3HYPA

Crystal structure of bacteroides fragilis trxp_s105g mutant
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
117
structure length
117
Chain Sequence
GTIHLTRAEFLKKIADYENHSKEWKYLGDKPAIVDFYADWCGPCKMVAPILEELSKEYAGKIYIYKVNVDKEPELARDFGIQGIPTIWFVPMKGEPQVNMGALSKEQLKGYIDKVLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thioredoxin
publication title In vivo oxidative protein folding can be facilitated by oxidation-reduction cycling
pubmed doi rcsb
source organism Bacteroides fragilis
molecule tags Electron transport
total genus 25
structure length 117
sequence length 117
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3hypA01
2LSTA 2B1KA 3KD0A 5JWOB 3VFIA 2GLRA 2F9SA 2A2RA 2R3XA 4RI7A 2OKAA 2J9HA 1VF4A 2B5XA 4HZ2A 4YAPA 1FVKA 5G2ZA 5F0GA 3F4RA 5IIZA 4WXTA 1XWCA 2IMDA 4E8EA 4OFMA 1J0FA 1B4PA 2C8UA 3BOAA 2G0FA 5JWQB 4MK3A 3ZIJA 4FYBA 4LMVA 3TKQA 3TJFA 3KP9A 2GSSA 1E2YA 4WR5A 1B4QA 3ED3A 1R5PA 4PQHA 4K7OA 17GSA 1JZDA 4F82A 2WGRA 1SKSB 3QDNA 3VI5A 3D4TA 2KP1A 1WRYA 1GTBA 2MMZA 4GRFA 2ZUPA 4L5LA 4V1Ag 2XC2A 1AQXA 1GUHA 3IHQA 4K0GA 1Z6NA 1PKZA 2B3SA 12GSA 1O7UA 5JWRB 1U3AA 2LKUA 3D0ZA 4DVCA 4IQ1A 3LXTA 1RK4A 1V58A 2H74A 1J08A 2JSYA 2DJ0A 3GTUB 1F9MA 2AB6A 1X9WB 4N30A 3RDWA 2YP6A 1LBKA 3DIEA 4ZL8A 1O85A 3RPPA 3EYTA 1PD21 4LL4B 2R6KA 2LTKA 4JR4A 5HFKA 3WD6A 2GQMA 5C00A 5CRGA 4BPYA 3APOA 4RQXA 4ISDA 4TR1B 3HKRA 1A24A 1O81A 1O73A 3GMFA 3IC4A 4XRAA 1XWKA 3CYNA 3GV1A 4HQZA 5ECNB 1SJZA 1EP8A 5ELAA 2V2GA 5D93A 1EWXA 4P3YB 2NTOA 4MJAA 16GSA 1SJ6A 1VRSD 1T7PB 1SD8A 5J9BA 2E2MA 1FB6A 3TCOA 3LQ7A 1K0AA 2DLXA 3D5JA 2PU9C 2N5BA 1XWAA 4ZXGA 1ZYQB 3RBTA 3FZ5A 2GTUA 5CYYA 2MMNA 1ON4A 2ZNMA 3FY7A 3O3TA 5DVBA 2H6ZA 1TRVA 4NMUA 5A4VA 5A4WA 2VCWA 4XS1A 2VO4A 3TJBA 1CQHA 1M7TA 3IPZA 3UEMA 5B6MA 1WE0A 4MA9A 2GZYA 4OFNA 5ECPB 3FEUA 3GX0A 1U88A 3GH6A 4NWYA 3P2AA 2CZ2A 4QL7A 5F07A 9GSSA 14GSA 4JU5A 4YQVA 4O32A 3ZMLA 2ON5A 1EOGA 5DALB 3CBUA 2WULA 5B8AA 4L5OA 5IPGA 4H86A 3WGXA 4MJCA 4WF5A 2FWFA 3D21A 1K0NA 1OVNA 4EE0A 1GNWA 1AQWA 3UJ1A 5H5SA 5LNKe 2B7JA 3EE2A 3GSTA 4F0BA 1GNEA 5C04A 4JZQA 3CRTA 5AISA 5ECQB 5EPFA 3E3EA 5CP1A 3FK8A 1TI3A 4JE1A 3PH9A 4N10A 2LQOA 2LEGA 1OYJA 5B6NA 3GKKA 3BBYA 3EMXA 2YJ7A 2WJUA 1U87A 6GSWA 2C3NA 5DQSA 5INYA 2IMEA 4HOJA 4MF5A 3NZNA 3E0UA 4RQRA 5D73A 1AIUA 5IQYA 3QR6A 4L0UA 2VCZA 2QKEA 4K1FA 5FT3A 1A2MA 2DMMA 3FW2A 3ERFA 4IQAA 1NHOA 5FWGA 3TRXA 1PGTA 4KE3A 4KAEA 2AJQB 2V6OA 1TU8A 1NHYA 3ZVJD 2O89A 3H93A 4PGTA 3QAGA 6GSYA 6GSTA 5G31A 2PMTA 5JCWA 1SL0B 2O87A 4ACSA 1UC7A 4AF2A 1K3LA 1EGOA 1AQVA 2MMOA 5GAPD 5B7CA 1T3BA 1VF1A 1ERUA 1ZYEA 3UVHA 4NHWA 3H8QA 2FWGA 1JLWA 3GA4A 1GP1A 3A2VA 2LRNA 3I69A 3WT2A 1HNCA 3EWLA 3IAM2 3I9V2 5AIXA 1W4VA 4MP4A 3UARA 4KSOA 3LJRA 4I8BA 2A2SA 3L4NA 2DIYA 1AAZA 2K8VA 2HRNA 2YWIA 4TR3A 1PN9A 13GSA 2H75A 1Y25A 3SWLA 1USBA 2EIOA 2L4QA 4IELA 4KGIA 4IKHA 5ID2B 4AJ8A 2IL3A 1T1VA 3A5WA 4OWYA 2JZSA 2CT6A 3CTFA 3TRQA 1YY7A 5L71A 1WOUA 3KH7A 5ECMB 2X99A 1OKDA 2IMIA 3GKNA 1FW1A 1HYUA 5G5FA 2ON7A 3GL5A 2GSRA 3HVXA 4TXOA 3M8NA 1GSFA 1F3AA 1OC8A 2DJ1A 2VM2A 2B5YA 1ILOA 1YZXA 2R37A 3EINA 3MDKA 5D9WA 4DSSB 4J56E 1K3OA 1SJIA 1OC9B 1YKAA 3RHCA 2GZZA 2WFCA 4MABA 1GLPA 5DDLA 1GSDA 2IIYA 1Q98A 4ZL7A 5ECOB 2JU5A 4GQFA 2H0IA 5GAND 4OO4A 3M1GA 11GSA 2C4JA 4EVMA 2YZHA 4KSMA 1OAZA 1A8LA 1SL2B 1S3DA 4TR0A 1GTIA 2DC5A 2PVQA 3HDCA 2GS3A 2H6XA 3GSSA 2GQLA 5IMAA 2FUG2 1QK8A 1V40A 1XVQA 1FOVA 2OBKA 3CXGA 3US3A 4JR6A 4O92A 4F03A 4EXJA 4IHUA 4WF4A 5F05A 3WT1A 2CVDA 3Q74A 3I43A 1LU4A 1HQOA 1EOHA 2DJ2A 4O5RA 1THOA 1R4WA 4LLRA 4BWQA 4POKA 3PGTA 4KDXA 2E7PA 2QC7A 3DWVA 4I2UA 4POBA 1PA3A 1Z3EA 2L5LA 2HXKA 4ILFA 2DSAA 4J57E 3O76A 3C8EA 2H8LA 4FO5A 4YAVA 3VK9A 3NOFA 2H0HA 1X5EA 4MH3A 4OFTA 5DCHA 3DRNA 1A23A 2V6KA 2QGVA 5KN2A 3L9UA 1K0CA 2FHEA 4PNGA 4IGJA 1XFLA 4RI6A 5IMZA 3DYRA 4XS4B 4ECIA 3CTGA 3IXRA 2P5RA 1ERWA 1XWBA 3ZFLA 1ABAA 1VF3A 2LNTA 2AV4A 3GNJA 1V98A 3G7JA 5IMCA 5CRHA 2JADA 2PN8A 2DIZA 1GUMA 5DBQA 3F6FA 1G6YA 3M3MA 1WPIA 2FGXA 3C73A 1G6WA 2GQKA 2O8VB 4TOPA 3VPQA 3LWAA 4ECJA 3F4SA 2VD1A 3KEBA 2OBIA 1R26A 3VLNA 3D6IA 3O6TA 3UMAA 5CAXA 1V2AA 5GSTA 1M2BA 4BWSA 2LUSA 4L0WA 1BYEA 4V2LA 4F9ZA 1YJ6A 1X5DA 3A3TA 2FCHA 3BCIA 2CAQA 3M0FA 1WP0A 1DUGA 4CDOA 3KTLA 2WRTA 4KW6A 2IFQA 4XCSA 4MCUA 3UAPA 2REMA 1Z7PA 3R2QA 1XBSA 4EDZA 4XIHA 5KN0A 1GL8A 2H1GA 3ZREA 4F0CA 5ECHB 1MDIA 1MDKA 3FZ4A 2FWHA 3GN3A 4MZCA 5HQPA 1XWGA 4IVFA 1TW9A 4GQCA 1PQNA 1NSWA 2KOKA 3FKFA 4D73A 1MTCA 1TJDA 3GIXA 3DKSA 2DBCA 1O8XA 2XHFA 1Z6MA 2AHEA 3KXOA 1MEKA 3GKXA 3QMXA 4TW5A 6GSUA 3EURA 5ECLB 3ZVJA 2TRCP 4NV2A 2DJKA 5F8BA 2FNOA 4MZWA 4GXZA 1PKWA 3ISOA 5H5QA 4L8EA 3DMLA 4XTSA 5IO2A 2MBSA 2V1MA 4AJ6A 1YEXA 2FD3A 2MMAA 5ELGA 1BEDA 1OE7A 2I4AA 2H73A 1YEPA 2A4VA 3ZTLA 2VUPA 2M80A 2OE1A 5B8BA 1T4ZA 2KHPA 4OCEA 5IPHA 2JSZA 2O7KA 2IPAA 3DEXA 5J4UA 2FY6A 4X0XA 4V2MA 2IFQB 3HZ8A 1V9WA 3LYKA 1JZRA 3M9KA 2F3MA 3QAVA 3RPNA 2VL2A 4HJ2A 5IM9A 3UIWA 1ACVA 2VCQA 2VLVA 4LMWA 1CQGA 2HRFA 2VAFA 3LXZA 3E9JB 5EL8A 1XCCA 3HA9A 3VWXA 2P0GA 3F4TA 2OE3A 4PX1A 1GWCA 1T00A 1Z5YE 2NDOA 3HXSA 1B8XA 3D22A 1F2EA 2HZFA 3C1SA 3Q19A 1ZCPA 4ZILA 2YANA 3IK9A 4XS6A 3W8SA 3MNGA 4N11A 1SKWB 4POMA 2ES7A 4K0NA 1YDKA 2MBTA 3APQA 1HD2A 3VI7A 1YKCA 4Q5FA 3UL3A 3TKPA 1JHBA 1ZL9A 1KBNA 2OACA 3ERGA 2FLSA 4POLA 2XPEA 3FR9A 2ALBA 4WKWA 5D8IA 5DJMA 2YCDA 2HZEA 3FRCA 2X8HA 4KUNA 2C0EA 4Q5NA 4IJ3A 1TTZA 4GSTA 1BJXA 4KA0A 3ZMKA 2VOCA 3OR5A 3EU4A 5E4WA 2RIIA 4FIWA 4EKZA 3F3QA 3HVSA 1GTUA 1WMJA 2NBSA 3ZLPA 3BJ5A 1T4YA 1S3AA 4KDYA 4Z7XA 4BL7A 1NW2A 3TDGA 2H66A 2X8GA 2CQ9A 1XW5A 4K6XA 1THXA 3EVIA 3FZ9A 3TKSA 1N8JA 4K8MA 1RQMA 1K0BA 5IMVA 4TXVA 5KN1A 4X1UA 1TP9A 2YN1A 5IMDA 5ABRA 4ZBAA 2I81A 2QSIA 3ME8A 5D9TA 1SK2A 3MWHA 3ZIVA 3IE3A 4GCIA 2L6CA 5ENUA 4MH2A 1PRXA 4EF0A 2PGTA 4J2FA 4CHSA 2IMFA 2L57A 1I5GA 1GH2A 4KX4A 3UVTA 3TB2A 4DEJA 3RHBA 20GSA 5DAKA 1HNAA 2KLXA 5J41A 3IAS2 1BX9A 1SD9A 3N5OA 3JCML 2BTOT 4EL1A 2DMLA 2LV3A 3L0HA 3QD9A 1M9AA 1N2AA 2FA8A 2RLIA 4NHZA 1B9YC 2HYXA 5HFIA 1ML6A 2J23A 1MDJA 2HT9A 2FWEA 1M0UA 2YWOA 3VWWA 1X9SB 4GSNA 1HNBA 4HI7A 4EC0A 2CVBA 1EEMA 2YWNA 5D9VA 4NAXA 1GSQA 7GSSA 3LORA 2JZTA 3TUEA 1TOFA 3GHAA 2L6DA 3LYPA 3L9SA 3KTBA 4TKYA 3GURA 1T8EB 3TJGA 4IJIA 3V1WA 4NXIA 4ZL9A 1YQ1A 5J3RA 1AW9A 1QQ2A 4OO5A 3LG6A 4ML6A 4JEDA 5CRWA 3KMNA 2TIRA 1G7OA 1IYIA 1SK1A 1X0RA 2VCXA 3UBKA 1Q4JA 2M72A 1SKRB 5HR3A 2LS5A 2VL2C 2L4CA 2WS2A 3KMOA 1WIKA 2OADA 2C80A 2VM1A 3MAKA 2RUFA 1KEBA 4LL1B 1K0MA 5JCGA 1A8YA 2B7KA 1EV9A 2IJYA 2WZ9A 4I97A 1X5CA 3IOSA 4MLYA 5DAKB 3G9BA 3G7IA 3HD5A 4ML1A 2AYTA 5DQYA 1IYHA 1ZOFA 4ECBA 2PBJA 4FYUA 1SK0A 1LJRA 2DJ3A 3FZAA 2H1AA 2YV9A 2XBQA 3VURA 3L78A 2HSHA 2NPBA 1WJKA 2MZCA 5A4UA 2EIQA 5CNWA 2PUKC 4PQIA 3TOTA 3TKSE 2H01A 1K0OA 1PX6A 3QFBC 4ZB6A 1VGLA 3APSA 1K0DA 2H76A 1XOBA 4CW9A 4IP6A 4RUVA 5EVOA 1GSYA 2H72A 4K7IA 1XVWA 4AJ7A 4OMVA 3F0IA 5D96A 5J5NA 4HU7A 3FHKA 1JZWA 3GYKA 3QCPA 1A2JA 2D2ZA 4JBBA 4E8HA 2NVLA 1MD4A 6GSXA 1SENA 4G9HA 4TXOB 3C71A 1Z9HA 1GTAA 5ECKB 1UN2A 1QGVA 4GWRA 3IBHA 5J9CA 2GT6A 3U6VA 4MDCA 3GUSA 1PL1A 2HI7A 4WEYA 4HDEA 5ECRB 1KNGA 5ECSA 2PPTA 3KIJA 2R4VA 2VLUA 1X9MB 4G2EA 2LRTA 1B9XC 2L59A 1GULA 3HVVA 3Q18A 3F9UA 4AGSA 1A2LA 2HSYA 2VLTA 1F6MC 1TK0B 2H1BA 3LEFA 2WDUA 2XBIA 4WR4A 3TKSC 4HQSA 1A0RP 2H1DA 3EMPA 3HCZA 2P31A 1DSBA 2JL4A 5EY6A 5GSSA 2GSQA 4BA7A 1JLVA 2LJRA 4TR4A 3D4MA 1K3YA 3FYGA 3CRUA 4N0VA 3P7XA 3EU3A 5E59A 1PMTA 4YH2A 1JZOA 2MYGA 3C7MA 3IV4A 3VPTA 3TJJA 2R2JA 3F63A 3UBLA 3KP8A 1BAYA 3Q6OA 4TR1A 4MJEA 4G19A 1BG5A 2XPDA 1SU9A 5COHA 3HZ4A 19GSA 1GRXA 1U3IA 2C0FA 2HE3A 3GFKA 4V2NA 4PUFC 1O6JA 4KCEA 2CX4A 3HJMA 1YF1A 1TRSA 4DSRA 3KH9A 2IN3A 1TK8B 4ZBBA 4HJMA 1EEJA 4ULXA 2K6VA 3A2XA 1XOAA 2R5GA 2VL9A 1MD3A 2C3TA 4KNDA 2WCIA 3DGQA 2GGTA 1VF2A 2JACA 2X8CA 3ZL5A 2VCTA 3DVXA 2O85A 4K2DA 5G5EA 1AC1A 4MPGA 3H79A 3TKRA 3GRXA 4LA1A 4GF0A 1G0TA 2F8FA 1PX7A 3EC3A 4I5QA 1OC3A 2VD0A 3PINA 2HLSA 1RW1A 1TI1A 2C0GA 4ID0A 2HNLA 3I6AA 2E0QA 2V41A 2HFDA 1I9DA 2GSTA 2C1YA 2YZUA 3HJPA 1GUKA 2VIMA 3KJYA 2F8AA 1SL1B 4I2TA 4KCAA 1ERVA 5DALA 1R7HA 5AIVA 2K8SA 4PQ1A 2CV4A 2G2QA 2GZPA 4EUYA 3L9VA 1AXDA 1H75A 1GSEA 3WYWA 2AAWA 1EGRA 1TRUA 1O8WA 1F37A 2N5AA 3KM6A 3ZFBA 2RM6A 3TJKA 2V32A 6GSSA 1G7EA 3ZITA 4PUAA 4YQUA 3ZZXA 3WGEA 2L5OA 1EZKA 3HYPA 2IMKA 4TRXA 3HJOA 4HUAA 1R5AA 4D73B 3GH9A 4IP1A 3BD2A 5IOWA 4FYCA 4ZBDA 4BVXA 5DCGA 4IBPA 4G10A 5IMFA 3RAZA 3J7Yk 5HR0A 2CX3A 5HR2A 4O7HA 5H5RA 4OD7A 3PR8A 1UVZA 4K7NA 1PSQA 4NV5A 2K18A 3HY2A 1FB0A 1OE8A 1W89A 1J9BA 1TRWA 3CSIA 4ZB8A 2H30A 2I9HA 2CA8A 4V1Ap 2GT5A 2FA4A 4QL9A 5KEJA 5LCZA 2OE0A 1M9BA 2X64A 1GSSA 3DXBA 2EC4A 1DE2A 3ZYWA 3U5RE 2BMXA 1KTEA 1QUWA 3CSJA 1TXXA 3TRPA 3J7Yb 1FHEA 2H0GA 3KCMA 1TKDB 5HR1A 4ECCA 1SYRA 4HS1A 3WGDA 1ERTA 6GSVA 2E2GA 4MJBA 1TK5B 2ZCTA 3SBCA 1BQ7A 2EIRA 4DSQA 4WBJA 2YV7A 2K9FA 1AUCA 1FG4A 4HZ4A 1Y6EA 1FVJA 3W6GA 1SYXA 5ID2A 4IW9A 5LD0A 3QOUA 2LNSA 1URMA 4TN8A 2N5FA 4MZBA 2JZRA 4PURA 4F2IA 2H6YA 1YF0A 5IOXA 2YWMA 3A2WA 3MSZA 4YQMA 3VWVA 1QXHA 4GLTA 4MMMA 2OA7A 1XW6A 3GKMA 1XXUA 4KH7A 2YNXA 2HZEB 5G1LA 5HFGA 4DSSA 2OJLA 4ZIJA 4X43A 3QAWA 4I6XA 2LJAA 1OC9A 3LGCA 1S3CA 1OKTA 1F3BA 4GTUA 10GSA 1A0FA 2YJHA 3H4KA 4IS0A 1TDIA 3KZQA 2M46A 4TVEA 3N9JA 4HU9A 2BJXA 1E6BA 3GL3A 1U6TA 3M9JA 4KB3A 5A5KA 1QFNA 2KUCA 5CO3A 5CREA 2I3YA 3C1RA 2GDRA 3IA1A 4FH8A 5AGYA 4MF6A 4BVYA 2B6MA 3LSZA 2YPMA 2H71A 2PERA 3QFAC 4XHMA 4QQ7A 3ME7A 18GSA 4WETA 1JFUA 3F3RA 1V57A 1ST9A 5JCUA 2I1UA 4K9ZA 1UA5A 2LJKA 2AUVA 4OCFA 1ZGNA 3KGKA 5D9XA 3F8UA 3TOUA 3CSHA 3G7YA 4HEA2 3W8JA 3UOMA 4ZB9A 3IR4A 4WBRD 4PNFA 2F51A 1M2DA 4XS4A 1XPVA 2KP2A 1FAAA 2H19A 1M99A 2DJJA 3IK7A 3IRAA 1EV4A 1ZZYA 5FHIA 2PWJA 4Q5RA 5CRDA 1PL2A 3TGZA 2H70A 3FR6A 1C72A 2P5QA 4EO3A 2C0DA 4XRDA 3DD3A 22GSA 2CVKA 2GVPA 1WWJA 1EP7A 3FR3A 3LFLA 4JRRA 3ZRDA 3BCKA 3S9FA 2VL3A 3F6DA 3P90A 2IWTA 1ZMAA 2RUEA 4GSSA 4NPBA 3GX8A 2Z9SA 8GSSA 2LQQA 3QPMA 4EDYA 3DVWA 1GLQA 5KN3A 3NIVA 1B48A 2CAIA 1GSUA 1TU7A 1XW9A 1NM3A 3HHVA 3ERWA 4IN0A 2LRCA 2YOIA 5DJLA 5IO0A 4N0ZA 1DE1A 4KDUA 4MPFA 3H1NA 3K8NA 3AY8A 2WB9A 1Z7RA 4PXOA 5ECIB 5AN1A 1XIYA 2TRXA 1DBYA 2B1LA 1FO5A 2VCVA 2RM5A 2CZ3A 3CMIA 1XZOA 3P8WA 1QMVA 5GZZB 3VWUA 4MF7A 3IDVA 2C3QA 2B5EA 4Q5QA 1M2AA 1H4OA 3GTUA 2PVOC 5G30A 5F06A 5G1KA
