3IRAA

The crystal structure of one domain of the conserved protein from methanosarcina mazei go1
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
172
structure length
172
Chain Sequence
AEPNRLIKEKSPYLLQHAYNPVDWYPWGEEAFEKARKENKPVFLSIGYSTCHWCHMMAHESFEDEEVAGLMNEAFVSIKVDREERPDIDNIYMTVCQIILGRGGWPLNIIMTPGKKPFFAGTYIPKNTRFNQIGMLELVPRIKEIWEQQHEEVLDSAEKITSTIQEMIKESS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Conserved protein
publication title The crystal structure of one domain of the conserved protein from Methanosarcina mazei Go1
rcsb
source organism Methanosarcina mazei
molecule tags Structural genomics, unknown function
total genus 50
structure length 172
sequence length 172
ec nomenclature
pdb deposition date 2009-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03190 Thioredox_DsbH Protein of unknown function, DUF255
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3iraA00
2M80A 4D73B 3IBHA 2CA8A 1X5DA 5B6MA 2CQ9A 2HNLA 1F3AA 5F07A 1OAZA 1Z7RA 4EDYA 4NMUA 2FGXA 1XW5A 5CRDA 3DKSA 1OC9B 3E0UA 4I8BA 1JFUA 2HRNA 2VCXA 4EO3A 2JADA 5DALB 4F2IA 4TR1A 4OCEA 1A2JA 4XS1A 3WD6A 3K8NA 4MJAA 3HCZA 2I9HA 2C0GA 5ELAA 3TKPA 5EVOA 3ERWA 5IMFA 3HVXA 5DAKA 5H5RA 3E9JB 4WXTA 4HJMA 4QL9A 3CRUA 2X99A 5INYA 5J9BA 2OACA 3DD3A 2C0EA 1GSFA 4MA9A 2DJKA 1QUWA 2VO4A 2BTOT 2WULA 3BOAA 1ML6A 2FY6A 1EP7A 5EY6A 4JZQA 1XWKA 4K9ZA 1KEBA 2B5XA 2Z9SA 2FWEA 1HQOA 4PUFC 4POKA 2N5BA 2RM6A 3SBCA 3APOA 1BQ7A 2C8UA 3KM6A 2HI7A 4XS4B 2N5AA 3FK8A 1XCCA 1I5GA 3HJPA 2C80A 3TRPA 5AISA 5EL8A 2H70A 4LL4B 3ISOA 5HR2A 4L0UA 3ZRDA 3DVWA 1SJ6A 3GV1A 4DSSA 3BBYA 2HSYA 4V1Ag 5D73A 4GLTA 3WGDA 3KEBA 4F0BA 1SL2B 3VURA 1GUHA 4OFNA 4G2EA 1PKWA 2H72A 1Z5YE 3GNJA 1U3AA 3FZ5A 4LMWA 3J7Yb 4O5RA 3F9UA 1YZXA 1B9YC 2CVBA 2JZRA 2IN3A 3QOUA 5F06A 2B7JA 2MZCA 2VLVA 2YN1A 1MD4A 1A8YA 2VD0A 4TXOB 2X8CA 4ZIJA 1WRYA 3IOSA 4PNFA 3L4NA 1ZYEA 1ZMAA 1GNWA 2H73A 2PN8A 4K0GA 5IPHA 4KSMA 2MMOA 2I1UA 3DGQA 2CX4A 2DJ1A 4POLA 1TI3A 4PUAA 1SKSB 4JR4A 1GH2A 2FNOA 3M9KA 3HVSA 1NHOA 2H0GA 1C72A 4K7IA 2H0HA 3CTFA 4KCEA 2FHEA 2VM2A 3IHQA 2H6YA 3IPZA 4MABA 3UL3A 2F3MA 3BD2A 4K8MA 5LD0A 1VRSD 2VAFA 2C0DA 1K0OA 1LJRA 3UAPA 3QAWA 4PX1A 1EEMA 4DEJA 1M0UA 3ZLPA 1MTCA 1O73A 3GA4A 3O6TA 1V58A 1PQNA 1PRXA 3VI5A 2C0FA 2NVLA 20GSA 3IK9A 3UIWA 2J23A 4ZB6A 1WIKA 1YEPA 5G30A 1B9XC 1Y6EA 3G7IA 2HSHA 1SL0B 2B5EA 3I6AA 5DBQA 1BG5A 3FR3A 5G5FA 1GL8A 2YZHA 4X0XA 3TRQA 1TXXA 4F82A 3OR5A 1YJ6A 2OA7A 2DBCA 1TRSA 3VI7A 3I43A 1S3AA 5HFKA 1YKCA 3KJYA 5HR1A 4JR6A 2QC7A 3A2WA 1VF3A 1GTAA 1NM3A 1RK4A 3FZ9A 2OE0A 3M9JA 1ABAA 2M46A 4PURA 5CREA 4MH2A 3RAZA 1PX7A 4IBPA 2LQQA 1DE2A 2VCQA 2DSAA 4MZWA 4JE1A 1VF2A 5B6NA 4WF5A 1J08A 2NDOA 1X9SB 4ECIA 1K0CA 2GQKA 4MDCA 6GSTA 1E2YA 5JCWA 5D8IA 2GZZA 1GSYA 4LA1A 2C3NA 1THOA 1B48A 2P5QA 3KP9A 1V98A 2LQOA 2PGTA 2CT6A 3KMOA 1M2AA 4V2LA 5AIXA 3G9BA 4YQVA 4NV5A 5G1KA 2OBIA 4KH7A 2FUG2 4ZB8A 1MEKA 1OVNA 2PPTA 3VWUA 3U5RE 5JWQB 2DJ3A 5GAND 4HI7A 1XOAA 4RI6A 1AW9A 4FO5A 5ECKB 5IIZA 2YJHA 1BAYA 4Q5NA 4WR4A 1RW1A 1N8JA 1EOHA 4GSNA 3DIEA 3DMLA 2P0GA 4XRDA 3N5OA 5DQYA 5G2ZA 5KN0A 2WCIA 3QR6A 3C8EA 1FB6A 1VF4A 1R26A 1ACVA 2YWMA 2GT6A 1K3LA 1FVJA 3TJFA 2AB6A 4L0WA 3GIXA 4O92A 3GSSA 3ERFA 3HKRA 1ERWA 1GLQA 2CVDA 2GLRA 5GSTA 3UBKA 1K0BA 2H01A 4MJCA 2AJQB 2QSIA 3F63A 3TJBA 4IP1A 2NBSA 3D5JA 1HNBA 2OE3A 3BCKA 3JCML 5KN3A 4K7NA 3TJGA 3CXGA 3DYRA 2H19A 1G7OA 3C71A 1AQWA 2PU9C 4K2DA 1AAZA 3MSZA 3Q19A 1VGLA 1J9BA 2OADA 3IDVA 1B4PA 3HZ4A 2E7PA 3KTLA 3IAM2 4GTUA 4IS0A 1GSSA 2V1MA 1DBYA 3MWHA 3TJJA 1QK8A 1R5AA 2LS5A 2YV7A 2A2RA 1M9AA 1NHYA 3CSIA 2LRTA 3D6IA 14GSA 3L0HA 2OKAA 4ZL8A 3ZVJA 1GTUA 1JLVA 3TKQA 1V57A 1TRVA 3EC3A 2GT5A 1TP9A 2X8GA 3WGEA 2GTUA 4TR1B 4F9ZA 3FZ4A 1O81A 2IMFA 1TI1A 4JEDA 4E8EA 1F2EA 2X64A 1LBKA 2LSTA 1TW9A 5DAKB 2YWIA 4ZBDA 3IR4A 2H30A 13GSA 3ED3A 3ZL5A 4O7HA 3GX8A 3ZITA 3EINA 4ZL9A 4PXOA 1XW9A 4ACSA 3EWLA 3GFKA 4I97A 5G5EA 2IIYA 1HYUA 1YY7A 4EKZA 4IN0A 2YJ7A 1GSDA 1SKRB 2V41A 1O7UA 2HZFA 3ZMLA 1XWGA 2GSQA 2YCDA 1OC3A 5F05A 4KCAA 1U6TA 3TKSC 3J7Yk 1XFLA 5G1LA 4K7OA 1ZZYA 3IE3A 1B4QA 1M2DA 3GSTA 4YQUA 4BL7A 1IYIA 2VUPA 2JZTA 4K6XA 1K3YA 1EV9A 4WKWA 7GSSA 3ZVJD 5F0GA 2E2GA 1RQMA 1GUMA 4RQXA 5A5KA 5JWRB 3HJMA 5ECLB 2I3YA 1H75A 3HD5A 2KUCA 4DSSB 4EVMA 1F6MC 5IOWA 3GHAA 3FEUA 3FW2A 4TRXA 1X0RA 2HXKA 1A0RP 1DSBA 3DRNA 2B7KA 1ILOA 4XHMA 2L6DA 1TJDA 2VD1A 4MMMA 2ZNMA 3QFAC 3RPPA 4TN8A 5DJMA 4BWQA 3VWWA 1JZDA 3F8UA 1QQ2A 4MJBA 3IXRA 1O8WA 5IMAA 3QCPA 2IL3A 1ZOFA 1TU7A 1O85A 1TK8B 4GQFA 4XIHA 4Z7XA 1AIUA 3RPNA 5DJLA 2E2MA 3LFLA 3LORA 3LQ7A 4NHZA 3KZQA 3DVXA 4FIWA 4OCFA 4WR5A 1T4YA 3TJKA 1TK0B 5ECOB 5ECQB 4V2MA 3FY7A 1M7TA 4KSOA 2FA8A 2LKUA 3A3TA 4KUNA 4TOPA 3TUEA 2FD3A 1SK2A 3IV4A 5IMVA 2P5RA 3IRAA 2L57A 1OE7A 3QAVA 4V2NA 5IQYA 1NW2A 2YWOA 4KB3A 3H1NA 2VOCA 2CZ2A 3F3QA 2B6MA 3BJ5A 2H1AA 3FR6A 4GSSA 4GWRA 4MZBA 3KXOA 3KTBA 5ENUA 2LJRA 3TKRA 1GULA 3CMIA 3NOFA 1YKAA 3S9FA 4NAXA 2PWJA 1THXA 4KNDA 2F51A 1TDIA 2LV3A 3TOTA 5KN1A 1FOVA 1SYRA 2L59A 1TOFA 3RDWA 2YPMA 2LJAA 2YANA 1SJZA 3SWLA 2JL4A 1K0DA 2KHPA 5HQPA 4X1UA 3W8SA 1GSQA 1GTIA 2LTKA 1WOUA 2C4JA 5ECSA 3ZYWA 1MDKA 3EVIA 4OO5A 5IMDA 3QD9A 5J4UA 5A4UA 1F37A 4GRFA 5D9TA 2WFCA 4NV2A 1XWCA 3UJ1A 4WETA 4F0CA 3M1GA 3QFBC 3ZTLA 5C04A 2VM1A 4ZILA 5DCGA 4AJ7A 3NZNA 1OE8A 2GQLA 3EMXA 5KEJA 2MMZA 1KBNA 1MDIA 3PINA 2REMA 4HU9A 2KP2A 2O87A 2YP6A 4JU5A 1A8LA 4AJ8A 1K0NA 4YAVA 3P7XA 1MDJA 3RHBA 4Q5FA 2N5FA 1UC7A 2EIOA 3PGTA 2YNXA 5GZZB 3LEFA 5LNKe 2H1DA 2V32A 2AHEA 3HA9A 2WDUA 2IFQA 4EC0A 2EC4A 4XS4A 1WWJA 3ME7A 1UVZA 5AGYA 1WJKA 1ZCPA 3F6FA 1U87A 1PSQA 5CAXA 4QQ7A 17GSA 2H8LA 1URMA 3D21A 1Y25A 1X5CA 1GWCA 2K9FA 2YOIA 1KTEA 4YQMA 3TKSE 2DMLA 3KIJA 3UVTA 2OBKA 3F4SA 3A2XA 2WS2A 2DMMA 2K18A 2FCHA 4G9HA 2JSYA 1PKZA 1FHEA 4N11A 2R5GA 3GTUA 1O6JA 2B3SA 4KX4A 1SU9A 5IPGA 2CVKA 3CRTA 4PQIA 1ERVA 4MK3A 2B5YA 3G7JA 2IMIA 4N30A 4RI7A 5D93A 4EXJA 1F3BA 1V2AA 1J0FA 3CSJA 5GSSA 4HS1A 1X5EA 2GVPA 5IO0A 2VCVA 4AJ6A 2VL9A 4MF5A 5IMZA 1QGVA 3QAGA 2F8FA 5HFGA 2WRTA 3IA1A 5CO3A 1Z6MA 3QPMA 6GSVA 4BWSA 2ON7A 4MJEA 1SENA 1VF1A 3H79A 4ZB9A 3GKKA 1USBA 3EMPA 3KH9A 1AUCA 1HNAA 2J9HA 2RM5A 1T00A 2H1BA 3FHKA 2HT9A 2DJJA 3RHCA 3ME8A 1EGRA 2EIQA 4K1FA 2NTOA 3GUSA 5B8AA 1XWAA 2WZ9A 1W4VA 4FYUA 1G7EA 4FYBA 3A2VA 2H6XA 2GSTA 1O8XA 5HFIA 2H71A 1XBSA 4BVYA 2QGVA 1X9WB 1QFNA 4WF4A 2H0IA 1CQHA 3VPTA 3BCIA 4ZXGA 1FO5A 2C1YA 4EDZA 3W6GA 2H66A 3HYPA 3L78A 4J2FA 3LSZA 2JSZA 5ID2A 3KGKA 4TR4A 11GSA 3R2QA 5H5SA 4MLYA 4ZBBA 2CZ3A 2LNTA 2VCWA 4HU7A 3H4KA 1GLPA 4LL1B 3L9SA 3WYWA 4IW9A 1T7PB 3UEMA 5L71A 2IJYA 2K8SA 2F9SA 4I2TA 1AQVA 5FT3A 5HR0A 1V9WA 3CYNA 4Q5QA 2KOKA 1K0MA 2MMNA 3DXBA 3GURA 4HOJA 4GXZA 4IELA 5ECIB 1YF0A 4DSQA 2R37A 1XOBA 4NWYA 1TRWA 2DIYA 1DE1A 1BYEA 4H86A 3GL3A 2VL2A 4PQ1A 3TCOA 4E8HA 2JZSA 2VCZA 3FR9A 5CRGA 2LNSA 5KN2A 1XW6A 2R6KA 2VIMA 4ECBA 3ERGA 2PVQA 2NPBA 2XHFA 1W89A 4YH2A 1A0FA 2DLXA 4TVEA 2E0QA 3F0IA 3ZFLA 2VL2C 3TB2A 1PX6A 6GSXA 2VCTA 3ZZXA 1V40A 5CYYA 1AXDA 2PUKC 1Q98A 3I9V2 3Q18A 2O8VB 3QDNA 1XZOA 3EURA 2H6ZA 3D0ZA 1PMTA 1PA3A 2ZUPA 4MZCA 3GMFA 3G7YA 1SJIA 2MBSA 2XPDA 4HZ2A 1FVKA 1OYJA 4ULXA 3GYKA 3EYTA 2YZUA 5ECRB 5J41A 5B7CA 1Q4JA 1PL1A 5A4WA 2LEGA 1QXHA 2FWFA 4N0VA 1U3IA 2G0FA 4IVFA 3HVVA 3HY2A 16GSA 3U6VA 4BVXA 4KE3A 1GSEA 1E6BA 4POBA 5IO2A 3ZIVA 3Q6OA 18GSA 5DVBA 3LG6A 1EV4A 9GSSA 2XPEA 1GSUA 2XBIA 3L9UA 3LGCA 3ZMKA 4IGJA 3GRXA 2ES7A 2RUEA 4OMVA 2X8HA 2HZEA 3EU4A 1SKWB 5ECNB 3MAKA 1AC1A 3RBTA 4HEA2 4IP6A 1XVWA 3FKFA 4MPFA 2AAWA 1XXUA 2O85A 1G6WA 5J5NA 2L4CA 1BEDA 1TRUA 3KP8A 4LLRA 3GH9A 1PN9A 6GSYA 1YEXA 3GN3A 2DJ2A 5F8BA 4GSTA 4IQ1A 4ID0A 4KA0A 3TGZA 4BPYA 3HJOA 3EE2A 2PMTA 2BMXA 4GF0A 2LJKA 2WJUA 5D9WA 1TK5B 5COHA 3A5WA 1ERUA 4HQZA 5EPFA 4OO4A 4EUYA 1WE0A 5A4VA 1TU8A 2A4VA 4XRAA 4PNGA 1PL2A 2GS3A 3CTGA 4EL1A 1WMJA 2R4VA 6GSWA 1TTZA 2K8VA 1YDKA 4PQHA 5D9VA 1JHBA 4IKHA 4IQAA 5D9XA 1EGOA 2IFQB 1ST9A 2PBJA 3IC4A 2H1GA 4I6XA 8GSSA 3F6DA 4CW9A 2DJ0A 2ZCTA 1SL1B 2FWHA 4D73A 4KAEA 10GSA 4P3YB 2L5LA 5ECHB 3O3TA 5DCHA 4HDEA 2K6VA 3M8NA 1H4OA 3VK9A 5CRWA 1XVQA 2VLTA 2RUFA 4EF0A 2GGTA 4FH8A 5AIVA 3GKNA 1KNGA 5J3RA 2MMAA 1OC9A 2GQMA 2H75A 4TXVA 1A24A 4MCUA 4YAPA 3HXSA 3GTUB 5H5QA 3DWVA 1OKDA 5FHIA 2GSRA 4MF6A 1R7HA 4J57E 2IPAA 4HZ4A 2TIRA 4XCSA 2KLXA 2AUVA 5DALA 3C7MA 1FAAA 2BJXA 4MH3A 3ZIJA 12GSA 1SK1A 4KDUA 1OC8A 3E3EA 2TRXA 4IJ3A 3P8WA 2CAIA 3FYGA 4I2UA 3P2AA 1ERTA 4ZL7A 3VWXA 2G2QA 3FRCA 1FB0A 4ECJA 2ON5A 3UBLA 4WBRD 2R3XA 3FZAA 4KGIA 5LCZA 5DQSA 5ELGA 1K0AA 5AN1A 3F3RA 4IHUA 1JZOA 2O89A 1SYXA 1T1VA 1K3OA 1JZWA 4MF7A 4KDXA 3APSA 5ABRA 2PVOC 4LMVA 5CNWA 1UA5A 2P31A 3ZREA 2F8AA 2TRCP 3D22A 4POMA 4TR0A 3Q74A 4TR3A 1EP8A 2B1LA 1U88A 2IMDA 5GAPD 1FW1A 4ZBAA 3MNGA 4NXIA 1EZKA 1SK0A 4MPGA 5D96A 1AQXA 1R4WA 2HE3A 5CP1A 2IWTA 2MYGA 2HYXA 3LYKA 2GZYA 19GSA 4AGSA 3MDKA 4ECCA 3VWVA 2VLUA 4XS6A 2I81A 5ID2B 4JRRA 1MD3A 3EU3A 3M0FA 4TKYA 3HZ8A 4F03A 1GNEA 1XPVA 4EE0A 4GCIA 1GP1A 3CBUA 1ZGNA 1Z7PA 4J56E 4CDOA 1BX9A 4Q5RA 1XIYA 4V1Ap 1LU4A 6GSSA 1FG4A 2L6CA 1T8EB 3PH9A 1JZRA 4HQSA 2LUSA 5IMCA 3NIVA 5B8BA 3O76A 4ISDA 4TXOA 1G0TA 1SD9A 4OWYA 2MBTA 3H8QA 3UVHA 2WB9A 1ZL9A 1YF1A 4AF2A 2CAQA 2RLIA 4KDYA 1R5PA 5J9CA 2FA4A 2YV9A 5CRHA 3UARA 3PR8A 4O32A 3LXTA 2O7KA 3HDCA 3GH6A 1A23A 5E4WA 1N2AA 3P90A 2AV4A 2C3QA 4XTSA 2QKEA 2D2ZA 3F4TA 4PGTA 4BA7A 4KW6A 1S3CA 5IM9A 4RUVA 2R2JA 3L9VA 1DUGA 1ZYQB 1B8XA 3IK7A 5JCGA 2GSSA 2HLSA 1S3DA 4DVCA 2AYTA 2M72A 2JACA 5DDLA 3IAS2 1GTBA 1Z6NA 5ECPB 2YWNA 1ON4A 2VL3A 2IMKA 2L4QA 4DSRA 2H76A 4QL7A 3LJRA 5IOXA 1GRXA 3LWAA 2I4AA 3C1RA 4G10A 3KH7A 1UN2A 3KD0A 3TRXA 1GUKA 4TW5A 2CV4A 3HHVA 3TDGA 2FLSA 2V6KA 3V1WA 2XC2A 5HR3A 1PD21 3VLNA 2EIRA 4NHWA 2JU5A 3WGXA 1OKTA 2FWGA 3F4RA 1TKDB 2ALBA 1EEJA 2DC5A 2A2SA 3N9JA 3LYPA 6GSUA 1I9DA 3VPQA 1NSWA 3WT2A 2PERA 4GQCA 1M2BA 3KMNA 3KCMA 1T3BA 3ZFBA 3WT1A 1YQ1A 3C73A 5C00A 4CHSA 4L5LA 4OD7A 4N0ZA 2KP1A 3APQA 1WP0A 1BJXA 2DIZA 1XWBA 2V2GA 3GL5A 2HZEB 1M9BA 1G6YA 1M99A 3GKMA 3DEXA 5G31A 4WBJA 3UOMA 4L5OA 2GZPA 3M3MA 3VFIA 4NPBA 1T4ZA 3TOUA 1WPIA 2B1KA 4X43A 4ILFA 4MP4A 1A2LA 3GKXA 5FWGA 5JCUA 2WGRA 2HRFA 3AY8A 4OFTA 2LRCA 2C3TA 4RQRA 1QMVA 2CX3A 4L8EA 3H93A 2XBQA 4HUAA 3TKSA 4G19A 1HNCA 1Z3EA 4IJIA 4ML6A 4K0NA 4N10A 2HFDA 5ECMB 2GDRA 3QMXA 1Z9HA 1X9MB 2OJLA 1CQGA 3I69A 1IYHA 1HD2A 4ML1A 4WEYA 3GX0A 3CSHA 1A2MA 3US3A 3D4MA 4JBBA 2H74A 4HJ2A 3UMAA 2RIIA 5JWOB 2LRNA 4I5QA 4OFMA 3W8JA 1PGTA 2OE1A 1EOGA 2V6OA 22GSA 2L5OA 1EWXA 1JLWA 4FYCA 2IMEA 5E59A 1SD8A 1F9MA 3LXZA 3D4TA 3C1SA
