3IRAA

The crystal structure of one domain of the conserved protein from methanosarcina mazei go1
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
172
structure length
172
Chain Sequence
AEPNRLIKEKSPYLLQHAYNPVDWYPWGEEAFEKARKENKPVFLSIGYSTCHWCHMMAHESFEDEEVAGLMNEAFVSIKVDREERPDIDNIYMTVCQIILGRGGWPLNIIMTPGKKPFFAGTYIPKNTRFNQIGMLELVPRIKEIWEQQHEEVLDSAEKITSTIQEMIKESS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Conserved protein
publication title The crystal structure of one domain of the conserved protein from Methanosarcina mazei Go1
rcsb
source organism Methanosarcina mazei
total genus 50
structure length 172
sequence length 172
ec nomenclature
pdb deposition date 2009-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03190 Thioredox_DsbH Protein of unknown function, DUF255
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3iraA00
3WGDA 5D9WA 3KMNA 2KP1A 3R2QA 4TRXA 3HCZA 4TR3A 3GTUB 5ID2B 2NBSA 3MWHA 3ZVJD 1T1VA 5IM9A 4WETA 2GSQA 3NOFA 5GAPD 2X8GA 1AAZA 3UARA 3F4TA 2OBIA 2VIMA 1G6WA 22GSA 2EIQA 4JE1A 5ECNB 1TOFA 4ZB9A 2PU9C 3NIVA 5IQYA 3I69A 2B5XA 2VL2C 5J4UA 4MF5A 3F3RA 3WYWA 4HUAA 4AJ6A 2AAWA 4N30A 2JZTA 5JCWA 3CRUA 1EWXA 2RLIA 4KE3A 2DJKA 2LV3A 1OE7A 2M80A 4MJAA 3KM6A 2CT6A 4JR6A 1EOGA 4IJ3A 4ECCA 3DVXA 3TOUA 1UC7A 4MABA 4QL9A 11GSA 2GSSA 1X5EA 4EKZA 1Z7PA 4MJBA 1Q98A 1EGOA 1WPIA 4MJEA 5DJMA 1TRVA 5E4WA 3K8NA 3LWAA 4BPYA 1X9SB 2C80A 4POMA 3LXZA 2MYGA 4EXJA 4TR1B 3IC4A 2K9FA 5H5QA 1T4ZA 4EDZA 2CAQA 4J2FA 4EF0A 1TTZA 5A5KA 5G5EA 1M9AA 2VCWA 1PQNA 6GSVA 4POBA 4TKYA 2DBCA 3IA1A 5KN1A 4YQMA 3MNGA 2VCQA 5FWGA 1I5GA 1BJXA 5ECSA 3HZ8A 2H74A 1M2DA 2CZ2A 1F6MC 1QQ2A 1MDKA 3DD3A 4ZBBA 3M9KA 2H70A 3KCMA 4XRAA 7GSSA 1QUWA 4GLTA 3TUEA 3LJRA 1OAZA 2PERA 4PURA 1XZOA 1TI1A 3D21A 3S9FA 2CVBA 4IJIA 1TRWA 5DQSA 3HD5A 5ECPB 3FY7A 1KEBA 3M1GA 3EU4A 4WF4A 2HSYA 2C3NA 2L5LA 5KN3A 3W8SA 5IPHA 1J9BA 3ZL5A 3E0UA 1A8YA 4TR0A 4TVEA 1NHOA 1MD3A 2H75A 3Q19A 1URMA 1BEDA 1XWKA 2H01A 3O6TA 5ELAA 1ILOA 2AHEA 1YJ6A 2H73A 2C3TA 1AQWA 3CSJA 2G0FA 4NWYA 4Q5NA 1XPVA 2GZYA 3Q74A 1X5DA 4HQZA 3GH6A 4TXOA 1GUMA 4DEJA 4LL4B 1U3IA 2QGVA 2IMIA 2IJYA 1EV9A 4ACSA 3P8WA 3ME7A 2C1YA 1CQHA 2O87A 3TKSC 2YV9A 1WP0A 4PQ1A 1S3DA 1V98A 5J3RA 1XWCA 2GLRA 3U6VA 3LYKA 4K7IA 3DEXA 4IELA 1S3AA 3G7YA 1HNCA 4OO4A 3ZMLA 2L6DA 2LSTA 5IIZA 3TOTA 3FR6A 4Q5RA 1VF1A 1VF4A 5DALA 2F51A 6GSTA 5B8AA 3IK7A 1F3BA 1JLVA 2HE3A 2K8SA 3FHKA 1FW1A 2I1UA 1OYJA 4AJ8A 2I81A 4NHZA 1TW9A 4IVFA 3IRAA 1FO5A 5HR2A 2DMMA 2L57A 4WF5A 2IL3A 1B48A 3HVSA 4MCUA 5AGYA 1J08A 3NZNA 3FKFA 1OC3A 2R37A 4I2TA 3TKQA 1XCCA 1R5AA 1YF1A 5ECKB 2OJLA 2V1MA 2WS2A 2YWOA 3HJMA 3TKSA 2H76A 4IKHA 3VK9A 5ECMB 1A0RP 3KP9A 2L5OA 4V1Ap 3MDKA 1TDIA 2GSTA 2WB9A 2QKEA 4LA1A 4YH2A 3KEBA 2KLXA 2NVLA 4O92A 3RPNA 2DJJA 3HJOA 2F3MA 8GSSA 2LJAA 5DDLA 2WZ9A 4TW5A 3C1RA 4EC0A 5LNKe 3D22A 4GSTA 4YQUA 2YWNA 3US3A 3RHBA 3N5OA 1G6YA 4YAPA 4YAVA 1GL8A 2CQ9A 13GSA 2VUPA 2MBSA 5EL8A 4J56E 3V1WA 3ZFLA 2JU5A 3GYKA 1XXUA 1PX6A 2P5RA 3TCOA 1YQ1A 5ECLB 4K8MA 4MP4A 1GWCA 3O3TA 2PWJA 3CMIA 4HJ2A 2FWEA 2CV4A 2O8VB 3GH9A 1SKRB 4F2IA 1TXXA 1QK8A 5IMCA 3QFBC 1B8XA 2FWGA 2R6KA 2E7PA 2TRXA 1OVNA 2P5QA 2H1GA 1JZOA 3U5RE 4BVYA 1EEMA 1F3AA 6GSXA 1A2LA 5J9BA 5J5NA 3F3QA 6GSUA 2LRCA 5ECHB 1ML6A 1JLWA 2YWIA 1Y25A 2YOIA 1EP8A 4TXOB 3ZYWA 3GX0A 4NXIA 1G0TA 5G1LA 2XHFA 2C4JA 3LORA 1M9BA 3ZRDA 1DUGA 17GSA 5CREA 1THOA 3FR3A 5B8BA 1O6JA 1GP1A 4QQ7A 2DJ0A 3DYRA 4F0CA 1F9MA 3HJPA 3QFAC 3RBTA 4FYCA 4MZWA 2FD3A 3D5JA 1AUCA 1KNGA 3TRQA 4PNFA 3GIXA 2A2RA 3H93A 3HVVA 2JSYA 2H6ZA 5DALB 2IMFA 1RW1A 1GNEA 2YNXA 1GTBA 1XIYA 5CAXA 1CQGA 2HZFA 3ZITA 2LRTA 3TGZA 2C0GA 5IMFA 4KX4A 4XCSA 3UVHA 1W4VA 4XS1A 2H6YA 9GSSA 1XFLA 2O7KA 1RK4A 2OE0A 1GTIA 2IFQA 2I3YA 3L78A 3QAVA 5JCUA 3TB2A 4F82A 4IGJA 1B9XC 3TJGA 4ZB6A 1B9YC 4GQFA 2FWFA 3VWVA 4JEDA 1GH2A 1JZDA 1SD8A 2E2GA 1HNAA 3HXSA 1GSDA 2TIRA 2K18A 2AJQB 1FOVA 4WXTA 1QXHA 2G2QA 2R4VA 3P2AA 3ERWA 5CRGA 5J9CA 5AISA 4Q5QA 3H79A 2CVDA 1SYRA 1Z6MA 4O7HA 2FLSA 3GURA 2J9HA 2V6OA 3IHQA 4F9ZA 3BCKA 4KH7A 3VI5A 3A2WA 1TU7A 2VD1A 5GSTA 2GT5A 3A2VA 2LNTA 2V32A 2PGTA 2K6VA 1ZOFA 2DMLA 4ML1A 2EIOA 3GHAA 2ZNMA 2IMEA 1PD21 2GS3A 3PR8A 4I97A 1JZRA 1Z3EA 3F6DA 5DVBA 2IPAA 1O8XA 1UA5A 5H5SA 1KTEA 2L4CA 1MD4A 2B1LA 5A4WA 4PUFC 4GSSA 1E2YA 1T00A 1BAYA 12GSA 3HKRA 4PXOA 3EC3A 2QSIA 3D6IA 2DLXA 5FHIA 3IXRA 2H19A 4IQ1A 2H30A 1ZZYA 1WE0A 3D0ZA 2H1DA 2BJXA 3W8JA 1M0UA 2OADA 3BBYA 3HY2A 2IIYA 3EURA 3TJJA 3UBLA 2C0DA 3HA9A 4MZBA 4KDXA 3F9UA 3RDWA 2OE1A 3DWVA 4OO5A 2LQQA 3IOSA 2NPBA 4EDYA 1G7OA 2JSZA 1B4QA 5LD0A 5DCGA 4ULXA 2LJRA 2YJHA 1GULA 2V41A 1FVKA 1QMVA 5CO3A 3LQ7A 4OMVA 4L8EA 4WR4A 4WEYA 1BYEA 4ZXGA 1GSSA 3RPPA 2GQLA 4PQHA 5IOXA 2N5BA 1YZXA 2OBKA 4BL7A 3GN3A 5D9VA 1Q4JA 3KH9A 4D73A 1HQOA 2WDUA 3G7JA 4N0ZA 2N5FA 6GSYA 1T3BA 1GSQA 4PX1A 1N2AA 2L6CA 2VL3A 1ZMAA 2DJ3A 16GSA 3TKSE 2VOCA 2HRNA 5B7CA 1K0NA 4GF0A 4ZL7A 1K3LA 3MSZA 3WGXA 2V2GA 3KH7A 1HD2A 1NW2A 2IFQB 2AUVA 5AIXA 1ST9A 4MF7A 3VWWA 4TN8A 1FHEA 3IDVA 2E2MA 2B3SA 3CSHA 5COHA 4AF2A 2BMXA 5DQYA 4PUAA 1ZYQB 3VLNA 2GDRA 1EZKA 1KBNA 2VLUA 4YQVA 1XOBA 1BX9A 3BD2A 2OKAA 2XPEA 4F03A 2DIYA 3LEFA 2J23A 2C3QA 4ISDA 2B6MA 2BTOT 3BJ5A 2WGRA 4L5OA 2CVKA 4CHSA 1LJRA 2ON5A 3LG6A 1UVZA 3PH9A 2VL9A 3C1SA 2VLTA 2YZUA 1XW9A 4MJCA 4I5QA 1SL2B 1QGVA 5G5FA 2VCVA 1N8JA 2GGTA 1AXDA 3CBUA 4OD7A 4HDEA 4NAXA 2PN8A 1O85A 5A4VA 5C00A 3SBCA 2D2ZA 4LMWA 4HZ4A 4L5LA 3GL5A 4K1FA 3KGKA 1BG5A 5EY6A 3M3MA 4HQSA 3N9JA 3HVXA 1K0DA 2OACA 2RUFA 4MPFA 4E8HA 2MMAA 3A2XA 1F37A 4HEA2 3ZIVA 5DBQA 3UBKA 3LSZA 1Y6EA 1M7TA 1GSEA 3IV4A 4ECIA 2CX4A 3H8QA 4KSMA 1M2AA 4IP1A 4K7OA 1ERTA 1VRSD 5HR3A 1XWBA 1K0BA 4X43A 2B7KA 5JCGA 4KW6A 2NTOA 3PINA 2B5EA 1AC1A 1XWGA 6GSWA 2VD0A 3GFKA 2OA7A 1QFNA 2H6XA 5IOWA 2DJ2A 2YZHA 5F06A 2AV4A 4XHMA 3ED3A 2LRNA 5GZZB 3P7XA 2XPDA 4V2NA 4G2EA 1G7EA 4NPBA 2CX3A 2LUSA 4N0VA 2K8VA 2GQKA 2VCZA 1OC9A 4O32A 4RQRA 2RUEA 5JWOB 1O8WA 4FIWA 1K0MA 1U3AA 1WWJA 1TJDA 1AQVA 2IWTA 1XWAA 4I6XA 2H1AA 4IQAA 4EE0A 3ERGA 3SWLA 2PUKC 1YKCA 3E3EA 4RI6A 4EL1A 4CW9A 4OCEA 1X9WB 5ELGA 1A8LA 1T7PB 3A5WA 3FZAA 3KZQA 3FZ5A 2IN3A 3DMLA 3RAZA 1TRUA 2WRTA 4GCIA 1JHBA 4D73B 3M8NA 4P3YB 2XBIA 2VLVA 1YF0A 4ZBAA 1GSYA 2A2SA 3GA4A 1WMJA 1O73A 4KAEA 4MH2A 5HFGA 2HZEA 2YWMA 3A3TA 5D9XA 1EGRA 2VM1A 2C8UA 1AIUA 3APOA 1LBKA 2HNLA 3FW2A 1SK0A 3GNJA 4GSNA 3OR5A 1XBSA 4TR4A 3L9UA 3MAKA 4JZQA 2H72A 3ZLPA 3GKKA 5CRDA 4EUYA 2JADA 3D4TA 3UVTA 4GWRA 4RQXA 5EVOA 3GMFA 4KNDA 2JL4A 2MMNA 3G7IA 4OCFA 1GUKA 4K6XA 2TRCP 3HYPA 4MF6A 2ZUPA 3HDCA 3UL3A 4O5RA 4HU7A 4XS4A 1BQ7A 1IYIA 3GKMA 1SK1A 4PQIA 1M2BA 1ON4A 5F0GA 1HYUA 1TK8B 5C04A 4PGTA 1XVQA 2KHPA 1RQMA 4LMVA 1C72A 2WCIA 4HOJA 4AGSA 2VAFA 2R2JA 4G9HA 3GL3A 1ZL9A 3DIEA 2AYTA 4GRFA 4BWSA 2ES7A 3EE2A 5IPGA 1TI3A 1GTAA 1MEKA 2PMTA 3CYNA 1USBA 4ZL8A 5DJLA 5CRWA 3IAM2 2H0GA 5INYA 1ABAA 4AJ7A 1OKDA 2X8HA 5D9TA 1JZWA 3LGCA 5ECQB 2B7JA 1K0CA 4K9ZA 1ZYEA 1U87A 5IO2A 5HFKA 3J7Yk 3GKXA 4EO3A 14GSA 1H4OA 3FZ4A 4G19A 3DXBA 1DE2A 4ECJA 2F8AA 1TKDB 4EVMA 3D4MA 3GX8A 1SYXA 1PMTA 1EEJA 1Z9HA 1YY7A 4K7NA 1U6TA 3ZZXA 2IMDA 1V2AA 2RIIA 3FK8A 1TK5B 2GZPA 3EYTA 3CTGA 3QPMA 2VM2A 3VPQA 4NV2A 5ENUA 4K0GA 4KGIA 2L4QA 4ML6A 1ZCPA 5AN1A 4ZIJA 1S3CA 3GUSA 4V2MA 3Q18A 4POKA 4I2UA 2FCHA 1OC8A 3KJYA 3EINA 1R26A 5FT3A 5GSSA 5H5RA 2PPTA 4WBJA 2B1KA 1SJIA 2OE3A 2FY6A 2VCTA 1UN2A 4XIHA 4OFTA 3RHCA 2ALBA 1OC9B 3TDGA 1GUHA 3ZTLA 1MDJA 4RI7A 5HQPA 3FZ9A 2REMA 3APSA 5A4UA 4XS6A 2HFDA 3F8UA 1MTCA 3KD0A 2MMZA 3ZREA 3E9JB 1YEPA 4BWQA 1ZGNA 3ZMKA 2KUCA 1B4PA 1NM3A 2KP2A 3UOMA 3L9SA 3EU3A 1SL1B 1FB6A 2X8CA 1W89A 1FVJA 1PA3A 4HZ2A 4MLYA 2VCXA 4N10A 2EC4A 3F6FA 1PN9A 5G2ZA 4DVCA 1JFUA 19GSA 1TU8A 4IS0A 2FUG2 4QL7A 1I9DA 2HZEB 4RUVA 2FNOA 3GKNA 1EOHA 2L59A 3KTLA 1A0FA 2HLSA 5ECIB 4TXVA 4H86A 2MMOA 4DSQA 4DSRA 3CSIA 1U88A 4JU5A 1GSUA 1GRXA 1O7UA 2CA8A 3QOUA 2WJUA 1PGTA 1NHYA 20GSA 3DKSA 3LFLA 5CNWA 1XVWA 3DVWA 1SKWB 2E0QA 2VL2A 4KUNA 2KOKA 4JRRA 4IW9A 3QCPA 2ZCTA 5F05A 4LLRA 3BCIA 1A24A 4GXZA 4PNGA 10GSA 1A23A 4FO5A 4XS4B 3TRPA 5DCHA 3HHVA 2H8LA 1YDKA 5JWQB 1SJZA 4V1Ag 1H75A 5DAKA 3FYGA 3VWXA 4DSSA 5HFIA 1V58A 2WFCA 2YJ7A 2V6KA 1ERVA 2P31A 3C7MA 3HZ4A 4ECBA 4MZCA 3F0IA 4ZBDA 2XBQA 1GTUA 2YN1A 2H66A 3QR6A 5KN0A 2DIZA 1ERUA 4MMMA 3KTBA 3APQA 4XTSA 4FH8A 1EP7A 1SJ6A 4K2DA 1K0OA 3F4RA 1O81A 1F2EA 5D96A 5ECRB 4FYBA 3F4SA 3VURA 3I9V2 2A4VA 1K3OA 4HI7A 1WIKA 2H0IA 1SD9A 1AW9A 1DBYA 4F0BA 3W6GA 3ZFBA 2NDOA 4CDOA 1SENA 2HYXA 1K0AA 5KEJA 4FYUA 1X9MB 4MPGA 1XW5A 1V57A 3WD6A 5J41A 3UAPA 3QMXA 2N5AA 3JCML 1NSWA 5IMZA 4XRDA 4X1UA 4KCEA 2YPMA 4Q5FA 2R5GA 2HXKA 3GSTA 2PVOC 5AIVA 3FR9A 2PBJA 3H4KA 1SK2A 1A2MA 2RM6A 2GVPA 4E8EA 1YKAA 2JZSA 1TP9A 2I4AA 3UEMA 2VO4A 4WBRD 3J7Yb 2AB6A 3M9JA 3VFIA 4POLA 2X99A 1SL0B 2FA8A 3M0FA 3KXOA 1V40A 2ON7A 3ZIJA 3TJBA 2F9SA 3F63A 2CZ3A 1DSBA 2LJKA 3TKRA 2P0GA 3GRXA 2MBTA 3I43A 5IMAA 1SU9A 4NHWA 2JACA 2C0FA 2LTKA 3GTUA 18GSA 4LL1B 5ID2A 3FEUA 3ISOA 3CTFA 2DSAA 2PVQA 2B5YA 1ERWA 3Q6OA 5LCZA 3QAGA 2GSRA 2I9HA 2Z9SA 3L4NA 1AQXA 5HR1A 3VI7A 3VPTA 2MZCA 2O89A 3TRXA 4ZB8A 4ZILA 4IP6A 2C0EA 4TOPA 4V2LA 3EVIA 2HSHA 3L0HA 3H1NA 2YV7A 1LU4A 5JWRB 4HJMA 4WKWA 2LQOA 2YANA 5G31A 3I6AA 4KSOA 1PX7A 5G30A 4HU9A 2IMKA 3TKPA 3EMPA 2FA4A 3VWUA 1VF3A 3G9BA 1Z5YE 4MA9A 1M99A 3PGTA 1X0RA 3EWLA 3IBHA 4OWYA 5D8IA 3IR4A 4KDUA 4MDCA 1ACVA 2LNSA 1HNBA 5EPFA 2H0HA 4J57E 2GQMA 1A2JA 2FWHA 5F8BA 1TRSA 5CRHA 3C73A 2GTUA 2JZRA 3IK9A 4ZL9A 1THXA 4KB3A 3UIWA 3QDNA 1PL1A 1R4WA 4ID0A 3DRNA 3TJFA 1FAAA 1OKTA 1VF2A 1Z7RA 3KP8A 3WGEA 1E6BA 3C71A 5IMDA 4JBBA 3TJKA 4GTUA 4IN0A 3QAWA 3ME8A 4TR1A 2QC7A 2M46A 6GSSA 5IMVA 5ECOB 5DAKB 4OFMA 5G1KA 4DSSB 5ABRA 2LS5A 4KDYA 1PL2A 1SKSB 1WJKA 3CRTA 1TK0B 3IE3A 4BA7A 3WT1A 3EMXA 4I8BA 1XW6A 3IAS2 2WULA 3O76A 3WT2A 1X5CA 3GV1A 4KA0A 1PSQA 4K0NA 4NV5A 3L9VA 4OFNA 5KN2A 4WR5A 3LYPA 1FG4A 3C8EA 3AY8A 3UJ1A 4GQCA 3P90A 2DJ1A 1DE1A 2FHEA 5F07A 1GLPA 2CAIA 4NMUA 2LEGA 2M72A 4G10A 3LXTA 1WOUA 2YCDA 3DGQA 5L71A 1R7HA 1YEXA 4IBPA 3KIJA 2H71A 5D93A 5CYYA 3CXGA 4HS1A 1R5PA 4L0UA 1V9WA 4MK3A 3ZVJA 1PKZA 5HR0A 1GNWA 3IPZA 1K3YA 5D73A 2YP6A 2H1BA 1XOAA 4X0XA 2DC5A 3QD9A 5IO0A 1J0FA 1OE8A 4ILFA 5E59A 1MDIA 1GSFA 2HT9A 1IYHA 4JR4A 2O85A 3UMAA 1FB0A 3ERFA 2HI7A 1T8EB 5B6MA 2X64A 1Z6NA 4N11A 1EV4A 3GSSA 1T4YA 5B6NA 2LKUA 1PRXA 1GLQA 1VGLA 3FRCA 4IHUA 2F8FA 1PKWA 2GZZA 4KCAA 2EIRA 2XC2A 4Z7XA 3KMOA 2HRFA 2R3XA 2RM5A 5GAND 2FGXA 4L0WA 2GT6A 1WRYA 3BOAA 5CP1A 4BVXA 4MH3A
