2VLUA

Crystal structure of barley thioredoxin h isoform 2 in partially radiation-reduced state
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
111
structure length
111
Chain Sequence
AEVISVHSLEQWTMQIEEANTAKKLVVIDFTASWCGPCRIMAPVFADLAKKFPNAVFLKVDVDELKPIAEQFSVEAMPTFLFMKEGDVKDRVVGAIKEELTAKVGLHAAAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords THIOREDOXIN H ISOFORM 2.
publication title Crystal Structures of Barley Thioredoxin H Isoforms Hvtrxh1 and Hvtrxh2 Reveal Features Involved in Protein Recognition and Possibly in Discriminating the Isoform Specificity.
pubmed doi rcsb
source organism Hordeum vulgare var. distichum
total genus 32
structure length 111
sequence length 111
chains with identical sequence B
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 2008-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2vluA01
2VD0A 3G9BA 2DJ0A 3UJ1A 2OJLA 2H70A 3BJ5A 4EDZA 1TI1A 2GS3A 1YDKA 1RQMA 2DSAA 1G6YA 4KB3A 2FD3A 3HJPA 5G1KA 4LL1B 4POMA 5HR0A 2B7JA 1WE0A 2Z9SA 3BCIA 2YP6A 5G5EA 2OE1A 2CA8A 2FGXA 2V41A 2OADA 16GSA 3L78A 3MSZA 1PX6A 3EWLA 4RUVA 1YF1A 1GUMA 3CRTA 3UARA 2KP1A 4Z7XA 2YV9A 1KBNA 5DQYA 1SYXA 1GNWA 2E2MA 1XPVA 5IMFA 4HQSA 1AW9A 5AIVA 4TRXA 3EE2A 3I6AA 2CZ2A 1Z3EA 3FZ9A 1NM3A 4QL9A 1WWJA 3KM6A 3TJJA 4N0VA 5HQPA 5CRGA 4KSOA 4EVMA 1NSWA 2R6KA 1AC1A 4ISDA 1V57A 3TJGA 5EPFA 3M3MA 4ECCA 10GSA 1W4VA 5GSTA 3D0ZA 3HVVA 2DMMA 2PVOC 3W6GA 2PPTA 2K18A 3DVXA 3U6VA 2TRXA 4KSMA 3GH9A 5A4UA 3IC4A 5F05A 1XWCA 5CO3A 1I9DA 3ZLPA 4MH3A 1EGOA 2H6ZA 3ERGA 3C8EA 3M9KA 2X8HA 1SK2A 1OE7A 5F06A 1UC7A 4MF7A 5HR3A 1A2LA 3IBHA 2MMZA 4O5RA 1GTAA 4WR4A 5IMVA 4K2DA 3GRXA 3I43A 4MJBA 4MA9A 2L4CA 3QPMA 1NHYA 1Z9HA 5A4VA 4G19A 3GSSA 4MH2A 1LJRA 2OBIA 5DJMA 3JCML 2IPAA 2B1LA 2P0GA 1FOVA 3FR3A 4O7HA 3O76A 1ERWA 2WB9A 2C3TA 2X8CA 3CBUA 1Q98A 1VF2A 4IW9A 4EKZA 1J9BA 3ED3A 4IJIA 2YJHA 1XW6A 4ECIA 1J08A 3PGTA 4I5QA 3HDCA 4DVCA 1O7UA 2GSTA 3HJMA 17GSA 4KAEA 4LLRA 1SL0B 4YH2A 1I5GA 2YZHA 6GSSA 4ZL7A 2HSYA 4V1Ap 1PD21 4XCSA 1E2YA 1DE2A 4MJAA 2QKEA 3EURA 2O8VB 4YAVA 2H1GA 1ABAA 3ZVJA 3DXBA 4MLYA 1JZWA 3HVSA 5E59A 2YNXA 4FYUA 1NHOA 1ON4A 4V2NA 3ZFLA 1V58A 1TK8B 4MK3A 2CZ3A 3EINA 5LNKe 4AJ8A 4F03A 2JU5A 4XS6A 3IRAA 1SENA 1GSSA 2I81A 4WEYA 3EVIA 3DYRA 2H71A 2V1MA 3Q18A 5DQSA 3TKRA 2EIQA 4JBBA 2ON7A 5HR2A 2I1UA 1H75A 2NBSA 3E9JB 3RHBA 4PQHA 5IMCA 1B48A 4EDYA 2YPMA 3L9VA 4HU9A 4IN0A 3KH7A 1JZDA 4F2IA 2GT6A 1MD3A 3I9V2 3GX0A 5DVBA 4TR4A 4WF5A 4Q5RA 1MDIA 2A2RA 4MCUA 1OC9A 7GSSA 1VF4A 4KW6A 2C0EA 1TW9A 4X0XA 2P31A 3L9UA 1OC9B 3LQ7A 3AY8A 4V2LA 5ELAA 5IO2A 4WR5A 5AIXA 5LD0A 1ZL9A 6GSXA 3GMFA 4KGIA 2HYXA 1U6TA 4MDCA 1ERVA 5G31A 3QOUA 1M2DA 1K0NA 1THXA 1WPIA 2LQQA 3GURA 4K1FA 3ZL5A 2DIYA 3UMAA 5D73A 4Q5NA 1GTIA 3F6DA 4IP6A 3F6FA 5C04A 4PNFA 1M7TA 3KP8A 2H76A 3G7JA 3TKSE 4ECBA 4WBRD 1PRXA 2IFQA 2K6VA 2VAFA 1JLWA 3ERFA 1TXXA 2IFQB 3KIJA 4ECJA 4NPBA 4GF0A 1QK8A 5DALA 4D73A 11GSA 4F9ZA 4YQMA 1N8JA 5DALB 4D73B 1FB0A 1YF0A 2AYTA 1PKWA 5H5SA 3QDNA 1PQNA 2OE3A 2WDUA 4TW5A 5IQYA 2C1YA 5B8BA 2NTOA 1G0TA 4G10A 2LKUA 5DCGA 1MTCA 5GZZB 3WYWA 5G5FA 4MJEA 4RQXA 3C71A 3LJRA 3IDVA 3VWWA 5JCUA 4AJ7A 3PH9A 3H93A 4HJMA 4EE0A 3VI7A 1G6WA 4XHMA 4JEDA 1URMA 2R2JA 1IYHA 4KDXA 2AB6A 4OFMA 5EY6A 4ILFA 3LG6A 4F82A 2KLXA 3CMIA 1K0OA 2NDOA 1X0RA 6GSYA 1GWCA 2GDRA 3WGXA 2IMDA 2C0DA 1X9MB 3GHAA 5DBQA 4NHZA 1X5EA 1M2BA 2FHEA 4ML6A 4HZ2A 5L71A 1TTZA 3MWHA 5DDLA 2KUCA 4CHSA 2YJ7A 2VLTA 4IS0A 2VIMA 1H4OA 1GSYA 3F4SA 3TRQA 4V1Ag 4XS1A 2KP2A 2LUSA 1GSDA 1V9WA 4MJCA 4J2FA 1SL2B 1YY7A 1T7PB 2OA7A 5ELGA 3KP9A 5G1LA 2B7KA 1XWBA 4O32A 1K0AA 2B5EA 2VCQA 5D8IA 2M46A 4E8EA 5J9CA 4GWRA 3CYNA 1YKCA 3G7YA 1CQHA 3ZZXA 3KJYA 5J41A 4OFTA 1TU7A 4HUAA 2C0GA 2E0QA 2FWEA 1K3YA 1ZCPA 3D21A 3FZAA 1KTEA 1SK1A 2GLRA 4I2TA 4L5OA 2YCDA 1OAZA 1GUKA 5CRWA 2F8FA 2BJXA 2OACA 1K0CA 1JZOA 3ZTLA 4NAXA 5DJLA 1Z7RA 5KN3A 5IMAA 2LNTA 2L6DA 1TU8A 4HOJA 1O8XA 2RLIA 2F8AA 1YQ1A 3P8WA 4GSNA 4KDYA 2YV7A 4WXTA 1XWAA 2HT9A 4TR1A 5CP1A 1RW1A 3QD9A 4YQUA 3BBYA 4TR1B 2C4JA 5D9WA 3GN3A 1FB6A 3TGZA 3IXRA 1XIYA 2MMNA 4MP4A 2DJ2A 1A2MA 5ID2B 4DSRA 2RIIA 3E3EA 5COHA 3UVTA 4RI6A 3QAWA 2H1BA 4I2UA 2K9FA 1M9BA 3US3A 2V6KA 4IP1A 4ZILA 1QFNA 5IMDA 1SKWB 4K7NA 1ZMAA 14GSA 1MD4A 4HJ2A 3WGEA 1TRVA 1EEMA 3TCOA 1K3OA 1GUHA 5A4WA 3HHVA 2WULA 4WBJA 3MAKA 3F9UA 5D9XA 1F3AA 4N11A 2I3YA 4BA7A 2FNOA 2IN3A 1USBA 2AV4A 1PGTA 1SJIA 3RAZA 2QSIA 5C00A 3ZREA 3ZITA 6GSWA 3DRNA 2REMA 1OVNA 3QMXA 4GTUA 3FHKA 4HI7A 1MEKA 3ZYWA 1K0MA 2JACA 3KZQA 2H01A 4JZQA 1A0FA 2GQLA 2CV4A 1UN2A 1FG4A 2HZFA 2VL2A 4TOPA 1OE8A 4IELA 2R37A 2I9HA 2O7KA 1F6MC 2DJJA 4HQZA 2F3MA 5IO0A 3H79A 1O85A 1HD2A 2LQOA 4O92A 4OO5A 2FA8A 1K0BA 2VO4A 2HZEA 2G2QA 1XZOA 3GIXA 2HZEB 2N5BA 4EC0A 2M80A 4ZBDA 3ZRDA 4NV2A 3Q6OA 2FWHA 1VRSD 5JCWA 3P7XA 4JR4A 1SD8A 4TVEA 3KTLA 1PX7A 3F3QA 3TKQA 2TIRA 4KX4A 2H66A 4OMVA 1OC3A 4DSSA 3G7IA 3UBLA 4BL7A 4DSSB 3IHQA 4KH7A 2YWMA 4GRFA 1UA5A 3ME7A 2C3QA 2RUEA 1DE1A 1PMTA 3WGDA 3CTFA 5D9VA 1ACVA 4HDEA 3LXTA 1WP0A 2GZPA 4AJ6A 4PQIA 2CVKA 4V2MA 2DIZA 2DBCA 2MBTA 2B5YA 4EUYA 4FIWA 3M9JA 4G9HA 3QAVA 4K7IA 2X99A 2MZCA 4ZL8A 4ACSA 1ST9A 1XCCA 3RPNA 3M0FA 1XVWA 2YWNA 5IIZA 3FK8A 2DJ3A 2GZZA 2WZ9A 2E2GA 13GSA 3SWLA 4OO4A 5IOWA 2OE0A 1OKTA 3LSZA 1M2AA 3DVWA 4BPYA 1ZYEA 4QL7A 1BYEA 1THOA 1G7OA 2JADA 1SU9A 2CVBA 5B6NA 2B5XA 5ECRB 3PINA 3W8JA 1X5DA 4PUFC 1B4QA 2GGTA 3IAM2 2IMIA 2O85A 3GYKA 4IGJA 5CNWA 3CSHA 3ZMKA 3E0UA 1FW1A 3N9JA 1J0FA 4OCFA 2V2GA 2C80A 3NOFA 5FHIA 1JHBA 4Q5QA 5INYA 4TKYA 1K3LA 1BEDA 3UVHA 2PUKC 2PBJA 20GSA 4NV5A 1WOUA 1FVKA 2PMTA 4TN8A 3KTBA 1JFUA 1A2JA 5J4UA 3RPPA 18GSA 4H86A 1W89A 3TKSA 3VK9A 3UAPA 2BTOT 2WRTA 1QQ2A 3TOTA 1WMJA 3LORA 4N30A 4POKA 2H0GA 1SL1B 2R3XA 2MBSA 3A2XA 4BWQA 2O89A 3BCKA 2QGVA 3HA9A 1HQOA 4FO5A 2DJKA 2PGTA 2VCTA 1QXHA 5IPGA 4K7OA 4IQAA 5CRHA 19GSA 1XVQA 2FWFA 5B8AA 1EP8A 4ZB9A 3N5OA 3L9SA 1N2AA 4KDUA 3HKRA 5GSSA 4ZB8A 1M99A 2GSRA 2F9SA 3ISOA 2EIRA 4XS4A 1XOAA 4XS4B 2A4VA 2C0FA 1DBYA 2H73A 3DWVA 3QFBC 4WKWA 2HNLA 3IR4A 2VL9A 4K9ZA 2CT6A 3TJKA 1TK0B 2VCXA 3O6TA 5A5KA 2VD1A 5IM9A 1U3IA 3ZFBA 2LTKA 3IE3A 3IOSA 5J9BA 2WGRA 3GKMA 1DSBA 2LRCA 2O87A 1S3DA 2BMXA 4WETA 1R5PA 4IVFA 4ZBAA 6GSTA 4GQFA 3C1RA 2WJUA 1V2AA 2YOIA 4EL1A 3WT1A 2H0HA 1ML6A 1WRYA 2TRCP 2GQMA 5F0GA 4G2EA 1X5CA 4TR0A 4KCAA 2PWJA 1T3BA 3DD3A 4AGSA 9GSSA 2CX3A 2P5QA 5EVOA 1WIKA 1LBKA 5F8BA 1KEBA 2YN1A 3H8QA 2YWOA 3LYPA 2VCWA 1EOGA 4NMUA 5ECQB 5KN1A 4F0BA 3F4RA 3KCMA 3IK7A 4K6XA 3Q74A 4NHWA 5ABRA 1Q4JA 2H74A 3HZ8A 3KGKA 1B9YC 1VF1A 1X9WB 2JSZA 3EU4A 3P90A 5FT3A 1ERUA 1U3AA 4LA1A 5CREA 3FW2A 1XWGA 1ERTA 1EV9A 2VM2A 3OR5A 1BX9A 1NW2A 6GSVA 3LXZA 1Z6NA 1PN9A 4JU5A 1TI3A 4EO3A 4NWYA 2IWTA 2WCIA 4HEA2 5GAPD 1E6BA 1BAYA 2PVQA 1FHEA 2LS5A 2HXKA 3QAGA 1EOHA 4LMVA 3ZIJA 3DIEA 1R26A 2LJKA 1FO5A 2AHEA 2FA4A 3GSTA 2L5OA 4BVYA 1TRUA 3A2WA 3APOA 3D22A 2E7PA 3IA1A 1VF3A 5ECSA 2H0IA 3FYGA 4I97A 4N10A 1HNBA 2YWIA 3S9FA 1ILOA 1YKAA 1TOFA 3MDKA 2HI7A 3DEXA 2HE3A 3KXOA 1TRWA 4E8HA 3TKSC 1JZRA 5HFIA 1T4YA 2ALBA 1FVJA 5KN2A 1JLVA 3TRPA 2DC5A 4JE1A 1EZKA 3KH9A 4I8BA 3NIVA 1ZOFA 3RDWA 22GSA 1TKDB 2IL3A 4XRDA 4JR6A 4NXIA 3F63A 1SKSB 4FYCA 2H8LA 5ECOB 3FRCA 4KCEA 3W8SA 2XPDA 3J7Yb 3IV4A 2KHPA 1YEPA 2B6MA 4L5LA 3MNGA 2LJAA 4MZBA 2J23A 3F8UA 2GSQA 4KNDA 1SKRB 4ULXA 2LNSA 1IYIA 4P3YB 3UOMA 5HFKA 4OD7A 4MZWA 5IOXA 4IQ1A 2CVDA 3TJFA 4FYBA 2K8SA 3CXGA 2DLXA 5H5QA 4RI7A 3GFKA 3QCPA 1A8YA 1A0RP 4IJ3A 4YAPA 3J7Yk 3U5RE 1RK4A 4ML1A 8GSSA 5AGYA 2HRFA 3TJBA 5KN0A 3F0IA 4PUAA 2GT5A 5FWGA 3D5JA 4XTSA 1Z5YE 2L5LA 3KMNA 4TXOA 3CSIA 1ZZYA 4J57E 4TXOB 2VLUA 2H6XA 3H1NA 1Y25A 5DAKA 1HNCA 3HJOA 1T1VA 4PGTA 4IHUA 2FUG2 1PL1A 4KA0A 5DAKB 2FY6A 1BJXA 1GULA 2IJYA 3C7MA 1DUGA 2N5AA 1PL2A 2H6YA 1B4PA 3C73A 1V98A 2IMEA 4POBA 3APQA 1X9SB 3O3TA 1B8XA 2M72A 5ECNB 2HSHA 2IIYA 3H4KA 3IAS2 1EP7A 2LRNA 3LFLA 4L0UA 5HR1A 3D6IA 3L0HA 1V40A 4LMWA 3HXSA 3M1GA 5G30A 1U88A 4MABA 5JCGA 3ZIVA 4GSTA 1R5AA 3GL5A 3GKXA 2ZCTA 3P2AA 12GSA 4GCIA 5GAND 2LJRA 5KEJA 2AUVA 3GX8A 5G2ZA 4EXJA 4WF4A 3QFAC 3LEFA 3FR6A 1GTBA 2VCZA 3A3TA 4L8EA 2B1KA 2JZRA 2XBQA 1XOBA 2VOCA 2H19A 2B3SA 3CRUA 2VUPA 4MPGA 2GZYA 3GKNA 4OWYA 5EL8A 3RBTA 3UIWA 1UVZA 2XHFA 3CTGA 4TR3A 4X1UA 2FCHA 2HLSA 2AAWA 3ME8A 1F2EA 3LWAA 1GL8A 3EMXA 2EC4A 3FEUA 1K0DA 3KMOA 3ERWA 4EF0A 3FZ5A 3UL3A 3VLNA 4TXVA 4K0GA 4YQVA 3R2QA 5IMZA 2QC7A 1SK0A 4PQ1A 1GP1A 3F4TA 3DKSA 2JZSA 1XFLA 4N0ZA 3FKFA 3DMLA 3PR8A 2AJQB 2MYGA 3UEMA 3FZ4A 1C72A 3KD0A 2WFCA 3WD6A 3GV1A 3VPTA 5AISA 1GH2A 5H5RA 2RM6A 2GTUA 2JZTA 1YEXA 1ZYQB 3GKKA 1QUWA 4K0NA 4KUNA 2R5GA 1AAZA 3GH6A 2H1DA 4GSSA 2ON5A 5JWOB 1KNGA 1T00A 3ZMLA 4GXZA 5CAXA 3VPQA 4J56E 3GTUA 2H30A 4GQCA 3GTUB 3EMPA 2HRNA 5ECHB 2H72A 5JWQB 1BQ7A 2RUFA 1VGLA 4ZBBA 4X43A 5F07A 1XWKA 4MMMA 2CAIA 2LRTA 3VURA 5ECMB 2XPEA 1CQGA 2DMLA 4MZCA 2IMFA 1SJ6A 5D96A 1GSEA 2RM5A 2GVPA 2ES7A 3F3RA 3LYKA 4PURA 1Y6EA 1TJDA 5B6MA 4I6XA 4K8MA 5ECPB 1AQVA 1O8WA 2DJ1A 5AN1A 2C3NA 2VL2C 4ZXGA 3DGQA 1AXDA 3UBKA 3NZNA 4HZ4A 3A2VA 2FWGA 2OBKA 2YZUA 1OKDA 1B9XC 3K8NA 4AF2A 1AQXA 1AQWA 3VWVA 3HZ4A 3RHCA 1OYJA 3KEBA 4FH8A 5ECIB 3TOUA 2IMKA 2J9HA 3HVXA 2C8UA 4GLTA 3VWXA 2CQ9A 3HD5A 2KOKA 4BWSA 3HCZA 3GA4A 1F9MA 1M0UA 1HNAA 3CSJA 1GLQA 2P5RA 1EWXA 2JL4A 2OKAA 2L4QA 2N5FA 2ZNMA 4XIHA 3V1WA 2A2SA 2NVLA 3SBCA 4PXOA 1QMVA 2PERA 5CRDA 1TK5B 1QGVA 4OCEA 1PA3A 2GQKA 1GSUA 5D9TA 4POLA 1O73A 5ECKB 1YZXA 1OC8A 3D4MA 4CDOA 1EGRA 5D93A 2PN8A 1FAAA 4ID0A 3IK9A 1T4ZA 1O6JA 1Z6MA 2V6OA 3VI5A 5HFGA 4QQ7A 5IPHA 2X8GA 4JRRA 4Q5FA 2CAQA 1GRXA 2F51A 1XBSA 3BD2A 1A24A 3TUEA 3QR6A 3C1SA 2K8VA 1SD9A 1GLPA 4IBPA 1S3CA 3EU3A 3APSA 4PX1A 3GUSA 2FLSA 3Q19A 2VLVA 1BG5A 4XRAA 1EV4A 1F3BA 1GTUA 3HYPA 3VWUA 5B7CA 3M8NA 2PU9C 2CX4A 1GNEA 4LL4B 3TB2A 1Z7PA 4BVXA 5LCZA 3TRXA 2LSTA 6GSUA 1TRSA 3FR9A 4HU7A 1M9AA 4HS1A 1XW9A 4L0WA 2YANA 1TP9A 1T8EB 2D2ZA 4IKHA 2I4AA 1XXUA 1LU4A 1SJZA 1YJ6A 2XBIA 1WJKA 5JWRB 5ECLB 3GL3A 1MDKA 5E4WA 3EC3A 1XW5A 2JSYA 1PKZA 5DCHA 2MMAA 1HYUA 2H75A 2LV3A 4MF6A 3IPZA 4DSQA 1EEJA 1AIUA 1SYRA 2MMOA 2VCVA 1GSFA 3D4TA 4CW9A 2L59A 3GNJA 1R7HA 3VFIA 1PSQA 5J3RA 2X64A 2ZUPA 3I69A 4DEJA 3TDGA 2EIOA 3HY2A 4KE3A 1MDJA 1TDIA 2V32A 1A8LA 1R4WA 2HFDA 1GSQA 3WT2A 3EYTA 1S3AA 5ENUA 3TKPA 5J5NA 1AUCA 4ZIJA 4PNGA 2GSSA 1U87A 3ZVJD 4MPFA 3BOAA 5CYYA 1O81A 4F0CA 1ZGNA 4ZB6A 3FY7A 4RQRA 2R4VA 2WS2A 2LEGA 2VL3A 4OFNA 1G7EA 4ZL9A 3LGCA 5ID2A 1F37A 2G0FA 2NPBA 2XC2A 2H1AA 2L57A 1A23A 3L4NA 4MF5A 2L6CA 2VM1A 3A5WA