chains in the Genus database with same CATH superfamily
2LSTA 2B1KA 3KD0A 4MNNA 5JWOB 3VFIA 2GLRA 2F9SA 2A2RA 2R3XA 4RI7A 2OKAA 2J9HA 1VF4A 2B5XA 4HZ2A 4YAPA 1FVKA 5G2ZA 5F0GA 4A5PA 3F4RA 5IIZA 4WXTA 1XWCA 2IMDA 4E8EA 4OFMA 1J0FA 1B4PA 2C8UA 3BOAA 2G0FA 5JWQB 4MK3A 3ZIJA 4FYBA 4LMVA 3TKQA 3TJFA 3KP9A 2GSSA 1E2YA 4WR5A 1B4QA 3ED3A 1R5PA 4PQHA 4K7OA 17GSA 1JZDA 4F82A 2WGRA 1SKSB 3QDNA 3VI5A 3D4TA 2KP1A 1WRYA 1GTBA 2HRKA 2MMZA 4GRFA 2ZUPA 4L5LA 4V1Ag 2XC2A 1AQXA 1GUHA 3IHQA 4K0GA 1Z6NA 1PKZA 2B3SA 12GSA 1O7UA 5JWRB 1U3AA 2LKUA 3D0ZA 4DVCA 4IQ1A 3LXTA 1RK4A 1V58A 2H74A 1J08A 2JSYA 2DJ0A 3GTUB 4K2XA 1F9MA 2AB6A 1X9WB 4N30A 3RDWA 2YP6A 1LBKA 3DIEA 4ZL8A 1O85A 3RPPA 3EYTA 1PD21 1XG8A 4LL4B 2R6KA 2LTKA 2HRAA 4JR4A 5HFKA 3WD6A 2GQMA 5C00A 5CRGA 4BPYA 3APOA 4RQXA 5BRTA 4ISDA 4TR1B 3HKRA 1A24A 1O81A 1O73A 3GMFA 3IC4A 4XRAA 1XWKA 3CYNA 3GV1A 4HQZA 5ECNB 1SJZA 1EP8A 5ELAA 2V2GA 5D93A 1EWXA 4P3YB 2NTOA 4MJAA 4KF9A 16GSA 1SJ6A 1VRSD 1T7PB 1SD8A 5J9BA 2E2MA 1FB6A 3TCOA 3LQ7A 1K0AA 2DLXA 4X4JA 3D5JA 2PU9C 2N5BA 1XWAA 4ZXGA 1ZYQB 3RBTA 3FZ5A 2GTUA 5CYYA 2MMNA 1ON4A 2ZNMA 3FY7A 3O3TA 5DVBA 2H6ZA 1TRVA 4NMUA 5A4VA 5A4WA 2VCWA 4XS1A 2VO4A 3TJBA 1CQHA 1M7TA 3IPZA 3UEMA 5B6MA 1WE0A 4MA9A 2GZYA 4OFNA 5ECPB 3FEUA 3GX0A 1U88A 3GH6A 4NWYA 3P2AA 2CZ2A 5BMUA 4QL7A 5F07A 3MIXA 9GSSA 14GSA 5KOWA 4JU5A 4YQVA 4O32A 3ZMLA 2ON5A 4PTSA 1EOGA 3CBUA 5DALB 2WULA 5B8AA 4L5OA 5IPGA 4H86A 3WGXA 4MJCA 4WF5A 2FWFA 3D21A 1K0NA 1OVNA 4EE0A 1GNWA 1AQWA 3UJ1A 5H5SA 5LNKe 2B7JA 3A5IA 3EE2A 3GSTA 4F0BA 1GNEA 5C04A 4JZQA 3CRTA 5AISA 5ECQB 5EPFA 3E3EA 5CP1A 3FK8A 1TI3A 4JE1A 3PH9A 4N10A 2LQOA 2LEGA 1OYJA 5B6NA 3GKKA 3BBYA 3EMXA 2YJ7A 2WJUA 1U87A 6GSWA 2C3NA 5DQSA 5INYA 2IMEA 4HOJA 4MF5A 3NZNA 3E0UA 4RQRA 5D73A 1AIUA 5IQYA 3QR6A 4L0UA 2VCZA 2QKEA 4K1FA 5FT3A 1A2MA 2DMMA 3FW2A 3ERFA 4IQAA 1NHOA 5FWGA 3TRXA 1PGTA 4KE3A 4KAEA 2AJQB 2V6OA 1TU8A 1NHYA 3ZVJD 2O89A 3H93A 4PGTA 3QAGA 6GSYA 6GSTA 5G31A 2PMTA 5JCWA 1SL0B 2O87A 4ACSA 1UC7A 4AF2A 1K3LA 1EGOA 1AQVA 2MMOA 5GAPD 5B7CA 1T3BA 1VF1A 1ERUA 1ZYEA 3UVHA 4NHWA 3H8QA 2FWGA 1JLWA 3GA4A 1GP1A 3A2VA 2LRNA 3I69A 3WT2A 1HNCA 3EWLA 3IAM2 3I9V2 5AIXA 1W4VA 4MP4A 3UARA 4KSOA 3LJRA 4I8BA 2A2SA 3L4NA 2DIYA 1AAZA 2K8VA 2HRNA 2YWIA 4TR3A 1PN9A 13GSA 2H75A 1Y25A 3SWLA 1USBA 2EIOA 2L4QA 4IELA 4KGIA 4IKHA 5ID2B 4AJ8A 2IL3A 1T1VA 3A5WA 4OWYA 2JZSA 2CT6A 3CTFA 3TRQA 1YY7A 5L71A 1WOUA 3KH7A 5ECMB 2X99A 4O5UA 1OKDA 2IMIA 3GKNA 1FW1A 1HYUA 5G5FA 2ON7A 3GL5A 2GSRA 3HVXA 4TXOA 3M8NA 1GSFA 1F3AA 1OC8A 2DJ1A 2VM2A 2B5YA 1ILOA 1YZXA 2R37A 3EINA 3MDKA 5D9WA 4DSSB 4J56E 1K3OA 1SJIA 1OC9B 1YKAA 3RHCA 2GZZA 2WFCA 4MABA 1GLPA 5DDLA 1GSDA 2IIYA 1Q98A 4ZL7A 5ECOB 2JU5A 4GQFA 2H0IA 5GAND 4OO4A 3M1GA 4CY6A 11GSA 2C4JA 4EVMA 2YZHA 4KSMA 1OAZA 1A8LA 1SL2B 1S3DA 4TR0A 1GTIA 2DC5A 2PVQA 3HDCA 2GS3A 2H6XA 2QA1A 4YKGA 3GSSA 2GQLA 5IMAA 2FUG2 1QK8A 1V40A 1XVQA 1FOVA 2OBKA 3CXGA 3US3A 4JR6A 4O92A 4F03A 4EXJA 4IHUA 4WF4A 5F05A 3WT1A 2CVDA 3Q74A 3I43A 1LU4A 1HQOA 1EOHA 2DJ2A 4O5RA 1THOA 1R4WA 4LLRA 4BWQA 4POKA 3PGTA 4KDXA 2E7PA 2QC7A 3DWVA 4I2UA 4POBA 1PA3A 1Z3EA 2L5LA 2HXKA 4ILFA 2DSAA 4J57E 3O76A 3C8EA 2H8LA 4FO5A 4YAVA 3VK9A 3NOFA 2H0HA 1X5EA 4MH3A 4OFTA 5DCHA 3DRNA 1A23A 2V6KA 2QGVA 5KN2A 3L9UA 1K0CA 2FHEA 4PNGA 5KOXA 4IGJA 1XFLA 4RI6A 5IMZA 3DYRA 2X4AA 4XS4B 4ECIA 1ZYPA 3CTGA 2A2PA 3IXRA 2P5RA 1ERWA 1XWBA 3ZFLA 1ABAA 1VF3A 2LNTA 2AV4A 3GNJA 1V98A 3PPUA 3G7JA 5IMCA 5CRHA 2JADA 2PN8A 2DIZA 1GUMA 5DBQA 3F6FA 1G6YA 3M3MA 1WPIA 2FGXA 3C73A 1G6WA 2GQKA 2O8VB 4K5RA 4TOPA 3VPQA 3LWAA 4ECJA 3F4SA 1M3JA 2VD1A 3KEBA 2OBIA 1R26A 3VLNA 3D6IA 3O6TA 3UMAA 5CAXA 1V2AA 5GSTA 1M2BA 4BWSA 2LUSA 4L0WA 1BYEA 4V2LA 4F9ZA 1YJ6A 1X5DA 3A3TA 2FCHA 3BCIA 2CAQA 3M0FA 1WP0A 1DUGA 4CDOA 3KTLA 2WRTA 4KW6A 2IFQA 4XCSA 4MCUA 3UAPA 2REMA 1Z7PA 3R2QA 1XBSA 4EDZA 4XIHA 5KN0A 1GL8A 2H1GA 3ZREA 4F0CA 5ECHB 1MDIA 1MDKA 3FZ4A 2FWHA 3GN3A 4MZCA 5HQPA 1XWGA 4IVFA 1TW9A 4GQCA 1PQNA 1NSWA 2KOKA 3FKFA 4D73A 1MTCA 1TJDA 3GIXA 3DKSA 2DBCA 1O8XA 2XHFA 1Z6MA 2AHEA 3KXOA 1MEKA 3GKXA 3QMXA 4TW5A 6GSUA 3EURA 5ECLB 3ZVJA 2TRCP 4NV2A 2DJKA 5F8BA 2FNOA 4MZWA 4GXZA 1PKWA 3ISOA 5H5QA 4L8EA 3DMLA 4XTSA 5IO2A 2MBSA 2V1MA 4AJ6A 1YEXA 2FD3A 2MMAA 5ELGA 1BEDA 1OE7A 2I4AA 1M3IA 2H73A 1YEPA 2A4VA 3ZTLA 2VUPA 2M80A 2OE1A 5B8BA 1T4ZA 2KHPA 3R3EA 4OCEA 5IPHA 2JSZA 2O7KA 2IPAA 3DEXA 4G0LA 5J4UA 2FY6A 4X0XA 4V2MA 2IFQB 3HZ8A 1V9WA 4Z2RA 3LYKA 1JZRA 3M9KA 2F3MA 3QAVA 3RPNA 2VL2A 4HJ2A 5IM9A 4O5QA 3UIWA 1ACVA 2VCQA 2VLVA 4LMWA 1CQGA 2HRFA 2VAFA 3LXZA 3E9JB 5EL8A 1XCCA 3HA9A 3VWXA 2P0GA 3F4TA 2OE3A 4PX1A 1GWCA 1T00A 1Z5YE 2NDOA 3HXSA 1B8XA 3D22A 1F2EA 2HZFA 3C1SA 3Q19A 1ZCPA 4ZILA 2YANA 3IK9A 4XS6A 3W8SA 3MNGA 4N11A 1SKWB 4POMA 2ES7A 4K0NA 1YDKA 2MBTA 3APQA 1HD2A 3VI7A 1YKCA 4Q5FA 3UL3A 3TKPA 1JHBA 1ZL9A 1KBNA 2OACA 3ERGA 2FLSA 4POLA 2DKIA 2XPEA 3FR9A 2ALBA 4WKWA 5D8IA 5DJMA 2YCDA 2HZEA 3FRCA 2X8HA 1S3RA 4KUNA 2C0EA 4Q5NA 4IJ3A 1TTZA 4GSTA 1BJXA 4KA0A 3ZMKA 2VOCA 3OR5A 3EU4A 5E4WA 2RIIA 4FIWA 4EKZA 3F3QA 3HVSA 1GTUA 1WMJA 2NBSA 3ZLPA 3BJ5A 1T4YA 1S3AA 4KDYA 4Z7XA 4BL7A 4K5SA 4G0IA 1NW2A 3TDGA 2QA2A 2H66A 2X8GA 2CQ9A 1XW5A 4K6XA 1THXA 3EVIA 3FZ9A 3TKSA 1N8JA 4K8MA 1RQMA 1K0BA 5IMVA 4TXVA 5KN1A 4X1UA 4G0KA 1TP9A 2YN1A 5IMDA 5ABRA 4ZBAA 2I81A 2QSIA 3ME8A 5D9TA 4CY8A 4ICYA 1SK2A 3MWHA 3ZIVA 3IE3A 4GCIA 2L6CA 5ENUA 4MH2A 1PRXA 4EF0A 2PGTA 4J2FA 4CHSA 2IMFA 2L57A 1I5GA 1GH2A 4KX4A 3UVTA 3TB2A 4DEJA 3RHBA 20GSA 5DAKA 1HNAA 2KLXA 5J41A 3IAS2 1BX9A 1SD9A 3N5OA 3JCML 2BTOT 4EL1A 2DMLA 2LV3A 3L0HA 3QD9A 1M9AA 1N2AA 2FA8A 2RLIA 4NHZA 1B9YC 2R0GA 2HYXA 5HFIA 1ML6A 2J23A 1MDJA 2HT9A 2FWEA 1M0UA 2YWOA 3VWWA 2HSMA 1X9SB 4GSNA 1HNBA 4HI7A 4EC0A 2CVBA 1EEMA 2YWNA 5D9VA 4NAXA 1GSQA 7GSSA 3LORA 2JZTA 3TUEA 1TOFA 3GHAA 2L6DA 3LYPA 3L9SA 3KTBA 4TKYA 3GURA 1T8EB 3TJGA 4IJIA 3V1WA 4NXIA 4ZL9A 1YQ1A 5J3RA 1AW9A 1QQ2A 4OO5A 3LG6A 4ML6A 4JEDA 5CRWA 3KMNA 2TIRA 1G7OA 1IYIA 1SK1A 1X0RA 2VCXA 3UBKA 1Q4JA 2M72A 1SKRB 5HR3A 2LS5A 2VL2C 2L4CA 2WS2A 3KMOA 3IC8A 1WIKA 4YKFA 2OADA 2C80A 2VM1A 3MAKA 2RUFA 1KEBA 4LL1B 1K0MA 5JCGA 1A8YA 2B7KA 1EV9A 2IJYA 2WZ9A 4I97A 1X5CA 3IOSA 4MLYA 5DAKB 3G9BA 3G7IA 3HD5A 4ML1A 2AYTA 4BIKA 5DQYA 1IYHA 2R0CA 1ZOFA 4ECBA 2PBJA 4FYUA 1SK0A 1LJRA 2DJ3A 3FZAA 2H1AA 2YV9A 2XBQA 3VURA 3L78A 2HSHA 2NPBA 1WJKA 2MZCA 5A4UA 2EIQA 5CNWA 2PUKC 4PQIA 3TOTA 3TKSE 2H01A 1K0OA 1PX6A 3QFBC 4ZB6A 3EPTA 1VGLA 3APSA 1K0DA 2H76A 1XOBA 4CW9A 4IP6A 4RUVA 5EVOA 1GSYA 2H72A 4K7IA 1XVWA 4AJ7A 4OMVA 3F0IA 5D96A 5J5NA 4HU7A 3FHKA 1JZWA 3GYKA 3QCPA 1A2JA 2D2ZA 4JBBA 4E8HA 2NVLA 1MD4A 6GSXA 1SENA 4G9HA 4TXOB 3C71A 1Z9HA 1GTAA 5ECKB 1UN2A 1QGVA 4GWRA 3IBHA 5J9CA 2GT6A 3U6VA 4MDCA 3GUSA 1PL1A 2HI7A 4WEYA 4HDEA 5ECRB 1KNGA 4USSA 2PPTA 5ECSA 3KIJA 2R4VA 2VLUA 1X9MB 4G2EA 2LRTA 1B9XC 2L59A 1GULA 3HVVA 3Q18A 3F9UA 4AGSA 1A2LA 2HSYA 2VLTA 1F6MC 1TK0B 2H1BA 3LEFA 2WDUA 2XBIA 4WR4A 3TKSC 4HQSA 1A0RP 2H1DA 1FOHA 3EMPA 3HCZA 2P31A 1DSBA 2JL4A 5EY6A 5GSSA 2GSQA 4BA7A 1JLVA 4EIQA 2LJRA 4TR4A 3D4MA 1K3YA 3FYGA 3CRUA 4N0VA 3P7XA 3EU3A 5E59A 1PMTA 4YH2A 1JZOA 2MYGA 3C7MA 3IV4A 3VPTA 3TJJA 2R2JA 3F63A 3UBLA 4EIPA 3KP8A 1BAYA 3Q6OA 2X49A 4TR1A 4MJEA 4G19A 1BG5A 2XPDA 1SU9A 5COHA 3HZ4A 19GSA 1GRXA 1U3IA 2C0FA 2HE3A 3GFKA 4V2NA 4PUFC 1O6JA 4KCEA 2CX4A 3HJMA 1YF1A 1TRSA 4DSRA 3KH9A 2IN3A 1TK8B 4ZBBA 4HJMA 1EEJA 4ULXA 2K6VA 3A2XA 1XOAA 2R5GA 2VL9A 1MD3A 2C3TA 4KNDA 2WCIA 3DGQA 2GGTA 1VF2A 2JACA 2X8CA 3ZL5A 2VCTA 3DVXA 1PFOA 2O85A 4K2DA 5G5EA 1AC1A 4MPGA 3H79A 3TKRA 3GRXA 4LA1A 4GF0A 1G0TA 2F8FA 1PX7A 3EC3A 4I5QA 1OC3A 2VD0A 4FQUA 3PINA 2HLSA 1RW1A 1TI1A 2C0GA 4ID0A 2HNLA 3I6AA 2E0QA 2V41A 2HFDA 1I9DA 2GSTA 2C1YA 2YZUA 3HJPA 1GUKA 2VIMA 3KJYA 2F8AA 1SL1B 4I2TA 4KCAA 1ERVA 5DALA 1R7HA 5AIVA 2K8SA 4PQ1A 2CV4A 2G2QA 4EUYA 3L9VA 1AXDA 1H75A 1GSEA 3WYWA 2AAWA 1EGRA 1TRUA 1O8WA 1F37A 2N5AA 3KM6A 3ZFBA 2RM6A 3TJKA 2V32A 6GSSA 1G7EA 3ZITA 4PUAA 4YQUA 3ZZXA 2R0PA 3WGEA 2L5OA 1EZKA 3HYPA 2IMKA 4TRXA 3HJOA 4HUAA 1R5AA 4D73B 3GH9A 4IP1A 3BD2A 5IOWA 1PN0A 4FYCA 4ZBDA 4BVXA 5DCGA 4IBPA 4G10A 5IMFA 3RAZA 3J7Yk 5HR0A 2CX3A 5HR2A 4O7HA 5H5RA 4OD7A 3PR8A 1UVZA 4K7NA 1PSQA 4NV5A 2K18A 3HY2A 1FB0A 1OE8A 1W89A 1J9BA 1TRWA 3CSIA 4ZB8A 2H30A 2I9HA 2CA8A 4V1Ap 2GT5A 2FA4A 4QL9A 5KEJA 5LCZA 2OE0A 1M9BA 2X64A 1GSSA 3DXBA 2EC4A 1DE2A 3ZYWA 3U5RE 2BMXA 1KTEA 1QUWA 3CSJA 1TXXA 3TRPA 3J7Yb 1FHEA 2H0GA 3KCMA 1TKDB 5HR1A 4ECCA 1SYRA 4HS1A 3WGDA 1ERTA 