chains in the Genus database with same CATH superfamily
3WGDA 5D9WA 3KMNA 2KP1A 3R2QA 4TRXA 3HCZA 4TR3A 3GTUB 5ID2B 2NBSA 3MWHA 3ZVJD 1T1VA 5IM9A 4WETA 2GSQA 3NOFA 5GAPD 2X8GA 5KOWA 1AAZA 4G0KA 3UARA 3F4TA 2OBIA 2VIMA 1G6WA 22GSA 2EIQA 4JE1A 5ECNB 1TOFA 4ZB9A 2PU9C 3NIVA 5IQYA 3I69A 2DKHA 2B5XA 2VL2C 5J4UA 4MF5A 3F3RA 3WYWA 4HUAA 4AJ6A 2AAWA 4N30A 2JZTA 5JCWA 3CRUA 1EWXA 2RLIA 2DKIA 4KE3A 2DJKA 2LV3A 1OE7A 2M80A 4MJAA 3KM6A 2CT6A 4JR6A 1EOGA 4IJ3A 4ECCA 3DVXA 3TOUA 1UC7A 4MABA 4QL9A 11GSA 2GSSA 1X5EA 4EKZA 1Z7PA 4MJBA 1Q98A 1EGOA 1WPIA 4MJEA 5DJMA 1TRVA 5E4WA 3K8NA 3LWAA 4BPYA 1X9SB 2C80A 4POMA 3LXZA 2MYGA 4EXJA 4TR1B 3IC4A 2K9FA 5H5QA 1T4ZA 4EDZA 2CAQA 4J2FA 4EF0A 1TTZA 5A5KA 5G5EA 1M9AA 2VCWA 1PQNA 6GSVA 4POBA 4TKYA 2DBCA 3IA1A 5KN1A 4YQMA 3MNGA 2VCQA 5FWGA 1I5GA 1BJXA 5ECSA 3HZ8A 2H74A 1M2DA 2CZ2A 1F6MC 1QQ2A 1MDKA 3DD3A 4ZBBA 3M9KA 2H70A 3KCMA 4XRAA 7GSSA 1QUWA 4GLTA 3TUEA 3LJRA 1OAZA 2PERA 4PURA 1XZOA 1TI1A 3D21A 3S9FA 2CVBA 4IJIA 1TRWA 5DQSA 3HD5A 5ECPB 1XG8A 3FY7A 1KEBA 3M1GA 3EU4A 4KF9A 4WF4A 2HSYA 2C3NA 2L5LA 5KN3A 3W8SA 2HRKA 5IPHA 1J9BA 3ZL5A 3E0UA 1A8YA 4TR0A 4TVEA 1NHOA 1MD3A 2H75A 3Q19A 1URMA 1BEDA 1XWKA 2H01A 3R3EA 3O6TA 5ELAA 1ILOA 2AHEA 1YJ6A 2H73A 2C3TA 1AQWA 3CSJA 2G0FA 4NWYA 4FQUA 4Q5NA 1XPVA 2GZYA 3Q74A 1X5DA 4HQZA 3GH6A 4TXOA 1GUMA 4DEJA 4LL4B 1U3IA 4Z2UA 2QGVA 2IMIA 2IJYA 1EV9A 4ACSA 3P8WA 3ME7A 2C1YA 1CQHA 2O87A 3TKSC 2YV9A 1WP0A 4PQ1A 1S3DA 1V98A 5J3RA 1XWCA 2GLRA 3U6VA 3LYKA 4K7IA 3DEXA 1M3JA 4IELA 1S3AA 3G7YA 1HNCA 4OO4A 4BVXB 3ZMLA 2L6DA 2LSTA 5IIZA 2HSMA 3TOTA 3FR6A 4Q5RA 1VF1A 1VF4A 5DALA 2F51A 6GSTA 5B8AA 3IK7A 1F3BA 1JLVA 2HE3A 2K8SA 3FHKA 1FW1A 2I1UA 1OYJA 4AJ8A 2I81A 4NHZA 1TW9A 4IVFA 3IRAA 1FO5A 5HR2A 3EPTA 2DMMA 2L57A 4WF5A 2IL3A 1B48A 3HVSA 4MCUA 5AGYA 1J08A 3NZNA 3FKFA 1OC3A 2R37A 4I2TA 3TKQA 1XCCA 1R5AA 1YF1A 5ECKB 2OJLA 5BRTA 2V1MA 2WS2A 2YWOA 3HJMA 3TKSA 2H76A 4YKFA 4IKHA 3VK9A 5ECMB 3FMWA 1A0RP 3KP9A 2L5OA 4V1Ap 3MDKA 1TDIA 2GSTA 2WB9A 2QKEA 4LA1A 4YH2A 3KEBA 2KLXA 2NVLA 4O92A 3RPNA 2DJJA 3HJOA 2F3MA 8GSSA 2LJAA 5DDLA 2WZ9A 4TW5A 3C1RA 4EC0A 5LNKe 3D22A 4GSTA 4YQUA 2YWNA 3US3A 3RHBA 3N5OA 1G6YA 4YAPA 4YAVA 1GL8A 2CQ9A 13GSA 2VUPA 2MBSA 5EL8A 4J56E 3V1WA 3ZFLA 2JU5A 3GYKA 1XXUA 1PX6A 2P5RA 3TCOA 1YQ1A 5ECLB 4K8MA 4MP4A 1GWCA 3O3TA 2PWJA 3CMIA 5KOXA 4HJ2A 2FWEA 2CV4A 2O8VB 3GH9A 1SKRB 4F2IA 1TXXA 1QK8A 5IMCA 3QFBC 1B8XA 2FWGA 2R6KA 2E7PA 2TRXA 1OVNA 2P5QA 2H1GA 4EIQA 1JZOA 3U5RE 4BVYA 1EEMA 1F3AA 6GSXA 1A2LA 5J9BA 5J5NA 3F3QA 6GSUA 2LRCA 5ECHB 1ML6A 1JLWA 2YWIA 1Y25A 2YOIA 1EP8A 4TXOB 3ZYWA 3GX0A 4NXIA 1G0TA 5G1LA 2XHFA 2C4JA 3LORA 1M9BA 3ZRDA 1DUGA 17GSA 5CREA 4HSCX 1THOA 3FR3A 5B8BA 1O6JA 1GP1A 4QQ7A 2DJ0A 3DYRA 4F0CA 1F9MA 3HJPA 3QFAC 3RBTA 4FYCA 4MZWA 2FD3A 3D5JA 1AUCA 1KNGA 3TRQA 4PNFA 3GIXA 2A2RA 3H93A 3HVVA 2JSYA 2H6ZA 5DALB 2IMFA 1RW1A 1GNEA 2YNXA 1GTBA 1XIYA 5CAXA 1CQGA 2HZFA 3ZITA 2LRTA 3TGZA 2C0GA 4K5RA 5IMFA 4KX4A 4XCSA 3UVHA 1W4VA 4XS1A 2H6YA 9GSSA 1XFLA 2O7KA 1RK4A 2OE0A 1GTIA 2IFQA 2I3YA 3L78A 3QAVA 5JCUA 3TB2A 4F82A 4IGJA 1B9XC 3MYDA 4ZB6A 3TJGA 1ZYNA 1B9YC 4GQFA 2FWFA 3VWVA 4JEDA 1GH2A 1JZDA 1SD8A 2E2GA 1HNAA 3HXSA 1GSDA 2TIRA 2K18A 2AJQB 1FOVA 4WXTA 1QXHA 2G2QA 2R4VA 3P2AA 3ERWA 5CRGA 5J9CA 5AISA 4Q5QA 3H79A 2CVDA 1SYRA 1Z6MA 4O7HA 2FLSA 3GURA 2J9HA 2V6OA 3IHQA 4F9ZA 3BCKA 4KH7A 3VI5A 3A2WA 1TU7A 2VD1A 5GSTA 2GT5A 3A2VA 2LNTA 2V32A 2PGTA 2K6VA 1ZOFA 2DMLA 4ML1A 2EIOA 3GHAA 2ZNMA 2IMEA 1PD21 2GS3A 3PR8A 4I97A 1JZRA 1Z3EA 3F6DA 5DVBA 2IPAA 4K5SA 1O8XA 1UA5A 5H5SA 1KTEA 2L4CA 1MD4A 2B1LA 5A4WA 4PUFC 4GSSA 1E2YA 1T00A 4CY6A 1BAYA 12GSA 3HKRA 4PXOA 3EC3A 2QSIA 3D6IA 2DLXA 5FHIA 3IXRA 2H19A 4IQ1A 2H30A 1ZZYA 1WE0A 3D0ZA 2H1DA 2BJXA 3W8JA 1M0UA 3CQFA 2OADA 3A5IA 3BBYA 3HY2A 2IIYA 3EURA 3TJJA 3UBLA 2C0DA 3HA9A 4MZBA 1ZYPA 4KDXA 3F9UA 3RDWA 2OE1A 3DWVA 4OO5A 2LQQA 3IOSA 2NPBA 4EDYA 1G7OA 2JSZA 4BVYB 1B4QA 5LD0A 5DCGA 4ULXA 2LJRA 2YJHA 1GULA 2V41A 1FVKA 1QMVA 5CO3A 3LQ7A 4OMVA 4L8EA 4WR4A 4WEYA 1BYEA 4ZXGA 1GSSA 3RPPA 2GQLA 4PQHA 5IOXA 2N5BA 1YZXA 2OBKA 4BL7A 1M3IA 3GN3A 5D9VA 1Q4JA 3KH9A 4D73A 1HQOA 2WDUA 3G7JA 4N0ZA 2N5FA 6GSYA 1T3BA 1GSQA 4PX1A 1N2AA 2L6CA 2VL3A 1ZMAA 2DJ3A 16GSA 3TKSE 2VOCA 2HRNA 2UZ8A 5B7CA 1K0NA 4GF0A 4ZL7A 1K3LA 3MSZA 3WGXA 2V2GA 3KH7A 1HD2A 1NW2A 2IFQB 2AUVA 5AIXA 1ST9A 4MF7A 2QA1A 3VWWA 4TN8A 1FHEA 3IDVA 2E2MA 2B3SA 3CSHA 5COHA 4AF2A 2BMXA 5DQYA 4PUAA 1ZYQB 3VLNA 2GDRA 1EZKA 1KBNA 2VLUA 4YQVA 1XOBA 1BX9A 3BD2A 2OKAA 2XPEA 4F03A 2DIYA 3LEFA 2J23A 2C3QA 4ISDA 2B6MA 2BTOT 3BJ5A 2WGRA 4L5OA 2CVKA 4CHSA 1LJRA 2ON5A 3LG6A 1UVZA 3PH9A 2VL9A 3C1SA 2VLTA 2YZUA 1XW9A 4MJCA 4I5QA 1SL2B 1QGVA 5G5FA 2VCVA 1N8JA 4USSA 2GGTA 1AXDA 3CBUA 4OD7A 4HDEA 4NAXA 2PN8A 1O85A 2X4AA 5A4VA 5C00A 3SBCA 2D2ZA 4LMWA 4HZ4A 4L5LA 3GL5A 4K1FA 3KGKA 1BG5A 5EY6A 3M3MA 4HQSA 3N9JA 3HVXA 1K0DA 2OACA 4A5PA 2RUFA 4MPFA 4E8HA 2MMAA 3A2XA 1F37A 4HEA2 3ZIVA 5DBQA 3UBKA 3LSZA 1Y6EA 1M7TA 1GSEA 3IV4A 4ECIA 2CX4A 3H8QA 4KSMA 1M2AA 4IP1A 4K7OA 1ERTA 1VRSD 5HR3A 1XWBA 1K0BA 4X43A 2B7KA 4MNNA 5JCGA 4KW6A 2NTOA 3PINA 2B5EA 1AC1A 1XWGA 6GSWA 2VD0A 3GFKA 2OA7A 1QFNA 2H6XA 5IOWA 2DJ2A 2YZHA 5F06A 2AV4A 4XHMA 3ED3A 2LRNA 1S3RA 5GZZB 3P7XA 2XPDA 4V2NA 4G2EA 1G7EA 4NPBA 2CX3A 2R0CA 2LUSA 4N0VA 2K8VA 2GQKA 2VCZA 1OC9A 4O32A 4RQRA 2RUEA 5JWOB 1O8WA 4FIWA 1K0MA 1U3AA 1WWJA 1TJDA 1AQVA 2A4HA 1XWAA 2IWTA 4I6XA 2H1AA 4IQAA 4EE0A 3ERGA 3SWLA 2PUKC 1YKCA 3E3EA 1PN0A 4RI6A 4EL1A 4CW9A 4OCEA 1X9WB 5ELGA 1A8LA 1T7PB 3A5WA 4BL7B 3FZAA 3KZQA 3FZ5A 2IN3A 3DMLA 3RAZA 1TRUA 2WRTA 4GCIA 1JHBA 4D73B 3M8NA 4P3YB 3PPUA 2XBIA 2VLVA 1YF0A 4ZBAA 1GSYA 2A2SA 3GA4A 1WMJA 1O73A 4KAEA 4MH2A 5HFGA 2HZEA 2YWMA 3A3TA 5D9XA 1EGRA 2VM1A 2X49A 2C8UA 1AIUA 3APOA 1LBKA 2HNLA 2HRAA 4G0IA 3FW2A 1SK0A 3GNJA 4GSNA 3OR5A 1XBSA 4TR4A 3L9UA 3MAKA 4JZQA 2H72A 3ZLPA 3GKKA 5CRDA 4EUYA 2JADA 3D4TA 3UVTA 4GWRA 4RQXA 5EVOA 3GMFA 4KNDA 2JL4A 2MMNA 3G7IA 4OCFA 1GUKA 4K6XA 2TRCP 3HYPA 4MF6A 2ZUPA 3HDCA 3UL3A 4O5RA 4HU7A 3MIXA 4XS4A 1BQ7A 1IYIA 3GKMA 4YKGA 1SK1A 4PQIA 1M2BA 1ON4A 5F0GA 1HYUA 1TK8B 5C04A 4PGTA 1XVQA 2KHPA 1RQMA 4LMVA 1C72A 2WCIA 4HOJA 4AGSA 2VAFA 2R2JA 4G9HA 3GL3A 1ZL9A 4G0LA 3DIEA 2AYTA 4GRFA 4BWSA 2ES7A 3EE2A 5IPGA 1TI3A 1GTAA 1MEKA 2PMTA 3CYNA 1USBA 4ZL8A 5DJLA 5CRWA 3IAM2 2H0GA 5INYA 1ABAA 4AJ7A 1OKDA 2X8HA 5D9TA 1JZWA 3LGCA 5ECQB 2B7JA 1K0CA 4K9ZA 1ZYEA 1U87A 5IO2A 5HFKA 3J7Yk 3GKXA 4EO3A 14GSA 1H4OA 3FZ4A 4G19A 3DXBA 1DE2A 4ECJA 2F8AA 1TKDB 4EVMA 3D4MA 3GX8A 1SYXA 1PMTA 1EEJA 1Z9HA 1YY7A 4K7NA 1U6TA 3ZZXA 2IMDA 1V2AA 4CY8A 2RIIA 3FK8A 1TK5B 2GZPA 3EYTA 3CTGA 3QPMA 2VM2A 3VPQA 4NV2A 5ENUA 4K0GA 4KGIA 2L4QA 4ML6A 1ZCPA 5AN1A 4ZIJA 1S3CA 3HVNA 3GUSA 4V2MA 3Q18A 4POKA 4I2UA 2FCHA 1OC8A 3KJYA 3EINA 1R26A 5FT3A 5GSSA 5H5RA 2PPTA 4WBJA 2B1KA 1SJIA 2OE3A 2FY6A 2VCTA 1UN2A 4XIHA 4OFTA 3RHCA 2ALBA 1OC9B 3TDGA 1GUHA 3ZTLA 1MDJA 4RI7A 5HQPA 3FZ9A 2REMA 3APSA 5A4UA 4XS6A 2HFDA 3F8UA 1MTCA 3KD0A 2MMZA 3ZREA 2A2PA 1YEPA 3E9JB 4BWQA 1ZGNA 3ZMKA 2KUCA 1B4PA 1NM3A 2KP2A 2R0PA 3UOMA 3L9SA 3EU3A 3IHGA 1SL1B 1FB6A 2X8CA 1W89A 1FVJA 1PA3A 4HZ2A 4MLYA 2VCXA 4N10A 2EC4A 3F6FA 1PN9A 5G2ZA 4DVCA 1JFUA 19GSA 1TU8A 4IS0A 2FUG2 4QL7A 1I9DA 2HZEB 4RUVA 2FNOA 3GKNA 1EOHA 2L59A 3KTLA 1A0FA 2HLSA 5ECIB 4TXVA 4H86A 2MMOA 4DSQA 4DSRA 3CSIA 1U88A 4JU5A 1GSUA 1GRXA 1O7UA 2CA8A 3QOUA 2WJUA 1PGTA 1NHYA 20GSA 3DKSA 3LFLA 5CNWA 1XVWA 3DVWA 1SKWB 2E0QA 2VL2A 4KUNA 2KOKA 4JRRA 4IW9A 3QCPA 2ZCTA 5F05A 4LLRA 3BCIA 1A24A 4GXZA 4PNGA 10GSA 1A23A 4FO5A 4XS4B 3TRPA 5DCHA 3HHVA 2H8LA 1YDKA 5JWQB 1SJZA 4V1Ag 1H75A 5DAKA 3FYGA 3VWXA 4DSSA 5HFIA 1V58A 2WFCA 2YJ7A 2V6KA 1ERVA 2P31A 3C7MA 3HZ4A 4O5UA 4ECBA 4MZCA 3F0IA 4ZBDA 2R0GA 2XBQA 1GTUA 2YN1A 2H66A 3QR6A 4O5QA 5KN0A 2DIZA 1ERUA 4MMMA 4Z2TA 3KTBA 3APQA 4XTSA 4FH8A 1EP7A 1SJ6A 4K2DA 1K0OA 3F4RA 1O81A 1F2EA 5D96A 5ECRB 4FYBA 3F4SA 3VURA 3I9V2 2A4VA 1K3OA 4HI7A 1WIKA 2H0IA 1SD9A 1AW9A 1DBYA 4F0BA 3W6GA 3ZFBA 2NDOA 4CDOA 1SENA 2HYXA 1K0AA 5KEJA 4FYUA 1X9MB 4MPGA 1XW5A 1V57A 3WD6A 5J41A 3UAPA 3QMXA 4K2XA 2N5AA 3JCML 1NSWA 5IMZA 4XRDA 4X1UA 4KCEA 2YPMA 4Q5FA 4BIKA 2R5GA 2HXKA 3GSTA 2PVOC 5AIVA 3FR9A 2PBJA 3H4KA 1SK2A 1A2MA 2RM6A 2GVPA 4E8EA 1YKAA 2JZSA 1TP9A 2I4AA 3UEMA 2VO4A 4WBRD 3J7Yb 2AB6A 3M9JA 3VFIA 4POLA 2X99A 