chains in the Genus database with same CATH superfamily
2VD0A 3G9BA 2DJ0A 3UJ1A 2OJLA 2H70A 3BJ5A 4EDZA 1TI1A 2GS3A 1YDKA 1RQMA 2DSAA 1G6YA 4KB3A 2FD3A 3HJPA 5G1KA 4LL1B 4O5UA 4POMA 5HR0A 2B7JA 1WE0A 2Z9SA 3BCIA 2YP6A 5G5EA 2OE1A 2CA8A 2FGXA 2V41A 2OADA 16GSA 3L78A 3MSZA 1PX6A 3EWLA 4RUVA 1YF1A 1GUMA 3CRTA 3UARA 2KP1A 4Z7XA 2YV9A 1KBNA 4BIKA 5DQYA 1SYXA 1GNWA 2E2MA 1XPVA 5IMFA 4HQSA 1AW9A 5AIVA 4TRXA 3EE2A 3I6AA 2CZ2A 1Z3EA 3FZ9A 1NM3A 4QL9A 1WWJA 3KM6A 3TJJA 4N0VA 5HQPA 5CRGA 4KSOA 4EVMA 1NSWA 2R6KA 1AC1A 4ISDA 1V57A 3TJGA 5EPFA 3M3MA 4ECCA 10GSA 1W4VA 5GSTA 3D0ZA 3HVVA 2DMMA 2PVOC 3W6GA 2PPTA 2K18A 3DVXA 3U6VA 2TRXA 4HSCX 4KSMA 3GH9A 5A4UA 3IC4A 5F05A 1XWCA 5CO3A 1I9DA 3ZLPA 4MH3A 1EGOA 2H6ZA 3ERGA 3C8EA 3M9KA 2X8HA 1SK2A 1OE7A 5F06A 1UC7A 4MF7A 5HR3A 4CY6A 4Z2RA 1A2LA 3IBHA 2MMZA 4O5RA 1GTAA 4WR4A 5IMVA 4K2DA 3GRXA 3I43A 4MJBA 4MA9A 2L4CA 3QPMA 1NHYA 1Z9HA 5A4VA 4G19A 3GSSA 4MH2A 1LJRA 2OBIA 5DJMA 3JCML 2IPAA 2B1LA 2P0GA 1FOVA 3FR3A 2QA1A 4O7HA 3O76A 1ERWA 2WB9A 2C3TA 2X8CA 3CBUA 1Q98A 1VF2A 4IW9A 4EKZA 4Z2UA 1J9BA 3ED3A 2X49A 4IJIA 2YJHA 1XW6A 4ECIA 1J08A 3PGTA 3PPUA 4I5QA 3HDCA 4DVCA 1O7UA 2GSTA 3HJMA 17GSA 4G0IA 4KAEA 4CY8A 4LLRA 2R0GA 1SL0B 4YH2A 4Z2TA 1I5GA 2YZHA 6GSSA 4ZL7A 2HSYA 4V1Ap 1PD21 4XCSA 1E2YA 1DE2A 4MJAA 2QKEA 3EURA 2O8VB 4YAVA 2H1GA 1ABAA 3ZVJA 1M3IA 3DXBA 4MLYA 1JZWA 3HVSA 5E59A 2YNXA 4FYUA 1NHOA 1ON4A 4V2NA 3ZFLA 1V58A 1TK8B 4MK3A 2CZ3A 3EINA 5LNKe 4AJ8A 4F03A 2JU5A 4XS6A 3IRAA 1SENA 1GSSA 2I81A 4WEYA 3EVIA 3DYRA 2H71A 2V1MA 3Q18A 5DQSA 3TKRA 2EIQA 4JBBA 2ON7A 5HR2A 2I1UA 1H75A 2NBSA 3E9JB 3RHBA 4PQHA 2QA2A 1B48A 5IMCA 4EDYA 2YPMA 3L9VA 4HU9A 4IN0A 3KH7A 1JZDA 4F2IA 2GT6A 1MD3A 3I9V2 3GX0A 5DVBA 4TR4A 4WF5A 4Q5RA 1MDIA 2A2RA 4MCUA 1OC9A 7GSSA 1VF4A 4KW6A 2C0EA 1TW9A 4X0XA 2P31A 3L9UA 1OC9B 3LQ7A 3AY8A 4V2LA 5ELAA 5IO2A 4WR5A 5AIXA 5LD0A 1ZL9A 6GSXA 3GMFA 4KGIA 2HYXA 1U6TA 4MDCA 1ERVA 5G31A 3QOUA 1M2DA 1K0NA 2UZ8A 1THXA 1WPIA 2LQQA 3GURA 4K1FA 3ZL5A 2DIYA 3UMAA 5D73A 4Q5NA 1GTIA 3F6DA 4IP6A 3F6FA 5C04A 4PNFA 1M7TA 3KP8A 2H76A 3G7JA 3TKSE 4ECBA 4WBRD 1PRXA 2IFQA 2K6VA 2VAFA 1JLWA 3ERFA 1TXXA 2IFQB 3KIJA 4ECJA 4NPBA 4GF0A 1QK8A 5DALA 4D73A 4K5SA 11GSA 4F9ZA 4YQMA 1N8JA 5DALB 4D73B 1FB0A 1YF0A 2AYTA 1PKWA 5H5SA 3QDNA 1PQNA 2OE3A 2WDUA 4TW5A 5IQYA 2C1YA 5B8BA 2NTOA 1G0TA 4G10A 2LKUA 5DCGA 1MTCA 5GZZB 3WYWA 5G5FA 4MJEA 4RQXA 3C71A 3LJRA 3IDVA 5KOWA 3VWWA 5JCUA 4AJ7A 3PH9A 3H93A 4HJMA 4EE0A 3VI7A 1G6WA 4XHMA 4JEDA 1URMA 2R2JA 1IYHA 4KDXA 2AB6A 4OFMA 5EY6A 4ILFA 3LG6A 4F82A 2KLXA 3CMIA 1K0OA 2NDOA 1X0RA 6GSYA 1GWCA 2GDRA 3WGXA 1S3RA 2IMDA 2C0DA 1X9MB 3GHAA 5DBQA 4NHZA 1X5EA 1M2BA 2FHEA 4ML6A 4HZ2A 5L71A 1TTZA 3MWHA 5DDLA 2KUCA 4CHSA 2YJ7A 1M3JA 2HRAA 2VLTA 4IS0A 4KF9A 2VIMA 1H4OA 1GSYA 3F4SA 3TRQA 4V1Ag 4XS1A 2KP2A 2LUSA 1GSDA 1V9WA 4MJCA 4J2FA 1SL2B 1YY7A 1T7PB 2OA7A 5ELGA 3KP9A 5G1LA 2B7KA 1XWBA 4O32A 1K0AA 2B5EA 2VCQA 5D8IA 2M46A 4E8EA 5J9CA 4GWRA 3CYNA 1YKCA 3G7YA 1CQHA 3ZZXA 4YKGA 3KJYA 5J41A 4OFTA 1TU7A 4HUAA 2C0GA 2E0QA 2FWEA 1K3YA 1ZCPA 3D21A 3FZAA 1KTEA 1SK1A 2GLRA 4I2TA 4L5OA 2YCDA 1OAZA 1GUKA 5CRWA 2F8FA 2BJXA 2OACA 1K0CA 1JZOA 3ZTLA 4NAXA 3LW9A 5DJLA 1Z7RA 5KN3A 5IMAA 2LNTA 2L6DA 1TU8A 4HOJA 1O8XA 2RLIA 2F8AA 1YQ1A 3P8WA 4GSNA 4KDYA 2YV7A 4WXTA 1XWAA 2HT9A 5KOXA 4TR1A 5CP1A 1RW1A 3QD9A 4YQUA 3IC8A 3BBYA 4TR1B 2C4JA 5D9WA 3GN3A 1FB6A 3TGZA 3IXRA 1XIYA 2MMNA 4MP4A 2DKHA 2DJ2A 1A2MA 5ID2B 4DSRA 2RIIA 3E3EA 5COHA 3UVTA 4RI6A 3QAWA 2H1BA 4I2UA 2K9FA 1M9BA 3US3A 2V6KA 4IP1A 1ZYNA 4ZILA 1QFNA 5IMDA 1SKWB 4K7NA 1ZMAA 14GSA 1MD4A 3EPTA 4HJ2A 3WGEA 1TRVA 1EEMA 5BRTA 3TCOA 1K3OA 1GUHA 5A4WA 3HHVA 2WULA 4WBJA 3MAKA 3F9UA 5D9XA 1F3AA 4N11A 2I3YA 4BA7A 2FNOA 2IN3A 1USBA 2AV4A 1PGTA 1SJIA 4G0KA 3RAZA 2QSIA 5C00A 3ZREA 3ZITA 6GSWA 3DRNA 2REMA 1OVNA 3QMXA 4GTUA 3FHKA 4HI7A 1MEKA 3ZYWA 1K0MA 2JACA 3KZQA 2H01A 4JZQA 1A0FA 2GQLA 2CV4A 1UN2A 1FG4A 2HZFA 2VL2A 4TOPA 1OE8A 4IELA 2R37A 2I9HA 2O7KA 1F6MC 2DJJA 4HQZA 2F3MA 5IO0A 3H79A 1O85A 1HD2A 2LQOA 4O92A 4OO5A 2FA8A 1K0BA 2VO4A 2HZEA 2G2QA 4A5PA 1XZOA 3GIXA 2HZEB 2N5BA 4EC0A 2M80A 4ZBDA 3ZRDA 4NV2A 4G0LA 3Q6OA 2FWHA 1VRSD 5JCWA 3P7XA 4JR4A 1SD8A 4TVEA 3KTLA 1PX7A 3CQFA 3F3QA 3TKQA 2TIRA 4KX4A 2H66A 4OMVA 1OC3A 4DSSA 3G7IA 3UBLA 4BL7A 4DSSB 3IHQA 4BL7B 4KH7A 2YWMA 4GRFA 1UA5A 3ME7A 2C3QA 2HRKA 2RUEA 1DE1A 1PMTA 3WGDA 3CTFA 5D9VA 1ACVA 4HDEA 3LXTA 1WP0A 2GZPA 4AJ6A 4PQIA 2CVKA 4V2MA 2DIZA 2DBCA 2MBTA 2B5YA 4EUYA 4FIWA 3M9JA 4G9HA 3QAVA 4K7IA 2X99A 2MZCA 4ZL8A 4ACSA 1ST9A 1XCCA 3RPNA 4X4JA 3M0FA 3IHGA 1XVWA 2YWNA 5IIZA 3FK8A 2DJ3A 2GZZA 2WZ9A 2E2GA 13GSA 3SWLA 4OO4A 5IOWA 2OE0A 1OKTA 3LSZA 1M2AA 3DVWA 4BPYA 1ZYEA 4QL7A 1BYEA 1THOA 1G7OA 2JADA 1SU9A 2CVBA 5B6NA 2B5XA 5ECRB 3PINA 3W8JA 1X5DA 4PUFC 1B4QA 2GGTA 4EIQA 3IAM2 2IMIA 2O85A 3GYKA 4IGJA 5CNWA 3CSHA 3ZMKA 3E0UA 1FW1A 4YKFA 3N9JA 1J0FA 4OCFA 2V2GA 2C80A 3NOFA 5FHIA 1JHBA 4Q5QA 5INYA 4TKYA 1K3LA 1BEDA 3UVHA 2PUKC 2PBJA 20GSA 4NV5A 1WOUA 1FVKA 2PMTA 4TN8A 3KTBA 1JFUA 1A2JA 5J4UA 3RPPA 18GSA 4H86A 1W89A 3TKSA 3VK9A 3UAPA 2BTOT 2WRTA 1QQ2A 3TOTA 1WMJA 3LORA 4N30A 4POKA 2H0GA 1SL1B 2R3XA 2MBSA 3A2XA 4BWQA 2O89A 3BCKA 2QGVA 3HA9A 1HQOA 4FO5A 2DJKA 2PGTA 2VCTA 1QXHA 5IPGA 4K7OA 4IQAA 5CRHA 19GSA 1XVQA 2FWFA 5B8AA 1EP8A 4ZB9A 3N5OA 3L9SA 1N2AA 4KDUA 3HKRA 3R3EA 5GSSA 2R0CA 4ZB8A 1M99A 2GSRA 2F9SA 3ISOA 2EIRA 4XS4A 1XOAA 4XS4B 2A4VA 2C0FA 1DBYA 2H73A 3DWVA 3QFBC 4WKWA 2HNLA 3IR4A 2VL9A 4K9ZA 2CT6A 3TJKA 1TK0B 2VCXA 3O6TA 5A5KA 2VD1A 5IM9A 1U3IA 3ZFBA 2LTKA 3IE3A 3IOSA 5J9BA 2WGRA 3GKMA 1DSBA 2LRCA 2O87A 5BMUA 1S3DA 2BMXA 4WETA 4K2XA 1R5PA 4IVFA 4ZBAA 6GSTA 4GQFA 3C1RA 2WJUA 1V2AA 2YOIA 4EL1A 3WT1A 2H0HA 1ML6A 1WRYA 2TRCP 2GQMA 5F0GA 4G2EA 1X5CA 4TR0A 4KCAA 2PWJA 1T3BA 3DD3A 4AGSA 9GSSA 2CX3A 2P5QA 5EVOA 1WIKA 1LBKA 5F8BA 1KEBA 2YN1A 3H8QA 2YWOA 3LYPA 2VCWA 1EOGA 4NMUA 5ECQB 5KN1A 4F0BA 3F4RA 3KCMA 3IK7A 4K6XA 3Q74A 4NHWA 5ABRA 1Q4JA 2H74A 3HZ8A 3KGKA 1B9YC 1VF1A 4K5RA 1X9WB 2JSZA 3EU4A 3P90A 5FT3A 4ICYA 1ERUA 1U3AA 5CREA 4LA1A 3FW2A 1XWGA 1ERTA 1EV9A 2VM2A 3OR5A 1BX9A 1NW2A 6GSVA 3LXZA 1Z6NA 1PN9A 4JU5A 1TI3A 4EO3A 4NWYA 2IWTA 2WCIA 4HEA2 5GAPD 2HSMA 1E6BA 1BAYA 2PVQA 1FHEA 2LS5A 2HXKA 3QAGA 1EOHA 4LMVA 3ZIJA 3DIEA 1R26A 2LJKA 1FO5A 2AHEA 2FA4A 3GSTA 2L5OA 4BVYA 1TRUA 3A2WA 3APOA 3D22A 2E7PA 3IA1A 1VF3A 5ECSA 2H0IA 3FYGA 4I97A 4N10A 1HNBA 4BVYB 2YWIA 3S9FA 1ILOA 1YKAA 1TOFA 3MDKA 2HI7A 3DEXA 2HE3A 3KXOA 1TRWA 4E8HA 3TKSC 1JZRA 5HFIA 1T4YA 2ALBA 1FVJA 5KN2A 1JLVA 2R0PA 3TRPA 2DC5A 4JE1A 1EZKA 3KH9A 4I8BA 3NIVA 1ZOFA 3RDWA 22GSA 1TKDB 2IL3A 4XRDA 4JR6A 4NXIA 3F63A 1SKSB 4FYCA 2H8LA 5ECOB 3FRCA 4KCEA 3W8SA 2XPDA 3J7Yb 3IV4A 2KHPA 1YEPA 2B6MA 4L5LA 3MNGA 2LJAA 4MZBA 4USSA 2J23A 3F8UA 2GSQA 4KNDA 1SKRB 4ULXA 2LNSA 1IYIA 4P3YB 3UOMA 5HFKA 4OD7A 4MZWA 5IOXA 4IQ1A 2CVDA 3TJFA 4FYBA 2K8SA 3CXGA 2DLXA 5H5QA 4RI7A 3GFKA 3QCPA 1A8YA 1A0RP 4IJ3A 4YAPA 3J7Yk 3U5RE 1RK4A 4ML1A 8GSSA 5AGYA 2HRFA 3TJBA 3HVNA 3A5IA 5KN0A 3F0IA 4PUAA 2GT5A 5FWGA 3D5JA 4XTSA 1Z5YE 2L5LA 3KMNA 4TXOA 3CSIA 1ZZYA 4J57E 4TXOB 2VLUA 2H6XA 3H1NA 1Y25A 5DAKA 1HNCA 3HJOA 1T1VA 4PGTA 4IHUA 2FUG2 1PL1A 4KA0A 5DAKB 2FY6A 1BJXA 1GULA 2IJYA 3C7MA 1DUGA 2N5AA 1PL2A 2H6YA 1B4PA 3C73A 1V98A 1FOHA 2IMEA 4POBA 3APQA 1X9SB 3O3TA 1B8XA 2M72A 5ECNB 2HSHA 2IIYA 3H4KA 3IAS2 1EP7A 2LRNA 3LFLA 4L0UA 4O5QA 5HR1A 3D6IA 3L0HA 1V40A 4LMWA 3HXSA 3M1GA 5G30A 1U88A 4MABA 5JCGA 3ZIVA 4GSTA 1R5AA 3GL5A 3GKXA 2ZCTA 3P2AA 12GSA 4GCIA 5GAND 2LJRA 5KEJA 2AUVA 3GX8A 5G2ZA 4EXJA 4WF4A 3QFAC 3LEFA 3FR6A 1GTBA 2VCZA 3A3TA 4L8EA 2B1KA 2JZRA 2XBQA 1XOBA 2VOCA 2H19A 2B3SA 3CRUA 2VUPA 4MPGA 2GZYA 3GKNA 4OWYA 5EL8A 3RBTA 3UIWA 1UVZA 2XHFA 3CTGA 4TR3A 4X1UA 2FCHA 2HLSA 2AAWA 3ME8A 1F2EA 3LWAA 1GL8A 3EMXA 2EC4A 3FEUA 1K0DA 3KMOA 3ERWA 4EF0A 3FZ5A 3UL3A 3VLNA 4TXVA 4K0GA 4YQVA 3R2QA 5IMZA 2QC7A 1SK0A 4PQ1A 1GP1A 3F4TA 3DKSA 2JZSA 1XFLA 4N0ZA 3FKFA 3DMLA 3PR8A 2AJQB 2MYGA 3UEMA 3FZ4A 1C72A 1PFOA 3KD0A 2WFCA 3WD6A 3GV1A 3VPTA 5AISA 1GH2A 5H5RA 2X4AA 2RM6A 2GTUA 2JZTA 1YEXA 1ZYQB 3GKKA 1QUWA 4K0NA 4KUNA 2R5GA 1AAZA 3GH6A 2H1DA 4GSSA 2ON5A 5JWOB 1KNGA 1T00A 3ZMLA 4GXZA 5CAXA 3VPQA 4J56E 3GTUA 2H30A 4GQCA 3GTUB 3EMPA 2HRNA 5ECHB 2H72A 5JWQB 1BQ7A 2RUFA 1VGLA 4ZBBA 4X43A 5F07A 1XWKA 4MMMA 2CAIA 