chains in the Genus database with same CATH superfamily
2M80A 4D73B 3IBHA 2CA8A 1X5DA 2DKIA 5B6MA 2CQ9A 2HNLA 1F3AA 5F07A 1OAZA 1Z7RA 4EDYA 4NMUA 2FGXA 1XW5A 5CRDA 3DKSA 1OC9B 3E0UA 4I8BA 1JFUA 1PN0A 2HRNA 2VCXA 4EO3A 2JADA 5DALB 4F2IA 4TR1A 4OCEA 1A2JA 4XS1A 3WD6A 3K8NA 4MJAA 3HCZA 2I9HA 2C0GA 5ELAA 3TKPA 5EVOA 3ERWA 5IMFA 3HVXA 5DAKA 5H5RA 3E9JB 4WXTA 4HJMA 4QL9A 3CRUA 2X99A 4G0IA 5J9BA 5INYA 2OACA 3DD3A 2C0EA 1GSFA 4MA9A 2DJKA 1QUWA 2VO4A 2BTOT 2WULA 3BOAA 1ML6A 2FY6A 1EP7A 5EY6A 4O5QA 2A4HA 4JZQA 1XWKA 4K9ZA 1KEBA 2B5XA 2Z9SA 2FWEA 1HQOA 4PUFC 4FQUA 4POKA 2N5BA 2RM6A 3SBCA 3APOA 1BQ7A 2C8UA 3KM6A 2HI7A 4XS4B 2DKHA 2N5AA 3FK8A 1XCCA 1I5GA 3HJPA 2C80A 3TRPA 5AISA 5EL8A 2QA2A 2H70A 4LL4B 3ISOA 5HR2A 4L0UA 3ZRDA 3DVWA 1SJ6A 3GV1A 4DSSA 3BBYA 2HSYA 2QA1A 4V1Ag 5D73A 4GLTA 3WGDA 3KEBA 4F0BA 4G0LA 1SL2B 3VURA 1GUHA 4OFNA 4G2EA 1PKWA 2H72A 1Z5YE 3GNJA 2A2PA 1U3AA 3FZ5A 4LMWA 3J7Yb 4O5RA 3F9UA 1YZXA 1B9YC 2CVBA 2JZRA 2IN3A 3QOUA 5F06A 2B7JA 2MZCA 2VLVA 2YN1A 1MD4A 1A8YA 2VD0A 4TXOB 2X8CA 4ZIJA 1WRYA 3IOSA 4PNFA 3L4NA 1ZYEA 1ZMAA 1GNWA 2H73A 2PN8A 4K0GA 5IPHA 4KSMA 2MMOA 2I1UA 3DGQA 2CX4A 2DJ1A 4POLA 1TI3A 4PUAA 1SKSB 4JR4A 1GH2A 2FNOA 3M9KA 3HVSA 1NHOA 2H0GA 1C72A 4K7IA 2H0HA 3CTFA 4KCEA 2FHEA 2VM2A 3IHQA 2H6YA 3IPZA 4MABA 3UL3A 2F3MA 3BD2A 4K8MA 5LD0A 1VRSD 4X4JA 2VAFA 2C0DA 1K0OA 1XG8A 1LJRA 3UAPA 3QAWA 4PX1A 1EEMA 4DEJA 1M0UA 3ZLPA 1MTCA 1O73A 3GA4A 3O6TA 1V58A 1PQNA 1PRXA 3VI5A 2C0FA 2NVLA 20GSA 3IK9A 3UIWA 2J23A 4ZB6A 1WIKA 1YEPA 5G30A 1B9XC 1Y6EA 3G7IA 2HSHA 1SL0B 2B5EA 2HRKA 3I6AA 5DBQA 1BG5A 3FR3A 5G5FA 1GL8A 2YZHA 4X0XA 3TRQA 1TXXA 4F82A 3OR5A 1YJ6A 5KOWA 2OA7A 2DBCA 1TRSA 3VI7A 3I43A 1S3AA 5HFKA 1YKCA 3KJYA 5HR1A 4JR6A 2QC7A 3A2WA 1VF3A 1GTAA 1NM3A 1RK4A 3FZ9A 2OE0A 3M9JA 1ABAA 2M46A 4PURA 5CREA 4MH2A 3RAZA 1PX7A 4IBPA 2LQQA 1DE2A 2VCQA 2DSAA 4MZWA 3MYDA 1VF2A 4JE1A 5B6NA 4WF5A 1J08A 2NDOA 1X9SB 4ECIA 1K0CA 2GQKA 4MDCA 6GSTA 1E2YA 5JCWA 5D8IA 2GZZA 1GSYA 4LA1A 2C3NA 3EPTA 1THOA 1B48A 2P5QA 3KP9A 1V98A 2LQOA 2PGTA 2CT6A 3KMOA 1M2AA 4V2LA 5AIXA 3G9BA 4YQVA 4NV5A 5G1KA 2OBIA 4KH7A 2FUG2 4ZB8A 1MEKA 1OVNA 2PPTA 3VWUA 3U5RE 5JWQB 2DJ3A 5GAND 4HI7A 1XOAA 4RI6A 1AW9A 4FO5A 5ECKB 5IIZA 2YJHA 1BAYA 4Q5NA 4WR4A 1RW1A 1N8JA 1EOHA 4GSNA 3DIEA 4ICYA 3DMLA 2P0GA 4XRDA 3N5OA 5DQYA 5G2ZA 5KN0A 2WCIA 3QR6A 3C8EA 1FB6A 1VF4A 1R26A 1ACVA 2YWMA 2GT6A 1K3LA 1FVJA 3TJFA 2AB6A 4L0WA 3GIXA 4O92A 3GSSA 3ERFA 3HKRA 1ERWA 1GLQA 2CVDA 2GLRA 5GSTA 3UBKA 1K0BA 2H01A 4MJCA 2AJQB 2QSIA 3F63A 3TJBA 4IP1A 2NBSA 3D5JA 1HNBA 2OE3A 1FOHA 3BCKA 3JCML 2R0GA 5KN3A 4K7NA 3TJGA 3CXGA 3DYRA 2H19A 1G7OA 3C71A 1AQWA 2PU9C 4K2DA 1AAZA 3MSZA 3Q19A 1VGLA 1J9BA 2OADA 3IDVA 1B4PA 3HZ4A 2E7PA 3KTLA 3IAM2 4GTUA 4IS0A 1GSSA 2V1MA 1DBYA 3MWHA 3TJJA 1QK8A 1R5AA 2LS5A 2YV7A 2A2RA 2X4AA 1M9AA 1NHYA 3CSIA 2LRTA 3D6IA 14GSA 3L0HA 2OKAA 4ZL8A 3ZVJA 1GTUA 1JLVA 3TKQA 1V57A 1TRVA 3EC3A 2GT5A 1TP9A 2X8GA 3WGEA 2GTUA 4TR1B 4F9ZA 3FZ4A 1O81A 2IMFA 1TI1A 4JEDA 4E8EA 1F2EA 2X64A 3R3EA 1LBKA 2LSTA 1TW9A 5DAKB 2YWIA 4ZBDA 3IR4A 2H30A 13GSA 3ED3A 3ZL5A 4O7HA 3GX8A 3ZITA 3EINA 4ZL9A 4PXOA 1XW9A 4ACSA 3EWLA 3GFKA 4I97A 5G5EA 2IIYA 1HYUA 1YY7A 4EKZA 4IN0A 2YJ7A 1GSDA 1SKRB 2V41A 1O7UA 2HZFA 3ZMLA 1XWGA 2GSQA 2YCDA 1OC3A 5F05A 4KCAA 1U6TA 3TKSC 3J7Yk 1XFLA 5G1LA 4K7OA 1ZZYA 3IE3A 1B4QA 1M2DA 3GSTA 4YQUA 4BL7A 1IYIA 2VUPA 2JZTA 4K6XA 1K3YA 1EV9A 4WKWA 7GSSA 3ZVJD 5F0GA 2E2GA 1RQMA 1GUMA 4RQXA 5A5KA 4USSA 5JWRB 3HJMA 5ECLB 2I3YA 1H75A 3HD5A 2KUCA 4DSSB 4EVMA 1F6MC 5IOWA 3GHAA 3FEUA 3FW2A 4TRXA 1X0RA 2HXKA 1A0RP 1DSBA 3DRNA 2B7KA 1ILOA 4XHMA 2L6DA 1TJDA 2VD1A 4MMMA 2ZNMA 3QFAC 3RPPA 4TN8A 5DJMA 4BWQA 3VWWA 1JZDA 3F8UA 1QQ2A 4MJBA 3IXRA 1O8WA 5IMAA 3QCPA 2IL3A 1ZOFA 1TU7A 1O85A 1TK8B 4GQFA 4XIHA 4Z7XA 1AIUA 3RPNA 5DJLA 2E2MA 3LFLA 3LORA 3LQ7A 4NHZA 3KZQA 3DVXA 4FIWA 4OCFA 4WR5A 1T4YA 3TJKA 1TK0B 5ECOB 5ECQB 4V2MA 4YKGA 3FY7A 1M7TA 4KSOA 2FA8A 2LKUA 3A3TA 4KUNA 4TOPA 3TUEA 2FD3A 1SK2A 3IV4A 5IMVA 2P5RA 3IRAA 2L57A 1OE7A 3QAVA 4V2NA 5IQYA 1NW2A 2YWOA 4KB3A 3H1NA 2VOCA 2CZ2A 3F3QA 2B6MA 3BJ5A 2H1AA 3FR6A 4GSSA 4GWRA 4MZBA 3KXOA 3KTBA 5ENUA 2LJRA 3TKRA 4EIPA 1GULA 3CMIA 3NOFA 1YKAA 3S9FA 4NAXA 2PWJA 1THXA 4KNDA 2F51A 1TDIA 2LV3A 3TOTA 4EIQA 5KN1A 1FOVA 1SYRA 3PPUA 2L59A 1TOFA 3RDWA 2YPMA 2LJAA 2YANA 1SJZA 3SWLA 2JL4A 1K0DA 2KHPA 5HQPA 4X1UA 3W8SA 1GSQA 1GTIA 2LTKA 1WOUA 2C4JA 5ECSA 3ZYWA 1MDKA 3EVIA 4OO5A 5IMDA 3QD9A 5J4UA 5A4UA 1F37A 4GRFA 5D9TA 2WFCA 4NV2A 1XWCA 3UJ1A 4WETA 4F0CA 3M1GA 3QFBC 3ZTLA 4HSCX 5C04A 2VM1A 4ZILA 5DCGA 4AJ7A 3NZNA 1OE8A 2GQLA 3EMXA 5KEJA 2MMZA 1KBNA 1MDIA 3PINA 2REMA 4HU9A 2KP2A 2O87A 2YP6A 4JU5A 1A8LA 4AJ8A 1K0NA 4YAVA 3P7XA 1MDJA 3RHBA 4Q5FA 2N5FA 1UC7A 2EIOA 3PGTA 2YNXA 5GZZB 3LEFA 5LNKe 2H1DA 2V32A 2AHEA 3LW9A 3HA9A 2WDUA 2IFQA 4EC0A 2EC4A 4XS4A 1WWJA 3ME7A 1UVZA 5AGYA 1WJKA 1ZCPA 3F6FA 1U87A 1PSQA 4K2XA 4YKFA 5CAXA 4QQ7A 17GSA 2H8LA 1URMA 3D21A 1Y25A 1X5CA 1GWCA 2K9FA 2YOIA 1KTEA 4YQMA 3TKSE 2DMLA 3KIJA 3UVTA 2OBKA 3F4SA 3A2XA 2WS2A 2DMMA 2K18A 2FCHA 4G9HA 2JSYA 1PKZA 1FHEA 4N11A 2R5GA 3GTUA 1O6JA 2B3SA 4KX4A 1SU9A 5IPGA 2CVKA 3CRTA 4PQIA 1ERVA 4MK3A 2B5YA 3G7JA 2IMIA 4N30A 4RI7A 5D93A 4EXJA 1F3BA 1V2AA 1J0FA 3CSJA 1PFOA 5GSSA 4HS1A 1X5EA 2GVPA 5IO0A 2VCVA 4AJ6A 2VL9A 4MF5A 5IMZA 1QGVA 3QAGA 2F8FA 5HFGA 2WRTA 3IA1A 5CO3A 1Z6MA 3QPMA 6GSVA 4BWSA 2ON7A 4MJEA 1SENA 1VF1A 3H79A 4ZB9A 3GKKA 1USBA 3EMPA 3KH9A 1AUCA 1HNAA 4O5UA 2J9HA 2RM5A 1T00A 1ZYPA 2H1BA 3FHKA 2HT9A 2DJJA 3RHCA 3ME8A 1EGRA 2EIQA 4K1FA 2NTOA 3GUSA 5B8AA 1XWAA 2WZ9A 1W4VA 4FYUA 1G7EA 4FYBA 3A2VA 2H6XA 2GSTA 1O8XA 5HFIA 2H71A 1XBSA 4BVYA 2QGVA 1X9WB 2R0PA 1QFNA 4WF4A 2H0IA 1CQHA 3VPTA 3BCIA 4ZXGA 1FO5A 2C1YA 4EDZA 4PTSA 3W6GA 2H66A 3HYPA 3L78A 4J2FA 3LSZA 2JSZA 5ID2A 3KGKA 4TR4A 11GSA 3R2QA 5H5SA 4MLYA 4ZBBA 2CZ3A 2LNTA 2VCWA 4HU7A 3H4KA 1GLPA 4LL1B 4BL7B 3L9SA 3WYWA 4IW9A 1T7PB 3UEMA 5BMUA 5L71A 2IJYA 2K8SA 2F9SA 4I2TA 1AQVA 5FT3A 5HR0A 1V9WA 3CYNA 3IHGA 4Q5QA 2KOKA 1K0MA 2MMNA 3DXBA 3GURA 4HOJA 5BRTA 4GXZA 4IELA 5ECIB 1YF0A 4DSQA 2R37A 1XOBA 4NWYA 1TRWA 2DIYA 4G0KA 1DE1A 1BYEA 4H86A 3GL3A 2VL2A 4PQ1A 3TCOA 4E8HA 2JZSA 2VCZA 3FR9A 5CRGA 2LNSA 5KN2A 1XW6A 2R6KA 2VIMA 4ECBA 3ERGA 2PVQA 2HRAA 2NPBA 2XHFA 1W89A 4YH2A 1A0FA 2DLXA 4TVEA 2E0QA 3F0IA 3ZFLA 2VL2C 3TB2A 1PX6A 2HSMA 6GSXA 2VCTA 3ZZXA 1V40A 5CYYA 1AXDA 2PUKC 1Q98A 3I9V2 3Q18A 2O8VB 3QDNA 3IC8A 1XZOA 3EURA 2H6ZA 3D0ZA 1PMTA 1PA3A 2ZUPA 4MZCA 3GMFA 3G7YA 1SJIA 2MBSA 2XPDA 4HZ2A 1FVKA 1OYJA 4ULXA 3GYKA 3EYTA 2YZUA 5ECRB 5J41A 5B7CA 1Q4JA 1PL1A 4CY6A 4MNNA 5A4WA 2LEGA 1QXHA 2FWFA 3HVNA 4N0VA 1U3IA 2G0FA 4IVFA 3HVVA 3HY2A 16GSA 3U6VA 4BVXA 4KE3A 1GSEA 1E6BA 4POBA 4CY8A 5IO2A 3ZIVA 3Q6OA 18GSA 5DVBA 3LG6A 2UZ8A 1EV4A 9GSSA 2XPEA 1GSUA 2XBIA 3L9UA 3LGCA 3ZMKA 4IGJA 3GRXA 2ES7A 2RUEA 4OMVA 2X8HA 2HZEA 3EU4A 1SKWB 5ECNB 3MAKA 1AC1A 3RBTA 4HEA2 4IP6A 1XVWA 3FKFA 4MPFA 2AAWA 1XXUA 2O85A 1G6WA 5J5NA 2L4CA 1BEDA 1TRUA 3KP8A 4LLRA 3GH9A 1PN9A 6GSYA 1YEXA 3GN3A 2DJ2A 5F8BA 4GSTA 4IQ1A 4ID0A 4KA0A 3TGZA 4BPYA 3HJOA 3EE2A 2PMTA 2BMXA 4GF0A 2LJKA 2WJUA 5D9WA 1TK5B 5COHA 3A5WA 1ERUA 4HQZA 5EPFA 4OO4A 4EUYA 1WE0A 5A4VA 1TU8A 2A4VA 4XRAA 4PNGA 4A5PA 1PL2A 2GS3A 3CTGA 4EL1A 1WMJA 2R4VA 6GSWA 1TTZA 2K8VA 1YDKA 4PQHA 5D9VA 1JHBA 4IKHA 4IQAA 5D9XA 1EGOA 2IFQB 1ST9A 2PBJA 3IC4A 2H1GA 4I6XA 8GSSA 3F6DA 4CW9A 2DJ0A 2ZCTA 1SL1B 2FWHA 4D73A 4KAEA 10GSA 4P3YB 2L5LA 5ECHB 3O3TA 5DCHA 4HDEA 2K6VA 3M8NA 1H4OA 3VK9A 5CRWA 1XVQA 2VLTA 2RUFA 4EF0A 2GGTA 4FH8A 5AIVA 3GKNA 1KNGA 5J3RA 2MMAA 1OC9A 2GQMA 2H75A 4TXVA 1A24A 4MCUA 4YAPA 3HXSA 3GTUB 5H5QA 3DWVA 1OKDA 5FHIA 2GSRA 4MF6A 1R7HA 4J57E 2IPAA 4HZ4A 2TIRA 4XCSA 2KLXA 2AUVA 5DALA 3C7MA 1FAAA 2BJXA 4MH3A 3ZIJA 12GSA 1SK1A 4KDUA 1OC8A 3E3EA 4Z2RA 2TRXA 4IJ3A 3FMWA 3P8WA 2CAIA 3FYGA 4I2UA 3P2AA 1ERTA 4ZL7A 3VWXA 2G2QA 3FRCA 4BIKA 1FB0A 4ECJA 2ON5A 3UBLA 4WBRD 2R3XA 3FZAA 4KGIA 5LCZA 5DQSA 5ELGA 1K0AA 5AN1A 3F3RA 4IHUA 1JZOA 2O89A 1SYXA 1T1VA 1K3OA 1JZWA 4MF7A 4KDXA 3APSA 5ABRA 2PVOC 4Z2TA 4LMVA 5CNWA 1UA5A 2P31A 3ZREA 2F8AA 2TRCP 3D22A 4POMA 4TR0A 3Q74A 4TR3A 1EP8A 2B1LA 1U88A 2IMDA 5GAPD 4BVYB 1FW1A 4ZBAA 3MNGA 4NXIA 1EZKA 1SK0A 4MPGA 5D96A 1AQXA 1R4WA 2HE3A 5CP1A 2IWTA 2MYGA 