1JFUA

Crystal structure of the soluble domain of tlpa from bradyrhizobium japonicum
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
176
structure length
176
Chain Sequence
TGDPACRAAVATAQKIAPLAHGEVAALTMASAPLKLPDLAFEDADGKPKKLSDFRGKTLLVNLWATWCVPCRKEMPALDELQGKLSGPNFEVVAINIDTRDPEKPKTFLKEANLTRLGYFNDQKAKVFQDLKAIGRALGMPTSVLVDPQGCEIATIAGPAEWASEDALKLIRAATG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords THIOL:DISULFIDE INTERCHANGE PROTEIN TLPA
publication title Structure of the soluble domain of a membrane-anchored thioredoxin-like protein from Bradyrhizobium japonicum reveals unusual properties.
pubmed doi rcsb
source organism Bradyrhizobium japonicum
total genus 50
structure length 176
sequence length 176
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08534 Redoxin Redoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1jfuA00
2VLUA 2OBIA 4HU7A 4O92A 2D2ZA 4TR4A 3ISOA 2V6OA 2G2QA 1AC1A 1WE0A 2H01A 1EGRA 3IE3A 3HJOA 4O32A 5IQYA 2LRNA 4YH2A 3P90A 1T7PB 4RQXA 1O81A 1JLWA 1T3BA 3EMPA 3H1NA 5COHA 4IELA 6GSSA 2OE1A 2MMAA 4QQ7A 4DSSA 2VOCA 4HQZA 2DMLA 1A8LA 2CQ9A 1Q4JA 3G7YA 1EWXA 1WJKA 3VK9A 3LYPA 3PH9A 2PERA 2RM6A 5KEJA 1M2AA 4ZBDA 2LNTA 4PGTA 4GSSA 3ZFBA 1FW1A 1V9WA 3WGXA 3EYTA 1XW5A 2V32A 3GUSA 5IM9A 2PVQA 4WEYA 4J56E 4ZILA 1F37A 4GLTA 4AJ8A 4GTUA 3F9UA 1OKDA 11GSA 3TOTA 1JFUA 1PQNA 2PUKC 2ZUPA 2L57A 4IJ3A 4TXOB 20GSA 1M2DA 3RAZA 1G7EA 1ZCPA 1THXA 3O3TA 2HE3A 3QCPA 4HJ2A 3CTGA 3MSZA 1EP8A 1XOBA 1K3YA 2H0GA 5IMVA 3WYWA 5AN1A 1A8YA 2C3QA 2R4VA 4HDEA 2M46A 4EF0A 3KTBA 1XBSA 1PKWA 1FB6A 1FHEA 1G0TA 3FZ4A 4BA7A 5D9XA 2LRTA 1WPIA 4OFMA 1EGOA 2GLRA 2GQLA 4WETA 4MCUA 1DBYA 2FUG2 3HCZA 3IHQA 2WRTA 4OD7A 3EVIA 3SWLA 3DRNA 3E9JB 1BJXA 2F8FA 5IO2A 2DIYA 4EC0A 5D73A 2YP6A 4IGJA 2YPMA 4NAXA 3D5JA 1GTIA 4IVFA 3IOSA 2V6KA 4KUNA 4RQRA 3QMXA 2B5EA 1V57A 3A5WA 4PUAA 3F8UA 4HUAA 3KIJA 4F82A 2CVDA 2WS2A 3ME7A 3UVTA 2ES7A 1AW9A 2YJHA 3LYKA 1SU9A 2QGVA 2X8HA 4DVCA 4F03A 5J41A 2LV3A 2GQKA 3N5OA 3GSSA 1YF1A 2M80A 3VI5A 3I43A 2YZHA 3GYKA 3W8SA 2B7JA 5C04A 3GRXA 1A24A 1F3AA 3TOUA 4EXJA 1KBNA 4HU9A 4V2LA 3M0FA 2I9HA 5J3RA 3IK7A 1EP7A 1YEPA 2R3XA 3ZRDA 4OFTA 4IHUA 4POBA 4AJ6A 4G2EA 4L0UA 4WBJA 3TCOA 2V41A 5GZZB 2PBJA 3GFKA 5DCHA 2IN3A 1F3BA 2WZ9A 4PUFC 3ERFA 1NHOA 2DJJA 2LSTA 3APOA 4MP4A 5J4UA 1ML6A 3APQA 5KN0A 1YKAA 4BPYA 1HYUA 3GN3A 3I69A 2K8SA 1JZOA 5D8IA 4DSRA 2LRCA 1QMVA 2H6XA 3J7Yb 1LJRA 4XHMA 1GL8A 1ERTA 4MZWA 4ACSA 2GTUA 5G2ZA 4NXIA 3HYPA 3TRXA 1GLPA 2JADA 5DALA 5AIXA 2H8LA 2XC2A 3EU3A 3NZNA 3TDGA 1TK5B 1CQGA 1GSFA 3TRPA 1Q98A 2MMNA 2CAIA 2HT9A 2VM1A 4MF7A 3OR5A 4V2MA 2CVBA 4Q5QA 13GSA 3KD0A 2B5YA 5HR3A 2J23A 2L59A 2GGTA 1MD3A 2J9HA 3CXGA 1TI3A 3KMOA 2G0FA 3HVSA 2CAQA 1W89A 2QC7A 2H71A 2P31A 2DBCA 1MDJA 2AHEA 5ECKB 3EMXA 2CV4A 1M9AA 5ID2B 1M0UA 2K18A 4G10A 1RW1A 3ZVJA 2H73A 5DJLA 3LXZA 4FYBA 5B6MA 3F63A 4NHZA 3MDKA 2C0EA 5FHIA 2YJ7A 1GSUA 1A2LA 2VO4A 5HR0A 5DDLA 2K6VA 3K8NA 3NOFA 1OVNA 1ON4A 1SJZA 2VL2A 2PPTA 3P8WA 1O85A 3CRUA 2O7KA 5JCWA 2LJAA 2GDRA 3A2XA 4MK3A 5IIZA 4NHWA 4XCSA 2C0FA 2HSYA 3TJJA 5AIVA 3TKRA 2XPEA 1TRUA 1TP9A 3IAS2 1OC9A 1Z6MA 1TW9A 2DIZA 2HXKA 4K0GA 1I5GA 4KW6A 3IC4A 2NPBA 2BMXA 2B1LA 3I6AA 5KN3A 1FO5A 3DYRA 1XZOA 4KDUA 2VCWA 3GURA 1TTZA 5H5SA 4Q5FA 2FWHA 2I81A 5E59A 3KTLA 3DXBA 2HYXA 1E6BA 4J57E 1O73A 5ECLB 1O8XA 3F3RA 5AISA 1F6MC 1R5AA 2H30A 1PL1A 3V1WA 1NHYA 4OO4A 1Z9HA 1WRYA 4ECJA 1XIYA 4XTSA 1T1VA 5DAKA 2I3YA 3FR9A 3ZL5A 1Y25A 2JSYA 1SL0B 2GS3A 4AF2A 1JHBA 1NM3A 2VLTA 4D73A 4TOPA 1O7UA 1T4ZA 3D0ZA 4N30A 3TKSE 18GSA 3IR4A 2VLVA 1ZMAA 4Z7XA 1XWAA 1X5CA 1MDIA 4FYCA 4V1Ag 3WT2A 4ML6A 4WKWA 1YEXA 2H72A 5CRWA 1A0FA 3QAWA 3FZ9A 3E0UA 3ZREA 1NW2A 2ZCTA 2YV7A 1TU7A 3F6DA 1BX9A 1U3AA 2REMA 3C1RA 5EPFA 3QAVA 2IPAA 5B6NA 1WP0A 2VAFA 3DVXA 4MA9A 2H1BA 2YWOA 3H93A 1KTEA 1THOA 3ZITA 2OBKA 5GSTA 1CQHA 2H1DA 5G1KA 3VWUA 5CAXA 4F2IA 3EU4A 4HS1A 3QOUA 1OYJA 2YN1A 3GIXA 5HQPA 22GSA 2B1KA 4HZ4A 5E4WA 1HQOA 2R2JA 3HD5A 3WD6A 2GVPA 2YANA 2VD1A 1BYEA 5HFIA 1A2JA 1HNBA 4Q5NA 3P7XA 4HOJA 8GSSA 2MBSA 2EIQA 2PVOC 3VI7A 3BCIA 2KP2A 2NTOA 2AAWA 1S3AA 3QFAC 5J9BA 4N10A 1XWGA 2TRCP 2C80A 17GSA 4YQMA 1SJ6A 2WCIA 2HNLA 2YCDA 2TRXA 2K9FA 1N8JA 1SYXA 1PRXA 1Z6NA 4NV5A 1UVZA 2X8GA 1K0DA 3F6FA 3H8QA 2ZNMA 1K3OA 1XCCA 2A4VA 1SYRA 2K8VA 1R4WA 3BD2A 3IXRA 1EZKA 2N5AA 1GLQA 4ECIA 1SK2A 4I5QA 5DCGA 2LQQA 4L5LA 5DBQA 2LS5A 3NIVA 4LMVA 2C0GA 1XWKA 1SL1B 4OCFA 2QSIA 1PSQA 2IWTA 3PR8A 2RLIA 3H4KA 1U88A 2BTOT 3IK9A 3C71A 1VRSD 2X64A 2KOKA 1SK1A 3GL3A 3UBKA 1VGLA 1HD2A 2YNXA 3GL5A 5JWOB 1ACVA 3QPMA 2MYGA 5IPHA 4JE1A 4OCEA 1PL2A 4IBPA 4TR0A 2HZEA 2JU5A 4WF4A 3GKMA 1YZXA 1X9WB 1GWCA 2JZRA 2VM2A 4WR5A 4ZL9A 3US3A 4KAEA 5GAPD 2A2RA 4AGSA 1HNCA 5ELGA 3TGZA 4KCEA 1K0OA 1VF3A 2FNOA 1K3LA 4ULXA 4TR1A 2YWIA 3CSIA 3D4MA 3BOAA 4EDZA 1BAYA 3FEUA 1FVKA 5LCZA 2IFQA 4XS4A 2B5XA 3P2AA 2VL9A 3FR3A 5CREA 3FYGA 2NVLA 5J9CA 1J08A 1T00A 3PINA 1B48A 2XHFA 2H6ZA 2GSTA 1E2YA 3E3EA 3UIWA 2P0GA 4ZL8A 3UBLA 1OC3A 3RPPA 3UMAA 2WDUA 1YJ6A 2F51A 2H66A 2FA4A 3GKXA 3PGTA 1FG4A 4DSSB 3GKNA 2N5BA 2H19A 5ELAA 4JZQA 3FY7A 3EURA 2DJ2A 4K7OA 3W6GA 3G9BA 2YZUA 2XBIA 3EWLA 12GSA 1M7TA 3CSJA 1U6TA 1AQXA 4OMVA 2KP1A 4JU5A 3TUEA 3ERWA 4QL7A 4X0XA 4MF6A 2JZSA 1HNAA 3ED3A 3M9JA 3IBHA 2O8VB 1QGVA 3A3TA 1R5PA 3KM6A 1FB0A 1F9MA 3S9FA 3GNJA 2DLXA 4DSQA 5G30A 2L4CA 1JLVA 2L4QA 4FIWA 2PN8A 3O76A 1ZYQB 3LSZA 1UC7A 4BWQA 1ERVA 4K0NA 2CZ3A 1OE7A 1WOUA 5AGYA 5IOXA 1QUWA 3C73A 5FWGA 4NPBA 5A4WA 4MJAA 3FR6A 3ZIJA 2V1MA 5ECOB 5EL8A 2R37A 1V40A 3SBCA 2IMKA 4PQIA 1ERWA 4RI6A 1SL2B 2YOIA 1TKDB 5B8AA 3GSTA 4ECBA 3GV1A 2IFQB 3EE2A 5D9WA 1NSWA 2OJLA 4HJMA 2F8AA 2C0DA 2R5GA 4JEDA 3HDCA 1XWCA 2VCQA 1QFNA 5ECSA 4TVEA 4POMA 1TI1A 4YQVA 1TDIA 3IPZA 3KEBA 2QKEA 3GA4A 4BWSA 4N11A 4BVYA 3AY8A 3F4TA 4IJIA 1LU4A 2F3MA 5D93A 3D22A 3ZZXA 1K0MA 4MF5A 1OC8A 2FWEA 2FGXA 1J0FA 1GRXA 4YAVA 1ZGNA 3G7IA 4TRXA 2DC5A 5CO3A 1X5EA 3TRQA 1ILOA 3TKSC 1TRWA 2FY6A 3M3MA 2DJKA 3ME8A 4PNGA 1QK8A 2PMTA 3QAGA 4ECCA 2H1AA 2H0HA 1GNEA 4NV2A 4I2UA 3DEXA 4ID0A 2LQOA 5KN1A 19GSA 3GH6A 4GWRA 5B8BA 5IOWA 3GHAA 1TU8A 4ZXGA 1XVWA 3ZIVA 4EO3A 1ST9A 3U5RE 3VLNA 2E2GA 2E2MA 2PU9C 1PN9A 1V58A 1C72A 5CRHA 4GSTA 4X43A 3L78A 2H74A 3KP8A 4K1FA 2O89A 4JR6A 2HFDA 3R2QA 1PX6A 3KZQA 2JZTA 1T4YA 4MPFA 3MAKA 1S3CA 4TN8A 3U6VA 1KEBA 3DMLA 4F0BA 1A2MA 1F2EA 2WGRA 3JCML 3L4NA 3RPNA 1O8WA 5DALB 2VCTA 1T8EB 2I1UA 1AXDA 2KHPA 5ECHB 2HI7A 1S3DA 1DE1A 1SENA 5ECMB 1GH2A 1QQ2A 4KX4A 3I9V2 3J7Yk 3TKPA 2F9SA 3QDNA 4G9HA 1U3IA 5KN2A 2GQMA 3CSHA 1WWJA 3HZ8A 4ZBBA 1ABAA 1VF4A 1SKWB 4KA0A 1GTBA 3M1GA 2MMZA 5ABRA 2JACA 3LG6A 4K9ZA 3WGEA 4MJCA 3FRCA 1RK4A 3RHCA 2CX3A 1X9MB 3BCKA 4XIHA 4LMWA 2HSHA 4LLRA 2MBTA 3LORA 4EUYA 2C3NA 2OA7A 5JCGA 1XVQA 1GP1A 1OKTA 16GSA 4KH7A 3LJRA 2L6DA 3FW2A 3GKKA 1PA3A 5A4VA 4POKA 1ERUA 3IDVA 1Z3EA 1W4VA 5D9VA 3UJ1A 4L8EA 1DE2A 1OC9B 2MMOA 3MWHA 4YQUA 5ECRB 1TXXA 1MD4A 1GUMA 4JBBA 4O7HA 2H70A 5F05A 1G7OA 2IJYA 2FHEA 1B9YC 3CRTA 3FKFA 4TXOA 2E0QA 4JRRA 5JCUA 4MMMA 4JR4A 4PXOA 1B4PA 3IV4A 4IW9A 4XRDA 1EV4A 2GT5A 1FOVA 3ZTLA 2HZFA 4L0WA 1FVJA 4HQSA 2CT6A 3VWXA 4ZIJA 2GT6A 3Q19A 3KJYA 1YF0A 3KGKA 1WMJA 5A4UA 3RBTA 4ZB6A 2DJ0A 3QD9A 1USBA 4RI7A 3F3QA 4CW9A 5DAKB 1X9SB 2B3SA 6GSUA 4NMUA 1EV9A 4ZB9A 1Z7RA 3BJ5A 5ECIB 2RM5A 4D73B 5ECNB 1PD21 3HZ4A 5H5RA 3DKSA 1OE8A 4V1Ap 5JWRB 2IMDA 4IN0A 2VIMA 4YAPA 3TJGA 3LGCA 5D96A 2EIRA 2LEGA 1BEDA 4K7IA 4MH3A 4BL7A 1G6YA 1V2AA 1K0NA 6GSTA 2FWGA 4POLA 3MNGA 4CDOA 3CMIA 2VUPA 2LJKA 3UEMA 2CVKA 1SKSB 2X8CA 1TRSA 1EOGA 4E8HA 2NDOA 3D4TA 1PX7A 1AUCA 4PQ1A 4E8EA 4GF0A 4I2TA 3TJFA 1DUGA 5D9TA 2HLSA 2C4JA 1GTUA 3DVWA 1ZYEA 3EC3A 4WF5A 2B7KA 1XOAA 1YKCA 2FD3A 1AIUA 1GSSA 1XW6A 2EC4A 2YV9A 2LTKA 1JZDA 3TJKA 2O85A 