4HU9 A;  2C8U A;  2HI7 A;  3DRN A;  1H75 A;  2IFQ A;  4MF7 A;  1XVQ A;  2LJA A;  5ECL B;  5CYY A;  3SBC A;  2LST A;  4NXI A;  4NV2 A;  3A2V A;  5D9V A;  4F03 A;  1K3O A;  4TXV A;  1YKC A;  1WMJ A;  1OC9 B;  5E4W A;  4RQR A;  5EPF A;  4TR0 A;  3D6I A;  4XS1 A;  1GUL A;  2CV4 A;  4N30 A;  2VIM A;  4FYC A;  5A4U A;  2BJX A;  2JAC A;  1OE8 A;  5ENU A;  1WOU A;  3V1W A;  3IE3 A;  5KN3 A;  4WR5 A;  1NW2 A;  1G6Y A;  4BWS A;  1WP0 A;  1YY7 A;  2WJU A;  3FZ5 A;  1FB0 A;  1BX9 A;  1O6J A;  4WR4 A;  3CSI A;  2P31 A;  3HJM A;  2WGR A;  3RBT A;  3F63 A;  1UVZ A;  3P7X A;  2XBQ A;  2H6Z A;  1FVK A;  3IOS A;  3EMP A;  3HJO A;  3KXO A;  5ECS A;  3KP9 A;  3TOT A;  2KOK A;  1RK4 A;  4ZL8 A;  2CA8 A;  2HE3 A;  3UAP A;  3TKS A;  3KCM A;  3MWH A;  2C3T A;  4JRR A;  4KSM A;  4KCE A;  2L5L A;  4IGJ A;  3IK7 A;  1WRY A;  3F3Q A;  3US3 A;  3IAM 2;  1FOV A;  2KUC A;  3ZZX A;  1TTZ A;  4TW5 A;  2YP6 A;  3W8J A;  2JZR A;  5IMD A;  3A5W A;  2O89 A;  3VPT A;  4IS0 A;  5JWQ B;  12GS A;  2B7K A;  2F8F A;  4FO5 A;  4PQH A;  1VF1 A;  1UA5 A;  3HDC A;  1V58 A;  3FZ9 A;  3GIX A;  5CRE A;  1FG4 A;  4HQS A;  1I9D A;  2HFD A;  3M8N A;  6GSS A;  3HZ4 A;  2O85 A;  4AGS A;  2DIY A;  2F8A A;  1PRX A;  3GYK A;  1ZL9 A;  3RPP A;  2JAD A;  3IDV A;  3KIJ A;  1GLP A;  2IMF A;  3FKF A;  3Q74 A;  3C7M A;  2XBI A;  2YJH A;  4ZB8 A;  1BG5 A;  4N10 A;  3E0U A;  3ZFB A;  4TN8 A;  3PH9 A;  3FR9 A;  2MBT A;  2LUS A;  1SK0 A;  2YPM A;  5D8I A;  2H72 A;  2VUP A;  1SL0 B;  2V6K A;  3LSZ A;  3LYP A;  22GS A;  2O7K A;  4OCF A;  3U5R E;  3ZTL A;  3ZLP A;  1MDJ A;  4AF2 A;  1PMT A;  2PU9 C;  1PL2 A;  4MJE A;  4ECJ A;  3KM6 A;  5IMV A;  3I6A A;  1Q4J A;  3WD6 A;  2F3M A;  3FR6 A;  3ZML A;  5FT3 A;  5CRW A;  4PNF A;  4IVF A;  1THX A;  1DSB A;  1R26 A;  1X5D A;  2F9S A;  5IMA A;  2LQO A;  1X9W B;  2GLR A;  5CRG A;  3O6T A;  1BYE A;  3FZA A;  2LV3 A;  2ALB A;  3GHA A;  1M99 A;  3LXZ A;  5ELG A;  3L9U A;  2YN1 A;  3DIE A;  3GA4 A;  1K0N A;  1TI1 A;  1F37 A;  4K7O A;  1EWX A;  7GSS A;  4BL7 A;  1MD4 A;  4PQ1 A;  4MMM A;  1AW9 A;  4TVE A;  1ABA A;  1VF4 A;  3EYT A;  3R2Q A;  4O92 A;  5J5N A;  4N11 A;  2REM A;  2A2S A;  3ZYW A;  4L0W A;  1MD3 A;  5CO3 A;  3G7J A;  1YF0 A;  2YOI A;  3CYN A;  4D73 A;  4TR1 A;  3ZIJ A;  2H1D A;  4YQV A;  1WJK A;  3GX8 A;  1JZR A;  3FR3 A;  4KSO A;  4BWQ A;  2I3Y A;  1S3D A;  5IQY A;  1A24 A;  4MK3 A;  4JED A;  3N5O A;  3VI7 A;  1OE7 A;  3FHK A;  5HQP A;  3KH9 A;  1AQW A;  1O85 A;  2R5G A;  1PQN A;  2MMZ A;  2LQQ A;  3EU4 A;  1YEP A;  1YZX A;  3UL3 A;  3IHQ A;  2ZCT A;  1U88 A;  1J9B A;  3P2A A;  2MMO A;  4QL7 A;  2L57 A;  4YH2 A;  1HNB A;  3KTB A;  1OKT A;  4XTS A;  4KB3 A;  1XW6 A;  2DJ1 A;  1HNA A;  2GZY A;  4MJC A;  1M2B A;  1PSQ A;  1R5P A;  1OC3 A;  1W4V A;  1HNC A;  3FRC A;  5IOX A;  3MSZ A;  5G2Z A;  3CSH A;  3LG6 A;  4PXO A;  1GTA A;  2V1M A;  2WRT A;  5KN2 A;  2CZ2 A;  2AUV A;  1K3L A;  1QXH A;  3W8S A;  2GQM A;  4KDY A;  4BVY A;  2H8L A;  3GH9 A;  2H0G A;  3DKS A;  1ERU A;  3IRA A;  4J57 E;  5IMF A;  2B6M A;  3APO A;  4HEA 2;  3HA9 A;  4RUV A;  4KND A;  3TJJ A;  2JSY A;  4ECB A;  1SJI A;  2FLS A;  3F4S A;  2AB6 A;  2IMK A;  3IR4 A;  1TW9 A;  1EZK A;  4MP4 A;  3UIW A;  4OD7 A;  4O32 A;  4J2F A;  3AY8 A;  5E59 A;  4KCA A;  2NDO A;  2F51 A;  3L9V A;  5DAK B;  1FVJ A;  5ECP B;  1TRU A;  4ECI A;  1MTC A;  2B5E A;  4WXT A;  3LGC A;  4L0U A;  3D0Z A;  3RDW A;  1B4Q A;  5C04 A;  3DVX A;  2H6X A;  2H0H A;  3TOU A;  5DQY A;  4XRA A;  4POK A;  3GST A;  2GQL A;  3C71 A;  10GS A;  5JWR B;  3PGT A;  1PX6 A;  2R37 A;  2M46 A;  2CAI A;  1PA3 A;  2MMA A;  2VD1 A;  1B9Y C;  3NZN A;  4KDX A;  4QQ7 A;  19GS A;  4YQU A;  1ZOF A;  3ED3 A;  1ON4 A;  1TK0 B;  4ISD A;  3QOU A;  2HRF A;  1J0F A;  5GST A;  1K3Y A;  5ID2 A;  5C00 A;  2OAD A;  4ZBA A;  4DSQ A;  3C73 A;  1MEK A;  3TKP A;  2PVQ A;  1SKW B;  4TR4 A;  2B7J A;  1TJD A;  2H73 A;  3DGQ A;  5F8B A;  1CQG A;  2LRN A;  3TKS E;  2VCQ A;  2JL4 A;  3QFA C;  5B8A A;  3QD9 A;  4WET A;  2DJK A;  3RPN A;  5ECO B;  3HKR A;  1SL1 B;  4HOJ A;  2WUL A;  5DAL B;  3UEM A;  5J9B A;  3LJR A;  1Z9H A;  2WDU A;  2P5R A;  2G0F A;  3RHB A;  6GSU A;  4GXZ A;  1GUK A;  1SKR B;  4K7I A;  3LXT A;  2FY6 A;  5EY6 A;  4IP6 A;  1EGO A;  2HZE B;  5A5K A;  1F6M C;  3D4T A;  1YQ1 A;  5J9C A;  4KA0 A;  3IXR A;  3GUR A;  3CMI A;  4CHS A;  