1SL0B 2FA8A 3M0FA 3KXOA 1V40A 2ON7A 3ZIJA 3TJBA 2F9SA 3F63A 2CZ3A 1DSBA 2LJKA 3TKRA 2P0GA 5BMUA 3GRXA 2MBTA 4PTSA 3I43A 5IMAA 1SU9A 4NHWA 2JACA 2C0FA 2LTKA 3GTUA 18GSA 4LL1B 5ID2A 3FEUA 3ISOA 3CTFA 2DSAA 2PVQA 2B5YA 1ERWA 3Q6OA 5LCZA 3QAGA 2GSRA 2I9HA 3LW9A 2Z9SA 3L4NA 1AQXA 5HR1A 3VI7A 4X4JA 3VPTA 2MZCA 2O89A 3TRXA 4ZB8A 4ZILA 4IP6A 2C0EA 4TOPA 4V2LA 3EVIA 2HSHA 3L0HA 3H1NA 2YV7A 1LU4A 5JWRB 4HJMA 4WKWA 2LQOA 2YANA 5G31A 3I6AA 4KSOA 1PX7A 5G30A 4HU9A 2IMKA 3TKPA 3EMPA 2FA4A 3VWUA 1VF3A 3G9BA 1Z5YE 4MA9A 1M99A 3PGTA 1X0RA 1PFOA 3EWLA 3IBHA 4OWYA 5D8IA 3IR4A 4KDUA 4MDCA 1ACVA 2LNSA 1HNBA 5EPFA 2H0HA 4J57E 2GQMA 1A2JA 2FWHA 5F8BA 4EIPA 1TRSA 5CRHA 3C73A 2GTUA 2JZRA 3IK9A 4ZL9A 1THXA 4KB3A 3UIWA 3QDNA 1PL1A 1R4WA 4ID0A 3DRNA 2QA2A 3TJFA 1FAAA 1OKTA 1VF2A 1Z7RA 3KP8A 3WGEA 1E6BA 3C71A 5IMDA 4JBBA 3TJKA 4GTUA 4IN0A 3QAWA 3ME8A 4TR1A 2QC7A 2M46A 6GSSA 5IMVA 5ECOB 5DAKB 4OFMA 5G1KA 4DSSB 5ABRA 2LS5A 4KDYA 1PL2A 4Z2RA 1SKSB 1WJKA 3CRTA 1TK0B 3IE3A 4BA7A 3WT1A 3EMXA 4I8BA 1XW6A 3IAS2 2WULA 3O76A 4ICYA 3WT2A 1X5CA 3GV1A 4KA0A 1PSQA 4K0NA 4NV5A 3L9VA 4OFNA 5KN2A 4WR5A 3LYPA 1FG4A 3C8EA 3AY8A 3UJ1A 4GQCA 3P90A 2DJ1A 1DE1A 2FHEA 5F07A 1GLPA 2CAIA 4NMUA 2LEGA 2M72A 4G10A 3LXTA 1WOUA 2YCDA 3DGQA 5L71A 1R7HA 1YEXA 4IBPA 3KIJA 2H71A 5D93A 5CYYA 3IC8A 3CXGA 4HS1A 1R5PA 4L0UA 1V9WA 4MK3A 3ZVJA 1PKZA 5HR0A 1GNWA 3IPZA 1K3YA 5D73A 2YP6A 2H1BA 1XOAA 4X0XA 2DC5A 3QD9A 5IO0A 1J0FA 1OE8A 4ILFA 5E59A 1MDIA 1GSFA 2HT9A 1IYHA 4JR4A 2O85A 3UMAA 1FB0A 3ERFA 2HI7A 1FOHA 1T8EB 5B6MA 2X64A 1Z6NA 4N11A 1EV4A 3GSSA 1T4YA 5B6NA 2LKUA 1PRXA 1GLQA 1VGLA 3FRCA 4IHUA 2F8FA 1PKWA 2GZZA 4KCAA 2EIRA 2XC2A 4Z7XA 3KMOA 2HRFA 2R3XA 2RM5A 5GAND 2FGXA 4L0WA 2GT6A 1WRYA 3BOAA 5CP1A 4BVXA 4MH3A
chains in the Genus database with same CATH topology
3WGDA 5D9WA 3KMNA 2KP1A 3R2QA 4TRXA 3HCZA 4TR3A 3GTUB 5ID2B 2NBSA 3MWHA 3ZVJD 1T1VA 5IM9A 4WETA 2GSQA 3NOFA 5GAPD 2X8GA 5KOWA 1AAZA 4G0KA 3UARA 3F4TA 2OBIA 2VIMA 1G6WA 22GSA 2EIQA 4JE1A 5ECNB 1TOFA 4ZB9A 2PU9C 3NIVA 5IQYA 3I69A 2DKHA 2B5XA 2VL2C 5J4UA 4MF5A 3F3RA 3WYWA 4HUAA 4AJ6A 2AAWA 4N30A 2JZTA 5JCWA 3CRUA 1EWXA 2RLIA 2DKIA 4KE3A 2DJKA 2LV3A 1OE7A 2M80A 4MJAA 3KM6A 2CT6A 4JR6A 1EOGA 4IJ3A 4ECCA 3DVXA 3TOUA 1UC7A 4MABA 4QL9A 11GSA 2GSSA 1X5EA 4EKZA 1Z7PA 4MJBA 1Q98A 1EGOA 1WPIA 4MJEA 5DJMA 1TRVA 5E4WA 3K8NA 3LWAA 4BPYA 1X9SB 2C80A 4POMA 3LXZA 2MYGA 4EXJA 4TR1B 3IC4A 2K9FA 5H5QA 1T4ZA 4EDZA 2CAQA 4J2FA 4EF0A 1TTZA 5A5KA 5G5EA 1M9AA 2VCWA 1PQNA 6GSVA 4POBA 4TKYA 2DBCA 3IA1A 5KN1A 4YQMA 3MNGA 2VCQA 5FWGA 1I5GA 1BJXA 5ECSA 3HZ8A 2H74A 1M2DA 2CZ2A 1F6MC 1QQ2A 1MDKA 3DD3A 4ZBBA 3M9KA 2H70A 3KCMA 4XRAA 7GSSA 1QUWA 4GLTA 3TUEA 3LJRA 1OAZA 2PERA 4PURA 1XZOA 1TI1A 3D21A 3S9FA 2CVBA 4IJIA 1TRWA 5DQSA 3HD5A 5ECPB 3FY7A 1KEBA 3M1GA 3EU4A 4KF9A 4WF4A 2HSYA 2C3NA 2L5LA 5KN3A 3W8SA 2HRKA 5IPHA 1J9BA 3ZL5A 3E0UA 1A8YA 4TR0A 4TVEA 1NHOA 1MD3A 2H75A 3Q19A 1URMA 1BEDA 1XWKA 2H01A 3R3EA 3O6TA 5ELAA 1ILOA 2AHEA 1YJ6A 2H73A 2C3TA 1AQWA 3CSJA 2G0FA 4NWYA 4FQUA 4Q5NA 1XPVA 2GZYA 3Q74A 1X5DA 4HQZA 3GH6A 4TXOA 1GUMA 4DEJA 4LL4B 1U3IA 4Z2UA 2QGVA 2IMIA 2IJYA 1EV9A 4ACSA 3P8WA 3ME7A 2C1YA 1CQHA 2O87A 3TKSC 2YV9A 1WP0A 4PQ1A 1S3DA 1V98A 5J3RA 1XWCA 2GLRA 3U6VA 3LYKA 4K7IA 3DEXA 4IELA 1S3AA 3G7YA 1HNCA 4OO4A 4BVXB 3ZMLA 2L6DA 2LSTA 5IIZA 2HSMA 3TOTA 3FR6A 4Q5RA 1VF1A 1VF4A 5DALA 2F51A 6GSTA 5B8AA 3IK7A 1F3BA 1JLVA 2HE3A 2K8SA 3FHKA 1FW1A 2I1UA 1OYJA 4AJ8A 2I81A 4NHZA 1TW9A 4IVFA 3IRAA 1FO5A 5HR2A 3EPTA 2DMMA 2L57A 4WF5A 2IL3A 1B48A 3HVSA 4MCUA 5AGYA 1J08A 3NZNA 3FKFA 1OC3A 2R37A 4I2TA 3TKQA 1XCCA 1R5AA 1YF1A 5ECKB 2OJLA 5BRTA 2V1MA 2WS2A 2YWOA 3HJMA 3TKSA 2H76A 4YKFA 4IKHA 3VK9A 5ECMB 3FMWA 1A0RP 3KP9A 2L5OA 4V1Ap 3MDKA 1TDIA 2GSTA 2WB9A 2QKEA 4LA1A 4YH2A 3KEBA 2KLXA 2NVLA 4O92A 3RPNA 2DJJA 3HJOA 2F3MA 8GSSA 2LJAA 5DDLA 2WZ9A 4TW5A 3C1RA 4EC0A 5LNKe 3D22A 4GSTA 4YQUA 2YWNA 3US3A 3RHBA 3N5OA 1G6YA 4YAPA 4YAVA 1GL8A 2CQ9A 13GSA 2VUPA 2MBSA 5EL8A 4J56E 3V1WA 3ZFLA 2JU5A 3GYKA 1XXUA 1PX6A 2P5RA 3TCOA 1YQ1A 5ECLB 4K8MA 4MP4A 1GWCA 3O3TA 2PWJA 3CMIA 5KOXA 4HJ2A 2FWEA 2CV4A 2O8VB 3GH9A 1SKRB 4F2IA 1TXXA 1QK8A 5IMCA 3QFBC 1B8XA 2FWGA 2R6KA 2E7PA 2TRXA 1OVNA 2P5QA 2H1GA 4EIQA 1JZOA 3U5RE 4BVYA 1EEMA 1F3AA 6GSXA 1A2LA 5J9BA 5J5NA 3F3QA 6GSUA 2LRCA 5ECHB 1ML6A 1JLWA 2YWIA 1Y25A 2YOIA 1EP8A 4TXOB 3ZYWA 3GX0A 4NXIA 1G0TA 5G1LA 2XHFA 2C4JA 3LORA 1M9BA 3ZRDA 1DUGA 17GSA 5CREA 1THOA 3FR3A 5B8BA 1O6JA 1GP1A 4QQ7A 2DJ0A 3DYRA 4F0CA 1F9MA 3HJPA 3QFAC 3RBTA 4FYCA 4MZWA 2FD3A 3D5JA 1AUCA 1KNGA 3TRQA 4PNFA 3GIXA 2A2RA 3H93A 3HVVA 2JSYA 2H6ZA 5DALB 2IMFA 1RW1A 1GNEA 2YNXA 1GTBA 1XIYA 5CAXA 1CQGA 2HZFA 3ZITA 2LRTA 3TGZA 2C0GA 4K5RA 5IMFA 4KX4A 4XCSA 3UVHA 1W4VA 4XS1A 2H6YA 9GSSA 1XFLA 2O7KA 1RK4A 2OE0A 1GTIA 2IFQA 2I3YA 3L78A 3QAVA 5JCUA 3TB2A 4F82A 4IGJA 1B9XC 3MYDA 4ZB6A 3TJGA 1ZYNA 1B9YC 4GQFA 2FWFA 3VWVA 4JEDA 1GH2A 1JZDA 1SD8A 2E2GA 1HNAA 3HXSA 1GSDA 2TIRA 2K18A 2AJQB 1FOVA 4WXTA 1QXHA 2G2QA 2R4VA 3P2AA 3ERWA 5CRGA 5J9CA 5AISA 4Q5QA 3H79A 2CVDA 1SYRA 1Z6MA 4O7HA 2FLSA 3GURA 2J9HA 2V6OA 3IHQA 4F9ZA 3BCKA 4KH7A 3VI5A 3A2WA 1TU7A 2VD1A 5GSTA 2GT5A 3A2VA 2LNTA 2V32A 2PGTA 2K6VA 1ZOFA 2DMLA 4ML1A 2EIOA 3GHAA 2ZNMA 2IMEA 1PD21 2GS3A 3PR8A 4I97A 1JZRA 1Z3EA 3F6DA 5DVBA 2IPAA 4K5SA 1O8XA 1UA5A 5H5SA 1KTEA 2L4CA 1MD4A 2B1LA 5A4WA 4PUFC 4GSSA 1E2YA 1T00A 4CY6A 1BAYA 12GSA 3HKRA 4PXOA 3EC3A 2QSIA 3D6IA 2DLXA 5FHIA 3IXRA 2H19A 4IQ1A 2H30A 1ZZYA 1WE0A 3D0ZA 2H1DA 2BJXA 3W8JA 1M0UA 2OADA 3A5IA 3BBYA 3HY2A 2IIYA 3EURA 3TJJA 3UBLA 2C0DA 3HA9A 4MZBA 1ZYPA 4KDXA 3F9UA 3RDWA 2OE1A 3DWVA 4OO5A 2LQQA 3IOSA 2NPBA 4EDYA 1G7OA 2JSZA 4BVYB 1B4QA 5LD0A 5DCGA 4ULXA 2LJRA 2YJHA 1GULA 2V41A 1FVKA 1QMVA 5CO3A 3LQ7A 4OMVA 4L8EA 4WR4A 4WEYA 1BYEA 4ZXGA 1GSSA 3RPPA 2GQLA 4PQHA 5IOXA 2N5BA 1YZXA 2OBKA 4BL7A 3GN3A 5D9VA 1Q4JA 3KH9A 4D73A 1HQOA 2WDUA 3G7JA 4N0ZA 2N5FA 6GSYA 1T3BA 1GSQA 4PX1A 1N2AA 2L6CA 2VL3A 1ZMAA 2DJ3A 16GSA 3TKSE 2VOCA 2HRNA 2UZ8A 5B7CA 1K0NA 4GF0A 4ZL7A 1K3LA 3MSZA 3WGXA 2V2GA 3KH7A 1HD2A 1NW2A 2IFQB 2AUVA 5AIXA 1ST9A 4MF7A 2QA1A 3VWWA 4TN8A 1FHEA 3IDVA 2E2MA 2B3SA 3CSHA 5COHA 4AF2A 2BMXA 5DQYA 4PUAA 1ZYQB 3VLNA 2GDRA 1EZKA 1KBNA 2VLUA 4YQVA 1XOBA 1BX9A 3BD2A 2OKAA 2XPEA 4F03A 2DIYA 3LEFA 2J23A 2C3QA 4ISDA 2B6MA 2BTOT 3BJ5A 2WGRA 4L5OA 2CVKA 4CHSA 1LJRA 2ON5A 3LG6A 1UVZA 3PH9A 2VL9A 3C1SA 2VLTA 2YZUA 1XW9A 4MJCA 4I5QA 1SL2B 1QGVA 5G5FA 2VCVA 1N8JA 4USSA 2GGTA 1AXDA 3CBUA 4OD7A 4HDEA 4NAXA 2PN8A 1O85A 2X4AA 5A4VA 5C00A 3SBCA 2D2ZA 4LMWA 4HZ4A 4L5LA 3GL5A 4K1FA 3KGKA 1BG5A 5EY6A 3M3MA 4HQSA 3N9JA 3HVXA 1K0DA 2OACA 4A5PA 2RUFA 4MPFA 4E8HA 2MMAA 3A2XA 1F37A 4HEA2 3ZIVA 5DBQA 3UBKA 3LSZA 1Y6EA 1M7TA 1GSEA 3IV4A 4ECIA 2CX4A 3H8QA 4KSMA 1M2AA 4IP1A 4K7OA 1ERTA 1VRSD 5HR3A 1XWBA 1K0BA 4X43A 2B7KA 4MNNA 5JCGA 4KW6A 2NTOA 3PINA 2B5EA 1AC1A 1XWGA 6GSWA 2VD0A 3GFKA 2OA7A 1QFNA 2H6XA 5IOWA 2DJ2A 2YZHA 5F06A 2AV4A 4XHMA 3ED3A 2LRNA 5GZZB 3P7XA 2XPDA 4V2NA 4G2EA 1G7EA 4NPBA 2CX3A 2R0CA 2LUSA 4N0VA 2K8VA 2GQKA 2VCZA 1OC9A 4O32A 4RQRA 2RUEA 5JWOB 1O8WA 4FIWA 1K0MA 1U3AA 1WWJA 1TJDA 1AQVA 2A4HA 1XWAA 2IWTA 4I6XA 2H1AA 4IQAA 4EE0A 3ERGA 3SWLA 2PUKC 1YKCA 3E3EA 1PN0A 4RI6A 4EL1A 4CW9A 4OCEA 1X9WB 5ELGA 1A8LA 1T7PB 3A5WA 4BL7B 3FZAA 3KZQA 3FZ5A 2IN3A 3DMLA 3RAZA 1TRUA 2WRTA 4GCIA 1JHBA 4D73B 3M8NA 4P3YB 3PPUA 2XBIA 2VLVA 1YF0A 4ZBAA 1GSYA 2A2SA 3GA4A 1WMJA 1O73A 4KAEA 4MH2A 5HFGA 2HZEA 2YWMA 3A3TA 5D9XA 1EGRA 2VM1A 2X49A 2C8UA 1AIUA 3APOA 1LBKA 2HNLA 2HRAA 4G0IA 3FW2A 1SK0A 3GNJA 4GSNA 3OR5A 1XBSA 4TR4A 3L9UA 3MAKA 4JZQA 2H72A 3ZLPA 3GKKA 5CRDA 4EUYA 2JADA 3D4TA 3UVTA 4GWRA 4RQXA 5EVOA 3GMFA 4KNDA 2JL4A 2MMNA 3G7IA 4OCFA 1GUKA 4K6XA 2TRCP 3HYPA 4MF6A 2ZUPA 3HDCA 3UL3A 4O5RA 4HU7A 3MIXA 4XS4A 1BQ7A 1IYIA 3GKMA 4YKGA 1SK1A 4PQIA 1M2BA 1ON4A 5F0GA 1HYUA 1TK8B 5C04A 4PGTA 1XVQA 2KHPA 1RQMA 4LMVA 1C72A 2WCIA 4HOJA 4AGSA 2VAFA 2R2JA 4G9HA 3GL3A 1ZL9A 4G0LA 3DIEA 2AYTA 4GRFA 4BWSA 2ES7A 3EE2A 5IPGA 1TI3A 1GTAA 1MEKA 2PMTA 3CYNA 1USBA 4ZL8A 5DJLA 5CRWA 3IAM2 2H0GA 5INYA 1ABAA 4AJ7A 1OKDA 2X8HA 5D9TA 1JZWA 3LGCA 5ECQB 2B7JA 1K0CA 4K9ZA 1ZYEA 1U87A 5IO2A 5HFKA 3J7Yk 3GKXA 4EO3A 14GSA 1H4OA 3FZ4A 4G19A 3DXBA 1DE2A 4ECJA 2F8AA 1TKDB 4EVMA 3D4MA 3GX8A 1SYXA 1PMTA 1EEJA 1Z9HA 1YY7A 4K7NA 1U6TA 3ZZXA 2IMDA 1V2AA 4CY8A 2RIIA 3FK8A 1TK5B 2GZPA 3EYTA 3CTGA 3QPMA 2VM2A 3VPQA 4NV2A 5ENUA 4K0GA 4KGIA 2L4QA 4ML6A 1ZCPA 5AN1A 4ZIJA 1S3CA 3GUSA 4V2MA 3Q18A 4POKA 4I2UA 2FCHA 1OC8A 3KJYA 3EINA 1R26A 5FT3A 5GSSA 5H5RA 2PPTA 4WBJA 2B1KA 1SJIA 2OE3A 2FY6A 2VCTA 1UN2A 4XIHA 4OFTA 3RHCA 2ALBA 1OC9B 3TDGA 1GUHA 3ZTLA 1MDJA 4RI7A 5HQPA 3FZ9A 2REMA 3APSA 5A4UA 4XS6A 2HFDA 3F8UA 1MTCA 3KD0A 2MMZA 3ZREA 2A2PA 1YEPA 3E9JB 4BWQA 1ZGNA 3ZMKA 2KUCA 1B4PA 1NM3A 2KP2A 2R0PA 3UOMA 3L9SA 3EU3A 3IHGA 1SL1B 1FB6A 2X8CA 1W89A 1FVJA 1PA3A 4HZ2A 4MLYA 2VCXA 4N10A 2EC4A 3F6FA 1PN9A 5G2ZA 4DVCA 1JFUA 19GSA 1TU8A 4IS0A 2FUG2 4QL7A 1I9DA 2HZEB 4RUVA 2FNOA 3GKNA 1EOHA 2L59A 3KTLA 1A0FA 2HLSA 5ECIB 4TXVA 4H86A 2MMOA 4DSQA 4DSRA 3CSIA 1U88A 4JU5A 1GSUA 1GRXA 1O7UA 2CA8A 3QOUA 2WJUA 1PGTA 1NHYA 20GSA 3DKSA 3LFLA 5CNWA 1XVWA 3DVWA 1SKWB 2E0QA 2VL2A 4KUNA 2KOKA 4JRRA 4IW9A 3QCPA 2ZCTA 5F05A 4LLRA 3BCIA 1A24A 4GXZA 4PNGA 10GSA 1A23A 4FO5A 4XS4B 3TRPA 5DCHA 3HHVA 2H8LA 1YDKA 5JWQB 1SJZA 4V1Ag 1H75A 5DAKA 3FYGA 3VWXA 4DSSA 5HFIA 1V58A 2WFCA 2YJ7A 2V6KA 