3O6TA 1H75A 1RQMA 1VF1A 2CX4A 3HY2A 5G1LA 2CZ2A 4HEA2 3CYNA 3FHKA 4KSOA 2P5QA 3TJBA 5GSSA 2B6MA 4KDXA 5INYA 2E7PA 3LEFA 4OFNA 1IYIA 4KDYA 3RHBA 1TJDA 3L9SA 2IMEA 1YY7A 4MJEA 4KNDA 5IMZA 5LD0A 4RUVA 4IP1A 3TKSA 1GUHA 3LFLA 2DSAA 5HFGA 4O5RA 1EEJA 2OE0A 1XXUA 3DWVA 6GSWA 3VPQA 3KH9A 1GULA 5HR1A 2DJ1A 2M72A 4K2DA 1SK0A 4WBRD 4IKHA 1XWBA 3N9JA 4MPGA 5ENUA 4GCIA 5CNWA 3VWVA 4H86A 2LUSA 4P3YB 3D21A 3Q74A 1BQ7A 3KMNA 1MDKA 3RDWA 2GSQA 1R7HA 2MZCA 2R6KA 2KUCA 1FAAA 2C8UA 4K6XA 3CBUA 2JSZA 3IAM2 2JL4A 4X1UA 2LNSA 3ERGA 3UOMA 5GAND 1PMTA 2IMIA 4XS1A 1AQVA 5CYYA 3ZVJD 4MLYA 3F4SA 5B7CA 4KSMA 2OADA 2GZPA 2L6CA 3VWWA 1X0RA 1YDKA 3KCMA 3GX0A 3UL3A 4ILFA 3QFBC 3FZAA 2HZEB 2VCVA 1J9BA 1B4QA 2RUEA 3M9KA 4K8MA 5IMDA 2H76A 4G19A 4PNFA 3M8NA 2YWNA 2YWMA 2EIOA 3KP9A 4IP6A 2H6YA 3L9VA 5IMAA 5CP1A 1UA5A 3G7JA 4I6XA 4GRFA 4F0CA 2DMMA 3F0IA 4TW5A 5ID2A 3TKQA 4KB3A 1K0BA 1BG5A 1YQ1A 3ZMKA 3IA1A 2O87A 4EDYA 1GSQA 3A2VA 3UVHA 4MZCA 3APSA 5DVBA 5DJMA 1B8XA 4TR1B 2GSSA 3WGDA 4PX1A 2IIYA 5F06A 1SKRB 3ZFLA 1G6WA 1SJIA 1AAZA 4XS4B 1ZL9A 4L5OA 1K0AA 3LQ7A 4GSNA 2OACA 2WB9A 1Y6EA 2FWFA 4FH8A 2AV4A 2ON7A 1GNWA 5G5EA 4J2FA 2FLSA 4ZL7A 1OAZA 1GTAA 3C1SA 2I4AA 3GX8A 1JZRA 3L9UA 6GSVA 2AYTA 3GTUA 2RUFA 5DQYA 1M9BA 1XPVA 1N2AA 4ZBAA 2WFCA 1GSDA 3HJMA 4MJBA 2C3TA 3GMFA 1XFLA 4XRAA 5IMFA 9GSSA 5A5KA 4TR3A 2H0IA 3CTFA 3Q6OA 1MTCA 3D6IA 4Q5RA 1VF2A 3HJPA 2KLXA 2P5RA 3QR6A 1QXHA 1URMA 1SD9A 2AB6A 3A2WA 3DGQA 1DSBA 3FZ5A 4TXVA 2FCHA 4GQCA 2FA8A 3WT1A 1ZZYA 5CRDA 5HR2A 4QL9A 2PGTA 3HKRA 2WULA 1B9XC 3VFIA 5ECQB 4IQ1A 1JZWA 4HI7A 2X99A 1V98A 5DQSA 5IPGA 1M99A 4LL4B 3EINA 5IO0A 4ML1A 3DD3A 1GSYA 5G5FA 4TKYA 3ZMLA 4MDCA 2GZYA 5L71A 4KE3A 5J5NA 2VCZA 6GSYA 2BJXA 3H79A 1MEKA 3ZYWA 1A0RP 3C8EA 3L0HA 4GQFA 2ON5A 1EEMA 4WXTA 1I9DA 3W8JA 4IS0A 4BVXA 4CHSA 5F8BA 4NWYA 2VCXA 2TIRA 1TK8B 3DIEA 3VURA 1TOFA 2DJ3A 3UARA 1O6JA 3GTUB 3KH7A 1TRVA 2ALBA 1GUKA 2H1GA 3KXOA 5HFKA 2AJQB 4N0ZA 6GSXA 4OWYA 1M2BA 2H75A 4IQAA 4AJ7A 4FO5A 2VD0A 2HRNA 4KCAA 4PURA 3IRAA 2XPDA 2C1YA 1AQWA 1K0CA 2V2GA 4XS6A 3GH9A 3ZLPA 1U87A 5LNKe 3LXTA 1XW9A 5G31A 5IMCA 4ISDA 2VL3A 7GSSA 1ZOFA 4LL1B 3TB2A 1GSEA 1KNGA 2HRFA 3F4RA 5F07A 3FK8A 1UN2A 5H5QA 2L5OA 2N5FA 1SD8A 5FT3A 3HVXA 4GXZA 1X5DA 1Z7PA 2IMFA 4MZBA 2LKUA 4K7NA 2Z9SA 2IL3A 4I8BA 3VPTA 4MABA 4I97A 2XBQA 4EVMA 4EE0A 2PWJA 4MH2A 4KGIA 3UAPA 3C7MA 5EVOA 1A23A 2WJUA 4OO5A 4HZ2A 4EL1A 4WR4A 4LA1A 2RIIA 5CRGA 2NBSA 4PQHA 5ECPB 4EKZA 5C00A 3LWAA 1R26A 3HXSA 2OE3A 5JWQB 4ZB8A 2GSRA 3HHVA 3HA9A 1LBKA 3HVVA 4F9ZA 4DEJA 14GSA 1TK0B 2LJRA 4N0VA 4V2NA 2CA8A 1IYHA 1EOHA 5F0GA 1PGTA 2A2SA 1H4OA 2AUVA 1PKZA 2OKAA 5EY6A 4FYUA 2VL2C 10GSA 3Q18A 3BBYA 1WIKA 1Z5YE 2GZZA 2L5LA
chains in the Genus database with same CATH superfamily
4Z2RA 2VLUA 2OBIA 4HU7A 4O92A 2D2ZA 4TR4A 3ISOA 2V6OA 2G2QA 1AC1A 4G0LA 1WE0A 2H01A 1EGRA 3IE3A 3HJOA 4O32A 5IQYA 2LRNA 4YH2A 3P90A 1T7PB 4RQXA 1O81A 1JLWA 1T3BA 3EMPA 3H1NA 5COHA 4IELA 6GSSA 2OE1A 2MMAA 4QQ7A 4DSSA 2VOCA 4HQZA 2DMLA 1A8LA 2CQ9A 1Q4JA 3G7YA 1EWXA 1WJKA 3VK9A 3LYPA 3PH9A 2PERA 2RM6A 4A5PA 2UZ8A 5KEJA 1M2AA 4ZBDA 2LNTA 4PGTA 4GSSA 3ZFBA 1FW1A 1V9WA 3WGXA 3EYTA 1XW5A 2V32A 3GUSA 5IM9A 2PVQA 4WEYA 4J56E 4ZILA 1F37A 4GLTA 4AJ8A 4GTUA 3F9UA 1OKDA 11GSA 3TOTA 1JFUA 1PQNA 2PUKC 2ZUPA 2L57A 4IJ3A 4TXOB 4Z2UA 20GSA 1M2DA 3RAZA 1G7EA 1ZCPA 1THXA 3O3TA 2HE3A 3QCPA 4HJ2A 3CTGA 3MSZA 1EP8A 1XOBA 1K3YA 2H0GA 5IMVA 3WYWA 5AN1A 1A8YA 2C3QA 2R4VA 4HDEA 2M46A 4EF0A 3KTBA 1XBSA 1PKWA 1FB6A 1FHEA 4ICYA 1G0TA 3FZ4A 4BA7A 5D9XA 2LRTA 1WPIA 4OFMA 1EGOA 2GLRA 2GQLA 4WETA 4MCUA 1DBYA 2FUG2 3HCZA 3IHQA 4CY6A 2WRTA 4OD7A 3EVIA 3SWLA 3DRNA 3E9JB 1BJXA 2F8FA 1M3JA 5IO2A 2DIYA 4EC0A 5D73A 2YP6A 4IGJA 2YPMA 4NAXA 3D5JA 1GTIA 4IVFA 4BL7B 3IOSA 3PPUA 2A4HA 2V6KA 4KUNA 4RQRA 3QMXA 2B5EA 3MYDA 5KOWA 1V57A 3A5WA 4PUAA 3F8UA 4HUAA 3KIJA 4F82A 2CVDA 2WS2A 3ME7A 4CY8A 3UVTA 2ES7A 1AW9A 2YJHA 3LYKA 1SU9A 2QGVA 2X8HA 4DVCA 4F03A 5J41A 2LV3A 2GQKA 3N5OA 3GSSA 1YF1A 2M80A 3VI5A 3I43A 2YZHA 3GYKA 3W8SA 2B7JA 5C04A 3GRXA 1A24A 1F3AA 3TOUA 4EXJA 1KBNA 2R0PA 4HU9A 4V2LA 3M0FA 2I9HA 5J3RA 3IK7A 1EP7A 1YEPA 2R3XA 3ZRDA 4OFTA 4IHUA 4POBA 4AJ6A 4G2EA 4L0UA 4WBJA 3TCOA 2V41A 5GZZB 5BMUA 2PBJA 3GFKA 5DCHA 2IN3A 1F3BA 2WZ9A 4PUFC 3ERFA 1NHOA 2DJJA 2LSTA 3APOA 4MP4A 5J4UA 1ML6A 3APQA 5KN0A 1YKAA 4BPYA 1HYUA 3GN3A 3I69A 2K8SA 1JZOA 5D8IA 4DSRA 2LRCA 1QMVA 2H6XA 3J7Yb 1LJRA 4XHMA 1GL8A 1ERTA 4MZWA 4ACSA 2GTUA 5G2ZA 4NXIA 3HYPA 3TRXA 1GLPA 2JADA 2R0CA 5DALA 2H8LA 5AIXA 2XC2A 3EU3A 4O5QA 3NZNA 3TDGA 1TK5B 1CQGA 1GSFA 3TRPA 1Q98A 2MMNA 2CAIA 1ZYPA 2HT9A 2VM1A 4MF7A 3OR5A 4V2MA 2CVBA 4Q5QA 13GSA 3KD0A 2B5YA 5HR3A 4K5RA 2J23A 2L59A 2GGTA 1MD3A 2J9HA 3CXGA 1TI3A 3KMOA 2G0FA 3HVSA 2CAQA 1W89A 2QC7A 2H71A 2P31A 2DBCA 1MDJA 2AHEA 5ECKB 3EMXA 2CV4A 1M9AA 5ID2B 1M0UA 2K18A 4G10A 1RW1A 3ZVJA 2H73A 5DJLA 3LXZA 4FYBA 5B6MA 3F63A 4NHZA 3MDKA 2C0EA 5FHIA 2YJ7A 1GSUA 1A2LA 2VO4A 5HR0A 5DDLA 2K6VA 3K8NA 3NOFA 1OVNA 1ON4A 1SJZA 2VL2A 2PPTA 3P8WA 1O85A 3CRUA 2O7KA 5JCWA 2LJAA 2GDRA 2QA1A 1ZYNA 3A2XA 4MK3A 5IIZA 4NHWA 4XCSA 2C0FA 2HSYA 3TJJA 5AIVA 3TKRA 2XPEA 1TRUA 1TP9A 3IAS2 1OC9A 1Z6MA 1TW9A 3EPTA 2DIZA 2HXKA 4K0GA 1I5GA 4KW6A 3IC4A 2NPBA 2BMXA 2B1LA 3I6AA 5KN3A 1FO5A 3DYRA 1XZOA 4KDUA 2VCWA 3GURA 1TTZA 5H5SA 4Q5FA 2FWHA 2I81A 5E59A 3KTLA 4BIKA 3DXBA 2HYXA 1E6BA 4J57E 1O73A 5ECLB 1O8XA 3F3RA 5AISA 1F6MC 1R5AA 2H30A 1PL1A 3V1WA 1NHYA 4OO4A 1Z9HA 1WRYA 4ECJA 1XIYA 4XTSA 1T1VA 5DAKA 2I3YA 3FR9A 3ZL5A 1Y25A 2JSYA 1SL0B 2GS3A 4AF2A 1JHBA 1NM3A 2VLTA 4D73A 4TOPA 1O7UA 1T4ZA 3D0ZA 4N30A 3TKSE 18GSA 3IR4A 2VLVA 1ZMAA 4Z7XA 1XWAA 1X5CA 1MDIA 4FYCA 4V1Ag 3WT2A 4ML6A 4WKWA 1YEXA 2H72A 5CRWA 1A0FA 3QAWA 3FZ9A 3E0UA 3ZREA 1NW2A 2ZCTA 2YV7A 1TU7A 3F6DA 1BX9A 1U3AA 2REMA 3C1RA 5EPFA 3QAVA 2IPAA 5B6NA 1WP0A 2VAFA 3DVXA 4MA9A 2H1BA 2YWOA 3H93A 1KTEA 4BVXB 1THOA 3ZITA 2OBKA 5GSTA 1CQHA 2H1DA 5G1KA 3VWUA 5CAXA 4F2IA 3EU4A 4HS1A 3QOUA 1OYJA 2YN1A 3GIXA 5HQPA 22GSA 2B1KA 4HZ4A 5E4WA 1HQOA 2R2JA 3HD5A 3WD6A 2GVPA 2YANA 2VD1A 1BYEA 5HFIA 3FMWA 1A2JA 1HNBA 4Q5NA 3P7XA 4HOJA 8GSSA 2MBSA 2EIQA 2PVOC 3VI7A 3BCIA 2KP2A 2NTOA 2AAWA 1S3AA 3QFAC 5J9BA 4N10A 1XWGA 2TRCP 2C80A 17GSA 4YQMA 1SJ6A 2WCIA 2HNLA 2YCDA 2TRXA 2K9FA 1N8JA 1SYXA 1PRXA 1Z6NA 4NV5A 1UVZA 2X8GA 1K0DA 3F6FA 3H8QA 2ZNMA 1K3OA 1XCCA 2A4VA 1SYRA 2K8VA 1R4WA 3BD2A 3IXRA 4EIQA 1EZKA 2N5AA 1GLQA 4ECIA 1SK2A 4I5QA 5DCGA 2LQQA 4L5LA 4YKGA 5DBQA 2LS5A 3NIVA 3CQFA 4LMVA 2C0GA 1XWKA 1SL1B 4OCFA 2QSIA 1PSQA 2IWTA 3PR8A 2RLIA 3H4KA 1U88A 2BTOT 3IK9A 3C71A 1VRSD 2X64A 2KOKA 1SK1A 3GL3A 3UBKA 1VGLA 1HD2A 2YNXA 3GL5A 5JWOB 1ACVA 3QPMA 2MYGA 5IPHA 4JE1A 4OCEA 1PL2A 4IBPA 4TR0A 2HZEA 2JU5A 4WF4A 3GKMA 1YZXA 1X9WB 1GWCA 2JZRA 2VM2A 1M3IA 4WR5A 4ZL9A 3US3A 4KAEA 5GAPD 2A2RA 4AGSA 1HNCA 5ELGA 3TGZA 4KCEA 1K0OA 1VF3A 2FNOA 1K3LA 4ULXA 4TR1A 2YWIA 3CSIA 3D4MA 3BOAA 4EDZA 1BAYA 3FEUA 1FVKA 5LCZA 3IHGA 2IFQA 4XS4A 2B5XA 3P2AA 2VL9A 3FR3A 4MNNA 5CREA 3FYGA 2NVLA 5J9CA 1J08A 1T00A 3PINA 1B48A 2XHFA 2H6ZA 2GSTA 1E2YA 3E3EA 3UIWA 2P0GA 4ZL8A 3UBLA 1OC3A 3RPPA 3UMAA 2WDUA 1YJ6A 2F51A 2H66A 2FA4A 3GKXA 3PGTA 1FG4A 4DSSB 3GKNA 2N5BA 2H19A 5ELAA 4JZQA 3FY7A 3EURA 2DJ2A 4K7OA 3W6GA 3G9BA 2YZUA 2XBIA 3EWLA 12GSA 1M7TA 3CSJA 1U6TA 1AQXA 4OMVA 2KP1A 4JU5A 3TUEA 3ERWA 4QL7A 4X0XA 4MF6A 2JZSA 1HNAA 3ED3A 3M9JA 3IBHA 2O8VB 1QGVA 4K5SA 3A3TA 1R5PA 3KM6A 1FB0A 1F9MA 3S9FA 3GNJA 2DLXA 4DSQA 5G30A 2L4CA 1JLVA 2L4QA 4FIWA 2PN8A 3O76A 1ZYQB 3LSZA 1UC7A 4BWQA 1ERVA 4K0NA 2CZ3A 1OE7A 3MIXA 1WOUA 5AGYA 5IOXA 1QUWA 3C73A 5FWGA 4NPBA 5A4WA 4MJAA 3FR6A 3ZIJA 2V1MA 5ECOB 5EL8A 2R37A 1V40A 3SBCA 2IMKA 4PQIA 1ERWA 4RI6A 1SL2B 2YOIA 1TKDB 5B8AA 3GSTA 4ECBA 3GV1A 2IFQB 3EE2A 5D9WA 1NSWA 2OJLA 