2B3S A;  4MF6 A;  2GS3 A;  3GKM A;  2CVK A;  3KJY A;  2FCH A;  3HZ8 A;  2YZU A;  4NV5 A;  2OKA A;  2NBS A;  2IFQ B;  4PNG A;  1XPV A;  3QAV A;  3M0F A;  1VF2 A;  1SK2 A;  3GKN A;  2JU5 A;  4JR4 A;  4GCI A;  2OA7 A;  3KH7 A;  2YJ7 A;  2GTU A;  4ZL9 A;  1M9A A;  4V2N A;  1PD2 1;  5D73 A;  3H4K A;  2K9F A;  1GTI A;  2DIZ A;  3KZQ A;  5B6M A;  4EL1 A;  5D9X A;  5G30 A;  2DC5 A;  2EC4 A;  5INY A;  1LJR A;  1Z6M A;  2I9H A;  2FHE A;  5CRH A;  3DML A;  5COH A;  1A2L A;  1GSY A;  2CAQ A;  3SWL A;  5AIV A;  1ML6 A;  2VCW A;  1ST9 A;  4WBR D;  1EOH A;  1GP1 A;  1TP9 A;  1HQO A;  3QFB C;  1PKZ A;  1GSQ A;  1N2A A;  5H5S A;  2DJ3 A;  2RUE A;  2VCX A;  4IQ1 A;  2AV4 A;  1YDK A;  3APQ A;  5AGY A;  1V2A A;  2CX4 A;  2J23 A;  2EIO A;  3D22 A;  2PER A;  2LS5 A;  2MYG A;  3A3T A;  5J3R A;  1LBK A;  2OBK A;  2HSH A;  6GSW A; 
#chains in the Genus database with same CATH topology
 4MPF A;  1SU9 A;  3KGK A;  4MJA A;  2LRC A;  2GZP A;  4EC0 A;  2N5F A;  3BJ5 A;  1OKD A;  4EO3 A;  1USB A;  3GTU B;  1R4W A;  2B5X A;  2GQK A;  3TGZ A;  2JSZ A;  1OC9 A;  4OFM A;  3M9J A;  1SYX A;  3IBH A;  4WF4 A;  4HJM A;  2L4C A;  4ILF A;  1TDI A;  1X9M B;  4NAX A;  5KN0 A;  4J56 E;  2L4Q A;  3LOR A;  3L9S A;  1ZCP A;  1Y25 A;  4IHU A;  2GSS A;  2N5B A;  4OCE A;  1GL8 A;  3GH6 A;  1NSW A;  2YV7 A;  1CQH A;  4N0Z A;  5F0G A;  2VLV A;  4ZIJ A;  3WYW A;  2IME A;  3FZ4 A;  2I1U A;  1JLV A;  2C1Y A;  3ME8 A;  2DSA A;  4EIQ A;  4IQA A;  3ZIT A;  2X99 A;  1TKD B;  4EIP A;  2VL2 A;  3ZIV A;  1EEM A;  3F4T A;  1SEN A;  2DML A;  2HNL A;  4I6X A;  1WE0 A;  5BMU A;  4POB A;  4XCS A;  1KEB A;  2O8V B;  3C1S A;  4DVC A;  3RAZ A;  2K8S A;  1A8Y A;  3MYD A;  4I8B A;  1NM3 A;  3BBY A;  5J41 A;  4TXO A;  2HRN A;  3IPZ A;  4EKZ A;  1E6B A;  2CT6 A;  3J7Y b;  4HZ4 A;  3HY2 A;  4IN0 A;  3KTL A;  3VWX A;  4NMU A;  2X8H A;  1X5C A;  2YZH A;  1F2E A;  4GSN A;  4ACS A;  2B5Y A;  4XHM A;  5CAX A;  2MZC A;  3UBL A;  1SKS B;  2YCD A;  5ECR B;  20GS A;  4FIW A;  2H1G A;  3D21 A;  4TR3 A;  1A23 A;  4Q5R A;  2LNT A;  3G7Y A;  4GQC A;  1PL1 A;  1GSD A;  3GSS A;  1S3R A;  4GLT A;  3A2W A;  1FO5 A;  5D9T A;  14GS A;  8GSS A;  4ZB9 A;  1TK5 B;  3TKS C;  2FD3 A;  4ZB6 A;  2H74 A;  1A2J A;  1R5A A;  1PX7 A;  5G1L A;  1SYR A;  2E7P A;  3L78 A;  1MDK A;  5EL8 A;  5L71 A;  4PTS A;  2DLX A;  4EDZ A;  3A2X A;  1SL2 B;  1XW9 A;  3ME7 A;  2PBJ A;  1A8L A;  4GF0 A;  4PUR A;  1K0D A;  2DMM A;  1ZYN A;  4G19 A;  3WT2 A;  3WT1 A;  1SD8 A;  4G0K A;  1KBN A;  2QKE A;  3LEF A;  4DSR A;  3TJF A;  4CY6 A;  5ECN B;  1TI3 A;  2TIR A;  3CRT A;  1PGT A;  1V98 A;  2RM6 A;  3F3R A;  4K7N A;  1UN2 A;  5FWG A;  3VLN A;  2O87 A;  4PUA A;  1M7T A;  1ERT A;  5JWO B;  3G9B A;  1ZGN A;  2HSM A;  1T4Y A;  1GNE A;  4OFT A;  2MBS A;  2R4V A;  5G1K A;  1IYI A;  1DE1 A;  1DUG A;  1E2Y A;  4LLR A;  3O3T A;  1XZO A;  2FWG A;  4OMV A;  1SJ6 A;  1TOF A;  2DKH A;  3ZMK A;  2HLS A;  2XC2 A;  3EVI A;  2HYX A;  4V2L A;  1XOB A;  4EVM A;  1MDI A;  4L5O A;  1EEJ A;  5DVB A;  1FAA A;  1K0B A;  5BRT A;  3DYR A;  3S9F A;  3Q18 A;  2RLI A;  9GSS A;  1TRW A;  4OWY A;  2X64 A;  4CY8 A;  2FA4 A;  2ON7 A;  1K0O A;  3FYG A;  4HI7 A;  4XS4 A;  2E2M A;  3FW2 A;  1URM A;  6GST A;  5GSS A;  4OO5 A;  4IJI A;  2DJ0 A;  2VAF A;  2OE1 A;  4ZXG A;  4K0N A;  3DVW A;  4V2M A;  4P3Y B;  3HVV A;  2N5A A;  2AHE A;  1B48 A;  2CX3 A;  3GL3 A;  3GMF A;  4F2I A;  2QGV A;  4NWY A;  2VCZ A;  1X0R A;  2VCT A;  5CNW A;  1EGR A;  3D5J A;  1PN0 A;  1OVN A;  5LNK e;  3DWV A;  1XOA A;  3GRX A;  1ACV A;  3DXB A;  3I9V 2;  3TJB A;  1XWG A;  1XIY A;  2H71 A;  1QMV A;  3MAK A;  1O81 A;  1Z6N A;  2PUK C;  3VUR A;  1M3J A;  2IPA A;  1X9S B;  4LA1 A;  3L4N A;  4E8H A;  1BED A;  4WF5 A;  4X1U A;  2R3X A;  5AIS A;  3BD2 A;  4XRD A;  1ZYQ B;  2C0G A;  5H5Q A;  5GAN D;  3E9J B;  1QFN A;  3FK8 A;  2RII A;  4ML1 A;  1JZW A;  4OFN A;  3TKQ A;  5J4U A;  1Q98 A;  1GUH A;  1XCC A;  1GRX A;  2NTO A;  5IPG A;  3EU3 A;  2L5O A;  3H93 A;  1TU8 A;  1K0C A;  1UC7 A;  3TRP A;  2AJQ B;  4X4J A;  1BAY A;  3GKK A;  2C4J A;  4TRX A;  1Y6E A;  4BPY A;  4LL4 B;  1RQM A;  4ZL7 A;  2C3Q A;  4ML6 A;  5DBQ A;  4BVX B;  3H8Q A;  3F0I A;  5G5F A;  4ZIL A;  4F82 A;  1ZMA A;  1O73 A;  5CP1 A;  3VK9 A;  2R0P A;  5EVO A;  1JHB A;  4GWR A;  4ICY A;  1JZD A;  3CTG A;  4IJ3 A;  4F9Z A;  4I2T A;  2M80 A;  