1ERVA 2P31A 3C7MA 3HZ4A 4O5UA 4ECBA 4MZCA 3F0IA 4ZBDA 2R0GA 2XBQA 1GTUA 2YN1A 2H66A 3QR6A 4O5QA 5KN0A 2DIZA 1ERUA 4MMMA 4Z2TA 3KTBA 3APQA 4XTSA 4FH8A 1EP7A 1SJ6A 4K2DA 1K0OA 3F4RA 1O81A 1F2EA 5D96A 5ECRB 4FYBA 3F4SA 3VURA 3I9V2 2A4VA 1K3OA 4HI7A 1WIKA 2H0IA 1SD9A 1AW9A 1DBYA 4F0BA 3W6GA 3ZFBA 2NDOA 4CDOA 1SENA 2HYXA 1K0AA 5KEJA 4FYUA 1X9MB 4MPGA 1XW5A 1V57A 3WD6A 5J41A 3UAPA 3QMXA 4K2XA 2N5AA 3JCML 1NSWA 5IMZA 4XRDA 4X1UA 4KCEA 2YPMA 4Q5FA 2R5GA 2HXKA 3GSTA 2PVOC 5AIVA 3FR9A 2PBJA 3H4KA 1SK2A 1A2MA 2RM6A 2GVPA 4E8EA 1YKAA 2JZSA 1TP9A 2I4AA 3UEMA 2VO4A 4WBRD 3J7Yb 2AB6A 3M9JA 3VFIA 4POLA 2X99A 1SL0B 2FA8A 3M0FA 3KXOA 1V40A 2ON7A 3ZIJA 3TJBA 2F9SA 3F63A 2CZ3A 1DSBA 2LJKA 3TKRA 2P0GA 5BMUA 3GRXA 2MBTA 4PTSA 3I43A 5IMAA 1SU9A 4NHWA 2JACA 2C0FA 2LTKA 3GTUA 18GSA 4LL1B 5ID2A 3FEUA 3ISOA 3CTFA 2DSAA 2PVQA 2B5YA 1ERWA 3Q6OA 5LCZA 3QAGA 2GSRA 2I9HA 3LW9A 2Z9SA 3L4NA 1AQXA 5HR1A 3VI7A 4X4JA 3VPTA 2MZCA 2O89A 3TRXA 4ZB8A 4ZILA 4IP6A 2C0EA 4TOPA 4V2LA 3EVIA 2HSHA 3L0HA 3H1NA 2YV7A 1LU4A 5JWRB 4HJMA 4WKWA 2LQOA 2YANA 5G31A 3I6AA 4KSOA 1PX7A 5G30A 4HU9A 2IMKA 3TKPA 3EMPA 2FA4A 3VWUA 1VF3A 3G9BA 1Z5YE 4MA9A 1M99A 3PGTA 1X0RA 3EWLA 3IBHA 4OWYA 5D8IA 3IR4A 4KDUA 4MDCA 1ACVA 2LNSA 1HNBA 5EPFA 2H0HA 4J57E 2GQMA 1A2JA 2FWHA 5F8BA 4EIPA 1TRSA 5CRHA 3C73A 2GTUA 2JZRA 3IK9A 4ZL9A 1THXA 4KB3A 3UIWA 3QDNA 1PL1A 1R4WA 4ID0A 3DRNA 2QA2A 3TJFA 1FAAA 1OKTA 1VF2A 1Z7RA 3KP8A 3WGEA 1E6BA 3C71A 5IMDA 4JBBA 3TJKA 4GTUA 4IN0A 3QAWA 3ME8A 4TR1A 2QC7A 2M46A 6GSSA 5IMVA 5ECOB 5DAKB 4OFMA 5G1KA 4DSSB 5ABRA 2LS5A 4KDYA 1PL2A 4Z2RA 1SKSB 1WJKA 3CRTA 1TK0B 3IE3A 4BA7A 3WT1A 3EMXA 4I8BA 1XW6A 3IAS2 2WULA 3O76A 4ICYA 3WT2A 1X5CA 3GV1A 4KA0A 1PSQA 4K0NA 4NV5A 3L9VA 4OFNA 5KN2A 4WR5A 3LYPA 1FG4A 3C8EA 3AY8A 3UJ1A 4GQCA 3P90A 2DJ1A 1DE1A 2FHEA 5F07A 1GLPA 2CAIA 4NMUA 2LEGA 2M72A 4G10A 3LXTA 1WOUA 2YCDA 3DGQA 5L71A 1R7HA 1YEXA 4IBPA 3KIJA 2H71A 5D93A 5CYYA 3IC8A 3CXGA 4HS1A 1R5PA 4L0UA 1V9WA 4MK3A 3ZVJA 1PKZA 5HR0A 1GNWA 3IPZA 1K3YA 5D73A 2YP6A 2H1BA 1XOAA 4X0XA 2DC5A 3QD9A 5IO0A 1J0FA 1OE8A 4ILFA 5E59A 1MDIA 1GSFA 2HT9A 1IYHA 4JR4A 2O85A 3UMAA 1FB0A 3ERFA 2HI7A 1FOHA 1T8EB 5B6MA 2X64A 1Z6NA 4N11A 1EV4A 3GSSA 1T4YA 5B6NA 2LKUA 1PRXA 1GLQA 1VGLA 3FRCA 4IHUA 2F8FA 1PKWA 2GZZA 4KCAA 2EIRA 2XC2A 4Z7XA 3KMOA 2HRFA 2R3XA 2RM5A 5GAND 2FGXA 4L0WA 2GT6A 1WRYA 3BOAA 5CP1A 4BVXA 4MH3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WGD A;  5D9W A;  3KMN A;  2KP1 A;  3R2Q A;  4TRX A;  3HCZ A;  4TR3 A;  3GTU B;  5ID2 B;  2NBS A;  3MWH A;  3ZVJ D;  1T1V A;  5IM9 A;  4WET A;  2GSQ A;  3NOF A;  5GAP D;  2X8G A;  1AAZ A;  3UAR A;  3F4T A;  2OBI A;  2VIM A;  1G6W A;  22GS A;  2EIQ A;  4JE1 A;  5ECN B;  1TOF A;  4ZB9 A;  2PU9 C;  3NIV A;  5IQY A;  3I69 A;  2B5X A;  2VL2 C;  5J4U A;  4MF5 A;  3F3R A;  3WYW A;  4HUA A;  4AJ6 A;  2AAW A;  4N30 A;  2JZT A;  5JCW A;  3CRU A;  1EWX A;  2RLI A;  4KE3 A;  2DJK A;  2LV3 A;  1OE7 A;  2M80 A;  4MJA A;  3KM6 A;  2CT6 A;  4JR6 A;  1EOG A;  4IJ3 A;  4ECC A;  3DVX A;  3TOU A;  1UC7 A;  4MAB A;  4QL9 A;  11GS A;  2GSS A;  1X5E A;  4EKZ A;  1Z7P A;  4MJB A;  1Q98 A;  1EGO A;  1WPI A;  4MJE A;  5DJM A;  1TRV A;  5E4W A;  3K8N A;  3LWA A;  4BPY A;  1X9S B;  2C80 A;  4POM A;  3LXZ A;  2MYG A;  4EXJ A;  4TR1 B;  3IC4 A;  2K9F A;  5H5Q A;  1T4Z A;  4EDZ A;  2CAQ A;  4J2F A;  4EF0 A;  1TTZ A;  5A5K A;  5G5E A;  1M9A A;  2VCW A;  1PQN A;  6GSV A;  4POB A;  4TKY A;  2DBC A;  3IA1 A;  5KN1 A;  4YQM A;  3MNG A;  2VCQ A;  5FWG A;  1I5G A;  1BJX A;  5ECS A;  3HZ8 A;  2H74 A;  1M2D A;  2CZ2 A;  1F6M C;  1QQ2 A;  1MDK A;  3DD3 A;  4ZBB A;  3M9K A;  2H70 A;  3KCM A;  4XRA A;  7GSS A;  1QUW A;  4GLT A;  3TUE A;  3LJR A;  1OAZ A;  2PER A;  4PUR A;  1XZO A;  1TI1 A;  3D21 A;  3S9F A;  2CVB A;  4IJI A;  1TRW A;  5DQS A;  3HD5 A;  5ECP B;  3FY7 A;  1KEB A;  3M1G A;  3EU4 A;  4WF4 A;  2HSY A;  2C3N A;  2L5L A;  5KN3 A;  3W8S A;  5IPH A;  1J9B A;  3ZL5 A;  3E0U A;  1A8Y A;  4TR0 A;  4TVE A;  1NHO A;  1MD3 A;  2H75 A;  3Q19 A;  1URM A;  1BED A;  1XWK A;  2H01 A;  3O6T A;  5ELA A;  1ILO A;  2AHE A;  1YJ6 A;  2H73 A;  2C3T A;  1AQW A;  3CSJ A;  2G0F A;  4NWY A;  4Q5N A;  1XPV A;  2GZY A;  3Q74 A;  1X5D A;  4HQZ A;  3GH6 A;  4TXO A;  1GUM A;  4DEJ A;  4LL4 B;  1U3I A;  2QGV A;  2IMI A;  2IJY A;  1EV9 A;  4ACS A;  3P8W A;  3ME7 A;  2C1Y A;  1CQH A;  2O87 A;  3TKS C;  2YV9 A;  1WP0 A;  4PQ1 A;  1S3D A;  1V98 A;  5J3R A;  1XWC A;  2GLR A;  3U6V A;  3LYK A;  4K7I A;  3DEX A;  4IEL A;  1S3A A;  3G7Y A;  1HNC A;  4OO4 A;  3ZML A;  2L6D A;  2LST A;  5IIZ A;  3TOT A;  3FR6 A;  4Q5R A;  1VF1 A;  1VF4 A;  5DAL A;  2F51 A;  6GST A;  5B8A A;  3IK7 A;  1F3B A;  1JLV A;  2HE3 A;  2K8S A;  3FHK A;  1FW1 A;  2I1U A;  1OYJ A;  4AJ8 A;  2I81 A;  4NHZ A;  1TW9 A;  4IVF A;  3IRA A;  1FO5 A;  5HR2 A;  2DMM A;  2L57 A;  4WF5 A;  2IL3 A;  1B48 A;  3HVS A;  4MCU A;  5AGY A;  1J08 A;  3NZN A;  3FKF A;  1OC3 A;  2R37 A;  4I2T A;  3TKQ A;  1XCC A;  1R5A A;  1YF1 A;  5ECK B;  2OJL A;  2V1M A;  2WS2 A;  2YWO A;  3HJM A;  3TKS A;  2H76 A;  4IKH A;  3VK9 A;  5ECM B;  1A0R P;  3KP9 A;  2L5O A;  4V1A p;  3MDK A;  1TDI A;  2GST A;  2WB9 A;  2QKE A;  4LA1 A;  4YH2 A;  3KEB A;  2KLX A;  2NVL A;  4O92 A;  3RPN A;  2DJJ A;  3HJO A;  2F3M A;  8GSS A;  2LJA A;  5DDL A;  2WZ9 A;  4TW5 A;  3C1R A;  4EC0 A;  5LNK e;  3D22 A;  4GST A;  4YQU A;  2YWN A;  3US3 A;  3RHB A;  3N5O A;  1G6Y A;  4YAP A;  4YAV A;  1GL8 A;  2CQ9 A;  13GS A;  2VUP A;  2MBS A;  5EL8 A;  4J56 E;  3V1W A;  3ZFL A;  2JU5 A;  3GYK A;  1XXU A;  1PX6 A;  2P5R A;  3TCO A;  1YQ1 A;  5ECL B;  4K8M A;  4MP4 A;  1GWC A;  3O3T A;  2PWJ A;  3CMI A;  4HJ2 A;  2FWE A;  2CV4 A;  2O8V B;  3GH9 A;  1SKR B;  4F2I A;  1TXX A;  1QK8 A;  5IMC A;  3QFB C;  1B8X A;  2FWG A;  2R6K A;  2E7P A;  2TRX A;  1OVN A;  2P5Q A;  2H1G A;  1JZO A;  3U5R E;  4BVY A;  1EEM A;  1F3A A;  6GSX A;  1A2L A;  5J9B A;  5J5N A;  3F3Q A;  6GSU A;  2LRC A;  5ECH B;  1ML6 A;  1JLW A;  2YWI A;  1Y25 A;  2YOI A;  1EP8 A;  4TXO B;  3ZYW A;  3GX0 A;  4NXI A;  1G0T A;  5G1L A;  2XHF A;  2C4J A;  3LOR A;  1M9B A;  3ZRD A;  1DUG A;  17GS A;  5CRE A;  1THO A;  3FR3 A;  5B8B A;  1O6J A;  1GP1 A;  4QQ7 A;  2DJ0 A;  3DYR A;  4F0C A;  1F9M A;  3HJP A;  3QFA C;  3RBT A;  4FYC A;  4MZW A;  2FD3 A;  3D5J A;  1AUC A;  1KNG A;  3TRQ A;  4PNF A;  3GIX A;  2A2R A;  3H93 A;  3HVV A;  2JSY A;  2H6Z A;  5DAL B;  2IMF A;  1RW1 A;  1GNE A;  2YNX A;  1GTB A;  1XIY A;  5CAX A;  1CQG A;  2HZF A;  3ZIT A;  2LRT A;  3TGZ A;  2C0G A;  5IMF A;  4KX4 A;  4XCS A;  3UVH A;  1W4V A;  4XS1 A;  2H6Y A;  9GSS A;  1XFL A;  2O7K A;  1RK4 A;  2OE0 A;  1GTI A;  2IFQ A;  2I3Y A;  3L78 A;  3QAV A;  5JCU A;  3TB2 A;  4F82 A;  4IGJ A;  1B9X C;  3TJG A;  4ZB6 A;  1B9Y C;  4GQF A;  2FWF A;  3VWV A;  4JED A;  1GH2 A;  1JZD A;  1SD8 A;  2E2G A;  1HNA A;  3HXS A;  1GSD A;  2TIR A;  2K18 A;  2AJQ B;  1FOV A;  4WXT A;  1QXH A;  2G2Q A;  2R4V A;  3P2A A;  3ERW A;  5CRG A;  5J9C A;  5AIS A;  4Q5Q A;  3H79 A;  2CVD A;  1SYR A;  1Z6M A;  4O7H A;  2FLS A;  3GUR A;  2J9H A;  2V6O A;  3IHQ A;  4F9Z A;  3BCK A;  4KH7 A;  3VI5 A;  3A2W A;  1TU7 A;  2VD1 A;  5GST A;  2GT5 A;  3A2V A;  2LNT A;  2V32 A;  2PGT A;  2K6V A;  1ZOF A;  2DML A;  4ML1 A;  2EIO A;  3GHA A;  2ZNM A;  2IME A;  1PD2 1;  2GS3 A;  3PR8 A;  4I97 A;  1JZR A;  1Z3E A;  3F6D A;  5DVB A;  2IPA A;  1O8X A;  1UA5 A;  5H5S A;  1KTE A;  2L4C A;  1MD4 A;  2B1L A;  5A4W A;  4PUF C;  4GSS A;  1E2Y A;  1T00 A;  1BAY A;  12GS A;  3HKR A;  4PXO A;  3EC3 A;  2QSI A;  3D6I A;  2DLX A;  5FHI A;  3IXR A;  2H19 A;  4IQ1 A;  2H30 A;  1ZZY A;  1WE0 A;  3D0Z A;  2H1D A;  2BJX A;  3W8J A;  1M0U A;  2OAD A;  3BBY A;  3HY2 A;  2IIY A;  3EUR A;  3TJJ A;  3UBL A;  2C0D A;  3HA9 A;  4MZB A;  4KDX A;  3F9U A;  3RDW A;  2OE1 A;  3DWV A;  4OO5 A;  2LQQ A;  3IOS A;  2NPB A;  4EDY A;  1G7O A;  2JSZ A;  1B4Q A;  5LD0 A;  5DCG A;  4ULX A;  2LJR A;  2YJH A;  1GUL A;  2V41 A;  1FVK A;  1QMV A;  5CO3 A;  3LQ7 A;  4OMV A;  4L8E A;  4WR4 A;  4WEY A;  1BYE A;  4ZXG A;  1GSS A;  3RPP A;  2GQL A;  4PQH A;  5IOX A;  2N5B A;  1YZX A;  2OBK A;  4BL7 A;  3GN3 A;  5D9V A;  1Q4J A;  3KH9 A;  4D73 A;  1HQO A;  2WDU A;  3G7J A;  4N0Z A;  2N5F A;  6GSY A;  1T3B A;  1GSQ A;  4PX1 A;  1N2A A;  2L6C A;  2VL3 A;  1ZMA A;  2DJ3 A;  16GS A;  3TKS E;  2VOC A;  2HRN A;  5B7C A;  1K0N A;  4GF0 A;  4ZL7 A;  1K3L A;  3MSZ A;  3WGX A;  2V2G A;  3KH7 A;  1HD2 A;  1NW2 A;  2IFQ B;  2AUV A;  5AIX A;  1ST9 A;  4MF7 A;  3VWW A;  4TN8 A;  1FHE A;  3IDV A;  2E2M A;  2B3S A;  3CSH A;  5COH A;  4AF2 A;  2BMX A;  5DQY A;  4PUA A;  1ZYQ B;  3VLN A;  2GDR A;  1EZK A;  1KBN A;  2VLU A;  4YQV A;  1XOB A;  1BX9 A;  3BD2 A;  2OKA A;  2XPE A;  4F03 A;  2DIY A;  3LEF A;  2J23 A;  2C3Q A;  4ISD A;  2B6M A;  2BTO T;  3BJ5 A;  2WGR A;  4L5O A;  2CVK A;  4CHS A;  1LJR A;  2ON5 A;  3LG6 A;  1UVZ A;  3PH9 A;  2VL9 A;  3C1S A;  2VLT A;  2YZU A;  1XW9 A;  4MJC A;  4I5Q A;  1SL2 B;  1QGV A;  5G5F A;  2VCV A;  1N8J A;  2GGT A;  1AXD A;  3CBU A;  4OD7 A;  4HDE A;  4NAX A;  2PN8 A;  1O85 A;  5A4V A;  5C00 A;  3SBC A;  2D2Z A;  4LMW A;  4HZ4 A;  4L5L A;  3GL5 A;  4K1F A;  3KGK A;  1BG5 A;  5EY6 A;  3M3M A;  4HQS A;  3N9J A;  3HVX A;  1K0D A;  2OAC A;  2RUF A;  4MPF