4HJMA 2F8AA 2C0DA 2R5GA 4JEDA 3HDCA 1XWCA 2VCQA 1QFNA 5ECSA 4TVEA 4POMA 1TI1A 4YQVA 1TDIA 3IPZA 3KEBA 2QKEA 3GA4A 4BWSA 4N11A 4BVYA 3AY8A 3F4TA 4IJIA 1LU4A 2F3MA 5D93A 3D22A 2QA2A 3ZZXA 1K0MA 4MF5A 1OC8A 5KOXA 2FWEA 2FGXA 1J0FA 1GRXA 4YAVA 1ZGNA 3G7IA 4TRXA 2DC5A 5CO3A 1X5EA 3TRQA 1ILOA 3TKSC 1TRWA 2FY6A 3M3MA 2DJKA 3ME8A 4PNGA 1QK8A 2PMTA 3QAGA 4ECCA 2H1AA 2H0HA 4NV2A 1GNEA 4I2UA 3DEXA 4ID0A 2LQOA 5KN1A 19GSA 3GH6A 4GWRA 5B8BA 5IOWA 3GHAA 1TU8A 4ZXGA 1XVWA 3ZIVA 4EO3A 1ST9A 3U5RE 4EIPA 4FQUA 3VLNA 2E2GA 2E2MA 2PU9C 1PN9A 1V58A 1C72A 5CRHA 4GSTA 4X43A 3L78A 2H74A 3KP8A 4K1FA 2O89A 4JR6A 2HFDA 3R2QA 1PX6A 3KZQA 2JZTA 1T4YA 4MPFA 3MAKA 1S3CA 4X4JA 4TN8A 3U6VA 1KEBA 3DMLA 4F0BA 1A2MA 1F2EA 2WGRA 3JCML 3L4NA 3RPNA 1O8WA 5DALB 2VCTA 1T8EB 2I1UA 1AXDA 2KHPA 5ECHB 2HI7A 1S3DA 4BVYB 1DE1A 1SENA 5ECMB 1GH2A 1QQ2A 4KX4A 3I9V2 3J7Yk 3TKPA 2F9SA 3QDNA 4G9HA 1U3IA 5KN2A 2GQMA 3CSHA 1WWJA 3HZ8A 4ZBBA 1ABAA 3LW9A 1VF4A 1SKWB 4KA0A 1GTBA 3M1GA 2MMZA 5ABRA 2JACA 3LG6A 4K9ZA 3WGEA 4MJCA 3FRCA 1RK4A 4YKFA 3RHCA 2CX3A 1X9MB 3BCKA 4XIHA 4LMWA 1PN0A 2HSHA 4LLRA 2MBTA 3LORA 4EUYA 2C3NA 2OA7A 5JCGA 1XVQA 1GP1A 1OKTA 4KF9A 16GSA 4KH7A 3LJRA 2L6DA 3FW2A 3GKKA 1PA3A 5A4VA 4POKA 1ERUA 2DKIA 3IDVA 1Z3EA 1W4VA 5D9VA 3UJ1A 4L8EA 1DE2A 1OC9B 2MMOA 3MWHA 4YQUA 5ECRB 1TXXA 1MD4A 1GUMA 4JBBA 4O7HA 2H70A 5F05A 1G7OA 2IJYA 2FHEA 1B9YC 3CRTA 4HSCX 3FKFA 4TXOA 2E0QA 4JRRA 5JCUA 4MMMA 4JR4A 4PXOA 1B4PA 3IV4A 4IW9A 4XRDA 1EV4A 2GT5A 1FOVA 3ZTLA 2HZFA 4L0WA 1FVJA 4PTSA 4HQSA 2CT6A 3VWXA 4ZIJA 2GT6A 3Q19A 3KJYA 1YF0A 4G0KA 3KGKA 1WMJA 5A4UA 3RBTA 4ZB6A 2DJ0A 3QD9A 1USBA 4RI7A 3F3QA 4CW9A 5DAKB 1X9SB 2B3SA 6GSUA 4NMUA 2HRKA 1EV9A 4ZB9A 1Z7RA 3BJ5A 5ECIB 2RM5A 4D73B 5ECNB 1PD21 3HZ4A 5H5RA 3DKSA 1OE8A 4V1Ap 5JWRB 1S3RA 2IMDA 4IN0A 2VIMA 4YAPA 3TJGA 3LGCA 5D96A 2EIRA 2LEGA 1BEDA 4K7IA 4MH3A 4BL7A 1G6YA 1V2AA 1K0NA 6GSTA 2FWGA 4POLA 3MNGA 4CDOA 3CMIA 2VUPA 2A2PA 2LJKA 3UEMA 2CVKA 1SKSB 2X49A 2X8CA 1TRSA 1EOGA 4E8HA 2R0GA 2NDOA 3D4TA 1PX7A 1AUCA 4PQ1A 4E8EA 4GF0A 4I2TA 3TJFA 1DUGA 5D9TA 2HLSA 2C4JA 1GTUA 3DVWA 1ZYEA 3EC3A 4WF5A 2B7KA 1XOAA 1YKCA 2FD3A 1AIUA 1GSSA 1XW6A 2EC4A 2YV9A 2LTKA 1JZDA 3TJKA 2O85A 3O6TA 1H75A 1RQMA 1VF1A 2CX4A 3HY2A 5G1LA 2CZ2A 4HEA2 3IC8A 3CYNA 3FHKA 4KSOA 2P5QA 3TJBA 5GSSA 2B6MA 4KDXA 5INYA 2E7PA 3LEFA 4OFNA 1IYIA 4KDYA 3RHBA 1TJDA 3L9SA 2IMEA 1YY7A 4MJEA 4KNDA 5IMZA 5LD0A 4RUVA 4IP1A 3TKSA 1GUHA 3LFLA 2DSAA 1XG8A 4K2XA 2DKHA 5HFGA 4O5RA 1EEJA 2OE0A 1XXUA 3DWVA 6GSWA 3VPQA 3KH9A 1GULA 5HR1A 2DJ1A 2M72A 2X4AA 4K2DA 1SK0A 4WBRD 4IKHA 1XWBA 3N9JA 4MPGA 5ENUA 4GCIA 5CNWA 3VWVA 4H86A 2LUSA 4P3YB 3D21A 3Q74A 1BQ7A 3KMNA 1MDKA 3RDWA 2GSQA 1R7HA 2MZCA 2R6KA 2KUCA 1FAAA 2C8UA 4K6XA 3CBUA 2JSZA 3IAM2 2JL4A 4X1UA 2LNSA 3ERGA 3UOMA 5GAND 1PMTA 2IMIA 4XS1A 1AQVA 5CYYA 3ZVJD 4MLYA 3F4SA 5B7CA 4KSMA 2OADA 2GZPA 2L6CA 3VWWA 1X0RA 1YDKA 3KCMA 3GX0A 3UL3A 4ILFA 3QFBC 3FZAA 2HZEB 2VCVA 1J9BA 1B4QA 2RUEA 3M9KA 4K8MA 5IMDA 2H76A 4G19A 4PNFA 3M8NA 3R3EA 2YWNA 2YWMA 2EIOA 3KP9A 4IP6A 2H6YA 3L9VA 5IMAA 5CP1A 1UA5A 3G7JA 4I6XA 4GRFA 4F0CA 2DMMA 3F0IA 4TW5A 5ID2A 3TKQA 4KB3A 1K0BA 1BG5A 1YQ1A 3ZMKA 3IA1A 2O87A 4EDYA 1GSQA 3A2VA 3UVHA 2HRAA 4MZCA 3APSA 5DVBA 5DJMA 1B8XA 4TR1B 2GSSA 3WGDA 4PX1A 2IIYA 5F06A 1SKRB 3ZFLA 1G6WA 1SJIA 1AAZA 4XS4B 1ZL9A 4L5OA 1K0AA 3LQ7A 4GSNA 2OACA 2WB9A 1Y6EA 2FWFA 4FH8A 2HSMA 2AV4A 2ON7A 5BRTA 1GNWA 5G5EA 4J2FA 2FLSA 4ZL7A 1OAZA 1GTAA 3C1SA 2I4AA 3GX8A 1FOHA 1JZRA 3L9UA 6GSVA 2AYTA 3GTUA 2RUFA 5DQYA 1M9BA 1XPVA 1N2AA 4ZBAA 2WFCA 1GSDA 3HJMA 4MJBA 2C3TA 3GMFA 1XFLA 4XRAA 5IMFA 9GSSA 5A5KA 4TR3A 2H0IA 3CTFA 3Q6OA 1MTCA 3D6IA 4Q5RA 1VF2A 3HJPA 2KLXA 2P5RA 3QR6A 1QXHA 1URMA 1SD9A 2AB6A 3A2WA 3DGQA 1DSBA 3FZ5A 4TXVA 2FCHA 4GQCA 2FA8A 3WT1A 1ZZYA 5CRDA 5HR2A 4QL9A 2PGTA 3HKRA 2WULA 1B9XC 3VFIA 5ECQB 4IQ1A 1JZWA 4HI7A 2X99A 1V98A 5DQSA 5IPGA 1M99A 4LL4B 3EINA 5IO0A 4ML1A 3A5IA 3DD3A 1GSYA 5G5FA 4TKYA 3ZMLA 4MDCA 2GZYA 5L71A 4KE3A 5J5NA 2VCZA 6GSYA 2BJXA 3H79A 1MEKA 3ZYWA 1A0RP 3C8EA 3L0HA 4GQFA 2ON5A 3HVNA 1EEMA 4WXTA 1I9DA 3W8JA 4IS0A 4BVXA 4CHSA 5F8BA 4NWYA 2VCXA 2TIRA 1TK8B 3DIEA 3VURA 1TOFA 2DJ3A 3UARA 1O6JA 3GTUB 1PFOA 3KH7A 1TRVA 2ALBA 1GUKA 2H1GA 3KXOA 5HFKA 2AJQB 4N0ZA 6GSXA 4OWYA 1M2BA 2H75A 4IQAA 4O5UA 4AJ7A 4FO5A 2VD0A 2HRNA 4KCAA 4PURA 3IRAA 2XPDA 2C1YA 1AQWA 1K0CA 2V2GA 4XS6A 3GH9A 3ZLPA 1U87A 5LNKe 3LXTA 1XW9A 5G31A 5IMCA 4ISDA 2VL3A 7GSSA 1ZOFA 4LL1B 3TB2A 1GSEA 1KNGA 2HRFA 3F4RA 5F07A 3FK8A 1UN2A 5H5QA 2L5OA 2N5FA 1SD8A 5FT3A 3HVXA 4GXZA 1X5DA 1Z7PA 2IMFA 4MZBA 2LKUA 4K7NA 2Z9SA 2IL3A 4I8BA 3VPTA 4MABA 4I97A 4Z2TA 2XBQA 4EVMA 4EE0A 2PWJA 4MH2A 4KGIA 3UAPA 3C7MA 5EVOA 1A23A 2WJUA 4OO5A 4HZ2A 4EL1A 4WR4A 4LA1A 2RIIA 5CRGA 2NBSA 4PQHA 5ECPB 4EKZA 5C00A 3LWAA 1R26A 3HXSA 2OE3A 5JWQB 4ZB8A 2GSRA 3HHVA 3HA9A 1LBKA 3HVVA 4F9ZA 4DEJA 14GSA 1TK0B 2LJRA 4N0VA 4V2NA 4USSA 2CA8A 1IYHA 1EOHA 5F0GA 1PGTA 2A2SA 1H4OA 2AUVA 1PKZA 4G0IA 2OKAA 5EY6A 4FYUA 2VL2C 10GSA 3Q18A 3BBYA 1WIKA 1Z5YE 2GZZA 2L5LA
chains in the Genus database with same CATH topology
4Z2RA 2VLUA 2OBIA 4HU7A 4O92A 2D2ZA 4TR4A 3ISOA 2V6OA 2G2QA 1AC1A 4G0LA 1WE0A 2H01A 1EGRA 3IE3A 3HJOA 4O32A 5IQYA 2LRNA 4YH2A 3P90A 1T7PB 4RQXA 1O81A 1JLWA 1T3BA 3EMPA 3H1NA 5COHA 4IELA 6GSSA 2OE1A 2MMAA 4QQ7A 4DSSA 2VOCA 4HQZA 2DMLA 1A8LA 2CQ9A 1Q4JA 3G7YA 1EWXA 1WJKA 3VK9A 3LYPA 3PH9A 2PERA 2RM6A 4A5PA 2UZ8A 5KEJA 1M2AA 4ZBDA 2LNTA 4PGTA 4GSSA 3ZFBA 1FW1A 1V9WA 3WGXA 3EYTA 1XW5A 2V32A 3GUSA 5IM9A 2PVQA 4WEYA 4J56E 4ZILA 1F37A 4GLTA 4AJ8A 4GTUA 3F9UA 1OKDA 11GSA 3TOTA 1JFUA 1PQNA 2PUKC 2ZUPA 2L57A 4IJ3A 4TXOB 4Z2UA 20GSA 1M2DA 3RAZA 1G7EA 1ZCPA 1THXA 3O3TA 2HE3A 3QCPA 4HJ2A 3CTGA 3MSZA 1EP8A 1XOBA 1K3YA 2H0GA 5IMVA 3WYWA 5AN1A 1A8YA 2C3QA 2R4VA 4HDEA 2M46A 4EF0A 3KTBA 1XBSA 1PKWA 1FB6A 1FHEA 4ICYA 1G0TA 3FZ4A 4BA7A 5D9XA 2LRTA 1WPIA 4OFMA 1EGOA 2GLRA 2GQLA 4WETA 4MCUA 1DBYA 2FUG2 3HCZA 3IHQA 4CY6A 2WRTA 4OD7A 3EVIA 3SWLA 3DRNA 3E9JB 1BJXA 2F8FA 5IO2A 2DIYA 4EC0A 5D73A 2YP6A 4IGJA 2YPMA 4NAXA 3D5JA 1GTIA 4IVFA 4BL7B 3IOSA 3PPUA 2A4HA 2V6KA 4KUNA 4RQRA 3QMXA 2B5EA 3MYDA 5KOWA 1V57A 3A5WA 4PUAA 3F8UA 4HUAA 3KIJA 4F82A 2CVDA 2WS2A 3ME7A 4CY8A 3UVTA 2ES7A 1AW9A 2YJHA 3LYKA 1SU9A 2QGVA 2X8HA 4DVCA 4F03A 5J41A 2LV3A 2GQKA 3N5OA 3GSSA 1YF1A 2M80A 3VI5A 3I43A 2YZHA 3GYKA 3W8SA 2B7JA 5C04A 3GRXA 1A24A 1F3AA 3TOUA 4EXJA 1KBNA 2R0PA 4HU9A 4V2LA 3M0FA 2I9HA 5J3RA 3IK7A 1EP7A 1YEPA 2R3XA 3ZRDA 4OFTA 4IHUA 4POBA 4AJ6A 4G2EA 4L0UA 4WBJA 3TCOA 2V41A 5GZZB 5BMUA 2PBJA 3GFKA 5DCHA 2IN3A 1F3BA 2WZ9A 4PUFC 3ERFA 1NHOA 2DJJA 2LSTA 3APOA 4MP4A 5J4UA 1ML6A 3APQA 5KN0A 1YKAA 4BPYA 1HYUA 3GN3A 3I69A 2K8SA 1JZOA 5D8IA 4DSRA 2LRCA 1QMVA 2H6XA 3J7Yb 1LJRA 4XHMA 1GL8A 1ERTA 4MZWA 4ACSA 2GTUA 5G2ZA 4NXIA 3HYPA 3TRXA 1GLPA 2JADA 2R0CA 5DALA 5AIXA 2H8LA 2XC2A 3EU3A 4O5QA 3NZNA 3TDGA 1TK5B 1CQGA 1GSFA 3TRPA 1Q98A 2MMNA 2CAIA 1ZYPA 2HT9A 2VM1A 4MF7A 3OR5A 4V2MA 2CVBA 4Q5QA 13GSA 3KD0A 2B5YA 5HR3A 4K5RA 2J23A 2L59A 2GGTA 1MD3A 2J9HA 3CXGA 1TI3A 3KMOA 2G0FA 3HVSA 2CAQA 1W89A 2QC7A 2H71A 2P31A 2DBCA 1MDJA 2AHEA 5ECKB 3EMXA 2CV4A 1M9AA 5ID2B 1M0UA 2K18A 4G10A 1RW1A 3ZVJA 2H73A 5DJLA 3LXZA 4FYBA 5B6MA 3F63A 4NHZA 3MDKA 2C0EA 5FHIA 2YJ7A 1GSUA 1A2LA 2VO4A 5HR0A 5DDLA 2K6VA 3K8NA 3NOFA 1OVNA 1ON4A 1SJZA 2VL2A 2PPTA 3P8WA 1O85A 3CRUA 2O7KA 5JCWA 2LJAA 2GDRA 2QA1A 1ZYNA 3A2XA 4MK3A 5IIZA 4NHWA 4XCSA 2C0FA 2HSYA 3TJJA 5AIVA 3TKRA 2XPEA 1TRUA 1TP9A 3IAS2 1OC9A 1Z6MA 1TW9A 3EPTA 2DIZA 2HXKA 4K0GA 1I5GA 4KW6A 3IC4A 2NPBA 2BMXA 2B1LA 3I6AA 5KN3A 1FO5A 3DYRA 1XZOA 4KDUA 2VCWA 3GURA 1TTZA 5H5SA 4Q5FA 2FWHA 2I81A 5E59A 3KTLA 3DXBA 2HYXA 1E6BA 4J57E 1O73A 5ECLB 1O8XA 3F3RA 5AISA 1F6MC 1R5AA 2H30A 1PL1A 3V1WA 1NHYA 4OO4A 1Z9HA 