1M3JA 2HYXA 3LYKA 2GZYA 19GSA 4AGSA 3MDKA 4ECCA 3VWVA 2VLUA 4XS6A 2I81A 5ID2B 4JRRA 1MD3A 3EU3A 3M0FA 4TKYA 3HZ8A 4KF9A 4F03A 1GNEA 1XPVA 4EE0A 4GCIA 1GP1A 3CBUA 1ZGNA 1Z7PA 4J56E 4CDOA 1BX9A 4Q5RA 1XIYA 4V1Ap 1LU4A 6GSSA 1FG4A 2L6CA 1T8EB 3PH9A 1JZRA 4HQSA 2LUSA 5IMCA 3NIVA 5B8BA 3O76A 4ISDA 4TXOA 1G0TA 1SD9A 4OWYA 2MBTA 4K5SA 3H8QA 3UVHA 2WB9A 1ZL9A 1YF1A 4AF2A 2CAQA 2RLIA 4KDYA 1R5PA 5J9CA 2FA4A 2YV9A 5CRHA 3UARA 3PR8A 4O32A 3LXTA 2O7KA 3HDCA 3GH6A 1A23A 5E4WA 1N2AA 3P90A 2AV4A 2C3QA 4XTSA 2QKEA 2D2ZA 3F4TA 4PGTA 4BA7A 4KW6A 1S3CA 5IM9A 4RUVA 2R0CA 2R2JA 3L9VA 1DUGA 1ZYQB 1B8XA 3IK7A 3CQFA 5JCGA 2GSSA 2HLSA 1S3DA 4DVCA 2AYTA 2M72A 4K5RA 2JACA 5DDLA 3IAS2 1GTBA 1Z6NA 5ECPB 2YWNA 1ON4A 2VL3A 2IMKA 2L4QA 4DSRA 2H76A 4QL7A 3LJRA 5IOXA 1GRXA 3LWAA 2I4AA 3C1RA 4G10A 3KH7A 1UN2A 3KD0A 3TRXA 1GUKA 2X49A 4TW5A 2CV4A 3HHVA 3TDGA 2FLSA 2V6KA 3V1WA 2XC2A 5HR3A 1PD21 3MIXA 3VLNA 2EIRA 4NHWA 2JU5A 3WGXA 1OKTA 2FWGA 3F4RA 1TKDB 2ALBA 1EEJA 2DC5A 2A2SA 3N9JA 3LYPA 6GSUA 4BVXB 1I9DA 3VPQA 1NSWA 3WT2A 2PERA 4GQCA 1M2BA 3KMNA 3KCMA 1T3BA 3ZFBA 3WT1A 1YQ1A 3C73A 5C00A 4CHSA 4L5LA 4OD7A 4N0ZA 2KP1A 1ZYNA 3APQA 1S3RA 1WP0A 1BJXA 2DIZA 1XWBA 2V2GA 3GL5A 2HZEB 1M9BA 1G6YA 1M99A 3GKMA 3DEXA 5G31A 4WBJA 3UOMA 4L5OA 2GZPA 3M3MA 3VFIA 4NPBA 1T4ZA 3TOUA 1WPIA 2B1KA 4X43A 4ILFA 4MP4A 1A2LA 3GKXA 5FWGA 3A5IA 5JCUA 2WGRA 2HRFA 3AY8A 4OFTA 2LRCA 2C3TA 4Z2UA 4RQRA 1QMVA 2CX3A 4L8EA 3H93A 2XBQA 4HUAA 3TKSA 4G19A 1HNCA 1Z3EA 4IJIA 4ML6A 4K0NA 4N10A 2HFDA 5ECMB 2GDRA 3QMXA 1Z9HA 1X9MB 2OJLA 1CQGA 3I69A 1IYHA 1HD2A 4ML1A 4WEYA 3GX0A 3CSHA 1A2MA 1M3IA 3US3A 3D4MA 4JBBA 2H74A 4HJ2A 3UMAA 2RIIA 5JWOB 2LRNA 4I5QA 4OFMA 3W8JA 1PGTA 2OE1A 1EOGA 2V6OA 5KOXA 22GSA 2L5OA 1EWXA 1JLWA 4FYCA 2IMEA 5E59A 1SD8A 1F9MA 3LXZA 3D4TA 3C1SA
chains in the Genus database with same CATH topology
2M80A 4D73B 3IBHA 2CA8A 1X5DA 2DKIA 5B6MA 2CQ9A 2HNLA 1F3AA 5F07A 1OAZA 1Z7RA 4EDYA 4NMUA 2FGXA 1XW5A 5CRDA 3DKSA 1OC9B 3E0UA 4I8BA 1JFUA 1PN0A 2HRNA 2VCXA 4EO3A 2JADA 5DALB 4F2IA 4TR1A 4OCEA 1A2JA 4XS1A 3WD6A 3K8NA 4MJAA 3HCZA 2I9HA 2C0GA 5ELAA 3TKPA 5EVOA 3ERWA 5IMFA 3HVXA 5DAKA 5H5RA 3E9JB 4WXTA 4HJMA 4QL9A 3CRUA 2X99A 4G0IA 5J9BA 5INYA 2OACA 3DD3A 2C0EA 1GSFA 4MA9A 2DJKA 1QUWA 2VO4A 2BTOT 2WULA 3BOAA 1ML6A 2FY6A 1EP7A 5EY6A 4O5QA 2A4HA 4JZQA 1XWKA 4K9ZA 1KEBA 2B5XA 2Z9SA 2FWEA 1HQOA 4PUFC 4FQUA 4POKA 2N5BA 2RM6A 3SBCA 3APOA 1BQ7A 2C8UA 3KM6A 2HI7A 4XS4B 2DKHA 2N5AA 3FK8A 1XCCA 1I5GA 3HJPA 2C80A 3TRPA 5AISA 5EL8A 2QA2A 2H70A 4LL4B 3ISOA 5HR2A 4L0UA 3ZRDA 3DVWA 1SJ6A 3GV1A 4DSSA 3BBYA 2HSYA 2QA1A 4V1Ag 5D73A 4GLTA 3WGDA 3KEBA 4F0BA 4G0LA 1SL2B 3VURA 1GUHA 4OFNA 4G2EA 1PKWA 2H72A 1Z5YE 3GNJA 2A2PA 1U3AA 3FZ5A 4LMWA 3J7Yb 4O5RA 3F9UA 1YZXA 1B9YC 2CVBA 2JZRA 2IN3A 3QOUA 5F06A 2B7JA 2MZCA 2VLVA 2YN1A 1MD4A 1A8YA 2VD0A 4TXOB 2X8CA 4ZIJA 1WRYA 3IOSA 4PNFA 3L4NA 1ZYEA 1ZMAA 1GNWA 2H73A 2PN8A 4K0GA 5IPHA 4KSMA 2MMOA 2I1UA 3DGQA 2CX4A 2DJ1A 4POLA 1TI3A 4PUAA 1SKSB 4JR4A 1GH2A 2FNOA 3M9KA 3HVSA 1NHOA 2H0GA 1C72A 4K7IA 2H0HA 3CTFA 4KCEA 2FHEA 2VM2A 3IHQA 2H6YA 3IPZA 4MABA 3UL3A 2F3MA 3BD2A 4K8MA 5LD0A 1VRSD 4X4JA 2VAFA 2C0DA 1K0OA 1LJRA 3UAPA 3QAWA 4PX1A 1EEMA 4DEJA 1M0UA 3ZLPA 1MTCA 1O73A 3GA4A 3O6TA 1V58A 1PQNA 1PRXA 3VI5A 2C0FA 2NVLA 20GSA 3IK9A 3UIWA 2J23A 4ZB6A 1WIKA 1YEPA 5G30A 1B9XC 1Y6EA 3G7IA 2HSHA 1SL0B 2B5EA 2HRKA 3I6AA 5DBQA 1BG5A 3FR3A 5G5FA 1GL8A 2YZHA 4X0XA 3TRQA 1TXXA 4F82A 3OR5A 1YJ6A 5KOWA 2OA7A 2DBCA 1TRSA 3VI7A 3I43A 1S3AA 5HFKA 1YKCA 3KJYA 5HR1A 4JR6A 2QC7A 3A2WA 1VF3A 1GTAA 1NM3A 1RK4A 3FZ9A 2OE0A 3M9JA 1ABAA 2M46A 4PURA 5CREA 4MH2A 3RAZA 1PX7A 4IBPA 2LQQA 1DE2A 2VCQA 2DSAA 4MZWA 3MYDA 1VF2A 4JE1A 5B6NA 4WF5A 1J08A 2NDOA 1X9SB 4ECIA 1K0CA 2GQKA 4MDCA 6GSTA 1E2YA 5JCWA 5D8IA 2GZZA 1GSYA 4LA1A 2C3NA 3EPTA 1THOA 1B48A 2P5QA 3KP9A 1V98A 2LQOA 2PGTA 2CT6A 3KMOA 1M2AA 4V2LA 5AIXA 3G9BA 4YQVA 4NV5A 5G1KA 2OBIA 4KH7A 2FUG2 4ZB8A 1MEKA 1OVNA 2PPTA 3VWUA 3U5RE 5JWQB 2DJ3A 5GAND 4HI7A 1XOAA 4RI6A 1AW9A 4FO5A 5ECKB 5IIZA 2YJHA 1BAYA 4Q5NA 4WR4A 1RW1A 1N8JA 1EOHA 4GSNA 3DIEA 4ICYA 3DMLA 2P0GA 4XRDA 3N5OA 5DQYA 5G2ZA 5KN0A 2WCIA 3QR6A 3C8EA 1FB6A 1VF4A 1R26A 1ACVA 2YWMA 2GT6A 1K3LA 1FVJA 3TJFA 2AB6A 4L0WA 3GIXA 4O92A 3GSSA 3ERFA 3HKRA 1ERWA 1GLQA 2CVDA 2GLRA 5GSTA 3UBKA 1K0BA 2H01A 4MJCA 2AJQB 2QSIA 3F63A 3TJBA 4IP1A 2NBSA 3D5JA 1HNBA 2OE3A 1FOHA 3BCKA 3JCML 2R0GA 5KN3A 4K7NA 3TJGA 3CXGA 3DYRA 2H19A 1G7OA 3C71A 1AQWA 2PU9C 4K2DA 1AAZA 3MSZA 3Q19A 1VGLA 1J9BA 2OADA 3IDVA 1B4PA 3HZ4A 2E7PA 3KTLA 3IAM2 4GTUA 4IS0A 1GSSA 2V1MA 1DBYA 3MWHA 3TJJA 1QK8A 1R5AA 2LS5A 2YV7A 2A2RA 2X4AA 1M9AA 1NHYA 3CSIA 2LRTA 3D6IA 14GSA 3L0HA 2OKAA 4ZL8A 3ZVJA 1GTUA 1JLVA 3TKQA 1V57A 1TRVA 3EC3A 2GT5A 1TP9A 2X8GA 3WGEA 2GTUA 4TR1B 4F9ZA 3FZ4A 1O81A 2IMFA 1TI1A 4JEDA 4E8EA 1F2EA 2X64A 3R3EA 1LBKA 2LSTA 1TW9A 5DAKB 2YWIA 4ZBDA 3IR4A 2H30A 13GSA 3ED3A 3ZL5A 4O7HA 3GX8A 3ZITA 3EINA 4ZL9A 4PXOA 1XW9A 4ACSA 3EWLA 3GFKA 4I97A 5G5EA 2IIYA 1HYUA 1YY7A 4EKZA 4IN0A 2YJ7A 1GSDA 1SKRB 2V41A 1O7UA 2HZFA 3ZMLA 1XWGA 2GSQA 2YCDA 1OC3A 5F05A 4KCAA 1U6TA 3TKSC 3J7Yk 1XFLA 5G1LA 4K7OA 1ZZYA 3IE3A 1B4QA 1M2DA 3GSTA 4YQUA 4BL7A 1IYIA 2VUPA 2JZTA 4K6XA 1K3YA 1EV9A 4WKWA 7GSSA 3ZVJD 5F0GA 2E2GA 1RQMA 1GUMA 4RQXA 5A5KA 4USSA 5JWRB 3HJMA 5ECLB 2I3YA 1H75A 3HD5A 2KUCA 4DSSB 4EVMA 1F6MC 5IOWA 3GHAA 3FEUA 3FW2A 4TRXA 1X0RA 2HXKA 1A0RP 1DSBA 3DRNA 2B7KA 1ILOA 4XHMA 2L6DA 1TJDA 2VD1A 4MMMA 2ZNMA 3QFAC 3RPPA 4TN8A 5DJMA 4BWQA 3VWWA 1JZDA 3F8UA 1QQ2A 4MJBA 3IXRA 1O8WA 5IMAA 3QCPA 2IL3A 1ZOFA 1TU7A 1O85A 1TK8B 4GQFA 4XIHA 4Z7XA 1AIUA 3RPNA 5DJLA 2E2MA 3LFLA 3LORA 3LQ7A 4NHZA 3KZQA 3DVXA 4FIWA 4OCFA 4WR5A 1T4YA 3TJKA 1TK0B 5ECOB 5ECQB 4V2MA 4YKGA 3FY7A 1M7TA 4KSOA 2FA8A 2LKUA 3A3TA 4KUNA 4TOPA 3TUEA 2FD3A 1SK2A 3IV4A 5IMVA 2P5RA 3IRAA 2L57A 1OE7A 3QAVA 4V2NA 5IQYA 1NW2A 2YWOA 4KB3A 3H1NA 2VOCA 2CZ2A 3F3QA 2B6MA 3BJ5A 2H1AA 3FR6A 4GSSA 4GWRA 4MZBA 3KXOA 3KTBA 5ENUA 2LJRA 3TKRA 4EIPA 1GULA 3CMIA 3NOFA 1YKAA 3S9FA 4NAXA 2PWJA 1THXA 4KNDA 2F51A 1TDIA 2LV3A 3TOTA 4EIQA 5KN1A 1FOVA 1SYRA 3PPUA 2L59A 1TOFA 3RDWA 2YPMA 2LJAA 2YANA 1SJZA 3SWLA 2JL4A 1K0DA 2KHPA 5HQPA 4X1UA 3W8SA 1GSQA 1GTIA 2LTKA 1WOUA 2C4JA 5ECSA 3ZYWA 1MDKA 3EVIA 4OO5A 5IMDA 3QD9A 5J4UA 5A4UA 1F37A 4GRFA 5D9TA 2WFCA 4NV2A 1XWCA 3UJ1A 4WETA 4F0CA 3M1GA 3QFBC 3ZTLA 5C04A 2VM1A 4ZILA 5DCGA 4AJ7A 3NZNA 1OE8A 2GQLA 3EMXA 5KEJA 2MMZA 1KBNA 1MDIA 3PINA 2REMA 4HU9A 2KP2A 2O87A 2YP6A 4JU5A 1A8LA 4AJ8A 1K0NA 4YAVA 3P7XA 1MDJA 3RHBA 4Q5FA 2N5FA 1UC7A 2EIOA 3PGTA 2YNXA 5GZZB 3LEFA 5LNKe 2H1DA 2V32A 2AHEA 3LW9A 3HA9A 2WDUA 2IFQA 4EC0A 2EC4A 4XS4A 1WWJA 3ME7A 1UVZA 5AGYA 1WJKA 1ZCPA 3F6FA 1U87A 1PSQA 4K2XA 4YKFA 5CAXA 4QQ7A 17GSA 2H8LA 1URMA 3D21A 1Y25A 1X5CA 1GWCA 2K9FA 2YOIA 1KTEA 4YQMA 3TKSE 2DMLA 3KIJA 3UVTA 2OBKA 3F4SA 3A2XA 2WS2A 2DMMA 2K18A 2FCHA 4G9HA 2JSYA 1PKZA 1FHEA 4N11A 2R5GA 3GTUA 1O6JA 2B3SA 4KX4A 1SU9A 5IPGA 2CVKA 3CRTA 4PQIA 1ERVA 4MK3A 2B5YA 3G7JA 2IMIA 4N30A 4RI7A 5D93A 4EXJA 1F3BA 1V2AA 1J0FA 3CSJA 5GSSA 4HS1A 1X5EA 2GVPA 5IO0A 2VCVA 4AJ6A 2VL9A 4MF5A 5IMZA 1QGVA 3QAGA 2F8FA 5HFGA 2WRTA 3IA1A 5CO3A 1Z6MA 3QPMA 6GSVA 4BWSA 2ON7A 4MJEA 1SENA 1VF1A 3H79A 4ZB9A 3GKKA 1USBA 3EMPA 3KH9A 1AUCA 1HNAA 4O5UA 2J9HA 2RM5A 1T00A 1ZYPA 2H1BA 3FHKA 2HT9A 2DJJA 3RHCA 3ME8A 1EGRA 2EIQA 4K1FA 2NTOA 3GUSA 5B8AA 1XWAA 2WZ9A 1W4VA 4FYUA 1G7EA 4FYBA 3A2VA 2H6XA 2GSTA 1O8XA 5HFIA 2H71A 1XBSA 4BVYA 2QGVA 1X9WB 2R0PA 1QFNA 4WF4A 2H0IA 1CQHA 3VPTA 3BCIA 4ZXGA 1FO5A 2C1YA 4EDZA 4PTSA 3W6GA 2H66A 3HYPA 3L78A 4J2FA 3LSZA 2JSZA 5ID2A 3KGKA 4TR4A 11GSA 3R2QA 5H5SA 4MLYA 4ZBBA 2CZ3A 2LNTA 2VCWA 4HU7A 3H4KA 1GLPA 4LL1B 4BL7B 3L9SA 3WYWA 4IW9A 1T7PB 3UEMA 5BMUA 5L71A 2IJYA 2K8SA 2F9SA 4I2TA 1AQVA 5FT3A 5HR0A 1V9WA 3CYNA 3IHGA 4Q5QA 2KOKA 1K0MA 2MMNA 3DXBA 3GURA 4HOJA 5BRTA 4GXZA 4IELA 5ECIB 1YF0A 4DSQA 2R37A 1XOBA 4NWYA 1TRWA 2DIYA 4G0KA 1DE1A 1BYEA 4H86A 3GL3A 2VL2A 4PQ1A 3TCOA 4E8HA 2JZSA 2VCZA 3FR9A 5CRGA 2LNSA 5KN2A 1XW6A 2R6KA 2VIMA 4ECBA 3ERGA 2PVQA 2HRAA 2NPBA 2XHFA 1W89A 4YH2A 1A0FA 2DLXA 4TVEA 2E0QA 3F0IA 3ZFLA 2VL2C 3TB2A 1PX6A 2HSMA 6GSXA 2VCTA 3ZZXA 1V40A 5CYYA 1AXDA 2PUKC 1Q98A 3I9V2 3Q18A 2O8VB 3QDNA 3IC8A 1XZOA 3EURA 2H6ZA 3D0ZA 1PMTA 1PA3A 2ZUPA 4MZCA 3GMFA 3G7YA 1SJIA 2MBSA 2XPDA 4HZ2A 1FVKA 1OYJA 4ULXA 3GYKA 3EYTA 2YZUA 5ECRB 5J41A 5B7CA 1Q4JA 1PL1A 4CY6A 4MNNA 5A4WA 2LEGA 1QXHA 2FWFA 4N0VA 1U3IA 2G0FA 4IVFA 3HVVA 3HY2A 16GSA 3U6VA 4BVXA 4KE3A 1GSEA 1E6BA 4POBA 4CY8A 5IO2A 3ZIVA 3Q6OA 18GSA 5DVBA 3LG6A 2UZ8A 1EV4A 9GSSA 2XPEA 1GSUA 2XBIA 3L9UA 3LGCA 3ZMKA 4IGJA 3GRXA 2ES7A 2RUEA 4OMVA 2X8HA 2HZEA 3EU4A 1SKWB 5ECNB 3MAKA 1AC1A 3RBTA 4HEA2 4IP6A 1XVWA 3FKFA 4MPFA 2AAWA 1XXUA 2O85A 1G6WA 5J5NA 2L4CA 1BEDA 1TRUA 3KP8A 4LLRA 3GH9A 1PN9A 6GSYA 1YEXA 3GN3A 2DJ2A 5F8BA 4GSTA 4IQ1A 4ID0A 4KA0A 3TGZA 4BPYA 3HJOA 3EE2A 2PMTA 2BMXA 4GF0A 2LJKA 2WJUA 5D9WA 1TK5B 5COHA 3A5WA 1ERUA 4HQZA 5EPFA 4OO4A 4EUYA 1WE0A 5A4VA 1TU8A 2A4VA 4XRAA 4PNGA 4A5PA 1PL2A 2GS3A 3CTGA 4EL1A 1WMJA 2R4VA 6GSWA 1TTZA 2K8VA 1YDKA 4PQHA 5D9VA 1JHBA 4IKHA 4IQAA 5D9XA 1EGOA 2IFQB 1ST9A 2PBJA 3IC4A 2H1GA 4I6XA 8GSSA 3F6DA 4CW9A 2DJ0A 2ZCTA 1SL1B 2FWHA 4D73A 4KAEA 10GSA 4P3YB 2L5LA 5ECHB 3O3TA 5DCHA 4HDEA 2K6VA 3M8NA 1H4OA 3VK9A 5CRWA 1XVQA 2VLTA 2RUFA 4EF0A 2GGTA 4FH8A 5AIVA 3GKNA 1KNGA 5J3RA 2MMAA 1OC9A 2GQMA 2H75A 4TXVA 1A24A 4MCUA 