6GSVA 2E2GA 4MJBA 1TK5B 2ZCTA 3SBCA 1BQ7A 2EIRA 4DSQA 4WBJA 2YV7A 2K9FA 1AUCA 1FG4A 4HZ4A 1Y6EA 1FVJA 3W6GA 4BVXB 1SYXA 5ID2A 5F06A 4IW9A 5LD0A 3QOUA 2LNSA 1URMA 4TN8A 2N5FA 4MZBA 2JZRA 3HVNA 4PURA 4F2IA 2H6YA 1YF0A 5IOXA 2YWMA 3A2WA 3MSZA 4YQMA 3VWVA 1QXHA 4GLTA 4MMMA 2OA7A 1XW6A 3GKMA 1XXUA 4KH7A 2A4HA 2YNXA 2HZEB 5G1LA 5HFGA 4DSSA 2OJLA 4ZIJA 4X43A 3QAWA 4I6XA 2LJAA 1OC9A 3LGCA 1S3CA 1OKTA 1F3BA 4GTUA 10GSA 1A0FA 2YJHA 3H4KA 4IS0A 1TDIA 3KZQA 2M46A 4TVEA 3CQFA 3N9JA 4HU9A 2BJXA 1E6BA 3GL3A 1U6TA 3IHGA 3M9JA 4KB3A 5A5KA 1QFNA 4BL7B 2KUCA 5CO3A 5CREA 2I3YA 3C1RA 2GDRA 3IA1A 4FH8A 5AGYA 4MF6A 4BVYA 2B6MA 3LSZA 2YPMA 2H71A 2PERA 3QFAC 4XHMA 4QQ7A 3ME7A 18GSA 4WETA 1JFUA 3F3RA 1V57A 1ST9A 5JCUA 2I1UA 3MYDA 4K9ZA 1UA5A 2LJKA 2AUVA 4OCFA 1ZGNA 2DKHA 3KGKA 5D9XA 3F8UA 3TOUA 3CSHA 3G7YA 4HEA2 3W8JA 3UOMA 4ZB9A 3IR4A 4WBRD 4Z2UA 4PNFA 2F51A 1M2DA 3FMWA 4XS4A 1XPVA 2KP2A 1FAAA 2H19A 1M99A 2DJJA 3IK7A 3IRAA 1EV4A 1ZZYA 5FHIA 2PWJA 4Q5RA 5CRDA 1PL2A 3TGZA 2H70A 3FR6A 1C72A 2P5QA 4EO3A 2C0DA 4XRDA 3DD3A 22GSA 2CVKA 2GVPA 1WWJA 1EP7A 3FR3A 3LFLA 4JRRA 3ZRDA 2UZ8A 3BCKA 3S9FA 2VL3A 4BVYB 3F6DA 4Z2TA 3P90A 2IWTA 1ZMAA 2RUEA 4GSSA 4NPBA 3GX8A 2Z9SA 8GSSA 2LQQA 3QPMA 4EDYA 1ZYNA 3DVWA 1GLQA 5KN3A 3NIVA 1B48A 4HSCX 2CAIA 1GSUA 1TU7A 1XW9A 1NM3A 3HHVA 3ERWA 4IN0A 2LRCA 2YOIA 5DJLA 5IO0A 4N0ZA 1DE1A 4KDUA 4MPFA 3H1NA 3K8NA 3AY8A 2WB9A 1Z7RA 4PXOA 5ECIB 5AN1A 1XIYA 3LW9A 2TRXA 1DBYA 2B1LA 1FO5A 2VCVA 2RM5A 2CZ3A 3CMIA 1XZOA 3P8WA 1QMVA 5GZZB 3VWUA 4MF7A 3IDVA 2C3QA 2B5EA 4Q5QA 1M2AA 1H4OA 3GTUA 2PVOC 5G30A 2GZPA 5G1KA
chains in the Genus database with same CATH topology
2LSTA 2B1KA 3KD0A 4MNNA 5JWOB 3VFIA 2GLRA 2F9SA 2A2RA 2R3XA 4RI7A 2OKAA 2J9HA 1VF4A 2B5XA 4HZ2A 4YAPA 1FVKA 5G2ZA 5F0GA 4A5PA 3F4RA 5IIZA 4WXTA 1XWCA 2IMDA 4E8EA 4OFMA 1J0FA 1B4PA 2C8UA 3BOAA 2G0FA 5JWQB 4MK3A 3ZIJA 4FYBA 4LMVA 3TKQA 3TJFA 3KP9A 2GSSA 1E2YA 4WR5A 1B4QA 3ED3A 1R5PA 4PQHA 4K7OA 17GSA 1JZDA 4F82A 2WGRA 1SKSB 3QDNA 3VI5A 3D4TA 2KP1A 1WRYA 1GTBA 2HRKA 2MMZA 4GRFA 2ZUPA 4L5LA 4V1Ag 2XC2A 1AQXA 1GUHA 3IHQA 4K0GA 1Z6NA 1PKZA 2B3SA 12GSA 1O7UA 5JWRB 1U3AA 2LKUA 3D0ZA 4DVCA 4IQ1A 3LXTA 1RK4A 1V58A 2H74A 1J08A 2JSYA 2DJ0A 3GTUB 4K2XA 1F9MA 2AB6A 1X9WB 4N30A 3RDWA 2YP6A 1LBKA 3DIEA 4ZL8A 1O85A 3RPPA 3EYTA 1PD21 4LL4B 2R6KA 2LTKA 2HRAA 4JR4A 5HFKA 3WD6A 2GQMA 5C00A 5CRGA 4BPYA 3APOA 4RQXA 5BRTA 4ISDA 4TR1B 3HKRA 1A24A 1O81A 1O73A 3GMFA 3IC4A 4XRAA 1XWKA 3CYNA 3GV1A 4HQZA 5ECNB 1SJZA 1EP8A 5ELAA 2V2GA 5D93A 1EWXA 4P3YB 2NTOA 4MJAA 4KF9A 16GSA 1SJ6A 1VRSD 1T7PB 1SD8A 5J9BA 2E2MA 1FB6A 3TCOA 3LQ7A 1K0AA 2DLXA 4X4JA 3D5JA 2PU9C 2N5BA 1XWAA 4ZXGA 1ZYQB 3RBTA 3FZ5A 2GTUA 5CYYA 2MMNA 1ON4A 2ZNMA 3FY7A 3O3TA 5DVBA 2H6ZA 1TRVA 4NMUA 5A4VA 5A4WA 2VCWA 4XS1A 2VO4A 3TJBA 1CQHA 1M7TA 3IPZA 3UEMA 5B6MA 1WE0A 4MA9A 2GZYA 4OFNA 5ECPB 3FEUA 3GX0A 1U88A 3GH6A 4NWYA 3P2AA 2CZ2A 5BMUA 4QL7A 5F07A 3MIXA 9GSSA 14GSA 5KOWA 4JU5A 4YQVA 4O32A 3ZMLA 2ON5A 4PTSA 1EOGA 3CBUA 5DALB 2WULA 5B8AA 4L5OA 5IPGA 4H86A 3WGXA 4MJCA 4WF5A 2FWFA 3D21A 1K0NA 1OVNA 4EE0A 1GNWA 1AQWA 3UJ1A 5H5SA 5LNKe 2B7JA 3A5IA 3EE2A 3GSTA 4F0BA 1GNEA 5C04A 4JZQA 3CRTA 5AISA 5ECQB 5EPFA 3E3EA 5CP1A 3FK8A 1TI3A 4JE1A 3PH9A 4N10A 2LQOA 2LEGA 1OYJA 5B6NA 3GKKA 3BBYA 3EMXA 2YJ7A 2WJUA 1U87A 6GSWA 2C3NA 5DQSA 5INYA 2IMEA 4HOJA 4MF5A 3NZNA 3E0UA 4RQRA 5D73A 1AIUA 5IQYA 3QR6A 4L0UA 2VCZA 2QKEA 4K1FA 5FT3A 1A2MA 2DMMA 3FW2A 3ERFA 4IQAA 1NHOA 5FWGA 3TRXA 1PGTA 4KE3A 4KAEA 2AJQB 2V6OA 1TU8A 1NHYA 3ZVJD 2O89A 3H93A 4PGTA 3QAGA 6GSYA 6GSTA 5G31A 2PMTA 5JCWA 1SL0B 2O87A 4ACSA 1UC7A 4AF2A 1K3LA 1EGOA 1AQVA 2MMOA 5GAPD 5B7CA 1T3BA 1VF1A 1ERUA 1ZYEA 3UVHA 4NHWA 3H8QA 2FWGA 1JLWA 3GA4A 1GP1A 3A2VA 2LRNA 3I69A 3WT2A 1HNCA 3EWLA 3IAM2 3I9V2 5AIXA 1W4VA 4MP4A 3UARA 4KSOA 3LJRA 4I8BA 2A2SA 3L4NA 2DIYA 1AAZA 2K8VA 2HRNA 2YWIA 4TR3A 1PN9A 13GSA 2H75A 1Y25A 3SWLA 1USBA 2EIOA 2L4QA 4IELA 4KGIA 4IKHA 5ID2B 4AJ8A 2IL3A 1T1VA 3A5WA 4OWYA 2JZSA 2CT6A 3CTFA 3TRQA 1YY7A 5L71A 1WOUA 3KH7A 5ECMB 2X99A 4O5UA 1OKDA 2IMIA 3GKNA 1FW1A 1HYUA 5G5FA 2ON7A 3GL5A 2GSRA 3HVXA 4TXOA 3M8NA 1GSFA 1F3AA 1OC8A 2DJ1A 2VM2A 2B5YA 1ILOA 1YZXA 2R37A 3EINA 3MDKA 5D9WA 4DSSB 4J56E 1K3OA 1SJIA 1OC9B 1YKAA 3RHCA 2GZZA 2WFCA 4MABA 1GLPA 5DDLA 1GSDA 2IIYA 1Q98A 4ZL7A 5ECOB 2JU5A 4GQFA 2H0IA 5GAND 4OO4A 3M1GA 4CY6A 11GSA 2C4JA 4EVMA 2YZHA 4KSMA 1OAZA 1A8LA 1SL2B 1S3DA 4TR0A 1GTIA 2DC5A 2PVQA 3HDCA 2GS3A 2H6XA 2QA1A 4YKGA 3GSSA 2GQLA 5IMAA 2FUG2 1QK8A 1V40A 1XVQA 1FOVA 2OBKA 3CXGA 3US3A 4JR6A 4O92A 4F03A 4EXJA 4IHUA 4WF4A 5F05A 3WT1A 2CVDA 3Q74A 3I43A 1LU4A 1HQOA 1EOHA 2DJ2A 4O5RA 1THOA 1R4WA 4LLRA 4BWQA 4POKA 3PGTA 4KDXA 2E7PA 2QC7A 3DWVA 4I2UA 4POBA 1PA3A 1Z3EA 2L5LA 2HXKA 4ILFA 2DSAA 4J57E 3O76A 3C8EA 2H8LA 4FO5A 4YAVA 3VK9A 3NOFA 2H0HA 1X5EA 4MH3A 4OFTA 5DCHA 3DRNA 1A23A 2V6KA 2QGVA 5KN2A 3L9UA 1K0CA 2FHEA 4PNGA 5KOXA 4IGJA 1XFLA 4RI6A 5IMZA 3DYRA 2X4AA 4XS4B 4ECIA 1ZYPA 3CTGA 2A2PA 3IXRA 2P5RA 1ERWA 1XWBA 3ZFLA 1ABAA 1VF3A 2LNTA 2AV4A 3GNJA 1V98A 3PPUA 3G7JA 5IMCA 5CRHA 2JADA 2PN8A 2DIZA 1GUMA 5DBQA 3F6FA 1G6YA 3M3MA 1WPIA 2FGXA 3C73A 1G6WA 2GQKA 2O8VB 4K5RA 4TOPA 3VPQA 3LWAA 4ECJA 3F4SA 2VD1A 3KEBA 2OBIA 1R26A 3VLNA 3D6IA 3O6TA 3UMAA 5CAXA 1V2AA 5GSTA 1M2BA 4BWSA 2LUSA 4L0WA 1BYEA 4V2LA 4F9ZA 1YJ6A 1X5DA 3A3TA 2FCHA 3BCIA 2CAQA 3M0FA 1WP0A 1DUGA 4CDOA 3KTLA 2WRTA 4KW6A 2IFQA 4XCSA 4MCUA 3UAPA 2REMA 1Z7PA 3R2QA 1XBSA 4EDZA 4XIHA 5KN0A 1GL8A 2H1GA 3ZREA 4F0CA 5ECHB 1MDIA 1MDKA 3FZ4A 2FWHA 3GN3A 4MZCA 5HQPA 1XWGA 4IVFA 1TW9A 4GQCA 1PQNA 1NSWA 2KOKA 3FKFA 4D73A 1MTCA 1TJDA 3GIXA 3DKSA 2DBCA 1O8XA 2XHFA 1Z6MA 2AHEA 3KXOA 1MEKA 3GKXA 3QMXA 4TW5A 6GSUA 3EURA 5ECLB 3ZVJA 2TRCP 4NV2A 2DJKA 5F8BA 2FNOA 4MZWA 4GXZA 1PKWA 3ISOA 5H5QA 4L8EA 3DMLA 4XTSA 5IO2A 2MBSA 2V1MA 4AJ6A 1YEXA 2FD3A 2MMAA 5ELGA 1BEDA 1OE7A 2I4AA 2H73A 1YEPA 2A4VA 3ZTLA 2VUPA 2M80A 2OE1A 5B8BA 1T4ZA 2KHPA 3R3EA 4OCEA 5IPHA 2JSZA 2O7KA 2IPAA 3DEXA 4G0LA 5J4UA 2FY6A 4X0XA 4V2MA 2IFQB 3HZ8A 1V9WA 4Z2RA 3LYKA 1JZRA 3M9KA 2F3MA 3QAVA 3RPNA 2VL2A 4HJ2A 5IM9A 4O5QA 3UIWA 1ACVA 2VCQA 2VLVA 4LMWA 1CQGA 2HRFA 2VAFA 3LXZA 3E9JB 5EL8A 1XCCA 3HA9A 3VWXA 2P0GA 3F4TA 2OE3A 4PX1A 1GWCA 1T00A 1Z5YE 2NDOA 3HXSA 1B8XA 3D22A 1F2EA 2HZFA 3C1SA 3Q19A 1ZCPA 4ZILA 2YANA 3IK9A 4XS6A 3W8SA 3MNGA 4N11A 1SKWB 4POMA 2ES7A 4K0NA 1YDKA 2MBTA 3APQA 1HD2A 3VI7A 1YKCA 4Q5FA 3UL3A 3TKPA 1JHBA 1ZL9A 1KBNA 2OACA 3ERGA 2FLSA 4POLA 2DKIA 2XPEA 3FR9A 2ALBA 4WKWA 5D8IA 5DJMA 2YCDA 2HZEA 3FRCA 2X8HA 4KUNA 2C0EA 4Q5NA 4IJ3A 1TTZA 4GSTA 1BJXA 4KA0A 3ZMKA 2VOCA 3OR5A 3EU4A 5E4WA 2RIIA 4FIWA 4EKZA 3F3QA 3HVSA 1GTUA 1WMJA 2NBSA 3ZLPA 3BJ5A 1T4YA 1S3AA 4KDYA 4Z7XA 4BL7A 4K5SA 4G0IA 1NW2A 3TDGA 2QA2A 2H66A 2X8GA 2CQ9A 1XW5A 4K6XA 1THXA 3EVIA 3FZ9A 3TKSA 1N8JA 4K8MA 1RQMA 1K0BA 5IMVA 4TXVA 5KN1A 4X1UA 4G0KA 1TP9A 2YN1A 5IMDA 5ABRA 4ZBAA 2I81A 2QSIA 3ME8A 5D9TA 4CY8A 4ICYA 1SK2A 3MWHA 3ZIVA 3IE3A 4GCIA 2L6CA 5ENUA 4MH2A 1PRXA 4EF0A 2PGTA 4J2FA 4CHSA 2IMFA 2L57A 1I5GA 1GH2A 4KX4A 3UVTA 3TB2A 4DEJA 3RHBA 20GSA 5DAKA 1HNAA 2KLXA 5J41A 3IAS2 1BX9A 1SD9A 3N5OA 3JCML 2BTOT 4EL1A 2DMLA 2LV3A 3L0HA 3QD9A 1M9AA 1N2AA 2FA8A 2RLIA 4NHZA 1B9YC 2R0GA 2HYXA 5HFIA 1ML6A 2J23A 1MDJA 2HT9A 2FWEA 1M0UA 2YWOA 3VWWA 2HSMA 1X9SB 4GSNA 1HNBA 4HI7A 4EC0A 2CVBA 1EEMA 2YWNA 5D9VA 4NAXA 1GSQA 7GSSA 3LORA 2JZTA 3TUEA 1TOFA 3GHAA 2L6DA 3LYPA 3L9SA 3KTBA 4TKYA 3GURA 1T8EB 3TJGA 4IJIA 3V1WA 4NXIA 4ZL9A 1YQ1A 5J3RA 1AW9A 1QQ2A 4OO5A 3LG6A 4ML6A 4JEDA 5CRWA 3KMNA 2TIRA 1G7OA 1IYIA 1SK1A 1X0RA 2VCXA 3UBKA 1Q4JA 2M72A 1SKRB 5HR3A 2LS5A 2VL2C 2L4CA 2WS2A 3KMOA 3IC8A 1WIKA 4YKFA 2OADA 2C80A 2VM1A 3MAKA 2RUFA 1KEBA 4LL1B 1K0MA 5JCGA 1A8YA 2B7KA 1EV9A 2IJYA 2WZ9A 4I97A 1X5CA 3IOSA 4MLYA 5DAKB 3G9BA 3G7IA 3HD5A 4ML1A 2AYTA 5DQYA 1IYHA 2R0CA 1ZOFA 4ECBA 2PBJA 4FYUA 1SK0A 1LJRA 2DJ3A 3FZAA 2H1AA 2YV9A 2XBQA 3VURA 3L78A 2HSHA 2NPBA 1WJKA 2MZCA 5A4UA 2EIQA 5CNWA 2PUKC 4PQIA 3TOTA 3TKSE 2H01A 1K0OA 1PX6A 3QFBC 4ZB6A 3EPTA 1VGLA 3APSA 1K0DA 2H76A 1XOBA 4CW9A 4IP6A 4RUVA 5EVOA 1GSYA 2H72A 4K7IA 1XVWA 4AJ7A 4OMVA 3F0IA 5D96A 5J5NA 4HU7A 3FHKA 1JZWA 3GYKA 3QCPA 1A2JA 2D2ZA 4JBBA 4E8HA 2NVLA 1MD4A 6GSXA 1SENA 4G9HA 4TXOB 3C71A 1Z9HA 1GTAA 5ECKB 1UN2A 1QGVA 4GWRA 3IBHA 5J9CA 2GT6A 3U6VA 4MDCA 3GUSA 1PL1A 2HI7A 4WEYA 4HDEA 5ECRB 1KNGA 4USSA 2PPTA 5ECSA 3KIJA 2R4VA 2VLUA 1X9MB 4G2EA 2LRTA 1B9XC 2L59A 1GULA 3HVVA 3Q18A 3F9UA 4AGSA 1A2LA 2HSYA 2VLTA 1F6MC 1TK0B 2H1BA 3LEFA 2WDUA 2XBIA 4WR4A 3TKSC 4HQSA 1A0RP 2H1DA 1FOHA 3EMPA 3HCZA 2P31A 1DSBA 2JL4A 5EY6A 5GSSA 2GSQA 4BA7A 1JLVA 4EIQA 2LJRA 4TR4A 3D4MA 1K3YA 3FYGA 3CRUA 4N0VA 3P7XA 3EU3A 5E59A 1PMTA 4YH2A 1JZOA 2MYGA 3C7MA 3IV4A 3VPTA 3TJJA 2R2JA 3F63A 3UBLA 4EIPA 3KP8A 1BAYA 3Q6OA 2X49A 4TR1A 4MJEA 4G19A 1BG5A 2XPDA 1SU9A 5COHA 3HZ4A 19GSA 1GRXA 1U3IA 2C0FA 2HE3A 3GFKA 4V2NA 4PUFC 1O6JA 4KCEA 2CX4A 3HJMA 1YF1A 1TRSA 4DSRA 3KH9A 2IN3A 1TK8B 4ZBBA 4HJMA 1EEJA 4ULXA 2K6VA 3A2XA 1XOAA 2R5GA 2VL9A 1MD3A 2C3TA 4KNDA 2WCIA 3DGQA 2GGTA 1VF2A 2JACA 2X8CA 3ZL5A 2VCTA 3DVXA 2O85A 4K2DA 5G5EA 1AC1A 4MPGA 3H79A 3TKRA 3GRXA 4LA1A 4GF0A 1G0TA 2F8FA 1PX7A 3EC3A 4I5QA 1OC3A 2VD0A 4FQUA 3PINA 2HLSA 1RW1A 1TI1A 2C0GA 4ID0A 2HNLA 3I6AA 2E0QA 2V41A 2HFDA 1I9DA 2GSTA 2C1YA 2YZUA 3HJPA 1GUKA 2VIMA 3KJYA 2F8AA 1SL1B 4I2TA 4KCAA 1ERVA 5DALA 1R7HA 5AIVA 2K8SA 