2LRTA 3VURA 5ECMB 2XPEA 1PN0A 1CQGA 2DMLA 4MZCA 2IMFA 1SJ6A 5D96A 1GSEA 2RM5A 2GVPA 2ES7A 3F3RA 3LYKA 4PURA 1Y6EA 1TJDA 5B6MA 4I6XA 4K8MA 3MYDA 5ECPB 1AQVA 1O8WA 2DJ1A 5AN1A 2C3NA 2VL2C 4ZXGA 3DGQA 1AXDA 3UBKA 3NZNA 4HZ4A 3A2VA 2FWGA 2OBKA 2YZUA 1OKDA 1B9XC 3K8NA 4AF2A 1AQXA 1AQWA 3VWVA 3HZ4A 3RHCA 1OYJA 3KEBA 4FH8A 5ECIB 3TOUA 2IMKA 2J9HA 3HVXA 2C8UA 4GLTA 3VWXA 2CQ9A 3HD5A 2KOKA 4BWSA 3HCZA 3GA4A 1F9MA 1M0UA 1HNAA 3CSJA 1GLQA 2P5RA 1EWXA 2JL4A 2OKAA 2L4QA 2N5FA 2ZNMA 4XIHA 4MNNA 3V1WA 2A2SA 2NVLA 3SBCA 4PXOA 1QMVA 2PERA 5CRDA 1TK5B 1QGVA 4OCEA 1PA3A 2GQKA 1GSUA 5D9TA 4POLA 1O73A 5ECKB 1YZXA 1OC8A 3D4MA 4CDOA 1EGRA 5D93A 2PN8A 1FAAA 4ID0A 3IK9A 1T4ZA 1O6JA 1Z6MA 2V6OA 3VI5A 5HFGA 4PTSA 4FQUA 4QQ7A 5IPHA 1ZYPA 2X8GA 4JRRA 4Q5FA 2CAQA 1GRXA 2F51A 1XBSA 3BD2A 1A24A 3TUEA 3QR6A 3C1SA 2K8VA 1SD9A 1GLPA 4IBPA 1S3CA 3EU3A 3APSA 4PX1A 2DKIA 3GUSA 2FLSA 3FMWA 3Q19A 2VLVA 1BG5A 4XRAA 1EV4A 1F3BA 1GTUA 3HYPA 3VWUA 5B7CA 3M8NA 2PU9C 2CX4A 1GNEA 4LL4B 3TB2A 1Z7PA 4BVXA 5LCZA 3TRXA 2LSTA 4BVXB 6GSUA 1TRSA 3FR9A 4HU7A 1M9AA 4HS1A 1XW9A 4L0WA 2YANA 1TP9A 1T8EB 2D2ZA 4IKHA 2I4AA 1XXUA 1LU4A 1SJZA 1YJ6A 2XBIA 1WJKA 5JWRB 5ECLB 3GL3A 1MDKA 5E4WA 3EC3A 1XW5A 2JSYA 1PKZA 5DCHA 2MMAA 1HYUA 2H75A 2LV3A 4MF6A 3IPZA 4DSQA 1EEJA 1AIUA 1SYRA 2MMOA 2VCVA 2A2PA 1GSFA 3D4TA 4CW9A 2L59A 3GNJA 1R7HA 3VFIA 1PSQA 5J3RA 2X64A 4EIPA 2ZUPA 3I69A 4DEJA 3TDGA 2EIOA 3HY2A 4KE3A 1MDJA 1TDIA 2V32A 2A4HA 1A8LA 1R4WA 2HFDA 1GSQA 3WT2A 3EYTA 1S3AA 5ENUA 3TKPA 5J5NA 1AUCA 4ZIJA 4PNGA 2GSSA 1U87A 3ZVJD 4MPFA 3BOAA 5CYYA 1O81A 4F0CA 1ZGNA 4ZB6A 3FY7A 4RQRA 2R4VA 2WS2A 2LEGA 2VL3A 4OFNA 1G7EA 4ZL9A 3LGCA 5ID2A 1F37A 2G0FA 2NPBA 2XC2A 1XG8A 2H1AA 3MIXA 2L57A 1A23A 3L4NA 4MF5A 2L6CA 2VM1A 3A5WA
chains in the Genus database with same CATH topology
2VD0A 3G9BA 2DJ0A 3UJ1A 2OJLA 2H70A 3BJ5A 4EDZA 1TI1A 2GS3A 1YDKA 1RQMA 2DSAA 1G6YA 4KB3A 2FD3A 3HJPA 5G1KA 4LL1B 4O5UA 4POMA 5HR0A 2B7JA 1WE0A 2Z9SA 3BCIA 2YP6A 5G5EA 2OE1A 2CA8A 2FGXA 2V41A 2OADA 16GSA 3L78A 3MSZA 1PX6A 3EWLA 4RUVA 1YF1A 1GUMA 3CRTA 3UARA 2KP1A 4Z7XA 2YV9A 1KBNA 5DQYA 1SYXA 1GNWA 2E2MA 1XPVA 5IMFA 4HQSA 1AW9A 5AIVA 4TRXA 3EE2A 3I6AA 2CZ2A 1Z3EA 3FZ9A 1NM3A 4QL9A 1WWJA 3KM6A 3TJJA 4N0VA 5HQPA 5CRGA 4KSOA 4EVMA 1NSWA 2R6KA 1AC1A 4ISDA 1V57A 3TJGA 5EPFA 3M3MA 4ECCA 10GSA 1W4VA 5GSTA 3D0ZA 3HVVA 2DMMA 2PVOC 3W6GA 2PPTA 2K18A 3DVXA 3U6VA 2TRXA 4KSMA 3GH9A 5A4UA 3IC4A 5F05A 1XWCA 5CO3A 1I9DA 3ZLPA 4MH3A 1EGOA 2H6ZA 3ERGA 3C8EA 3M9KA 2X8HA 1SK2A 1OE7A 5F06A 1UC7A 4MF7A 5HR3A 4CY6A 4Z2RA 1A2LA 3IBHA 2MMZA 4O5RA 1GTAA 4WR4A 5IMVA 4K2DA 3GRXA 3I43A 4MJBA 4MA9A 2L4CA 3QPMA 1NHYA 1Z9HA 5A4VA 4G19A 3GSSA 4MH2A 1LJRA 2OBIA 5DJMA 3JCML 2IPAA 2B1LA 2P0GA 1FOVA 3FR3A 2QA1A 4O7HA 3O76A 1ERWA 2WB9A 2C3TA 2X8CA 3CBUA 1Q98A 1VF2A 4IW9A 4EKZA 4Z2UA 1J9BA 3ED3A 2X49A 4IJIA 2YJHA 1XW6A 4ECIA 1J08A 3PGTA 3PPUA 4I5QA 3HDCA 4DVCA 1O7UA 2GSTA 3HJMA 17GSA 4G0IA 4KAEA 4CY8A 4LLRA 2R0GA 1SL0B 4YH2A 4Z2TA 1I5GA 2YZHA 6GSSA 4ZL7A 2HSYA 4V1Ap 1PD21 4XCSA 1E2YA 1DE2A 4MJAA 2QKEA 3EURA 2O8VB 4YAVA 2H1GA 1ABAA 3ZVJA 3DXBA 4MLYA 1JZWA 3HVSA 5E59A 2YNXA 4FYUA 1NHOA 1ON4A 4V2NA 3ZFLA 1V58A 1TK8B 4MK3A 2CZ3A 3EINA 5LNKe 4AJ8A 4F03A 2JU5A 4XS6A 3IRAA 1SENA 1GSSA 2I81A 4WEYA 3EVIA 3DYRA 2H71A 2V1MA 3Q18A 5DQSA 3TKRA 2EIQA 4JBBA 2ON7A 5HR2A 2I1UA 1H75A 2NBSA 3E9JB 3RHBA 4PQHA 2QA2A 1B48A 5IMCA 4EDYA 2YPMA 3L9VA 4HU9A 4IN0A 3KH7A 1JZDA 4F2IA 2GT6A 1MD3A 3I9V2 3GX0A 5DVBA 4TR4A 4WF5A 4Q5RA 1MDIA 2A2RA 4MCUA 1OC9A 7GSSA 1VF4A 4KW6A 2C0EA 1TW9A 4X0XA 2P31A 3L9UA 1OC9B 3LQ7A 3AY8A 4V2LA 5ELAA 5IO2A 4WR5A 5AIXA 5LD0A 1ZL9A 6GSXA 3GMFA 4KGIA 2HYXA 1U6TA 4MDCA 1ERVA 5G31A 3QOUA 1M2DA 1K0NA 2UZ8A 1THXA 1WPIA 2LQQA 3GURA 4K1FA 3ZL5A 2DIYA 3UMAA 5D73A 4Q5NA 1GTIA 3F6DA 4IP6A 3F6FA 5C04A 4PNFA 1M7TA 3KP8A 2H76A 3G7JA 3TKSE 4ECBA 4WBRD 1PRXA 2IFQA 2K6VA 2VAFA 1JLWA 3ERFA 1TXXA 2IFQB 3KIJA 4ECJA 4NPBA 4GF0A 1QK8A 5DALA 4D73A 4K5SA 11GSA 4F9ZA 4YQMA 1N8JA 5DALB 4D73B 1FB0A 1YF0A 2AYTA 1PKWA 5H5SA 3QDNA 1PQNA 2OE3A 2WDUA 4TW5A 5IQYA 2C1YA 5B8BA 2NTOA 1G0TA 4G10A 2LKUA 5DCGA 1MTCA 5GZZB 3WYWA 5G5FA 4MJEA 4RQXA 3C71A 3LJRA 3IDVA 5KOWA 3VWWA 5JCUA 4AJ7A 3PH9A 3H93A 4HJMA 4EE0A 3VI7A 1G6WA 4XHMA 4JEDA 1URMA 2R2JA 1IYHA 4KDXA 2AB6A 4OFMA 5EY6A 4ILFA 3LG6A 4F82A 2KLXA 3CMIA 1K0OA 2NDOA 1X0RA 6GSYA 1GWCA 2GDRA 3WGXA 2IMDA 2C0DA 1X9MB 3GHAA 5DBQA 4NHZA 1X5EA 1M2BA 2FHEA 4ML6A 4HZ2A 5L71A 1TTZA 3MWHA 5DDLA 2KUCA 4CHSA 2YJ7A 2HRAA 2VLTA 4IS0A 4KF9A 2VIMA 1H4OA 1GSYA 3F4SA 3TRQA 4V1Ag 4XS1A 2KP2A 2LUSA 1GSDA 1V9WA 4MJCA 4J2FA 1SL2B 1YY7A 1T7PB 2OA7A 5ELGA 3KP9A 5G1LA 2B7KA 1XWBA 4O32A 1K0AA 2B5EA 2VCQA 5D8IA 2M46A 4E8EA 5J9CA 4GWRA 3CYNA 1YKCA 3G7YA 1CQHA 3ZZXA 4YKGA 3KJYA 5J41A 4OFTA 1TU7A 4HUAA 2C0GA 2E0QA 2FWEA 1K3YA 1ZCPA 3D21A 3FZAA 1KTEA 1SK1A 2GLRA 4I2TA 4L5OA 2YCDA 1OAZA 1GUKA 5CRWA 2F8FA 2BJXA 2OACA 1K0CA 1JZOA 3ZTLA 4NAXA 3LW9A 5DJLA 1Z7RA 5KN3A 5IMAA 2LNTA 2L6DA 1TU8A 4HOJA 1O8XA 2RLIA 2F8AA 1YQ1A 3P8WA 4GSNA 4KDYA 2YV7A 4WXTA 1XWAA 2HT9A 5KOXA 4TR1A 5CP1A 1RW1A 3QD9A 4YQUA 3IC8A 3BBYA 4TR1B 2C4JA 5D9WA 3GN3A 1FB6A 3TGZA 3IXRA 1XIYA 2MMNA 4MP4A 2DKHA 2DJ2A 1A2MA 5ID2B 4DSRA 2RIIA 3E3EA 5COHA 3UVTA 4RI6A 3QAWA 2H1BA 4I2UA 2K9FA 1M9BA 3US3A 2V6KA 4IP1A 1ZYNA 4ZILA 1QFNA 5IMDA 1SKWB 4K7NA 1ZMAA 14GSA 1MD4A 3EPTA 4HJ2A 3WGEA 1TRVA 1EEMA 5BRTA 3TCOA 1K3OA 1GUHA 5A4WA 3HHVA 2WULA 4WBJA 3MAKA 3F9UA 5D9XA 1F3AA 4N11A 2I3YA 4BA7A 2FNOA 2IN3A 1USBA 2AV4A 1PGTA 1SJIA 4G0KA 3RAZA 2QSIA 5C00A 3ZREA 3ZITA 6GSWA 3DRNA 2REMA 1OVNA 3QMXA 4GTUA 3FHKA 4HI7A 1MEKA 3ZYWA 1K0MA 2JACA 3KZQA 2H01A 4JZQA 1A0FA 2GQLA 2CV4A 1UN2A 1FG4A 2HZFA 2VL2A 4TOPA 1OE8A 4IELA 2R37A 2I9HA 2O7KA 1F6MC 2DJJA 4HQZA 2F3MA 5IO0A 3H79A 1O85A 1HD2A 2LQOA 4O92A 4OO5A 2FA8A 1K0BA 2VO4A 2HZEA 2G2QA 4A5PA 1XZOA 3GIXA 2HZEB 2N5BA 4EC0A 2M80A 4ZBDA 3ZRDA 4NV2A 4G0LA 3Q6OA 2FWHA 1VRSD 5JCWA 3P7XA 4JR4A 1SD8A 4TVEA 3KTLA 1PX7A 3F3QA 3TKQA 2TIRA 4KX4A 2H66A 4OMVA 1OC3A 4DSSA 3G7IA 3UBLA 4BL7A 4DSSB 3IHQA 4BL7B 4KH7A 2YWMA 4GRFA 1UA5A 3ME7A 2C3QA 2HRKA 2RUEA 1DE1A 1PMTA 3WGDA 3CTFA 5D9VA 1ACVA 4HDEA 3LXTA 1WP0A 2GZPA 4AJ6A 4PQIA 2CVKA 4V2MA 2DIZA 2DBCA 2MBTA 2B5YA 4EUYA 4FIWA 3M9JA 4G9HA 3QAVA 4K7IA 2X99A 2MZCA 4ZL8A 4ACSA 1ST9A 1XCCA 3RPNA 4X4JA 3M0FA 3IHGA 1XVWA 2YWNA 5IIZA 3FK8A 2DJ3A 2GZZA 2WZ9A 2E2GA 13GSA 3SWLA 4OO4A 5IOWA 2OE0A 1OKTA 3LSZA 1M2AA 3DVWA 4BPYA 1ZYEA 4QL7A 1BYEA 1THOA 1G7OA 2JADA 1SU9A 2CVBA 5B6NA 2B5XA 5ECRB 3PINA 3W8JA 1X5DA 4PUFC 1B4QA 2GGTA 4EIQA 3IAM2 2IMIA 2O85A 3GYKA 4IGJA 5CNWA 3CSHA 3ZMKA 3E0UA 1FW1A 4YKFA 3N9JA 1J0FA 4OCFA 2V2GA 2C80A 3NOFA 5FHIA 1JHBA 4Q5QA 5INYA 4TKYA 1K3LA 1BEDA 3UVHA 2PUKC 2PBJA 20GSA 4NV5A 1WOUA 1FVKA 2PMTA 4TN8A 3KTBA 1JFUA 1A2JA 5J4UA 3RPPA 18GSA 4H86A 1W89A 3TKSA 3VK9A 3UAPA 2BTOT 2WRTA 1QQ2A 3TOTA 1WMJA 3LORA 4N30A 4POKA 2H0GA 1SL1B 2R3XA 2MBSA 3A2XA 4BWQA 2O89A 3BCKA 2QGVA 3HA9A 1HQOA 4FO5A 2DJKA 2PGTA 2VCTA 1QXHA 5IPGA 4K7OA 4IQAA 5CRHA 19GSA 1XVQA 2FWFA 5B8AA 1EP8A 4ZB9A 3N5OA 3L9SA 1N2AA 4KDUA 3HKRA 3R3EA 5GSSA 2R0CA 4ZB8A 1M99A 2GSRA 2F9SA 3ISOA 2EIRA 4XS4A 1XOAA 4XS4B 2A4VA 2C0FA 1DBYA 2H73A 3DWVA 3QFBC 4WKWA 2HNLA 3IR4A 2VL9A 4K9ZA 2CT6A 3TJKA 1TK0B 2VCXA 3O6TA 5A5KA 2VD1A 5IM9A 1U3IA 3ZFBA 2LTKA 3IE3A 3IOSA 5J9BA 2WGRA 3GKMA 1DSBA 2LRCA 2O87A 5BMUA 1S3DA 2BMXA 4WETA 4K2XA 1R5PA 4IVFA 4ZBAA 6GSTA 4GQFA 3C1RA 2WJUA 1V2AA 2YOIA 4EL1A 3WT1A 2H0HA 1ML6A 1WRYA 2TRCP 2GQMA 5F0GA 4G2EA 1X5CA 4TR0A 4KCAA 2PWJA 1T3BA 3DD3A 4AGSA 9GSSA 2CX3A 2P5QA 5EVOA 1WIKA 1LBKA 5F8BA 1KEBA 2YN1A 3H8QA 2YWOA 3LYPA 2VCWA 1EOGA 4NMUA 5ECQB 5KN1A 4F0BA 3F4RA 3KCMA 3IK7A 4K6XA 3Q74A 4NHWA 5ABRA 1Q4JA 2H74A 3HZ8A 3KGKA 1B9YC 1VF1A 4K5RA 1X9WB 2JSZA 3EU4A 3P90A 5FT3A 4ICYA 1ERUA 1U3AA 5CREA 4LA1A 3FW2A 1XWGA 1ERTA 1EV9A 2VM2A 3OR5A 1BX9A 1NW2A 6GSVA 3LXZA 1Z6NA 1PN9A 4JU5A 1TI3A 4EO3A 4NWYA 2IWTA 2WCIA 4HEA2 5GAPD 2HSMA 1E6BA 1BAYA 2PVQA 1FHEA 2LS5A 2HXKA 3QAGA 1EOHA 4LMVA 3ZIJA 3DIEA 1R26A 2LJKA 1FO5A 2AHEA 2FA4A 3GSTA 2L5OA 4BVYA 1TRUA 3A2WA 3APOA 3D22A 2E7PA 3IA1A 1VF3A 5ECSA 2H0IA 3FYGA 4I97A 4N10A 1HNBA 4BVYB 2YWIA 3S9FA 1ILOA 1YKAA 1TOFA 3MDKA 2HI7A 3DEXA 2HE3A 3KXOA 1TRWA 4E8HA 3TKSC 1JZRA 5HFIA 1T4YA 2ALBA 1FVJA 5KN2A 1JLVA 2R0PA 3TRPA 2DC5A 4JE1A 1EZKA 3KH9A 4I8BA 3NIVA 1ZOFA 3RDWA 22GSA 1TKDB 2IL3A 4XRDA 4JR6A 4NXIA 3F63A 1SKSB 4FYCA 2H8LA 5ECOB 3FRCA 4KCEA 3W8SA 2XPDA 3J7Yb 3IV4A 2KHPA 1YEPA 2B6MA 4L5LA 3MNGA 2LJAA 4MZBA 4USSA 2J23A 3F8UA 2GSQA 4KNDA 1SKRB 4ULXA 2LNSA 1IYIA 4P3YB 3UOMA 5HFKA 4OD7A 4MZWA 5IOXA 4IQ1A 2CVDA 3TJFA 4FYBA 2K8SA 3CXGA 2DLXA 5H5QA 4RI7A 3GFKA 3QCPA 1A8YA 1A0RP 4IJ3A 4YAPA 3J7Yk 3U5RE 1RK4A 4ML1A 8GSSA 5AGYA 2HRFA 3TJBA 3A5IA 5KN0A 3F0IA 4PUAA 2GT5A 5FWGA 3D5JA 4XTSA 1Z5YE 2L5LA 3KMNA 4TXOA 3CSIA 1ZZYA 4J57E 4TXOB 2VLUA 2H6XA 3H1NA 1Y25A 5DAKA 1HNCA 3HJOA 1T1VA 4PGTA 4IHUA 2FUG2 1PL1A 4KA0A 5DAKB 2FY6A 1BJXA 1GULA 2IJYA 3C7MA 1DUGA 2N5AA 1PL2A 2H6YA 1B4PA 3C73A 1V98A 1FOHA 2IMEA 4POBA 3APQA 1X9SB 3O3TA 1B8XA 2M72A 5ECNB 2HSHA 2IIYA 3H4KA 3IAS2 1EP7A 2LRNA 3LFLA 4L0UA 4O5QA 5HR1A 3D6IA 3L0HA 1V40A 4LMWA 3HXSA 3M1GA 5G30A 1U88A 4MABA 5JCGA 3ZIVA 4GSTA 1R5AA 3GL5A 3GKXA 2ZCTA 3P2AA 12GSA 4GCIA 5GAND 2LJRA 5KEJA 2AUVA 3GX8A 5G2ZA 4EXJA 4WF4A 3QFAC 3LEFA 3FR6A 1GTBA 2VCZA 3A3TA 4L8EA 2B1KA 2JZRA 2XBQA 1XOBA 2VOCA 2H19A 2B3SA 3CRUA 2VUPA 4MPGA 