2M72 A;  3W6G A;  3WGD A;  1GSU A;  2IN3 A;  4AJ6 A;  2H0I A;  4K2D A;  4ZBB A;  4DSS A;  2EIR A;  5JCG A;  1KTE A;  4IP1 A;  4V1A p;  4ID0 A;  4MNN A;  2JZT A;  3HCZ A;  3UOM A;  4POL A;  2GSR A;  4LMV A;  2A4V A;  1OC8 A;  2R0G A;  1XFL A;  2QC7 A;  5B6N A;  1F3A A;  4QL9 A;  1S3C A;  3TCO A;  3GUS A;  4G10 A;  2YWI A;  4I5Q A;  2QA2 A;  3KMO A;  4JU5 A;  2WS2 A;  4KH7 A;  1A0F A;  2OAC A;  4Z2U A;  4BA7 A;  2IWT A;  1GNW A;  1KNG A;  2CVB A;  2YNX A;  2OJL A;  1QK8 A;  5DAL A;  4GRF A;  1K0M A;  2D2Z A;  3CQF A;  3EC3 A;  2L6D A;  2X8G A;  4KF9 A;  3K8N A;  3QAW A;  4NPB A;  3CXG A;  5IO0 A;  2TRC P;  4HSC X;  1QQ2 A;  2AYT A;  5KN1 A;  1B9X C;  2E0Q A;  1DE2 A;  2KLX A;  2PGT A;  4TKY A;  1M0U A;  3UVT A;  4HDE A;  2HZE A;  4GQF A;  4F0C A;  4EF0 A;  2RUF A;  3HVS A;  1Z7R A;  3HHV A;  4LMW A;  3J7Y k;  4I97 A;  2FWE A;  2KP1 A;  4JR6 A;  3G7I A;  1A0R P;  3ZRE A;  2HT9 A;  1XWB A;  5DJL A;  3ZL5 A;  2P0G A;  4MH3 A;  1RW1 A;  3BCI A;  1YEX A;  3PPU A;  2GSQ A;  5DDL A;  11GS A;  1YJ6 A;  1SD9 A;  4FH8 A;  1XWK A;  1T4Z A;  4MF5 A;  2FGX A;  1EV4 A;  2V2G A;  3PR8 A;  4G9H A;  1SK1 A;  5IO2 A;  2ON5 A;  1TK8 B;  3F8U A;  3TB2 A;  4V1A g;  2AAW A;  4WBJ A;  2GT6 A;  3WGE A;  2OE0 A;  2OE3 A;  1G7E A;  3M9K A;  4CDO A;  4KAE A;  2DJJ A;  4MJB A;  3KD0 A;  1GSE A;  1VF3 A;  1O8W A;  2MMN A;  5B7C A;  1GH2 A;  2YWO A;  5DCG A;  4EDY A;  2IJY A;  3EPT A;  1JLW A;  4JZQ A;  1LU4 A;  2BMX A;  3P90 A;  1O7U A;  4MCU A;  2GVP A;  1T8E B;  4X0X A;  1OYJ A;  13GS A;  2A2R A;  5ELA A;  5LCZ A;  1IYH A;  2QA1 A;  2IIY A;  1NHO A;  4PGT A;  4K8M A;  4NHZ A;  3F6F A;  2C80 A;  5HFK A;  3GX0 A;  2HZF A;  2C0E A;  4MDC A;  3P8W A;  3GN3 A;  3CTF A;  1M9B A;  5AN1 A;  3IAS 2;  3TRX A;  4TXO B;  1BJX A;  1T3B A;  1X5E A;  2K6V A;  2PVO C;  2X8C A;  3I43 A;  1B4P A;  3TUE A;  4K5S A;  3U6V A;  3UAR A;  3GTU A;  3MNG A;  1WWJ A;  5HR2 A;  5GZZ B;  4K1F A;  1VGL A;  4MZW A;  3VWU A;  4EUY A;  17GS A;  3HXS A;  2I81 A;  4HS1 A;  2C0F A;  4BL7 B;  4ZBD A;  5F06 A;  4I2U A;  2DJ2 A;  3TJG A;  3QAG A;  3C8E A;  3ZRD A;  2G2Q A;  4F0B A;  1DBY A;  1XVW A;  1JFU A;  3FEU A;  3HVN A;  3LW9 A;  2Z9S A;  3NOF A;  2WCI A;  3E3E A;  4PQI A;  2UZ8 A;  4D73 B;  3LQ7 A;  1N8J A;  4TR1 B;  1GSF A;  2H01 A;  4Q5Q A;  2XHF A;  3M1G A;  2ES7 A;  4KX4 A;  2YV9 A;  4N0V A;  4YAP A;  1S3A A;  2TRX A;  3CBU A;  1FB6 A;  2KHP A;  2LKU A;  1HD2 A;  2H19 A;  4DEJ A;  1XW5 A;  2B1K A;  5HR0 A;  4GTU A;  1U87 A;  1V57 A;  2LJK A;  1YKA A;  2GDR A;  1U3A A;  5DQS A;  1R7H A;  2VO4 A;  2VM1 A;  5G31 A;  2WFC A;  4K5R A;  2B1L A;  1B8X A;  1TU7 A;  1BQ7 A;  2PPT A;  2PWJ A;  3O76 A;  2NVL A;  4K9Z A;  3WGX A;  3QCP A;  4L5L A;  4ECC A;  1J08 A;  3D4M A;  4FYB A;  3VFI A;  5KOX A;  3QMX A;  2FWH A;  3HD5 A;  1Z7P A;  3PIN A;  3CRU A;  2H75 A;  3ERW A;  1VRS D;  4E8E A;  4Z2R A;  2H1B A;  2LTK A;  4MLY A;  4MZB A;  3EIN A;  3LWA A;  2VD0 A;  5FHI A;  2IMI A;  1GTU A;  2VL3 A;  1W89 A;  5A4V A;  4IKH A;  4Q5N A;  3VWW A;  1A2M A;  5ECQ B;  5ECM B;  3EUR A;  1PKW A;  1V9W A;  2H76 A;  4KGI A;  1ZYE A;  1O8X A;  2C0D A;  3GL5 A;  5IM9 A;  1GUM A;  3TJK A;  2VL2 C;  1QUW A;  1G7O A;  5JCW A;  2I4A A;  4FYU A;  5HFI A;  1AAZ A;  5HFG A;  4BVY B;  1Z5Y E;  4ULX A;  3F9U A;  4XS4 B;  2HXK A;  6GSY A;  3TKR A;  3KP8 A;  3TRQ A;  2PMT A;  2GZZ A;  2VCV A;  3EMX A;  4XS6 A;  4IW9 A;  5A4W A;  3LYK A;  2YWM A;  2LNS A;  3HJP A;  1GWC A;  1NHY A;  3RHC A;  1XBS A;  5DCH A;  3Q6O A;  2LEG A;  3ERG A;  2H1A A;  2NPB A;  3FY7 A;  5D93 A;  3BOA A;  2IL3 A;  5LD0 A;  5H5R A;  2WZ9 A;  3HVX A;  4K6X A;  4Z7X A;  1AIU A;  2EIQ A;  2P5Q A;  3H79 A;  3EWL A;  5IPH A;  3JCM L;  2H70 A;  2GGT A;  1OAZ A;  4EXJ A;  4EE0 A;  2KP2 A;  2VM2 A;  2CVD A;  2VL9 A;  3MDK A;  1ERW A;  3LFL A;  1F3B A;  1WIK A;  5ABR A;  2HSY A;  1M2D A;  3ZFL A;  5D9W A;  3KEB A;  4RI6 A;  5IIZ A;  3VWV A;  2XPD A;  3TDG A;  3GKX A;  1T00 A;  5CRD A;  4CW9 A;  2LJR A;  4K2X A;  2R2J A;  1PN9 A;  3OR5 A;  1TRV A;  4KDU A;  5GAP D;  1G6W A;  2K8V A;  5ID2 B;  4Z2T A;  1EOG A;  5F05 A;  2CQ9 A;  1K0A A;  1C72 A;  18GS A;  2VLU A;  1THO A;  2H30 A;  3ERF A;  2FNO A;  4L8E A;  1H4O A;  3UVH A;  2IMD A;  4JE1 A;  4GST A;  4MAB A;  5ECI B;  4KW6 A;  2GST A;  1T7P B;  1AUC A;  4O5R A;  4NHW A;  3IV4 A;  4GSS A;  