4YAPA 3HXSA 3GTUB 5H5QA 3DWVA 1OKDA 5FHIA 2GSRA 4MF6A 1R7HA 4J57E 2IPAA 4HZ4A 2TIRA 4XCSA 2KLXA 2AUVA 5DALA 3C7MA 1FAAA 2BJXA 4MH3A 3ZIJA 12GSA 1SK1A 4KDUA 1OC8A 3E3EA 4Z2RA 2TRXA 4IJ3A 3FMWA 3P8WA 2CAIA 3FYGA 4I2UA 3P2AA 1ERTA 4ZL7A 3VWXA 2G2QA 3FRCA 1FB0A 4ECJA 2ON5A 3UBLA 4WBRD 2R3XA 3FZAA 4KGIA 5LCZA 5DQSA 5ELGA 1K0AA 5AN1A 3F3RA 4IHUA 1JZOA 2O89A 1SYXA 1T1VA 1K3OA 1JZWA 4MF7A 4KDXA 3APSA 5ABRA 2PVOC 4Z2TA 4LMVA 5CNWA 1UA5A 2P31A 3ZREA 2F8AA 2TRCP 3D22A 4POMA 4TR0A 3Q74A 4TR3A 1EP8A 2B1LA 1U88A 2IMDA 5GAPD 4BVYB 1FW1A 4ZBAA 3MNGA 4NXIA 1EZKA 1SK0A 4MPGA 5D96A 1AQXA 1R4WA 2HE3A 5CP1A 2IWTA 2MYGA 2HYXA 3LYKA 2GZYA 19GSA 4AGSA 3MDKA 4ECCA 3VWVA 2VLUA 4XS6A 2I81A 5ID2B 4JRRA 1MD3A 3EU3A 3M0FA 4TKYA 3HZ8A 4KF9A 4F03A 1GNEA 1XPVA 4EE0A 4GCIA 1GP1A 3CBUA 1ZGNA 1Z7PA 4J56E 4CDOA 1BX9A 4Q5RA 1XIYA 4V1Ap 1LU4A 6GSSA 1FG4A 2L6CA 1T8EB 3PH9A 1JZRA 4HQSA 2LUSA 5IMCA 3NIVA 5B8BA 3O76A 4ISDA 4TXOA 1G0TA 1SD9A 4OWYA 2MBTA 4K5SA 3H8QA 3UVHA 2WB9A 1ZL9A 1YF1A 4AF2A 2CAQA 2RLIA 4KDYA 1R5PA 5J9CA 2FA4A 2YV9A 5CRHA 3UARA 3PR8A 4O32A 3LXTA 2O7KA 3HDCA 3GH6A 1A23A 5E4WA 1N2AA 3P90A 2AV4A 2C3QA 4XTSA 2QKEA 2D2ZA 3F4TA 4PGTA 4BA7A 4KW6A 1S3CA 5IM9A 4RUVA 2R0CA 2R2JA 3L9VA 1DUGA 1ZYQB 1B8XA 3IK7A 5JCGA 2GSSA 2HLSA 1S3DA 4DVCA 2AYTA 2M72A 4K5RA 2JACA 5DDLA 3IAS2 1GTBA 1Z6NA 5ECPB 2YWNA 1ON4A 2VL3A 2IMKA 2L4QA 4DSRA 2H76A 4QL7A 3LJRA 5IOXA 1GRXA 3LWAA 2I4AA 3C1RA 4G10A 3KH7A 1UN2A 3KD0A 3TRXA 1GUKA 2X49A 4TW5A 2CV4A 3HHVA 3TDGA 2FLSA 2V6KA 3V1WA 2XC2A 5HR3A 1PD21 3MIXA 3VLNA 2EIRA 4NHWA 2JU5A 3WGXA 1OKTA 2FWGA 3F4RA 1TKDB 2ALBA 1EEJA 2DC5A 2A2SA 3N9JA 3LYPA 6GSUA 4BVXB 1I9DA 3VPQA 1NSWA 3WT2A 2PERA 4GQCA 1M2BA 3KMNA 3KCMA 1T3BA 3ZFBA 3WT1A 1YQ1A 3C73A 5C00A 4CHSA 4L5LA 4OD7A 4N0ZA 2KP1A 1ZYNA 3APQA 1WP0A 1BJXA 2DIZA 1XWBA 2V2GA 3GL5A 2HZEB 1M9BA 1G6YA 1M99A 3GKMA 3DEXA 5G31A 4WBJA 3UOMA 4L5OA 2GZPA 3M3MA 3VFIA 4NPBA 1T4ZA 3TOUA 1WPIA 2B1KA 4X43A 4ILFA 4MP4A 1A2LA 3GKXA 5FWGA 3A5IA 5JCUA 2WGRA 2HRFA 3AY8A 4OFTA 2LRCA 2C3TA 4Z2UA 4RQRA 1QMVA 2CX3A 4L8EA 3H93A 2XBQA 4HUAA 3TKSA 4G19A 1HNCA 1Z3EA 4IJIA 4ML6A 4K0NA 4N10A 2HFDA 5ECMB 2GDRA 3QMXA 1Z9HA 1X9MB 2OJLA 1CQGA 3I69A 1IYHA 1HD2A 4ML1A 4WEYA 3GX0A 3CSHA 1A2MA 3US3A 3D4MA 4JBBA 2H74A 4HJ2A 3UMAA 2RIIA 5JWOB 2LRNA 4I5QA 4OFMA 3W8JA 1PGTA 2OE1A 1EOGA 2V6OA 5KOXA 22GSA 2L5OA 1EWXA 1JLWA 4FYCA 2IMEA 5E59A 1SD8A 1F9MA 3LXZA 3D4TA 3C1SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M80 A;  4D73 B;  3IBH A;  2CA8 A;  1X5D A;  5B6M A;  2CQ9 A;  2HNL A;  1F3A A;  5F07 A;  1OAZ A;  1Z7R A;  4EDY A;  4NMU A;  2FGX A;  1XW5 A;  5CRD A;  3DKS A;  1OC9 B;  3E0U A;  4I8B A;  1JFU A;  2HRN A;  2VCX A;  4EO3 A;  2JAD A;  5DAL B;  4F2I A;  4TR1 A;  4OCE A;  1A2J A;  4XS1 A;  3WD6 A;  3K8N A;  4MJA A;  3HCZ A;  2I9H A;  2C0G A;  5ELA A;  3TKP A;  5EVO A;  3ERW A;  5IMF A;  3HVX A;  5DAK A;  5H5R A;  3E9J B;  4WXT A;  4HJM A;  4QL9 A;  3CRU A;  2X99 A;  5INY A;  5J9B A;  2OAC A;  3DD3 A;  2C0E A;  1GSF A;  4MA9 A;  2DJK A;  1QUW A;  2VO4 A;  2BTO T;  2WUL A;  3BOA A;  1ML6 A;  2FY6 A;  1EP7 A;  5EY6 A;  4JZQ A;  1XWK A;  4K9Z A;  1KEB A;  2B5X A;  2Z9S A;  2FWE A;  1HQO A;  4PUF C;  4POK A;  2N5B A;  2RM6 A;  3SBC A;  3APO A;  1BQ7 A;  2C8U A;  3KM6 A;  2HI7 A;  4XS4 B;  2N5A A;  3FK8 A;  1XCC A;  1I5G A;  3HJP A;  2C80 A;  3TRP A;  5AIS A;  5EL8 A;  2H70 A;  4LL4 B;  3ISO A;  5HR2 A;  4L0U A;  3ZRD A;  3DVW A;  1SJ6 A;  3GV1 A;  4DSS A;  3BBY A;  2HSY A;  4V1A g;  5D73 A;  4GLT A;  3WGD A;  3KEB A;  4F0B A;  1SL2 B;  3VUR A;  1GUH A;  4OFN A;  4G2E A;  1PKW A;  2H72 A;  1Z5Y E;  3GNJ A;  1U3A A;  3FZ5 A;  4LMW A;  3J7Y b;  4O5R A;  3F9U A;  1YZX A;  1B9Y C;  2CVB A;  2JZR A;  2IN3 A;  3QOU A;  5F06 A;  2B7J A;  2MZC A;  2VLV A;  2YN1 A;  1MD4 A;  1A8Y A;  2VD0 A;  4TXO B;  2X8C A;  4ZIJ A;  1WRY A;  3IOS A;  4PNF A;  3L4N A;  1ZYE A;  1ZMA A;  1GNW A;  2H73 A;  2PN8 A;  4K0G A;  5IPH A;  4KSM A;  2MMO A;  2I1U A;  3DGQ A;  2CX4 A;  2DJ1 A;  4POL A;  1TI3 A;  4PUA A;  1SKS B;  4JR4 A;  1GH2 A;  2FNO A;  3M9K A;  3HVS A;  1NHO A;  2H0G A;  1C72 A;  4K7I A;  2H0H A;  3CTF A;  4KCE A;  2FHE A;  2VM2 A;  3IHQ A;  2H6Y A;  3IPZ A;  4MAB A;  3UL3 A;  2F3M A;  3BD2 A;  4K8M A;  5LD0 A;  1VRS D;  2VAF A;  2C0D A;  1K0O A;  1LJR A;  3UAP A;  3QAW A;  4PX1 A;  1EEM A;  4DEJ A;  1M0U A;  3ZLP A;  1MTC A;  1O73 A;  3GA4 A;  3O6T A;  1V58 A;  1PQN A;  1PRX A;  3VI5 A;  2C0F A;  2NVL A;  20GS A;  3IK9 A;  3UIW A;  2J23 A;  4ZB6 A;  1WIK A;  1YEP A;  5G30 A;  1B9X C;  1Y6E A;  3G7I A;  2HSH A;  1SL0 B;  2B5E A;  3I6A A;  5DBQ A;  1BG5 A;  3FR3 A;  5G5F A;  1GL8 A;  2YZH A;  4X0X A;  3TRQ A;  1TXX A;  4F82 A;  3OR5 A;  1YJ6 A;  2OA7 A;  2DBC A;  1TRS A;  3VI7 A;  3I43 A;  1S3A A;  5HFK A;  1YKC A;  3KJY A;  5HR1 A;  4JR6 A;  2QC7 A;  3A2W A;  1VF3 A;  1GTA A;  1NM3 A;  1RK4 A;  3FZ9 A;  2OE0 A;  3M9J A;  1ABA A;  2M46 A;  4PUR A;  5CRE A;  4MH2 A;  3RAZ A;  1PX7 A;  4IBP A;  2LQQ A;  1DE2 A;  2VCQ A;  2DSA A;  4MZW A;  4JE1 A;  1VF2 A;  5B6N A;  4WF5 A;  1J08 A;  2NDO A;  1X9S B;  4ECI A;  1K0C A;  2GQK A;  4MDC A;  6GST A;  1E2Y A;  5JCW A;  5D8I A;  2GZZ A;  1GSY A;  4LA1 A;  2C3N A;  1THO A;  1B48 A;  2P5Q A;  3KP9 A;  1V98 A;  2LQO A;  2PGT A;  2CT6 A;  3KMO A;  1M2A A;  4V2L A;  5AIX A;  3G9B A;  4YQV A;  4NV5 A;  5G1K A;  2OBI A;  4KH7 A;  2FUG 2;  4ZB8 A;  1MEK A;  1OVN A;  2PPT A;  3VWU A;  3U5R E;  5JWQ B;  2DJ3 A;  5GAN D;  4HI7 A;  1XOA A;  4RI6 A;  1AW9 A;  4FO5 A;  5ECK B;  5IIZ A;  2YJH A;  1BAY A;  4Q5N A;  4WR4 A;  1RW1 A;  1N8J A;  1EOH A;  4GSN A;  3DIE A;  3DML A;  2P0G A;  4XRD A;  3N5O A;  5DQY A;  5G2Z A;  5KN0 A;  2WCI A;  3QR6 A;  3C8E A;  1FB6 A;  1VF4 A;  1R26 A;  1ACV A;  2YWM A;  2GT6 A;  1K3L A;  1FVJ A;  3TJF A;  2AB6 A;  4L0W A;  3GIX A;  4O92 A;  3GSS A;  3ERF A;  3HKR A;  1ERW A;  1GLQ A;  2CVD A;  2GLR A;  5GST A;  3UBK A;  1K0B A;  2H01 A;  4MJC A;  2AJQ B;  2QSI A;  3F63 A;  3TJB A;  4IP1 A;  2NBS A;  3D5J A;  1HNB A;  2OE3 A;  3BCK A;  3JCM L;  5KN3 A;  4K7N A;  3TJG A;  3CXG A;  3DYR A;  2H19 A;  1G7O A;  3C71 A;  1AQW A;  2PU9 C;  4K2D A;  1AAZ A;  3MSZ A;  3Q19 A;  1VGL A;  1J9B A;  2OAD A;  3IDV A;  1B4P A;  3HZ4 A;  2E7P A;  3KTL A;  3IAM 2;  4GTU A;  4IS0 A;  1GSS A;  2V1M A;  1DBY A;  3MWH A;  3TJJ A;  1QK8 A;  1R5A A;  2LS5 A;  2YV7 A;  2A2R A;  1M9A A;  1NHY A;  3CSI A;  2LRT A;  3D6I A;  14GS A;  3L0H A;  2OKA A;  4ZL8 A;  3ZVJ A;  1GTU A;  1JLV A;  3TKQ A;  1V57 A;  1TRV A;  3EC3 A;  2GT5 A;  1TP9 A;  2X8G A;  3WGE A;  2GTU A;  4TR1 B;  4F9Z A;  3FZ4 A;  1O81 A;  2IMF A;  1TI1 A;  4JED A;  4E8E A;  1F2E A;  2X64 A;  1LBK A;  2LST A;  1TW9 A;  5DAK B;  2YWI A;  4ZBD A;  3IR4 A;  2H30 A;  13GS A;  3ED3 A;  3ZL5 A;  4O7H A;  3GX8 A;  3ZIT A;  3EIN A;  4ZL9 A;  4PXO A;  1XW9 A;  4ACS A;  3EWL A;  3GFK A;  4I97 A;  5G5E A;  2IIY A;  1HYU A;  1YY7 A;  4EKZ A;  4IN0 A;  2YJ7 A;  1GSD A;  1SKR B;  2V41 A;  1O7U A;  2HZF A;  3ZML A;  1XWG A;  2GSQ A;  2YCD A;  1OC3 A;  5F05 A;  4KCA A;  1U6T A;  3TKS C;  3J7Y k;  1XFL A;  5G1L A;  4K7O A;  1ZZY A;  3IE3 A;  1B4Q A;  1M2D A;  3GST A;  4YQU A;  4BL7 A;  1IYI A;  2VUP A;  2JZT A;  4K6X A;  1K3Y A;  1EV9 A;  4WKW A;  7GSS A;  3ZVJ D;  5F0G A;  2E2G A;  1RQM A;  1GUM A;  4RQX A;  5A5K A;  5JWR B;  3HJM A;  5ECL B;  2I3Y A;  1H75 A;  3HD5 A;  2KUC A;  4DSS B;  4EVM A;  1F6M C;  5IOW A;  3GHA A;  3FEU A;  3FW2 A;  4TRX A;  1X0R A;  2HXK A;  1A0R P;  1DSB A;  3DRN A;  2B7K A;  1ILO A;  4XHM A;  2L6D A;  1TJD A;  2VD1 A;  4MMM A;  2ZNM A;  3QFA C;  3RPP A;  4TN8 A;  5DJM A;  4BWQ A;  3VWW A;  1JZD A;  3F8U A;  1QQ2 A;  4MJB A;  3IXR A;  1O8W A;  5IMA A;  3QCP A;  2IL3 A;  1ZOF A;  1TU7 A;  1O85 A;  1TK8 B;  4GQF A;  4XIH A;  4Z7X A;  1AIU A;  3RPN A;  5DJL A;  2E2M A;  3LFL A;  3LOR A;  3LQ7 A;  4NHZ A;  3KZQ A;  3DVX A;  4FIW A;  4OCF A;  4WR5 A;  1T4Y A;  3TJK A;  1TK0 B;  5ECO B;  5ECQ B;  4V2M A;  3FY7 A;  1M7T A;  4KSO A;  2FA8 A;  2LKU A;  3A3T A;  4KUN A;  4TOP A;  3TUE A;  2FD3 A;  1SK2 A;  3IV4 A;  5IMV A;  2P5R A;  3IRA A;  2L57 A;  1OE7 A;  3QAV A;  4V2N A;  5IQY A;  1NW2 A;  2YWO A;  4KB3 A;  3H1N A;  2VOC A;  2CZ2 A;  3F3Q A;  2B6M A;  3BJ5 A;  2H1A A;  3FR6 A;  4GSS A;  4GWR A;  4MZB A;  3KXO A;  3KTB A;  5ENU A;  2LJR A;  3TKR A;  1GUL A;  3CMI A;  3NOF A;  1YKA A;  3S9F A;  4NAX A;  2PWJ A;  1THX A;  4KND A;  2F51 A;  1TDI A;  2LV3 A;  3TOT A;  5KN1 A;  1FOV A;  1SYR A;  2L59 A;  1TOF A;  3RDW A;  2YPM A;  2LJA A;  2YAN A;  1SJZ A;  3SWL A;  2JL4 A;  1K0D A;  2KHP A;  5HQP A;  4X1U A;  3W8S A;  1GSQ A;  1GTI A;  2LTK A;  1WOU A;  2C4J A;  5ECS A;  3ZYW A;  1MDK A;  3EVI A;  4OO5 A;  5IMD A;  3QD9 A;  5J4U A;  5A4U A;  1F37 A;  4GRF A;  5D9T A;  2WFC A;  4NV2 A;  1XWC A;  3UJ1 A;  4WET A;  4F0C A;  3M1G A;  3QFB C;  3ZTL A;  5C04 A;  2VM1 A;  4ZIL A;  5DCG A;  4AJ7 A;  3NZN A;  1OE8 A;  2GQL A;  3EMX A;  5KEJ A;  2MMZ A;  1KBN A;  1MDI A;  3PIN A;  2REM A;  4HU9 A;  2KP2 A;  2O87 A;  2YP6 A;  4JU5 A;  1A8L A;  4AJ8 A;  1K0N A;  4YAV A;  3P7X A;  1MDJ A;  3RHB A;  4Q5F A;  2N5F A;  1UC7 A;  2EIO A;  3PGT A;  2YNX A;  5GZZ B;  3LEF A;  5LNK e;  2H1D A;  2V32 A;  2AHE A;  3HA9 A;  2WDU A;  2IFQ A;  4EC0 A;  2EC4 A;  4XS4 