2GZYA 3GKNA 4OWYA 5EL8A 3RBTA 3UIWA 1UVZA 2XHFA 3CTGA 4TR3A 4X1UA 2FCHA 2HLSA 2AAWA 3ME8A 1F2EA 3LWAA 1GL8A 3EMXA 2EC4A 3FEUA 1K0DA 3KMOA 3ERWA 4EF0A 3FZ5A 3UL3A 3VLNA 4TXVA 4K0GA 4YQVA 3R2QA 5IMZA 2QC7A 1SK0A 4PQ1A 1GP1A 3F4TA 3DKSA 2JZSA 1XFLA 4N0ZA 3FKFA 3DMLA 3PR8A 2AJQB 2MYGA 3UEMA 3FZ4A 1C72A 3KD0A 2WFCA 3WD6A 3GV1A 3VPTA 5AISA 1GH2A 5H5RA 2X4AA 2RM6A 2GTUA 2JZTA 1YEXA 1ZYQB 3GKKA 1QUWA 4K0NA 4KUNA 2R5GA 1AAZA 3GH6A 2H1DA 4GSSA 2ON5A 5JWOB 1KNGA 1T00A 3ZMLA 4GXZA 5CAXA 3VPQA 4J56E 3GTUA 2H30A 4GQCA 3GTUB 3EMPA 2HRNA 5ECHB 2H72A 5JWQB 1BQ7A 2RUFA 1VGLA 4ZBBA 4X43A 5F07A 1XWKA 4MMMA 2CAIA 2LRTA 3VURA 5ECMB 2XPEA 1PN0A 1CQGA 2DMLA 4MZCA 2IMFA 1SJ6A 5D96A 1GSEA 2RM5A 2GVPA 2ES7A 3F3RA 3LYKA 4PURA 1Y6EA 1TJDA 5B6MA 4I6XA 4K8MA 3MYDA 5ECPB 1AQVA 1O8WA 2DJ1A 5AN1A 2C3NA 2VL2C 4ZXGA 3DGQA 1AXDA 3UBKA 3NZNA 4HZ4A 3A2VA 2FWGA 2OBKA 2YZUA 1OKDA 1B9XC 3K8NA 4AF2A 1AQXA 1AQWA 3VWVA 3HZ4A 3RHCA 1OYJA 3KEBA 4FH8A 5ECIB 3TOUA 2IMKA 2J9HA 3HVXA 2C8UA 4GLTA 3VWXA 2CQ9A 3HD5A 2KOKA 4BWSA 3HCZA 3GA4A 1F9MA 1M0UA 1HNAA 3CSJA 1GLQA 2P5RA 1EWXA 2JL4A 2OKAA 2L4QA 2N5FA 2ZNMA 4XIHA 4MNNA 3V1WA 2A2SA 2NVLA 3SBCA 4PXOA 1QMVA 2PERA 5CRDA 1TK5B 1QGVA 4OCEA 1PA3A 2GQKA 1GSUA 5D9TA 4POLA 1O73A 5ECKB 1YZXA 1OC8A 3D4MA 4CDOA 1EGRA 5D93A 2PN8A 1FAAA 4ID0A 3IK9A 1T4ZA 1O6JA 1Z6MA 2V6OA 3VI5A 5HFGA 4PTSA 4FQUA 4QQ7A 5IPHA 1ZYPA 2X8GA 4JRRA 4Q5FA 2CAQA 1GRXA 2F51A 1XBSA 3BD2A 1A24A 3TUEA 3QR6A 3C1SA 2K8VA 1SD9A 1GLPA 4IBPA 1S3CA 3EU3A 3APSA 4PX1A 2DKIA 3GUSA 2FLSA 3FMWA 3Q19A 2VLVA 1BG5A 4XRAA 1EV4A 1F3BA 1GTUA 3HYPA 3VWUA 5B7CA 3M8NA 2PU9C 2CX4A 1GNEA 4LL4B 3TB2A 1Z7PA 4BVXA 5LCZA 3TRXA 2LSTA 4BVXB 6GSUA 1TRSA 3FR9A 4HU7A 1M9AA 4HS1A 1XW9A 4L0WA 2YANA 1TP9A 1T8EB 2D2ZA 4IKHA 2I4AA 1XXUA 1LU4A 1SJZA 1YJ6A 2XBIA 1WJKA 5JWRB 5ECLB 3GL3A 1MDKA 5E4WA 3EC3A 1XW5A 2JSYA 1PKZA 5DCHA 2MMAA 1HYUA 2H75A 2LV3A 4MF6A 3IPZA 4DSQA 1EEJA 1AIUA 1SYRA 2MMOA 2VCVA 2A2PA 1GSFA 3D4TA 4CW9A 2L59A 3GNJA 1R7HA 3VFIA 1PSQA 5J3RA 2X64A 4EIPA 2ZUPA 3I69A 4DEJA 3TDGA 2EIOA 3HY2A 4KE3A 1MDJA 1TDIA 2V32A 2A4HA 1A8LA 1R4WA 2HFDA 1GSQA 3WT2A 3EYTA 1S3AA 5ENUA 3TKPA 5J5NA 1AUCA 4ZIJA 4PNGA 2GSSA 1U87A 3ZVJD 4MPFA 3BOAA 5CYYA 1O81A 4F0CA 1ZGNA 4ZB6A 3FY7A 4RQRA 2R4VA 2WS2A 2LEGA 2VL3A 4OFNA 1G7EA 4ZL9A 3LGCA 5ID2A 1F37A 2G0FA 2NPBA 2XC2A 2H1AA 3MIXA 2L57A 1A23A 3L4NA 4MF5A 2L6CA 2VM1A 3A5WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VD0 A;  3G9B A;  2DJ0 A;  3UJ1 A;  2OJL A;  2H70 A;  3BJ5 A;  4EDZ A;  1TI1 A;  2GS3 A;  1YDK A;  1RQM A;  2DSA A;  1G6Y A;  4KB3 A;  2FD3 A;  3HJP A;  5G1K A;  4LL1 B;  4POM A;  5HR0 A;  2B7J A;  1WE0 A;  2Z9S A;  3BCI A;  2YP6 A;  5G5E A;  2OE1 A;  2CA8 A;  2FGX A;  2V41 A;  2OAD A;  16GS A;  3L78 A;  3MSZ A;  1PX6 A;  3EWL A;  4RUV A;  1YF1 A;  1GUM A;  3CRT A;  3UAR A;  2KP1 A;  4Z7X A;  2YV9 A;  1KBN A;  5DQY A;  1SYX A;  1GNW A;  2E2M A;  1XPV A;  5IMF A;  4HQS A;  1AW9 A;  5AIV A;  4TRX A;  3EE2 A;  3I6A A;  2CZ2 A;  1Z3E A;  3FZ9 A;  1NM3 A;  4QL9 A;  1WWJ A;  3KM6 A;  3TJJ A;  4N0V A;  5HQP A;  5CRG A;  4KSO A;  4EVM A;  1NSW A;  2R6K A;  1AC1 A;  4ISD A;  1V57 A;  3TJG A;  5EPF A;  3M3M A;  4ECC A;  10GS A;  1W4V A;  5GST A;  3D0Z A;  3HVV A;  2DMM A;  2PVO C;  3W6G A;  2PPT A;  2K18 A;  3DVX A;  3U6V A;  2TRX A;  4KSM A;  3GH9 A;  5A4U A;  3IC4 A;  5F05 A;  1XWC A;  5CO3 A;  1I9D A;  3ZLP A;  4MH3 A;  1EGO A;  2H6Z A;  3ERG A;  3C8E A;  3M9K A;  2X8H A;  1SK2 A;  1OE7 A;  5F06 A;  1UC7 A;  4MF7 A;  5HR3 A;  1A2L A;  3IBH A;  2MMZ A;  4O5R A;  1GTA A;  4WR4 A;  5IMV A;  4K2D A;  3GRX A;  3I43 A;  4MJB A;  4MA9 A;  2L4C A;  3QPM A;  1NHY A;  1Z9H A;  5A4V A;  4G19 A;  3GSS A;  4MH2 A;  1LJR A;  2OBI A;  5DJM A;  3JCM L;  2IPA A;  2B1L A;  2P0G A;  1FOV A;  3FR3 A;  4O7H A;  3O76 A;  1ERW A;  2WB9 A;  2C3T A;  2X8C A;  3CBU A;  1Q98 A;  1VF2 A;  4IW9 A;  4EKZ A;  1J9B A;  3ED3 A;  4IJI A;  2YJH A;  1XW6 A;  4ECI A;  1J08 A;  3PGT A;  4I5Q A;  3HDC A;  4DVC A;  1O7U A;  2GST A;  3HJM A;  17GS A;  4KAE A;  4LLR A;  1SL0 B;  4YH2 A;  1I5G A;  2YZH A;  6GSS A;  4ZL7 A;  2HSY A;  4V1A p;  1PD2 1;  4XCS A;  1E2Y A;  1DE2 A;  4MJA A;  2QKE A;  3EUR A;  2O8V B;  4YAV A;  2H1G A;  1ABA A;  3ZVJ A;  3DXB A;  4MLY A;  1JZW A;  3HVS A;  5E59 A;  2YNX A;  4FYU A;  1NHO A;  1ON4 A;  4V2N A;  3ZFL A;  1V58 A;  1TK8 B;  4MK3 A;  2CZ3 A;  3EIN A;  5LNK e;  4AJ8 A;  4F03 A;  2JU5 A;  4XS6 A;  3IRA A;  1SEN A;  1GSS A;  2I81 A;  4WEY A;  3EVI A;  3DYR A;  2H71 A;  2V1M A;  3Q18 A;  5DQS A;  3TKR A;  2EIQ A;  4JBB A;  2ON7 A;  5HR2 A;  2I1U A;  1H75 A;  2NBS A;  3E9J B;  3RHB A;  4PQH A;  5IMC A;  1B48 A;  4EDY A;  2YPM A;  3L9V A;  4HU9 A;  4IN0 A;  3KH7 A;  1JZD A;  4F2I A;  2GT6 A;  1MD3 A;  3I9V 2;  3GX0 A;  5DVB A;  4TR4 A;  4WF5 A;  4Q5R A;  1MDI A;  2A2R A;  4MCU A;  1OC9 A;  7GSS A;  1VF4 A;  4KW6 A;  2C0E A;  1TW9 A;  4X0X A;  2P31 A;  3L9U A;  1OC9 B;  3LQ7 A;  3AY8 A;  4V2L A;  5ELA A;  5IO2 A;  4WR5 A;  5AIX A;  5LD0 A;  1ZL9 A;  6GSX A;  3GMF A;  4KGI A;  2HYX A;  1U6T A;  4MDC A;  1ERV A;  5G31 A;  3QOU A;  1M2D A;  1K0N A;  1THX A;  1WPI A;  2LQQ A;  3GUR A;  4K1F A;  3ZL5 A;  2DIY A;  3UMA A;  5D73 A;  4Q5N A;  1GTI A;  3F6D A;  4IP6 A;  3F6F A;  5C04 A;  4PNF A;  1M7T A;  3KP8 A;  2H76 A;  3G7J A;  3TKS E;  4ECB A;  4WBR D;  1PRX A;  2IFQ A;  2K6V A;  2VAF A;  1JLW A;  3ERF A;  1TXX A;  2IFQ B;  3KIJ A;  4ECJ A;  4NPB A;  4GF0 A;  1QK8 A;  5DAL A;  4D73 A;  11GS A;  4F9Z A;  4YQM A;  1N8J A;  5DAL B;  4D73 B;  1FB0 A;  1YF0 A;  2AYT A;  1PKW A;  5H5S A;  3QDN A;  1PQN A;  2OE3 A;  2WDU A;  4TW5 A;  5IQY A;  2C1Y A;  5B8B A;  2NTO A;  1G0T A;  4G10 A;  2LKU A;  5DCG A;  1MTC A;  5GZZ B;  3WYW A;  5G5F A;  4MJE A;  4RQX A;  3C71 A;  3LJR A;  3IDV A;  3VWW A;  5JCU A;  4AJ7 A;  3PH9 A;  3H93 A;  4HJM A;  4EE0 A;  3VI7 A;  1G6W A;  4XHM A;  4JED A;  1URM A;  2R2J A;  1IYH A;  4KDX A;  2AB6 A;  4OFM A;  5EY6 A;  4ILF A;  3LG6 A;  4F82 A;  2KLX A;  3CMI A;  1K0O A;  2NDO A;  1X0R A;  6GSY A;  1GWC A;  2GDR A;  3WGX A;  2IMD A;  2C0D A;  1X9M B;  3GHA A;  5DBQ A;  4NHZ A;  1X5E A;  1M2B A;  2FHE A;  4ML6 A;  4HZ2 A;  5L71 A;  1TTZ A;  3MWH A;  5DDL A;  2KUC A;  4CHS A;  2YJ7 A;  2VLT A;  4IS0 A;  2VIM A;  1H4O A;  1GSY A;  3F4S A;  3TRQ A;  4V1A g;  4XS1 A;  2KP2 A;  2LUS A;  1GSD A;  1V9W A;  4MJC A;  4J2F A;  1SL2 B;  1YY7 A;  1T7P B;  2OA7 A;  5ELG A;  3KP9 A;  5G1L A;  2B7K A;  1XWB A;  4O32 A;  1K0A A;  2B5E A;  2VCQ A;  5D8I A;  2M46 A;  4E8E A;  5J9C A;  4GWR A;  3CYN A;  1YKC A;  3G7Y A;  1CQH A;  3ZZX A;  3KJY A;  5J41 A;  4OFT A;  1TU7 A;  4HUA A;  2C0G A;  2E0Q A;  2FWE A;  1K3Y A;  1ZCP A;  3D21 A;  3FZA A;  1KTE A;  1SK1 A;  2GLR A;  4I2T A;  4L5O A;  2YCD A;  1OAZ A;  1GUK A;  5CRW A;  2F8F A;  2BJX A;  2OAC A;  1K0C A;  1JZO A;  3ZTL A;  4NAX A;  5DJL A;  1Z7R A;  5KN3 A;  5IMA A;  2LNT A;  2L6D A;  1TU8 A;  4HOJ A;  1O8X A;  2RLI A;  2F8A A;  1YQ1 A;  3P8W A;  4GSN A;  4KDY A;  2YV7 A;  4WXT A;  1XWA A;  2HT9 A;  4TR1 A;  5CP1 A;  1RW1 A;  3QD9 A;  4YQU A;  3BBY A;  4TR1 B;  2C4J A;  5D9W A;  3GN3 A;  1FB6 A;  3TGZ A;  3IXR A;  1XIY A;  2MMN A;  4MP4 A;  2DJ2 A;  1A2M A;  5ID2 B;  4DSR A;  2RII A;  3E3E A;  5COH A;  3UVT A;  4RI6 A;  3QAW A;  2H1B A;  4I2U A;  2K9F A;  1M9B A;  3US3 A;  2V6K A;  4IP1 A;  4ZIL A;  1QFN A;  5IMD A;  1SKW B;  4K7N A;  1ZMA A;  14GS A;  1MD4 A;  4HJ2 A;  3WGE A;  1TRV A;  1EEM A;  3TCO A;  1K3O A;  1GUH A;  5A4W A;  3HHV A;  2WUL A;  4WBJ A;  3MAK A;  3F9U A;  5D9X A;  1F3A A;  4N11 A;  2I3Y A;  4BA7 A;  2FNO A;  2IN3 A;  1USB A;  2AV4 A;  1PGT A;  1SJI A;  3RAZ A;  2QSI A;  5C00 A;  3ZRE A;  3ZIT A;  6GSW A;  3DRN A;  2REM A;  1OVN A;  3QMX A;  4GTU A;  3FHK A;  4HI7 A;  1MEK A;  3ZYW A;  1K0M A;  2JAC A;  3KZQ A;  2H01 A;  4JZQ A;  1A0F A;  2GQL A;  2CV4 A;  1UN2 A;  1FG4 A;  2HZF A;  2VL2 A;  4TOP A;  1OE8 A;  4IEL A;  2R37 A;  2I9H A;  2O7K A;  1F6M C;  2DJJ A;  4HQZ A;  2F3M A;  5IO0 A;  3H79 A;  1O85 A;  1HD2 A;  2LQO A;  4O92 A;  4OO5 A;  2FA8 A;  1K0B A;  2VO4 A;  2HZE A;  2G2Q A;  1XZO A;  3GIX A;  2HZE B;  2N5B A;  4EC0 A;  2M80 A;  4ZBD A;  3ZRD A;  4NV2 A;  3Q6O A;  2FWH A;  1VRS D;  5JCW A;  3P7X A;  4JR4 A;  1SD8 A;  4TVE A;  3KTL A;  1PX7 A;  3F3Q A;  3TKQ A;  2TIR A;  4KX4 A;  2H66 A;  4OMV A;  1OC3 A;  4DSS A;  3G7I A;  3UBL A;  4BL7 A;  4DSS B;  3IHQ A;  4KH7 A;  2YWM A;  4GRF A;  1UA5 A;  3ME7 A;  2C3Q A;  2RUE A;  1DE1 A;  1PMT A;  3WGD A;  3CTF A;  5D9V A;  1ACV A;  4HDE A;  3LXT A;  1WP0 A;  2GZP A;  4AJ6 A;  4PQI A;  2CVK A;  4V2M A;  2DIZ A;  2DBC A;  2MBT A;  2B5Y A;  4EUY A;  4FIW A;  3M9J A;  4G9H A;  3QAV A;  4K7I A;  2X99 A;  2MZC A;  4ZL8 A;  4ACS A;  1ST9 A;  1XCC A;  3RPN A;  3M0F A;  1XVW A;  2YWN A;  5IIZ A;  3FK8 A;  2DJ3 A;  2GZZ A;  2WZ9 A;  2E2G A;  13GS A;  3SWL A;  4OO4 A;  5IOW A;  2OE0 A;  1OKT A;  3LSZ A;  1M2A A;  3DVW A;  4BPY A;  1ZYE A;  4QL7 A;  1BYE A;  1THO A;  1G7O A;  2JAD A;  1SU9 A;  2CVB A;  5B6N A;  2B5X A;  5ECR B;  3PIN A;  3W8J A;  1X5D A;  4PUF C;  1B4Q A;  2GGT A;  3IAM 2;  2IMI A;  2O85 A;  3GYK A;  4IGJ A;  5CNW A;  3CSH A;  3ZMK A;  3E0U A;  1FW1 A;  3N9J A;  1J0F A;  4OCF A;  2V2G A;  2C80 A;  3NOF A;  5FHI A;  1JHB A;  4Q5Q