4JBB A;  1FHE A;  5JCU A;  3IC4 A;  3APS A;  1GLQ A;  4POM A;  3C1R A;  3UBK A;  4HJ2 A;  1T1V A;  5DAK A;  1FOH A;  3VPQ A;  2H66 A;  2OBI A;  3GFK A;  2YWN A;  2DKI A;  4RQX A;  5HR1 A;  4DSS B;  2V41 A;  1ERV A;  2LRT A;  3Q19 A;  2CZ3 A;  2JZS A;  4MA9 A;  4WEY A;  1PFO A;  1V40 A;  4H86 A;  1AXD A;  4K0G A;  4TOP A;  2DBC A;  1WPI A;  5ECH B;  3UMA A;  2V6O A;  3BCK A;  1GSS A;  1EP7 A;  1FW1 A;  5AIX A;  2K18 A;  2GT5 A;  4HQZ A;  4AJ8 A;  6GSV A;  4YAV A;  1ZZY A;  2PN8 A;  1AQX A;  1XG8 A;  2QSI A;  4AJ7 A;  4RI7 A;  4PX1 A;  1GTB A;  5IOW A;  3H1N A;  3IK9 A;  2ZUP A;  5HR3 A;  4OO4 A;  1EP8 A;  3N9J A;  16GS A;  4IBP A;  1TXX A;  4MZC A;  1Z3E A;  2VOC A;  1U3I A;  3M3M A;  4WKW A;  4PUF C;  1EV9 A;  4G2E A;  3I69 A;  1XXU A;  2VLT A;  3ZVJ D;  4YQM A;  3CSJ A;  3QR6 A;  3QDN A;  2WB9 A;  2L59 A;  3DEX A;  3L0H A;  3ISO A;  2L6C A;  2FUG 2;  4MH2 A;  2H6Y A;  1I5G A;  5ECK B;  3F6D A;  3GNJ A;  3VI5 A;  4BVX A;  4O7H A;  5KOW A;  4X43 A;  1ILO A;  1G0T A;  2V32 A;  3GV1 A;  5KEJ A;  2J9H A;  5IMC A;  1M3I A;  3HYP A;  1F9M A;  5F07 A;  4IEL A;  3EE2 A;  4KUN A;  3ZVJ A;  5DJM A;  1U6T A;  1JZO A;  3QPM A;  2E2G A;  1XWA A;  2FWF A;  3KMN A;  3UJ1 A;  4KE3 A;  1SJZ A;  2C3N A;  2XPE A;  4XIH A;  5D96 A;  3F4R A;  1AC1 A;  2R6K A;  2RM5 A;  1TRS A;  4YKF A;  3IC8 A;  3IA1 A;  1XWC A;  3DD3 A;  1QGV A;  2FA8 A;  4HU7 A;  4LL1 B;  2YAN A;  4Q5F A;  3NIV A;  4MPG A;  6GSX A;  5G5E A;  4HZ2 A;  1AQV A;  1YF1 A;  5B8B A;  2ZNM A;  1HYU A;  2BTO T;  4HUA A;  1M2A A;  5IMZ A;  4HU9 A;  2C8U A;  2HI7 A;  3DRN A;  1H75 A;  2IFQ A;  4MF7 A;  1XVQ A;  2LJA A;  5ECL B;  5CYY A;  3SBC A;  2LST A;  4NXI A;  4NV2 A;  3A2V A;  5D9V A;  4F03 A;  1K3O A;  4TXV A;  1YKC A;  1WMJ A;  1OC9 B;  5E4W A;  4RQR A;  5EPF A;  4TR0 A;  3D6I A;  4XS1 A;  1GUL A;  2CV4 A;  4N30 A;  2VIM A;  4FYC A;  5A4U A;  2BJX A;  2JAC A;  1OE8 A;  5ENU A;  1WOU A;  3V1W A;  3IE3 A;  5KN3 A;  4WR5 A;  1NW2 A;  1G6Y A;  4BWS A;  1WP0 A;  1YY7 A;  2WJU A;  3FZ5 A;  1FB0 A;  1BX9 A;  1O6J A;  4WR4 A;  3CSI A;  2P31 A;  3HJM A;  2WGR A;  3RBT A;  3F63 A;  1UVZ A;  3P7X A;  2XBQ A;  2H6Z A;  1FVK A;  3IOS A;  3EMP A;  3HJO A;  3KXO A;  5ECS A;  3KP9 A;  3TOT A;  2KOK A;  1RK4 A;  4ZL8 A;  2CA8 A;  2HE3 A;  3UAP A;  3TKS A;  3KCM A;  3MWH A;  2C3T A;  3IHG A;  4JRR A;  4KSM A;  4KCE A;  2L5L A;  4IGJ A;  3IK7 A;  1WRY A;  3F3Q A;  3US3 A;  3IAM 2;  1FOV A;  2R0C A;  2KUC A;  3ZZX A;  1TTZ A;  4TW5 A;  2YP6 A;  3W8J A;  2JZR A;  5IMD A;  3A5W A;  2O89 A;  3VPT A;  4IS0 A;  5JWQ B;  12GS A;  2B7K A;  2F8F A;  4FO5 A;  4PQH A;  1VF1 A;  1UA5 A;  3HDC A;  1V58 A;  3FZ9 A;  3GIX A;  5CRE A;  1FG4 A;  4YKG A;  4HQS A;  1I9D A;  2HFD A;  3M8N A;  6GSS A;  3HZ4 A;  2O85 A;  4AGS A;  2DIY A;  2F8A A;  1PRX A;  3GYK A;  1ZL9 A;  3RPP A;  2JAD A;  3IDV A;  3KIJ A;  1GLP A;  2IMF A;  3FKF A;  3Q74 A;  3C7M A;  2XBI A;  2YJH A;  4ZB8 A;  1BG5 A;  4N10 A;  3E0U A;  3ZFB A;  4TN8 A;  3PH9 A;  3FR9 A;  2MBT A;  2LUS A;  1SK0 A;  2YPM A;  5D8I A;  2H72 A;  2VUP A;  1SL0 B;  2V6K A;  3LSZ A;  2X4A A;  3LYP A;  22GS A;  2O7K A;  4OCF A;  3U5R E;  3ZTL A;  3ZLP A;  1MDJ A;  4AF2 A;  1PMT A;  2PU9 C;  1PL2 A;  4MJE A;  4ECJ A;  3KM6 A;  5IMV A;  3I6A A;  1Q4J A;  3WD6 A;  2F3M A;  3FR6 A;  3ZML A;  5FT3 A;  5CRW A;  4PNF A;  4IVF A;  1THX A;  1DSB A;  1R26 A;  1X5D A;  2F9S A;  1ZYP A;  5IMA A;  2LQO A;  1X9W B;  2GLR A;  5CRG A;  3O6T A;  1BYE A;  3FZA A;  2LV3 A;  2ALB A;  3GHA A;  1M99 A;  3LXZ A;  5ELG A;  3L9U A;  2YN1 A;  3DIE A;  3GA4 A;  1K0N A;  1TI1 A;  1F37 A;  4K7O A;  1EWX A;  7GSS A;  4BL7 A;  1MD4 A;  4PQ1 A;  4MMM A;  1AW9 A;  4TVE A;  1ABA A;  1VF4 A;  3EYT A;  3R2Q A;  2A4H A;  4O92 A;  5J5N A;  4N11 A;  2REM A;  2A2S A;  3ZYW A;  4L0W A;  1MD3 A;  5CO3 A;  3G7J A;  1YF0 A;  2YOI A;  3CYN A;  4D73 A;  4TR1 A;  3ZIJ A;  2H1D A;  4YQV A;  1WJK A;  3GX8 A;  1JZR A;  3FR3 A;  4KSO A;  4BWQ A;  2I3Y A;  1S3D A;  5IQY A;  1A24 A;  4MK3 A;  4JED A;  3N5O A;  3VI7 A;  1OE7 A;  4O5U A;  3FHK A;  5HQP A;  3KH9 A;  1AQW A;  1O85 A;  4BIK A;  2R5G A;  1PQN A;  2MMZ A;  2LQQ A;  3EU4 A;  3R3E A;  1YEP A;  1YZX A;  3UL3 A;  3IHQ A;  2ZCT A;  1U88 A;  1J9B A;  3P2A A;  2MMO A;  2X49 A;  2L57 A;  4QL7 A;  4YH2 A;  1HNB A;  3KTB A;  1OKT A;  4XTS A;  4KB3 A;  1XW6 A;  2DJ1 