4PQ1A 2CV4A 2G2QA 4EUYA 3L9VA 1AXDA 1H75A 1GSEA 3WYWA 2AAWA 1EGRA 1TRUA 1O8WA 1F37A 2N5AA 3KM6A 3ZFBA 2RM6A 3TJKA 2V32A 6GSSA 1G7EA 3ZITA 4PUAA 4YQUA 3ZZXA 2R0PA 3WGEA 2L5OA 1EZKA 3HYPA 2IMKA 4TRXA 3HJOA 4HUAA 1R5AA 4D73B 3GH9A 4IP1A 3BD2A 5IOWA 1PN0A 4FYCA 4ZBDA 4BVXA 5DCGA 4IBPA 4G10A 5IMFA 3RAZA 3J7Yk 5HR0A 2CX3A 5HR2A 4O7HA 5H5RA 4OD7A 3PR8A 1UVZA 4K7NA 1PSQA 4NV5A 2K18A 3HY2A 1FB0A 1OE8A 1W89A 1J9BA 1TRWA 3CSIA 4ZB8A 2H30A 2I9HA 2CA8A 4V1Ap 2GT5A 2FA4A 4QL9A 5KEJA 5LCZA 2OE0A 1M9BA 2X64A 1GSSA 3DXBA 2EC4A 1DE2A 3ZYWA 3U5RE 2BMXA 1KTEA 1QUWA 3CSJA 1TXXA 3TRPA 3J7Yb 1FHEA 2H0GA 3KCMA 1TKDB 5HR1A 4ECCA 1SYRA 4HS1A 3WGDA 1ERTA 6GSVA 2E2GA 4MJBA 1TK5B 2ZCTA 3SBCA 1BQ7A 2EIRA 4DSQA 4WBJA 2YV7A 2K9FA 1AUCA 1FG4A 4HZ4A 1Y6EA 1FVJA 3W6GA 4BVXB 1SYXA 5ID2A 5F06A 4IW9A 5LD0A 3QOUA 2LNSA 1URMA 4TN8A 2N5FA 4MZBA 2JZRA 4PURA 4F2IA 2H6YA 1YF0A 5IOXA 2YWMA 3A2WA 3MSZA 4YQMA 3VWVA 1QXHA 4GLTA 4MMMA 2OA7A 1XW6A 3GKMA 1XXUA 4KH7A 2A4HA 2YNXA 2HZEB 5G1LA 5HFGA 4DSSA 2OJLA 4ZIJA 4X43A 3QAWA 4I6XA 2LJAA 1OC9A 3LGCA 1S3CA 1OKTA 1F3BA 4GTUA 10GSA 1A0FA 2YJHA 3H4KA 4IS0A 1TDIA 3KZQA 2M46A 4TVEA 3N9JA 4HU9A 2BJXA 1E6BA 3GL3A 1U6TA 3IHGA 3M9JA 4KB3A 5A5KA 1QFNA 4BL7B 2KUCA 5CO3A 5CREA 2I3YA 3C1RA 2GDRA 3IA1A 4FH8A 5AGYA 4MF6A 4BVYA 2B6MA 3LSZA 2YPMA 2H71A 2PERA 3QFAC 4XHMA 4QQ7A 3ME7A 18GSA 4WETA 1JFUA 3F3RA 1V57A 1ST9A 5JCUA 2I1UA 3MYDA 4K9ZA 1UA5A 2LJKA 2AUVA 4OCFA 1ZGNA 2DKHA 3KGKA 5D9XA 3F8UA 3TOUA 3CSHA 3G7YA 4HEA2 3W8JA 3UOMA 4ZB9A 3IR4A 4WBRD 4Z2UA 4PNFA 2F51A 1M2DA 3FMWA 4XS4A 1XPVA 2KP2A 1FAAA 2H19A 1M99A 2DJJA 3IK7A 3IRAA 1EV4A 1ZZYA 5FHIA 2PWJA 4Q5RA 5CRDA 1PL2A 3TGZA 2H70A 3FR6A 1C72A 2P5QA 4EO3A 2C0DA 4XRDA 3DD3A 22GSA 2CVKA 2GVPA 1WWJA 1EP7A 3FR3A 3LFLA 4JRRA 3ZRDA 2UZ8A 3BCKA 3S9FA 2VL3A 4BVYB 3F6DA 4Z2TA 3P90A 2IWTA 1ZMAA 2RUEA 4GSSA 4NPBA 3GX8A 2Z9SA 8GSSA 2LQQA 3QPMA 4EDYA 1ZYNA 3DVWA 1GLQA 5KN3A 3NIVA 1B48A 2CAIA 1GSUA 1TU7A 1XW9A 1NM3A 3HHVA 3ERWA 4IN0A 2LRCA 2YOIA 5DJLA 5IO0A 4N0ZA 1DE1A 4KDUA 4MPFA 3H1NA 3K8NA 3AY8A 2WB9A 1Z7RA 4PXOA 5ECIB 5AN1A 1XIYA 3LW9A 2TRXA 1DBYA 2B1LA 1FO5A 2VCVA 2RM5A 2CZ3A 3CMIA 1XZOA 3P8WA 1QMVA 5GZZB 3VWUA 4MF7A 3IDVA 2C3QA 2B5EA 4Q5QA 1M2AA 1H4OA 3GTUA 2PVOC 5G30A 2GZPA 5G1KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LST A;  2B1K A;  3KD0 A;  5JWO B;  3VFI A;  2GLR A;  2F9S A;  2A2R A;  2R3X A;  4RI7 A;  2OKA A;  2J9H A;  1VF4 A;  2B5X A;  4HZ2 A;  4YAP A;  1FVK A;  5G2Z A;  5F0G A;  3F4R A;  5IIZ A;  4WXT A;  1XWC A;  2IMD A;  4E8E A;  4OFM A;  1J0F A;  1B4P A;  2C8U A;  3BOA A;  2G0F A;  5JWQ B;  4MK3 A;  3ZIJ A;  4FYB A;  4LMV A;  3TKQ A;  3TJF A;  3KP9 A;  2GSS A;  1E2Y A;  4WR5 A;  1B4Q A;  3ED3 A;  1R5P A;  4PQH A;  4K7O A;  17GS A;  1JZD A;  4F82 A;  2WGR A;  1SKS B;  3QDN A;  3VI5 A;  3D4T A;  2KP1 A;  1WRY A;  1GTB A;  2MMZ A;  4GRF A;  2ZUP A;  4L5L A;  4V1A g;  2XC2 A;  1AQX A;  1GUH A;  3IHQ A;  4K0G A;  1Z6N A;  1PKZ A;  2B3S A;  12GS A;  1O7U A;  5JWR B;  1U3A A;  2LKU A;  3D0Z A;  4DVC A;  4IQ1 A;  3LXT A;  1RK4 A;  1V58 A;  2H74 A;  1J08 A;  2JSY A;  2DJ0 A;  3GTU B;  1F9M A;  2AB6 A;  1X9W B;  4N30 A;  3RDW A;  2YP6 A;  1LBK A;  3DIE A;  4ZL8 A;  1O85 A;  3RPP A;  3EYT A;  1PD2 1;  4LL4 B;  2R6K A;  2LTK A;  4JR4 A;  5HFK A;  3WD6 A;  2GQM A;  5C00 A;  5CRG A;  4BPY A;  3APO A;  4RQX A;  4ISD A;  4TR1 B;  3HKR A;  1A24 A;  1O81 A;  1O73 A;  3GMF A;  3IC4 A;  4XRA A;  1XWK A;  3CYN A;  3GV1 A;  4HQZ A;  5ECN B;  1SJZ A;  1EP8 A;  5ELA A;  2V2G A;  5D93 A;  1EWX A;  4P3Y B;  2NTO A;  4MJA A;  16GS A;  1SJ6 A;  1VRS D;  1T7P B;  1SD8 A;  5J9B A;  2E2M A;  1FB6 A;  3TCO A;  3LQ7 A;  1K0A A;  2DLX A;  3D5J A;  2PU9 C;  2N5B A;  1XWA A;  4ZXG A;  1ZYQ B;  3RBT A;  3FZ5 A;  2GTU A;  5CYY A;  2MMN A;  1ON4 A;  2ZNM A;  3FY7 A;  3O3T A;  5DVB A;  2H6Z A;  1TRV A;  4NMU A;  5A4V A;  5A4W A;  2VCW A;  4XS1 A;  2VO4 A;  3TJB A;  1CQH A;  1M7T A;  3IPZ A;  3UEM A;  5B6M A;  1WE0 A;  4MA9 A;  2GZY A;  4OFN A;  5ECP B;  3FEU A;  3GX0 A;  1U88 A;  3GH6 A;  4NWY A;  3P2A A;  2CZ2 A;  4QL7 A;  5F07 A;  9GSS A;  14GS A;  4JU5 A;  4YQV A;  4O32 A;  3ZML A;  2ON5 A;  1EOG A;  5DAL B;  3CBU A;  2WUL A;  5B8A A;  4L5O A;  5IPG A;  4H86 A;  3WGX A;  4MJC A;  4WF5 A;  2FWF A;  3D21 A;  1K0N A;  1OVN A;  4EE0 A;  1GNW A;  1AQW A;  3UJ1 A;  5H5S A;  5LNK e;  2B7J A;  3EE2 A;  3GST A;  4F0B A;  1GNE A;  5C04 A;  4JZQ A;  3CRT A;  5AIS A;  5ECQ B;  5EPF A;  3E3E A;  5CP1 A;  3FK8 A;  1TI3 A;  4JE1 A;  3PH9 A;  4N10 A;  2LQO A;  2LEG A;  1OYJ A;  5B6N A;  3GKK A;  3BBY A;  3EMX A;  2YJ7 A;  2WJU A;  1U87 A;  6GSW A;  2C3N A;  5DQS A;  5INY A;  2IME A;  4HOJ A;  4MF5 A;  3NZN A;  3E0U A;  4RQR A;  5D73 A;  1AIU A;  5IQY A;  3QR6 A;  4L0U A;  2VCZ A;  2QKE A;  4K1F A;  5FT3 A;  1A2M A;  2DMM A;  3FW2 A;  3ERF A;  4IQA A;  1NHO A;  5FWG A;  3TRX A;  1PGT A;  4KE3 A;  4KAE A;  2AJQ B;  2V6O A;  1TU8 A;  1NHY A;  3ZVJ D;  2O89 A;  3H93 A;  4PGT A;  3QAG A;  6GSY A;  6GST A;  5G31 A;  2PMT A;  5JCW A;  1SL0 B;  2O87 A;  4ACS A;  1UC7 A;  4AF2 A;  1K3L A;  1EGO A;  1AQV A;  2MMO A;  5GAP D;  5B7C A;  1T3B A;  1VF1 A;  1ERU A;  1ZYE A;  3UVH A;  4NHW A;  3H8Q A;  2FWG A;  1JLW A;  3GA4 A;  1GP1 A;  3A2V A;  2LRN A;  3I69 A;  3WT2 A;  1HNC A;  3EWL A;  3IAM 2;  3I9V 2;  5AIX A;  1W4V A;  4MP4 A;  3UAR A;  4KSO A;  3LJR A;  4I8B A;  2A2S A;  3L4N A;  2DIY A;  1AAZ A;  2K8V A;  2HRN A;  2YWI A;  4TR3 A;  1PN9 A;  13GS A;  2H75 A;  1Y25 A;  3SWL A;  1USB A;  2EIO A;  2L4Q A;  4IEL A;  4KGI A;  4IKH A;  5ID2 B;  4AJ8 A;  2IL3 A;  1T1V A;  3A5W A;  4OWY A;  2JZS A;  2CT6 A;  3CTF A;  3TRQ A;  1YY7 A;  5L71 A;  1WOU A;  3KH7 A;  5ECM B;  2X99 A;  1OKD A;  2IMI A;  3GKN A;  1FW1 A;  1HYU A;  5G5F A;  2ON7 A;  3GL5 A;  2GSR A;  3HVX A;  4TXO A;  3M8N A;  1GSF A;  1F3A A;  1OC8 A;  2DJ1 A;  2VM2 A;  2B5Y A;  1ILO A;  1YZX A;  2R37 A;  3EIN A;  3MDK A;  5D9W A;  4DSS B;  4J56 E;  1K3O A;  1SJI A;  1OC9 B;  1YKA A;  3RHC A;  2GZZ A;  2WFC A;  4MAB A;  1GLP A;  5DDL A;  1GSD A;  2IIY A;  1Q98 A;  4ZL7 A;  5ECO B;  2JU5 A;  4GQF A;  2H0I A;  5GAN D;  4OO4 A;  3M1G A;  11GS A;  2C4J A;  4EVM A;  2YZH A;  4KSM A;  1OAZ A;  1A8L A;  1SL2 B;  1S3D A;  4TR0 A;  1GTI A;  2DC5 A;  2PVQ A;  3HDC A;  2GS3 A;  2H6X A;  3GSS A;  2GQL A;  5IMA A;  2FUG 2;  1QK8 A;  1V40 A;  1XVQ A;  1FOV A;  2OBK A;  3CXG A;  3US3 A;  4JR6 A;  4O92 A;  4F03 A;  4EXJ A;  4IHU A;  4WF4 A;  5F05 A;  3WT1 A;  2CVD A;  3Q74 A;  3I43 A;  1LU4 A;  1HQO A;  1EOH A;  2DJ2 A;  4O5R A;  1THO A;  1R4W A;  4LLR A;  4BWQ A;  4POK A;  3PGT A;  4KDX A;  2E7P A;  2QC7 A;  3DWV A;  4I2U A;  4POB A;  1PA3 A;  1Z3E A;  2L5L A;  2HXK A;  4ILF A;  2DSA A;  4J57 E;  3O76 A;  3C8E A;  2H8L A;  4FO5 A;  4YAV A;  3VK9 A;  3NOF A;  2H0H A;  1X5E A;  4MH3 A;  4OFT A;  5DCH A;  3DRN A;  1A23 A;  2V6K A;  2QGV A;  5KN2 A;  3L9U A;  1K0C A;  2FHE A;  4PNG A;  4IGJ A;  1XFL A;  4RI6 A;  5IMZ A;  3DYR A;  4XS4 B;  4ECI A;  3CTG A;  3IXR A;  2P5R A;  1ERW A;  1XWB A;  3ZFL A;  1ABA A;  1VF3 A;  2LNT A;  2AV4 A;  3GNJ A;  1V98 A;  3G7J A;  5IMC A;  5CRH A;  2JAD A;  2PN8 A;  2DIZ A;  1GUM A;  5DBQ A;  3F6F A;  1G6Y A;  3M3M A;  1WPI A;  2FGX A;  3C73 A;  1G6W A;  2GQK A;  2O8V B;  4TOP A;  3VPQ A;  3LWA A;  4ECJ A;  3F4S A;  2VD1 A;  3KEB A;  2OBI A;  1R26 A;  3VLN A;  3D6I A;  3O6T A;  3UMA A;  5CAX A;  1V2A A;  5GST A;  1M2B A;  4BWS A;  2LUS A;  4L0W A;  1BYE A;  4V2L A;  4F9Z A;  1YJ6 A;  1X5D A;  3A3T A;  2FCH A;  3BCI A;  2CAQ A;  3M0F A;  1WP0 A;  1DUG A;  4CDO A;  3KTL A;  2WRT A;  4KW6 A;  2IFQ A;  4XCS A;  4MCU A;  3UAP A;  2REM A;  1Z7P A;  3R2Q A;  1XBS A;  4EDZ A;  4XIH A;  5KN0 A;  1GL8 A;  2H1G A;  3ZRE A;  4F0C A;  5ECH B;  1MDI A;  1MDK A;  3FZ4 A;  2FWH A;  3GN3 A;  4MZC A;  5HQP A;  1XWG A;  4IVF A;  1TW9 A;  4GQC A;  1PQN A;  1NSW A;  2KOK A;  3FKF A;  4D73 A;  1MTC A;  1TJD A;  3GIX A;  3DKS A;  2DBC A;  1O8X A;  2XHF A;  1Z6M A;  2AHE A;  3KXO A;  1MEK A;  3GKX A;  3QMX A;  4TW5 A;  6GSU A;  3EUR A;  5ECL B;  3ZVJ A;  2TRC P;  4NV2 A;  2DJK A;  5F8B A;  2FNO A;  4MZW A;  4GXZ A;  1PKW A;  3ISO A;  5H5Q A;  4L8E A;  3DML A;  4XTS A;  5IO2 A;  2MBS A;  2V1M A;  4AJ6 A;  1YEX A;  2FD3 A;  2MMA A;  5ELG A;  1BED A;  1OE7 A;  2I4A A;  2H73 A;  1YEP A;  2A4V A;  3ZTL A;  2VUP A;  2M80 A;  2OE1 A;  5B8B A;  1T4Z A;  2KHP A;  4OCE A;  5IPH A;  2JSZ A;  2O7K A;  2IPA A;  3DEX A;  5J4U A;  2FY6 A;  4X0X A;  4V2M A;  2IFQ B;  3HZ8 A;  1V9W A;  3LYK A;  1JZR A;  3M9K A;  2F3M A;  3QAV A;  3RPN A;  2VL2 A;  4HJ2 A;  5IM9 A;  3UIW A;  1ACV A;  2VCQ A;  2VLV A;  4LMW A;  1CQG A;  2HRF A;  2VAF A;  3LXZ A;  3E9J B;  5EL8 A;  1XCC A;  3HA9 A;  3VWX A;  2P0G A;  3F4T A;  2OE3 A;  4PX1 A;  1GWC A;  1T00 A;  1Z5Y E;  2NDO A;  3HXS A;  1B8X A;  3D22 A;  1F2E A;  2HZF A;  3C1S A;  3Q19 A;  1ZCP A;  4ZIL A;  2YAN A;  3IK9 A;  4XS6 A;  3W8S A;  3MNG A;  4N11 A;  1SKW B;  4POM A;  2ES7 A;  4K0N A;  1YDK A;  2MBT A;  3APQ A;  1HD2 A;  3VI7 A;  1YKC A;  4Q5F A;  3UL3 A;  3TKP A;  1JHB A;  1ZL9 A;  1KBN A;  2OAC A;  3ERG A;  2FLS A;  4POL A;  2XPE A;  3FR9 A;  2ALB A;  4WKW A;  5D8I A;  5DJM A;  2YCD A;  2HZE A;  3FRC A;  2X8H A;  4KUN A;  2C0E A;  