A;  4E8H A;  2MMA A;  3A2X A;  1F37 A;  4HEA 2;  3ZIV A;  5DBQ A;  3UBK A;  3LSZ A;  1Y6E A;  1M7T A;  1GSE A;  3IV4 A;  4ECI A;  2CX4 A;  3H8Q A;  4KSM A;  1M2A A;  4IP1 A;  4K7O A;  1ERT A;  1VRS D;  5HR3 A;  1XWB A;  1K0B A;  4X43 A;  2B7K A;  5JCG A;  4KW6 A;  2NTO A;  3PIN A;  2B5E A;  1AC1 A;  1XWG A;  6GSW A;  2VD0 A;  3GFK A;  2OA7 A;  1QFN A;  2H6X A;  5IOW A;  2DJ2 A;  2YZH A;  5F06 A;  2AV4 A;  4XHM A;  3ED3 A;  2LRN A;  5GZZ B;  3P7X A;  2XPD A;  4V2N A;  4G2E A;  1G7E A;  4NPB A;  2CX3 A;  2LUS A;  4N0V A;  2K8V A;  2GQK A;  2VCZ A;  1OC9 A;  4O32 A;  4RQR A;  2RUE A;  5JWO B;  1O8W A;  4FIW A;  1K0M A;  1U3A A;  1WWJ A;  1TJD A;  1AQV A;  2IWT A;  1XWA A;  4I6X A;  2H1A A;  4IQA A;  4EE0 A;  3ERG A;  3SWL A;  2PUK C;  1YKC A;  3E3E A;  4RI6 A;  4EL1 A;  4CW9 A;  4OCE A;  1X9W B;  5ELG A;  1A8L A;  1T7P B;  3A5W A;  3FZA A;  3KZQ A;  3FZ5 A;  2IN3 A;  3DML A;  3RAZ A;  1TRU A;  2WRT A;  4GCI A;  1JHB A;  4D73 B;  3M8N A;  4P3Y B;  2XBI A;  2VLV A;  1YF0 A;  4ZBA A;  1GSY A;  2A2S A;  3GA4 A;  1WMJ A;  1O73 A;  4KAE A;  4MH2 A;  5HFG A;  2HZE A;  2YWM A;  3A3T A;  5D9X A;  1EGR A;  2VM1 A;  2C8U A;  1AIU A;  3APO A;  1LBK A;  2HNL A;  3FW2 A;  1SK0 A;  3GNJ A;  4GSN A;  3OR5 A;  1XBS A;  4TR4 A;  3L9U A;  3MAK A;  4JZQ A;  2H72 A;  3ZLP A;  3GKK A;  5CRD A;  4EUY A;  2JAD A;  3D4T A;  3UVT A;  4GWR A;  4RQX A;  5EVO A;  3GMF A;  4KND A;  2JL4 A;  2MMN A;  3G7I A;  4OCF A;  1GUK A;  4K6X A;  2TRC P;  3HYP A;  4MF6 A;  2ZUP A;  3HDC A;  3UL3 A;  4O5R A;  4HU7 A;  4XS4 A;  1BQ7 A;  1IYI A;  3GKM A;  1SK1 A;  4PQI A;  1M2B A;  1ON4 A;  5F0G A;  1HYU A;  1TK8 B;  5C04 A;  4PGT A;  1XVQ A;  2KHP A;  1RQM A;  4LMV A;  1C72 A;  2WCI A;  4HOJ A;  4AGS A;  2VAF A;  2R2J A;  4G9H A;  3GL3 A;  1ZL9 A;  3DIE A;  2AYT A;  4GRF A;  4BWS A;  2ES7 A;  3EE2 A;  5IPG A;  1TI3 A;  1GTA A;  1MEK A;  2PMT A;  3CYN A;  1USB A;  4ZL8 A;  5DJL A;  5CRW A;  3IAM 2;  2H0G A;  5INY A;  1ABA A;  4AJ7 A;  1OKD A;  2X8H A;  5D9T A;  1JZW A;  3LGC A;  5ECQ B;  2B7J A;  1K0C A;  4K9Z A;  1ZYE A;  1U87 A;  5IO2 A;  5HFK A;  3J7Y k;  3GKX A;  4EO3 A;  14GS A;  1H4O A;  3FZ4 A;  4G19 A;  3DXB A;  1DE2 A;  4ECJ A;  2F8A A;  1TKD B;  4EVM A;  3D4M A;  3GX8 A;  1SYX A;  1PMT A;  1EEJ A;  1Z9H A;  1YY7 A;  4K7N A;  1U6T A;  3ZZX A;  2IMD A;  1V2A A;  2RII A;  3FK8 A;  1TK5 B;  2GZP A;  3EYT A;  3CTG A;  3QPM A;  2VM2 A;  3VPQ A;  4NV2 A;  5ENU A;  4K0G A;  4KGI A;  2L4Q A;  4ML6 A;  1ZCP A;  5AN1 A;  4ZIJ A;  1S3C A;  3GUS A;  4V2M A;  3Q18 A;  4POK A;  4I2U A;  2FCH A;  1OC8 A;  3KJY A;  3EIN A;  1R26 A;  5FT3 A;  5GSS A;  5H5R A;  2PPT A;  4WBJ A;  2B1K A;  1SJI A;  2OE3 A;  2FY6 A;  2VCT A;  1UN2 A;  4XIH A;  4OFT A;  3RHC A;  2ALB A;  1OC9 B;  3TDG A;  1GUH A;  3ZTL A;  1MDJ A;  4RI7 A;  5HQP A;  3FZ9 A;  2REM A;  3APS A;  5A4U A;  4XS6 A;  2HFD A;  3F8U A;  1MTC A;  3KD0 A;  2MMZ A;  3ZRE A;  3E9J B;  1YEP A;  4BWQ A;  1ZGN A;  3ZMK A;  2KUC A;  1B4P A;  1NM3 A;  2KP2 A;  3UOM A;  3L9S A;  3EU3 A;  1SL1 B;  1FB6 A;  2X8C A;  1W89 A;  1FVJ A;  1PA3 A;  4HZ2 A;  4MLY A;  2VCX A;  4N10 A;  2EC4 A;  3F6F A;  1PN9 A;  5G2Z A;  4DVC A;  1JFU A;  19GS A;  1TU8 A;  4IS0 A;  2FUG 2;  4QL7 A;  1I9D A;  2HZE B;  4RUV A;  2FNO A;  3GKN A;  1EOH A;  2L59 A;  3KTL A;  1A0F A;  2HLS A;  5ECI B;  4TXV A;  4H86 A;  2MMO A;  4DSQ A;  4DSR A;  3CSI A;  1U88 A;  4JU5 A;  1GSU A;  1GRX A;  1O7U A;  2CA8 A;  3QOU A;  2WJU A;  1PGT A;  1NHY A;  20GS A;  3DKS A;  3LFL A;  5CNW A;  1XVW A;  3DVW A;  1SKW B;  2E0Q A;  2VL2 A;  4KUN A;  2KOK A;  4JRR A;  4IW9 A;  3QCP A;  2ZCT A;  5F05 A;  4LLR A;  3BCI A;  1A24 A;  4GXZ A;  4PNG A;  10GS A;  1A23 A;  4FO5 A;  4XS4 B;  3TRP A;  5DCH A;  3HHV A;  2H8L A;  1YDK A;  5JWQ B;  1SJZ A;  4V1A g;  1H75 A;  5DAK A;  3FYG A;  3VWX A;  4DSS A;  5HFI A;  1V58 A;  2WFC A;  2YJ7 A;  2V6K A;  1ERV A;  2P31 A;  3C7M A;  3HZ4 A;  4ECB A;  4MZC A;  3F0I A;  4ZBD A;  2XBQ A;  1GTU A;  2YN1 A;  2H66 A;  3QR6 A;  5KN0 A;  2DIZ A;  1ERU A;  4MMM A;  3KTB A;  3APQ A;  4XTS A;  4FH8 A;  1EP7 A;  1SJ6 A;  4K2D A;  1K0O A;  3F4R A;  1O81 A;  1F2E A;  5D96 A;  5ECR B;  4FYB A;  3F4S A;  3VUR A;  3I9V 2;  2A4V A;  1K3O A;  4HI7 A;  1WIK A;  2H0I A;  1SD9 A;  1AW9 A;  1DBY A;  4F0B A;  3W6G A;  3ZFB A;  2NDO A;  4CDO A;  1SEN A;  2HYX A;  1K0A A;  5KEJ A;  4FYU A;  1X9M B;  4MPG A;  1XW5 A;  1V57 A;  3WD6 A;  5J41 A;  3UAP A;  3QMX A;  2N5A A;  3JCM L;  1NSW A;  5IMZ A;  4XRD A;  4X1U A;  4KCE A;  2YPM A;  4Q5F A;  2R5G A;  2HXK A;  3GST A;  2PVO C;  5AIV A;  3FR9 A;  2PBJ A;  3H4K A;  1SK2 A;  1A2M A;  2RM6 A;  2GVP A;  4E8E A;  1YKA A;  2JZS A;  1TP9 A;  2I4A A;  3UEM A;  2VO4 A;  4WBR D;  3J7Y b;  2AB6 A;  3M9J A;  3VFI A;  4POL A;  2X99 A;  1SL0 B;  2FA8 A;  3M0F A;  3KXO A;  1V40 A;  2ON7 A;  3ZIJ A;  3TJB A;  2F9S A;  3F63 A;  2CZ3 A;  1DSB A;  2LJK A;  3TKR A;  2P0G A;  3GRX A;  2MBT A;  3I43 A;  5IMA A;  1SU9 A;  4NHW A;  2JAC A;  2C0F A;  2LTK A;  3GTU A;  18GS A;  4LL1 B;  5ID2 A;  3FEU A;  3ISO A;  3CTF A;  2DSA A;  2PVQ A;  2B5Y A;  1ERW A;  3Q6O A;  5LCZ A;  3QAG A;  2GSR A;  2I9H A;  2Z9S A;  3L4N A;  1AQX A;  5HR1 A;  3VI7 A;  3VPT A;  2MZC A;  2O89 A;  3TRX A;  4ZB8 A;  4ZIL A;  4IP6 A;  2C0E A;  4TOP A;  4V2L A;  3EVI A;  2HSH A;  3L0H A;  3H1N A;  2YV7 A;  1LU4 A;  5JWR B;  4HJM A;  4WKW A;  2LQO A;  2YAN A;  5G31 A;  3I6A A;  4KSO A;  1PX7 A;  5G30 A;  4HU9 A;  2IMK A;  3TKP A;  3EMP A;  2FA4 A;  3VWU A;  1VF3 A;  3G9B A;  1Z5Y E;  4MA9 A;  1M99 A;  3PGT A;  1X0R A;  3EWL A;  3IBH A;  4OWY A;  5D8I A;  3IR4 A;  4KDU A;  4MDC A;  1ACV A;  2LNS A;  1HNB A;  5EPF A;  2H0H A;  4J57 E;  2GQM A;  1A2J A;  2FWH A;  5F8B A;  1TRS A;  5CRH A;  3C73 A;  2GTU A;  2JZR A;  3IK9 A;  4ZL9 A;  1THX A;  4KB3 A;  3UIW A;  3QDN A;  1PL1 A;  1R4W A;  4ID0 A;  3DRN A;  3TJF A;  1FAA A;  1OKT A;  1VF2 A;  1Z7R A;  3KP8 A;  3WGE A;  1E6B A;  3C71 A;  5IMD A;  4JBB A;  3TJK A;  4GTU A;  4IN0 A;  3QAW A;  3ME8 A;  4TR1 A;  2QC7 A;  2M46 A;  6GSS A;  5IMV A;  5ECO B;  5DAK B;  4OFM A;  5G1K A;  4DSS B;  5ABR A;  2LS5 A;  4KDY A;  1PL2 A;  1SKS B;  1WJK A;  3CRT A;  1TK0 B;  3IE3 A;  4BA7 A;  3WT1 A;  3EMX A;  4I8B A;  1XW6 A;  3IAS 2;  2WUL A;  3O76 A;  3WT2 A;  1X5C A;  3GV1 A;  4KA0 A;  1PSQ A;  4K0N A;  4NV5 A;  3L9V A;  4OFN A;  5KN2 A;  4WR5 A;  3LYP A;  1FG4 A;  3C8E A;  3AY8 A;  3UJ1 A;  4GQC A;  3P90 A;  2DJ1 A;  1DE1 A;  2FHE A;  5F07 A;  1GLP A;  2CAI A;  4NMU A;  2LEG A;  2M72 A;  4G10 A;  3LXT A;  1WOU A;  2YCD A;  3DGQ A;  5L71 A;  1R7H A;  1YEX A;  4IBP A;  3KIJ A;  2H71 A;  5D93 A;  5CYY A;  3CXG A;  4HS1 A;  1R5P A;  4L0U A;  1V9W A;  4MK3 A;  3ZVJ A;  1PKZ A;  5HR0 A;  1GNW A;  3IPZ A;  1K3Y A;  5D73 A;  2YP6 A;  2H1B A;  1XOA A;  4X0X A;  2DC5 A;  3QD9 A;  5IO0 A;  1J0F A;  1OE8 A;  4ILF A;  5E59 A;  1MDI A;  1GSF A;  2HT9 A;  1IYH A;  4JR4 A;  2O85 A;  3UMA A;  1FB0 A;  3ERF A;  2HI7 A;  1T8E B;  5B6M A;  2X64 A;  1Z6N A;  4N11 A;  1EV4 A;  3GSS A;  1T4Y A;  5B6N A;  2LKU A;  1PRX A;  1GLQ A;  1VGL A;  3FRC A;  4IHU A;  2F8F A;  1PKW A;  2GZZ A;  4KCA A;  2EIR A;  2XC2 A;  4Z7X A;  3KMO A;  2HRF A;  2R3X A;  2RM5 A;  5GAN D;  2FGX A;  4L0W A;  2GT6 A;  1WRY A;  3BOA A;  5CP1 A;  4BVX A;  4MH3 A; 
#chains in the Genus database with same CATH topology
 3WGD A;  5D9W A;  3KMN A;  2KP1 A;  3R2Q A;  4TRX A;  3HCZ A;  4TR3 A;  3GTU B;  5ID2 B;  2NBS A;  3MWH A;  3ZVJ D;  1T1V A;  5IM9 A;  4WET A;  2GSQ A;  3NOF A;  5GAP D;  2X8G A;  5KOW A;  1AAZ A;  4G0K A;  3UAR A;  3F4T A;  2OBI A;  2VIM A;  1G6W A;  22GS A;  2EIQ A;  4JE1 A;  5ECN B;  1TOF A;  4ZB9 A;  2PU9 C;  3NIV A;  5IQY A;  3I69 A;  2DKH A;  2B5X A;  2VL2 C;  5J4U A;  4MF5 A;  3F3R A;  3WYW A;  4HUA A;  4AJ6 A;  2AAW A;  4N30 A;  2JZT A;  5JCW A;  3CRU A;  1EWX A;  2RLI A;  2DKI A;  4KE3 A;  2DJK A;  2LV3 A;  1OE7 A;  2M80 A;  4MJA A;  3KM6 A;  2CT6 A;  4JR6 A;  1EOG A;  4IJ3 A;  4ECC A;  3DVX A;  3TOU A;  1UC7 A;  4MAB A;  4QL9 A;  11GS A;  2GSS A;  1X5E A;  4EKZ A;  1Z7P A;  4MJB A;  1Q98 A;  1EGO A;  1WPI A;  4MJE A;  5DJM A;  1TRV A;  5E4W A;  3K8N A;  3LWA A;  4BPY A;  1X9S B;  2C80 A;  4POM A;  3LXZ A;  2MYG A;  4EXJ A;  4TR1 B;  3IC4 A;  2K9F A;  5H5Q A;  1T4Z A;  4EDZ A;  2CAQ A;  4J2F A;  4EF0 A;  1TTZ A;  5A5K A;  5G5E A;  1M9A A;  2VCW A;  1PQN A;  6GSV A;  4POB A;  4TKY A;  2DBC A;  3IA1 A;  5KN1 A;  4YQM A;  3MNG A;  2VCQ A;  5FWG A;  1I5G A;  1BJX A;  5ECS A;  3HZ8 A;  2H74 A;  1M2D A;  2CZ2 A;  1F6M C;  1QQ2 A;  1MDK A;  3DD3 A;  4ZBB A;  3M9K A;  2H70 A;  3KCM A;  4XRA A;  7GSS A;  1QUW A;  4GLT A;  3TUE A;  3LJR A;  1OAZ A;  2PER A;  4PUR A;  1XZO A;  1TI1 A;  3D21 A;  3S9F A;  2CVB A;  4IJI A;  1TRW A;  5DQS A;  3HD5 A;  5ECP B;  1XG8 A;  3FY7 A;  1KEB A;  3M1G A;  3EU4 A;  4KF9 A;  4WF4 A;  2HSY A;  2C3N A;  2L5L A;  5KN3 A;  3W8S A;  2HRK A;  5IPH A;  1J9B A;  3ZL5 A;  3E0U A;  1A8Y A;  4TR0 A;  4TVE A;  1NHO A;  1MD3 A;  2H75 A;  3Q19 A;  1URM A;  1BED A;  1XWK A;  2H01 A;  3R3E A;  3O6T A;  5ELA A;  1ILO A;  2AHE A;  1YJ6 A;  2H73 A;  2C3T A;  1AQW A;  3CSJ A;  2G0F A;  4NWY A;  4FQU A;  4Q5N A;  1XPV A;  2GZY A;  3Q74 A;  1X5D A;  4HQZ A;  3GH6 