A;  1HNA A;  2GZY A;  4MJC A;  1M2B A;  1PSQ A;  1R5P A;  1OC3 A;  1W4V A;  1HNC A;  3FRC A;  5IOX A;  3MSZ A;  5G2Z A;  3CSH A;  3LG6 A;  4PXO A;  1GTA A;  2V1M A;  2WRT A;  5KN2 A;  2CZ2 A;  2AUV A;  1K3L A;  1QXH A;  3W8S A;  2GQM A;  4KDY A;  4BVY A;  2H8L A;  3GH9 A;  2H0G A;  3DKS A;  1ERU A;  3IRA A;  4J57 E;  5IMF A;  2B6M A;  3APO A;  4HEA 2;  3HA9 A;  4RUV A;  4KND A;  3TJJ A;  2JSY A;  4ECB A;  1SJI A;  2FLS A;  3F4S A;  2AB6 A;  2IMK A;  3IR4 A;  1TW9 A;  1EZK A;  4MP4 A;  3UIW A;  4OD7 A;  4O32 A;  4J2F A;  4G0I A;  3AY8 A;  5E59 A;  4KCA A;  2NDO A;  2F51 A;  3L9V A;  5DAK B;  1FVJ A;  5ECP B;  1TRU A;  4ECI A;  1MTC A;  2B5E A;  4O5Q A;  4WXT A;  3LGC A;  4L0U A;  3D0Z A;  3RDW A;  1B4Q A;  5C04 A;  3DVX A;  2H6X A;  2H0H A;  3TOU A;  4A5P A;  5DQY A;  4XRA A;  4POK A;  3GST A;  4FQU A;  2GQL A;  3C71 A;  10GS A;  5JWR B;  3PGT A;  1PX6 A;  2R37 A;  2M46 A;  2CAI A;  1PA3 A;  2MMA A;  2VD1 A;  1B9Y C;  3NZN A;  4KDX A;  4QQ7 A;  19GS A;  4YQU A;  1ZOF A;  3ED3 A;  1ON4 A;  1TK0 B;  4ISD A;  3QOU A;  2HRF A;  1J0F A;  5GST A;  4USS A;  1K3Y A;  5ID2 A;  5C00 A;  2OAD A;  4ZBA A;  4DSQ A;  3C73 A;  1MEK A;  3TKP A;  2PVQ A;  1SKW B;  4TR4 A;  2B7J A;  1TJD A;  2H73 A;  3DGQ A;  5F8B A;  1CQG A;  2LRN A;  3TKS E;  2VCQ A;  2JL4 A;  3QFA C;  5B8A A;  3QD9 A;  4WET A;  2DJK A;  3RPN A;  5ECO B;  3HKR A;  3FMW A;  1SL1 B;  3MIX A;  4HOJ A;  2WUL A;  5DAL B;  3UEM A;  5J9B A;  3LJR A;  1Z9H A;  2WDU A;  2P5R A;  2G0F A;  3RHB A;  6GSU A;  4GXZ A;  1GUK A;  1SKR B;  4K7I A;  3LXT A;  2FY6 A;  5EY6 A;  4G0L A;  4IP6 A;  1EGO A;  2HZE B;  5A5K A;  1F6M C;  3D4T A;  1YQ1 A;  5J9C A;  4KA0 A;  3IXR A;  3GUR A;  3CMI A;  4CHS A;  2B3S A;  4MF6 A;  2GS3 A;  3GKM A;  2CVK A;  3KJY A;  2FCH A;  3HZ8 A;  2YZU A;  4NV5 A;  2OKA A;  2NBS A;  2IFQ B;  4PNG A;  1XPV A;  3QAV A;  3M0F A;  1VF2 A;  1SK2 A;  3GKN A;  2JU5 A;  4JR4 A;  4GCI A;  2A2P A;  2OA7 A;  3KH7 A;  2YJ7 A;  2GTU A;  4ZL9 A;  1M9A A;  4V2N A;  1PD2 1;  3A5I A;  5D73 A;  3H4K A;  2K9F A;  1GTI A;  2DIZ A;  3KZQ A;  5B6M A;  4EL1 A;  5D9X A;  5G30 A;  2DC5 A;  2EC4 A;  5INY A;  1LJR A;  1Z6M A;  2I9H A;  2FHE A;  5CRH A;  3DML A;  5COH A;  1A2L A;  1GSY A;  2CAQ A;  3SWL A;  5AIV A;  1ML6 A;  2VCW A;  1ST9 A;  4WBR D;  1EOH A;  1GP1 A;  2HRK A;  1TP9 A;  1HQO A;  3QFB C;  1PKZ A;  1GSQ A;  1N2A A;  5H5S A;  2DJ3 A;  2RUE A;  2VCX A;  4IQ1 A;  2HRA A;  2AV4 A;  1YDK A;  3APQ A;  5AGY A;  1V2A A;  2CX4 A;  2J23 A;  2EIO A;  3D22 A;  2PER A;  2LS5 A;  2MYG A;  3A3T A;  5J3R A;  1LBK A;  2OBK A;  2HSH A;  6GSW A; 
#chains in the Genus database with same CATH homology
 4MPF A;  1SU9 A;  3KGK A;  4MJA A;  2LRC A;  2GZP A;  4EC0 A;  2N5F A;  3BJ5 A;  1OKD A;  4EO3 A;  1USB A;  3GTU B;  1R4W A;  2B5X A;  2GQK A;  3TGZ A;  2JSZ A;  1OC9 A;  4OFM A;  3M9J A;  1SYX A;  3IBH A;  4WF4 A;  4HJM A;  2L4C A;  4ILF A;  1TDI A;  1X9M B;  4NAX A;  5KN0 A;  4J56 E;  2L4Q A;  3LOR A;  3L9S A;  1ZCP A;  1Y25 A;  4IHU A;  2GSS A;  2N5B A;  4OCE A;  1GL8 A;  3GH6 A;  1NSW A;  2YV7 A;  1CQH A;  4N0Z A;  5F0G A;  2VLV A;  4ZIJ A;  3WYW A;  2IME A;  3FZ4 A;  2I1U A;  1JLV A;  2C1Y A;  3ME8 A;  2DSA A;  4EIQ A;  4IQA A;  3ZIT A;  2X99 A;  1TKD B;  4EIP A;  2VL2 A;  3ZIV A;  1EEM A;  3F4T A;  1SEN A;  2DML A;  2HNL A;  4I6X A;  1WE0 A;  5BMU A;  4POB A;  4XCS A;  1KEB A;  2O8V B;  3C1S A;  4DVC A;  3RAZ A;  2K8S A;  1A8Y A;  3MYD A;  4I8B A;  1NM3 A;  3BBY A;  5J41 A;  4TXO A;  2HRN A;  3IPZ A;  4EKZ A;  1E6B A;  2CT6 A;  3J7Y b;  4HZ4 A;  3HY2 A;  4IN0 A;  3KTL A;  3VWX A;  4NMU A;  2X8H A;  1X5C A;  2YZH A;  1F2E A;  4GSN A;  4ACS A;  2B5Y A;  4XHM A;  5CAX A;  2MZC A;  3UBL A;  1SKS B;  2YCD A;  5ECR B;  20GS A;  4FIW A;  2H1G A;  3D21 A;  4TR3 A;  1A23 A;  4Q5R A;  2LNT A;  3G7Y A;  4GQC A;  1PL1 A;  1GSD A;  3GSS A;  4GLT A;  3A2W A;  1FO5 A;  5D9T A;  14GS A;  8GSS A;  4ZB9 A;  1TK5 B;  3TKS C;  2FD3 A;  4ZB6 A;  2H74 A;  1A2J A;  1R5A A;  1PX7 A;  5G1L A;  1SYR A;  2E7P A;  3L78 A;  1MDK A;  5EL8 A;  5L71 A;  4PTS A;  2DLX A;  4EDZ A;  3A2X A;  1SL2 B;  1XW9 A;  3ME7 A;  2PBJ A;  1A8L A;  4GF0 A;  4PUR A;  1K0D A;  2DMM A;  1ZYN A;  4G19 A;  3WT2 A;  3WT1 A;  1SD8 A;  4G0K A;  1KBN A;  2QKE A;  3LEF A;  4DSR A;  3TJF A;  4CY6 A;  5ECN B;  1TI3 A;  2TIR A;  3CRT A;  1PGT