A;  5INY A;  4TKY A;  1K3L A;  1BED A;  3UVH A;  2PUK C;  2PBJ A;  20GS A;  4NV5 A;  1WOU A;  1FVK A;  2PMT A;  4TN8 A;  3KTB A;  1JFU A;  1A2J A;  5J4U A;  3RPP A;  18GS A;  4H86 A;  1W89 A;  3TKS A;  3VK9 A;  3UAP A;  2BTO T;  2WRT A;  1QQ2 A;  3TOT A;  1WMJ A;  3LOR A;  4N30 A;  4POK A;  2H0G A;  1SL1 B;  2R3X A;  2MBS A;  3A2X A;  4BWQ A;  2O89 A;  3BCK A;  2QGV A;  3HA9 A;  1HQO A;  4FO5 A;  2DJK A;  2PGT A;  2VCT A;  1QXH A;  5IPG A;  4K7O A;  4IQA A;  5CRH A;  19GS A;  1XVQ A;  2FWF A;  5B8A A;  1EP8 A;  4ZB9 A;  3N5O A;  3L9S A;  1N2A A;  4KDU A;  3HKR A;  5GSS A;  4ZB8 A;  1M99 A;  2GSR A;  2F9S A;  3ISO A;  2EIR A;  4XS4 A;  1XOA A;  4XS4 B;  2A4V A;  2C0F A;  1DBY A;  2H73 A;  3DWV A;  3QFB C;  4WKW A;  2HNL A;  3IR4 A;  2VL9 A;  4K9Z A;  2CT6 A;  3TJK A;  1TK0 B;  2VCX A;  3O6T A;  5A5K A;  2VD1 A;  5IM9 A;  1U3I A;  3ZFB A;  2LTK A;  3IE3 A;  3IOS A;  5J9B A;  2WGR A;  3GKM A;  1DSB A;  2LRC A;  2O87 A;  1S3D A;  2BMX A;  4WET A;  1R5P A;  4IVF A;  4ZBA A;  6GST A;  4GQF A;  3C1R A;  2WJU A;  1V2A A;  2YOI A;  4EL1 A;  3WT1 A;  2H0H A;  1ML6 A;  1WRY A;  2TRC P;  2GQM A;  5F0G A;  4G2E A;  1X5C A;  4TR0 A;  4KCA A;  2PWJ A;  1T3B A;  3DD3 A;  4AGS A;  9GSS A;  2CX3 A;  2P5Q A;  5EVO A;  1WIK A;  1LBK A;  5F8B A;  1KEB A;  2YN1 A;  3H8Q A;  2YWO A;  3LYP A;  2VCW A;  1EOG A;  4NMU A;  5ECQ B;  5KN1 A;  4F0B A;  3F4R A;  3KCM A;  3IK7 A;  4K6X A;  3Q74 A;  4NHW A;  5ABR A;  1Q4J A;  2H74 A;  3HZ8 A;  3KGK A;  1B9Y C;  1VF1 A;  1X9W B;  2JSZ A;  3EU4 A;  3P90 A;  5FT3 A;  1ERU A;  1U3A A;  4LA1 A;  5CRE A;  3FW2 A;  1XWG A;  1ERT A;  1EV9 A;  2VM2 A;  3OR5 A;  1BX9 A;  1NW2 A;  6GSV A;  3LXZ A;  1Z6N A;  1PN9 A;  4JU5 A;  1TI3 A;  4EO3 A;  4NWY A;  2IWT A;  2WCI A;  4HEA 2;  5GAP D;  1E6B A;  1BAY A;  2PVQ A;  1FHE A;  2LS5 A;  2HXK A;  3QAG A;  1EOH A;  4LMV A;  3ZIJ A;  3DIE A;  1R26 A;  2LJK A;  1FO5 A;  2AHE A;  2FA4 A;  3GST A;  2L5O A;  4BVY A;  1TRU A;  3A2W A;  3APO A;  3D22 A;  2E7P A;  3IA1 A;  1VF3 A;  5ECS A;  2H0I A;  3FYG A;  4I97 A;  4N10 A;  1HNB A;  2YWI A;  3S9F A;  1ILO A;  1YKA A;  1TOF A;  3MDK A;  2HI7 A;  3DEX A;  2HE3 A;  3KXO A;  1TRW A;  4E8H A;  3TKS C;  1JZR A;  5HFI A;  1T4Y A;  2ALB A;  1FVJ A;  5KN2 A;  1JLV A;  3TRP A;  2DC5 A;  4JE1 A;  1EZK A;  3KH9 A;  4I8B A;  3NIV A;  1ZOF A;  3RDW A;  22GS A;  1TKD B;  2IL3 A;  4XRD A;  4JR6 A;  4NXI A;  3F63 A;  1SKS B;  4FYC A;  2H8L A;  5ECO B;  3FRC A;  4KCE A;  3W8S A;  2XPD A;  3J7Y b;  3IV4 A;  2KHP A;  1YEP A;  2B6M A;  4L5L A;  3MNG A;  2LJA A;  4MZB A;  2J23 A;  3F8U A;  2GSQ A;  4KND A;  1SKR B;  4ULX A;  2LNS A;  1IYI A;  4P3Y B;  3UOM A;  5HFK A;  4OD7 A;  4MZW A;  5IOX A;  4IQ1 A;  2CVD A;  3TJF A;  4FYB A;  2K8S A;  3CXG A;  2DLX A;  5H5Q A;  4RI7 A;  3GFK A;  3QCP A;  1A8Y A;  1A0R P;  4IJ3 A;  4YAP A;  3J7Y k;  3U5R E;  1RK4 A;  4ML1 A;  8GSS A;  5AGY A;  2HRF A;  3TJB A;  5KN0 A;  3F0I A;  4PUA A;  2GT5 A;  5FWG A;  3D5J A;  4XTS A;  1Z5Y E;  2L5L A;  3KMN A;  4TXO A;  3CSI A;  1ZZY A;  4J57 E;  4TXO B;  2VLU A;  2H6X A;  3H1N A;  1Y25 A;  5DAK A;  1HNC A;  3HJO A;  1T1V A;  4PGT A;  4IHU A;  2FUG 2;  1PL1 A;  4KA0 A;  5DAK B;  2FY6 A;  1BJX A;  1GUL A;  2IJY A;  3C7M A;  1DUG A;  2N5A A;  1PL2 A;  2H6Y A;  1B4P A;  3C73 A;  1V98 A;  2IME A;  4POB A;  3APQ A;  1X9S B;  3O3T A;  1B8X A;  2M72 A;  5ECN B;  2HSH A;  2IIY A;  3H4K A;  3IAS 2;  1EP7 A;  2LRN A;  3LFL A;  4L0U A;  5HR1 A;  3D6I A;  3L0H A;  1V40 A;  4LMW A;  3HXS A;  3M1G A;  5G30 A;  1U88 A;  4MAB A;  5JCG A;  3ZIV A;  4GST A;  1R5A A;  3GL5 A;  3GKX A;  2ZCT A;  3P2A A;  12GS A;  4GCI A;  5GAN D;  2LJR A;  5KEJ A;  2AUV A;  3GX8 A;  5G2Z A;  4EXJ A;  4WF4 A;  3QFA C;  3LEF A;  3FR6 A;  1GTB A;  2VCZ A;  3A3T A;  4L8E A;  2B1K A;  2JZR A;  2XBQ A;  1XOB A;  2VOC A;  2H19 A;  2B3S A;  3CRU A;  2VUP A;  4MPG A;  2GZY A;  3GKN A;  4OWY A;  5EL8 A;  3RBT A;  3UIW A;  1UVZ A;  2XHF A;  3CTG A;  4TR3 A;  4X1U A;  2FCH A;  2HLS A;  2AAW A;  3ME8 A;  1F2E A;  3LWA A;  1GL8 A;  3EMX A;  2EC4 A;  3FEU A;  1K0D A;  3KMO A;  3ERW A;  4EF0 A;  3FZ5 A;  3UL3 A;  3VLN A;  4TXV A;  4K0G A;  4YQV A;  3R2Q A;  5IMZ A;  2QC7 A;  1SK0 A;  4PQ1 A;  1GP1 A;  3F4T A;  3DKS A;  2JZS A;  1XFL A;  4N0Z A;  3FKF A;  3DML A;  3PR8 A;  2AJQ B;  2MYG A;  3UEM A;  3FZ4 A;  1C72 A;  3KD0 A;  2WFC A;  3WD6 A;  3GV1 A;  3VPT A;  5AIS A;  1GH2 A;  5H5R A;  2RM6 A;  2GTU A;  2JZT A;  1YEX A;  1ZYQ B;  3GKK A;  1QUW A;  4K0N A;  4KUN A;  2R5G A;  1AAZ A;  3GH6 A;  2H1D A;  4GSS A;  2ON5 A;  5JWO B;  1KNG A;  1T00 A;  3ZML A;  4GXZ A;  5CAX A;  3VPQ A;  4J56 E;  3GTU A;  2H30 A;  4GQC A;  3GTU B;  3EMP A;  2HRN A;  5ECH B;  2H72 A;  5JWQ B;  1BQ7 A;  2RUF A;  1VGL A;  4ZBB A;  4X43 A;  5F07 A;  1XWK A;  4MMM A;  2CAI A;  2LRT A;  3VUR A;  5ECM B;  2XPE A;  1CQG A;  2DML A;  4MZC A;  2IMF A;  1SJ6 A;  5D96 A;  1GSE A;  2RM5 A;  2GVP A;  2ES7 A;  3F3R A;  3LYK A;  4PUR A;  1Y6E A;  1TJD A;  5B6M A;  4I6X A;  4K8M A;  5ECP B;  1AQV A;  1O8W A;  2DJ1 A;  5AN1 A;  2C3N A;  2VL2 C;  4ZXG A;  3DGQ A;  1AXD A;  3UBK A;  3NZN A;  4HZ4 A;  3A2V A;  2FWG A;  2OBK A;  2YZU A;  1OKD A;  1B9X C;  3K8N A;  4AF2 A;  1AQX A;  1AQW A;  3VWV A;  3HZ4 A;  3RHC A;  1OYJ A;  3KEB A;  4FH8 A;  5ECI B;  3TOU A;  2IMK A;  2J9H A;  3HVX A;  2C8U A;  4GLT A;  3VWX A;  2CQ9 A;  3HD5 A;  2KOK A;  4BWS A;  3HCZ A;  3GA4 A;  1F9M A;  1M0U A;  1HNA A;  3CSJ A;  1GLQ A;  2P5R A;  1EWX A;  2JL4 A;  2OKA A;  2L4Q A;  2N5F A;  2ZNM A;  4XIH A;  3V1W A;  2A2S A;  2NVL A;  3SBC A;  4PXO A;  1QMV A;  2PER A;  5CRD A;  1TK5 B;  1QGV A;  4OCE A;  1PA3 A;  2GQK A;  1GSU A;  5D9T A;  4POL A;  1O73 A;  5ECK B;  1YZX A;  1OC8 A;  3D4M A;  4CDO A;  1EGR A;  5D93 A;  2PN8 A;  1FAA A;  4ID0 A;  3IK9 A;  1T4Z A;  1O6J A;  1Z6M A;  2V6O A;  3VI5 A;  5HFG A;  4QQ7 A;  5IPH A;  2X8G A;  4JRR A;  4Q5F A;  2CAQ A;  1GRX A;  2F51 A;  1XBS A;  3BD2 A;  1A24 A;  3TUE A;  3QR6 A;  3C1S A;  2K8V A;  1SD9 A;  1GLP A;  4IBP A;  1S3C A;  3EU3 A;  3APS A;  4PX1 A;  3GUS A;  2FLS A;  3Q19 A;  2VLV A;  1BG5 A;  4XRA A;  1EV4 A;  1F3B A;  1GTU A;  3HYP A;  3VWU A;  5B7C A;  3M8N A;  2PU9 C;  2CX4 A;  1GNE A;  4LL4 B;  3TB2 A;  1Z7P A;  4BVX A;  5LCZ A;  3TRX A;  2LST A;  6GSU A;  1TRS A;  3FR9 A;  4HU7 A;  1M9A A;  4HS1 A;  1XW9 A;  4L0W A;  2YAN A;  1TP9 A;  1T8E B;  2D2Z A;  4IKH A;  2I4A A;  1XXU A;  1LU4 A;  1SJZ A;  1YJ6 A;  2XBI A;  1WJK A;  5JWR B;  5ECL B;  3GL3 A;  1MDK A;  5E4W A;  3EC3 A;  1XW5 A;  2JSY A;  1PKZ A;  5DCH A;  2MMA A;  1HYU A;  2H75 A;  2LV3 A;  4MF6 A;  3IPZ A;  4DSQ A;  1EEJ A;  1AIU A;  1SYR A;  2MMO A;  2VCV A;  1GSF A;  3D4T A;  4CW9 A;  2L59 A;  3GNJ A;  1R7H A;  3VFI A;  1PSQ A;  5J3R A;  2X64 A;  2ZUP A;  3I69 A;  4DEJ A;  3TDG A;  2EIO A;  3HY2 A;  4KE3 A;  1MDJ A;  1TDI A;  2V32 A;  1A8L A;  1R4W A;  2HFD A;  1GSQ A;  3WT2 A;  3EYT A;  1S3A A;  5ENU A;  3TKP A;  5J5N A;  1AUC A;  4ZIJ A;  4PNG A;  2GSS A;  1U87 A;  3ZVJ D;  4MPF A;  3BOA A;  5CYY A;  1O81 A;  4F0C A;  1ZGN A;  4ZB6 A;  3FY7 A;  4RQR A;  2R4V A;  2WS2 A;  2LEG A;  2VL3 A;  4OFN A;  1G7E A;  4ZL9 A;  3LGC A;  5ID2 A;  1F37 A;  2G0F A;  2NPB A;  2XC2 A;  2H1A A;  2L57 A;  1A23 A;  3L4N A;  4MF5 A;  2L6C A;  2VM1 A;  3A5W A; 
#chains in the Genus database with same CATH topology
 2VD0 A;  3G9B A;  2DJ0 A;  3UJ1 A;  2OJL A;  2H70 A;  3BJ5 A;  4EDZ A;  1TI1 A;  2GS3 A;  1YDK A;  1RQM A;  2DSA A;  1G6Y A;  4KB3 A;  2FD3 A;  3HJP A;  5G1K A;  4LL1 B;  4O5U A;  4POM A;  5HR0 A;  2B7J A;  1WE0 A;  2Z9S A;  3BCI A;  2YP6 A;  5G5E A;  2OE1 A;  2CA8 A;  2FGX A;  2V41 A;  2OAD A;  16GS A;  3L78 A;  3MSZ A;  1PX6 A;  3EWL A;  4RUV A;  1YF1 A;  1GUM A;  3CRT A;  3UAR A;  2KP1 A;  4Z7X A;  2YV9 A;  1KBN A;  4BIK A;  5DQY A;  1SYX A;  1GNW A;  2E2M A;  1XPV A;  5IMF A;  4HQS A;  1AW9 A;  5AIV A;  4TRX A;  3EE2 A;  3I6A A;  2CZ2 A;  1Z3E A;  3FZ9 A;  1NM3 A;  4QL9 A;  1WWJ A;  3KM6 A;  3TJJ A;  4N0V A;  5HQP A;  5CRG A;  4KSO A;  4EVM A;  1NSW A;  2R6K A;  1AC1 A;  4ISD A;  1V57 A;  3TJG A;  5EPF A;  3M3M A;  4ECC A;  10GS A;  1W4V A;  5GST A;  3D0Z A;  3HVV A;  2DMM A;  2PVO C;  3W6G A;  2PPT A;  2K18 A;  3DVX A;  3U6V A;  2TRX A;  4HSC X;  4KSM A;  3GH9 A;  5A4U A;  3IC4 A;  5F05 A;  1XWC A;  5CO3 A;  1I9D A;  3ZLP A;  4MH3 A;  1EGO A;  2H6Z A;  3ERG A;  3C8E A;  3M9K A;  2X8H A;  1SK2 A;  1OE7 A;  5F06 A;  1UC7 A;  4MF7 A;  5HR3 A;  4CY6 A;  4Z2R A;  1A2L A;  3IBH A;  2MMZ A;  4O5R A;  1GTA A;  4WR4 A;  5IMV A;  4K2D A;  3GRX A;  3I43 A;  4MJB A;  4MA9 A;  2L4C A;  3QPM A;  1NHY A;  1Z9H A;  5A4V A;  4G19 A;  3GSS A;  4MH2 A;  1LJR A;  2OBI A;  5DJM A;  3JCM L;  2IPA A;  2B1L A;  2P0G A;  1FOV A;  3FR3 A;  2QA1 A;  4O7H A;  3O76 A;  1ERW A;  2WB9 A;  2C3T A;  2X8C A;  3CBU A;  1Q98 A;  1VF2 A;  4IW9 A;  4EKZ A;  4Z2U A;  1J9B A;  3ED3 A;  2X49 A;  4IJI A;  2YJH A;  1XW6 A;  4ECI A;  1J08 A;  3PGT A;  3PPU A;  4I5Q A;  3HDC A;  4DVC A;  1O7U A;  2GST A;  3HJM A;  17GS A;  4G0I A;  4KAE A;  4CY8 A;  4LLR A;  2R0G A;  1SL0 B;  4YH2 A;  4Z2T A;  1I5G A;  2YZH A;  6GSS A;  4ZL7 A;  2HSY A;  4V1A p;  1PD2 1;  4XCS A;  1E2Y A;  1DE2 A;  4MJA A;  2QKE A;  3EUR A;  2O8V