1WRYA 4ECJA 1XIYA 4XTSA 1T1VA 5DAKA 2I3YA 3FR9A 3ZL5A 1Y25A 2JSYA 1SL0B 2GS3A 4AF2A 1JHBA 1NM3A 2VLTA 4D73A 4TOPA 1O7UA 1T4ZA 3D0ZA 4N30A 3TKSE 18GSA 3IR4A 2VLVA 1ZMAA 4Z7XA 1XWAA 1X5CA 1MDIA 4FYCA 4V1Ag 3WT2A 4ML6A 4WKWA 1YEXA 2H72A 5CRWA 1A0FA 3QAWA 3FZ9A 3E0UA 3ZREA 1NW2A 2ZCTA 2YV7A 1TU7A 3F6DA 1BX9A 1U3AA 2REMA 3C1RA 5EPFA 3QAVA 2IPAA 5B6NA 1WP0A 2VAFA 3DVXA 4MA9A 2H1BA 2YWOA 3H93A 1KTEA 4BVXB 1THOA 3ZITA 2OBKA 5GSTA 1CQHA 2H1DA 5G1KA 3VWUA 5CAXA 4F2IA 3EU4A 4HS1A 3QOUA 1OYJA 2YN1A 3GIXA 5HQPA 22GSA 2B1KA 4HZ4A 5E4WA 1HQOA 2R2JA 3HD5A 3WD6A 2GVPA 2YANA 2VD1A 1BYEA 5HFIA 3FMWA 1A2JA 1HNBA 4Q5NA 3P7XA 4HOJA 8GSSA 2MBSA 2EIQA 2PVOC 3VI7A 3BCIA 2KP2A 2NTOA 2AAWA 1S3AA 3QFAC 5J9BA 4N10A 1XWGA 2TRCP 2C80A 17GSA 4YQMA 1SJ6A 2WCIA 2HNLA 2YCDA 2TRXA 2K9FA 1N8JA 1SYXA 1PRXA 1Z6NA 4NV5A 1UVZA 2X8GA 1K0DA 3F6FA 3H8QA 2ZNMA 1K3OA 1XCCA 2A4VA 1SYRA 2K8VA 1R4WA 3BD2A 3IXRA 4EIQA 1EZKA 2N5AA 1GLQA 4ECIA 1SK2A 4I5QA 5DCGA 2LQQA 4L5LA 4YKGA 5DBQA 2LS5A 3NIVA 4LMVA 2C0GA 1XWKA 1SL1B 4OCFA 2QSIA 1PSQA 2IWTA 3PR8A 2RLIA 3H4KA 1U88A 2BTOT 3IK9A 3C71A 1VRSD 2X64A 2KOKA 1SK1A 3GL3A 3UBKA 1VGLA 1HD2A 2YNXA 3GL5A 5JWOB 1ACVA 3QPMA 2MYGA 5IPHA 4JE1A 4OCEA 1PL2A 4IBPA 4TR0A 2HZEA 2JU5A 4WF4A 3GKMA 1YZXA 1X9WB 1GWCA 2JZRA 2VM2A 4WR5A 4ZL9A 3US3A 4KAEA 5GAPD 2A2RA 4AGSA 1HNCA 5ELGA 3TGZA 4KCEA 1K0OA 1VF3A 2FNOA 1K3LA 4ULXA 4TR1A 2YWIA 3CSIA 3D4MA 3BOAA 4EDZA 1BAYA 3FEUA 1FVKA 5LCZA 3IHGA 2IFQA 4XS4A 2B5XA 3P2AA 2VL9A 3FR3A 4MNNA 5CREA 3FYGA 2NVLA 5J9CA 1J08A 1T00A 3PINA 1B48A 2XHFA 2H6ZA 2GSTA 1E2YA 3E3EA 3UIWA 2P0GA 4ZL8A 3UBLA 1OC3A 3RPPA 3UMAA 2WDUA 1YJ6A 2F51A 2H66A 2FA4A 3GKXA 3PGTA 1FG4A 4DSSB 3GKNA 2N5BA 2H19A 5ELAA 4JZQA 3FY7A 3EURA 2DJ2A 4K7OA 3W6GA 3G9BA 2YZUA 2XBIA 3EWLA 12GSA 1M7TA 3CSJA 1U6TA 1AQXA 4OMVA 2KP1A 4JU5A 3TUEA 3ERWA 4QL7A 4X0XA 4MF6A 2JZSA 1HNAA 3ED3A 3M9JA 3IBHA 2O8VB 1QGVA 4K5SA 3A3TA 1R5PA 3KM6A 1FB0A 1F9MA 3S9FA 3GNJA 2DLXA 4DSQA 5G30A 2L4CA 1JLVA 2L4QA 4FIWA 2PN8A 3O76A 1ZYQB 3LSZA 1UC7A 4BWQA 1ERVA 4K0NA 2CZ3A 1OE7A 3MIXA 1WOUA 5AGYA 5IOXA 1QUWA 3C73A 5FWGA 4NPBA 5A4WA 4MJAA 3FR6A 3ZIJA 2V1MA 5ECOB 5EL8A 2R37A 1V40A 3SBCA 2IMKA 4PQIA 1ERWA 4RI6A 1SL2B 2YOIA 1TKDB 5B8AA 3GSTA 4ECBA 3GV1A 2IFQB 3EE2A 5D9WA 1NSWA 2OJLA 4HJMA 2F8AA 2C0DA 2R5GA 4JEDA 3HDCA 1XWCA 2VCQA 1QFNA 5ECSA 4TVEA 4POMA 1TI1A 4YQVA 1TDIA 3IPZA 3KEBA 2QKEA 3GA4A 4BWSA 4N11A 4BVYA 3AY8A 3F4TA 4IJIA 1LU4A 2F3MA 5D93A 3D22A 2QA2A 3ZZXA 1K0MA 4MF5A 1OC8A 5KOXA 2FWEA 2FGXA 1J0FA 1GRXA 4YAVA 1ZGNA 3G7IA 4TRXA 2DC5A 5CO3A 1X5EA 3TRQA 1ILOA 3TKSC 1TRWA 2FY6A 3M3MA 2DJKA 3ME8A 4PNGA 1QK8A 2PMTA 3QAGA 4ECCA 2H1AA 2H0HA 4NV2A 1GNEA 4I2UA 3DEXA 4ID0A 2LQOA 5KN1A 19GSA 3GH6A 4GWRA 5B8BA 5IOWA 3GHAA 1TU8A 4ZXGA 1XVWA 3ZIVA 4EO3A 1ST9A 3U5RE 4EIPA 4FQUA 3VLNA 2E2GA 2E2MA 2PU9C 1PN9A 1V58A 1C72A 5CRHA 4GSTA 4X43A 3L78A 2H74A 3KP8A 4K1FA 2O89A 4JR6A 2HFDA 3R2QA 1PX6A 3KZQA 2JZTA 1T4YA 4MPFA 3MAKA 1S3CA 4X4JA 4TN8A 3U6VA 1KEBA 3DMLA 4F0BA 1A2MA 1F2EA 2WGRA 3JCML 3L4NA 3RPNA 1O8WA 5DALB 2VCTA 1T8EB 2I1UA 1AXDA 2KHPA 5ECHB 2HI7A 1S3DA 4BVYB 1DE1A 1SENA 5ECMB 1GH2A 1QQ2A 4KX4A 3I9V2 3J7Yk 3TKPA 2F9SA 3QDNA 4G9HA 1U3IA 5KN2A 2GQMA 3CSHA 1WWJA 3HZ8A 4ZBBA 1ABAA 3LW9A 1VF4A 1SKWB 4KA0A 1GTBA 3M1GA 2MMZA 5ABRA 2JACA 3LG6A 4K9ZA 3WGEA 4MJCA 3FRCA 1RK4A 4YKFA 3RHCA 2CX3A 1X9MB 3BCKA 4XIHA 4LMWA 1PN0A 2HSHA 4LLRA 2MBTA 3LORA 4EUYA 2C3NA 2OA7A 5JCGA 1XVQA 1GP1A 1OKTA 4KF9A 16GSA 4KH7A 3LJRA 2L6DA 3FW2A 3GKKA 1PA3A 5A4VA 4POKA 1ERUA 2DKIA 3IDVA 1Z3EA 1W4VA 5D9VA 3UJ1A 4L8EA 1DE2A 1OC9B 2MMOA 3MWHA 4YQUA 5ECRB 1TXXA 1MD4A 1GUMA 4JBBA 4O7HA 2H70A 5F05A 1G7OA 2IJYA 2FHEA 1B9YC 3CRTA 3FKFA 4TXOA 2E0QA 4JRRA 5JCUA 4MMMA 4JR4A 4PXOA 1B4PA 3IV4A 4IW9A 4XRDA 1EV4A 2GT5A 1FOVA 3ZTLA 2HZFA 4L0WA 1FVJA 4PTSA 4HQSA 2CT6A 3VWXA 4ZIJA 2GT6A 3Q19A 3KJYA 1YF0A 4G0KA 3KGKA 1WMJA 5A4UA 3RBTA 4ZB6A 2DJ0A 3QD9A 1USBA 4RI7A 3F3QA 4CW9A 5DAKB 1X9SB 2B3SA 6GSUA 4NMUA 2HRKA 1EV9A 4ZB9A 1Z7RA 3BJ5A 5ECIB 2RM5A 4D73B 5ECNB 1PD21 3HZ4A 5H5RA 3DKSA 1OE8A 4V1Ap 5JWRB 2IMDA 4IN0A 2VIMA 4YAPA 3TJGA 3LGCA 5D96A 2EIRA 2LEGA 1BEDA 4K7IA 4MH3A 4BL7A 1G6YA 1V2AA 1K0NA 6GSTA 2FWGA 4POLA 3MNGA 4CDOA 3CMIA 2VUPA 2A2PA 2LJKA 3UEMA 2CVKA 1SKSB 2X49A 2X8CA 1TRSA 1EOGA 4E8HA 2R0GA 2NDOA 3D4TA 1PX7A 1AUCA 4PQ1A 4E8EA 4GF0A 4I2TA 3TJFA 1DUGA 5D9TA 2HLSA 2C4JA 1GTUA 3DVWA 1ZYEA 3EC3A 4WF5A 2B7KA 1XOAA 1YKCA 2FD3A 1AIUA 1GSSA 1XW6A 2EC4A 2YV9A 2LTKA 1JZDA 3TJKA 2O85A 3O6TA 1H75A 1RQMA 1VF1A 2CX4A 3HY2A 5G1LA 2CZ2A 4HEA2 3IC8A 3CYNA 3FHKA 4KSOA 2P5QA 3TJBA 5GSSA 2B6MA 4KDXA 5INYA 2E7PA 3LEFA 4OFNA 1IYIA 4KDYA 3RHBA 1TJDA 3L9SA 2IMEA 1YY7A 4MJEA 4KNDA 5IMZA 5LD0A 4RUVA 4IP1A 3TKSA 1GUHA 3LFLA 2DSAA 4K2XA 2DKHA 5HFGA 4O5RA 1EEJA 2OE0A 1XXUA 3DWVA 6GSWA 3VPQA 3KH9A 1GULA 5HR1A 2DJ1A 2M72A 2X4AA 4K2DA 1SK0A 4WBRD 4IKHA 1XWBA 3N9JA 4MPGA 5ENUA 4GCIA 5CNWA 3VWVA 4H86A 2LUSA 4P3YB 3D21A 3Q74A 1BQ7A 3KMNA 1MDKA 3RDWA 2GSQA 1R7HA 2MZCA 2R6KA 2KUCA 1FAAA 2C8UA 4K6XA 3CBUA 2JSZA 3IAM2 2JL4A 4X1UA 2LNSA 3ERGA 3UOMA 5GAND 1PMTA 2IMIA 4XS1A 1AQVA 5CYYA 3ZVJD 4MLYA 3F4SA 5B7CA 4KSMA 2OADA 2GZPA 2L6CA 3VWWA 1X0RA 1YDKA 3KCMA 3GX0A 3UL3A 4ILFA 3QFBC 3FZAA 2HZEB 2VCVA 1J9BA 1B4QA 2RUEA 3M9KA 4K8MA 5IMDA 2H76A 4G19A 4PNFA 3M8NA 3R3EA 2YWNA 2YWMA 2EIOA 3KP9A 4IP6A 2H6YA 3L9VA 5IMAA 5CP1A 1UA5A 3G7JA 4I6XA 4GRFA 4F0CA 2DMMA 3F0IA 4TW5A 5ID2A 3TKQA 4KB3A 1K0BA 1BG5A 1YQ1A 3ZMKA 3IA1A 2O87A 4EDYA 1GSQA 3A2VA 3UVHA 2HRAA 4MZCA 3APSA 5DVBA 5DJMA 1B8XA 4TR1B 2GSSA 3WGDA 4PX1A 2IIYA 5F06A 1SKRB 3ZFLA 1G6WA 1SJIA 1AAZA 4XS4B 1ZL9A 4L5OA 1K0AA 3LQ7A 4GSNA 2OACA 2WB9A 1Y6EA 2FWFA 4FH8A 2HSMA 2AV4A 2ON7A 5BRTA 1GNWA 5G5EA 4J2FA 2FLSA 4ZL7A 1OAZA 1GTAA 3C1SA 2I4AA 3GX8A 1FOHA 1JZRA 3L9UA 6GSVA 2AYTA 3GTUA 2RUFA 5DQYA 1M9BA 1XPVA 1N2AA 4ZBAA 2WFCA 1GSDA 3HJMA 4MJBA 2C3TA 3GMFA 1XFLA 4XRAA 5IMFA 9GSSA 5A5KA 4TR3A 2H0IA 3CTFA 3Q6OA 1MTCA 3D6IA 4Q5RA 1VF2A 3HJPA 2KLXA 2P5RA 3QR6A 1QXHA 1URMA 1SD9A 2AB6A 3A2WA 3DGQA 1DSBA 3FZ5A 4TXVA 2FCHA 4GQCA 2FA8A 3WT1A 1ZZYA 5CRDA 5HR2A 4QL9A 2PGTA 3HKRA 2WULA 1B9XC 3VFIA 5ECQB 4IQ1A 1JZWA 4HI7A 2X99A 1V98A 5DQSA 5IPGA 1M99A 4LL4B 3EINA 5IO0A 4ML1A 3A5IA 3DD3A 1GSYA 5G5FA 4TKYA 3ZMLA 4MDCA 2GZYA 5L71A 4KE3A 5J5NA 2VCZA 6GSYA 2BJXA 3H79A 1MEKA 3ZYWA 1A0RP 3C8EA 3L0HA 4GQFA 2ON5A 1EEMA 4WXTA 1I9DA 3W8JA 4IS0A 4BVXA 4CHSA 5F8BA 4NWYA 2VCXA 2TIRA 1TK8B 3DIEA 3VURA 1TOFA 2DJ3A 3UARA 1O6JA 3GTUB 3KH7A 1TRVA 2ALBA 1GUKA 2H1GA 3KXOA 5HFKA 2AJQB 4N0ZA 6GSXA 4OWYA 1M2BA 2H75A 4IQAA 4O5UA 4AJ7A 4FO5A 2VD0A 2HRNA 4KCAA 4PURA 3IRAA 2XPDA 2C1YA 1AQWA 1K0CA 2V2GA 4XS6A 3GH9A 3ZLPA 1U87A 5LNKe 3LXTA 1XW9A 5G31A 5IMCA 4ISDA 2VL3A 7GSSA 1ZOFA 4LL1B 3TB2A 1GSEA 1KNGA 2HRFA 3F4RA 5F07A 3FK8A 1UN2A 5H5QA 2L5OA 2N5FA 1SD8A 5FT3A 3HVXA 4GXZA 1X5DA 1Z7PA 2IMFA 4MZBA 2LKUA 4K7NA 2Z9SA 2IL3A 4I8BA 3VPTA 4MABA 4I97A 4Z2TA 2XBQA 4EVMA 4EE0A 2PWJA 4MH2A 4KGIA 3UAPA 3C7MA 5EVOA 1A23A 2WJUA 4OO5A 4HZ2A 4EL1A 4WR4A 4LA1A 2RIIA 5CRGA 2NBSA 4PQHA 5ECPB 4EKZA 5C00A 3LWAA 1R26A 3HXSA 2OE3A 5JWQB 4ZB8A 2GSRA 3HHVA 3HA9A 1LBKA 3HVVA 4F9ZA 4DEJA 14GSA 1TK0B 2LJRA 4N0VA 4V2NA 4USSA 2CA8A 1IYHA 1EOHA 5F0GA 1PGTA 2A2SA 1H4OA 2AUVA 1PKZA 4G0IA 2OKAA 5EY6A 4FYUA 2VL2C 10GSA 3Q18A 3BBYA 1WIKA 1Z5YE 2GZZA 2L5LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VLU A;  2OBI A;  4HU7 A;  4O92 A;  2D2Z A;  4TR4 A;  3ISO A;  2V6O A;  2G2Q A;  1AC1 A;  1WE0 A;  2H01 A;  1EGR A;  3IE3 A;  3HJO A;  4O32 A;  5IQY A;  2LRN A;  4YH2 A;  3P90 A;  1T7P B;  4RQX A;  1O81 A;  1JLW A;  1T3B A;  3EMP A;  3H1N A;  5COH A;  4IEL A;  6GSS A;  2OE1 A;  2MMA A;  4QQ7 A;  4DSS A;  2VOC A;  4HQZ A;  2DML A;  1A8L A;  2CQ9 A;  1Q4J A;  3G7Y A;  1EWX A;  1WJK A;  