A;  1V98 A;  2RM6 A;  3F3R A;  4K7N A;  1UN2 A;  5FWG A;  3VLN A;  2O87 A;  4PUA A;  1M7T A;  1ERT A;  5JWO B;  3G9B A;  1ZGN A;  2HSM A;  1T4Y A;  1GNE A;  4OFT A;  2MBS A;  2R4V A;  5G1K A;  1IYI A;  1DE1 A;  1DUG A;  1E2Y A;  4LLR A;  3O3T A;  1XZO A;  2FWG A;  4OMV A;  1SJ6 A;  1TOF A;  2DKH A;  3ZMK A;  2HLS A;  2XC2 A;  3EVI A;  2HYX A;  4V2L A;  1XOB A;  4EVM A;  1MDI A;  4L5O A;  1EEJ A;  5DVB A;  1FAA A;  1K0B A;  5BRT A;  3DYR A;  3S9F A;  3Q18 A;  2RLI A;  9GSS A;  1TRW A;  4OWY A;  2X64 A;  4CY8 A;  2FA4 A;  2ON7 A;  1K0O A;  3FYG A;  4HI7 A;  4XS4 A;  2E2M A;  3FW2 A;  1URM A;  6GST A;  5GSS A;  4OO5 A;  4IJI A;  2DJ0 A;  2VAF A;  2OE1 A;  4ZXG A;  4K0N A;  3DVW A;  4V2M A;  4P3Y B;  3HVV A;  2N5A A;  2AHE A;  1B48 A;  2CX3 A;  3GL3 A;  3GMF A;  4F2I A;  2QGV A;  4NWY A;  2VCZ A;  1X0R A;  2VCT A;  5CNW A;  1EGR A;  3D5J A;  1PN0 A;  1OVN A;  5LNK e;  3DWV A;  1XOA A;  3GRX A;  1ACV A;  3DXB A;  3I9V 2;  3TJB A;  1XWG A;  1XIY A;  2H71 A;  1QMV A;  3MAK A;  1O81 A;  1Z6N A;  2PUK C;  3VUR A;  2IPA A;  1X9S B;  4LA1 A;  3L4N A;  4E8H A;  1BED A;  4WF5 A;  4X1U A;  2R3X A;  5AIS A;  3BD2 A;  4XRD A;  1ZYQ B;  2C0G A;  5H5Q A;  5GAN D;  3E9J B;  1QFN A;  3FK8 A;  2RII A;  4ML1 A;  1JZW A;  4OFN A;  3TKQ A;  5J4U A;  1Q98 A;  1GUH A;  1XCC A;  1GRX A;  2NTO A;  5IPG A;  3EU3 A;  2L5O A;  3H93 A;  1TU8 A;  1K0C A;  1UC7 A;  3TRP A;  2AJQ B;  4X4J A;  1BAY A;  3GKK A;  2C4J A;  4TRX A;  1Y6E A;  4BPY A;  4LL4 B;  1RQM A;  4ZL7 A;  2C3Q A;  4ML6 A;  5DBQ A;  4BVX B;  3H8Q A;  3F0I A;  5G5F A;  4ZIL A;  4F82 A;  1ZMA A;  1O73 A;  5CP1 A;  3VK9 A;  2R0P A;  5EVO A;  1JHB A;  4GWR A;  4ICY A;  1JZD A;  3CTG A;  4IJ3 A;  4F9Z A;  4I2T A;  2M80 A;  2M72 A;  3W6G A;  3WGD A;  1GSU A;  2IN3 A;  4AJ6 A;  2H0I A;  4K2D A;  4ZBB A;  4DSS A;  2EIR A;  5JCG A;  1KTE A;  4IP1 A;  4V1A p;  4ID0 A;  4MNN A;  2JZT A;  3HCZ A;  3UOM A;  4POL A;  2GSR A;  4LMV A;  2A4V A;  1OC8 A;  2R0G A;  1XFL A;  2QC7 A;  5B6N A;  1F3A A;  4QL9 A;  1S3C A;  3TCO A;  3GUS A;  4G10 A;  2YWI A;  4I5Q A;  2QA2 A;  3KMO A;  4JU5 A;  2WS2 A;  4KH7 A;  1A0F A;  2OAC A;  4Z2U A;  4BA7 A;  2IWT A;  1GNW A;  1KNG A;  2CVB A;  2YNX A;  2OJL A;  1QK8 A;  5DAL A;  4GRF A;  1K0M A;  2D2Z A;  3EC3 A;  2L6D A;  2X8G A;  4KF9 A;  3K8N A;  3QAW A;  4NPB A;  3CXG A;  5IO0 A;  2TRC P;  1QQ2 A;  2AYT A;  5KN1 A;  1B9X C;  2E0Q A;  1DE2 A;  2KLX A;  2PGT A;  4TKY A;  1M0U A;  3UVT A;  4HDE A;  2HZE A;  4GQF A;  4F0C A;  4EF0 A;  2RUF A;  3HVS A;  1Z7R A;  3HHV A;  4LMW A;  3J7Y k;  4I97 A;  2FWE A;  2KP1 A;  4JR6 A;  3G7I A;  1A0R P;  3ZRE A;  2HT9 A;  1XWB A;  5DJL A;  3ZL5 A;  2P0G A;  4MH3 A;  1RW1 A;  3BCI A;  1YEX A;  3PPU A;  2GSQ A;  5DDL A;  11GS A;  1YJ6 A;  1SD9 A;  4FH8 A;  1XWK A;  1T4Z A;  4MF5 A;  2FGX A;  1EV4 A;  2V2G A;  3PR8 A;  4G9H A;  1SK1 A;  5IO2 A;  2ON5 A;  1TK8 B;  3F8U A;  3TB2 A;  4V1A g;  2AAW A;  4WBJ A;  2GT6 A;  3WGE A;  2OE0 A;  2OE3 A;  1G7E A;  3M9K A;  4CDO A;  4KAE A;  2DJJ A;  4MJB A;  3KD0 A;  1GSE A;  1VF3 A;  1O8W A;  2MMN A;  5B7C A;  1GH2 A;  2YWO A;  5DCG A;  4EDY A;  2IJY A;  3EPT A;  1JLW A;  4JZQ A;  1LU4 A;  2BMX A;  3P90 A;  1O7U A;  4MCU A;  2GVP A;  1T8E B;  4X0X A;  1OYJ A;  13GS A;  2A2R A;  5ELA A;  5LCZ A;  1IYH A;  2QA1 A;  2IIY A;  1NHO A;  4PGT A;  4K8M A;  4NHZ A;  3F6F A;  2C80 A;  5HFK A;  3GX0 A;  2HZF A;  2C0E A;  4MDC A;  3P8W A;  3GN3 A;  3CTF A;  1M9B A;  5AN1 A;  3IAS 2;  3TRX A;  4TXO B;  1BJX A;  1T3B A;  1X5E A;  2K6V A;  2PVO C;  2X8C A;  3I43 A;  1B4P A;  3TUE A;  4K5S A;  3U6V A;  3UAR A;  3GTU A;  3MNG A;  1WWJ A;  5HR2 A;  5GZZ B;  4K1F A;  1VGL A;  4MZW A;  3VWU A;  4EUY A;  17GS A;  3HXS A;  2I81 A;  4HS1 A;  2C0F A;  4BL7 B;  4ZBD A;  5F06 A;  4I2U A;  2DJ2 A;  3TJG A;  3QAG A;  3C8E A;  3ZRD A;  2G2Q A;  4F0B A;  1DBY A;  1XVW A;  1JFU A;  3FEU A;  3LW9 A;  2Z9S A;  3NOF A;  2WCI A;  3E3E A;  4PQI A;  2UZ8 A;  4D73 B;  3LQ7 A;  1N8J A;  4TR1 B;  1GSF A;  2H01 A;  4Q5Q A;  2XHF A;  3M1G A;  2ES7 A;  4KX4 A;  2YV9 A;  4N0V A;  4YAP A;  1S3A A;  2TRX A;  3CBU A;  1FB6 A;  2KHP A;  2LKU A;  1HD2 A;  2H19 A;  4DEJ A;  1XW5 A;  2B1K A;  5HR0 A;  4GTU A;  1U87 A;  1V57 A;  2LJK A;  1YKA A;  2GDR A;  1U3A A;  5DQS A;  1R7H A;  2VO4 A;  2VM1 A;  5G31 A;  2WFC A;  4K5R A;  2B1L A;  1B8X