B;  4YAV A;  2H1G A;  1ABA A;  3ZVJ A;  1M3I A;  3DXB A;  4MLY A;  1JZW A;  3HVS A;  5E59 A;  2YNX A;  4FYU A;  1NHO A;  1ON4 A;  4V2N A;  3ZFL A;  1V58 A;  1TK8 B;  4MK3 A;  2CZ3 A;  3EIN A;  5LNK e;  4AJ8 A;  4F03 A;  2JU5 A;  4XS6 A;  3IRA A;  1SEN A;  1GSS A;  2I81 A;  4WEY A;  3EVI A;  3DYR A;  2H71 A;  2V1M A;  3Q18 A;  5DQS A;  3TKR A;  2EIQ A;  4JBB A;  2ON7 A;  5HR2 A;  2I1U A;  1H75 A;  2NBS A;  3E9J B;  3RHB A;  4PQH A;  2QA2 A;  1B48 A;  5IMC A;  4EDY A;  2YPM A;  3L9V A;  4HU9 A;  4IN0 A;  3KH7 A;  1JZD A;  4F2I A;  2GT6 A;  1MD3 A;  3I9V 2;  3GX0 A;  5DVB A;  4TR4 A;  4WF5 A;  4Q5R A;  1MDI A;  2A2R A;  4MCU A;  1OC9 A;  7GSS A;  1VF4 A;  4KW6 A;  2C0E A;  1TW9 A;  4X0X A;  2P31 A;  3L9U A;  1OC9 B;  3LQ7 A;  3AY8 A;  4V2L A;  5ELA A;  5IO2 A;  4WR5 A;  5AIX A;  5LD0 A;  1ZL9 A;  6GSX A;  3GMF A;  4KGI A;  2HYX A;  1U6T A;  4MDC A;  1ERV A;  5G31 A;  3QOU A;  1M2D A;  1K0N A;  2UZ8 A;  1THX A;  1WPI A;  2LQQ A;  3GUR A;  4K1F A;  3ZL5 A;  2DIY A;  3UMA A;  5D73 A;  4Q5N A;  1GTI A;  3F6D A;  4IP6 A;  3F6F A;  5C04 A;  4PNF A;  1M7T A;  3KP8 A;  2H76 A;  3G7J A;  3TKS E;  4ECB A;  4WBR D;  1PRX A;  2IFQ A;  2K6V A;  2VAF A;  1JLW A;  3ERF A;  1TXX A;  2IFQ B;  3KIJ A;  4ECJ A;  4NPB A;  4GF0 A;  1QK8 A;  5DAL A;  4D73 A;  4K5S A;  11GS A;  4F9Z A;  4YQM A;  1N8J A;  5DAL B;  4D73 B;  1FB0 A;  1YF0 A;  2AYT A;  1PKW A;  5H5S A;  3QDN A;  1PQN A;  2OE3 A;  2WDU A;  4TW5 A;  5IQY A;  2C1Y A;  5B8B A;  2NTO A;  1G0T A;  4G10 A;  2LKU A;  5DCG A;  1MTC A;  5GZZ B;  3WYW A;  5G5F A;  4MJE A;  4RQX A;  3C71 A;  3LJR A;  3IDV A;  5KOW A;  3VWW A;  5JCU A;  4AJ7 A;  3PH9 A;  3H93 A;  4HJM A;  4EE0 A;  3VI7 A;  1G6W A;  4XHM A;  4JED A;  1URM A;  2R2J A;  1IYH A;  4KDX A;  2AB6 A;  4OFM A;  5EY6 A;  4ILF A;  3LG6 A;  4F82 A;  2KLX A;  3CMI A;  1K0O A;  2NDO A;  1X0R A;  6GSY A;  1GWC A;  2GDR A;  3WGX A;  1S3R A;  2IMD A;  2C0D A;  1X9M B;  3GHA A;  5DBQ A;  4NHZ A;  1X5E A;  1M2B A;  2FHE A;  4ML6 A;  4HZ2 A;  5L71 A;  1TTZ A;  3MWH A;  5DDL A;  2KUC A;  4CHS A;  2YJ7 A;  1M3J A;  2HRA A;  2VLT A;  4IS0 A;  4KF9 A;  2VIM A;  1H4O A;  1GSY A;  3F4S A;  3TRQ A;  4V1A g;  4XS1 A;  2KP2 A;  2LUS A;  1GSD A;  1V9W A;  4MJC A;  4J2F A;  1SL2 B;  1YY7 A;  1T7P B;  2OA7 A;  5ELG A;  3KP9 A;  5G1L A;  2B7K A;  1XWB A;  4O32 A;  1K0A A;  2B5E A;  2VCQ A;  5D8I A;  2M46 A;  4E8E A;  5J9C A;  4GWR A;  3CYN A;  1YKC A;  3G7Y A;  1CQH A;  3ZZX A;  4YKG A;  3KJY A;  5J41 A;  4OFT A;  1TU7 A;  4HUA A;  2C0G A;  2E0Q A;  2FWE A;  1K3Y A;  1ZCP A;  3D21 A;  3FZA A;  1KTE A;  1SK1 A;  2GLR A;  4I2T A;  4L5O A;  2YCD A;  1OAZ A;  1GUK A;  5CRW A;  2F8F A;  2BJX A;  2OAC A;  1K0C A;  1JZO A;  3ZTL A;  4NAX A;  3LW9 A;  5DJL A;  1Z7R A;  5KN3 A;  5IMA A;  2LNT A;  2L6D A;  1TU8 A;  4HOJ A;  1O8X A;  2RLI A;  2F8A A;  1YQ1 A;  3P8W A;  4GSN A;  4KDY A;  2YV7 A;  4WXT A;  1XWA A;  2HT9 A;  5KOX A;  4TR1 A;  5CP1 A;  1RW1 A;  3QD9 A;  4YQU A;  3IC8 A;  3BBY A;  4TR1 B;  2C4J A;  5D9W A;  3GN3 A;  1FB6 A;  3TGZ A;  3IXR A;  1XIY A;  2MMN A;  4MP4 A;  2DKH A;  2DJ2 A;  1A2M A;  5ID2 B;  4DSR A;  2RII A;  3E3E A;  5COH A;  3UVT A;  4RI6 A;  3QAW A;  2H1B A;  4I2U A;  2K9F A;  1M9B A;  3US3 A;  2V6K A;  4IP1 A;  1ZYN A;  4ZIL A;  1QFN A;  5IMD A;  1SKW B;  4K7N A;  1ZMA A;  14GS A;  1MD4 A;  3EPT A;  4HJ2 A;  3WGE A;  1TRV A;  1EEM A;  5BRT A;  3TCO A;  1K3O A;  1GUH A;  5A4W A;  3HHV A;  2WUL A;  4WBJ A;  3MAK A;  3F9U A;  5D9X A;  1F3A A;  4N11 A;  2I3Y A;  4BA7 A;  2FNO A;  2IN3 A;  1USB A;  2AV4 A;  1PGT A;  1SJI A;  4G0K A;  3RAZ A;  2QSI A;  5C00 A;  3ZRE A;  3ZIT A;  6GSW A;  3DRN A;  2REM A;  1OVN A;  3QMX A;  4GTU A;  3FHK A;  4HI7 A;  1MEK A;  3ZYW A;  1K0M A;  2JAC A;  3KZQ A;  2H01 A;  4JZQ A;  1A0F A;  2GQL A;  2CV4 A;  1UN2 A;  1FG4 A;  2HZF A;  2VL2 A;  4TOP A;  1OE8 A;  4IEL A;  2R37 A;  2I9H A;  2O7K A;  1F6M C;  2DJJ A;  4HQZ A;  2F3M A;  5IO0 A;  3H79 A;  1O85 A;  1HD2 A;  2LQO A;  4O92 A;  4OO5 A;  2FA8 A;  1K0B A;  2VO4 A;  2HZE A;  2G2Q A;  4A5P A;  1XZO A;  3GIX A;  2HZE B;  2N5B A;  4EC0 A;  2M80 A;  4ZBD A;  3ZRD A;  4NV2 A;  4G0L A;  3Q6O A;  2FWH A;  1VRS D;  5JCW A;  3P7X A;  4JR4 A;  1SD8 A;  4TVE A;  3KTL A;  1PX7 A;  3CQF A;  3F3Q A;  3TKQ A;  2TIR A;  4KX4 A;  2H66 A;  4OMV A;  1OC3 A;  4DSS A;  3G7I A;  3UBL A;  4BL7 A;  4DSS B;  3IHQ A;  4BL7 B;  4KH7 A;  2YWM A;  4GRF A;  1UA5 A;  3ME7 A;  2C3Q A;  2HRK A;  2RUE A;  1DE1 A;  1PMT A;  3WGD A;  3CTF A;  5D9V A;  1ACV A;  4HDE A;  3LXT A;  1WP0 A;  2GZP A;  4AJ6 A;  4PQI A;  2CVK A;  4V2M A;  2DIZ A;  2DBC A;  2MBT A;  2B5Y A;  4EUY A;  4FIW A;  3M9J A;  4G9H A;  3QAV A;  4K7I A;  2X99 A;  2MZC A;  4ZL8 A;  4ACS A;  1ST9 A;  1XCC A;  3RPN A;  4X4J A;  3M0F A;  3IHG A;  1XVW A;  2YWN A;  5IIZ A;  3FK8 A;  2DJ3 A;  2GZZ A;  2WZ9 A;  2E2G A;  13GS A;  3SWL A;  4OO4 A;  5IOW A;  2OE0 A;  1OKT A;  3LSZ A;  1M2A A;  3DVW A;  4BPY A;  1ZYE A;  4QL7 A;  1BYE A;  1THO A;  1G7O A;  2JAD A;  1SU9 A;  2CVB A;  5B6N A;  2B5X A;  5ECR B;  3PIN A;  3W8J A;  1X5D A;  4PUF C;  1B4Q A;  2GGT A;  4EIQ A;  3IAM 2;  2IMI A;  2O85 A;  3GYK A;  4IGJ A;  5CNW A;  3CSH A;  3ZMK A;  3E0U A;  1FW1 A;  4YKF A;  3N9J A;  1J0F A;  4OCF A;  2V2G A;  2C80 A;  3NOF A;  5FHI A;  1JHB A;  4Q5Q A;  5INY A;  4TKY A;  1K3L A;  1BED A;  3UVH A;  2PUK C;  2PBJ A;  20GS A;  4NV5 A;  1WOU A;  1FVK A;  2PMT A;  4TN8 A;  3KTB A;  1JFU A;  1A2J A;  5J4U A;  3RPP A;  18GS A;  4H86 A;  1W89 A;  3TKS A;  3VK9 A;  3UAP A;  2BTO T;  2WRT A;  1QQ2 A;  3TOT A;  1WMJ A;  3LOR A;  4N30 A;  4POK A;  2H0G A;  1SL1 B;  2R3X A;  2MBS A;  3A2X A;  4BWQ A;  2O89 A;  3BCK A;  2QGV A;  3HA9 A;  1HQO A;  4FO5 A;  2DJK A;  2PGT A;  2VCT A;  1QXH A;  5IPG A;  4K7O A;  4IQA A;  5CRH A;  19GS A;  1XVQ A;  2FWF A;  5B8A A;  1EP8 A;  4ZB9 A;  3N5O A;  3L9S A;  1N2A A;  4KDU A;  3HKR A;  3R3E A;  5GSS A;  2R0C A;  4ZB8 A;  1M99 A;  2GSR A;  2F9S A;  3ISO A;  2EIR A;  4XS4 A;  1XOA A;  4XS4 B;  2A4V A;  2C0F A;  1DBY A;  2H73 A;  3DWV A;  3QFB C;  4WKW A;  2HNL A;  3IR4 A;  2VL9 A;  4K9Z A;  2CT6 A;  3TJK A;  1TK0 B;  2VCX A;  3O6T A;  5A5K A;  2VD1 A;  5IM9 A;  1U3I A;  3ZFB A;  2LTK A;  3IE3 A;  3IOS A;  5J9B A;  2WGR A;  3GKM A;  1DSB A;  2LRC A;  2O87 A;  5BMU A;  1S3D A;  2BMX A;  4WET A;  4K2X A;  1R5P A;  4IVF A;  4ZBA A;  6GST A;  4GQF A;  3C1R A;  2WJU A;  1V2A A;  2YOI A;  4EL1 A;  3WT1 A;  2H0H A;  1ML6 A;  1WRY A;  2TRC P;  2GQM A;  5F0G A;  4G2E A;  1X5C A;  4TR0 A;  4KCA A;  2PWJ A;  1T3B A;  3DD3 A;  4AGS A;  9GSS A;  2CX3 A;  2P5Q A;  5EVO A;  1WIK A;  1LBK A;  5F8B A;  1KEB A;  2YN1 A;  3H8Q A;  2YWO A;  3LYP A;  2VCW A;  1EOG A;  4NMU A;  5ECQ B;  5KN1 A;  4F0B A;  3F4R A;  3KCM A;  3IK7 A;  4K6X A;  3Q74 A;  4NHW A;  5ABR A;  1Q4J A;  2H74 A;  3HZ8 A;  3KGK A;  1B9Y C;  1VF1 A;  4K5R A;  1X9W B;  2JSZ A;  3EU4 A;  3P90 A;  5FT3 A;  4ICY A;  1ERU A;  1U3A A;  5CRE A;  4LA1 A;  3FW2 A;  1XWG A;  1ERT A;  1EV9 A;  2VM2 A;  3OR5 A;  1BX9 A;  1NW2 A;  6GSV A;  3LXZ A;  1Z6N A;  1PN9 A;  4JU5 A;  1TI3 A;  4EO3 A;  4NWY A;  2IWT A;  2WCI A;  4HEA 2;  5GAP D;  2HSM A;  1E6B A;  1BAY A;  2PVQ A;  1FHE A;  2LS5 A;  2HXK A;  3QAG A;  1EOH A;  4LMV A;  3ZIJ A;  3DIE A;  1R26 A;  2LJK A;  1FO5 A;  2AHE A;  2FA4 A;  3GST A;  2L5O A;  4BVY A;  1TRU A;  3A2W A;  3APO A;  3D22 A;  2E7P A;  3IA1 A;  1VF3 A;  5ECS A;  2H0I A;  3FYG A;  4I97 A;  4N10 A;  1HNB A;  4BVY B;  2YWI A;  3S9F A;  1ILO A;  1YKA A;  1TOF A;  3MDK A;  2HI7 A;  3DEX A;  2HE3 A;  3KXO A;  1TRW A;  4E8H A;  3TKS C;  1JZR A;  5HFI A;  1T4Y A;  2ALB A;  1FVJ A;  5KN2 A;  1JLV A;  2R0P A;  3TRP A;  2DC5 A;  4JE1 A;  1EZK A;  3KH9 A;  4I8B A;  3NIV A;  1ZOF A;  3RDW A;  22GS A;  1TKD B;  2IL3 A;  4XRD A;  4JR6 A;  4NXI A;  3F63 A;  1SKS B;  4FYC A;  2H8L A;  5ECO B;  3FRC A;  4KCE A;  3W8S A;  2XPD A;  3J7Y b;  3IV4 A;  2KHP A;  1YEP A;  2B6M A;  4L5L A;  3MNG A;  2LJA A;  4MZB A;  4USS A;  2J23 A;  3F8U A;  2GSQ A;  4KND A;  1SKR B;  4ULX A;  2LNS A;  1IYI A;  4P3Y B;  3UOM A;  5HFK A;  4OD7 A;  4MZW A;  5IOX A;  4IQ1 A;  2CVD A;  3TJF A;  4FYB A;  2K8S A;  3CXG A;  2DLX A;  5H5Q A;  4RI7 A;  3GFK A;  3QCP A;  1A8Y A;  1A0R P;  4IJ3 A;  4YAP A;  3J7Y k;  3U5R E;  1RK4 A;  4ML1 A;  8GSS A;  5AGY A;  2HRF A;  3TJB A;  3HVN A;  3A5I A;  5KN0 A;  3F0I A;  4PUA A;  2GT5 A;  5FWG A;  3D5J A;  4XTS A;  1Z5Y E;  2L5L A;  3KMN A;  4TXO A;  3CSI A;  1ZZY A;  4J57 E;  4TXO B;  2VLU A;  2H6X A;  3H1N A;  1Y25 A;  5DAK A;  1HNC A;  3HJO A;  1T1V A;  4PGT A;  4IHU A;  2FUG 2;  1PL1 A;  4KA0 A;  5DAK B;  2FY6 A;  1BJX A;  1GUL A;  2IJY A;  3C7M A;  1DUG A;  2N5A A;  1PL2 A;  2H6Y A;  1B4P A;  3C73 A;  1V98 A;  1FOH A;  2IME A;  4POB A;  3APQ A;  1X9S B;  3O3T A;  1B8X A;  2M72 A;  5ECN B;  2HSH A;  2IIY A;  3H4K A;  3IAS 2;  1EP7 A;  2LRN A;  3LFL A;  4L0U A;  4O5Q A;  5HR1 A;  3D6I A;  3L0H A;  1V40 A;  4LMW A;  3HXS A;  3M1G A;  5G30 A;  1U88 A;  4MAB A;  5JCG A;  3ZIV A;  4GST A;  1R5A A;  3GL5 A;  3GKX A;  2ZCT A;  3P2A A;  12GS A;  4GCI A;  5GAN D;  2LJR A;  5KEJ A;  2AUV A;  3GX8 A;  5G2Z A;  4EXJ A;  4WF4 A;  3QFA C;  3LEF A;  3FR6 A;  1GTB A;  2VCZ A;  3A3T