A;  1WWJ A;  3ME7 A;  1UVZ A;  5AGY A;  1WJK A;  1ZCP A;  3F6F A;  1U87 A;  1PSQ A;  5CAX A;  4QQ7 A;  17GS A;  2H8L A;  1URM A;  3D21 A;  1Y25 A;  1X5C A;  1GWC A;  2K9F A;  2YOI A;  1KTE A;  4YQM A;  3TKS E;  2DML A;  3KIJ A;  3UVT A;  2OBK A;  3F4S A;  3A2X A;  2WS2 A;  2DMM A;  2K18 A;  2FCH A;  4G9H A;  2JSY A;  1PKZ A;  1FHE A;  4N11 A;  2R5G A;  3GTU A;  1O6J A;  2B3S A;  4KX4 A;  1SU9 A;  5IPG A;  2CVK A;  3CRT A;  4PQI A;  1ERV A;  4MK3 A;  2B5Y A;  3G7J A;  2IMI A;  4N30 A;  4RI7 A;  5D93 A;  4EXJ A;  1F3B A;  1V2A A;  1J0F A;  3CSJ A;  5GSS A;  4HS1 A;  1X5E A;  2GVP A;  5IO0 A;  2VCV A;  4AJ6 A;  2VL9 A;  4MF5 A;  5IMZ A;  1QGV A;  3QAG A;  2F8F A;  5HFG A;  2WRT A;  3IA1 A;  5CO3 A;  1Z6M A;  3QPM A;  6GSV A;  4BWS A;  2ON7 A;  4MJE A;  1SEN A;  1VF1 A;  3H79 A;  4ZB9 A;  3GKK A;  1USB A;  3EMP A;  3KH9 A;  1AUC A;  1HNA A;  2J9H A;  2RM5 A;  1T00 A;  2H1B A;  3FHK A;  2HT9 A;  2DJJ A;  3RHC A;  3ME8 A;  1EGR A;  2EIQ A;  4K1F A;  2NTO A;  3GUS A;  5B8A A;  1XWA A;  2WZ9 A;  1W4V A;  4FYU A;  1G7E A;  4FYB A;  3A2V A;  2H6X A;  2GST A;  1O8X A;  5HFI A;  2H71 A;  1XBS A;  4BVY A;  2QGV A;  1X9W B;  1QFN A;  4WF4 A;  2H0I A;  1CQH A;  3VPT A;  3BCI A;  4ZXG A;  1FO5 A;  2C1Y A;  4EDZ A;  3W6G A;  2H66 A;  3HYP A;  3L78 A;  4J2F A;  3LSZ A;  2JSZ A;  5ID2 A;  3KGK A;  4TR4 A;  11GS A;  3R2Q A;  5H5S A;  4MLY A;  4ZBB A;  2CZ3 A;  2LNT A;  2VCW A;  4HU7 A;  3H4K A;  1GLP A;  4LL1 B;  3L9S A;  3WYW A;  4IW9 A;  1T7P B;  3UEM A;  5L71 A;  2IJY A;  2K8S A;  2F9S A;  4I2T A;  1AQV A;  5FT3 A;  5HR0 A;  1V9W A;  3CYN A;  4Q5Q A;  2KOK A;  1K0M A;  2MMN A;  3DXB A;  3GUR A;  4HOJ A;  4GXZ A;  4IEL A;  5ECI B;  1YF0 A;  4DSQ A;  2R37 A;  1XOB A;  4NWY A;  1TRW A;  2DIY A;  1DE1 A;  1BYE A;  4H86 A;  3GL3 A;  2VL2 A;  4PQ1 A;  3TCO A;  4E8H A;  2JZS A;  2VCZ A;  3FR9 A;  5CRG A;  2LNS A;  5KN2 A;  1XW6 A;  2R6K A;  2VIM A;  4ECB A;  3ERG A;  2PVQ A;  2NPB A;  2XHF A;  1W89 A;  4YH2 A;  1A0F A;  2DLX A;  4TVE A;  2E0Q A;  3F0I A;  3ZFL A;  2VL2 C;  3TB2 A;  1PX6 A;  6GSX A;  2VCT A;  3ZZX A;  1V40 A;  5CYY A;  1AXD A;  2PUK C;  1Q98 A;  3I9V 2;  3Q18 A;  2O8V B;  3QDN A;  1XZO A;  3EUR A;  2H6Z A;  3D0Z A;  1PMT A;  1PA3 A;  2ZUP A;  4MZC A;  3GMF A;  3G7Y A;  1SJI A;  2MBS A;  2XPD A;  4HZ2 A;  1FVK A;  1OYJ A;  4ULX A;  3GYK A;  3EYT A;  2YZU A;  5ECR B;  5J41 A;  5B7C A;  1Q4J A;  1PL1 A;  5A4W A;  2LEG A;  1QXH A;  2FWF A;  4N0V A;  1U3I A;  2G0F A;  4IVF A;  3HVV A;  3HY2 A;  16GS A;  3U6V A;  4BVX A;  4KE3 A;  1GSE A;  1E6B A;  4POB A;  5IO2 A;  3ZIV A;  3Q6O A;  18GS A;  5DVB A;  3LG6 A;  1EV4 A;  9GSS A;  2XPE A;  1GSU A;  2XBI A;  3L9U A;  3LGC A;  3ZMK A;  4IGJ A;  3GRX A;  2ES7 A;  2RUE A;  4OMV A;  2X8H A;  2HZE A;  3EU4 A;  1SKW B;  5ECN B;  3MAK A;  1AC1 A;  3RBT A;  4HEA 2;  4IP6 A;  1XVW A;  3FKF A;  4MPF A;  2AAW A;  1XXU A;  2O85 A;  1G6W A;  5J5N A;  2L4C A;  1BED A;  1TRU A;  3KP8 A;  4LLR A;  3GH9 A;  1PN9 A;  6GSY A;  1YEX A;  3GN3 A;  2DJ2 A;  5F8B A;  4GST A;  4IQ1 A;  4ID0 A;  4KA0 A;  3TGZ A;  4BPY A;  3HJO A;  3EE2 A;  2PMT A;  2BMX A;  4GF0 A;  2LJK A;  2WJU A;  5D9W A;  1TK5 B;  5COH A;  3A5W A;  1ERU A;  4HQZ A;  5EPF A;  4OO4 A;  4EUY A;  1WE0 A;  5A4V A;  1TU8 A;  2A4V A;  4XRA A;  4PNG A;  1PL2 A;  2GS3 A;  3CTG A;  4EL1 A;  1WMJ A;  2R4V A;  6GSW A;  1TTZ A;  2K8V A;  1YDK A;  4PQH A;  5D9V A;  1JHB A;  4IKH A;  4IQA A;  5D9X A;  1EGO A;  2IFQ B;  1ST9 A;  2PBJ A;  3IC4 A;  2H1G A;  4I6X A;  8GSS A;  3F6D A;  4CW9 A;  2DJ0 A;  2ZCT A;  1SL1 B;  2FWH A;  4D73 A;  4KAE A;  10GS A;  4P3Y B;  2L5L A;  5ECH B;  3O3T A;  5DCH A;  4HDE A;  2K6V A;  3M8N A;  1H4O A;  3VK9 A;  5CRW A;  1XVQ A;  2VLT A;  2RUF A;  4EF0 A;  2GGT A;  4FH8 A;  5AIV A;  3GKN A;  1KNG A;  5J3R A;  2MMA A;  1OC9 A;  2GQM A;  2H75 A;  4TXV A;  1A24 A;  4MCU A;  4YAP A;  3HXS A;  3GTU B;  5H5Q A;  3DWV A;  1OKD A;  5FHI A;  2GSR A;  4MF6 A;  1R7H A;  4J57 E;  2IPA A;  4HZ4 A;  2TIR A;  4XCS A;  2KLX A;  2AUV A;  5DAL A;  3C7M A;  1FAA A;  2BJX A;  4MH3 A;  3ZIJ A;  12GS A;  1SK1 A;  4KDU A;  1OC8 A;  3E3E A;  2TRX A;  4IJ3 A;  3P8W A;  2CAI A;  3FYG A;  4I2U A;  3P2A A;  1ERT A;  4ZL7 A;  3VWX A;  2G2Q A;  3FRC A;  1FB0 A;  4ECJ A;  2ON5 A;  3UBL A;  4WBR D;  2R3X A;  3FZA A;  4KGI A;  5LCZ A;  5DQS A;  5ELG A;  1K0A A;  5AN1 A;  3F3R A;  4IHU A;  1JZO A;  2O89 A;  1SYX A;  1T1V A;  1K3O A;  1JZW A;  4MF7 A;  4KDX A;  3APS A;  5ABR A;  2PVO C;  4LMV A;  5CNW A;  1UA5 A;  2P31 A;  3ZRE A;  2F8A A;  2TRC P;  3D22 A;  4POM A;  4TR0 A;  3Q74 A;  4TR3 A;  1EP8 A;  2B1L A;  1U88 A;  2IMD A;  5GAP D;  1FW1 A;  4ZBA A;  3MNG A;  4NXI A;  1EZK A;  1SK0 A;  4MPG A;  5D96 A;  1AQX A;  1R4W A;  2HE3 A;  5CP1 A;  2IWT A;  2MYG A;  2HYX A;  3LYK A;  2GZY A;  19GS A;  4AGS A;  3MDK A;  4ECC A;  3VWV A;  2VLU A;  4XS6 A;  2I81 A;  5ID2 B;  4JRR A;  1MD3 A;  3EU3 A;  3M0F A;  4TKY A;  3HZ8 A;  4F03 A;  1GNE A;  1XPV A;  4EE0 A;  4GCI A;  1GP1 A;  3CBU A;  1ZGN A;  1Z7P A;  4J56 E;  4CDO A;  1BX9 A;  4Q5R A;  1XIY A;  4V1A p;  1LU4 A;  6GSS A;  1FG4 A;  2L6C A;  1T8E B;  3PH9 A;  1JZR A;  4HQS A;  2LUS A;  5IMC A;  3NIV A;  5B8B A;  3O76 A;  4ISD A;  4TXO A;  1G0T A;  1SD9 A;  4OWY A;  2MBT A;  3H8Q A;  3UVH A;  2WB9 A;  1ZL9 A;  1YF1 A;  4AF2 A;  2CAQ A;  2RLI A;  4KDY A;  1R5P A;  5J9C A;  2FA4 A;  2YV9 A;  5CRH A;  3UAR A;  3PR8 A;  4O32 A;  3LXT A;  2O7K A;  3HDC A;  3GH6 A;  1A23 A;  5E4W A;  1N2A A;  3P90 A;  2AV4 A;  2C3Q A;  4XTS A;  2QKE A;  2D2Z A;  3F4T A;  4PGT A;  4BA7 A;  4KW6 A;  1S3C A;  5IM9 A;  4RUV A;  2R2J A;  3L9V A;  1DUG A;  1ZYQ B;  1B8X A;  3IK7 A;  5JCG A;  2GSS A;  2HLS A;  1S3D A;  4DVC A;  2AYT A;  2M72 A;  2JAC A;  5DDL A;  3IAS 2;  1GTB A;  1Z6N A;  5ECP B;  2YWN A;  1ON4 A;  2VL3 A;  2IMK A;  2L4Q A;  4DSR A;  2H76 A;  4QL7 A;  3LJR A;  5IOX A;  1GRX A;  3LWA A;  2I4A A;  3C1R A;  4G10 A;  3KH7 A;  1UN2 A;  3KD0 A;  3TRX A;  1GUK A;  4TW5 A;  2CV4 A;  3HHV A;  3TDG A;  2FLS A;  2V6K A;  3V1W A;  2XC2 A;  5HR3 A;  1PD2 1;  3VLN A;  2EIR A;  4NHW A;  2JU5 A;  3WGX A;  1OKT A;  2FWG A;  3F4R A;  1TKD B;  2ALB A;  1EEJ A;  2DC5 A;  2A2S A;  3N9J A;  3LYP A;  6GSU A;  1I9D A;  3VPQ A;  1NSW A;  3WT2 A;  2PER A;  4GQC A;  1M2B A;  3KMN A;  3KCM A;  1T3B A;  3ZFB A;  3WT1 A;  1YQ1 A;  3C73 A;  5C00 A;  4CHS A;  4L5L A;  4OD7 A;  4N0Z A;  2KP1 A;  3APQ A;  1WP0 A;  1BJX A;  2DIZ A;  1XWB A;  2V2G A;  3GL5 A;  2HZE B;  1M9B A;  1G6Y A;  1M99 A;  3GKM A;  3DEX A;  5G31 A;  4WBJ A;  3UOM A;  4L5O A;  2GZP A;  3M3M A;  3VFI A;  4NPB A;  1T4Z A;  3TOU A;  1WPI A;  2B1K A;  4X43 A;  4ILF A;  4MP4 A;  1A2L A;  3GKX A;  5FWG A;  5JCU A;  2WGR A;  2HRF A;  3AY8 A;  4OFT A;  2LRC A;  2C3T A;  4RQR A;  1QMV A;  2CX3 A;  4L8E A;  3H93 A;  2XBQ A;  4HUA A;  3TKS A;  4G19 A;  1HNC A;  1Z3E A;  4IJI A;  4ML6 A;  4K0N A;  4N10 A;  2HFD A;  5ECM B;  2GDR A;  3QMX A;  1Z9H A;  1X9M B;  2OJL A;  1CQG A;  3I69 A;  1IYH A;  1HD2 A;  4ML1 A;  4WEY A;  3GX0 A;  3CSH A;  1A2M A;  3US3 A;  3D4M A;  4JBB A;  2H74 A;  4HJ2 A;  3UMA A;  2RII A;  5JWO B;  2LRN A;  4I5Q A;  4OFM A;  3W8J A;  1PGT A;  2OE1 A;  1EOG A;  2V6O A;  22GS A;  2L5O A;  1EWX A;  1JLW A;  4FYC A;  2IME A;  5E59 A;  1SD8 A;  1F9M A;  3LXZ A;  3D4T A;  3C1S A; 
#chains in the Genus database with same CATH topology
 2M80 A;  4D73 B;  3IBH A;  2CA8 A;  1X5D A;  2DKI A;  5B6M A;  2CQ9 A;  2HNL A;  1F3A A;  5F07 A;  1OAZ A;  1Z7R A;  4EDY A;  4NMU A;  2FGX A;  1XW5 A;  5CRD A;  3DKS A;  1OC9 B;  3E0U A;  4I8B A;  1JFU A;  1PN0 A;  2HRN A;  2VCX A;  4EO3 A;  2JAD A;  5DAL B;  4F2I A;  4TR1 A;  4OCE A;  1A2J A;  4XS1 A;  3WD6 A;  3K8N A;  4MJA A;  3HCZ A;  2I9H A;  2C0G A;  5ELA A;  3TKP A;  5EVO A;  3ERW A;  5IMF A;  3HVX A;  5DAK A;  5H5R A;  3E9J B;  4WXT A;  4HJM A;  4QL9 A;  3CRU A;  2X99 A;  4G0I A;  5J9B A;  5INY A;  2OAC A;  3DD3 A;  2C0E A;  1GSF A;  4MA9 A;  2DJK A;  1QUW A;  2VO4 A;  2BTO T;  2WUL A;  3BOA A;  1ML6 A;  2FY6 A;  1EP7 A;  5EY6 A;  4O5Q A;  2A4H A;  4JZQ A;  1XWK A;  4K9Z A;  1KEB A;  2B5X A;  2Z9S A;  2FWE A;  1HQO A;  4PUF C;  4FQU A;  4POK A;  2N5B A;  2RM6 A;  3SBC A;  3APO A;  1BQ7 A;  2C8U A;  3KM6 A;  2HI7 A;  4XS4 B;  2DKH A;  2N5A A;  3FK8 A;  1XCC A;  1I5G A;  3HJP A;  2C80 A;  3TRP A;  5AIS A;  5EL8 A;  2QA2 A;  2H70 A;  4LL4 B;  3ISO A;  5HR2 A;  4L0U A;  3ZRD A;  3DVW A;  1SJ6 A;  3GV1 A;  4DSS A;  3BBY A;  2HSY A;  2QA1 A;  4V1A g;  5D73 A;  4GLT A;  3WGD A;  3KEB A;  4F0B A;  4G0L A;  1SL2 B;  3VUR A;  1GUH A;  4OFN A;  4G2E A;  1PKW A;  2H72 A;  1Z5Y E;  3GNJ A;  2A2P A;  1U3A A;  3FZ5 A;  4LMW A;  3J7Y b;  4O5R A;  3F9U A;  1YZX A;  1B9Y C;  2CVB A;  2JZR A;  2IN3 A;  3QOU A;  5F06 A;  2B7J A;  2MZC A;  2VLV A;  2YN1 A;  1MD4 A;  1A8Y A;  2VD0 A;  4TXO B;  2X8C A;  4ZIJ A;  1WRY A;  3IOS A;  4PNF A;  3L4N A;  1ZYE A;  1ZMA A;  1GNW A;  2H73 A;  2PN8 A;  4K0G A;  5IPH A;  4KSM A;  2MMO A;  2I1U A;  3DGQ A;  2CX4 A;  2DJ1 A;  4POL A;  1TI3 A;  4PUA A;  1SKS B;  4JR4 A;  1GH2 A;  2FNO A;  3M9K A;  3HVS A;  1NHO A;  2H0G A;  1C72 A;  4K7I A;  2H0H A;  3CTF A;  4KCE A;  2FHE A;  2VM2 A;  3IHQ A;  2H6Y A;  3IPZ A;  4MAB A;  3UL3 A;  2F3M