A;  1TU7 A;  1BQ7 A;  2PPT A;  2PWJ A;  3O76 A;  2NVL A;  4K9Z A;  3WGX A;  3QCP A;  4L5L A;  4ECC A;  1J08 A;  3D4M A;  4FYB A;  3VFI A;  5KOX A;  3QMX A;  2FWH A;  3HD5 A;  1Z7P A;  3PIN A;  3CRU A;  2H75 A;  3ERW A;  1VRS D;  4E8E A;  4Z2R A;  2H1B A;  2LTK A;  4MLY A;  4MZB A;  3EIN A;  3LWA A;  2VD0 A;  5FHI A;  2IMI A;  1GTU A;  2VL3 A;  1W89 A;  5A4V A;  4IKH A;  4Q5N A;  3VWW A;  1A2M A;  5ECQ B;  5ECM B;  3EUR A;  1PKW A;  1V9W A;  2H76 A;  4KGI A;  1ZYE A;  1O8X A;  2C0D A;  3GL5 A;  5IM9 A;  1GUM A;  3TJK A;  2VL2 C;  1QUW A;  1G7O A;  5JCW A;  2I4A A;  4FYU A;  5HFI A;  1AAZ A;  5HFG A;  4BVY B;  1Z5Y E;  4ULX A;  3F9U A;  4XS4 B;  2HXK A;  6GSY A;  3TKR A;  3KP8 A;  3TRQ A;  2PMT A;  2GZZ A;  2VCV A;  3EMX A;  4XS6 A;  4IW9 A;  5A4W A;  3LYK A;  2YWM A;  2LNS A;  3HJP A;  1GWC A;  1NHY A;  3RHC A;  1XBS A;  5DCH A;  3Q6O A;  2LEG A;  3ERG A;  2H1A A;  2NPB A;  3FY7 A;  5D93 A;  3BOA A;  2IL3 A;  5LD0 A;  5H5R A;  2WZ9 A;  3HVX A;  4K6X A;  4Z7X A;  1AIU A;  2EIQ A;  2P5Q A;  3H79 A;  3EWL A;  5IPH A;  3JCM L;  2H70 A;  2GGT A;  1OAZ A;  4EXJ A;  4EE0 A;  2KP2 A;  2VM2 A;  2CVD A;  2VL9 A;  3MDK A;  1ERW A;  3LFL A;  1F3B A;  1WIK A;  5ABR A;  2HSY A;  1M2D A;  3ZFL A;  5D9W A;  3KEB A;  4RI6 A;  5IIZ A;  3VWV A;  2XPD A;  3TDG A;  3GKX A;  1T00 A;  5CRD A;  4CW9 A;  2LJR A;  4K2X A;  2R2J A;  1PN9 A;  3OR5 A;  1TRV A;  4KDU A;  5GAP D;  1G6W A;  2K8V A;  5ID2 B;  4Z2T A;  1EOG A;  5F05 A;  2CQ9 A;  1K0A A;  1C72 A;  18GS A;  2VLU A;  1THO A;  2H30 A;  3ERF A;  2FNO A;  4L8E A;  1H4O A;  3UVH A;  2IMD A;  4JE1 A;  4GST A;  4MAB A;  5ECI B;  4KW6 A;  2GST A;  1T7P B;  1AUC A;  4O5R A;  4NHW A;  3IV4 A;  4GSS A;  4JBB A;  1FHE A;  5JCU A;  3IC4 A;  3APS A;  1GLQ A;  4POM A;  3C1R A;  3UBK A;  4HJ2 A;  1T1V A;  5DAK A;  1FOH A;  3VPQ A;  2H66 A;  2OBI A;  3GFK A;  2YWN A;  2DKI A;  4RQX A;  5HR1 A;  4DSS B;  2V41 A;  1ERV A;  2LRT A;  3Q19 A;  2CZ3 A;  2JZS A;  4MA9 A;  4WEY A;  1V40 A;  4H86 A;  1AXD A;  4K0G A;  4TOP A;  2DBC A;  1WPI A;  5ECH B;  3UMA A;  2V6O A;  3BCK A;  1GSS A;  1EP7 A;  1FW1 A;  5AIX A;  2K18 A;  2GT5 A;  4HQZ A;  4AJ8 A;  6GSV A;  4YAV A;  1ZZY A;  2PN8 A;  1AQX A;  2QSI A;  4AJ7 A;  4RI7 A;  4PX1 A;  1GTB A;  5IOW A;  3H1N A;  3IK9 A;  2ZUP A;  5HR3 A;  4OO4 A;  1EP8 A;  3N9J A;  16GS A;  4IBP A;  1TXX A;  4MZC A;  1Z3E A;  2VOC A;  1U3I A;  3M3M A;  4WKW A;  4PUF C;  1EV9 A;  4G2E A;  3I69 A;  1XXU A;  2VLT A;  3ZVJ D;  4YQM A;  3CSJ A;  3QR6 A;  3QDN A;  2WB9 A;  2L59 A;  3DEX A;  3L0H A;  3ISO A;  2L6C A;  2FUG 2;  4MH2 A;  2H6Y A;  1I5G A;  5ECK B;  3F6D A;  3GNJ A;  3VI5 A;  4BVX A;  4O7H A;  5KOW A;  4X43 A;  1ILO A;  1G0T A;  2V32 A;  3GV1 A;  5KEJ A;  2J9H A;  5IMC A;  3HYP A;  1F9M A;  5F07 A;  4IEL A;  3EE2 A;  4KUN A;  3ZVJ A;  5DJM A;  1U6T A;  1JZO A;  3QPM A;  2E2G A;  1XWA A;  2FWF A;  3KMN A;  3UJ1 A;  4KE3 A;  1SJZ A;  2C3N A;  2XPE A;  4XIH A;  5D96 A;  3F4R A;  1AC1 A;  2R6K A;  2RM5 A;  1TRS A;  4YKF A;  3IC8 A;  3IA1 A;  1XWC A;  3DD3 A;  1QGV A;  2FA8 A;  4HU7 A;  4LL1 B;  2YAN A;  4Q5F A;  3NIV A;  4MPG A;  6GSX A;  5G5E A;  4HZ2 A;  1AQV A;  1YF1 A;  5B8B A;  2ZNM A;  1HYU A;  2BTO T;  4HUA A;  1M2A A;  5IMZ A;  4HU9 A;  2C8U A;  2HI7 A;  3DRN A;  1H75 A;  2IFQ A;  4MF7 A;  1XVQ A;  2LJA A;  5ECL B;  5CYY A;  3SBC A;  2LST A;  4NXI A;  4NV2 A;  3A2V A;  5D9V A;  4F03 A;  1K3O A;  4TXV A;  1YKC A;  1WMJ A;  1OC9 B;  5E4W A;  4RQR A;  5EPF A;  4TR0 A;  3D6I A;  4XS1 A;  1GUL A;  2CV4 A;  4N30 A;  2VIM A;  4FYC A;  5A4U A;  2BJX A;  2JAC A;  1OE8 A;  5ENU A;  1WOU A;  3V1W A;  3IE3 A;  5KN3 A;  4WR5 A;  1NW2 A;  1G6Y A;  4BWS A;  1WP0 A;  1YY7 A;  2WJU A;  3FZ5 A;  1FB0 A;  1BX9 A;  1O6J A;  4WR4 A;  3CSI A;  2P31 A;  3HJM A;  2WGR A;  3RBT A;  3F63 A;  1UVZ A;  3P7X A;  2XBQ A;  2H6Z A;  1FVK A;  3IOS A;  3EMP A;  3HJO A;  3KXO A;  5ECS A;  3KP9 A;  3TOT A;  2KOK A;  1RK4 A;  4ZL8 A;  2CA8 A;  2HE3 A;  3UAP A;  3TKS A;  3KCM A;  3MWH A;  2C3T A;  3IHG A;  4JRR A;  4KSM A;  4KCE A;  2L5L A;  4IGJ A;  3IK7 A;  1WRY A;  3F3Q A;  3US3 A;  3IAM 2;  1FOV A;  2R0C A;  2KUC A;  3ZZX A;  1TTZ A;  4TW5 A;  2YP6 A;  3W8J A;  2JZR A;  5IMD A;  3A5W A;  2O89 A;  3VPT A;  4IS0 A;  5JWQ B;  12GS A;  2B7K A;  2F8F A;  4FO5 A;  4PQH A;  1VF1 A;  1UA5 A;  3HDC A;  1V58 