3VK9 A;  3LYP A;  3PH9 A;  2PER A;  2RM6 A;  5KEJ A;  1M2A A;  4ZBD A;  2LNT A;  4PGT A;  4GSS A;  3ZFB A;  1FW1 A;  1V9W A;  3WGX A;  3EYT A;  1XW5 A;  2V32 A;  3GUS A;  5IM9 A;  2PVQ A;  4WEY A;  4J56 E;  4ZIL A;  1F37 A;  4GLT A;  4AJ8 A;  4GTU A;  3F9U A;  1OKD A;  11GS A;  3TOT A;  1JFU A;  1PQN A;  2PUK C;  2ZUP A;  2L57 A;  4IJ3 A;  4TXO B;  20GS A;  1M2D A;  3RAZ A;  1G7E A;  1ZCP A;  1THX A;  3O3T A;  2HE3 A;  3QCP A;  4HJ2 A;  3CTG A;  3MSZ A;  1EP8 A;  1XOB A;  1K3Y A;  2H0G A;  5IMV A;  3WYW A;  5AN1 A;  1A8Y A;  2C3Q A;  2R4V A;  4HDE A;  2M46 A;  4EF0 A;  3KTB A;  1XBS A;  1PKW A;  1FB6 A;  1FHE A;  1G0T A;  3FZ4 A;  4BA7 A;  5D9X A;  2LRT A;  1WPI A;  4OFM A;  1EGO A;  2GLR A;  2GQL A;  4WET A;  4MCU A;  1DBY A;  2FUG 2;  3HCZ A;  3IHQ A;  2WRT A;  4OD7 A;  3EVI A;  3SWL A;  3DRN A;  3E9J B;  1BJX A;  2F8F A;  5IO2 A;  2DIY A;  4EC0 A;  5D73 A;  2YP6 A;  4IGJ A;  2YPM A;  4NAX A;  3D5J A;  1GTI A;  4IVF A;  3IOS A;  2V6K A;  4KUN A;  4RQR A;  3QMX A;  2B5E A;  1V57 A;  3A5W A;  4PUA A;  3F8U A;  4HUA A;  3KIJ A;  4F82 A;  2CVD A;  2WS2 A;  3ME7 A;  3UVT A;  2ES7 A;  1AW9 A;  2YJH A;  3LYK A;  1SU9 A;  2QGV A;  2X8H A;  4DVC A;  4F03 A;  5J41 A;  2LV3 A;  2GQK A;  3N5O A;  3GSS A;  1YF1 A;  2M80 A;  3VI5 A;  3I43 A;  2YZH A;  3GYK A;  3W8S A;  2B7J A;  5C04 A;  3GRX A;  1A24 A;  1F3A A;  3TOU A;  4EXJ A;  1KBN A;  4HU9 A;  4V2L A;  3M0F A;  2I9H A;  5J3R A;  3IK7 A;  1EP7 A;  1YEP A;  2R3X A;  3ZRD A;  4OFT A;  4IHU A;  4POB A;  4AJ6 A;  4G2E A;  4L0U A;  4WBJ A;  3TCO A;  2V41 A;  5GZZ B;  2PBJ A;  3GFK A;  5DCH A;  2IN3 A;  1F3B A;  2WZ9 A;  4PUF C;  3ERF A;  1NHO A;  2DJJ A;  2LST A;  3APO A;  4MP4 A;  5J4U A;  1ML6 A;  3APQ A;  5KN0 A;  1YKA A;  4BPY A;  1HYU A;  3GN3 A;  3I69 A;  2K8S A;  1JZO A;  5D8I A;  4DSR A;  2LRC A;  1QMV A;  2H6X A;  3J7Y b;  1LJR A;  4XHM A;  1GL8 A;  1ERT A;  4MZW A;  4ACS A;  2GTU A;  5G2Z A;  4NXI A;  3HYP A;  3TRX A;  1GLP A;  2JAD A;  5DAL A;  5AIX A;  2H8L A;  2XC2 A;  3EU3 A;  3NZN A;  3TDG A;  1TK5 B;  1CQG A;  1GSF A;  3TRP A;  1Q98 A;  2MMN A;  2CAI A;  2HT9 A;  2VM1 A;  4MF7 A;  3OR5 A;  4V2M A;  2CVB A;  4Q5Q A;  13GS A;  3KD0 A;  2B5Y A;  5HR3 A;  2J23 A;  2L59 A;  2GGT A;  1MD3 A;  2J9H A;  3CXG A;  1TI3 A;  3KMO A;  2G0F A;  3HVS A;  2CAQ A;  1W89 A;  2QC7 A;  2H71 A;  2P31 A;  2DBC A;  1MDJ A;  2AHE A;  5ECK B;  3EMX A;  2CV4 A;  1M9A A;  5ID2 B;  1M0U A;  2K18 A;  4G10 A;  1RW1 A;  3ZVJ A;  2H73 A;  5DJL A;  3LXZ A;  4FYB A;  5B6M A;  3F63 A;  4NHZ A;  3MDK A;  2C0E A;  5FHI A;  2YJ7 A;  1GSU A;  1A2L A;  2VO4 A;  5HR0 A;  5DDL A;  2K6V A;  3K8N A;  3NOF A;  1OVN A;  1ON4 A;  1SJZ A;  2VL2 A;  2PPT A;  3P8W A;  1O85 A;  3CRU A;  2O7K A;  5JCW A;  2LJA A;  2GDR A;  3A2X A;  4MK3 A;  5IIZ A;  4NHW A;  4XCS A;  2C0F A;  2HSY A;  3TJJ A;  5AIV A;  3TKR A;  2XPE A;  1TRU A;  1TP9 A;  3IAS 2;  1OC9 A;  1Z6M A;  1TW9 A;  2DIZ A;  2HXK A;  4K0G A;  1I5G A;  4KW6 A;  3IC4 A;  2NPB A;  2BMX A;  2B1L A;  3I6A A;  5KN3 A;  1FO5 A;  3DYR A;  1XZO A;  4KDU A;  2VCW A;  3GUR A;  1TTZ A;  5H5S A;  4Q5F A;  2FWH A;  2I81 A;  5E59 A;  3KTL A;  3DXB A;  2HYX A;  1E6B A;  4J57 E;  1O73 A;  5ECL B;  1O8X A;  3F3R A;  5AIS A;  1F6M C;  1R5A A;  2H30 A;  1PL1 A;  3V1W A;  1NHY A;  4OO4 A;  1Z9H A;  1WRY A;  4ECJ A;  1XIY A;  4XTS A;  1T1V A;  5DAK A;  2I3Y A;  3FR9 A;  3ZL5 A;  1Y25 A;  2JSY A;  1SL0 B;  2GS3 A;  4AF2 A;  1JHB A;  1NM3 A;  2VLT A;  4D73 A;  4TOP A;  1O7U A;  1T4Z A;  3D0Z A;  4N30 A;  3TKS E;  18GS A;  3IR4 A;  2VLV A;  1ZMA A;  4Z7X A;  1XWA A;  1X5C A;  1MDI A;  4FYC A;  4V1A g;  3WT2 A;  4ML6 A;  4WKW A;  1YEX A;  2H72 A;  5CRW A;  1A0F A;  3QAW A;  3FZ9 A;  3E0U A;  3ZRE A;  1NW2 A;  2ZCT A;  2YV7 A;  1TU7 A;  3F6D A;  1BX9 A;  1U3A A;  2REM A;  3C1R A;  5EPF A;  3QAV A;  2IPA A;  5B6N A;  1WP0 A;  2VAF A;  3DVX A;  4MA9 A;  2H1B A;  2YWO A;  3H93 A;  1KTE A;  1THO A;  3ZIT A;  2OBK A;  5GST A;  1CQH A;  2H1D A;  5G1K A;  3VWU A;  5CAX A;  4F2I A;  3EU4 A;  4HS1 A;  3QOU A;  1OYJ A;  2YN1 A;  3GIX A;  5HQP A;  22GS A;  2B1K A;  4HZ4 A;  5E4W A;  1HQO A;  2R2J A;  3HD5 A;  3WD6 A;  2GVP A;  2YAN A;  2VD1 A;  1BYE A;  5HFI A;  1A2J A;  1HNB A;  4Q5N A;  3P7X A;  4HOJ A;  8GSS A;  2MBS A;  2EIQ A;  2PVO C;  3VI7 A;  3BCI A;  2KP2 A;  2NTO A;  2AAW A;  1S3A A;  3QFA C;  5J9B A;  4N10 A;  1XWG A;  2TRC P;  2C80 A;  17GS A;  4YQM A;  1SJ6 A;  2WCI A;  2HNL A;  2YCD A;  2TRX A;  2K9F A;  1N8J A;  1SYX A;  1PRX A;  1Z6N A;  4NV5 A;  1UVZ A;  2X8G A;  1K0D A;  3F6F A;  3H8Q A;  2ZNM A;  1K3O A;  1XCC A;  2A4V A;  1SYR A;  2K8V A;  1R4W A;  3BD2 A;  3IXR A;  1EZK A;  2N5A A;  1GLQ A;  4ECI A;  1SK2 A;  4I5Q A;  5DCG A;  2LQQ A;  4L5L A;  5DBQ A;  2LS5 A;  3NIV A;  4LMV A;  2C0G A;  1XWK A;  1SL1 B;  4OCF A;  2QSI A;  1PSQ A;  2IWT A;  3PR8 A;  2RLI A;  3H4K A;  1U88 A;  2BTO T;  3IK9 A;  3C71 A;  1VRS D;  2X64 A;  2KOK A;  1SK1 A;  3GL3 A;  3UBK A;  1VGL A;  1HD2 A;  2YNX A;  3GL5 A;  5JWO B;  1ACV A;  3QPM A;  2MYG A;  5IPH A;  4JE1 A;  4OCE A;  1PL2 A;  4IBP A;  4TR0 A;  2HZE A;  2JU5 A;  4WF4 A;  3GKM A;  1YZX A;  1X9W B;  1GWC A;  2JZR A;  2VM2 A;  4WR5 A;  4ZL9 A;  3US3 A;  4KAE A;  5GAP D;  2A2R A;  4AGS A;  1HNC A;  5ELG A;  3TGZ A;  4KCE A;  1K0O A;  1VF3 A;  2FNO A;  1K3L A;  4ULX A;  4TR1 A;  2YWI A;  3CSI A;  3D4M A;  3BOA A;  4EDZ A;  1BAY A;  3FEU A;  1FVK A;  5LCZ A;  2IFQ A;  4XS4 A;  2B5X A;  3P2A A;  2VL9 A;  3FR3 A;  5CRE A;  3FYG A;  2NVL A;  5J9C A;  1J08 A;  1T00 A;  3PIN A;  1B48 A;  2XHF A;  2H6Z A;  2GST A;  1E2Y A;  3E3E A;  3UIW A;  2P0G A;  4ZL8 A;  3UBL A;  1OC3 A;  3RPP A;  3UMA A;  2WDU A;  1YJ6 A;  2F51 A;  2H66 A;  2FA4 A;  3GKX A;  3PGT A;  1FG4 A;  4DSS B;  3GKN A;  2N5B A;  2H19 A;  5ELA A;  4JZQ A;  3FY7 A;  3EUR A;  2DJ2 A;  4K7O A;  3W6G A;  3G9B A;  2YZU A;  2XBI A;  3EWL A;  12GS A;  1M7T A;  3CSJ A;  1U6T A;  1AQX A;  4OMV A;  2KP1 A;  4JU5 A;  3TUE A;  3ERW A;  4QL7 A;  4X0X A;  4MF6 A;  2JZS A;  1HNA A;  3ED3 A;  3M9J A;  3IBH A;  2O8V B;  1QGV A;  3A3T A;  1R5P A;  3KM6 A;  1FB0 A;  1F9M A;  3S9F A;  3GNJ A;  2DLX A;  4DSQ A;  5G30 A;  2L4C A;  1JLV A;  2L4Q A;  4FIW A;  2PN8 A;  3O76 A;  1ZYQ B;  3LSZ A;  1UC7 A;  4BWQ A;  1ERV A;  4K0N A;  2CZ3 A;  1OE7 A;  1WOU A;  5AGY A;  5IOX A;  1QUW A;  3C73 A;  5FWG A;  4NPB A;  5A4W A;  4MJA A;  3FR6 A;  3ZIJ A;  2V1M A;  5ECO B;  5EL8 A;  2R37 A;  1V40 A;  3SBC A;  2IMK A;  4PQI A;  1ERW A;  4RI6 A;  1SL2 B;  2YOI A;  1TKD B;  5B8A A;  3GST A;  4ECB A;  3GV1 A;  2IFQ B;  3EE2 A;  5D9W A;  1NSW A;  2OJL A;  4HJM A;  2F8A A;  2C0D A;  2R5G A;  4JED A;  3HDC A;  1XWC A;  2VCQ A;  1QFN A;  5ECS A;  4TVE A;  4POM A;  1TI1 A;  4YQV A;  1TDI A;  3IPZ A;  3KEB A;  2QKE A;  3GA4 A;  4BWS A;  4N11 A;  4BVY A;  3AY8 A;  3F4T A;  4IJI A;  1LU4 A;  2F3M A;  5D93 A;  3D22 A;  3ZZX A;  1K0M A;  4MF5 A;  1OC8 A;  2FWE A;  2FGX A;  1J0F A;  1GRX A;  4YAV A;  1ZGN A;  3G7I A;  4TRX A;  2DC5 A;  5CO3 A;  1X5E A;  3TRQ A;  1ILO A;  3TKS C;  1TRW A;  2FY6 A;  3M3M A;  2DJK A;  3ME8 A;  4PNG A;  1QK8 A;  2PMT A;  3QAG A;  4ECC A;  2H1A A;  2H0H A;  1GNE A;  4NV2 A;  4I2U A;  3DEX A;  4ID0 A;  2LQO A;  5KN1 A;  19GS A;  3GH6 A;  4GWR A;  5B8B A;  5IOW A;  3GHA A;  1TU8 A;  4ZXG A;  1XVW A;  3ZIV A;  4EO3 A;  1ST9 A;  3U5R E;  3VLN A;  2E2G A;  2E2M A;  2PU9 C;  1PN9 A;  1V58 A;  1C72 A;  5CRH A;  4GST A;  4X43 A;  3L78 A;  2H74 A;  3KP8 A;  4K1F A;  2O89 A;  4JR6 A;  2HFD A;  3R2Q A;  1PX6 A;  3KZQ A;  2JZT A;  1T4Y A;  4MPF A;  3MAK A;  1S3C A;  4TN8 A;  3U6V A;  1KEB A;  3DML