A;  3BD2 A;  4K8M A;  5LD0 A;  1VRS D;  4X4J A;  2VAF A;  2C0D A;  1K0O A;  1XG8 A;  1LJR A;  3UAP A;  3QAW A;  4PX1 A;  1EEM A;  4DEJ A;  1M0U A;  3ZLP A;  1MTC A;  1O73 A;  3GA4 A;  3O6T A;  1V58 A;  1PQN A;  1PRX A;  3VI5 A;  2C0F A;  2NVL A;  20GS A;  3IK9 A;  3UIW A;  2J23 A;  4ZB6 A;  1WIK A;  1YEP A;  5G30 A;  1B9X C;  1Y6E A;  3G7I A;  2HSH A;  1SL0 B;  2B5E A;  2HRK A;  3I6A A;  5DBQ A;  1BG5 A;  3FR3 A;  5G5F A;  1GL8 A;  2YZH A;  4X0X A;  3TRQ A;  1TXX A;  4F82 A;  3OR5 A;  1YJ6 A;  5KOW A;  2OA7 A;  2DBC A;  1TRS A;  3VI7 A;  3I43 A;  1S3A A;  5HFK A;  1YKC A;  3KJY A;  5HR1 A;  4JR6 A;  2QC7 A;  3A2W A;  1VF3 A;  1GTA A;  1NM3 A;  1RK4 A;  3FZ9 A;  2OE0 A;  3M9J A;  1ABA A;  2M46 A;  4PUR A;  5CRE A;  4MH2 A;  3RAZ A;  1PX7 A;  4IBP A;  2LQQ A;  1DE2 A;  2VCQ A;  2DSA A;  4MZW A;  3MYD A;  1VF2 A;  4JE1 A;  5B6N A;  4WF5 A;  1J08 A;  2NDO A;  1X9S B;  4ECI A;  1K0C A;  2GQK A;  4MDC A;  6GST A;  1E2Y A;  5JCW A;  5D8I A;  2GZZ A;  1GSY A;  4LA1 A;  2C3N A;  3EPT A;  1THO A;  1B48 A;  2P5Q A;  3KP9 A;  1V98 A;  2LQO A;  2PGT A;  2CT6 A;  3KMO A;  1M2A A;  4V2L A;  5AIX A;  3G9B A;  4YQV A;  4NV5 A;  5G1K A;  2OBI A;  4KH7 A;  2FUG 2;  4ZB8 A;  1MEK A;  1OVN A;  2PPT A;  3VWU A;  3U5R E;  5JWQ B;  2DJ3 A;  5GAN D;  4HI7 A;  1XOA A;  4RI6 A;  1AW9 A;  4FO5 A;  5ECK B;  5IIZ A;  2YJH A;  1BAY A;  4Q5N A;  4WR4 A;  1RW1 A;  1N8J A;  1EOH A;  4GSN A;  3DIE A;  4ICY A;  3DML A;  2P0G A;  4XRD A;  3N5O A;  5DQY A;  5G2Z A;  5KN0 A;  2WCI A;  3QR6 A;  3C8E A;  1FB6 A;  1VF4 A;  1R26 A;  1ACV A;  2YWM A;  2GT6 A;  1K3L A;  1FVJ A;  3TJF A;  2AB6 A;  4L0W A;  3GIX A;  4O92 A;  3GSS A;  3ERF A;  3HKR A;  1ERW A;  1GLQ A;  2CVD A;  2GLR A;  5GST A;  3UBK A;  1K0B A;  2H01 A;  4MJC A;  2AJQ B;  2QSI A;  3F63 A;  3TJB A;  4IP1 A;  2NBS A;  3D5J A;  1HNB A;  2OE3 A;  1FOH A;  3BCK A;  3JCM L;  2R0G A;  5KN3 A;  4K7N A;  3TJG A;  3CXG A;  3DYR A;  2H19 A;  1G7O A;  3C71 A;  1AQW A;  2PU9 C;  4K2D A;  1AAZ A;  3MSZ A;  3Q19 A;  1VGL A;  1J9B A;  2OAD A;  3IDV A;  1B4P A;  3HZ4 A;  2E7P A;  3KTL A;  3IAM 2;  4GTU A;  4IS0 A;  1GSS A;  2V1M A;  1DBY A;  3MWH A;  3TJJ A;  1QK8 A;  1R5A A;  2LS5 A;  2YV7 A;  2A2R A;  2X4A A;  1M9A A;  1NHY A;  3CSI A;  2LRT A;  3D6I A;  14GS A;  3L0H A;  2OKA A;  4ZL8 A;  3ZVJ A;  1GTU A;  1JLV A;  3TKQ A;  1V57 A;  1TRV A;  3EC3 A;  2GT5 A;  1TP9 A;  2X8G A;  3WGE A;  2GTU A;  4TR1 B;  4F9Z A;  3FZ4 A;  1O81 A;  2IMF A;  1TI1 A;  4JED A;  4E8E A;  1F2E A;  2X64 A;  3R3E A;  1LBK A;  2LST A;  1TW9 A;  5DAK B;  2YWI A;  4ZBD A;  3IR4 A;  2H30 A;  13GS A;  3ED3 A;  3ZL5 A;  4O7H A;  3GX8 A;  3ZIT A;  3EIN A;  4ZL9 A;  4PXO A;  1XW9 A;  4ACS A;  3EWL A;  3GFK A;  4I97 A;  5G5E A;  2IIY A;  1HYU A;  1YY7 A;  4EKZ A;  4IN0 A;  2YJ7 A;  1GSD A;  1SKR B;  2V41 A;  1O7U A;  2HZF A;  3ZML A;  1XWG A;  2GSQ A;  2YCD A;  1OC3 A;  5F05 A;  4KCA A;  1U6T A;  3TKS C;  3J7Y k;  1XFL A;  5G1L A;  4K7O A;  1ZZY A;  3IE3 A;  1B4Q A;  1M2D A;  3GST A;  4YQU A;  4BL7 A;  1IYI A;  2VUP A;  2JZT A;  4K6X A;  1K3Y A;  1EV9 A;  4WKW A;  7GSS A;  3ZVJ D;  5F0G A;  2E2G A;  1RQM A;  1GUM A;  4RQX A;  5A5K A;  4USS A;  5JWR B;  3HJM A;  5ECL B;  2I3Y A;  1H75 A;  3HD5 A;  2KUC A;  4DSS B;  4EVM A;  1F6M C;  5IOW A;  3GHA A;  3FEU A;  3FW2 A;  4TRX A;  1X0R A;  2HXK A;  1A0R P;  1DSB A;  3DRN A;  2B7K A;  1ILO A;  4XHM A;  2L6D A;  1TJD A;  2VD1 A;  4MMM A;  2ZNM A;  3QFA C;  3RPP A;  4TN8 A;  5DJM A;  4BWQ A;  3VWW A;  1JZD A;  3F8U A;  1QQ2 A;  4MJB A;  3IXR A;  1O8W A;  5IMA A;  3QCP A;  2IL3 A;  1ZOF A;  1TU7 A;  1O85 A;  1TK8 B;  4GQF A;  4XIH A;  4Z7X A;  1AIU A;  3RPN A;  5DJL A;  2E2M A;  3LFL A;  3LOR A;  3LQ7 A;  4NHZ A;  3KZQ A;  3DVX A;  4FIW A;  4OCF A;  4WR5 A;  1T4Y A;  3TJK A;  1TK0 B;  5ECO B;  5ECQ B;  4V2M A;  4YKG A;  3FY7 A;  1M7T A;  4KSO A;  2FA8 A;  2LKU A;  3A3T A;  4KUN A;  4TOP A;  3TUE A;  2FD3 A;  1SK2 A;  3IV4 A;  5IMV A;  2P5R A;  3IRA A;  2L57 A;  1OE7 A;  3QAV A;  4V2N A;  5IQY A;  1NW2 A;  2YWO A;  4KB3 A;  3H1N A;  2VOC A;  2CZ2 A;  3F3Q A;  2B6M A;  3BJ5 A;  2H1A A;  3FR6 A;  4GSS A;  4GWR A;  4MZB A;  3KXO A;  3KTB A;  5ENU A;  2LJR A;  3TKR A;  4EIP A;  1GUL A;  3CMI A;  3NOF A;  1YKA A;  3S9F A;  4NAX A;  2PWJ A;  1THX A;  4KND A;  2F51 A;  1TDI A;  2LV3 A;  3TOT A;  4EIQ A;  5KN1 A;  1FOV A;  1SYR A;  3PPU A;  2L59 A;  1TOF A;  3RDW A;  2YPM A;  2LJA A;  2YAN A;  1SJZ A;  3SWL A;  2JL4 A;  1K0D A;  2KHP A;  5HQP A;  4X1U A;  3W8S A;  1GSQ A;  1GTI A;  2LTK A;  1WOU A;  2C4J A;  5ECS A;  3ZYW A;  1MDK A;  3EVI A;  4OO5 A;  5IMD A;  3QD9 A;  5J4U A;  5A4U A;  1F37 A;  4GRF A;  5D9T A;  2WFC A;  4NV2 A;  1XWC A;  3UJ1 A;  4WET A;  4F0C A;  3M1G A;  3QFB C;  3ZTL A;  4HSC X;  5C04 A;  2VM1 A;  4ZIL A;  5DCG A;  4AJ7 A;  3NZN A;  1OE8 A;  2GQL A;  3EMX A;  5KEJ A;  2MMZ A;  1KBN A;  1MDI A;  3PIN A;  2REM A;  4HU9 A;  2KP2 A;  2O87 A;  2YP6 A;  4JU5 A;  1A8L A;  4AJ8 A;  1K0N A;  4YAV A;  3P7X A;  1MDJ A;  3RHB A;  4Q5F A;  2N5F A;  1UC7 A;  2EIO A;  3PGT A;  2YNX A;  5GZZ B;  3LEF A;  5LNK e;  2H1D A;  2V32 A;  2AHE A;  3LW9 A;  3HA9 A;  2WDU A;  2IFQ A;  4EC0 A;  2EC4 A;  4XS4 A;  1WWJ A;  3ME7 A;  1UVZ A;  5AGY A;  1WJK A;  1ZCP A;  3F6F A;  1U87 A;  1PSQ A;  4K2X A;  4YKF A;  5CAX A;  4QQ7 A;  17GS A;  2H8L A;  1URM A;  3D21 A;  1Y25 A;  1X5C A;  1GWC A;  2K9F A;  2YOI A;  1KTE A;  4YQM A;  3TKS E;  2DML A;  3KIJ A;  3UVT A;  2OBK A;  3F4S A;  3A2X A;  2WS2 A;  2DMM A;  2K18 A;  2FCH A;  4G9H A;  2JSY A;  1PKZ A;  1FHE A;  4N11 A;  2R5G A;  3GTU A;  1O6J A;  2B3S A;  4KX4 A;  1SU9 A;  5IPG A;  2CVK A;  3CRT A;  4PQI A;  1ERV A;  4MK3 A;  2B5Y A;  3G7J A;  2IMI A;  4N30 A;  4RI7 A;  5D93 A;  4EXJ A;  1F3B A;  1V2A A;  1J0F A;  3CSJ A;  1PFO A;  5GSS A;  4HS1 A;  1X5E A;  2GVP A;  5IO0 A;  2VCV A;  4AJ6 A;  2VL9 A;  4MF5 A;  5IMZ A;  1QGV A;  3QAG A;  2F8F A;  5HFG A;  2WRT A;  3IA1 A;  5CO3 A;  1Z6M A;  3QPM A;  6GSV A;  4BWS A;  2ON7 A;  4MJE A;  1SEN A;  1VF1 A;  3H79 A;  4ZB9 A;  3GKK A;  1USB A;  3EMP A;  3KH9 A;  1AUC A;  1HNA A;  4O5U A;  2J9H A;  2RM5 A;  1T00 A;  1ZYP A;  2H1B A;  3FHK A;  2HT9 A;  2DJJ A;  3RHC A;  3ME8 A;  1EGR A;  2EIQ A;  4K1F A;  2NTO A;  3GUS A;  5B8A A;  1XWA A;  2WZ9 A;  1W4V A;  4FYU A;  1G7E A;  4FYB A;  3A2V A;  2H6X A;  2GST A;  1O8X A;  5HFI A;  2H71 A;  1XBS A;  4BVY A;  2QGV A;  1X9W B;  2R0P A;  1QFN A;  4WF4 A;  2H0I A;  1CQH A;  3VPT A;  3BCI A;  4ZXG A;  1FO5 A;  2C1Y A;  4EDZ A;  4PTS A;  3W6G A;  2H66 A;  3HYP A;  3L78 A;  4J2F A;  3LSZ A;  2JSZ A;  5ID2 A;  3KGK A;  4TR4 A;  11GS A;  3R2Q A;  5H5S A;  4MLY A;  4ZBB A;  2CZ3 A;  2LNT A;  2VCW A;  4HU7 A;  3H4K A;  1GLP A;  4LL1 B;  4BL7 B;  3L9S A;  3WYW A;  4IW9 A;  1T7P B;  3UEM A;  5BMU A;  5L71 A;  2IJY A;  2K8S A;  2F9S A;  4I2T A;  1AQV A;  5FT3 A;  5HR0 A;  1V9W A;  3CYN A;  3IHG A;  4Q5Q A;  2KOK A;  1K0M A;  2MMN A;  3DXB A;  3GUR A;  4HOJ A;  5BRT A;  4GXZ A;  4IEL A;  5ECI B;  1YF0 A;  4DSQ A;  2R37 A;  1XOB A;  4NWY A;  1TRW A;  2DIY A;  4G0K A;  1DE1 A;  1BYE A;  4H86 A;  3GL3 A;  2VL2 A;  4PQ1 A;  3TCO A;  4E8H A;  2JZS A;  2VCZ A;  3FR9 A;  5CRG A;  2LNS A;  5KN2 A;  1XW6 A;  2R6K A;  2VIM A;  4ECB A;  3ERG A;  2PVQ A;  2HRA A;  2NPB A;  2XHF A;  1W89 A;  4YH2 A;  1A0F A;  2DLX A;  4TVE A;  2E0Q A;  3F0I A;  3ZFL A;  2VL2 C;  3TB2 A;  1PX6 A;  2HSM A;  6GSX A;  2VCT A;  3ZZX A;  1V40 A;  5CYY A;  1AXD A;  2PUK C;  1Q98 A;  3I9V 2;  3Q18 A;  2O8V B;  3QDN A;  3IC8 A;  1XZO A;  3EUR A;  2H6Z A;  3D0Z A;  1PMT A;  1PA3 A;  2ZUP A;  4MZC A;  3GMF A;  3G7Y A;  1SJI A;  2MBS A;  2XPD A;  4HZ2 A;  1FVK A;  1OYJ A;  4ULX A;  3GYK A;  3EYT A;  2YZU A;  5ECR B;  5J41 A;  5B7C A;  1Q4J A;  1PL1 A;  4CY6 A;  4MNN A;  5A4W A;  2LEG A;  1QXH A;  2FWF A;  3HVN A;  4N0V A;  1U3I A;  2G0F A;  4IVF A;  3HVV A;  3HY2 A;  16GS A;  3U6V A;  4BVX A;  4KE3 A;  1GSE A;  1E6B A;  4POB A;  4CY8 A;  5IO2 A;  3ZIV A;  3Q6O A;  18GS A;  5DVB A;  3LG6 A;  2UZ8 A;  1EV4 A;  9GSS A;  2XPE A;  1GSU A;  2XBI A;  3L9U A;  3LGC A;  3ZMK A;  4IGJ A;  3GRX A;  2ES7 A;  2RUE A;  4OMV A;  2X8H A;  2HZE A;  3EU4 A;  1SKW B;  5ECN B;  3MAK A;  1AC1 A;  3RBT A;  4HEA 2;  4IP6 A;  1XVW A;  3FKF A;  4MPF A;  2AAW A;  1XXU A;  2O85 A;  1G6W A;  5J5N A;  2L4C A;  1BED A;  1TRU A;  3KP8 A;  4LLR A;  3GH9 A;  1PN9 A;  6GSY A;  1YEX A;  3GN3 A;  2DJ2 A;  5F8B A;  4GST A;  4IQ1 A;  4ID0 A;  4KA0 A;  3TGZ A;  4BPY A;  3HJO A;  3EE2 A;  2PMT A;  2BMX A;  4GF0 A;  2LJK A;  2WJU A;  5D9W A;  1TK5 B;  5COH A;  3A5W A;  1ERU A;  4HQZ A;  5EPF A;  4OO4 A;  4EUY A;  1WE0 A;  5A4V A;  1TU8 A;  2A4V A;  4XRA A;  4PNG A;  4A5P A;  1PL2 A;  2GS3 A;  3CTG A;  4EL1 A;  1WMJ A;  2R4V A;  6GSW A;  1TTZ A;  2K8V A;  1YDK A;  4PQH A;  5D9V A;  1JHB A;  4IKH A;  4IQA A;  5D9X A;  1EGO A;  2IFQ B;  1ST9 A;  2PBJ A;  3IC4 A;  2H1G A;  4I6X A;  8GSS A;  3F6D A;  4CW9 A;  2DJ0 A;  2ZCT A;  1SL1 B;  2FWH A;  4D73 A;  4KAE A;  10GS A;  4P3Y B;  2L5L A;  5ECH B;  3O3T A;  5DCH A;  4HDE A;  2K6V A;  3M8N A;  1H4O A;  3VK9 A;  5CRW A;  1XVQ A;  2VLT A;  2RUF A;  4EF0 A;  2GGT A;  4FH8 A;  5AIV A;  3GKN A;  1KNG A;  5J3R A;  2MMA A;  1OC9 A;  