A;  4L8E A;  2B1K A;  2JZR A;  2XBQ A;  1XOB A;  2VOC A;  2H19 A;  2B3S A;  3CRU A;  2VUP A;  4MPG A;  2GZY A;  3GKN A;  4OWY A;  5EL8 A;  3RBT A;  3UIW A;  1UVZ A;  2XHF A;  3CTG A;  4TR3 A;  4X1U A;  2FCH A;  2HLS A;  2AAW A;  3ME8 A;  1F2E A;  3LWA A;  1GL8 A;  3EMX A;  2EC4 A;  3FEU A;  1K0D A;  3KMO A;  3ERW A;  4EF0 A;  3FZ5 A;  3UL3 A;  3VLN A;  4TXV A;  4K0G A;  4YQV A;  3R2Q A;  5IMZ A;  2QC7 A;  1SK0 A;  4PQ1 A;  1GP1 A;  3F4T A;  3DKS A;  2JZS A;  1XFL A;  4N0Z A;  3FKF A;  3DML A;  3PR8 A;  2AJQ B;  2MYG A;  3UEM A;  3FZ4 A;  1C72 A;  1PFO A;  3KD0 A;  2WFC A;  3WD6 A;  3GV1 A;  3VPT A;  5AIS A;  1GH2 A;  5H5R A;  2X4A A;  2RM6 A;  2GTU A;  2JZT A;  1YEX A;  1ZYQ B;  3GKK A;  1QUW A;  4K0N A;  4KUN A;  2R5G A;  1AAZ A;  3GH6 A;  2H1D A;  4GSS A;  2ON5 A;  5JWO B;  1KNG A;  1T00 A;  3ZML A;  4GXZ A;  5CAX A;  3VPQ A;  4J56 E;  3GTU A;  2H30 A;  4GQC A;  3GTU B;  3EMP A;  2HRN A;  5ECH B;  2H72 A;  5JWQ B;  1BQ7 A;  2RUF A;  1VGL A;  4ZBB A;  4X43 A;  5F07 A;  1XWK A;  4MMM A;  2CAI A;  2LRT A;  3VUR A;  5ECM B;  2XPE A;  1PN0 A;  1CQG A;  2DML A;  4MZC A;  2IMF A;  1SJ6 A;  5D96 A;  1GSE A;  2RM5 A;  2GVP A;  2ES7 A;  3F3R A;  3LYK A;  4PUR A;  1Y6E A;  1TJD A;  5B6M A;  4I6X A;  4K8M A;  3MYD A;  5ECP B;  1AQV A;  1O8W A;  2DJ1 A;  5AN1 A;  2C3N A;  2VL2 C;  4ZXG A;  3DGQ A;  1AXD A;  3UBK A;  3NZN A;  4HZ4 A;  3A2V A;  2FWG A;  2OBK A;  2YZU A;  1OKD A;  1B9X C;  3K8N A;  4AF2 A;  1AQX A;  1AQW A;  3VWV A;  3HZ4 A;  3RHC A;  1OYJ A;  3KEB A;  4FH8 A;  5ECI B;  3TOU A;  2IMK A;  2J9H A;  3HVX A;  2C8U A;  4GLT A;  3VWX A;  2CQ9 A;  3HD5 A;  2KOK A;  4BWS A;  3HCZ A;  3GA4 A;  1F9M A;  1M0U A;  1HNA A;  3CSJ A;  1GLQ A;  2P5R A;  1EWX A;  2JL4 A;  2OKA A;  2L4Q A;  2N5F A;  2ZNM A;  4XIH A;  4MNN A;  3V1W A;  2A2S A;  2NVL A;  3SBC A;  4PXO A;  1QMV A;  2PER A;  5CRD A;  1TK5 B;  1QGV A;  4OCE A;  1PA3 A;  2GQK A;  1GSU A;  5D9T A;  4POL A;  1O73 A;  5ECK B;  1YZX A;  1OC8 A;  3D4M A;  4CDO A;  1EGR A;  5D93 A;  2PN8 A;  1FAA A;  4ID0 A;  3IK9 A;  1T4Z A;  1O6J A;  1Z6M A;  2V6O A;  3VI5 A;  5HFG A;  4PTS A;  4FQU A;  4QQ7 A;  5IPH A;  1ZYP A;  2X8G A;  4JRR A;  4Q5F A;  2CAQ A;  1GRX A;  2F51 A;  1XBS A;  3BD2 A;  1A24 A;  3TUE A;  3QR6 A;  3C1S A;  2K8V A;  1SD9 A;  1GLP A;  4IBP A;  1S3C A;  3EU3 A;  3APS A;  4PX1 A;  2DKI A;  3GUS A;  2FLS A;  3FMW A;  3Q19 A;  2VLV A;  1BG5 A;  4XRA A;  1EV4 A;  1F3B A;  1GTU A;  3HYP A;  3VWU A;  5B7C A;  3M8N A;  2PU9 C;  2CX4 A;  1GNE A;  4LL4 B;  3TB2 A;  1Z7P A;  4BVX A;  5LCZ A;  3TRX A;  2LST A;  4BVX B;  6GSU A;  1TRS A;  3FR9 A;  4HU7 A;  1M9A A;  4HS1 A;  1XW9 A;  4L0W A;  2YAN A;  1TP9 A;  1T8E B;  2D2Z A;  4IKH A;  2I4A A;  1XXU A;  1LU4 A;  1SJZ A;  1YJ6 A;  2XBI A;  1WJK A;  5JWR B;  5ECL B;  3GL3 A;  1MDK A;  5E4W A;  3EC3 A;  1XW5 A;  2JSY A;  1PKZ A;  5DCH A;  2MMA A;  1HYU A;  2H75 A;  2LV3 A;  4MF6 A;  3IPZ A;  4DSQ A;  1EEJ A;  1AIU A;  1SYR A;  2MMO A;  2VCV A;  2A2P A;  1GSF A;  3D4T A;  4CW9 A;  2L59 A;  3GNJ A;  1R7H A;  3VFI A;  1PSQ A;  5J3R A;  2X64 A;  4EIP A;  2ZUP A;  3I69 A;  4DEJ A;  3TDG A;  2EIO A;  3HY2 A;  4KE3 A;  1MDJ A;  1TDI A;  2V32 A;  2A4H A;  1A8L A;  1R4W A;  2HFD A;  1GSQ A;  3WT2 A;  3EYT A;  1S3A A;  5ENU A;  3TKP A;  5J5N A;  1AUC A;  4ZIJ A;  4PNG A;  2GSS A;  1U87 A;  3ZVJ D;  4MPF A;  3BOA A;  5CYY A;  1O81 A;  4F0C A;  1ZGN A;  4ZB6 A;  3FY7 A;  4RQR A;  2R4V A;  2WS2 A;  2LEG A;  2VL3 A;  4OFN A;  1G7E A;  4ZL9 A;  3LGC A;  5ID2 A;  1F37 A;  2G0F A;  2NPB A;  2XC2 A;  1XG8 A;  2H1A A;  3MIX A;  2L57 A;  1A23 A;  3L4N A;  4MF5 A;  2L6C A;  2VM1 A;  3A5W A; 
#chains in the Genus database with same CATH homology
 2VD0 A;  3G9B A;  2DJ0 A;  3UJ1 A;  2OJL A;  2H70 A;  3BJ5 A;  4EDZ A;  1TI1 A;  2GS3 A;  1YDK A;  1RQM A;  2DSA A;  1G6Y A;  4KB3 A;  2FD3 A;  3HJP A;  5G1K A;  4LL1 B;  4O5U A;  4POM A;  5HR0 A;  2B7J A;  1WE0 A;  2Z9S A;  3BCI A;  2YP6 A;  5G5E A;  2OE1 A;  2CA8 A;  2FGX A;  2V41 A;  2OAD A;  16GS A;  3L78 A;  3MSZ A;  1PX6 A;  3EWL A;  4RUV A;  1YF1 A;  1GUM A;  3CRT A;  3UAR A;  2KP1 A;  4Z7X A;  2YV9 A;  1KBN A;  5DQY A;  1SYX A;  1GNW A;  2E2M A;  1XPV A;  5IMF A;  4HQS A;  1AW9 A;  5AIV A;  4TRX A;  3EE2 A;  3I6A A;  2CZ2 A;  1Z3E A;  3FZ9 A;  1NM3 A;  4QL9 A;  1WWJ A;  3KM6 A;  3TJJ A;  4N0V A;  5HQP A;  5CRG A;  4KSO A;  4EVM A;  1NSW A;  2R6K A;  1AC1 A;  4ISD A;  1V57 A;  3TJG A;  5EPF A;  3M3M A;  4ECC A;  10GS A;  1W4V A;  5GST A;  3D0Z A;  3HVV A;  2DMM A;  2PVO C;  3W6G A;  2PPT A;  2K18 A;  3DVX A;  3U6V A;  2TRX A;  4KSM A;  3GH9 A;  5A4U A;  3IC4 A;  5F05 A;  1XWC A;  5CO3 A;  1I9D A;  3ZLP A;  4MH3 A;  1EGO A;  2H6Z A;  3ERG A;  3C8E A;  3M9K A;  2X8H A;  1SK2 A;  1OE7 A;  5F06 A;  1UC7 A;  4MF7 A;  5HR3 A;  4CY6 A;  4Z2R A;  1A2L A;  3IBH A;  2MMZ A;  4O5R A;  1GTA A;  4WR4 A;  5IMV A;  4K2D A;  3GRX A;  3I43 A;  4MJB A;  4MA9 A;  2L4C A;  3QPM A;  1NHY A;  1Z9H A;  5A4V A;  4G19 A;  3GSS A;  4MH2 A;  1LJR A;  2OBI A;  5DJM A;  3JCM L;  2IPA A;  2B1L A;  2P0G A;  1FOV A;  3FR3 A;  2QA1 A;  4O7H A;  3O76 A;  1ERW A;  2WB9 A;  2C3T A;  2X8C A;  3CBU A;  1Q98 A;  1VF2 A;  4IW9 A;  4EKZ A;  4Z2U A;  1J9B A;  3ED3 A;  2X49 A;  4IJI A;  2YJH A;  1XW6 A;  4ECI A;  1J08 A;  3PGT A;  3PPU A;  4I5Q A;  3HDC A;  4DVC A;  1O7U A;  2GST A;  3HJM A;  17GS A;  4G0I A;  4KAE A;  4CY8 A;  4LLR A;  2R0G A;  1SL0 B;  4YH2 A;  4Z2T A;  1I5G A;  2YZH A;  6GSS A;  4ZL7 A;  2HSY A;  4V1A p;  1PD2 1;  4XCS A;  1E2Y A;  1DE2 A;  4MJA A;  2QKE A;  3EUR A;  2O8V B;  4YAV A;  2H1G A;  1ABA A;  3ZVJ A;  3DXB A;  4MLY A;  1JZW A;  3HVS A;  5E59 A;  2YNX A;  4FYU A;  1NHO A;  1ON4 A;  4V2N A;  3ZFL A;  1V58 A;  1TK8 B;  4MK3 A;  2CZ3 A;  3EIN A;  5LNK e;  4AJ8 A;  4F03 A;  2JU5 A;  4XS6 A;  3IRA A;  1SEN A;  1GSS A;  2I81 A;  4WEY A;  3EVI A;  3DYR A;  2H71 A;  2V1M A;  3Q18 A;  5DQS A;  3TKR A;  2EIQ A;  4JBB A;  2ON7 A;  5HR2 A;  2I1U A;  1H75 A;  2NBS A;  3E9J B;  3RHB A;  4PQH A;  2QA2 A;  1B48 A;  5IMC A;  4EDY A;  2YPM A;  3L9V A;  4HU9 A;  4IN0 A;  3KH7 A;  1JZD A;  4F2I A;  2GT6 A;  1MD3 A;  3I9V 2;  3GX0 A;  5DVB A;  4TR4 A;  4WF5 A;  4Q5R A;  1MDI A;  2A2R A;  4MCU A;  1OC9 A;  7GSS A;  1VF4 A;  4KW6 A;  2C0E A;  1TW9 A;  4X0X A;  2P31 A;  3L9U A;  1OC9 B;  3LQ7 A;  3AY8 A;  4V2L A;  5ELA A;  5IO2 A;  4WR5 A;  5AIX A;  5LD0 A;  1ZL9 A;  6GSX A;  3GMF A;  4KGI A;  2HYX A;  1U6T A;  4MDC A;  1ERV A;  5G31 A;  3QOU A;  1M2D A;  1K0N A;  2UZ8 A;  1THX A;  1WPI A;  2LQQ A;  3GUR A;  4K1F A;  3ZL5 A;  2DIY A;  3UMA A;  5D73 A;  4Q5N A;  1GTI A;  3F6D A;  4IP6 A;  3F6F A;  5C04 A;  4PNF A;  1M7T A;  3KP8 A;  2H76 A;  3G7J A;  3TKS E;  4ECB A;  4WBR D;  1PRX A;  2IFQ A;  2K6V A;  2VAF A;  1JLW A;  3ERF A;  1TXX A;  2IFQ B;  3KIJ A;  4ECJ A;  4NPB A;  4GF0 A;  1QK8 A;  5DAL A;  4D73 A;  4K5S A;  11GS A;  4F9Z A;  4YQM A;  1N8J A;  5DAL B;  4D73 B;  1FB0 A;  1YF0 A;  2AYT A;  1PKW A;  5H5S A;  3QDN A;  1PQN A;  2OE3 A;  2WDU A;  4TW5 A;  5IQY A;  2C1Y A;  5B8B A;  2NTO A;  1G0T A;  4G10 A;  2LKU A;  5DCG A;  1MTC A;  5GZZ B;  3WYW A;  5G5F A;  4MJE A;  4RQX A;  3C71 A;  3LJR A;  3IDV A;  5KOW A;  3VWW A;  5JCU A;  4AJ7 A;  3PH9 A;  3H93 A;  4HJM A;  4EE0 A;  3VI7 A;  1G6W A;  4XHM A;  4JED A;  1URM A;  2R2J A;  1IYH A;  4KDX A;  2AB6 A;  4OFM A;  5EY6 A;  4ILF A;  3LG6 A;  4F82 A;  2KLX A;  3CMI A;  1K0O A;  2NDO A;  1X0R A;  6GSY A;  1GWC A;  2GDR A;  3WGX A;  2IMD A;  2C0D A;  1X9M B;  3GHA A;  5DBQ A;  4NHZ A;  1X5E A;  1M2B A;  2FHE A;  4ML6 A;  4HZ2 A;  5L71 A;  1TTZ A;  3MWH A;  5DDL A;  2KUC A;  4CHS A;  2YJ7 A;  2HRA A;  2VLT A;  4IS0 A;  4KF9 A;  2VIM A;  1H4O A;  1GSY A;  3F4S A;  3TRQ A;  4V1A g;  4XS1 A;  2KP2 A;  2LUS A;  1GSD A;  1V9W A;  4MJC A;  4J2F A;  1SL2 B;  1YY7 A;  1T7P B;  2OA7 A;  5ELG A;  3KP9 A;  5G1L A;  2B7K A;  1XWB A;  4O32 A;  1K0A A;  2B5E A;  2VCQ A;  5D8I A;  2M46 A;  4E8E A;  5J9C A;  4GWR A;  3CYN A;  1YKC A;  3G7Y A;  1CQH A;  3ZZX A;  4YKG A;  3KJY A;  5J41 A;  4OFT A;  1TU7 A;  4HUA A;  2C0G A;  2E0Q A;  2FWE A;  1K3Y A;  1ZCP A;  3D21 A;  3FZA A;  1KTE A;  1SK1 A;  2GLR A;  4I2T A;  4L5O A;  2YCD A;  1OAZ A;  1GUK A;  5CRW A;  2F8F A;  2BJX A;  2OAC A;  1K0C A;  1JZO A;  3ZTL A;  4NAX A;  3LW9 A;  5DJL A;  1Z7R A;  5KN3 A;  5IMA A;  2LNT A;  2L6D A;  1TU8 A;  4HOJ A;  1O8X A;  2RLI A;  2F8A A;  1YQ1 A;  3P8W A;  4GSN A;  4KDY A;  2YV7 A;  4WXT A;  1XWA A;  2HT9 A;  5KOX A;  4TR1 A;  5CP1 A;  1RW1 A;  3QD9 A;  4YQU A;  3IC8 A;  3BBY A;  4TR1 B;  2C4J A;  5D9W A;  3GN3 A;  1FB6 A;  3TGZ A;  3IXR A;  1XIY A;  2MMN A;  4MP4 A;  2DKH A;  2DJ2 A;  1A2M A;  5ID2 B;  4DSR A;  2RII A;  3E3E A;  5COH A;  3UVT A;  4RI6 A;  3QAW A;  2H1B A;  4I2U A;  2K9F A;  1M9B A;  3US3 A;  2V6K A;  4IP1 A;  1ZYN A;  4ZIL A;  1QFN A;  5IMD A;  1SKW B;  4K7N A;  1ZMA A;  14GS A;  1MD4 A;  3EPT A;  4HJ2 A;  3WGE A;  1TRV A;  1EEM A;  5BRT A;  3TCO A;  1K3O A;  1GUH A;  5A4W A;  3HHV A;  2WUL A;  4WBJ A;  3MAK A;  3F9U A;  5D9X A;  1F3A A;  4N11 A;  2I3Y A;  4BA7 A;  2FNO A;  2IN3 A;  1USB A;  2AV4 A;  1PGT A;  1SJI A;  4G0K A;  3RAZ A;  2QSI A;  5C00 A;  3ZRE A;  3ZIT A;  6GSW A;  3DRN A;  2REM