A;  4F0B A;  1A2M A;  1F2E A;  2WGR A;  3JCM L;  3L4N A;  3RPN A;  1O8W A;  5DAL B;  2VCT A;  1T8E B;  2I1U A;  1AXD A;  2KHP A;  5ECH B;  2HI7 A;  1S3D A;  1DE1 A;  1SEN A;  5ECM B;  1GH2 A;  1QQ2 A;  4KX4 A;  3I9V 2;  3J7Y k;  3TKP A;  2F9S A;  3QDN A;  4G9H A;  1U3I A;  5KN2 A;  2GQM A;  3CSH A;  1WWJ A;  3HZ8 A;  4ZBB A;  1ABA A;  1VF4 A;  1SKW B;  4KA0 A;  1GTB A;  3M1G A;  2MMZ A;  5ABR A;  2JAC A;  3LG6 A;  4K9Z A;  3WGE A;  4MJC A;  3FRC A;  1RK4 A;  3RHC A;  2CX3 A;  1X9M B;  3BCK A;  4XIH A;  4LMW A;  2HSH A;  4LLR A;  2MBT A;  3LOR A;  4EUY A;  2C3N A;  2OA7 A;  5JCG A;  1XVQ A;  1GP1 A;  1OKT A;  16GS A;  4KH7 A;  3LJR A;  2L6D A;  3FW2 A;  3GKK A;  1PA3 A;  5A4V A;  4POK A;  1ERU A;  3IDV A;  1Z3E A;  1W4V A;  5D9V A;  3UJ1 A;  4L8E A;  1DE2 A;  1OC9 B;  2MMO A;  3MWH A;  4YQU A;  5ECR B;  1TXX A;  1MD4 A;  1GUM A;  4JBB A;  4O7H A;  2H70 A;  5F05 A;  1G7O A;  2IJY A;  2FHE A;  1B9Y C;  3CRT A;  3FKF A;  4TXO A;  2E0Q A;  4JRR A;  5JCU A;  4MMM A;  4JR4 A;  4PXO A;  1B4P A;  3IV4 A;  4IW9 A;  4XRD A;  1EV4 A;  2GT5 A;  1FOV A;  3ZTL A;  2HZF A;  4L0W A;  1FVJ A;  4HQS A;  2CT6 A;  3VWX A;  4ZIJ A;  2GT6 A;  3Q19 A;  3KJY A;  1YF0 A;  3KGK A;  1WMJ A;  5A4U A;  3RBT A;  4ZB6 A;  2DJ0 A;  3QD9 A;  1USB A;  4RI7 A;  3F3Q A;  4CW9 A;  5DAK B;  1X9S B;  2B3S A;  6GSU A;  4NMU A;  1EV9 A;  4ZB9 A;  1Z7R A;  3BJ5 A;  5ECI B;  2RM5 A;  4D73 B;  5ECN B;  1PD2 1;  3HZ4 A;  5H5R A;  3DKS A;  1OE8 A;  4V1A p;  5JWR B;  2IMD A;  4IN0 A;  2VIM A;  4YAP A;  3TJG A;  3LGC A;  5D96 A;  2EIR A;  2LEG A;  1BED A;  4K7I A;  4MH3 A;  4BL7 A;  1G6Y A;  1V2A A;  1K0N A;  6GST A;  2FWG A;  4POL A;  3MNG A;  4CDO A;  3CMI A;  2VUP A;  2LJK A;  3UEM A;  2CVK A;  1SKS B;  2X8C A;  1TRS A;  1EOG A;  4E8H A;  2NDO A;  3D4T A;  1PX7 A;  1AUC A;  4PQ1 A;  4E8E A;  4GF0 A;  4I2T A;  3TJF A;  1DUG A;  5D9T A;  2HLS A;  2C4J A;  1GTU A;  3DVW A;  1ZYE A;  3EC3 A;  4WF5 A;  2B7K A;  1XOA A;  1YKC A;  2FD3 A;  1AIU A;  1GSS A;  1XW6 A;  2EC4 A;  2YV9 A;  2LTK A;  1JZD A;  3TJK A;  2O85 A;  3O6T A;  1H75 A;  1RQM A;  1VF1 A;  2CX4 A;  3HY2 A;  5G1L A;  2CZ2 A;  4HEA 2;  3CYN A;  3FHK A;  4KSO A;  2P5Q A;  3TJB A;  5GSS A;  2B6M A;  4KDX A;  5INY A;  2E7P A;  3LEF A;  4OFN A;  1IYI A;  4KDY A;  3RHB A;  1TJD A;  3L9S A;  2IME A;  1YY7 A;  4MJE A;  4KND A;  5IMZ A;  5LD0 A;  4RUV A;  4IP1 A;  3TKS A;  1GUH A;  3LFL A;  2DSA A;  5HFG A;  4O5R A;  1EEJ A;  2OE0 A;  1XXU A;  3DWV A;  6GSW A;  3VPQ A;  3KH9 A;  1GUL A;  5HR1 A;  2DJ1 A;  2M72 A;  4K2D A;  1SK0 A;  4WBR D;  4IKH A;  1XWB A;  3N9J A;  4MPG A;  5ENU A;  4GCI A;  5CNW A;  3VWV A;  4H86 A;  2LUS A;  4P3Y B;  3D21 A;  3Q74 A;  1BQ7 A;  3KMN A;  1MDK A;  3RDW A;  2GSQ A;  1R7H A;  2MZC A;  2R6K A;  2KUC A;  1FAA A;  2C8U A;  4K6X A;  3CBU A;  2JSZ A;  3IAM 2;  2JL4 A;  4X1U A;  2LNS A;  3ERG A;  3UOM A;  5GAN D;  1PMT A;  2IMI A;  4XS1 A;  1AQV A;  5CYY A;  3ZVJ D;  4MLY A;  3F4S A;  5B7C A;  4KSM A;  2OAD A;  2GZP A;  2L6C A;  3VWW A;  1X0R A;  1YDK A;  3KCM A;  3GX0 A;  3UL3 A;  4ILF A;  3QFB C;  3FZA A;  2HZE B;  2VCV A;  1J9B A;  1B4Q A;  2RUE A;  3M9K A;  4K8M A;  5IMD A;  2H76 A;  4G19 A;  4PNF A;  3M8N A;  2YWN A;  2YWM A;  2EIO A;  3KP9 A;  4IP6 A;  2H6Y A;  3L9V A;  5IMA A;  5CP1 A;  1UA5 A;  3G7J A;  4I6X A;  4GRF A;  4F0C A;  2DMM A;  3F0I A;  4TW5 A;  5ID2 A;  3TKQ A;  4KB3 A;  1K0B A;  1BG5 A;  1YQ1 A;  3ZMK A;  3IA1 A;  2O87 A;  4EDY A;  1GSQ A;  3A2V A;  3UVH A;  4MZC A;  3APS A;  5DVB A;  5DJM A;  1B8X A;  4TR1 B;  2GSS A;  3WGD A;  4PX1 A;  2IIY A;  5F06 A;  1SKR B;  3ZFL A;  1G6W A;  1SJI A;  1AAZ A;  4XS4 B;  1ZL9 A;  4L5O A;  1K0A A;  3LQ7 A;  4GSN A;  2OAC A;  2WB9 A;  1Y6E A;  2FWF A;  4FH8 A;  2AV4 A;  2ON7 A;  1GNW A;  5G5E A;  4J2F A;  2FLS A;  4ZL7 A;  1OAZ A;  1GTA A;  3C1S A;  2I4A A;  3GX8 A;  1JZR A;  3L9U A;  6GSV A;  2AYT A;  3GTU A;  2RUF A;  5DQY A;  1M9B A;  1XPV A;  1N2A A;  4ZBA A;  2WFC A;  1GSD A;  3HJM A;  4MJB A;  2C3T A;  3GMF A;  1XFL A;  4XRA A;  5IMF A;  9GSS A;  5A5K A;  4TR3 A;  2H0I A;  3CTF A;  3Q6O A;  1MTC A;  3D6I A;  4Q5R A;  1VF2 A;  3HJP A;  2KLX A;  2P5R A;  3QR6 A;  1QXH A;  1URM A;  1SD9 A;  2AB6 A;  3A2W A;  3DGQ A;  1DSB A;  3FZ5 A;  4TXV A;  2FCH A;  4GQC A;  2FA8 A;  3WT1 A;  1ZZY A;  5CRD A;  5HR2 A;  4QL9 A;  2PGT A;  3HKR A;  2WUL A;  1B9X C;  3VFI A;  5ECQ B;  4IQ1 A;  1JZW A;  4HI7 A;  2X99 A;  1V98 A;  5DQS A;  5IPG A;  1M99 A;  4LL4 B;  3EIN A;  5IO0 A;  4ML1 A;  3DD3 A;  1GSY A;  5G5F A;  4TKY A;  3ZML A;  4MDC A;  2GZY A;  5L71 A;  4KE3 A;  5J5N A;  2VCZ A;  6GSY A;  2BJX A;  3H79 A;  1MEK A;  3ZYW A;  1A0R P;  3C8E A;  3L0H A;  4GQF A;  2ON5 A;  1EEM A;  4WXT A;  1I9D A;  3W8J A;  4IS0 A;  4BVX A;  4CHS A;  5F8B A;  4NWY A;  2VCX A;  2TIR A;  1TK8 B;  3DIE A;  3VUR A;  1TOF A;  2DJ3 A;  3UAR A;  1O6J A;  3GTU B;  3KH7 A;  1TRV A;  2ALB A;  1GUK A;  2H1G A;  3KXO A;  5HFK A;  2AJQ B;  4N0Z A;  6GSX A;  4OWY A;  1M2B A;  2H75 A;  4IQA A;  4AJ7 A;  4FO5 A;  2VD0 A;  2HRN A;  4KCA A;  4PUR A;  3IRA A;  2XPD A;  2C1Y A;  1AQW A;  1K0C A;  2V2G A;  4XS6 A;  3GH9 A;  3ZLP A;  1U87 A;  5LNK e;  3LXT A;  1XW9 A;  5G31 A;  5IMC A;  4ISD A;  2VL3 A;  7GSS A;  1ZOF A;  4LL1 B;  3TB2 A;  1GSE A;  1KNG A;  2HRF A;  3F4R A;  5F07 A;  3FK8 A;  1UN2 A;  5H5Q A;  2L5O A;  2N5F A;  1SD8 A;  5FT3 A;  3HVX A;  4GXZ A;  1X5D A;  1Z7P A;  2IMF A;  4MZB A;  2LKU A;  4K7N A;  2Z9S A;  2IL3 A;  4I8B A;  3VPT A;  4MAB A;  4I97 A;  2XBQ A;  4EVM A;  4EE0 A;  2PWJ A;  4MH2 A;  4KGI A;  3UAP A;  3C7M A;  5EVO A;  1A23 A;  2WJU A;  4OO5 A;  4HZ2 A;  4EL1 A;  4WR4 A;  4LA1 A;  2RII A;  5CRG A;  2NBS A;  4PQH A;  5ECP B;  4EKZ A;  5C00 A;  3LWA A;  1R26 A;  3HXS A;  2OE3 A;  5JWQ B;  4ZB8 A;  2GSR A;  3HHV A;  3HA9 A;  1LBK A;  3HVV A;  4F9Z A;  4DEJ A;  14GS A;  1TK0 B;  2LJR A;  4N0V A;  4V2N A;  2CA8 A;  1IYH A;  1EOH A;  5F0G A;  1PGT A;  2A2S A;  1H4O A;  2AUV A;  1PKZ A;  2OKA A;  5EY6 A;  4FYU A;  2VL2 C;  10GS A;  3Q18 A;  3BBY A;  1WIK A;  1Z5Y E;  2GZZ A;  2L5L A; 
#chains in the Genus database with same CATH topology
 4Z2R A;  2VLU A;  2OBI A;  4HU7 A;  4O92 A;  2D2Z A;  4TR4 A;  3ISO A;  2V6O A;  2G2Q A;  1AC1 A;  4G0L A;  1WE0 A;  2H01 A;  1EGR A;  3IE3 A;  3HJO A;  4O32 A;  5IQY A;  2LRN A;  4YH2 A;  3P90 A;  1T7P B;  4RQX A;  1O81 A;  1JLW A;  1T3B A;  3EMP A;  3H1N A;  5COH A;  4IEL A;  6GSS A;  2OE1 A;  2MMA A;  4QQ7 A;  4DSS A;  2VOC A;  4HQZ A;  2DML A;  1A8L A;  2CQ9 A;  1Q4J A;  3G7Y A;  1EWX A;  1WJK A;  3VK9 A;  3LYP A;  3PH9 A;  2PER A;  2RM6 A;  4A5P A;  2UZ8 A;  5KEJ A;  1M2A A;  4ZBD A;  2LNT A;  4PGT A;  4GSS A;  3ZFB A;  1FW1 A;  1V9W A;  3WGX A;  3EYT A;  1XW5 A;  2V32 A;  3GUS A;  5IM9 A;  2PVQ A;  4WEY A;  4J56 E;  4ZIL A;  1F37 A;  4GLT A;  4AJ8 A;  4GTU A;  3F9U A;  1OKD A;  11GS A;  3TOT A;  1JFU A;  1PQN A;  2PUK C;  2ZUP A;  2L57 A;  4IJ3 A;  4TXO B;  4Z2U A;  20GS A;  1M2D A;  3RAZ A;  1G7E A;  1ZCP A;  1THX A;  3O3T A;  2HE3 A;  3QCP A;  4HJ2 A;  3CTG A;  3MSZ A;  1EP8 A;  1XOB A;  1K3Y A;  2H0G A;  5IMV A;  3WYW A;  5AN1 A;  1A8Y A;  2C3Q A;  2R4V A;  4HDE A;  2M46 A;  4EF0 A;  3KTB A;  1XBS A;  1PKW A;  1FB6 A;  1FHE A;  4ICY A;  1G0T A;  3FZ4 A;  4BA7 A;  5D9X A;  2LRT A;  1WPI A;  4OFM A;  1EGO A;  2GLR A;  2GQL A;  4WET A;  4MCU A;  1DBY A;  2FUG 2;  3HCZ A;  3IHQ A;  4CY6 A;  2WRT A;  4OD7 A;  3EVI A;  3SWL A;  3DRN A;  3E9J B;  1BJX A;  2F8F A;  1M3J A;  5IO2 A;  2DIY A;  4EC0 A;  5D73 A;  2YP6 A;  4IGJ A;  2YPM A;  4NAX A;  3D5J A;  1GTI A;  4IVF A;  4BL7 B;  3IOS A;  3PPU A;  2A4H