A;  4TXO A;  1GUM A;  4DEJ A;  4LL4 B;  1U3I A;  4Z2U A;  2QGV A;  2IMI A;  2IJY A;  1EV9 A;  4ACS A;  3P8W A;  3ME7 A;  2C1Y A;  1CQH A;  2O87 A;  3TKS C;  2YV9 A;  1WP0 A;  4PQ1 A;  1S3D A;  1V98 A;  5J3R A;  1XWC A;  2GLR A;  3U6V A;  3LYK A;  4K7I A;  3DEX A;  1M3J A;  4IEL A;  1S3A A;  3G7Y A;  1HNC A;  4OO4 A;  4BVX B;  3ZML A;  2L6D A;  2LST A;  5IIZ A;  2HSM A;  3TOT A;  3FR6 A;  4Q5R A;  1VF1 A;  1VF4 A;  5DAL A;  2F51 A;  6GST A;  5B8A A;  3IK7 A;  1F3B A;  1JLV A;  2HE3 A;  2K8S A;  3FHK A;  1FW1 A;  2I1U A;  1OYJ A;  4AJ8 A;  2I81 A;  4NHZ A;  1TW9 A;  4IVF A;  3IRA A;  1FO5 A;  5HR2 A;  3EPT A;  2DMM A;  2L57 A;  4WF5 A;  2IL3 A;  1B48 A;  3HVS A;  4MCU A;  5AGY A;  1J08 A;  3NZN A;  3FKF A;  1OC3 A;  2R37 A;  4I2T A;  3TKQ A;  1XCC A;  1R5A A;  1YF1 A;  5ECK B;  2OJL A;  5BRT A;  2V1M A;  2WS2 A;  2YWO A;  3HJM A;  3TKS A;  2H76 A;  4YKF A;  4IKH A;  3VK9 A;  5ECM B;  3FMW A;  1A0R P;  3KP9 A;  2L5O A;  4V1A p;  3MDK A;  1TDI A;  2GST A;  2WB9 A;  2QKE A;  4LA1 A;  4YH2 A;  3KEB A;  2KLX A;  2NVL A;  4O92 A;  3RPN A;  2DJJ A;  3HJO A;  2F3M A;  8GSS A;  2LJA A;  5DDL A;  2WZ9 A;  4TW5 A;  3C1R A;  4EC0 A;  5LNK e;  3D22 A;  4GST A;  4YQU A;  2YWN A;  3US3 A;  3RHB A;  3N5O A;  1G6Y A;  4YAP A;  4YAV A;  1GL8 A;  2CQ9 A;  13GS A;  2VUP A;  2MBS A;  5EL8 A;  4J56 E;  3V1W A;  3ZFL A;  2JU5 A;  3GYK A;  1XXU A;  1PX6 A;  2P5R A;  3TCO A;  1YQ1 A;  5ECL B;  4K8M A;  4MP4 A;  1GWC A;  3O3T A;  2PWJ A;  3CMI A;  5KOX A;  4HJ2 A;  2FWE A;  2CV4 A;  2O8V B;  3GH9 A;  1SKR B;  4F2I A;  1TXX A;  1QK8 A;  5IMC A;  3QFB C;  1B8X A;  2FWG A;  2R6K A;  2E7P A;  2TRX A;  1OVN A;  2P5Q A;  2H1G A;  4EIQ A;  1JZO A;  3U5R E;  4BVY A;  1EEM A;  1F3A A;  6GSX A;  1A2L A;  5J9B A;  5J5N A;  3F3Q A;  6GSU A;  2LRC A;  5ECH B;  1ML6 A;  1JLW A;  2YWI A;  1Y25 A;  2YOI A;  1EP8 A;  4TXO B;  3ZYW A;  3GX0 A;  4NXI A;  1G0T A;  5G1L A;  2XHF A;  2C4J A;  3LOR A;  1M9B A;  3ZRD A;  1DUG A;  17GS A;  5CRE A;  4HSC X;  1THO A;  3FR3 A;  5B8B A;  1O6J A;  1GP1 A;  4QQ7 A;  2DJ0 A;  3DYR A;  4F0C A;  1F9M A;  3HJP A;  3QFA C;  3RBT A;  4FYC A;  4MZW A;  2FD3 A;  3D5J A;  1AUC A;  1KNG A;  3TRQ A;  4PNF A;  3GIX A;  2A2R A;  3H93 A;  3HVV A;  2JSY A;  2H6Z A;  5DAL B;  2IMF A;  1RW1 A;  1GNE A;  2YNX A;  1GTB A;  1XIY A;  5CAX A;  1CQG A;  2HZF A;  3ZIT A;  2LRT A;  3TGZ A;  2C0G A;  4K5R A;  5IMF A;  4KX4 A;  4XCS A;  3UVH A;  1W4V A;  4XS1 A;  2H6Y A;  9GSS A;  1XFL A;  2O7K A;  1RK4 A;  2OE0 A;  1GTI A;  2IFQ A;  2I3Y A;  3L78 A;  3QAV A;  5JCU A;  3TB2 A;  4F82 A;  4IGJ A;  1B9X C;  3MYD A;  4ZB6 A;  3TJG A;  1ZYN A;  1B9Y C;  4GQF A;  2FWF A;  3VWV A;  4JED A;  1GH2 A;  1JZD A;  1SD8 A;  2E2G A;  1HNA A;  3HXS A;  1GSD A;  2TIR A;  2K18 A;  2AJQ B;  1FOV A;  4WXT A;  1QXH A;  2G2Q A;  2R4V A;  3P2A A;  3ERW A;  5CRG A;  5J9C A;  5AIS A;  4Q5Q A;  3H79 A;  2CVD A;  1SYR A;  1Z6M A;  4O7H A;  2FLS A;  3GUR A;  2J9H A;  2V6O A;  3IHQ A;  4F9Z A;  3BCK A;  4KH7 A;  3VI5 A;  3A2W A;  1TU7 A;  2VD1 A;  5GST A;  2GT5 A;  3A2V A;  2LNT A;  2V32 A;  2PGT A;  2K6V A;  1ZOF A;  2DML A;  4ML1 A;  2EIO A;  3GHA A;  2ZNM A;  2IME A;  1PD2 1;  2GS3 A;  3PR8 A;  4I97 A;  1JZR A;  1Z3E A;  3F6D A;  5DVB A;  2IPA A;  4K5S A;  1O8X A;  1UA5 A;  5H5S A;  1KTE A;  2L4C A;  1MD4 A;  2B1L A;  5A4W A;  4PUF C;  4GSS A;  1E2Y A;  1T00 A;  4CY6 A;  1BAY A;  12GS A;  3HKR A;  4PXO A;  3EC3 A;  2QSI A;  3D6I A;  2DLX A;  5FHI A;  3IXR A;  2H19 A;  4IQ1 A;  2H30 A;  1ZZY A;  1WE0 A;  3D0Z A;  2H1D A;  2BJX A;  3W8J A;  1M0U A;  3CQF A;  2OAD A;  3A5I A;  3BBY A;  3HY2 A;  2IIY A;  3EUR A;  3TJJ A;  3UBL A;  2C0D A;  3HA9 A;  4MZB A;  1ZYP A;  4KDX A;  3F9U A;  3RDW A;  2OE1 A;  3DWV A;  4OO5 A;  2LQQ A;  3IOS A;  2NPB A;  4EDY A;  1G7O A;  2JSZ A;  4BVY B;  1B4Q A;  5LD0 A;  5DCG A;  4ULX A;  2LJR A;  2YJH A;  1GUL A;  2V41 A;  1FVK A;  1QMV A;  5CO3 A;  3LQ7 A;  4OMV A;  4L8E A;  4WR4 A;  4WEY A;  1BYE A;  4ZXG A;  1GSS A;  3RPP A;  2GQL A;  4PQH A;  5IOX A;  2N5B A;  1YZX A;  2OBK A;  4BL7 A;  1M3I A;  3GN3 A;  5D9V A;  1Q4J A;  3KH9 A;  4D73 A;  1HQO A;  2WDU A;  3G7J A;  4N0Z A;  2N5F A;  6GSY A;  1T3B A;  1GSQ A;  4PX1 A;  1N2A A;  2L6C A;  2VL3 A;  1ZMA A;  2DJ3 A;  16GS A;  3TKS E;  2VOC A;  2HRN A;  2UZ8 A;  5B7C A;  1K0N A;  4GF0 A;  4ZL7 A;  1K3L A;  3MSZ A;  3WGX A;  2V2G A;  3KH7 A;  1HD2 A;  1NW2 A;  2IFQ B;  2AUV A;  5AIX A;  1ST9 A;  4MF7 A;  2QA1 A;  3VWW A;  4TN8 A;  1FHE A;  3IDV A;  2E2M A;  2B3S A;  3CSH A;  5COH A;  4AF2 A;  2BMX A;  5DQY A;  4PUA A;  1ZYQ B;  3VLN A;  2GDR A;  1EZK A;  1KBN A;  2VLU A;  4YQV A;  1XOB A;  1BX9 A;  3BD2 A;  2OKA A;  2XPE A;  4F03 A;  2DIY A;  3LEF A;  2J23 A;  2C3Q A;  4ISD A;  2B6M A;  2BTO T;  3BJ5 A;  2WGR A;  4L5O A;  2CVK A;  4CHS A;  1LJR A;  2ON5 A;  3LG6 A;  1UVZ A;  3PH9 A;  2VL9 A;  3C1S A;  2VLT A;  2YZU A;  1XW9 A;  4MJC A;  4I5Q A;  1SL2 B;  1QGV A;  5G5F A;  2VCV A;  1N8J A;  4USS A;  2GGT A;  1AXD A;  3CBU A;  4OD7 A;  4HDE A;  4NAX A;  2PN8 A;  1O85 A;  2X4A A;  5A4V A;  5C00 A;  3SBC A;  2D2Z A;  4LMW A;  4HZ4 A;  4L5L A;  3GL5 A;  4K1F A;  3KGK A;  1BG5 A;  5EY6 A;  3M3M A;  4HQS A;  3N9J A;  3HVX A;  1K0D A;  2OAC A;  4A5P A;  2RUF A;  4MPF A;  4E8H A;  2MMA A;  3A2X A;  1F37 A;  4HEA 2;  3ZIV A;  5DBQ A;  3UBK A;  3LSZ A;  1Y6E A;  1M7T A;  1GSE A;  3IV4 A;  4ECI A;  2CX4 A;  3H8Q A;  4KSM A;  1M2A A;  4IP1 A;  4K7O A;  1ERT A;  1VRS D;  5HR3 A;  1XWB A;  1K0B A;  4X43 A;  2B7K A;  4MNN A;  5JCG A;  4KW6 A;  2NTO A;  3PIN A;  2B5E A;  1AC1 A;  1XWG A;  6GSW A;  2VD0 A;  3GFK A;  2OA7 A;  1QFN A;  2H6X A;  5IOW A;  2DJ2 A;  2YZH A;  5F06 A;  2AV4 A;  4XHM A;  3ED3 A;  2LRN A;  1S3R A;  5GZZ B;  3P7X A;  2XPD A;  4V2N A;  4G2E A;  1G7E A;  4NPB A;  2CX3 A;  2R0C A;  2LUS A;  4N0V A;  2K8V A;  2GQK A;  2VCZ A;  1OC9 A;  4O32 A;  4RQR A;  2RUE A;  5JWO B;  1O8W A;  4FIW A;  1K0M A;  1U3A A;  1WWJ A;  1TJD A;  1AQV A;  2A4H A;  1XWA A;  2IWT A;  4I6X A;  2H1A A;  4IQA A;  4EE0 A;  3ERG A;  3SWL A;  2PUK C;  1YKC A;  3E3E A;  1PN0 A;  4RI6 A;  4EL1 A;  4CW9 A;  4OCE A;  1X9W B;  5ELG A;  1A8L A;  1T7P B;  3A5W A;  4BL7 B;  3FZA A;  3KZQ A;  3FZ5 A;  2IN3 A;  3DML A;  3RAZ A;  1TRU A;  2WRT A;  4GCI A;  1JHB A;  4D73 B;  3M8N A;  4P3Y B;  3PPU A;  2XBI A;  2VLV A;  1YF0 A;  4ZBA A;  1GSY A;  2A2S A;  3GA4 A;  1WMJ A;  1O73 A;  4KAE A;  4MH2 A;  5HFG A;  2HZE A;  2YWM A;  3A3T A;  5D9X A;  1EGR A;  2VM1 A;  2X49 A;  2C8U A;  1AIU A;  3APO A;  1LBK A;  2HNL A;  2HRA A;  4G0I A;  3FW2 A;  1SK0 A;  3GNJ A;  4GSN A;  3OR5 A;  1XBS A;  4TR4 A;  3L9U A;  3MAK A;  4JZQ A;  2H72 A;  3ZLP A;  3GKK A;  5CRD A;  4EUY A;  2JAD A;  3D4T A;  3UVT A;  4GWR A;  4RQX A;  5EVO A;  3GMF A;  4KND A;  2JL4 A;  2MMN A;  3G7I A;  4OCF A;  1GUK A;  4K6X A;  2TRC P;  3HYP A;  4MF6 A;  2ZUP A;  3HDC A;  3UL3 A;  4O5R A;  4HU7 A;  3MIX A;  4XS4 A;  1BQ7 A;  1IYI A;  3GKM A;  4YKG A;  1SK1 A;  4PQI A;  1M2B A;  1ON4 A;  5F0G A;  1HYU A;  1TK8 B;  5C04 A;  4PGT A;  1XVQ A;  2KHP A;  1RQM A;  4LMV A;  1C72 A;  2WCI A;  4HOJ A;  4AGS A;  2VAF A;  2R2J A;  4G9H A;  3GL3 A;  1ZL9 A;  4G0L A;  3DIE A;  2AYT A;  4GRF A;  4BWS A;  2ES7 A;  3EE2 A;  5IPG A;  1TI3 A;  1GTA A;  1MEK A;  2PMT A;  3CYN A;  1USB A;  4ZL8 A;  5DJL A;  5CRW A;  3IAM 2;  2H0G A;  5INY A;  1ABA A;  4AJ7 A;  1OKD A;  2X8H A;  5D9T A;  1JZW A;  3LGC A;  5ECQ B;  2B7J A;  1K0C A;  4K9Z A;  1ZYE A;  1U87 A;  5IO2 A;  5HFK A;  3J7Y k;  3GKX A;  4EO3 A;  14GS A;  1H4O A;  3FZ4 A;  4G19 A;  3DXB A;  1DE2 A;  4ECJ A;  2F8A A;  1TKD B;  4EVM A;  3D4M A;  3GX8 A;  1SYX A;  1PMT A;  1EEJ A;  1Z9H A;  1YY7 A;  4K7N A;  1U6T A;  3ZZX A;  2IMD A;  1V2A A;  4CY8 A;  2RII A;  3FK8 A;  1TK5 B;  2GZP A;  3EYT A;  3CTG A;  3QPM A;  2VM2 A;  3VPQ A;  4NV2 A;  5ENU A;  4K0G A;  4KGI A;  2L4Q A;  4ML6 A;  1ZCP A;  5AN1 A;  4ZIJ A;  1S3C A;  3HVN A;  3GUS A;  4V2M A;  3Q18 A;  4POK A;  4I2U A;  2FCH A;  1OC8 A;  3KJY A;  3EIN A;  1R26 A;  5FT3 A;  5GSS A;  5H5R A;  2PPT A;  4WBJ A;  2B1K A;  1SJI A;  2OE3 A;  2FY6 A;  2VCT A;  1UN2 A;  4XIH A;  4OFT A;  3RHC A;  2ALB A;  1OC9 B;  3TDG A;  1GUH A;  3ZTL A;  1MDJ A;  4RI7 A;  5HQP A;  3FZ9 A;  2REM A;  3APS A;  5A4U A;  4XS6 A;  2HFD A;  3F8U A;  1MTC A;  3KD0 A;  2MMZ A;  3ZRE A;  2A2P A;  1YEP A;  3E9J B;  4BWQ A;  1ZGN A;  3ZMK A;  2KUC A;  1B4P A;  1NM3 A;  2KP2 A;  2R0P A;  3UOM A;  3L9S A;  3EU3 A;  3IHG A;  1SL1 B;  1FB6 A;  2X8C A;  1W89 A;  1FVJ A;  1PA3 A;  4HZ2 A;  4MLY A;  2VCX A;  4N10 A;  2EC4 A;  3F6F A;  1PN9 A;  5G2Z A;  4DVC A;  1JFU A;  19GS A;  1TU8 A;  4IS0 A;  2FUG 2;  4QL7 A;  1I9D A;  2HZE B;  4RUV A;  2FNO A;  3GKN A;  1EOH A;  2L59 A;  3KTL A;  1A0F A;  2HLS A;  5ECI B;  4TXV A;  4H86 A;  2MMO A;  4DSQ A;  4DSR A;  3CSI A;  1U88 A;  4JU5 A;  1GSU A;  1GRX A;  1O7U A;  2CA8 A;  3QOU A;  2WJU A;  1PGT A;  1NHY A;  20GS A;  3DKS A;  3LFL A;  5CNW A;  1XVW A;  3DVW A;  1SKW B;  2E0Q A;  2VL2 A;  4KUN A;  2KOK A;  4JRR A;  4IW9 A;  3QCP A;  2ZCT A;  5F05 A;  4LLR A;  3BCI A;  1A24 A;  4GXZ A;  4PNG A;  10GS A;  1A23 A;  4FO5 A;  4XS4 B;  3TRP A;  5DCH A;  3HHV A;  2H8L A;  1YDK A;  5JWQ B;  1SJZ A;  4V1A g;  1H75 A;  5DAK A;  3FYG A;  3VWX A;  4DSS A;  5HFI A;  1V58 A;  2WFC A;  2YJ7 A;  2V6K A;  1ERV A;  2P31 A;  3C7M A;  3HZ4 A;  4O5U A;  4ECB A;  4MZC A;  3F0I A;  4ZBD A;  2R0G A;  2XBQ A;  1GTU A;  2YN1 A;  2H66 A;  3QR6 A;  4O5Q A;  5KN0 A;  2DIZ A;  1ERU A;  4MMM A;  4Z2T A;  3KTB A;  3APQ A;  4XTS A;  4FH8 A;  1EP7 A;  1SJ6 A;  4K2D A;  1K0O A;  3F4R A;  1O81 A;  1F2E A;  5D96 A;  5ECR B;  4FYB A;  3F4S A;  3VUR A;  3I9V 2;  2A4V A;  1K3O A;  4HI7 A;  1WIK A;  2H0I A;  1SD9 A;  1AW9 A;  1DBY A;  4F0B A;  3W6G A;  3ZFB A;  2NDO A;  4CDO A;  1SEN A;  2HYX A;  1K0A A;  5KEJ A;  4FYU A;  1X9M B;  4MPG A;  1XW5 A;  1V57 A;  3WD6 A;  5J41 A;  3UAP A;  3QMX A;  4K2X A;  2N5A A;  3JCM L;  1NSW A;  5IMZ A;  4XRD A;  4X1U A;  4KCE A;  2YPM A;  4Q5F A;  4BIK A;  2R5G A;  2HXK A;  3GST A;  2PVO C;  5AIV A;  3FR9 A;  2PBJ A;  3H4K A;  1SK2 A;  1A2M A;  2RM6 A;  2GVP A;  4E8E A;  1YKA A;  2JZS A;  1TP9 A;  2I4A A;  3UEM A;  2VO4 A;  4WBR D;  3J7Y b;  2AB6 A;  3M9J A;  3VFI A;  4POL A;  2X99 A;  1SL0 B;  2FA8 A;  3M0F A;  3KXO A;  1V40 A;  2ON7 A;  3ZIJ A;  3TJB A;  2F9S A;  3F63 A;  2CZ3 A;  1DSB A;  2LJK A;  3TKR A;  2P0G A;  5BMU A;  3GRX A;  2MBT A;  4PTS A;  3I43 A;  5IMA A;  1SU9 A;  4NHW A;  2JAC A;  2C0F A;  2LTK A;  3GTU A;  18GS A;  4LL1 B;  5ID2 A;  3FEU A;  3ISO A;  3CTF A;  2DSA A;  2PVQ A;  2B5Y A;  1ERW A;  3Q6O A;  5LCZ A;  3QAG A;  2GSR A;  2I9H A;  3LW9 A;  2Z9S A;  3L4N A;  1AQX A;  5HR1 A;  3VI7 A;  4X4J A;  3VPT A;  2MZC A;  2O89 A;  3TRX A;  4ZB8 A;  4ZIL A;  4IP6 A;  2C0E A;  4TOP A;  4V2L A;  3EVI A;  2HSH A;  3L0H A;  3H1N A;  2YV7 A;  1LU4 A;  5JWR B;  4HJM A;  4WKW A;  2LQO A;  2YAN A;  5G31 A;  3I6A A;  4KSO A;  1PX7 A;  5G30 A;  4HU9 A;  2IMK A;  3TKP A;  3EMP A;  2FA4 A;  3VWU A;  1VF3 A;  3G9B A;  1Z5Y E;  4MA9 A;  1M99 A;  3PGT A;  1X0R A;  1PFO A;  3EWL A;  3IBH A;  4OWY A;  5D8I A;  3IR4 A;  4KDU A;  4MDC A;  1ACV A;  2LNS A;  1HNB A;  5EPF A;  2H0H A;  4J57 E;  2GQM A;  1A2J A;  2FWH A;  5F8B A;  4EIP A;  1TRS A;  5CRH A;  3C73 A;  2GTU A;  2JZR A;  3IK9 A;  4ZL9 A;  1THX A;  4KB3 A;  3UIW A;  3QDN A;  1PL1 A;  1R4W A;  4ID0 A;  3DRN A;  2QA2 A;  3TJF A;  1FAA A;  1OKT A;  1VF2 A;  1Z7R A;  3KP8 A;  3WGE A;  1E6B A;  3C71 A;  5IMD A;  4JBB A;  3TJK A;  4GTU A;  4IN0 A;  3QAW A;  3ME8 A;  4TR1 A;  2QC7 A;  2M46 A;  6GSS A;  5IMV A;  5ECO B;  5DAK B;  4OFM A;  5G1K A;  4DSS B;  5ABR A;  2LS5 A;  4KDY A;  1PL2 A;  4Z2R A;  1SKS B;  1WJK A;  3CRT A;  1TK0 B;  3IE3 A;  4BA7 A;  3WT1 A;  3EMX A;  4I8B A;  1XW6 A;  3IAS 2;  2WUL A;  3O76 A;  4ICY A;  3WT2 A;  1X5C A;  3GV1 A;  4KA0 A;  1PSQ A;  4K0N A;  4NV5 A;  3L9V A;  4OFN A;  5KN2 A;  4WR5 A;  3LYP A;  1FG4 A;  3C8E A;  3AY8 A;  3UJ1 A;  4GQC A;  3P90 A;  2DJ1 A;  1DE1 A;  2FHE A;  5F07 A;  1GLP A;  2CAI A;  4NMU A;  2LEG A;  2M72 A;  4G10 A;  3LXT A;  1WOU A;  2YCD A;  3DGQ A;  5L71 A;  1R7H A;  1YEX A;  4IBP A;  3KIJ A;  2H71 A;  5D93 A;  5CYY A;  3IC8 A;  3CXG A;  4HS1 A;  1R5P A;  4L0U A;  1V9W A;  4MK3 A;  3ZVJ A;  1PKZ A;  5HR0 A;  1GNW A;  3IPZ A;  1K3Y A;  5D73 A;  2YP6 A;  2H1B A;  1XOA A;  4X0X A;  2DC5 A;  3QD9 A;  5IO0 A;  1J0F A;  1OE8 A;  4ILF A;  5E59 A;  1MDI A;  1GSF A;  2HT9 A;  1IYH A;  4JR4 A;  2O85 A;  3UMA A;  1FB0 A;  3ERF A;  2HI7 A;  1FOH A;  1T8E B;  5B6M A;  2X64 A;  1Z6N A;  4N11 A;  1EV4 A;  3GSS A;  1T4Y A;  5B6N A;  2LKU A;  1PRX A;  1GLQ A;  1VGL A;  3FRC A;  4IHU A;  2F8F A;  1PKW A;  2GZZ A;  4KCA A;  2EIR A;  2XC2 A;  4Z7X A;  3KMO A;  2HRF A;  2R3X A;  2RM5 A;  5GAN D;  2FGX A;  4L0W A;  2GT6 A;  1WRY A;  3BOA A;  5CP1 A;  4BVX A;  4MH3 A; 
#chains in the Genus database with same CATH homology
 3WGD A;  5D9W A;  3KMN A;  2KP1 A;  3R2Q A;  4TRX A;  3HCZ A;  4TR3 A;  3GTU B;  5ID2 B;  2NBS A;  3MWH A;  3ZVJ D;  1T1V A;  5IM9 A;  4WET A;  2GSQ A;  3NOF A;  5GAP D;  2X8G A;  5KOW A;  1AAZ A;  4G0K A;  3UAR A;  3F4T A;  2OBI A;  2VIM A;  1G6W A;  22GS A;  2EIQ A;  4JE1 A;  5ECN B;  1TOF A;  4ZB9 A;  2PU9 C;  3NIV A;  5IQY A;  3I69 A;  2DKH A;  2B5X A;  2VL2 C;  5J4U A;  4MF5 A;  3F3R A;  3WYW A;  4HUA A;  4AJ6 A;  2AAW A;  4N30 A;  2JZT A;  5JCW A;  3CRU A;  1EWX A;  2RLI A;  2DKI A;  4KE3 A;  2DJK A;  2LV3 A;  1OE7 A;  2M80 A;  4MJA A;  3KM6 A;  2CT6 A;  4JR6 A;  1EOG A;  4IJ3 A;  4ECC A;  3DVX A;  3TOU A;  1UC7 A;  4MAB A;  4QL9 A;  11GS A;  2GSS A;  1X5E A;  4EKZ A;  1Z7P A;  4MJB A;  1Q98 A;  1EGO A;  1WPI A;  4MJE A;  5DJM A;  1TRV A;  5E4W A;  3K8N A;  3LWA A;  4BPY A;  1X9S B;  2C80 A;  4POM A;  3LXZ A;  2MYG A;  4EXJ A;  4TR1 B;  3IC4 A;  2K9F A;  5H5Q A;  1T4Z A;  4EDZ A;  2CAQ A;  4J2F A;  4EF0 A;  1TTZ A;  5A5K A;  5G5E A;  1M9A A;  2VCW A;  1PQN A;  6GSV A;  4POB A;  4TKY A;  2DBC A;  3IA1 A;  5KN1 A;  4YQM A;  3MNG A;  2VCQ A;  5FWG A;  1I5G A;  1BJX A;  5ECS A;  3HZ8 A;  2H74 A;  1M2D A;  2CZ2 A;  1F6M C;  1QQ2 A;  1MDK A;  3DD3 A;  4ZBB A;  3M9K A;  2H70 A;  3KCM A;  4XRA A;  7GSS A;  1QUW A;  4GLT A;  3TUE A;  3LJR A;  1OAZ A;  2PER A;  4PUR A;  1XZO A;  1TI1 A;  3D21 A;  3S9F A;  2CVB A;  4IJI A;  1TRW A;  5DQS A;  3HD5 A;  5ECP B;  3FY7 A;  1KEB A;  3M1G A;  3EU4 A;  4KF9 A;  4WF4 A;  2HSY A;  2C3N A;  2L5L A;  5KN3 A;  3W8S A;  2HRK A;  5IPH A;  1J9B A;  3ZL5 A;  3E0U A;  1A8Y A;  4TR0 A;  4TVE A;  1NHO A;  1MD3 A;  2H75 A;  3Q19 A;  1URM A;  1BED A;  1XWK A;  2H01 A;  3R3E A;  3O6T A;  5ELA A;  1ILO A;  2AHE A;  1YJ6 A;  2H73 A;  2C3T A;  1AQW A;  3CSJ A;  2G0F A;  4NWY A;  4FQU A;  4Q5N A;  1XPV A;  2GZY A;  3Q74 A;  1X5D A;  4HQZ A;  3GH6 A;  4TXO A;  1GUM A;  4DEJ A;  4LL4 B;  1U3I A;  4Z2U A;  2QGV A;  2IMI A;  2IJY A;  1EV9 A;  4ACS A;  3P8W A;  3ME7 A;  2C1Y A;  1CQH A;  2O87 A;  3TKS C;  2YV9 A;  1WP0 A;  4PQ1 A;  1S3D A;  1V98 A;  5J3R A;  1XWC A;  2GLR A;  3U6V A;  3LYK A;  4K7I A;  3DEX A;  4IEL A;  1S3A A;  3G7Y A;  1HNC A;  4OO4 A;  4BVX B;  3ZML A;  2L6D A;  2LST A;  5IIZ A;  2HSM A;  3TOT A;  3FR6 A;  4Q5R A;  1VF1 A;  1VF4 A;  5DAL A;  2F51 A;  6GST A;  5B8A A;  3IK7 A;  1F3B A;  1JLV A;  2HE3 A;  2K8S A;  3FHK A;  1FW1 A;  2I1U A;  1OYJ A;  4AJ8 A;  2I81 A;  4NHZ A;  1TW9 A;  4IVF A;  3IRA A;  1FO5 A;  5HR2 A;  3EPT A;  2DMM A;  2L57 A;  4WF5 A;  2IL3 A;  1B48 A;  3HVS A;  4MCU A;  5AGY A;  1J08 A;  3NZN A;  3FKF A;  1OC3 A;  2R37 A;  4I2T A;  3TKQ A;  1XCC A;  1R5A A;  1YF1 A;  5ECK B;  2OJL A;  5BRT A;  2V1M A;  2WS2 A;  2YWO A;  3HJM A;  3TKS A;  2H76 A;  4YKF A;  4IKH A;  3VK9 A;  5ECM B;  3FMW A;  1A0R P;  3KP9 A;  2L5O A;  4V1A p;  3MDK A;  1TDI A;  2GST A;  2WB9 A;  2QKE A;  4LA1 A;  4YH2 A;  3KEB A;  2KLX A;  2NVL A;  4O92 A;  3RPN A;  2DJJ A;  3HJO A;  2F3M A;  8GSS A;  2LJA A;  5DDL A;  2WZ9 A;  4TW5 A;  3C1R A;  4EC0 A;  5LNK e;  3D22 A;  4GST A;  4YQU A;  2YWN A;  3US3 A;  3RHB A;  3N5O A;  1G6Y A;  4YAP A;  4YAV A;  1GL8 A;  2CQ9 A;  13GS A;  2VUP A;  2MBS A;  5EL8 A;  4J56 E;  3V1W A;  3ZFL A;  2JU5 A;  3GYK A;  1XXU A;  1PX6 A;  2P5R A;  3TCO A;  1YQ1 A;  5ECL B;  4K8M A;  4MP4 A;  1GWC A;  3O3T A;  2PWJ A;  3CMI A;  5KOX A;  4HJ2 A;  2FWE A;  2CV4 A;  2O8V B;  3GH9 A;  1SKR B;  4F2I A;  1TXX A;  1QK8 A;  5IMC A;  3QFB C;  1B8X A;  2FWG A;  2R6K A;  2E7P A;  2TRX A;  1OVN A;  2P5Q A;  2H1G A;  4EIQ A;  1JZO A;  3U5R E;  4BVY A;  1EEM A;  1F3A A;  6GSX A;  1A2L A;  5J9B A;  5J5N A;  3F3Q A;  6GSU A;  2LRC A;  5ECH B;  1ML6 A;  1JLW A;  2YWI A;  1Y25 A;  2YOI A;  1EP8 A;  4TXO B;  3ZYW A;  3GX0 A;  4NXI A;  1G0T A;  5G1L A;  2XHF A;  2C4J A;  3LOR A;  1M9B A;  3ZRD A;  1DUG A;  17GS A;  5CRE A;  1THO A;  3FR3 A;  5B8B A;  1O6J A;  1GP1 A;  4QQ7 A;  2DJ0 A;  3DYR A;  4F0C A;  1F9M A;  3HJP A;  3QFA C;  3RBT A;  4FYC A;  4MZW A;  2FD3 A;  3D5J A;  1AUC A;  1KNG A;  3TRQ A;  4PNF A;  3GIX A;  2A2R A;  3H93 A;  3HVV A;  2JSY A;  2H6Z A;  5DAL B;  2IMF A;  1RW1 A;  1GNE A;  2YNX A;  1GTB A;  1XIY A;  5CAX A;  1CQG A;  2HZF A;  3ZIT A;  2LRT A;  3TGZ A;  2C0G A;  4K5R A;  5IMF A;  4KX4 A;  4XCS A;  3UVH A;  1W4V A;  4XS1 A;  2H6Y A;  9GSS A;  1XFL A;  2O7K A;  1RK4 A;  2OE0 A;  1GTI A;  2IFQ A;  2I3Y A;  3L78 A;  3QAV A;  5JCU A;  3TB2 A;  4F82 A;  4IGJ A;  1B9X C;  3MYD A;  4ZB6 A;  3TJG A;  1ZYN A;  1B9Y C;  4GQF A;  2FWF A;  3VWV A;  4JED A;  1GH2 A;  1JZD A;  1SD8 A;  2E2G A;  1HNA A;  3HXS A;  1GSD A;  2TIR A;  2K18 A;  2AJQ B;  1FOV A;  4WXT A;  1QXH A;  2G2Q A;  2R4V A;  3P2A A;  3ERW A;  5CRG A;  5J9C A;  5AIS A;  4Q5Q A;  3H79 A;  2CVD A;  1SYR A;  1Z6M A;  4O7H A;  2FLS A;  3GUR A;  2J9H A;  2V6O A;  3IHQ A;  4F9Z A;  3BCK A;  4KH7 A;  3VI5 A;  3A2W A;  1TU7 A;  2VD1 A;  5GST A;  2GT5 A;  3A2V A;  2LNT A;  2V32 A;  2PGT A;  2K6V A;  1ZOF A;  2DML A;  4ML1 A;  2EIO A;  3GHA A;  2ZNM A;  2IME A;  1PD2 1;  2GS3 A;  3PR8 A;  4I97 A;  1JZR A;  1Z3E A;  3F6D A;  5DVB A;  2IPA A;  4K5S A;  1O8X A;  1UA5 A;  5H5S A;  1KTE A;  2L4C A;  1MD4 A;  2B1L A;  5A4W A;  4PUF C;  4GSS A;  1E2Y A;  1T00 A;  4CY6 A;  1BAY A;  12GS A;  3HKR A;  4PXO A;  3EC3 A;  2QSI A;  3D6I A;  2DLX A;  5FHI A;  3IXR A;  2H19 A;  4IQ1 A;  2H30 A;  1ZZY A;  1WE0 A;  3D0Z A;  2H1D A;  2BJX A;  3W8J A;  1M0U A;  2OAD A;  3A5I A;  3BBY A;  3HY2 A;  2IIY A;  3EUR A;  3TJJ A;  3UBL