4Q5N A;  4IJ3 A;  1TTZ A;  4GST A;  1BJX A;  4KA0 A;  3ZMK A;  2VOC A;  3OR5 A;  3EU4 A;  5E4W A;  2RII A;  4FIW A;  4EKZ A;  3F3Q A;  3HVS A;  1GTU A;  1WMJ A;  2NBS A;  3ZLP A;  3BJ5 A;  1T4Y A;  1S3A A;  4KDY A;  4Z7X A;  4BL7 A;  1NW2 A;  3TDG A;  2H66 A;  2X8G A;  2CQ9 A;  1XW5 A;  4K6X A;  1THX A;  3EVI A;  3FZ9 A;  3TKS A;  1N8J A;  4K8M A;  1RQM A;  1K0B A;  5IMV A;  4TXV A;  5KN1 A;  4X1U A;  1TP9 A;  2YN1 A;  5IMD A;  5ABR A;  4ZBA A;  2I81 A;  2QSI A;  3ME8 A;  5D9T A;  1SK2 A;  3MWH A;  3ZIV A;  3IE3 A;  4GCI A;  2L6C A;  5ENU A;  4MH2 A;  1PRX A;  4EF0 A;  2PGT A;  4J2F A;  4CHS A;  2IMF A;  2L57 A;  1I5G A;  1GH2 A;  4KX4 A;  3UVT A;  3TB2 A;  4DEJ A;  3RHB A;  20GS A;  5DAK A;  1HNA A;  2KLX A;  5J41 A;  3IAS 2;  1BX9 A;  1SD9 A;  3N5O A;  3JCM L;  2BTO T;  4EL1 A;  2DML A;  2LV3 A;  3L0H A;  3QD9 A;  1M9A A;  1N2A A;  2FA8 A;  2RLI A;  4NHZ A;  1B9Y C;  2HYX A;  5HFI A;  1ML6 A;  2J23 A;  1MDJ A;  2HT9 A;  2FWE A;  1M0U A;  2YWO A;  3VWW A;  1X9S B;  4GSN A;  1HNB A;  4HI7 A;  4EC0 A;  2CVB A;  1EEM A;  2YWN A;  5D9V A;  4NAX A;  1GSQ A;  7GSS A;  3LOR A;  2JZT A;  3TUE A;  1TOF A;  3GHA A;  2L6D A;  3LYP A;  3L9S A;  3KTB A;  4TKY A;  3GUR A;  1T8E B;  3TJG A;  4IJI A;  3V1W A;  4NXI A;  4ZL9 A;  1YQ1 A;  5J3R A;  1AW9 A;  1QQ2 A;  4OO5 A;  3LG6 A;  4ML6 A;  4JED A;  5CRW A;  3KMN A;  2TIR A;  1G7O A;  1IYI A;  1SK1 A;  1X0R A;  2VCX A;  3UBK A;  1Q4J A;  2M72 A;  1SKR B;  5HR3 A;  2LS5 A;  2VL2 C;  2L4C A;  2WS2 A;  3KMO A;  1WIK A;  2OAD A;  2C80 A;  2VM1 A;  3MAK A;  2RUF A;  1KEB A;  4LL1 B;  1K0M A;  5JCG A;  1A8Y A;  2B7K A;  1EV9 A;  2IJY A;  2WZ9 A;  4I97 A;  1X5C A;  3IOS A;  4MLY A;  5DAK B;  3G9B A;  3G7I A;  3HD5 A;  4ML1 A;  2AYT A;  5DQY A;  1IYH A;  1ZOF A;  4ECB A;  2PBJ A;  4FYU A;  1SK0 A;  1LJR A;  2DJ3 A;  3FZA A;  2H1A A;  2YV9 A;  2XBQ A;  3VUR A;  3L78 A;  2HSH A;  2NPB A;  1WJK A;  2MZC A;  5A4U A;  2EIQ A;  5CNW A;  2PUK C;  4PQI A;  3TOT A;  3TKS E;  2H01 A;  1K0O A;  1PX6 A;  3QFB C;  4ZB6 A;  1VGL A;  3APS A;  1K0D A;  2H76 A;  1XOB A;  4CW9 A;  4IP6 A;  4RUV A;  5EVO A;  1GSY A;  2H72 A;  4K7I A;  1XVW A;  4AJ7 A;  4OMV A;  3F0I A;  5D96 A;  5J5N A;  4HU7 A;  3FHK A;  1JZW A;  3GYK A;  3QCP A;  1A2J A;  2D2Z A;  4JBB A;  4E8H A;  2NVL A;  1MD4 A;  6GSX A;  1SEN A;  4G9H A;  4TXO B;  3C71 A;  1Z9H A;  1GTA A;  5ECK B;  1UN2 A;  1QGV A;  4GWR A;  3IBH A;  5J9C A;  2GT6 A;  3U6V A;  4MDC A;  3GUS A;  1PL1 A;  2HI7 A;  4WEY A;  4HDE A;  5ECR B;  1KNG A;  5ECS A;  2PPT A;  3KIJ A;  2R4V A;  2VLU A;  1X9M B;  4G2E A;  2LRT A;  1B9X C;  2L59 A;  1GUL A;  3HVV A;  3Q18 A;  3F9U A;  4AGS A;  1A2L A;  2HSY A;  2VLT A;  1F6M C;  1TK0 B;  2H1B A;  3LEF A;  2WDU A;  2XBI A;  4WR4 A;  3TKS C;  4HQS A;  1A0R P;  2H1D A;  3EMP A;  3HCZ A;  2P31 A;  1DSB A;  2JL4 A;  5EY6 A;  5GSS A;  2GSQ A;  4BA7 A;  1JLV A;  2LJR A;  4TR4 A;  3D4M A;  1K3Y A;  3FYG A;  3CRU A;  4N0V A;  3P7X A;  3EU3 A;  5E59 A;  1PMT A;  4YH2 A;  1JZO A;  2MYG A;  3C7M A;  3IV4 A;  3VPT A;  3TJJ A;  2R2J A;  3F63 A;  3UBL A;  3KP8 A;  1BAY A;  3Q6O A;  4TR1 A;  4MJE A;  4G19 A;  1BG5 A;  2XPD A;  1SU9 A;  5COH A;  3HZ4 A;  19GS A;  1GRX A;  1U3I A;  2C0F A;  2HE3 A;  3GFK A;  4V2N A;  4PUF C;  1O6J A;  4KCE A;  2CX4 A;  3HJM A;  1YF1 A;  1TRS A;  4DSR A;  3KH9 A;  2IN3 A;  1TK8 B;  4ZBB A;  4HJM A;  1EEJ A;  4ULX A;  2K6V A;  3A2X A;  1XOA A;  2R5G A;  2VL9 A;  1MD3 A;  2C3T A;  4KND A;  2WCI A;  3DGQ A;  2GGT A;  1VF2 A;  2JAC A;  2X8C A;  3ZL5 A;  2VCT A;  3DVX A;  2O85 A;  4K2D A;  5G5E A;  1AC1 A;  4MPG A;  3H79 A;  3TKR A;  3GRX A;  4LA1 A;  4GF0 A;  1G0T A;  2F8F A;  1PX7 A;  3EC3 A;  4I5Q A;  1OC3 A;  2VD0 A;  3PIN A;  2HLS A;  1RW1 A;  1TI1 A;  2C0G A;  4ID0 A;  2HNL A;  3I6A A;  2E0Q A;  2V41 A;  2HFD A;  1I9D A;  2GST A;  2C1Y A;  2YZU A;  3HJP A;  1GUK A;  2VIM A;  3KJY A;  2F8A A;  1SL1 B;  4I2T A;  4KCA A;  1ERV A;  5DAL A;  1R7H A;  5AIV A;  2K8S A;  4PQ1 A;  2CV4 A;  2G2Q A;  2GZP A;  4EUY A;  3L9V A;  1AXD A;  1H75 A;  1GSE A;  3WYW A;  2AAW A;  1EGR A;  1TRU A;  1O8W A;  1F37 A;  2N5A A;  3KM6 A;  3ZFB A;  2RM6 A;  3TJK A;  2V32 A;  6GSS A;  1G7E A;  3ZIT A;  4PUA A;  4YQU A;  3ZZX A;  3WGE A;  2L5O A;  1EZK A;  3HYP A;  2IMK A;  4TRX A;  3HJO A;  4HUA A;  1R5A A;  4D73 B;  3GH9 A;  4IP1 A;  3BD2 A;  5IOW A;  4FYC A;  4ZBD A;  4BVX A;  5DCG A;  4IBP A;  4G10 A;  5IMF A;  3RAZ A;  3J7Y k;  5HR0 A;  2CX3 A;  5HR2 A;  4O7H A;  5H5R A;  4OD7 A;  3PR8 A;  1UVZ A;  4K7N A;  1PSQ A;  4NV5 A;  2K18 A;  3HY2 A;  1FB0 A;  1OE8 A;  1W89 A;  1J9B A;  1TRW A;  3CSI A;  4ZB8 A;  2H30 A;  2I9H A;  2CA8 A;  4V1A p;  2GT5 A;  2FA4 A;  4QL9 A;  5KEJ A;  5LCZ A;  2OE0 A;  1M9B A;  2X64 A;  1GSS A;  3DXB A;  2EC4 A;  1DE2 A;  3ZYW A;  3U5R E;  2BMX A;  1KTE A;  1QUW A;  3CSJ A;  1TXX A;  3TRP A;  3J7Y b;  1FHE A;  2H0G A;  3KCM A;  1TKD B;  5HR1 A;  4ECC A;  1SYR A;  4HS1 A;  3WGD A;  1ERT A;  6GSV A;  2E2G A;  4MJB A;  1TK5 B;  2ZCT A;  3SBC A;  1BQ7 A;  2EIR A;  4DSQ A;  4WBJ A;  2YV7 A;  2K9F A;  1AUC A;  1FG4 A;  4HZ4 A;  1Y6E A;  1FVJ A;  3W6G A;  1SYX A;  5ID2 A;  4IW9 A;  5LD0 A;  3QOU A;  2LNS A;  1URM A;  4TN8 A;  2N5F A;  4MZB A;  2JZR A;  4PUR A;  4F2I A;  2H6Y A;  1YF0 A;  5IOX A;  2YWM A;  3A2W A;  3MSZ A;  4YQM A;  3VWV A;  1QXH A;  4GLT A;  4MMM A;  2OA7 A;  1XW6 A;  3GKM A;  1XXU A;  4KH7 A;  2YNX A;  2HZE B;  5G1L A;  5HFG A;  4DSS A;  2OJL A;  4ZIJ A;  4X43 A;  3QAW A;  4I6X A;  2LJA A;  1OC9 A;  3LGC A;  1S3C A;  1OKT A;  1F3B A;  4GTU A;  10GS A;  1A0F A;  2YJH A;  3H4K A;  4IS0 A;  1TDI A;  3KZQ A;  2M46 A;  4TVE A;  3N9J A;  4HU9 A;  2BJX A;  1E6B A;  3GL3 A;  1U6T A;  3M9J A;  4KB3 A;  5A5K A;  1QFN A;  2KUC A;  5CO3 A;  5CRE A;  2I3Y A;  3C1R A;  2GDR A;  3IA1 A;  4FH8 A;  5AGY A;  4MF6 A;  4BVY A;  2B6M A;  3LSZ A;  2YPM A;  2H71 A;  2PER A;  3QFA C;  4XHM A;  4QQ7 A;  3ME7 A;  18GS A;  4WET A;  1JFU A;  3F3R A;  1V57 A;  1ST9 A;  5JCU A;  2I1U A;  4K9Z A;  1UA5 A;  2LJK A;  2AUV A;  4OCF A;  1ZGN A;  3KGK A;  5D9X A;  3F8U A;  3TOU A;  3CSH A;  3G7Y A;  4HEA 2;  3W8J A;  3UOM A;  4ZB9 A;  3IR4 A;  4WBR D;  4PNF A;  2F51 A;  1M2D A;  4XS4 A;  1XPV A;  2KP2 A;  1FAA A;  2H19 A;  1M99 A;  2DJJ A;  3IK7 A;  3IRA A;  1EV4 A;  1ZZY A;  5FHI A;  2PWJ A;  4Q5R A;  5CRD A;  1PL2 A;  3TGZ A;  2H70 A;  3FR6 A;  1C72 A;  2P5Q A;  4EO3 A;  2C0D A;  4XRD A;  3DD3 A;  22GS A;  2CVK A;  2GVP A;  1WWJ A;  1EP7 A;  3FR3 A;  3LFL A;  4JRR A;  3ZRD A;  3BCK A;  3S9F A;  2VL3 A;  3F6D A;  3P90 A;  2IWT A;  1ZMA A;  2RUE A;  4GSS A;  4NPB A;  3GX8 A;  2Z9S A;  8GSS A;  2LQQ A;  3QPM A;  4EDY A;  3DVW A;  1GLQ A;  5KN3 A;  3NIV A;  1B48 A;  2CAI A;  1GSU A;  1TU7 A;  1XW9 A;  1NM3 A;  3HHV A;  3ERW A;  4IN0 A;  2LRC A;  2YOI A;  5DJL A;  5IO0 A;  4N0Z A;  1DE1 A;  4KDU A;  4MPF A;  3H1N A;  3K8N A;  3AY8 A;  2WB9 A;  1Z7R A;  4PXO A;  5ECI B;  5AN1 A;  1XIY A;  2TRX A;  1DBY A;  2B1L A;  1FO5 A;  2VCV A;  2RM5 A;  2CZ3 A;  3CMI A;  1XZO A;  3P8W A;  1QMV A;  5GZZ B;  3VWU A;  4MF7 A;  3IDV A;  2C3Q A;  2B5E A;  4Q5Q A;  1M2A A;  1H4O A;  3GTU A;  2PVO C;  5G30 A;  5F06 A;  5G1K A; 
#chains in the Genus database with same CATH topology
 2LST A;  2B1K A;  3KD0 A;  4MNN A;  5JWO B;  3VFI A;  2GLR A;  2F9S A;  2A2R A;  2R3X A;  4RI7 A;  2OKA A;  2J9H A;  1VF4 A;  2B5X A;  4HZ2 A;  4YAP A;  1FVK A;  5G2Z A;  5F0G A;  4A5P A;  3F4R A;  5IIZ A;  4WXT A;  1XWC A;  2IMD A;  4E8E A;  4OFM A;  1J0F A;  1B4P A;  2C8U A;  3BOA A;  2G0F A;  5JWQ B;  4MK3 A;  3ZIJ A;  4FYB A;  4LMV A;  3TKQ A;  3TJF A;  3KP9 A;  2GSS A;  1E2Y A;  4WR5 A;  1B4Q A;  3ED3 A;  1R5P A;  4PQH A;  4K7O A;  17GS A;  1JZD A;  4F82 A;  2WGR A;  1SKS B;  3QDN A;  3VI5 A;  3D4T A;  2KP1 A;  1WRY A;  1GTB A;  2HRK A;  2MMZ A;  4GRF A;  2ZUP A;  4L5L A;  4V1A g;  2XC2 A;  1AQX A;  1GUH A;  3IHQ A;  4K0G A;  1Z6N A;  1PKZ A;  2B3S A;  12GS A;  1O7U A;  5JWR B;  1U3A A;  2LKU A;  3D0Z A;  4DVC A;  4IQ1 A;  3LXT A;  1RK4 A;  1V58 A;  2H74 A;  1J08 A;  2JSY A;  2DJ0 A;  3GTU B;  4K2X A;  1F9M A;  2AB6 A;  1X9W B;  4N30 A;  3RDW A;  2YP6 A;  1LBK A;  3DIE A;  4ZL8 A;  1O85 A;  3RPP A;  3EYT A;  1PD2 1;  1XG8 A;  4LL4 B;  2R6K A;  2LTK A;  2HRA A;  4JR4 A;  5HFK A;  3WD6 A;  2GQM A;  5C00 A;  5CRG A;  4BPY A;  3APO A;  4RQX A;  5BRT A;  4ISD A;  4TR1 B;  3HKR A;  1A24 A;  1O81 A;  1O73 A;  3GMF A;  3IC4 A;  4XRA A;  1XWK A;  3CYN A;  3GV1 A;  4HQZ A;  5ECN B;  1SJZ A;  1EP8 A;  5ELA A;  2V2G A;  5D93 A;  1EWX A;  4P3Y B;  2NTO A;  4MJA A;  4KF9 A;  16GS A;  1SJ6 A;  1VRS D;  1T7P B;  1SD8 A;  5J9B A;  2E2M A;  1FB6 A;  3TCO A;  3LQ7 A;  1K0A A;  2DLX A;  4X4J A;  3D5J A;  2PU9 C;  2N5B A;  1XWA A;  4ZXG A;  1ZYQ B;  3RBT A;  3FZ5 A;  2GTU A;  5CYY A;  2MMN A;  1ON4 A;  2ZNM A;  3FY7 A;  3O3T A;  5DVB A;  2H6Z A;  1TRV A;  4NMU A;  5A4V A;  5A4W A;  2VCW A;  4XS1 A;  2VO4 A;  3TJB A;  1CQH A;  1M7T A;  3IPZ A;  3UEM A;  5B6M A;  1WE0 A;  4MA9 A;  2GZY A;  4OFN A;  5ECP B;  3FEU A;  3GX0 A;  1U88 A;  3GH6 A;  4NWY A;  3P2A A;  2CZ2 A;  5BMU A;  4QL7 A;  5F07 A;  3MIX A;  9GSS A;  14GS A;  5KOW A;  4JU5 A;  4YQV A;  4O32 A;  3ZML A;  2ON5 A;  4PTS A;  1EOG A;  3CBU A;  5DAL B;  2WUL A;  5B8A A;  4L5O A;  5IPG A;  4H86 A;  3WGX A;  4MJC A;  4WF5 A;  2FWF A;  3D21 A;  1K0N A;  1OVN A;  4EE0 A;  1GNW A;  1AQW A;  3UJ1 A;  5H5S A;  5LNK e;  2B7J A;  3A5I A;  3EE2 A;  3GST A;  4F0B A;  1GNE A;  5C04 A;  4JZQ A;  3CRT A;  5AIS A;  5ECQ B;  5EPF A;  3E3E A;  5CP1 A;  3FK8 A;  1TI3 A;  4JE1 A;  3PH9 A;  4N10 A;  2LQO A;  2LEG A;  1OYJ A;  5B6N A;  3GKK A;  3BBY A;  3EMX A;  2YJ7 A;  2WJU A;  1U87 A;  6GSW A;  2C3N A;  5DQS A;  5INY A;  2IME A;  4HOJ A;  4MF5 A;  3NZN A;  3E0U A;  4RQR A;  5D73 A;  1AIU A;  5IQY A;  3QR6 A;  4L0U A;  2VCZ A;  2QKE A;  4K1F A;  5FT3 A;  1A2M A;  2DMM A;  3FW2 A;  3ERF A;  4IQA A;  1NHO A;  5FWG A;  3TRX A;  1PGT A;  4KE3 A;  4KAE A;  2AJQ B;  2V6O A;  1TU8 A;  1NHY A;  3ZVJ D;  2O89 A;  3H93 A;  4PGT A;  3QAG A;  6GSY A;  6GST A;  5G31 A;  2PMT A;  5JCW A;  1SL0 B;  2O87 A;  4ACS A;  1UC7 A;  4AF2 A;  1K3L A;  1EGO A;  1AQV A;  2MMO A;  5GAP D;  5B7C A;  1T3B A;  1VF1 A;  1ERU A;  1ZYE A;  3UVH A;  4NHW A;  3H8Q A;  2FWG A;  1JLW A;  3GA4 A;  1GP1 A;  3A2V A;  2LRN A;  3I69 A;  3WT2 A;  1HNC A;  3EWL A;  3IAM 2;  3I9V 2;  5AIX A;  1W4V A;  4MP4 A;  3UAR A;  4KSO A;  3LJR A;  4I8B A;  2A2S A;  3L4N A;  2DIY A;  1AAZ A;  2K8V A;  2HRN A;  2YWI A;  4TR3 A;  1PN9 A;  13GS A;  2H75 A;  1Y25 A;  3SWL A;  1USB A;  2EIO A;  2L4Q A;  4IEL A;  4KGI A;  4IKH A;  5ID2 B;  4AJ8 A;  2IL3 A;  1T1V A;  3A5W A;  4OWY A;  2JZS A;  2CT6 A;  3CTF A;  3TRQ A;  1YY7 A;  5L71 A;  1WOU A;  3KH7 A;  5ECM B;  2X99 A;  4O5U A;  1OKD A;  2IMI A;  3GKN A;  1FW1 A;  1HYU A;  5G5F A;  2ON7 A;  3GL5 A;  2GSR A;  3HVX A;  4TXO A;  3M8N A;  1GSF A;  1F3A A;  1OC8 A;  2DJ1 A;  2VM2 A;  2B5Y A;  1ILO A;  1YZX A;  2R37 A;  3EIN A;  3MDK A;  5D9W A;  4DSS B;  4J56 E;  1K3O A;  1SJI A;  1OC9 B;  1YKA A;  3RHC A;  2GZZ A;  2WFC A;  4MAB A;  1GLP A;  5DDL A;  1GSD A;  2IIY A;  1Q98 A;  4ZL7 A;  5ECO B;  2JU5 A;  4GQF A;  2H0I A;  5GAN D;  4OO4 A;  3M1G A;  4CY6 A;  11GS A;  2C4J A;  4EVM A;  2YZH A;  4KSM A;  1OAZ A;  1A8L A;  1SL2 B;  1S3D A;  4TR0 A;  1GTI A;  2DC5 A;  2PVQ A;  3HDC A;  2GS3 A;  2H6X A;  2QA1 A;  4YKG A;  3GSS A;  2GQL A;  5IMA A;  2FUG 2;  1QK8 A;  1V40 A;  1XVQ A;  1FOV A;  2OBK A;  3CXG A;  3US3 A;  4JR6 A;  4O92 A;  4F03 A;  4EXJ A;  4IHU A;  4WF4 A;  5F05 A;  3WT1 A;  2CVD A;  3Q74 A;  3I43 A;  1LU4 A;  1HQO A;  1EOH A;  2DJ2 A;  4O5R A;  1THO A;  1R4W A;  4LLR A;  4BWQ A;  4POK A;  3PGT A;  4KDX A;  2E7P A;  2QC7 A;  3DWV A;  4I2U A;  4POB A;  1PA3 A;  1Z3E A;  2L5L A;  2HXK A;  4ILF A;  2DSA A;  4J57 E;  3O76 A;  3C8E A;  2H8L A;  4FO5 A;  4YAV A;  3VK9 A;  3NOF A;  2H0H A;  1X5E A;  4MH3 A;  4OFT A;  5DCH A;  3DRN A;  1A23 A;  2V6K A;  2QGV A;  5KN2 A;  3L9U A;  1K0C A;  2FHE A;  4PNG A;  5KOX A;  4IGJ A;  1XFL A;  4RI6 A;  5IMZ A;  3DYR A;  2X4A A;  4XS4 B;  4ECI A;  1ZYP A;  3CTG A;  2A2P A;  3IXR A;  2P5R A;  1ERW A;  1XWB A;  3ZFL A;  1ABA A;  1VF3 A;  2LNT A;  2AV4 A;  3GNJ A;  1V98 A;  3PPU A;  3G7J A;  5IMC A;  5CRH A;  2JAD A;  2PN8 A;  2DIZ A;  1GUM A;  5DBQ A;  3F6F A;  1G6Y A;  3M3M A;  1WPI A;  2FGX A;  3C73 A;  1G6W A;  2GQK A;  2O8V B;  4K5R A;  4TOP A;  3VPQ A;  3LWA A;  4ECJ A;  3F4S A;  1M3J A;  2VD1 A;  3KEB A;  2OBI A;  1R26 A;  3VLN A;  3D6I A;  3O6T A;  3UMA A;  5CAX A;  1V2A A;  5GST A;  1M2B A;  4BWS A;  2LUS A;  4L0W A;  1BYE A;  4V2L A;  4F9Z A;  1YJ6 A;  1X5D A;  3A3T A;  2FCH A;  3BCI A;  2CAQ A;  3M0F A;  1WP0 A;  1DUG A;  4CDO A;  3KTL A;  2WRT A;  4KW6 A;  2IFQ A;  4XCS A;  4MCU A;  3UAP A;  2REM A;  1Z7P A;  3R2Q A;  1XBS A;  4EDZ A;  4XIH A;  5KN0 A;  1GL8 A;  2H1G A;  3ZRE A;  4F0C A;  5ECH B;  1MDI A;  1MDK A;  3FZ4 A;  2FWH A;  3GN3 A;  4MZC A;  5HQP A;  1XWG A;  4IVF A;  1TW9 A;  4GQC A;  1PQN A;  1NSW A;  2KOK A;  3FKF A;  4D73 A;  1MTC A;  1TJD A;  3GIX A;  3DKS A;  2DBC A;  1O8X A;  2XHF A;  1Z6M A;  2AHE A;  3KXO A;  1MEK A;  3GKX A;  3QMX A;  4TW5 A;  6GSU A;  3EUR A;  5ECL B;  3ZVJ A;  2TRC P;  4NV2 A;  2DJK A;  5F8B A;  2FNO A;  4MZW A;  4GXZ A;  1PKW A;  3ISO A;  5H5Q A;  4L8E A;  3DML A;  4XTS A;  5IO2 A;  2MBS A;  2V1M A;  4AJ6 A;  1YEX A;  2FD3 A;  2MMA A;  5ELG A;  1BED A;  1OE7 A;  2I4A A;  1M3I A;  2H73 A;  1YEP A;  2A4V A;  3ZTL A;  2VUP A;  2M80 A;  2OE1 A;  5B8B A;  1T4Z A;  2KHP A;  3R3E A;  4OCE A;  5IPH A;  2JSZ A;  2O7K A;  2IPA A;  3DEX A;  4G0L A;  5J4U A;  2FY6 A;  4X0X A;  4V2M A;  2IFQ B;  3HZ8 A;  1V9W A;  4Z2R A;  3LYK A;  1JZR A;  3M9K A;  2F3M A;  3QAV A;  3RPN A;  2VL2 A;  4HJ2 A;  5IM9 A;  4O5Q A;  3UIW A;  1ACV A;  2VCQ A;  2VLV A;  4LMW A;  1CQG A;  2HRF A;  2VAF A;  3LXZ A;  3E9J B;  5EL8 A;  1XCC A;  3HA9 A;  3VWX A;  2P0G A;  3F4T A;  2OE3 A;  4PX1 A;  1GWC A;  1T00 A;  1Z5Y E;  2NDO A;  3HXS A;  1B8X A;  3D22 A;  1F2E A;  2HZF A;  3C1S A;  3Q19 A;  1ZCP A;  4ZIL A;  2YAN A;  3IK9 A;  4XS6 A;  3W8S A;  3MNG A;  4N11 A;  1SKW B;  4POM A;  2ES7 A;  4K0N A;  1YDK A;  2MBT A;  3APQ A;  1HD2 A;  3VI7 A;  1YKC A;  4Q5F A;  3UL3 A;  3TKP A;  1JHB A;  1ZL9 A;  1KBN A;  2OAC A;  3ERG A;  2FLS A;  4POL A;  2DKI A;  2XPE A;  3FR9 A;  2ALB A;  4WKW A;  5D8I A;  5DJM A;  2YCD A;  2HZE A;  3FRC A;  2X8H A;  1S3R A;  4KUN A;  2C0E A;  4Q5N A;  4IJ3 A;  1TTZ A;  4GST A;  1BJX A;  4KA0 A;  3ZMK A;  2VOC A;  3OR5 A;  3EU4 A;  5E4W A;  2RII A;  4FIW A;  4EKZ A;  3F3Q A;  3HVS A;  1GTU A;  1WMJ A;  2NBS A;  3ZLP A;  3BJ5 A;  1T4Y A;  1S3A A;  4KDY A;  4Z7X A;  4BL7 A;  4K5S A;  4G0I A;  1NW2 A;  3TDG A;  2QA2 A;  2H66 A;  2X8G A;  2CQ9 A;  1XW5 A;  4K6X A;  1THX A;  3EVI A;  3FZ9 A;  3TKS A;  1N8J A;  4K8M A;  1RQM A;  1K0B A;  5IMV A;  4TXV A;  5KN1 A;  4X1U A;  4G0K A;  1TP9 A;  2YN1 A;  5IMD A;  5ABR A;  4ZBA A;  2I81 A;  2QSI A;  3ME8 A;  5D9T A;  4CY8 A;  4ICY A;  1SK2 A;  3MWH A;  3ZIV A;  3IE3 A;  4GCI A;  2L6C A;  5ENU A;  4MH2 A;  1PRX A;  4EF0 A;  2PGT A;  4J2F A;  4CHS A;  2IMF A;  2L57 A;  1I5G A;  1GH2 A;  4KX4 A;  3UVT A;  3TB2 A;  4DEJ A;  3RHB A;  20GS A;  5DAK A;  1HNA A;  2KLX A;  5J41 A;  3IAS 2;  1BX9 A;  1SD9 A;  3N5O A;  3JCM L;  2BTO T;  4EL1 A;  2DML A;  2LV3 A;  3L0H A;  3QD9 A;  1M9A A;  1N2A A;  2FA8 A;  2RLI A;  4NHZ A;  1B9Y C;  2R0G A;  2HYX A;  5HFI A;  1ML6 A;  2J23 A;  1MDJ A;  2HT9 A;  2FWE A;  1M0U A;  2YWO A;  3VWW A;  2HSM A;  1X9S B;  4GSN A;  1HNB A;  4HI7 A;  4EC0 A;  2CVB A;  1EEM A;  2YWN A;  5D9V A;  4NAX A;  1GSQ A;  7GSS A;  3LOR A;  2JZT A;  3TUE A;  1TOF A;  3GHA A;  2L6D A;  3LYP A;  3L9S A;  3KTB A;  4TKY A;  3GUR A;  1T8E B;  3TJG A;  4IJI A;  3V1W A;  4NXI A;  4ZL9 A;  1YQ1 A;  5J3R A;  1AW9 A;  1QQ2 A;  4OO5 A;  3LG6 A;  4ML6 A;  4JED A;  5CRW A;  3KMN A;  2TIR A;  1G7O A;  1IYI A;  1SK1 A;  1X0R A;  2VCX A;  3UBK A;  1Q4J A;  2M72 A;  1SKR B;  5HR3 A;  2LS5 A;  2VL2 C;  2L4C A;  2WS2 A;  3KMO A;  3IC8 A;  1WIK A;  4YKF A;  2OAD A;  2C80 A;  2VM1 A;  3MAK A;  2RUF A;  1KEB A;  4LL1 B;  1K0M A;  5JCG A;  1A8Y A;  2B7K A;  1EV9 A;  2IJY A;  2WZ9 A;  4I97 A;  1X5C A;  3IOS A;  4MLY A;  5DAK B;  3G9B A;  3G7I A;  3HD5 A;  4ML1 A;  2AYT A;  4BIK A;  5DQY A;  1IYH A;  2R0C A;  1ZOF A;  4ECB A;  2PBJ A;  4FYU A;  1SK0 A;  1LJR A;  2DJ3 A;  3FZA A;  2H1A A;  2YV9 A;  2XBQ A;  3VUR A;  3L78 A;  2HSH A;  2NPB A;  1WJK A;  2MZC A;  5A4U A;  2EIQ A;  5CNW A;  2PUK C;  4PQI A;  3TOT A;  3TKS E;  2H01 A;  1K0O A;  1PX6 A;  3QFB C;  4ZB6 A;  3EPT A;  1VGL A;  3APS A;  1K0D A;  2H76 A;  1XOB A;  4CW9 A;  4IP6 A;  4RUV A;  5EVO A;  1GSY A;  2H72 A;  4K7I A;  1XVW A;  4AJ7 A;  4OMV A;  3F0I A;  5D96 A;  5J5N A;  4HU7 A;  3FHK A;  1JZW A;  3GYK A;  3QCP A;  1A2J A;  2D2Z A;  4JBB A;  4E8H A;  2NVL A;  1MD4 A;  6GSX A;  1SEN A;  4G9H A;  4TXO B;  3C71 A;  1Z9H A;  1GTA A;  5ECK B;  1UN2 A;  1QGV A;  4GWR A;  3IBH A;  5J9C A;  2GT6 A;  3U6V A;  4MDC A;  3GUS A;  1PL1 A;  2HI7 A;  4WEY A;  4HDE A;  5ECR B;  1KNG A;  4USS A;  2PPT A;  5ECS A;  3KIJ A;  2R4V A;  2VLU A;  1X9M B;  4G2E A;  2LRT A;  1B9X C;  2L59 A;  1GUL A;  3HVV A;  3Q18 A;  3F9U A;  4AGS A;  1A2L A;  2HSY A;  2VLT A;  1F6M C;  1TK0 B;  2H1B A;  3LEF A;  2WDU A;  2XBI A;  4WR4 A;  3TKS C;  4HQS A;  1A0R P;  2H1D A;  1FOH A;  3EMP A;  3HCZ A;  2P31 A;  1DSB A;  2JL4 A;  5EY6 A;  5GSS A;  2GSQ A;  4BA7 A;  1JLV A;  4EIQ A;  2LJR A;  4TR4 A;  3D4M A;  1K3Y A;  3FYG A;  3CRU A;  4N0V A;  3P7X A;  3EU3 A;  5E59 A;  1PMT A;  4YH2 A;  1JZO A;  2MYG A;  3C7M A;  3IV4 A;  3VPT A;  3TJJ A;  2R2J A;  3F63 A;  3UBL A;  4EIP A;  3KP8 A;  1BAY A;  3Q6O A;  2X49 A;  4TR1 A;  4MJE A;  4G19 A;  1BG5 A;  2XPD A;  1SU9 A;  5COH A;  3HZ4 A;  19GS A;  1GRX A;  1U3I A;  2C0F A;  2HE3 A;  3GFK A;  4V2N A;  4PUF C;  1O6J A;  4KCE A;  2CX4 A;  3HJM A;  1YF1 A;  1TRS A;  4DSR A;  3KH9 A;  2IN3 A;  1TK8 B;  4ZBB A;  4HJM A;  1EEJ A;  4ULX A;  2K6V A;  3A2X A;  1XOA A;  2R5G A;  2VL9 A;  1MD3 A;  2C3T A;  4KND A;  2WCI A;  3DGQ A;  2GGT A;  1VF2 A;  2JAC A;  2X8C A;  3ZL5 A;  2VCT A;  3DVX A;  1PFO A;  2O85 A;  4K2D A;  5G5E A;  1AC1 A;  4MPG A;  3H79 A;  3TKR A;  3GRX A;  4LA1 A;  4GF0 A;  1G0T A;  2F8F A;  1PX7 A;  3EC3 A;  4I5Q A;  1OC3 A;  2VD0 A;  4FQU A;  3PIN A;  2HLS A;  1RW1 