2GQM A;  2H75 A;  4TXV A;  1A24 A;  4MCU A;  4YAP A;  3HXS A;  3GTU B;  5H5Q A;  3DWV A;  1OKD A;  5FHI A;  2GSR A;  4MF6 A;  1R7H A;  4J57 E;  2IPA A;  4HZ4 A;  2TIR A;  4XCS A;  2KLX A;  2AUV A;  5DAL A;  3C7M A;  1FAA A;  2BJX A;  4MH3 A;  3ZIJ A;  12GS A;  1SK1 A;  4KDU A;  1OC8 A;  3E3E A;  4Z2R A;  2TRX A;  4IJ3 A;  3FMW A;  3P8W A;  2CAI A;  3FYG A;  4I2U A;  3P2A A;  1ERT A;  4ZL7 A;  3VWX A;  2G2Q A;  3FRC A;  4BIK A;  1FB0 A;  4ECJ A;  2ON5 A;  3UBL A;  4WBR D;  2R3X A;  3FZA A;  4KGI A;  5LCZ A;  5DQS A;  5ELG A;  1K0A A;  5AN1 A;  3F3R A;  4IHU A;  1JZO A;  2O89 A;  1SYX A;  1T1V A;  1K3O A;  1JZW A;  4MF7 A;  4KDX A;  3APS A;  5ABR A;  2PVO C;  4Z2T A;  4LMV A;  5CNW A;  1UA5 A;  2P31 A;  3ZRE A;  2F8A A;  2TRC P;  3D22 A;  4POM A;  4TR0 A;  3Q74 A;  4TR3 A;  1EP8 A;  2B1L A;  1U88 A;  2IMD A;  5GAP D;  4BVY B;  1FW1 A;  4ZBA A;  3MNG A;  4NXI A;  1EZK A;  1SK0 A;  4MPG A;  5D96 A;  1AQX A;  1R4W A;  2HE3 A;  5CP1 A;  2IWT A;  2MYG A;  1M3J A;  2HYX A;  3LYK A;  2GZY A;  19GS A;  4AGS A;  3MDK A;  4ECC A;  3VWV A;  2VLU A;  4XS6 A;  2I81 A;  5ID2 B;  4JRR A;  1MD3 A;  3EU3 A;  3M0F A;  4TKY A;  3HZ8 A;  4KF9 A;  4F03 A;  1GNE A;  1XPV A;  4EE0 A;  4GCI A;  1GP1 A;  3CBU A;  1ZGN A;  1Z7P A;  4J56 E;  4CDO A;  1BX9 A;  4Q5R A;  1XIY A;  4V1A p;  1LU4 A;  6GSS A;  1FG4 A;  2L6C A;  1T8E B;  3PH9 A;  1JZR A;  4HQS A;  2LUS A;  5IMC A;  3NIV A;  5B8B A;  3O76 A;  4ISD A;  4TXO A;  1G0T A;  1SD9 A;  4OWY A;  2MBT A;  4K5S A;  3H8Q A;  3UVH A;  2WB9 A;  1ZL9 A;  1YF1 A;  4AF2 A;  2CAQ A;  2RLI A;  4KDY A;  1R5P A;  5J9C A;  2FA4 A;  2YV9 A;  5CRH A;  3UAR A;  3PR8 A;  4O32 A;  3LXT A;  2O7K A;  3HDC A;  3GH6 A;  1A23 A;  5E4W A;  1N2A A;  3P90 A;  2AV4 A;  2C3Q A;  4XTS A;  2QKE A;  2D2Z A;  3F4T A;  4PGT A;  4BA7 A;  4KW6 A;  1S3C A;  5IM9 A;  4RUV A;  2R0C A;  2R2J A;  3L9V A;  1DUG A;  1ZYQ B;  1B8X A;  3IK7 A;  3CQF A;  5JCG A;  2GSS A;  2HLS A;  1S3D A;  4DVC A;  2AYT A;  2M72 A;  4K5R A;  2JAC A;  5DDL A;  3IAS 2;  1GTB A;  1Z6N A;  5ECP B;  2YWN A;  1ON4 A;  2VL3 A;  2IMK A;  2L4Q A;  4DSR A;  2H76 A;  4QL7 A;  3LJR A;  5IOX A;  1GRX A;  3LWA A;  2I4A A;  3C1R A;  4G10 A;  3KH7 A;  1UN2 A;  3KD0 A;  3TRX A;  1GUK A;  2X49 A;  4TW5 A;  2CV4 A;  3HHV A;  3TDG A;  2FLS A;  2V6K A;  3V1W A;  2XC2 A;  5HR3 A;  1PD2 1;  3MIX A;  3VLN A;  2EIR A;  4NHW A;  2JU5 A;  3WGX A;  1OKT A;  2FWG A;  3F4R A;  1TKD B;  2ALB A;  1EEJ A;  2DC5 A;  2A2S A;  3N9J A;  3LYP A;  6GSU A;  4BVX B;  1I9D A;  3VPQ A;  1NSW A;  3WT2 A;  2PER A;  4GQC A;  1M2B A;  3KMN A;  3KCM A;  1T3B A;  3ZFB A;  3WT1 A;  1YQ1 A;  3C73 A;  5C00 A;  4CHS A;  4L5L A;  4OD7 A;  4N0Z A;  2KP1 A;  1ZYN A;  3APQ A;  1S3R A;  1WP0 A;  1BJX A;  2DIZ A;  1XWB A;  2V2G A;  3GL5 A;  2HZE B;  1M9B A;  1G6Y A;  1M99 A;  3GKM A;  3DEX A;  5G31 A;  4WBJ A;  3UOM A;  4L5O A;  2GZP A;  3M3M A;  3VFI A;  4NPB A;  1T4Z A;  3TOU A;  1WPI A;  2B1K A;  4X43 A;  4ILF A;  4MP4 A;  1A2L A;  3GKX A;  5FWG A;  3A5I A;  5JCU A;  2WGR A;  2HRF A;  3AY8 A;  4OFT A;  2LRC A;  2C3T A;  4Z2U A;  4RQR A;  1QMV A;  2CX3 A;  4L8E A;  3H93 A;  2XBQ A;  4HUA A;  3TKS A;  4G19 A;  1HNC A;  1Z3E A;  4IJI A;  4ML6 A;  4K0N A;  4N10 A;  2HFD A;  5ECM B;  2GDR A;  3QMX A;  1Z9H A;  1X9M B;  2OJL A;  1CQG A;  3I69 A;  1IYH A;  1HD2 A;  4ML1 A;  4WEY A;  3GX0 A;  3CSH A;  1A2M A;  1M3I A;  3US3 A;  3D4M A;  4JBB A;  2H74 A;  4HJ2 A;  3UMA A;  2RII A;  5JWO B;  2LRN A;  4I5Q A;  4OFM A;  3W8J A;  1PGT A;  2OE1 A;  1EOG A;  2V6O A;  5KOX A;  22GS A;  2L5O A;  1EWX A;  1JLW A;  4FYC A;  2IME A;  5E59 A;  1SD8 A;  1F9M A;  3LXZ A;  3D4T A;  3C1S A; 
#chains in the Genus database with same CATH homology
 2M80 A;  4D73 B;  3IBH A;  2CA8 A;  1X5D A;  2DKI A;  5B6M A;  2CQ9 A;  2HNL A;  1F3A A;  5F07 A;  1OAZ A;  1Z7R A;  4EDY A;  4NMU A;  2FGX A;  1XW5 A;  5CRD A;  3DKS A;  1OC9 B;  3E0U A;  4I8B A;  1JFU A;  1PN0 A;  2HRN A;  2VCX A;  4EO3 A;  2JAD A;  5DAL B;  4F2I A;  4TR1 A;  4OCE A;  1A2J A;  4XS1 A;  3WD6 A;  3K8N A;  4MJA A;  3HCZ A;  2I9H A;  2C0G A;  5ELA A;  3TKP A;  5EVO A;  3ERW A;  5IMF A;  3HVX A;  5DAK A;  5H5R A;  3E9J B;  4WXT A;  4HJM A;  4QL9 A;  3CRU A;  2X99 A;  4G0I A;  5J9B A;  5INY A;  2OAC A;  3DD3 A;  2C0E A;  1GSF A;  4MA9 A;  2DJK A;  1QUW A;  2VO4 A;  2BTO T;  2WUL A;  3BOA A;  1ML6 A;  2FY6 A;  1EP7 A;  5EY6 A;  4O5Q A;  2A4H A;  4JZQ A;  1XWK A;  4K9Z A;  1KEB A;  2B5X A;  2Z9S A;  2FWE A;  1HQO A;  4PUF C;  4FQU A;  4POK A;  2N5B A;  2RM6 A;  3SBC A;  3APO A;  1BQ7 A;  2C8U A;  3KM6 A;  2HI7 A;  4XS4 B;  2DKH A;  2N5A A;  3FK8 A;  1XCC A;  1I5G A;  3HJP A;  2C80 A;  3TRP A;  5AIS A;  5EL8 A;  2QA2 A;  2H70 A;  4LL4 B;  3ISO A;  5HR2 A;  4L0U A;  3ZRD A;  3DVW A;  1SJ6 A;  3GV1 A;  4DSS A;  3BBY A;  2HSY A;  2QA1 A;  4V1A g;  5D73 A;  4GLT A;  3WGD A;  3KEB A;  4F0B A;  4G0L A;  1SL2 B;  3VUR A;  1GUH A;  4OFN A;  4G2E A;  1PKW A;  2H72 A;  1Z5Y E;  3GNJ A;  2A2P A;  1U3A A;  3FZ5 A;  4LMW A;  3J7Y b;  4O5R A;  3F9U A;  1YZX A;  1B9Y C;  2CVB A;  2JZR A;  2IN3 A;  3QOU A;  5F06 A;  2B7J A;  2MZC A;  2VLV A;  2YN1 A;  1MD4 A;  1A8Y A;  2VD0 A;  4TXO B;  2X8C A;  4ZIJ A;  1WRY A;  3IOS A;  4PNF A;  3L4N A;  1ZYE A;  1ZMA A;  1GNW A;  2H73 A;  2PN8 A;  4K0G A;  5IPH A;  4KSM A;  2MMO A;  2I1U A;  3DGQ A;  2CX4 A;  2DJ1 A;  4POL A;  1TI3 A;  4PUA A;  1SKS B;  4JR4 A;  1GH2 A;  2FNO A;  3M9K A;  3HVS A;  1NHO A;  2H0G A;  1C72 A;  4K7I A;  2H0H A;  3CTF A;  4KCE A;  2FHE A;  2VM2 A;  3IHQ A;  2H6Y A;  3IPZ A;  4MAB A;  3UL3 A;  2F3M A;  3BD2 A;  4K8M A;  5LD0 A;  1VRS D;  4X4J A;  2VAF A;  2C0D A;  1K0O A;  1LJR A;  3UAP A;  3QAW A;  4PX1 A;  1EEM A;  4DEJ A;  1M0U A;  3ZLP A;  1MTC A;  1O73 A;  3GA4 A;  3O6T A;  1V58 A;  1PQN A;  1PRX A;  3VI5 A;  2C0F A;  2NVL A;  20GS A;  3IK9 A;  3UIW A;  2J23 A;  4ZB6 A;  1WIK A;  1YEP A;  5G30 A;  1B9X C;  1Y6E A;  3G7I A;  2HSH A;  1SL0 B;  2B5E A;  2HRK A;  3I6A A;  5DBQ A;  1BG5 A;  3FR3 A;  5G5F A;  1GL8 A;  2YZH A;  4X0X A;  3TRQ A;  1TXX A;  4F82 A;  3OR5 A;  1YJ6 A;  5KOW A;  2OA7 A;  2DBC A;  1TRS A;  3VI7 A;  3I43 A;  1S3A A;  5HFK A;  1YKC A;  3KJY A;  5HR1 A;  4JR6 A;  2QC7 A;  3A2W A;  1VF3 A;  1GTA A;  1NM3 A;  1RK4 A;  3FZ9 A;  2OE0 A;  3M9J A;  1ABA A;  2M46 A;  4PUR A;  5CRE A;  4MH2 A;  3RAZ A;  1PX7 A;  4IBP A;  2LQQ A;  1DE2 A;  2VCQ A;  2DSA A;  4MZW A;  3MYD A;  1VF2 A;  4JE1 A;  5B6N A;  4WF5 A;  1J08 A;  2NDO A;  1X9S B;  4ECI A;  1K0C A;  2GQK A;  4MDC A;  6GST A;  1E2Y A;  5JCW A;  5D8I A;  2GZZ A;  1GSY A;  4LA1 A;  2C3N A;  3EPT A;  1THO A;  1B48 A;  2P5Q A;  3KP9 A;  1V98 A;  2LQO A;  2PGT A;  2CT6 A;  3KMO A;  1M2A A;  4V2L A;  5AIX A;  3G9B A;  4YQV A;  4NV5 A;  5G1K A;  2OBI A;  4KH7 A;  2FUG 2;  4ZB8 A;  1MEK A;  1OVN A;  2PPT A;  3VWU A;  3U5R E;  5JWQ B;  2DJ3 A;  5GAN D;  4HI7 A;  1XOA A;  4RI6 A;  1AW9 A;  4FO5 A;  5ECK B;  5IIZ A;  2YJH A;  1BAY A;  4Q5N A;  4WR4 A;  1RW1 A;  1N8J A;  1EOH A;  4GSN A;  3DIE A;  4ICY A;  3DML A;  2P0G A;  4XRD A;  3N5O A;  5DQY A;  5G2Z A;  5KN0 A;  2WCI A;  3QR6 A;  3C8E A;  1FB6 A;  1VF4 A;  1R26 A;  1ACV A;  2YWM A;  2GT6 A;  1K3L A;  1FVJ A;  3TJF A;  2AB6 A;  4L0W A;  3GIX A;  4O92 A;  3GSS A;  3ERF A;  3HKR A;  1ERW A;  1GLQ A;  2CVD A;  2GLR A;  5GST A;  3UBK A;  1K0B A;  2H01 A;  4MJC A;  2AJQ B;  2QSI A;  3F63 A;  3TJB A;  4IP1 A;  2NBS A;  3D5J A;  1HNB A;  2OE3 A;  1FOH A;  3BCK A;  3JCM L;  2R0G A;  5KN3 A;  4K7N A;  3TJG A;  3CXG A;  3DYR A;  2H19 A;  1G7O A;  3C71 A;  1AQW A;  2PU9 C;  4K2D A;  1AAZ A;  3MSZ A;  3Q19 A;  1VGL A;  1J9B A;  2OAD A;  3IDV A;  1B4P A;  3HZ4 A;  2E7P A;  3KTL A;  3IAM 2;  4GTU A;  4IS0 A;  1GSS A;  2V1M A;  1DBY A;  3MWH A;  3TJJ A;  1QK8 A;  1R5A A;  2LS5 A;  2YV7 A;  2A2R A;  2X4A A;  1M9A A;  1NHY A;  3CSI A;  2LRT A;  3D6I A;  14GS A;  3L0H A;  2OKA A;  4ZL8 A;  3ZVJ A;  1GTU A;  1JLV A;  3TKQ A;  1V57 A;  1TRV A;  3EC3 A;  2GT5 A;  1TP9 A;  2X8G A;  3WGE A;  2GTU A;  4TR1 B;  4F9Z A;  3FZ4 A;  1O81 A;  2IMF A;  1TI1 A;  4JED A;  4E8E A;  1F2E A;  2X64 A;  3R3E A;  1LBK A;  2LST A;  1TW9 A;  5DAK B;  2YWI A;  4ZBD A;  3IR4 A;  2H30 A;  13GS A;  3ED3 A;  3ZL5 A;  4O7H A;  3GX8 A;  3ZIT A;  3EIN A;  4ZL9 A;  4PXO A;  1XW9 A;  4ACS A;  3EWL A;  3GFK A;  4I97 A;  5G5E A;  2IIY A;  1HYU A;  1YY7 A;  4EKZ A;  4IN0 A;  2YJ7 A;  1GSD A;  1SKR B;  2V41 A;  1O7U A;  2HZF A;  3ZML A;  1XWG A;  2GSQ A;  2YCD A;  1OC3 A;  5F05 A;  4KCA A;  1U6T A;  3TKS C;  3J7Y k;  1XFL A;  5G1L A;  4K7O A;  1ZZY A;  3IE3 A;  1B4Q A;  1M2D A;  3GST A;  4YQU A;  4BL7 A;  1IYI A;  2VUP A;  2JZT A;  4K6X A;  1K3Y A;  1EV9 A;  4WKW A;  7GSS A;  3ZVJ D;  5F0G A;  2E2G A;  1RQM A;  1GUM A;  4RQX A;  5A5K A;  4USS A;  5JWR B;  3HJM A;  5ECL B;  2I3Y A;  1H75 A;  3HD5 A;  2KUC A;  4DSS B;  4EVM A;  1F6M C;  5IOW A;  3GHA A;  3FEU A;  3FW2 A;  4TRX A;  1X0R A;  2HXK A;  1A0R P;  1DSB A;  3DRN A;  2B7K A;  1ILO A;  4XHM A;  2L6D A;  1TJD A;  2VD1 A;  4MMM A;  2ZNM A;  3QFA C;  3RPP A;  4TN8 A;  5DJM A;  4BWQ A;  3VWW A;  1JZD A;  3F8U A;  1QQ2 A;  4MJB A;  3IXR A;  1O8W A;  5IMA A;  3QCP A;  2IL3 A;  1ZOF A;  1TU7 A;  1O85 A;  1TK8 B;  4GQF A;  4XIH A;  