A;  2C0D A;  3HA9 A;  4MZB A;  1ZYP A;  4KDX A;  3F9U A;  3RDW A;  2OE1 A;  3DWV A;  4OO5 A;  2LQQ A;  3IOS A;  2NPB A;  4EDY A;  1G7O A;  2JSZ A;  4BVY B;  1B4Q A;  5LD0 A;  5DCG A;  4ULX A;  2LJR A;  2YJH A;  1GUL A;  2V41 A;  1FVK A;  1QMV A;  5CO3 A;  3LQ7 A;  4OMV A;  4L8E A;  4WR4 A;  4WEY A;  1BYE A;  4ZXG A;  1GSS A;  3RPP A;  2GQL A;  4PQH A;  5IOX A;  2N5B A;  1YZX A;  2OBK A;  4BL7 A;  3GN3 A;  5D9V A;  1Q4J A;  3KH9 A;  4D73 A;  1HQO A;  2WDU A;  3G7J A;  4N0Z A;  2N5F A;  6GSY A;  1T3B A;  1GSQ A;  4PX1 A;  1N2A A;  2L6C A;  2VL3 A;  1ZMA A;  2DJ3 A;  16GS A;  3TKS E;  2VOC A;  2HRN A;  2UZ8 A;  5B7C A;  1K0N A;  4GF0 A;  4ZL7 A;  1K3L A;  3MSZ A;  3WGX A;  2V2G A;  3KH7 A;  1HD2 A;  1NW2 A;  2IFQ B;  2AUV A;  5AIX A;  1ST9 A;  4MF7 A;  2QA1 A;  3VWW A;  4TN8 A;  1FHE A;  3IDV A;  2E2M A;  2B3S A;  3CSH A;  5COH A;  4AF2 A;  2BMX A;  5DQY A;  4PUA A;  1ZYQ B;  3VLN A;  2GDR A;  1EZK A;  1KBN A;  2VLU A;  4YQV A;  1XOB A;  1BX9 A;  3BD2 A;  2OKA A;  2XPE A;  4F03 A;  2DIY A;  3LEF A;  2J23 A;  2C3Q A;  4ISD A;  2B6M A;  2BTO T;  3BJ5 A;  2WGR A;  4L5O A;  2CVK A;  4CHS A;  1LJR A;  2ON5 A;  3LG6 A;  1UVZ A;  3PH9 A;  2VL9 A;  3C1S A;  2VLT A;  2YZU A;  1XW9 A;  4MJC A;  4I5Q A;  1SL2 B;  1QGV A;  5G5F A;  2VCV A;  1N8J A;  4USS A;  2GGT A;  1AXD A;  3CBU A;  4OD7 A;  4HDE A;  4NAX A;  2PN8 A;  1O85 A;  2X4A A;  5A4V A;  5C00 A;  3SBC A;  2D2Z A;  4LMW A;  4HZ4 A;  4L5L A;  3GL5 A;  4K1F A;  3KGK A;  1BG5 A;  5EY6 A;  3M3M A;  4HQS A;  3N9J A;  3HVX A;  1K0D A;  2OAC A;  4A5P A;  2RUF A;  4MPF A;  4E8H A;  2MMA A;  3A2X A;  1F37 A;  4HEA 2;  3ZIV A;  5DBQ A;  3UBK A;  3LSZ A;  1Y6E A;  1M7T A;  1GSE A;  3IV4 A;  4ECI A;  2CX4 A;  3H8Q A;  4KSM A;  1M2A A;  4IP1 A;  4K7O A;  1ERT A;  1VRS D;  5HR3 A;  1XWB A;  1K0B A;  4X43 A;  2B7K A;  4MNN A;  5JCG A;  4KW6 A;  2NTO A;  3PIN A;  2B5E A;  1AC1 A;  1XWG A;  6GSW A;  2VD0 A;  3GFK A;  2OA7 A;  1QFN A;  2H6X A;  5IOW A;  2DJ2 A;  2YZH A;  5F06 A;  2AV4 A;  4XHM A;  3ED3 A;  2LRN A;  5GZZ B;  3P7X A;  2XPD A;  4V2N A;  4G2E A;  1G7E A;  4NPB A;  2CX3 A;  2R0C A;  2LUS A;  4N0V A;  2K8V A;  2GQK A;  2VCZ A;  1OC9 A;  4O32 A;  4RQR A;  2RUE A;  5JWO B;  1O8W A;  4FIW A;  1K0M A;  1U3A A;  1WWJ A;  1TJD A;  1AQV A;  2A4H A;  1XWA A;  2IWT A;  4I6X A;  2H1A A;  4IQA A;  4EE0 A;  3ERG A;  3SWL A;  2PUK C;  1YKC A;  3E3E A;  1PN0 A;  4RI6 A;  4EL1 A;  4CW9 A;  4OCE A;  1X9W B;  5ELG A;  1A8L A;  1T7P B;  3A5W A;  4BL7 B;  3FZA A;  3KZQ A;  3FZ5 A;  2IN3 A;  3DML A;  3RAZ A;  1TRU A;  2WRT A;  4GCI A;  1JHB A;  4D73 B;  3M8N A;  4P3Y B;  3PPU A;  2XBI A;  2VLV A;  1YF0 A;  4ZBA A;  1GSY A;  2A2S A;  3GA4 A;  1WMJ A;  1O73 A;  4KAE A;  4MH2 A;  5HFG A;  2HZE A;  2YWM A;  3A3T A;  5D9X A;  1EGR A;  2VM1 A;  2X49 A;  2C8U A;  1AIU A;  3APO A;  1LBK A;  2HNL A;  2HRA A;  4G0I A;  3FW2 A;  1SK0 A;  3GNJ A;  4GSN A;  3OR5 A;  1XBS A;  4TR4 A;  3L9U A;  3MAK A;  4JZQ A;  2H72 A;  3ZLP A;  3GKK A;  5CRD A;  4EUY A;  2JAD A;  3D4T A;  3UVT A;  4GWR A;  4RQX A;  5EVO A;  3GMF A;  4KND A;  2JL4 A;  2MMN A;  3G7I A;  4OCF A;  1GUK A;  4K6X A;  2TRC P;  3HYP A;  4MF6 A;  2ZUP A;  3HDC A;  3UL3 A;  4O5R A;  4HU7 A;  3MIX A;  4XS4 A;  1BQ7 A;  1IYI A;  3GKM A;  4YKG A;  1SK1 A;  4PQI A;  1M2B A;  1ON4 A;  5F0G A;  1HYU A;  1TK8 B;  5C04 A;  4PGT A;  1XVQ A;  2KHP A;  1RQM A;  4LMV A;  1C72 A;  2WCI A;  4HOJ A;  4AGS A;  2VAF A;  2R2J A;  4G9H A;  3GL3 A;  1ZL9 A;  4G0L A;  3DIE A;  2AYT A;  4GRF A;  4BWS A;  2ES7 A;  3EE2 A;  5IPG A;  1TI3 A;  1GTA A;  1MEK A;  2PMT A;  3CYN A;  1USB A;  4ZL8 A;  5DJL A;  5CRW A;  3IAM 2;  2H0G A;  5INY A;  1ABA A;  4AJ7 A;  1OKD A;  2X8H A;  5D9T A;  1JZW A;  3LGC A;  5ECQ B;  2B7J A;  1K0C A;  4K9Z A;  1ZYE A;  1U87 A;  5IO2 A;  5HFK A;  3J7Y k;  3GKX A;  4EO3 A;  14GS A;  1H4O A;  3FZ4 A;  4G19 A;  3DXB A;  1DE2 A;  4ECJ A;  2F8A A;  1TKD B;  4EVM A;  3D4M A;  3GX8 A;  1SYX A;  1PMT A;  1EEJ A;  1Z9H A;  1YY7 A;  4K7N A;  1U6T A;  3ZZX A;  2IMD A;  1V2A A;  4CY8 A;  2RII A;  3FK8 A;  1TK5 B;  2GZP A;  3EYT A;  3CTG A;  3QPM A;  2VM2 A;  3VPQ A;  4NV2 A;  5ENU A;  4K0G A;  4KGI A;  2L4Q A;  4ML6 A;  1ZCP A;  5AN1 A;  4ZIJ A;  1S3C A;  3GUS A;  4V2M A;  3Q18 A;  4POK A;  4I2U A;  2FCH A;  1OC8 A;  3KJY A;  3EIN A;  1R26 A;  5FT3 A;  5GSS A;  5H5R A;  2PPT A;  4WBJ A;  2B1K A;  1SJI A;  2OE3 A;  2FY6 A;  2VCT A;  1UN2 A;  4XIH A;  4OFT A;  3RHC A;  2ALB A;  1OC9 B;  3TDG A;  1GUH A;  3ZTL A;  1MDJ A;  4RI7 A;  5HQP A;  3FZ9 A;  2REM A;  3APS A;  5A4U A;  4XS6 A;  2HFD A;  3F8U A;  1MTC A;  3KD0 A;  2MMZ A;  3ZRE A;  2A2P A;  1YEP A;  3E9J B;  4BWQ A;  1ZGN A;  3ZMK A;  2KUC A;  1B4P A;  1NM3 A;  2KP2 A;  2R0P A;  3UOM A;  3L9S A;  3EU3 A;  3IHG A;  1SL1 B;  1FB6 A;  2X8C A;  1W89 A;  1FVJ A;  1PA3 A;  4HZ2 A;  4MLY A;  2VCX A;  4N10 A;  2EC4 A;  3F6F A;  1PN9 A;  5G2Z A;  4DVC A;  1JFU A;  19GS A;  1TU8 A;  4IS0 A;  2FUG 2;  4QL7 A;  1I9D A;  2HZE B;  4RUV A;  2FNO A;  3GKN A;  1EOH A;  2L59 A;  3KTL A;  1A0F A;  2HLS A;  5ECI B;  4TXV A;  4H86 A;  2MMO A;  4DSQ A;  4DSR A;  3CSI A;  1U88 A;  4JU5 A;  1GSU A;  1GRX A;  1O7U A;  2CA8 A;  3QOU A;  2WJU A;  1PGT A;  1NHY A;  20GS A;  3DKS A;  3LFL A;  5CNW A;  1XVW A;  3DVW A;  1SKW B;  2E0Q A;  2VL2 A;  4KUN A;  2KOK A;  4JRR A;  4IW9 A;  3QCP A;  2ZCT A;  5F05 A;  4LLR A;  3BCI A;  1A24 A;  4GXZ A;  4PNG A;  10GS A;  1A23 A;  4FO5 A;  4XS4 B;  3TRP A;  5DCH A;  3HHV A;  2H8L A;  1YDK A;  5JWQ B;  1SJZ A;  4V1A g;  1H75 A;  5DAK A;  3FYG A;  3VWX A;  4DSS A;  5HFI A;  1V58 A;  2WFC A;  2YJ7 A;  2V6K A;  1ERV A;  2P31 A;  3C7M A;  3HZ4 A;  4O5U A;  4ECB A;  4MZC A;  3F0I A;  4ZBD A;  2R0G A;  2XBQ A;  1GTU A;  2YN1 A;  2H66 A;  3QR6 A;  4O5Q A;  5KN0 A;  2DIZ A;  1ERU A;  4MMM A;  4Z2T A;  3KTB A;  3APQ A;  4XTS A;  4FH8 A;  1EP7 A;  1SJ6 A;  4K2D A;  1K0O A;  3F4R A;  1O81 A;  1F2E A;  5D96 A;  5ECR B;  4FYB A;  3F4S A;  3VUR A;  3I9V 2;  2A4V A;  1K3O A;  4HI7 A;  1WIK A;  2H0I A;  1SD9 A;  1AW9 A;  1DBY A;  4F0B A;  3W6G A;  3ZFB A;  2NDO A;  4CDO A;  1SEN A;  2HYX A;  1K0A A;  5KEJ A;  4FYU A;  1X9M B;  4MPG A;  1XW5 A;  1V57 A;  3WD6 A;  5J41 A;  3UAP A;  3QMX A;  4K2X A;  2N5A A;  3JCM L;  1NSW A;  5IMZ A;  4XRD A;  4X1U A;  4KCE A;  2YPM A;  4Q5F A;  2R5G A;  2HXK A;  3GST A;  2PVO C;  5AIV A;  3FR9 A;  2PBJ A;  3H4K A;  1SK2 A;  1A2M A;  2RM6 A;  2GVP A;  4E8E A;  1YKA A;  2JZS A;  1TP9 A;  2I4A A;  3UEM A;  2VO4 A;  4WBR D;  3J7Y b;  2AB6 A;  3M9J A;  3VFI A;  4POL A;  2X99 A;  1SL0 B;  2FA8 A;  3M0F A;  3KXO A;  1V40 A;  2ON7 A;  3ZIJ A;  3TJB A;  2F9S A;  3F63 A;  2CZ3 A;  1DSB A;  2LJK A;  3TKR A;  2P0G A;  5BMU A;  3GRX A;  2MBT A;  4PTS A;  3I43 A;  5IMA A;  1SU9 A;  4NHW A;  2JAC A;  2C0F A;  2LTK A;  3GTU A;  18GS A;  4LL1 B;  5ID2 A;  3FEU A;  3ISO A;  3CTF A;  2DSA A;  2PVQ A;  2B5Y A;  1ERW A;  3Q6O A;  5LCZ A;  3QAG A;  2GSR A;  2I9H A;  3LW9 A;  2Z9S A;  3L4N A;  1AQX A;  5HR1 A;  3VI7 A;  4X4J A;  3VPT A;  2MZC A;  2O89 A;  3TRX A;  4ZB8 A;  4ZIL A;  4IP6 A;  2C0E A;  4TOP A;  4V2L A;  3EVI A;  2HSH A;  3L0H A;  3H1N A;  2YV7 A;  1LU4 A;  5JWR B;  4HJM A;  4WKW A;  2LQO A;  2YAN A;  5G31 A;  3I6A A;  4KSO A;  1PX7 A;  5G30 A;  4HU9 A;  2IMK A;  3TKP A;  3EMP A;  2FA4 A;  3VWU A;  1VF3 A;  3G9B A;  1Z5Y E;  4MA9 A;  1M99 A;  3PGT A;  1X0R A;  3EWL A;  3IBH A;  4OWY A;  5D8I A;  3IR4 A;  4KDU A;  4MDC A;  1ACV A;  2LNS A;  1HNB A;  5EPF A;  2H0H A;  4J57 E;  2GQM A;  1A2J A;  2FWH A;  5F8B A;  4EIP A;  1TRS A;  5CRH A;  3C73 A;  2GTU A;  2JZR A;  3IK9 A;  4ZL9 A;  1THX A;  4KB3 A;  3UIW A;  3QDN A;  1PL1 A;  1R4W A;  4ID0 A;  3DRN A;  2QA2 A;  3TJF A;  1FAA A;  1OKT A;  1VF2 A;  1Z7R A;  3KP8 A;  3WGE A;  1E6B A;  3C71 A;  5IMD A;  4JBB A;  3TJK A;  4GTU A;  4IN0 A;  3QAW A;  3ME8 A;  4TR1 A;  2QC7 A;  2M46 A;  6GSS A;  5IMV A;  5ECO B;  5DAK B;  4OFM A;  5G1K A;  4DSS B;  5ABR A;  2LS5 A;  4KDY A;  1PL2 A;  4Z2R A;  1SKS B;  1WJK A;  3CRT A;  1TK0 B;  3IE3 A;  4BA7 A;  3WT1 A;  3EMX A;  4I8B A;  1XW6 A;  3IAS 2;  2WUL A;  3O76 A;  4ICY A;  3WT2 A;  1X5C A;  3GV1 A;  4KA0 A;  1PSQ A;  4K0N A;  4NV5 A;  3L9V A;  4OFN A;  5KN2 A;  4WR5 A;  3LYP A;  1FG4 A;  3C8E A;  3AY8 A;  3UJ1 A;  4GQC A;  3P90 A;  2DJ1 A;  1DE1 A;  2FHE A;  5F07 A;  1GLP A;  2CAI A;  4NMU A;  2LEG A;  2M72 A;  4G10 A;  3LXT A;  1WOU A;  2YCD A;  3DGQ A;  5L71 A;  1R7H A;  1YEX A;  4IBP A;  3KIJ A;  2H71 A;  5D93 A;  5CYY A;  3IC8 A;  3CXG A;  4HS1 A;  1R5P A;  4L0U A;  1V9W A;  4MK3 A;  3ZVJ A;  1PKZ A;  5HR0 A;  1GNW A;  3IPZ A;  1K3Y A;  5D73 A;  2YP6 A;  2H1B A;  1XOA A;  4X0X A;  2DC5 A;  3QD9 A;  5IO0 A;  1J0F A;  1OE8 A;  4ILF A;  5E59 A;  1MDI A;  1GSF A;  2HT9 A;  1IYH A;  4JR4 A;  2O85 A;  3UMA A;  1FB0 A;  3ERF A;  2HI7 A;  1FOH A;  1T8E B;  5B6M A;  2X64 A;  1Z6N A;  4N11 A;  1EV4 A;  3GSS A;  1T4Y A;  5B6N A;  2LKU A;  1PRX A;  1GLQ A;  1VGL A;  3FRC A;  4IHU A;  2F8F A;  1PKW A;  2GZZ A;  4KCA A;  2EIR A;  2XC2 A;  4Z7X A;  3KMO A;  2HRF A;  2R3X A;  2RM5 A;  5GAN D;  2FGX A;  4L0W A;  2GT6 A;  1WRY A;  3BOA A;  5CP1 A;  4BVX A;  4MH3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...