A;  2V6K A;  4KUN A;  4RQR A;  3QMX A;  2B5E A;  3MYD A;  5KOW A;  1V57 A;  3A5W A;  4PUA A;  3F8U A;  4HUA A;  3KIJ A;  4F82 A;  2CVD A;  2WS2 A;  3ME7 A;  4CY8 A;  3UVT A;  2ES7 A;  1AW9 A;  2YJH A;  3LYK A;  1SU9 A;  2QGV A;  2X8H A;  4DVC A;  4F03 A;  5J41 A;  2LV3 A;  2GQK A;  3N5O A;  3GSS A;  1YF1 A;  2M80 A;  3VI5 A;  3I43 A;  2YZH A;  3GYK A;  3W8S A;  2B7J A;  5C04 A;  3GRX A;  1A24 A;  1F3A A;  3TOU A;  4EXJ A;  1KBN A;  2R0P A;  4HU9 A;  4V2L A;  3M0F A;  2I9H A;  5J3R A;  3IK7 A;  1EP7 A;  1YEP A;  2R3X A;  3ZRD A;  4OFT A;  4IHU A;  4POB A;  4AJ6 A;  4G2E A;  4L0U A;  4WBJ A;  3TCO A;  2V41 A;  5GZZ B;  5BMU A;  2PBJ A;  3GFK A;  5DCH A;  2IN3 A;  1F3B A;  2WZ9 A;  4PUF C;  3ERF A;  1NHO A;  2DJJ A;  2LST A;  3APO A;  4MP4 A;  5J4U A;  1ML6 A;  3APQ A;  5KN0 A;  1YKA A;  4BPY A;  1HYU A;  3GN3 A;  3I69 A;  2K8S A;  1JZO A;  5D8I A;  4DSR A;  2LRC A;  1QMV A;  2H6X A;  3J7Y b;  1LJR A;  4XHM A;  1GL8 A;  1ERT A;  4MZW A;  4ACS A;  2GTU A;  5G2Z A;  4NXI A;  3HYP A;  3TRX A;  1GLP A;  2JAD A;  2R0C A;  5DAL A;  2H8L A;  5AIX A;  2XC2 A;  3EU3 A;  4O5Q A;  3NZN A;  3TDG A;  1TK5 B;  1CQG A;  1GSF A;  3TRP A;  1Q98 A;  2MMN A;  2CAI A;  1ZYP A;  2HT9 A;  2VM1 A;  4MF7 A;  3OR5 A;  4V2M A;  2CVB A;  4Q5Q A;  13GS A;  3KD0 A;  2B5Y A;  5HR3 A;  4K5R A;  2J23 A;  2L59 A;  2GGT A;  1MD3 A;  2J9H A;  3CXG A;  1TI3 A;  3KMO A;  2G0F A;  3HVS A;  2CAQ A;  1W89 A;  2QC7 A;  2H71 A;  2P31 A;  2DBC A;  1MDJ A;  2AHE A;  5ECK B;  3EMX A;  2CV4 A;  1M9A A;  5ID2 B;  1M0U A;  2K18 A;  4G10 A;  1RW1 A;  3ZVJ A;  2H73 A;  5DJL A;  3LXZ A;  4FYB A;  5B6M A;  3F63 A;  4NHZ A;  3MDK A;  2C0E A;  5FHI A;  2YJ7 A;  1GSU A;  1A2L A;  2VO4 A;  5HR0 A;  5DDL A;  2K6V A;  3K8N A;  3NOF A;  1OVN A;  1ON4 A;  1SJZ A;  2VL2 A;  2PPT A;  3P8W A;  1O85 A;  3CRU A;  2O7K A;  5JCW A;  2LJA A;  2GDR A;  2QA1 A;  1ZYN A;  3A2X A;  4MK3 A;  5IIZ A;  4NHW A;  4XCS A;  2C0F A;  2HSY A;  3TJJ A;  5AIV A;  3TKR A;  2XPE A;  1TRU A;  1TP9 A;  3IAS 2;  1OC9 A;  1Z6M A;  1TW9 A;  3EPT A;  2DIZ A;  2HXK A;  4K0G A;  1I5G A;  4KW6 A;  3IC4 A;  2NPB A;  2BMX A;  2B1L A;  3I6A A;  5KN3 A;  1FO5 A;  3DYR A;  1XZO A;  4KDU A;  2VCW A;  3GUR A;  1TTZ A;  5H5S A;  4Q5F A;  2FWH A;  2I81 A;  5E59 A;  3KTL A;  4BIK A;  3DXB A;  2HYX A;  1E6B A;  4J57 E;  1O73 A;  5ECL B;  1O8X A;  3F3R A;  5AIS A;  1F6M C;  1R5A A;  2H30 A;  1PL1 A;  3V1W A;  1NHY A;  4OO4 A;  1Z9H A;  1WRY A;  4ECJ A;  1XIY A;  4XTS A;  1T1V A;  5DAK A;  2I3Y A;  3FR9 A;  3ZL5 A;  1Y25 A;  2JSY A;  1SL0 B;  2GS3 A;  4AF2 A;  1JHB A;  1NM3 A;  2VLT A;  4D73 A;  4TOP A;  1O7U A;  1T4Z A;  3D0Z A;  4N30 A;  3TKS E;  18GS A;  3IR4 A;  2VLV A;  1ZMA A;  4Z7X A;  1XWA A;  1X5C A;  1MDI A;  4FYC A;  4V1A g;  3WT2 A;  4ML6 A;  4WKW A;  1YEX A;  2H72 A;  5CRW A;  1A0F A;  3QAW A;  3FZ9 A;  3E0U A;  3ZRE A;  1NW2 A;  2ZCT A;  2YV7 A;  1TU7 A;  3F6D A;  1BX9 A;  1U3A A;  2REM A;  3C1R A;  5EPF A;  3QAV A;  2IPA A;  5B6N A;  1WP0 A;  2VAF A;  3DVX A;  4MA9 A;  2H1B A;  2YWO A;  3H93 A;  1KTE A;  4BVX B;  1THO A;  3ZIT A;  2OBK A;  5GST A;  1CQH A;  2H1D A;  5G1K A;  3VWU A;  5CAX A;  4F2I A;  3EU4 A;  4HS1 A;  3QOU A;  1OYJ A;  2YN1 A;  3GIX A;  5HQP A;  22GS A;  2B1K A;  4HZ4 A;  5E4W A;  1HQO A;  2R2J A;  3HD5 A;  3WD6 A;  2GVP A;  2YAN A;  2VD1 A;  1BYE A;  5HFI A;  3FMW A;  1A2J A;  1HNB A;  4Q5N A;  3P7X A;  4HOJ A;  8GSS A;  2MBS A;  2EIQ A;  2PVO C;  3VI7 A;  3BCI A;  2KP2 A;  2NTO A;  2AAW A;  1S3A A;  3QFA C;  5J9B A;  4N10 A;  1XWG A;  2TRC P;  2C80 A;  17GS A;  4YQM A;  1SJ6 A;  2WCI A;  2HNL A;  2YCD A;  2TRX A;  2K9F A;  1N8J A;  1SYX A;  1PRX A;  1Z6N A;  4NV5 A;  1UVZ A;  2X8G A;  1K0D A;  3F6F A;  3H8Q A;  2ZNM A;  1K3O A;  1XCC A;  2A4V A;  1SYR A;  2K8V A;  1R4W A;  3BD2 A;  3IXR A;  4EIQ A;  1EZK A;  2N5A A;  1GLQ A;  4ECI A;  1SK2 A;  4I5Q A;  5DCG A;  2LQQ A;  4L5L A;  4YKG A;  5DBQ A;  2LS5 A;  3NIV A;  3CQF A;  4LMV A;  2C0G A;  1XWK A;  1SL1 B;  4OCF A;  2QSI A;  1PSQ A;  2IWT A;  3PR8 A;  2RLI A;  3H4K A;  1U88 A;  2BTO T;  3IK9 A;  3C71 A;  1VRS D;  2X64 A;  2KOK A;  1SK1 A;  3GL3 A;  3UBK A;  1VGL A;  1HD2 A;  2YNX A;  3GL5 A;  5JWO B;  1ACV A;  3QPM A;  2MYG A;  5IPH A;  4JE1 A;  4OCE A;  1PL2 A;  4IBP A;  4TR0 A;  2HZE A;  2JU5 A;  4WF4 A;  3GKM A;  1YZX A;  1X9W B;  1GWC A;  2JZR A;  2VM2 A;  1M3I A;  4WR5 A;  4ZL9 A;  3US3 A;  4KAE A;  5GAP D;  2A2R A;  4AGS A;  1HNC A;  5ELG A;  3TGZ A;  4KCE A;  1K0O A;  1VF3 A;  2FNO A;  1K3L A;  4ULX A;  4TR1 A;  2YWI A;  3CSI A;  3D4M A;  3BOA A;  4EDZ A;  1BAY A;  3FEU A;  1FVK A;  5LCZ A;  3IHG A;  2IFQ A;  4XS4 A;  2B5X A;  3P2A A;  2VL9 A;  3FR3 A;  4MNN A;  5CRE A;  3FYG A;  2NVL A;  5J9C A;  1J08 A;  1T00 A;  3PIN A;  1B48 A;  2XHF A;  2H6Z A;  2GST A;  1E2Y A;  3E3E A;  3UIW A;  2P0G A;  4ZL8 A;  3UBL A;  1OC3 A;  3RPP A;  3UMA A;  2WDU A;  1YJ6 A;  2F51 A;  2H66 A;  2FA4 A;  3GKX A;  3PGT A;  1FG4 A;  4DSS B;  3GKN A;  2N5B A;  2H19 A;  5ELA A;  4JZQ A;  3FY7 A;  3EUR A;  2DJ2 A;  4K7O A;  3W6G A;  3G9B A;  2YZU A;  2XBI A;  3EWL A;  12GS A;  1M7T A;  3CSJ A;  1U6T A;  1AQX A;  4OMV A;  2KP1 A;  4JU5 A;  3TUE A;  3ERW A;  4QL7 A;  4X0X A;  4MF6 A;  2JZS A;  1HNA A;  3ED3 A;  3M9J A;  3IBH A;  2O8V B;  1QGV A;  4K5S A;  3A3T A;  1R5P A;  3KM6 A;  1FB0 A;  1F9M A;  3S9F A;  3GNJ A;  2DLX A;  4DSQ A;  5G30 A;  2L4C A;  1JLV A;  2L4Q A;  4FIW A;  2PN8 A;  3O76 A;  1ZYQ B;  3LSZ A;  1UC7 A;  4BWQ A;  1ERV A;  4K0N A;  2CZ3 A;  1OE7 A;  3MIX A;  1WOU A;  5AGY A;  5IOX A;  1QUW A;  3C73 A;  5FWG A;  4NPB A;  5A4W A;  4MJA A;  3FR6 A;  3ZIJ A;  2V1M A;  5ECO B;  5EL8 A;  2R37 A;  1V40 A;  3SBC A;  2IMK A;  4PQI A;  1ERW A;  4RI6 A;  1SL2 B;  2YOI A;  1TKD B;  5B8A A;  3GST A;  4ECB A;  3GV1 A;  2IFQ B;  3EE2 A;  5D9W A;  1NSW A;  2OJL A;  4HJM A;  2F8A A;  2C0D A;  2R5G A;  4JED A;  3HDC A;  1XWC A;  2VCQ A;  1QFN A;  5ECS A;  4TVE A;  4POM A;  1TI1 A;  4YQV A;  1TDI A;  3IPZ A;  3KEB A;  2QKE A;  3GA4 A;  4BWS A;  4N11 A;  4BVY A;  3AY8 A;  3F4T A;  4IJI A;  1LU4 A;  2F3M A;  5D93 A;  3D22 A;  2QA2 A;  3ZZX A;  1K0M A;  4MF5 A;  1OC8 A;  5KOX A;  2FWE A;  2FGX A;  1J0F A;  1GRX A;  4YAV A;  1ZGN A;  3G7I A;  4TRX A;  2DC5 A;  5CO3 A;  1X5E A;  3TRQ A;  1ILO A;  3TKS C;  1TRW A;  2FY6 A;  3M3M A;  2DJK A;  3ME8 A;  4PNG A;  1QK8 A;  2PMT A;  3QAG A;  4ECC A;  2H1A A;  2H0H A;  4NV2 A;  1GNE A;  4I2U A;  3DEX A;  4ID0 A;  2LQO A;  5KN1 A;  19GS A;  3GH6 A;  4GWR A;  5B8B A;  5IOW A;  3GHA A;  1TU8 A;  4ZXG A;  1XVW A;  3ZIV A;  4EO3 A;  1ST9 A;  3U5R E;  4EIP A;  4FQU A;  3VLN A;  2E2G A;  2E2M A;  2PU9 C;  1PN9 A;  1V58 A;  1C72 A;  5CRH A;  4GST A;  4X43 A;  3L78 A;  2H74 A;  3KP8 A;  4K1F A;  2O89 A;  4JR6 A;  2HFD A;  3R2Q A;  1PX6 A;  3KZQ A;  2JZT A;  1T4Y A;  4MPF A;  3MAK A;  1S3C A;  4X4J A;  4TN8 A;  3U6V A;  1KEB A;  3DML A;  4F0B A;  1A2M A;  1F2E A;  2WGR A;  3JCM L;  3L4N A;  3RPN A;  1O8W A;  5DAL B;  2VCT A;  1T8E B;  2I1U A;  1AXD A;  2KHP A;  5ECH B;  2HI7 A;  1S3D A;  4BVY B;  1DE1 A;  1SEN A;  5ECM B;  1GH2 A;  1QQ2 A;  4KX4 A;  3I9V 2;  3J7Y k;  3TKP A;  2F9S A;  3QDN A;  4G9H A;  1U3I A;  5KN2 A;  2GQM A;  3CSH A;  1WWJ A;  3HZ8 A;  4ZBB A;  1ABA A;  3LW9 A;  1VF4 A;  1SKW B;  4KA0 A;  1GTB A;  3M1G A;  2MMZ A;  5ABR A;  2JAC A;  3LG6 A;  4K9Z A;  3WGE A;  4MJC A;  3FRC A;  1RK4 A;  4YKF A;  3RHC A;  2CX3 A;  1X9M B;  3BCK A;  4XIH A;  4LMW A;  1PN0 A;  2HSH A;  4LLR A;  2MBT A;  3LOR A;  4EUY A;  2C3N A;  2OA7 A;  5JCG A;  1XVQ A;  1GP1 A;  1OKT A;  4KF9 A;  16GS A;  4KH7 A;  3LJR A;  