A;  1TI1 A;  2C0G A;  4ID0 A;  2HNL A;  3I6A A;  2E0Q A;  2V41 A;  2HFD A;  1I9D A;  2GST A;  2C1Y A;  2YZU A;  3HJP A;  1GUK A;  2VIM A;  3KJY A;  2F8A A;  1SL1 B;  4I2T A;  4KCA A;  1ERV A;  5DAL A;  1R7H A;  5AIV A;  2K8S A;  4PQ1 A;  2CV4 A;  2G2Q A;  4EUY A;  3L9V A;  1AXD A;  1H75 A;  1GSE A;  3WYW A;  2AAW A;  1EGR A;  1TRU A;  1O8W A;  1F37 A;  2N5A A;  3KM6 A;  3ZFB A;  2RM6 A;  3TJK A;  2V32 A;  6GSS A;  1G7E A;  3ZIT A;  4PUA A;  4YQU A;  3ZZX A;  2R0P A;  3WGE A;  2L5O A;  1EZK A;  3HYP A;  2IMK A;  4TRX A;  3HJO A;  4HUA A;  1R5A A;  4D73 B;  3GH9 A;  4IP1 A;  3BD2 A;  5IOW A;  1PN0 A;  4FYC A;  4ZBD A;  4BVX A;  5DCG A;  4IBP A;  4G10 A;  5IMF A;  3RAZ A;  3J7Y k;  5HR0 A;  2CX3 A;  5HR2 A;  4O7H A;  5H5R A;  4OD7 A;  3PR8 A;  1UVZ A;  4K7N A;  1PSQ A;  4NV5 A;  2K18 A;  3HY2 A;  1FB0 A;  1OE8 A;  1W89 A;  1J9B A;  1TRW A;  3CSI A;  4ZB8 A;  2H30 A;  2I9H A;  2CA8 A;  4V1A p;  2GT5 A;  2FA4 A;  4QL9 A;  5KEJ A;  5LCZ A;  2OE0 A;  1M9B A;  2X64 A;  1GSS A;  3DXB A;  2EC4 A;  1DE2 A;  3ZYW A;  3U5R E;  2BMX A;  1KTE A;  1QUW A;  3CSJ A;  1TXX A;  3TRP A;  3J7Y b;  1FHE A;  2H0G A;  3KCM A;  1TKD B;  5HR1 A;  4ECC A;  1SYR A;  4HS1 A;  3WGD A;  1ERT A;  6GSV A;  2E2G A;  4MJB A;  1TK5 B;  2ZCT A;  3SBC A;  1BQ7 A;  2EIR A;  4DSQ A;  4WBJ A;  2YV7 A;  2K9F A;  1AUC A;  1FG4 A;  4HZ4 A;  1Y6E A;  1FVJ A;  3W6G A;  4BVX B;  1SYX A;  5ID2 A;  5F06 A;  4IW9 A;  5LD0 A;  3QOU A;  2LNS A;  1URM A;  4TN8 A;  2N5F A;  4MZB A;  2JZR A;  3HVN A;  4PUR A;  4F2I A;  2H6Y A;  1YF0 A;  5IOX A;  2YWM A;  3A2W A;  3MSZ A;  4YQM A;  3VWV A;  1QXH A;  4GLT A;  4MMM A;  2OA7 A;  1XW6 A;  3GKM A;  1XXU A;  4KH7 A;  2A4H A;  2YNX A;  2HZE B;  5G1L A;  5HFG A;  4DSS A;  2OJL A;  4ZIJ A;  4X43 A;  3QAW A;  4I6X A;  2LJA A;  1OC9 A;  3LGC A;  1S3C A;  1OKT A;  1F3B A;  4GTU A;  10GS A;  1A0F A;  2YJH A;  3H4K A;  4IS0 A;  1TDI A;  3KZQ A;  2M46 A;  4TVE A;  3CQF A;  3N9J A;  4HU9 A;  2BJX A;  1E6B A;  3GL3 A;  1U6T A;  3IHG A;  3M9J A;  4KB3 A;  5A5K A;  1QFN A;  4BL7 B;  2KUC A;  5CO3 A;  5CRE A;  2I3Y A;  3C1R A;  2GDR A;  3IA1 A;  4FH8 A;  5AGY A;  4MF6 A;  4BVY A;  2B6M A;  3LSZ A;  2YPM A;  2H71 A;  2PER A;  3QFA C;  4XHM A;  4QQ7 A;  3ME7 A;  18GS A;  4WET A;  1JFU A;  3F3R A;  1V57 A;  1ST9 A;  5JCU A;  2I1U A;  3MYD A;  4K9Z A;  1UA5 A;  2LJK A;  2AUV A;  4OCF A;  1ZGN A;  2DKH A;  3KGK A;  5D9X A;  3F8U A;  3TOU A;  3CSH A;  3G7Y A;  4HEA 2;  3W8J A;  3UOM A;  4ZB9 A;  3IR4 A;  4WBR D;  4Z2U A;  4PNF A;  2F51 A;  1M2D A;  3FMW A;  4XS4 A;  1XPV A;  2KP2 A;  1FAA A;  2H19 A;  1M99 A;  2DJJ A;  3IK7 A;  3IRA A;  1EV4 A;  1ZZY A;  5FHI A;  2PWJ A;  4Q5R A;  5CRD A;  1PL2 A;  3TGZ A;  2H70 A;  3FR6 A;  1C72 A;  2P5Q A;  4EO3 A;  2C0D A;  4XRD A;  3DD3 A;  22GS A;  2CVK A;  2GVP A;  1WWJ A;  1EP7 A;  3FR3 A;  3LFL A;  4JRR A;  3ZRD A;  2UZ8 A;  3BCK A;  3S9F A;  2VL3 A;  4BVY B;  3F6D A;  4Z2T A;  3P90 A;  2IWT A;  1ZMA A;  2RUE A;  4GSS A;  4NPB A;  3GX8 A;  2Z9S A;  8GSS A;  2LQQ A;  3QPM A;  4EDY A;  1ZYN A;  3DVW A;  1GLQ A;  5KN3 A;  3NIV A;  1B48 A;  4HSC X;  2CAI A;  1GSU A;  1TU7 A;  1XW9 A;  1NM3 A;  3HHV A;  3ERW A;  4IN0 A;  2LRC A;  2YOI A;  5DJL A;  5IO0 A;  4N0Z A;  1DE1 A;  4KDU A;  4MPF A;  3H1N A;  3K8N A;  3AY8 A;  2WB9 A;  1Z7R A;  4PXO A;  5ECI B;  5AN1 A;  1XIY A;  3LW9 A;  2TRX A;  1DBY A;  2B1L A;  1FO5 A;  2VCV A;  2RM5 A;  2CZ3 A;  3CMI A;  1XZO A;  3P8W A;  1QMV A;  5GZZ B;  3VWU A;  4MF7 A;  3IDV A;  2C3Q A;  2B5E A;  4Q5Q A;  1M2A A;  1H4O A;  3GTU A;  2PVO C;  5G30 A;  2GZP A;  5G1K A; 
#chains in the Genus database with same CATH homology
 2LST A;  2B1K A;  3KD0 A;  4MNN A;  5JWO B;  3VFI A;  2GLR A;  2F9S A;  2A2R A;  2R3X A;  4RI7 A;  2OKA A;  2J9H A;  1VF4 A;  2B5X A;  4HZ2 A;  4YAP A;  1FVK A;  5G2Z A;  5F0G A;  4A5P A;  3F4R A;  5IIZ A;  4WXT A;  1XWC A;  2IMD A;  4E8E A;  4OFM A;  1J0F A;  1B4P A;  2C8U A;  3BOA A;  2G0F A;  5JWQ B;  4MK3 A;  3ZIJ A;  4FYB A;  4LMV A;  3TKQ A;  3TJF A;  3KP9 A;  2GSS A;  1E2Y A;  4WR5 A;  1B4Q A;  3ED3 A;  1R5P A;  4PQH A;  4K7O A;  17GS A;  1JZD A;  4F82 A;  2WGR A;  1SKS B;  3QDN A;  3VI5 A;  3D4T A;  2KP1 A;  1WRY A;  1GTB A;  2HRK A;  2MMZ A;  4GRF A;  2ZUP A;  4L5L A;  4V1A g;  2XC2 A;  1AQX A;  1GUH A;  3IHQ A;  4K0G A;  1Z6N A;  1PKZ A;  2B3S A;  12GS A;  1O7U A;  5JWR B;  1U3A A;  2LKU A;  3D0Z A;  4DVC A;  4IQ1 A;  3LXT A;  1RK4 A;  1V58 A;  2H74 A;  1J08 A;  2JSY A;  2DJ0 A;  3GTU B;  4K2X A;  1F9M A;  2AB6 A;  1X9W B;  4N30 A;  3RDW A;  2YP6 A;  1LBK A;  3DIE A;  4ZL8 A;  1O85 A;  3RPP A;  3EYT A;  1PD2 1;  4LL4 B;  2R6K A;  2LTK A;  2HRA A;  4JR4 A;  5HFK A;  3WD6 A;  2GQM A;  5C00 A;  5CRG A;  4BPY A;  3APO A;  4RQX A;  5BRT A;  4ISD A;  4TR1 B;  3HKR A;  1A24 A;  1O81 A;  1O73 A;  3GMF A;  3IC4 A;  4XRA A;  1XWK A;  3CYN A;  3GV1 A;  4HQZ A;  5ECN B;  1SJZ A;  1EP8 A;  5ELA A;  2V2G A;  5D93 A;  1EWX A;  4P3Y B;  2NTO A;  4MJA A;  4KF9 A;  16GS A;  1SJ6 A;  1VRS D;  1T7P B;  1SD8 A;  5J9B A;  2E2M A;  1FB6 A;  3TCO A;  3LQ7 A;  1K0A A;  2DLX A;  4X4J A;  3D5J A;  2PU9 C;  2N5B A;  1XWA A;  4ZXG A;  1ZYQ B;  3RBT A;  3FZ5 A;  2GTU A;  5CYY A;  2MMN A;  1ON4 A;  2ZNM A;  3FY7 A;  3O3T A;  5DVB A;  2H6Z A;  1TRV A;  4NMU A;  5A4V A;  5A4W A;  2VCW A;  4XS1 A;  2VO4 A;  3TJB A;  1CQH A;  1M7T A;  3IPZ A;  3UEM A;  5B6M A;  1WE0 A;  4MA9 A;  2GZY A;  4OFN A;  5ECP B;  3FEU A;  3GX0 A;  1U88 A;  3GH6 A;  4NWY A;  3P2A A;  2CZ2 A;  5BMU A;  4QL7 A;  5F07 A;  3MIX A;  9GSS A;  14GS A;  5KOW A;  4JU5 A;  4YQV A;  4O32 A;  3ZML A;  2ON5 A;  4PTS A;  1EOG A;  3CBU A;  5DAL B;  2WUL A;  5B8A A;  4L5O A;  5IPG A;  4H86 A;  3WGX A;  4MJC A;  4WF5 A;  2FWF A;  3D21 A;  1K0N A;  1OVN A;  4EE0 A;  1GNW A;  1AQW A;  3UJ1 A;  5H5S A;  5LNK e;  2B7J A;  3A5I A;  3EE2 A;  3GST A;  4F0B A;  1GNE A;  5C04 A;  4JZQ A;  3CRT A;  5AIS A;  5ECQ B;  5EPF A;  3E3E A;  5CP1 A;  3FK8 A;  1TI3 A;  4JE1 A;  3PH9 A;  4N10 A;  2LQO A;  2LEG A;  1OYJ A;  5B6N A;  3GKK A;  3BBY A;  3EMX A;  2YJ7 A;  2WJU A;  1U87 A;  6GSW A;  2C3N A;  5DQS A;  5INY A;  2IME A;  4HOJ A;  4MF5 A;  3NZN A;  3E0U A;  4RQR A;  5D73 A;  1AIU A;  5IQY A;  3QR6 A;  4L0U A;  2VCZ A;  2QKE A;  4K1F A;  5FT3 A;  1A2M A;  2DMM A;  3FW2 A;  3ERF A;  4IQA A;  1NHO A;  5FWG A;  3TRX A;  1PGT A;  4KE3 A;  4KAE A;  2AJQ B;  2V6O A;  1TU8 A;  1NHY A;  3ZVJ D;  2O89 A;  3H93 A;  4PGT A;  3QAG A;  6GSY A;  6GST A;  5G31 A;  2PMT A;  5JCW A;  1SL0 B;  2O87 A;  4ACS A;  1UC7 A;  4AF2 A;  1K3L A;  1EGO A;  1AQV A;  2MMO A;  5GAP D;  5B7C A;  1T3B A;  1VF1 A;  1ERU A;  1ZYE A;  3UVH A;  4NHW A;  3H8Q A;  2FWG A;  1JLW A;  3GA4 A;  1GP1 A;  3A2V A;  2LRN A;  3I69 A;  3WT2 A;  1HNC A;  3EWL A;  3IAM 2;  3I9V 2;  5AIX A;  1W4V A;  4MP4 A;  3UAR A;  4KSO A;  3LJR A;  4I8B A;  2A2S A;  3L4N A;  2DIY A;  1AAZ A;  2K8V A;  2HRN A;  2YWI A;  4TR3 A;  1PN9 A;  13GS A;  2H75 A;  1Y25 A;  3SWL A;  1USB A;  2EIO A;  2L4Q A;  4IEL A;  4KGI A;  4IKH A;  5ID2 B;  4AJ8 A;  2IL3 A;  1T1V A;  3A5W A;  4OWY A;  2JZS A;  2CT6 A;  3CTF A;  3TRQ A;  1YY7 A;  5L71 A;  1WOU A;  3KH7 A;  5ECM B;  2X99 A;  4O5U A;  1OKD A;  2IMI A;  3GKN A;  1FW1 A;  1HYU A;  5G5F A;  2ON7 A;  3GL5 A;  2GSR A;  3HVX A;  4TXO A;  3M8N A;  1GSF A;  1F3A A;  1OC8 A;  2DJ1 A;  2VM2 A;  2B5Y A;  1ILO A;  1YZX A;  2R37 A;  3EIN A;  3MDK A;  5D9W A;  4DSS B;  4J56 E;  1K3O A;  1SJI A;  1OC9 B;  1YKA A;  3RHC A;  2GZZ A;  2WFC A;  4MAB A;  1GLP A;  5DDL A;  1GSD A;  2IIY A;  1Q98 A;  4ZL7 A;  5ECO B;  2JU5 A;  4GQF A;  2H0I A;  5GAN D;  4OO4 A;  3M1G A;  4CY6 A;  11GS A;  2C4J A;  4EVM A;  2YZH A;  4KSM A;  1OAZ A;  1A8L A;  1SL2 B;  1S3D A;  4TR0 A;  1GTI A;  2DC5 A;  2PVQ A;  3HDC A;  2GS3 A;  2H6X A;  2QA1 A;  4YKG A;  3GSS A;  2GQL A;  5IMA A;  2FUG 2;  1QK8 A;  1V40 A;  1XVQ A;  1FOV A;  2OBK A;  3CXG A;  3US3 A;  4JR6 A;  4O92 A;  4F03 A;  4EXJ A;  4IHU A;  4WF4 A;  5F05 A;  3WT1 A;  2CVD A;  3Q74 A;  3I43 A;  1LU4 A;  1HQO A;  1EOH A;  2DJ2 A;  4O5R A;  1THO A;  1R4W A;  4LLR A;  4BWQ A;  4POK A;  3PGT A;  4KDX A;  2E7P A;  2QC7 A;  3DWV A;  4I2U A;  4POB A;  1PA3 A;  1Z3E A;  2L5L A;  2HXK A;  4ILF A;  2DSA A;  4J57 E;  3O76 A;  3C8E A;  2H8L A;  4FO5 A;  4YAV A;  3VK9 A;  3NOF A;  2H0H A;  1X5E A;  4MH3 A;  4OFT A;  5DCH A;  3DRN A;  1A23 A;  2V6K A;  2QGV A;  5KN2 A;  3L9U A;  1K0C A;  2FHE A;  4PNG A;  5KOX A;  4IGJ A;  1XFL A;  4RI6 A;  5IMZ A;  3DYR A;  2X4A A;  4XS4 B;  4ECI A;  1ZYP A;  3CTG A;  2A2P A;  3IXR A;  2P5R A;  1ERW A;  1XWB A;  3ZFL A;  1ABA A;  1VF3 A;  2LNT A;  2AV4 A;  3GNJ A;  1V98 A;  3PPU A;  3G7J A;  5IMC A;  5CRH A;  2JAD A;  2PN8 A;  2DIZ A;  1GUM A;  5DBQ A;  3F6F A;  1G6Y A;  3M3M A;  1WPI A;  2FGX A;  3C73 A;  1G6W A;  2GQK A;  2O8V B;  4K5R A;  4TOP A;  3VPQ A;  3LWA A;  4ECJ A;  3F4S A;  2VD1 A;  3KEB A;  2OBI A;  1R26 A;  3VLN A;  3D6I A;  3O6T A;  3UMA A;  5CAX A;  1V2A A;  5GST A;  1M2B A;  4BWS A;  2LUS A;  4L0W A;  1BYE A;  4V2L A;  4F9Z A;  1YJ6 A;  1X5D A;  3A3T A;  2FCH A;  3BCI A;  2CAQ A;  3M0F A;  1WP0 A;  1DUG A;  4CDO A;  3KTL A;  2WRT A;  4KW6 A;  2IFQ A;  4XCS A;  4MCU A;  3UAP