4Z7X A;  1AIU A;  3RPN A;  5DJL A;  2E2M A;  3LFL A;  3LOR A;  3LQ7 A;  4NHZ A;  3KZQ A;  3DVX A;  4FIW A;  4OCF A;  4WR5 A;  1T4Y A;  3TJK A;  1TK0 B;  5ECO B;  5ECQ B;  4V2M A;  4YKG A;  3FY7 A;  1M7T A;  4KSO A;  2FA8 A;  2LKU A;  3A3T A;  4KUN A;  4TOP A;  3TUE A;  2FD3 A;  1SK2 A;  3IV4 A;  5IMV A;  2P5R A;  3IRA A;  2L57 A;  1OE7 A;  3QAV A;  4V2N A;  5IQY A;  1NW2 A;  2YWO A;  4KB3 A;  3H1N A;  2VOC A;  2CZ2 A;  3F3Q A;  2B6M A;  3BJ5 A;  2H1A A;  3FR6 A;  4GSS A;  4GWR A;  4MZB A;  3KXO A;  3KTB A;  5ENU A;  2LJR A;  3TKR A;  4EIP A;  1GUL A;  3CMI A;  3NOF A;  1YKA A;  3S9F A;  4NAX A;  2PWJ A;  1THX A;  4KND A;  2F51 A;  1TDI A;  2LV3 A;  3TOT A;  4EIQ A;  5KN1 A;  1FOV A;  1SYR A;  3PPU A;  2L59 A;  1TOF A;  3RDW A;  2YPM A;  2LJA A;  2YAN A;  1SJZ A;  3SWL A;  2JL4 A;  1K0D A;  2KHP A;  5HQP A;  4X1U A;  3W8S A;  1GSQ A;  1GTI A;  2LTK A;  1WOU A;  2C4J A;  5ECS A;  3ZYW A;  1MDK A;  3EVI A;  4OO5 A;  5IMD A;  3QD9 A;  5J4U A;  5A4U A;  1F37 A;  4GRF A;  5D9T A;  2WFC A;  4NV2 A;  1XWC A;  3UJ1 A;  4WET A;  4F0C A;  3M1G A;  3QFB C;  3ZTL A;  5C04 A;  2VM1 A;  4ZIL A;  5DCG A;  4AJ7 A;  3NZN A;  1OE8 A;  2GQL A;  3EMX A;  5KEJ A;  2MMZ A;  1KBN A;  1MDI A;  3PIN A;  2REM A;  4HU9 A;  2KP2 A;  2O87 A;  2YP6 A;  4JU5 A;  1A8L A;  4AJ8 A;  1K0N A;  4YAV A;  3P7X A;  1MDJ A;  3RHB A;  4Q5F A;  2N5F A;  1UC7 A;  2EIO A;  3PGT A;  2YNX A;  5GZZ B;  3LEF A;  5LNK e;  2H1D A;  2V32 A;  2AHE A;  3LW9 A;  3HA9 A;  2WDU A;  2IFQ A;  4EC0 A;  2EC4 A;  4XS4 A;  1WWJ A;  3ME7 A;  1UVZ A;  5AGY A;  1WJK A;  1ZCP A;  3F6F A;  1U87 A;  1PSQ A;  4K2X A;  4YKF A;  5CAX A;  4QQ7 A;  17GS A;  2H8L A;  1URM A;  3D21 A;  1Y25 A;  1X5C A;  1GWC A;  2K9F A;  2YOI A;  1KTE A;  4YQM A;  3TKS E;  2DML A;  3KIJ A;  3UVT A;  2OBK A;  3F4S A;  3A2X A;  2WS2 A;  2DMM A;  2K18 A;  2FCH A;  4G9H A;  2JSY A;  1PKZ A;  1FHE A;  4N11 A;  2R5G A;  3GTU A;  1O6J A;  2B3S A;  4KX4 A;  1SU9 A;  5IPG A;  2CVK A;  3CRT A;  4PQI A;  1ERV A;  4MK3 A;  2B5Y A;  3G7J A;  2IMI A;  4N30 A;  4RI7 A;  5D93 A;  4EXJ A;  1F3B A;  1V2A A;  1J0F A;  3CSJ A;  5GSS A;  4HS1 A;  1X5E A;  2GVP A;  5IO0 A;  2VCV A;  4AJ6 A;  2VL9 A;  4MF5 A;  5IMZ A;  1QGV A;  3QAG A;  2F8F A;  5HFG A;  2WRT A;  3IA1 A;  5CO3 A;  1Z6M A;  3QPM A;  6GSV A;  4BWS A;  2ON7 A;  4MJE A;  1SEN A;  1VF1 A;  3H79 A;  4ZB9 A;  3GKK A;  1USB A;  3EMP A;  3KH9 A;  1AUC A;  1HNA A;  4O5U A;  2J9H A;  2RM5 A;  1T00 A;  1ZYP A;  2H1B A;  3FHK A;  2HT9 A;  2DJJ A;  3RHC A;  3ME8 A;  1EGR A;  2EIQ A;  4K1F A;  2NTO A;  3GUS A;  5B8A A;  1XWA A;  2WZ9 A;  1W4V A;  4FYU A;  1G7E A;  4FYB A;  3A2V A;  2H6X A;  2GST A;  1O8X A;  5HFI A;  2H71 A;  1XBS A;  4BVY A;  2QGV A;  1X9W B;  2R0P A;  1QFN A;  4WF4 A;  2H0I A;  1CQH A;  3VPT A;  3BCI A;  4ZXG A;  1FO5 A;  2C1Y A;  4EDZ A;  4PTS A;  3W6G A;  2H66 A;  3HYP A;  3L78 A;  4J2F A;  3LSZ A;  2JSZ A;  5ID2 A;  3KGK A;  4TR4 A;  11GS A;  3R2Q A;  5H5S A;  4MLY A;  4ZBB A;  2CZ3 A;  2LNT A;  2VCW A;  4HU7 A;  3H4K A;  1GLP A;  4LL1 B;  4BL7 B;  3L9S A;  3WYW A;  4IW9 A;  1T7P B;  3UEM A;  5BMU A;  5L71 A;  2IJY A;  2K8S A;  2F9S A;  4I2T A;  1AQV A;  5FT3 A;  5HR0 A;  1V9W A;  3CYN A;  3IHG A;  4Q5Q A;  2KOK A;  1K0M A;  2MMN A;  3DXB A;  3GUR A;  4HOJ A;  5BRT A;  4GXZ A;  4IEL A;  5ECI B;  1YF0 A;  4DSQ A;  2R37 A;  1XOB A;  4NWY A;  1TRW A;  2DIY A;  4G0K A;  1DE1 A;  1BYE A;  4H86 A;  3GL3 A;  2VL2 A;  4PQ1 A;  3TCO A;  4E8H A;  2JZS A;  2VCZ A;  3FR9 A;  5CRG A;  2LNS A;  5KN2 A;  1XW6 A;  2R6K A;  2VIM A;  4ECB A;  3ERG A;  2PVQ A;  2HRA A;  2NPB A;  2XHF A;  1W89 A;  4YH2 A;  1A0F A;  2DLX A;  4TVE A;  2E0Q A;  3F0I A;  3ZFL A;  2VL2 C;  3TB2 A;  1PX6 A;  2HSM A;  6GSX A;  2VCT A;  3ZZX A;  1V40 A;  5CYY A;  1AXD A;  2PUK C;  1Q98 A;  3I9V 2;  3Q18 A;  2O8V B;  3QDN A;  3IC8 A;  1XZO A;  3EUR A;  2H6Z A;  3D0Z A;  1PMT A;  1PA3 A;  2ZUP A;  4MZC A;  3GMF A;  3G7Y A;  1SJI A;  2MBS A;  2XPD A;  4HZ2 A;  1FVK A;  1OYJ A;  4ULX A;  3GYK A;  3EYT A;  2YZU A;  5ECR B;  5J41 A;  5B7C A;  1Q4J A;  1PL1 A;  4CY6 A;  4MNN A;  5A4W A;  2LEG A;  1QXH A;  2FWF A;  4N0V A;  1U3I A;  2G0F A;  4IVF A;  3HVV A;  3HY2 A;  16GS A;  3U6V A;  4BVX A;  4KE3 A;  1GSE A;  1E6B A;  4POB A;  4CY8 A;  5IO2 A;  3ZIV A;  3Q6O A;  18GS A;  5DVB A;  3LG6 A;  2UZ8 A;  1EV4 A;  9GSS A;  2XPE A;  1GSU A;  2XBI A;  3L9U A;  3LGC A;  3ZMK A;  4IGJ A;  3GRX A;  2ES7 A;  2RUE A;  4OMV A;  2X8H A;  2HZE A;  3EU4 A;  1SKW B;  5ECN B;  3MAK A;  1AC1 A;  3RBT A;  4HEA 2;  4IP6 A;  1XVW A;  3FKF A;  4MPF A;  2AAW A;  1XXU A;  2O85 A;  1G6W A;  5J5N A;  2L4C A;  1BED A;  1TRU A;  3KP8 A;  4LLR A;  3GH9 A;  1PN9 A;  6GSY A;  1YEX A;  3GN3 A;  2DJ2 A;  5F8B A;  4GST A;  4IQ1 A;  4ID0 A;  4KA0 A;  3TGZ A;  4BPY A;  3HJO A;  3EE2 A;  2PMT A;  2BMX A;  4GF0 A;  2LJK A;  2WJU A;  5D9W A;  1TK5 B;  5COH A;  3A5W A;  1ERU A;  4HQZ A;  5EPF A;  4OO4 A;  4EUY A;  1WE0 A;  5A4V A;  1TU8 A;  2A4V A;  4XRA A;  4PNG A;  4A5P A;  1PL2 A;  2GS3 A;  3CTG A;  4EL1 A;  1WMJ A;  2R4V A;  6GSW A;  1TTZ A;  2K8V A;  1YDK A;  4PQH A;  5D9V A;  1JHB A;  4IKH A;  4IQA A;  5D9X A;  1EGO A;  2IFQ B;  1ST9 A;  2PBJ A;  3IC4 A;  2H1G A;  4I6X A;  8GSS A;  3F6D A;  4CW9 A;  2DJ0 A;  2ZCT A;  1SL1 B;  2FWH A;  4D73 A;  4KAE A;  10GS A;  4P3Y B;  2L5L A;  5ECH B;  3O3T A;  5DCH A;  4HDE A;  2K6V A;  3M8N A;  1H4O A;  3VK9 A;  5CRW A;  1XVQ A;  2VLT A;  2RUF A;  4EF0 A;  2GGT A;  4FH8 A;  5AIV A;  3GKN A;  1KNG A;  5J3R A;  2MMA A;  1OC9 A;  2GQM A;  2H75 A;  4TXV A;  1A24 A;  4MCU A;  4YAP A;  3HXS A;  3GTU B;  5H5Q A;  3DWV A;  1OKD A;  5FHI A;  2GSR A;  4MF6 A;  1R7H A;  4J57 E;  2IPA A;  4HZ4 A;  2TIR A;  4XCS A;  2KLX A;  2AUV A;  5DAL A;  3C7M A;  1FAA A;  2BJX A;  4MH3 A;  3ZIJ A;  12GS A;  1SK1 A;  4KDU A;  1OC8 A;  3E3E A;  4Z2R A;  2TRX A;  4IJ3 A;  3FMW A;  3P8W A;  2CAI A;  3FYG A;  4I2U A;  3P2A A;  1ERT A;  4ZL7 A;  3VWX A;  2G2Q A;  3FRC A;  1FB0 A;  4ECJ A;  2ON5 A;  3UBL A;  4WBR D;  2R3X A;  3FZA A;  4KGI A;  5LCZ A;  5DQS A;  5ELG A;  1K0A A;  5AN1 A;  3F3R A;  4IHU A;  1JZO A;  2O89 A;  1SYX A;  1T1V A;  1K3O A;  1JZW A;  4MF7 A;  4KDX A;  3APS A;  5ABR A;  2PVO C;  4Z2T A;  4LMV A;  5CNW A;  1UA5 A;  2P31 A;  3ZRE A;  2F8A A;  2TRC P;  3D22 A;  4POM A;  4TR0 A;  3Q74 A;  4TR3 A;  1EP8 A;  2B1L A;  1U88 A;  2IMD A;  5GAP D;  4BVY B;  1FW1 A;  4ZBA A;  3MNG A;  4NXI A;  1EZK A;  1SK0 A;  4MPG A;  5D96 A;  1AQX A;  1R4W A;  2HE3 A;  5CP1 A;  2IWT A;  2MYG A;  2HYX A;  3LYK A;  2GZY A;  19GS A;  4AGS A;  3MDK A;  4ECC A;  3VWV A;  2VLU A;  4XS6 A;  2I81 A;  5ID2 B;  4JRR A;  1MD3 A;  3EU3 A;  3M0F A;  4TKY A;  3HZ8 A;  4KF9 A;  4F03 A;  1GNE A;  1XPV A;  4EE0 A;  4GCI A;  1GP1 A;  3CBU A;  1ZGN A;  1Z7P A;  4J56 E;  4CDO A;  1BX9 A;  4Q5R A;  1XIY A;  4V1A p;  1LU4 A;  6GSS A;  1FG4 A;  2L6C A;  1T8E B;  3PH9 A;  1JZR A;  4HQS A;  2LUS A;  5IMC A;  3NIV A;  5B8B A;  3O76 A;  4ISD A;  4TXO A;  1G0T A;  1SD9 A;  4OWY A;  2MBT A;  4K5S A;  3H8Q A;  3UVH A;  2WB9 A;  1ZL9 A;  1YF1 A;  4AF2 A;  2CAQ A;  2RLI A;  4KDY A;  1R5P A;  5J9C A;  2FA4 A;  2YV9 A;  5CRH A;  3UAR A;  3PR8 A;  4O32 A;  3LXT A;  2O7K A;  3HDC A;  3GH6 A;  1A23 A;  5E4W A;  1N2A A;  3P90 A;  2AV4 A;  2C3Q A;  4XTS A;  2QKE A;  2D2Z A;  3F4T A;  4PGT A;  4BA7 A;  4KW6 A;  1S3C A;  5IM9 A;  4RUV A;  2R0C A;  2R2J A;  3L9V A;  1DUG A;  1ZYQ B;  1B8X A;  3IK7 A;  5JCG A;  2GSS A;  2HLS A;  1S3D A;  4DVC A;  2AYT A;  2M72 A;  4K5R A;  2JAC A;  5DDL A;  3IAS 2;  1GTB A;  1Z6N A;  5ECP B;  2YWN A;  1ON4 A;  2VL3 A;  2IMK A;  2L4Q A;  4DSR A;  2H76 A;  4QL7 A;  3LJR A;  5IOX A;  1GRX A;  3LWA A;  2I4A A;  3C1R A;  4G10 A;  3KH7 A;  1UN2 A;  3KD0 A;  3TRX A;  1GUK A;  2X49 A;  4TW5 A;  2CV4 A;  3HHV A;  3TDG A;  2FLS A;  2V6K A;  3V1W A;  2XC2 A;  5HR3 A;  1PD2 1;  3MIX A;  3VLN A;  2EIR A;  4NHW A;  2JU5 A;  3WGX A;  1OKT A;  2FWG A;  3F4R A;  1TKD B;  2ALB A;  1EEJ A;  2DC5 A;  2A2S A;  3N9J A;  3LYP A;  6GSU A;  4BVX B;  1I9D A;  3VPQ A;  1NSW A;  3WT2 A;  2PER A;  4GQC A;  1M2B A;  3KMN A;  3KCM A;  1T3B A;  3ZFB A;  3WT1 A;  1YQ1 A;  3C73 A;  5C00 A;  4CHS A;  4L5L A;  4OD7 A;  4N0Z A;  2KP1 A;  1ZYN A;  3APQ A;  1WP0 A;  1BJX A;  2DIZ A;  1XWB A;  2V2G A;  3GL5 A;  2HZE B;  1M9B A;  1G6Y A;  1M99 A;  3GKM A;  3DEX A;  5G31 A;  4WBJ A;  3UOM A;  4L5O A;  2GZP A;  3M3M A;  3VFI A;  4NPB A;  1T4Z A;  3TOU A;  1WPI A;  2B1K A;  4X43 A;  4ILF A;  4MP4 A;  1A2L A;  3GKX A;  5FWG A;  3A5I A;  5JCU A;  2WGR A;  2HRF A;  3AY8 A;  4OFT A;  2LRC A;  2C3T A;  4Z2U A;  4RQR A;  1QMV A;  2CX3 A;  4L8E A;  3H93 A;  2XBQ A;  4HUA A;  3TKS A;  4G19 A;  1HNC A;  1Z3E A;  4IJI A;  4ML6 A;  4K0N A;  4N10 A;  2HFD A;  5ECM B;  2GDR A;  3QMX A;  1Z9H A;  1X9M B;  2OJL A;  1CQG A;  3I69 A;  1IYH A;  1HD2 A;  4ML1 A;  4WEY A;  3GX0 A;  3CSH A;  1A2M A;  3US3 A;  3D4M A;  4JBB A;  2H74 A;  4HJ2 A;  3UMA A;  2RII A;  5JWO B;  2LRN A;  4I5Q A;  4OFM A;  3W8J A;  1PGT A;  2OE1 A;  1EOG A;  2V6O A;  5KOX A;  22GS A;  2L5O A;  1EWX A;  1JLW A;  4FYC A;  2IME A;  5E59 A;  1SD8 A;  1F9M A;  3LXZ A;  3D4T A;  3C1S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...