A;  1OVN A;  3QMX A;  4GTU A;  3FHK A;  4HI7 A;  1MEK A;  3ZYW A;  1K0M A;  2JAC A;  3KZQ A;  2H01 A;  4JZQ A;  1A0F A;  2GQL A;  2CV4 A;  1UN2 A;  1FG4 A;  2HZF A;  2VL2 A;  4TOP A;  1OE8 A;  4IEL A;  2R37 A;  2I9H A;  2O7K A;  1F6M C;  2DJJ A;  4HQZ A;  2F3M A;  5IO0 A;  3H79 A;  1O85 A;  1HD2 A;  2LQO A;  4O92 A;  4OO5 A;  2FA8 A;  1K0B A;  2VO4 A;  2HZE A;  2G2Q A;  4A5P A;  1XZO A;  3GIX A;  2HZE B;  2N5B A;  4EC0 A;  2M80 A;  4ZBD A;  3ZRD A;  4NV2 A;  4G0L A;  3Q6O A;  2FWH A;  1VRS D;  5JCW A;  3P7X A;  4JR4 A;  1SD8 A;  4TVE A;  3KTL A;  1PX7 A;  3F3Q A;  3TKQ A;  2TIR A;  4KX4 A;  2H66 A;  4OMV A;  1OC3 A;  4DSS A;  3G7I A;  3UBL A;  4BL7 A;  4DSS B;  3IHQ A;  4BL7 B;  4KH7 A;  2YWM A;  4GRF A;  1UA5 A;  3ME7 A;  2C3Q A;  2HRK A;  2RUE A;  1DE1 A;  1PMT A;  3WGD A;  3CTF A;  5D9V A;  1ACV A;  4HDE A;  3LXT A;  1WP0 A;  2GZP A;  4AJ6 A;  4PQI A;  2CVK A;  4V2M A;  2DIZ A;  2DBC A;  2MBT A;  2B5Y A;  4EUY A;  4FIW A;  3M9J A;  4G9H A;  3QAV A;  4K7I A;  2X99 A;  2MZC A;  4ZL8 A;  4ACS A;  1ST9 A;  1XCC A;  3RPN A;  4X4J A;  3M0F A;  3IHG A;  1XVW A;  2YWN A;  5IIZ A;  3FK8 A;  2DJ3 A;  2GZZ A;  2WZ9 A;  2E2G A;  13GS A;  3SWL A;  4OO4 A;  5IOW A;  2OE0 A;  1OKT A;  3LSZ A;  1M2A A;  3DVW A;  4BPY A;  1ZYE A;  4QL7 A;  1BYE A;  1THO A;  1G7O A;  2JAD A;  1SU9 A;  2CVB A;  5B6N A;  2B5X A;  5ECR B;  3PIN A;  3W8J A;  1X5D A;  4PUF C;  1B4Q A;  2GGT A;  4EIQ A;  3IAM 2;  2IMI A;  2O85 A;  3GYK A;  4IGJ A;  5CNW A;  3CSH A;  3ZMK A;  3E0U A;  1FW1 A;  4YKF A;  3N9J A;  1J0F A;  4OCF A;  2V2G A;  2C80 A;  3NOF A;  5FHI A;  1JHB A;  4Q5Q A;  5INY A;  4TKY A;  1K3L A;  1BED A;  3UVH A;  2PUK C;  2PBJ A;  20GS A;  4NV5 A;  1WOU A;  1FVK A;  2PMT A;  4TN8 A;  3KTB A;  1JFU A;  1A2J A;  5J4U A;  3RPP A;  18GS A;  4H86 A;  1W89 A;  3TKS A;  3VK9 A;  3UAP A;  2BTO T;  2WRT A;  1QQ2 A;  3TOT A;  1WMJ A;  3LOR A;  4N30 A;  4POK A;  2H0G A;  1SL1 B;  2R3X A;  2MBS A;  3A2X A;  4BWQ A;  2O89 A;  3BCK A;  2QGV A;  3HA9 A;  1HQO A;  4FO5 A;  2DJK A;  2PGT A;  2VCT A;  1QXH A;  5IPG A;  4K7O A;  4IQA A;  5CRH A;  19GS A;  1XVQ A;  2FWF A;  5B8A A;  1EP8 A;  4ZB9 A;  3N5O A;  3L9S A;  1N2A A;  4KDU A;  3HKR A;  3R3E A;  5GSS A;  2R0C A;  4ZB8 A;  1M99 A;  2GSR A;  2F9S A;  3ISO A;  2EIR A;  4XS4 A;  1XOA A;  4XS4 B;  2A4V A;  2C0F A;  1DBY A;  2H73 A;  3DWV A;  3QFB C;  4WKW A;  2HNL A;  3IR4 A;  2VL9 A;  4K9Z A;  2CT6 A;  3TJK A;  1TK0 B;  2VCX A;  3O6T A;  5A5K A;  2VD1 A;  5IM9 A;  1U3I A;  3ZFB A;  2LTK A;  3IE3 A;  3IOS A;  5J9B A;  2WGR A;  3GKM A;  1DSB A;  2LRC A;  2O87 A;  5BMU A;  1S3D A;  2BMX A;  4WET A;  4K2X A;  1R5P A;  4IVF A;  4ZBA A;  6GST A;  4GQF A;  3C1R A;  2WJU A;  1V2A A;  2YOI A;  4EL1 A;  3WT1 A;  2H0H A;  1ML6 A;  1WRY A;  2TRC P;  2GQM A;  5F0G A;  4G2E A;  1X5C A;  4TR0 A;  4KCA A;  2PWJ A;  1T3B A;  3DD3 A;  4AGS A;  9GSS A;  2CX3 A;  2P5Q A;  5EVO A;  1WIK A;  1LBK A;  5F8B A;  1KEB A;  2YN1 A;  3H8Q A;  2YWO A;  3LYP A;  2VCW A;  1EOG A;  4NMU A;  5ECQ B;  5KN1 A;  4F0B A;  3F4R A;  3KCM A;  3IK7 A;  4K6X A;  3Q74 A;  4NHW A;  5ABR A;  1Q4J A;  2H74 A;  3HZ8 A;  3KGK A;  1B9Y C;  1VF1 A;  4K5R A;  1X9W B;  2JSZ A;  3EU4 A;  3P90 A;  5FT3 A;  4ICY A;  1ERU A;  1U3A A;  5CRE A;  4LA1 A;  3FW2 A;  1XWG A;  1ERT A;  1EV9 A;  2VM2 A;  3OR5 A;  1BX9 A;  1NW2 A;  6GSV A;  3LXZ A;  1Z6N A;  1PN9 A;  4JU5 A;  1TI3 A;  4EO3 A;  4NWY A;  2IWT A;  2WCI A;  4HEA 2;  5GAP D;  2HSM A;  1E6B A;  1BAY A;  2PVQ A;  1FHE A;  2LS5 A;  2HXK A;  3QAG A;  1EOH A;  4LMV A;  3ZIJ A;  3DIE A;  1R26 A;  2LJK A;  1FO5 A;  2AHE A;  2FA4 A;  3GST A;  2L5O A;  4BVY A;  1TRU A;  3A2W A;  3APO A;  3D22 A;  2E7P A;  3IA1 A;  1VF3 A;  5ECS A;  2H0I A;  3FYG A;  4I97 A;  4N10 A;  1HNB A;  4BVY B;  2YWI A;  3S9F A;  1ILO A;  1YKA A;  1TOF A;  3MDK A;  2HI7 A;  3DEX A;  2HE3 A;  3KXO A;  1TRW A;  4E8H A;  3TKS C;  1JZR A;  5HFI A;  1T4Y A;  2ALB A;  1FVJ A;  5KN2 A;  1JLV A;  2R0P A;  3TRP A;  2DC5 A;  4JE1 A;  1EZK A;  3KH9 A;  4I8B A;  3NIV A;  1ZOF A;  3RDW A;  22GS A;  1TKD B;  2IL3 A;  4XRD A;  4JR6 A;  4NXI A;  3F63 A;  1SKS B;  4FYC A;  2H8L A;  5ECO B;  3FRC A;  4KCE A;  3W8S A;  2XPD A;  3J7Y b;  3IV4 A;  2KHP A;  1YEP A;  2B6M A;  4L5L A;  3MNG A;  2LJA A;  4MZB A;  4USS A;  2J23 A;  3F8U A;  2GSQ A;  4KND A;  1SKR B;  4ULX A;  2LNS A;  1IYI A;  4P3Y B;  3UOM A;  5HFK A;  4OD7 A;  4MZW A;  5IOX A;  4IQ1 A;  2CVD A;  3TJF A;  4FYB A;  2K8S A;  3CXG A;  2DLX A;  5H5Q A;  4RI7 A;  3GFK A;  3QCP A;  1A8Y A;  1A0R P;  4IJ3 A;  4YAP A;  3J7Y k;  3U5R E;  1RK4 A;  4ML1 A;  8GSS A;  5AGY A;  2HRF A;  3TJB A;  3A5I A;  5KN0 A;  3F0I A;  4PUA A;  2GT5 A;  5FWG A;  3D5J A;  4XTS A;  1Z5Y E;  2L5L A;  3KMN A;  4TXO A;  3CSI A;  1ZZY A;  4J57 E;  4TXO B;  2VLU A;  2H6X A;  3H1N A;  1Y25 A;  5DAK A;  1HNC A;  3HJO A;  1T1V A;  4PGT A;  4IHU A;  2FUG 2;  1PL1 A;  4KA0 A;  5DAK B;  2FY6 A;  1BJX A;  1GUL A;  2IJY A;  3C7M A;  1DUG A;  2N5A A;  1PL2 A;  2H6Y A;  1B4P A;  3C73 A;  1V98 A;  1FOH A;  2IME A;  4POB A;  3APQ A;  1X9S B;  3O3T A;  1B8X A;  2M72 A;  5ECN B;  2HSH A;  2IIY A;  3H4K A;  3IAS 2;  1EP7 A;  2LRN A;  3LFL A;  4L0U A;  4O5Q A;  5HR1 A;  3D6I A;  3L0H A;  1V40 A;  4LMW A;  3HXS A;  3M1G A;  5G30 A;  1U88 A;  4MAB A;  5JCG A;  3ZIV A;  4GST A;  1R5A A;  3GL5 A;  3GKX A;  2ZCT A;  3P2A A;  12GS A;  4GCI A;  5GAN D;  2LJR A;  5KEJ A;  2AUV A;  3GX8 A;  5G2Z A;  4EXJ A;  4WF4 A;  3QFA C;  3LEF A;  3FR6 A;  1GTB A;  2VCZ A;  3A3T A;  4L8E A;  2B1K A;  2JZR A;  2XBQ A;  1XOB A;  2VOC A;  2H19 A;  2B3S A;  3CRU A;  2VUP A;  4MPG A;  2GZY A;  3GKN A;  4OWY A;  5EL8 A;  3RBT A;  3UIW A;  1UVZ A;  2XHF A;  3CTG A;  4TR3 A;  4X1U A;  2FCH A;  2HLS A;  2AAW A;  3ME8 A;  1F2E A;  3LWA A;  1GL8 A;  3EMX A;  2EC4 A;  3FEU A;  1K0D A;  3KMO A;  3ERW A;  4EF0 A;  3FZ5 A;  3UL3 A;  3VLN A;  4TXV A;  4K0G A;  4YQV A;  3R2Q A;  5IMZ A;  2QC7 A;  1SK0 A;  4PQ1 A;  1GP1 A;  3F4T A;  3DKS A;  2JZS A;  1XFL A;  4N0Z A;  3FKF A;  3DML A;  3PR8 A;  2AJQ B;  2MYG A;  3UEM A;  3FZ4 A;  1C72 A;  3KD0 A;  2WFC A;  3WD6 A;  3GV1 A;  3VPT A;  5AIS A;  1GH2 A;  5H5R A;  2X4A A;  2RM6 A;  2GTU A;  2JZT A;  1YEX A;  1ZYQ B;  3GKK A;  1QUW A;  4K0N A;  4KUN A;  2R5G A;  1AAZ A;  3GH6 A;  2H1D A;  4GSS A;  2ON5 A;  5JWO B;  1KNG A;  1T00 A;  3ZML A;  4GXZ A;  5CAX A;  3VPQ A;  4J56 E;  3GTU A;  2H30 A;  4GQC A;  3GTU B;  3EMP A;  2HRN A;  5ECH B;  2H72 A;  5JWQ B;  1BQ7 A;  2RUF A;  1VGL A;  4ZBB A;  4X43 A;  5F07 A;  1XWK A;  4MMM A;  2CAI A;  2LRT A;  3VUR A;  5ECM B;  2XPE A;  1PN0 A;  1CQG A;  2DML A;  4MZC A;  2IMF A;  1SJ6 A;  5D96 A;  1GSE A;  2RM5 A;  2GVP A;  2ES7 A;  3F3R A;  3LYK A;  4PUR A;  1Y6E A;  1TJD A;  5B6M A;  4I6X A;  4K8M A;  3MYD A;  5ECP B;  1AQV A;  1O8W A;  2DJ1 A;  5AN1 A;  2C3N A;  2VL2 C;  4ZXG A;  3DGQ A;  1AXD A;  3UBK A;  3NZN A;  4HZ4 A;  3A2V A;  2FWG A;  2OBK A;  2YZU A;  1OKD A;  1B9X C;  3K8N A;  4AF2 A;  1AQX A;  1AQW A;  3VWV A;  3HZ4 A;  3RHC A;  1OYJ A;  3KEB A;  4FH8 A;  5ECI B;  3TOU A;  2IMK A;  2J9H A;  3HVX A;  2C8U A;  4GLT A;  3VWX A;  2CQ9 A;  3HD5 A;  2KOK A;  4BWS A;  3HCZ A;  3GA4 A;  1F9M A;  1M0U A;  1HNA A;  3CSJ A;  1GLQ A;  2P5R A;  1EWX A;  2JL4 A;  2OKA A;  2L4Q A;  2N5F A;  2ZNM A;  4XIH A;  4MNN A;  3V1W A;  2A2S A;  2NVL A;  3SBC A;  4PXO A;  1QMV A;  2PER A;  5CRD A;  1TK5 B;  1QGV A;  4OCE A;  1PA3 A;  2GQK A;  1GSU A;  5D9T A;  4POL A;  1O73 A;  5ECK B;  1YZX A;  1OC8 A;  3D4M A;  4CDO A;  1EGR A;  5D93 A;  2PN8 A;  1FAA A;  4ID0 A;  3IK9 A;  1T4Z A;  1O6J A;  1Z6M A;  2V6O A;  3VI5 A;  5HFG A;  4PTS A;  4FQU A;  4QQ7 A;  5IPH A;  1ZYP A;  2X8G A;  4JRR A;  4Q5F A;  2CAQ A;  1GRX A;  2F51 A;  1XBS A;  3BD2 A;  1A24 A;  3TUE A;  3QR6 A;  3C1S A;  2K8V A;  1SD9 A;  1GLP A;  4IBP A;  1S3C A;  3EU3 A;  3APS A;  4PX1 A;  2DKI A;  3GUS A;  2FLS A;  3FMW A;  3Q19 A;  2VLV A;  1BG5 A;  4XRA A;  1EV4 A;  1F3B A;  1GTU A;  3HYP A;  3VWU A;  5B7C A;  3M8N A;  2PU9 C;  2CX4 A;  1GNE A;  4LL4 B;  3TB2 A;  1Z7P A;  4BVX A;  5LCZ A;  3TRX A;  2LST A;  4BVX B;  6GSU A;  1TRS A;  3FR9 A;  4HU7 A;  1M9A A;  4HS1 A;  1XW9 A;  4L0W A;  2YAN A;  1TP9 A;  1T8E B;  2D2Z A;  4IKH A;  2I4A A;  1XXU A;  1LU4 A;  1SJZ A;  1YJ6 A;  2XBI A;  1WJK A;  5JWR B;  5ECL B;  3GL3 A;  1MDK A;  5E4W A;  3EC3 A;  1XW5 A;  2JSY A;  1PKZ A;  5DCH A;  2MMA A;  1HYU A;  2H75 A;  2LV3 A;  4MF6 A;  3IPZ A;  4DSQ A;  1EEJ A;  1AIU A;  1SYR A;  2MMO A;  2VCV A;  2A2P A;  1GSF A;  3D4T A;  4CW9 A;  2L59 A;  3GNJ A;  1R7H A;  3VFI A;  1PSQ A;  5J3R A;  2X64 A;  4EIP A;  2ZUP A;  3I69 A;  4DEJ A;  3TDG A;  2EIO A;  3HY2 A;  4KE3 A;  1MDJ A;  1TDI A;  2V32 A;  2A4H A;  1A8L A;  1R4W A;  2HFD A;  1GSQ A;  3WT2 A;  3EYT A;  1S3A A;  5ENU A;  3TKP A;  5J5N A;  1AUC A;  4ZIJ A;  4PNG A;  2GSS A;  1U87 A;  3ZVJ D;  4MPF A;  3BOA A;  5CYY A;  1O81 A;  4F0C A;  1ZGN A;  4ZB6 A;  3FY7 A;  4RQR A;  2R4V A;  2WS2 A;  2LEG A;  2VL3 A;  4OFN A;  1G7E A;  4ZL9 A;  3LGC A;  5ID2 A;  1F37 A;  2G0F A;  2NPB A;  2XC2 A;  2H1A A;  3MIX A;  2L57 A;  1A23 A;  3L4N A;  4MF5 A;  2L6C A;  2VM1 A;  3A5W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...