A;  2REM A;  1Z7P A;  3R2Q A;  1XBS A;  4EDZ A;  4XIH A;  5KN0 A;  1GL8 A;  2H1G A;  3ZRE A;  4F0C A;  5ECH B;  1MDI A;  1MDK A;  3FZ4 A;  2FWH A;  3GN3 A;  4MZC A;  5HQP A;  1XWG A;  4IVF A;  1TW9 A;  4GQC A;  1PQN A;  1NSW A;  2KOK A;  3FKF A;  4D73 A;  1MTC A;  1TJD A;  3GIX A;  3DKS A;  2DBC A;  1O8X A;  2XHF A;  1Z6M A;  2AHE A;  3KXO A;  1MEK A;  3GKX A;  3QMX A;  4TW5 A;  6GSU A;  3EUR A;  5ECL B;  3ZVJ A;  2TRC P;  4NV2 A;  2DJK A;  5F8B A;  2FNO A;  4MZW A;  4GXZ A;  1PKW A;  3ISO A;  5H5Q A;  4L8E A;  3DML A;  4XTS A;  5IO2 A;  2MBS A;  2V1M A;  4AJ6 A;  1YEX A;  2FD3 A;  2MMA A;  5ELG A;  1BED A;  1OE7 A;  2I4A A;  2H73 A;  1YEP A;  2A4V A;  3ZTL A;  2VUP A;  2M80 A;  2OE1 A;  5B8B A;  1T4Z A;  2KHP A;  3R3E A;  4OCE A;  5IPH A;  2JSZ A;  2O7K A;  2IPA A;  3DEX A;  4G0L A;  5J4U A;  2FY6 A;  4X0X A;  4V2M A;  2IFQ B;  3HZ8 A;  1V9W A;  4Z2R A;  3LYK A;  1JZR A;  3M9K A;  2F3M A;  3QAV A;  3RPN A;  2VL2 A;  4HJ2 A;  5IM9 A;  4O5Q A;  3UIW A;  1ACV A;  2VCQ A;  2VLV A;  4LMW A;  1CQG A;  2HRF A;  2VAF A;  3LXZ A;  3E9J B;  5EL8 A;  1XCC A;  3HA9 A;  3VWX A;  2P0G A;  3F4T A;  2OE3 A;  4PX1 A;  1GWC A;  1T00 A;  1Z5Y E;  2NDO A;  3HXS A;  1B8X A;  3D22 A;  1F2E A;  2HZF A;  3C1S A;  3Q19 A;  1ZCP A;  4ZIL A;  2YAN A;  3IK9 A;  4XS6 A;  3W8S A;  3MNG A;  4N11 A;  1SKW B;  4POM A;  2ES7 A;  4K0N A;  1YDK A;  2MBT A;  3APQ A;  1HD2 A;  3VI7 A;  1YKC A;  4Q5F A;  3UL3 A;  3TKP A;  1JHB A;  1ZL9 A;  1KBN A;  2OAC A;  3ERG A;  2FLS A;  4POL A;  2DKI A;  2XPE A;  3FR9 A;  2ALB A;  4WKW A;  5D8I A;  5DJM A;  2YCD A;  2HZE A;  3FRC A;  2X8H A;  4KUN A;  2C0E A;  4Q5N A;  4IJ3 A;  1TTZ A;  4GST A;  1BJX A;  4KA0 A;  3ZMK A;  2VOC A;  3OR5 A;  3EU4 A;  5E4W A;  2RII A;  4FIW A;  4EKZ A;  3F3Q A;  3HVS A;  1GTU A;  1WMJ A;  2NBS A;  3ZLP A;  3BJ5 A;  1T4Y A;  1S3A A;  4KDY A;  4Z7X A;  4BL7 A;  4K5S A;  4G0I A;  1NW2 A;  3TDG A;  2QA2 A;  2H66 A;  2X8G A;  2CQ9 A;  1XW5 A;  4K6X A;  1THX A;  3EVI A;  3FZ9 A;  3TKS A;  1N8J A;  4K8M A;  1RQM A;  1K0B A;  5IMV A;  4TXV A;  5KN1 A;  4X1U A;  4G0K A;  1TP9 A;  2YN1 A;  5IMD A;  5ABR A;  4ZBA A;  2I81 A;  2QSI A;  3ME8 A;  5D9T A;  4CY8 A;  4ICY A;  1SK2 A;  3MWH A;  3ZIV A;  3IE3 A;  4GCI A;  2L6C A;  5ENU A;  4MH2 A;  1PRX A;  4EF0 A;  2PGT A;  4J2F A;  4CHS A;  2IMF A;  2L57 A;  1I5G A;  1GH2 A;  4KX4 A;  3UVT A;  3TB2 A;  4DEJ A;  3RHB A;  20GS A;  5DAK A;  1HNA A;  2KLX A;  5J41 A;  3IAS 2;  1BX9 A;  1SD9 A;  3N5O A;  3JCM L;  2BTO T;  4EL1 A;  2DML A;  2LV3 A;  3L0H A;  3QD9 A;  1M9A A;  1N2A A;  2FA8 A;  2RLI A;  4NHZ A;  1B9Y C;  2R0G A;  2HYX A;  5HFI A;  1ML6 A;  2J23 A;  1MDJ A;  2HT9 A;  2FWE A;  1M0U A;  2YWO A;  3VWW A;  2HSM A;  1X9S B;  4GSN A;  1HNB A;  4HI7 A;  4EC0 A;  2CVB A;  1EEM A;  2YWN A;  5D9V A;  4NAX A;  1GSQ A;  7GSS A;  3LOR A;  2JZT A;  3TUE A;  1TOF A;  3GHA A;  2L6D A;  3LYP A;  3L9S A;  3KTB A;  4TKY A;  3GUR A;  1T8E B;  3TJG A;  4IJI A;  3V1W A;  4NXI A;  4ZL9 A;  1YQ1 A;  5J3R A;  1AW9 A;  1QQ2 A;  4OO5 A;  3LG6 A;  4ML6 A;  4JED A;  5CRW A;  3KMN A;  2TIR A;  1G7O A;  1IYI A;  1SK1 A;  1X0R A;  2VCX A;  3UBK A;  1Q4J A;  2M72 A;  1SKR B;  5HR3 A;  2LS5 A;  2VL2 C;  2L4C A;  2WS2 A;  3KMO A;  3IC8 A;  1WIK A;  4YKF A;  2OAD A;  2C80 A;  2VM1 A;  3MAK A;  2RUF A;  1KEB A;  4LL1 B;  1K0M A;  5JCG A;  1A8Y A;  2B7K A;  1EV9 A;  2IJY A;  2WZ9 A;  4I97 A;  1X5C A;  3IOS A;  4MLY A;  5DAK B;  3G9B A;  3G7I A;  3HD5 A;  4ML1 A;  2AYT A;  5DQY A;  1IYH A;  2R0C A;  1ZOF A;  4ECB A;  2PBJ A;  4FYU A;  1SK0 A;  1LJR A;  2DJ3 A;  3FZA A;  2H1A A;  2YV9 A;  2XBQ A;  3VUR A;  3L78 A;  2HSH A;  2NPB A;  1WJK A;  2MZC A;  5A4U A;  2EIQ A;  5CNW A;  2PUK C;  4PQI A;  3TOT A;  3TKS E;  2H01 A;  1K0O A;  1PX6 A;  3QFB C;  4ZB6 A;  3EPT A;  1VGL A;  3APS A;  1K0D A;  2H76 A;  1XOB A;  4CW9 A;  4IP6 A;  4RUV A;  5EVO A;  1GSY A;  2H72 A;  4K7I A;  1XVW A;  4AJ7 A;  4OMV A;  3F0I A;  5D96 A;  5J5N A;  4HU7 A;  3FHK A;  1JZW A;  3GYK A;  3QCP A;  1A2J A;  2D2Z A;  4JBB A;  4E8H A;  2NVL A;  1MD4 A;  6GSX A;  1SEN A;  4G9H A;  4TXO B;  3C71 A;  1Z9H A;  1GTA A;  5ECK B;  1UN2 A;  1QGV A;  4GWR A;  3IBH A;  5J9C A;  2GT6 A;  3U6V A;  4MDC A;  3GUS A;  1PL1 A;  2HI7 A;  4WEY A;  4HDE A;  5ECR B;  1KNG A;  4USS A;  2PPT A;  5ECS A;  3KIJ A;  2R4V A;  2VLU A;  1X9M B;  4G2E A;  2LRT A;  1B9X C;  2L59 A;  1GUL A;  3HVV A;  3Q18 A;  3F9U A;  4AGS A;  1A2L A;  2HSY A;  2VLT A;  1F6M C;  1TK0 B;  2H1B A;  3LEF A;  2WDU A;  2XBI A;  4WR4 A;  3TKS C;  4HQS A;  1A0R P;  2H1D A;  1FOH A;  3EMP A;  3HCZ A;  2P31 A;  1DSB A;  2JL4 A;  5EY6 A;  5GSS A;  2GSQ A;  4BA7 A;  1JLV A;  4EIQ A;  2LJR A;  4TR4 A;  3D4M A;  1K3Y A;  3FYG A;  3CRU A;  4N0V A;  3P7X A;  3EU3 A;  5E59 A;  1PMT A;  4YH2 A;  1JZO A;  2MYG A;  3C7M A;  3IV4 A;  3VPT A;  3TJJ A;  2R2J A;  3F63 A;  3UBL A;  4EIP A;  3KP8 A;  1BAY A;  3Q6O A;  2X49 A;  4TR1 A;  4MJE A;  4G19 A;  1BG5 A;  2XPD A;  1SU9 A;  5COH A;  3HZ4 A;  19GS A;  1GRX A;  1U3I A;  2C0F A;  2HE3 A;  3GFK A;  4V2N A;  4PUF C;  1O6J A;  4KCE A;  2CX4 A;  3HJM A;  1YF1 A;  1TRS A;  4DSR A;  3KH9 A;  2IN3 A;  1TK8 B;  4ZBB A;  4HJM A;  1EEJ A;  4ULX A;  2K6V A;  3A2X A;  1XOA A;  2R5G A;  2VL9 A;  1MD3 A;  2C3T A;  4KND A;  2WCI A;  3DGQ A;  2GGT A;  1VF2 A;  2JAC A;  2X8C A;  3ZL5 A;  2VCT A;  3DVX A;  2O85 A;  4K2D A;  5G5E A;  1AC1 A;  4MPG A;  3H79 A;  3TKR A;  3GRX A;  4LA1 A;  4GF0 A;  1G0T A;  2F8F A;  1PX7 A;  3EC3 A;  4I5Q A;  1OC3 A;  2VD0 A;  4FQU A;  3PIN A;  2HLS A;  1RW1 A;  1TI1 A;  2C0G A;  4ID0 A;  2HNL A;  3I6A A;  2E0Q A;  2V41 A;  2HFD A;  1I9D A;  2GST A;  2C1Y A;  2YZU A;  3HJP A;  1GUK A;  2VIM A;  3KJY A;  2F8A A;  1SL1 B;  4I2T A;  4KCA A;  1ERV A;  5DAL A;  1R7H A;  5AIV A;  2K8S A;  4PQ1 A;  2CV4 A;  2G2Q A;  4EUY A;  3L9V A;  1AXD A;  1H75 A;  1GSE A;  3WYW A;  2AAW A;  1EGR A;  1TRU A;  1O8W A;  1F37 A;  2N5A A;  3KM6 A;  3ZFB A;  2RM6 A;  3TJK A;  2V32 A;  6GSS A;  1G7E A;  3ZIT A;  4PUA A;  4YQU A;  3ZZX A;  2R0P A;  3WGE A;  2L5O A;  1EZK A;  3HYP A;  2IMK A;  4TRX A;  3HJO A;  4HUA A;  1R5A A;  4D73 B;  3GH9 A;  4IP1 A;  3BD2 A;  5IOW A;  1PN0 A;  4FYC A;  4ZBD A;  4BVX A;  5DCG A;  4IBP A;  4G10 A;  5IMF A;  3RAZ A;  3J7Y k;  5HR0 A;  2CX3 A;  5HR2 A;  4O7H A;  5H5R A;  4OD7 A;  3PR8 A;  1UVZ A;  4K7N A;  1PSQ A;  4NV5 A;  2K18 A;  3HY2 A;  1FB0 A;  1OE8 A;  1W89 A;  1J9B A;  1TRW A;  3CSI A;  4ZB8 A;  2H30 A;  2I9H A;  2CA8 A;  4V1A p;  2GT5 A;  2FA4 A;  4QL9 A;  5KEJ A;  5LCZ A;  2OE0 A;  1M9B A;  2X64 A;  1GSS A;  3DXB A;  2EC4 A;  1DE2 A;  3ZYW A;  3U5R E;  2BMX A;  1KTE A;  1QUW A;  3CSJ A;  1TXX A;  3TRP A;  3J7Y b;  1FHE A;  2H0G A;  3KCM A;  1TKD B;  5HR1 A;  4ECC A;  1SYR A;  4HS1 A;  3WGD A;  1ERT A;  6GSV A;  2E2G A;  4MJB A;  1TK5 B;  2ZCT A;  3SBC A;  1BQ7 A;  2EIR A;  4DSQ A;  4WBJ A;  2YV7 A;  2K9F A;  1AUC A;  1FG4 A;  4HZ4 A;  1Y6E A;  1FVJ A;  3W6G A;  4BVX B;  1SYX A;  5ID2 A;  5F06 A;  4IW9 A;  5LD0 A;  3QOU A;  2LNS A;  1URM A;  4TN8 A;  2N5F A;  4MZB A;  2JZR A;  4PUR A;  4F2I A;  2H6Y A;  1YF0 A;  5IOX A;  2YWM A;  3A2W A;  3MSZ A;  4YQM A;  3VWV A;  1QXH A;  4GLT A;  4MMM A;  2OA7 A;  1XW6 A;  3GKM A;  1XXU A;  4KH7 A;  2A4H A;  2YNX A;  2HZE B;  5G1L A;  5HFG A;  4DSS A;  2OJL A;  4ZIJ A;  4X43 A;  3QAW A;  4I6X A;  2LJA A;  1OC9 A;  3LGC A;  1S3C A;  1OKT A;  1F3B A;  4GTU A;  10GS A;  1A0F A;  2YJH A;  3H4K A;  4IS0 A;  1TDI A;  3KZQ A;  2M46 A;  4TVE A;  3N9J A;  4HU9 A;  2BJX A;  1E6B A;  3GL3 A;  1U6T A;  3IHG A;  3M9J A;  4KB3 A;  5A5K A;  1QFN A;  4BL7 B;  2KUC A;  5CO3 A;  5CRE A;  2I3Y A;  3C1R A;  2GDR A;  3IA1 A;  4FH8 A;  5AGY A;  4MF6 A;  4BVY A;  2B6M A;  3LSZ A;  2YPM A;  2H71 A;  2PER A;  3QFA C;  4XHM A;  4QQ7 A;  3ME7 A;  18GS A;  4WET A;  1JFU A;  3F3R A;  1V57 A;  1ST9 A;  5JCU A;  2I1U A;  3MYD A;  4K9Z A;  1UA5 A;  2LJK A;  2AUV A;  4OCF A;  1ZGN A;  2DKH A;  3KGK A;  5D9X A;  3F8U A;  3TOU A;  3CSH A;  3G7Y A;  4HEA 2;  3W8J A;  3UOM A;  4ZB9 A;  3IR4 A;  4WBR D;  4Z2U A;  4PNF A;  2F51 A;  1M2D A;  3FMW A;  4XS4 A;  1XPV A;  2KP2 A;  1FAA A;  2H19 A;  1M99 A;  2DJJ A;  3IK7 A;  3IRA A;  1EV4 A;  1ZZY A;  5FHI A;  2PWJ A;  4Q5R A;  5CRD A;  1PL2 A;  3TGZ A;  2H70 A;  3FR6 A;  1C72 A;  2P5Q A;  4EO3 A;  2C0D A;  4XRD A;  3DD3 A;  22GS A;  2CVK A;  2GVP A;  1WWJ A;  1EP7 A;  3FR3 A;  3LFL A;  4JRR A;  3ZRD A;  2UZ8 A;  3BCK A;  3S9F A;  2VL3 A;  4BVY B;  3F6D A;  4Z2T A;  3P90 A;  2IWT A;  1ZMA A;  2RUE A;  4GSS A;  4NPB A;  3GX8 A;  2Z9S A;  8GSS A;  2LQQ A;  3QPM A;  4EDY A;  1ZYN A;  3DVW A;  1GLQ A;  5KN3 A;  3NIV A;  1B48 A;  2CAI A;  1GSU A;  1TU7 A;  1XW9 A;  1NM3 A;  3HHV A;  3ERW A;  4IN0 A;  2LRC A;  2YOI A;  5DJL A;  5IO0 A;  4N0Z A;  1DE1 A;  4KDU A;  4MPF A;  3H1N A;  3K8N A;  3AY8 A;  2WB9 A;  1Z7R A;  4PXO A;  5ECI B;  5AN1 A;  1XIY A;  3LW9 A;  2TRX A;  1DBY A;  2B1L A;  1FO5 A;  2VCV A;  2RM5 A;  2CZ3 A;  3CMI A;  1XZO A;  3P8W A;  1QMV A;  5GZZ B;  3VWU A;  4MF7 A;  3IDV A;  2C3Q A;  2B5E A;  4Q5Q A;  1M2A A;  1H4O A;  3GTU A;  2PVO C;  5G30 A;  2GZP A;  5G1K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...