A;  3FZ9 A;  3GIX A;  5CRE A;  1FG4 A;  4YKG A;  4HQS A;  1I9D A;  2HFD A;  3M8N A;  6GSS A;  3HZ4 A;  2O85 A;  4AGS A;  2DIY A;  2F8A A;  1PRX A;  3GYK A;  1ZL9 A;  3RPP A;  2JAD A;  3IDV A;  3KIJ A;  1GLP A;  2IMF A;  3FKF A;  3Q74 A;  3C7M A;  2XBI A;  2YJH A;  4ZB8 A;  1BG5 A;  4N10 A;  3E0U A;  3ZFB A;  4TN8 A;  3PH9 A;  3FR9 A;  2MBT A;  2LUS A;  1SK0 A;  2YPM A;  5D8I A;  2H72 A;  2VUP A;  1SL0 B;  2V6K A;  3LSZ A;  2X4A A;  3LYP A;  22GS A;  2O7K A;  4OCF A;  3U5R E;  3ZTL A;  3ZLP A;  1MDJ A;  4AF2 A;  1PMT A;  2PU9 C;  1PL2 A;  4MJE A;  4ECJ A;  3KM6 A;  5IMV A;  3I6A A;  1Q4J A;  3WD6 A;  2F3M A;  3FR6 A;  3ZML A;  5FT3 A;  5CRW A;  4PNF A;  4IVF A;  1THX A;  1DSB A;  1R26 A;  1X5D A;  2F9S A;  1ZYP A;  5IMA A;  2LQO A;  1X9W B;  2GLR A;  5CRG A;  3O6T A;  1BYE A;  3FZA A;  2LV3 A;  2ALB A;  3GHA A;  1M99 A;  3LXZ A;  5ELG A;  3L9U A;  2YN1 A;  3DIE A;  3GA4 A;  1K0N A;  1TI1 A;  1F37 A;  4K7O A;  1EWX A;  7GSS A;  4BL7 A;  1MD4 A;  4PQ1 A;  4MMM A;  1AW9 A;  4TVE A;  1ABA A;  1VF4 A;  3EYT A;  3R2Q A;  2A4H A;  4O92 A;  5J5N A;  4N11 A;  2REM A;  2A2S A;  3ZYW A;  4L0W A;  1MD3 A;  5CO3 A;  3G7J A;  1YF0 A;  2YOI A;  3CYN A;  4D73 A;  4TR1 A;  3ZIJ A;  2H1D A;  4YQV A;  1WJK A;  3GX8 A;  1JZR A;  3FR3 A;  4KSO A;  4BWQ A;  2I3Y A;  1S3D A;  5IQY A;  1A24 A;  4MK3 A;  4JED A;  3N5O A;  3VI7 A;  1OE7 A;  4O5U A;  3FHK A;  5HQP A;  3KH9 A;  1AQW A;  1O85 A;  2R5G A;  1PQN A;  2MMZ A;  2LQQ A;  3EU4 A;  3R3E A;  1YEP A;  1YZX A;  3UL3 A;  3IHQ A;  2ZCT A;  1U88 A;  1J9B A;  3P2A A;  2MMO A;  2X49 A;  2L57 A;  4QL7 A;  4YH2 A;  1HNB A;  3KTB A;  1OKT A;  4XTS A;  4KB3 A;  1XW6 A;  2DJ1 A;  1HNA A;  2GZY A;  4MJC A;  1M2B A;  1PSQ A;  1R5P A;  1OC3 A;  1W4V A;  1HNC A;  3FRC A;  5IOX A;  3MSZ A;  5G2Z A;  3CSH A;  3LG6 A;  4PXO A;  1GTA A;  2V1M A;  2WRT A;  5KN2 A;  2CZ2 A;  2AUV A;  1K3L A;  1QXH A;  3W8S A;  2GQM A;  4KDY A;  4BVY A;  2H8L A;  3GH9 A;  2H0G A;  3DKS A;  1ERU A;  3IRA A;  4J57 E;  5IMF A;  2B6M A;  3APO A;  4HEA 2;  3HA9 A;  4RUV A;  4KND A;  3TJJ A;  2JSY A;  4ECB A;  1SJI A;  2FLS A;  3F4S A;  2AB6 A;  2IMK A;  3IR4 A;  1TW9 A;  1EZK A;  4MP4 A;  3UIW A;  4OD7 A;  4O32 A;  4J2F A;  4G0I A;  3AY8 A;  5E59 A;  4KCA A;  2NDO A;  2F51 A;  3L9V A;  5DAK B;  1FVJ A;  5ECP B;  1TRU A;  4ECI A;  1MTC A;  2B5E A;  4O5Q A;  4WXT A;  3LGC A;  4L0U A;  3D0Z A;  3RDW A;  1B4Q A;  5C04 A;  3DVX A;  2H6X A;  2H0H A;  3TOU A;  4A5P A;  5DQY A;  4XRA A;  4POK A;  3GST A;  4FQU A;  2GQL A;  3C71 A;  10GS A;  5JWR B;  3PGT A;  1PX6 A;  2R37 A;  2M46 A;  2CAI A;  1PA3 A;  2MMA A;  2VD1 A;  1B9Y C;  3NZN A;  4KDX A;  4QQ7 A;  19GS A;  4YQU A;  1ZOF A;  3ED3 A;  1ON4 A;  1TK0 B;  4ISD A;  3QOU A;  2HRF A;  1J0F A;  5GST A;  4USS A;  1K3Y A;  5ID2 A;  5C00 A;  2OAD A;  4ZBA A;  4DSQ A;  3C73 A;  1MEK A;  3TKP A;  2PVQ A;  1SKW B;  4TR4 A;  2B7J A;  1TJD A;  2H73 A;  3DGQ A;  5F8B A;  1CQG A;  2LRN A;  3TKS E;  2VCQ A;  2JL4 A;  3QFA C;  5B8A A;  3QD9 A;  4WET A;  2DJK A;  3RPN A;  5ECO B;  3HKR A;  3FMW A;  1SL1 B;  3MIX A;  4HOJ A;  2WUL A;  5DAL B;  3UEM A;  5J9B A;  3LJR A;  1Z9H A;  2WDU A;  2P5R A;  2G0F A;  3RHB A;  6GSU A;  4GXZ A;  1GUK A;  1SKR B;  4K7I A;  3LXT A;  2FY6 A;  5EY6 A;  4G0L A;  4IP6 A;  1EGO A;  2HZE B;  5A5K A;  1F6M C;  3D4T A;  1YQ1 A;  5J9C A;  4KA0 A;  3IXR A;  3GUR A;  3CMI A;  4CHS A;  2B3S A;  4MF6 A;  2GS3 A;  3GKM A;  2CVK A;  3KJY A;  2FCH A;  3HZ8 A;  2YZU A;  4NV5 A;  2OKA A;  2NBS A;  2IFQ B;  4PNG A;  1XPV A;  3QAV A;  3M0F A;  1VF2 A;  1SK2 A;  3GKN A;  2JU5 A;  4JR4 A;  4GCI A;  2A2P A;  2OA7 A;  3KH7 A;  2YJ7 A;  2GTU A;  4ZL9 A;  1M9A A;  4V2N A;  1PD2 1;  3A5I A;  5D73 A;  3H4K A;  2K9F A;  1GTI A;  2DIZ A;  3KZQ A;  5B6M A;  4EL1 A;  5D9X A;  5G30 A;  2DC5 A;  2EC4 A;  5INY A;  1LJR A;  1Z6M A;  2I9H A;  2FHE A;  5CRH A;  3DML A;  5COH A;  1A2L A;  1GSY A;  2CAQ A;  3SWL A;  5AIV A;  1ML6 A;  2VCW A;  1ST9 A;  4WBR D;  1EOH A;  1GP1 A;  2HRK A;  1TP9 A;  1HQO A;  3QFB C;  1PKZ A;  1GSQ A;  1N2A A;  5H5S A;  2DJ3 A;  2RUE A;  2VCX A;  4IQ1 A;  2HRA A;  2AV4 A;  1YDK A;  3APQ A;  5AGY A;  1V2A A;  2CX4 A;  2J23 A;  2EIO A;  3D22 A;  2PER A;  2LS5 A;  2MYG A;  3A3T A;  5J3R A;  1LBK A;  2OBK A;  2HSH A;  6GSW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...