2L6D A;  3FW2 A;  3GKK A;  1PA3 A;  5A4V A;  4POK A;  1ERU A;  2DKI A;  3IDV A;  1Z3E A;  1W4V A;  5D9V A;  3UJ1 A;  4L8E A;  1DE2 A;  1OC9 B;  2MMO A;  3MWH A;  4YQU A;  5ECR B;  1TXX A;  1MD4 A;  1GUM A;  4JBB A;  4O7H A;  2H70 A;  5F05 A;  1G7O A;  2IJY A;  2FHE A;  1B9Y C;  3CRT A;  4HSC X;  3FKF A;  4TXO A;  2E0Q A;  4JRR A;  5JCU A;  4MMM A;  4JR4 A;  4PXO A;  1B4P A;  3IV4 A;  4IW9 A;  4XRD A;  1EV4 A;  2GT5 A;  1FOV A;  3ZTL A;  2HZF A;  4L0W A;  1FVJ A;  4PTS A;  4HQS A;  2CT6 A;  3VWX A;  4ZIJ A;  2GT6 A;  3Q19 A;  3KJY A;  1YF0 A;  4G0K A;  3KGK A;  1WMJ A;  5A4U A;  3RBT A;  4ZB6 A;  2DJ0 A;  3QD9 A;  1USB A;  4RI7 A;  3F3Q A;  4CW9 A;  5DAK B;  1X9S B;  2B3S A;  6GSU A;  4NMU A;  2HRK A;  1EV9 A;  4ZB9 A;  1Z7R A;  3BJ5 A;  5ECI B;  2RM5 A;  4D73 B;  5ECN B;  1PD2 1;  3HZ4 A;  5H5R A;  3DKS A;  1OE8 A;  4V1A p;  5JWR B;  1S3R A;  2IMD A;  4IN0 A;  2VIM A;  4YAP A;  3TJG A;  3LGC A;  5D96 A;  2EIR A;  2LEG A;  1BED A;  4K7I A;  4MH3 A;  4BL7 A;  1G6Y A;  1V2A A;  1K0N A;  6GST A;  2FWG A;  4POL A;  3MNG A;  4CDO A;  3CMI A;  2VUP A;  2A2P A;  2LJK A;  3UEM A;  2CVK A;  1SKS B;  2X49 A;  2X8C A;  1TRS A;  1EOG A;  4E8H A;  2R0G A;  2NDO A;  3D4T A;  1PX7 A;  1AUC A;  4PQ1 A;  4E8E A;  4GF0 A;  4I2T A;  3TJF A;  1DUG A;  5D9T A;  2HLS A;  2C4J A;  1GTU A;  3DVW A;  1ZYE A;  3EC3 A;  4WF5 A;  2B7K A;  1XOA A;  1YKC A;  2FD3 A;  1AIU A;  1GSS A;  1XW6 A;  2EC4 A;  2YV9 A;  2LTK A;  1JZD A;  3TJK A;  2O85 A;  3O6T A;  1H75 A;  1RQM A;  1VF1 A;  2CX4 A;  3HY2 A;  5G1L A;  2CZ2 A;  4HEA 2;  3IC8 A;  3CYN A;  3FHK A;  4KSO A;  2P5Q A;  3TJB A;  5GSS A;  2B6M A;  4KDX A;  5INY A;  2E7P A;  3LEF A;  4OFN A;  1IYI A;  4KDY A;  3RHB A;  1TJD A;  3L9S A;  2IME A;  1YY7 A;  4MJE A;  4KND A;  5IMZ A;  5LD0 A;  4RUV A;  4IP1 A;  3TKS A;  1GUH A;  3LFL A;  2DSA A;  1XG8 A;  4K2X A;  2DKH A;  5HFG A;  4O5R A;  1EEJ A;  2OE0 A;  1XXU A;  3DWV A;  6GSW A;  3VPQ A;  3KH9 A;  1GUL A;  5HR1 A;  2DJ1 A;  2M72 A;  2X4A A;  4K2D A;  1SK0 A;  4WBR D;  4IKH A;  1XWB A;  3N9J A;  4MPG A;  5ENU A;  4GCI A;  5CNW A;  3VWV A;  4H86 A;  2LUS A;  4P3Y B;  3D21 A;  3Q74 A;  1BQ7 A;  3KMN A;  1MDK A;  3RDW A;  2GSQ A;  1R7H A;  2MZC A;  2R6K A;  2KUC A;  1FAA A;  2C8U A;  4K6X A;  3CBU A;  2JSZ A;  3IAM 2;  2JL4 A;  4X1U A;  2LNS A;  3ERG A;  3UOM A;  5GAN D;  1PMT A;  2IMI A;  4XS1 A;  1AQV A;  5CYY A;  3ZVJ D;  4MLY A;  3F4S A;  5B7C A;  4KSM A;  2OAD A;  2GZP A;  2L6C A;  3VWW A;  1X0R A;  1YDK A;  3KCM A;  3GX0 A;  3UL3 A;  4ILF A;  3QFB C;  3FZA A;  2HZE B;  2VCV A;  1J9B A;  1B4Q A;  2RUE A;  3M9K A;  4K8M A;  5IMD A;  2H76 A;  4G19 A;  4PNF A;  3M8N A;  3R3E A;  2YWN A;  2YWM A;  2EIO A;  3KP9 A;  4IP6 A;  2H6Y A;  3L9V A;  5IMA A;  5CP1 A;  1UA5 A;  3G7J A;  4I6X A;  4GRF A;  4F0C A;  2DMM A;  3F0I A;  4TW5 A;  5ID2 A;  3TKQ A;  4KB3 A;  1K0B A;  1BG5 A;  1YQ1 A;  3ZMK A;  3IA1 A;  2O87 A;  4EDY A;  1GSQ A;  3A2V A;  3UVH A;  2HRA A;  4MZC A;  3APS A;  5DVB A;  5DJM A;  1B8X A;  4TR1 B;  2GSS A;  3WGD A;  4PX1 A;  2IIY A;  5F06 A;  1SKR B;  3ZFL A;  1G6W A;  1SJI A;  1AAZ A;  4XS4 B;  1ZL9 A;  4L5O A;  1K0A A;  3LQ7 A;  4GSN A;  2OAC A;  2WB9 A;  1Y6E A;  2FWF A;  4FH8 A;  2HSM A;  2AV4 A;  2ON7 A;  5BRT A;  1GNW A;  5G5E A;  4J2F A;  2FLS A;  4ZL7 A;  1OAZ A;  1GTA A;  3C1S A;  2I4A A;  3GX8 A;  1FOH A;  1JZR A;  3L9U A;  6GSV A;  2AYT A;  3GTU A;  2RUF A;  5DQY A;  1M9B A;  1XPV A;  1N2A A;  4ZBA A;  2WFC A;  1GSD A;  3HJM A;  4MJB A;  2C3T A;  3GMF A;  1XFL A;  4XRA A;  5IMF A;  9GSS A;  5A5K A;  4TR3 A;  2H0I A;  3CTF A;  3Q6O A;  1MTC A;  3D6I A;  4Q5R A;  1VF2 A;  3HJP A;  2KLX A;  2P5R A;  3QR6 A;  1QXH A;  1URM A;  1SD9 A;  2AB6 A;  3A2W A;  3DGQ A;  1DSB A;  3FZ5 A;  4TXV A;  2FCH A;  4GQC A;  2FA8 A;  3WT1 A;  1ZZY A;  5CRD A;  5HR2 A;  4QL9 A;  2PGT A;  3HKR A;  2WUL A;  1B9X C;  3VFI A;  5ECQ B;  4IQ1 A;  1JZW A;  4HI7 A;  2X99 A;  1V98 A;  5DQS A;  5IPG A;  1M99 A;  4LL4 B;  3EIN A;  5IO0 A;  4ML1 A;  3A5I A;  3DD3 A;  1GSY A;  5G5F A;  4TKY A;  3ZML A;  4MDC A;  2GZY A;  5L71 A;  4KE3 A;  5J5N A;  2VCZ A;  6GSY A;  2BJX A;  3H79 A;  1MEK A;  3ZYW A;  1A0R P;  3C8E A;  3L0H A;  4GQF A;  2ON5 A;  3HVN A;  1EEM A;  4WXT A;  1I9D A;  3W8J A;  4IS0 A;  4BVX A;  4CHS A;  5F8B A;  4NWY A;  2VCX A;  2TIR A;  1TK8 B;  3DIE A;  3VUR A;  1TOF A;  2DJ3 A;  3UAR A;  1O6J A;  3GTU B;  1PFO A;  3KH7 A;  1TRV A;  2ALB A;  1GUK A;  2H1G A;  3KXO A;  5HFK A;  2AJQ B;  4N0Z A;  6GSX A;  4OWY A;  1M2B A;  2H75 A;  4IQA A;  4O5U A;  4AJ7 A;  4FO5 A;  2VD0 A;  2HRN A;  4KCA A;  4PUR A;  3IRA A;  2XPD A;  2C1Y A;  1AQW A;  1K0C A;  2V2G A;  4XS6 A;  3GH9 A;  3ZLP A;  1U87 A;  5LNK e;  3LXT A;  1XW9 A;  5G31 A;  5IMC A;  4ISD A;  2VL3 A;  7GSS A;  1ZOF A;  4LL1 B;  3TB2 A;  1GSE A;  1KNG A;  2HRF A;  3F4R A;  5F07 A;  3FK8 A;  1UN2 A;  5H5Q A;  2L5O A;  2N5F A;  1SD8 A;  5FT3 A;  3HVX A;  4GXZ A;  1X5D A;  1Z7P A;  2IMF A;  4MZB A;  2LKU A;  4K7N A;  2Z9S A;  2IL3 A;  4I8B A;  3VPT A;  4MAB A;  4I97 A;  4Z2T A;  2XBQ A;  4EVM A;  4EE0 A;  2PWJ A;  4MH2 A;  4KGI A;  3UAP A;  3C7M A;  5EVO A;  1A23 A;  2WJU A;  4OO5 A;  4HZ2 A;  4EL1 A;  4WR4 A;  4LA1 A;  2RII A;  5CRG A;  2NBS A;  4PQH A;  5ECP B;  4EKZ A;  5C00 A;  3LWA A;  1R26 A;  3HXS A;  2OE3 A;  5JWQ B;  4ZB8 A;  2GSR A;  3HHV A;  3HA9 A;  1LBK A;  3HVV A;  4F9Z A;  4DEJ A;  14GS A;  1TK0 B;  2LJR A;  4N0V A;  4V2N A;  4USS A;  2CA8 A;  1IYH A;  1EOH A;  5F0G A;  1PGT A;  2A2S A;  1H4O A;  2AUV A;  1PKZ A;  4G0I A;  2OKA A;  5EY6 A;  4FYU A;  2VL2 C;  10GS A;  3Q18 A;  3BBY A;  1WIK A;  1Z5Y E;  2GZZ A;  2L5L A; 
#chains in the Genus database with same CATH homology
 4Z2R A;  2VLU A;  2OBI A;  4HU7 A;  4O92 A;  2D2Z A;  4TR4 A;  3ISO A;  2V6O A;  2G2Q A;  1AC1 A;  4G0L A;  1WE0 A;  2H01 A;  1EGR A;  3IE3 A;  3HJO A;  4O32 A;  5IQY A;  2LRN A;  4YH2 A;  3P90 A;  1T7P B;  4RQX A;  1O81 A;  1JLW A;  1T3B A;  3EMP A;  3H1N A;  5COH A;  4IEL A;  6GSS A;  2OE1 A;  2MMA A;  4QQ7 A;  4DSS A;  2VOC A;  4HQZ A;  2DML A;  1A8L A;  2CQ9 A;  1Q4J A;  3G7Y A;  1EWX A;  1WJK A;  3VK9 A;  3LYP A;  3PH9 A;  2PER A;  2RM6 A;  4A5P A;  2UZ8 A;  5KEJ A;  1M2A A;  4ZBD A;  2LNT A;  4PGT A;  4GSS A;  3ZFB A;  1FW1 A;  1V9W A;  3WGX A;  3EYT A;  1XW5 A;  2V32 A;  3GUS A;  5IM9 A;  2PVQ A;  4WEY A;  4J56 E;  4ZIL A;  1F37 A;  4GLT A;  4AJ8 A;  4GTU A;  3F9U A;  1OKD A;  11GS A;  3TOT A;  1JFU A;  1PQN A;  2PUK C;  2ZUP A;  2L57 A;  4IJ3 A;  4TXO B;  4Z2U A;  20GS A;  1M2D A;  3RAZ A;  1G7E A;  1ZCP A;  1THX A;  3O3T A;  2HE3 A;  3QCP A;  4HJ2 A;  3CTG A;  3MSZ A;  1EP8 A;  1XOB A;  1K3Y A;  2H0G A;  5IMV A;  3WYW A;  5AN1 A;  1A8Y A;  2C3Q A;  2R4V A;  4HDE A;  2M46 A;  4EF0 A;  3KTB A;  1XBS A;  1PKW A;  1FB6 A;  1FHE A;  4ICY A;  1G0T A;  3FZ4 A;  4BA7 A;  5D9X A;  2LRT A;  1WPI A;  4OFM A;  1EGO A;  2GLR A;  2GQL A;  4WET A;  4MCU A;  1DBY A;  2FUG 2;  3HCZ A;  3IHQ A;  4CY6 A;  2WRT A;  4OD7 A;  3EVI A;  3SWL A;  3DRN A;  3E9J B;  1BJX A;  2F8F A;  5IO2 A;  2DIY A;  4EC0 A;  5D73 A;  2YP6 A;  4IGJ A;  2YPM A;  4NAX A;  3D5J A;  1GTI A;  4IVF A;  4BL7 B;  3IOS A;  3PPU A;  2A4H A;  2V6K A;  4KUN A;  4RQR A;  3QMX A;  2B5E A;  3MYD A;  5KOW A;  1V57 A;  3A5W A;  4PUA A;  3F8U A;  4HUA A;  3KIJ A;  4F82 A;  2CVD A;  2WS2 A;  3ME7 A;  4CY8 A;  3UVT A;  2ES7 A;  1AW9 A;  2YJH A;  3LYK A;  1SU9 A;  2QGV A;  2X8H A;  4DVC A;  4F03 A;  5J41 A;  2LV3 A;  2GQK A;  3N5O A;  3GSS A;  1YF1 A;  2M80 A;  3VI5 A;  3I43 A;  2YZH A;  3GYK A;  3W8S A;  2B7J A;  5C04 A;  3GRX A;  1A24 A;  1F3A A;  3TOU A;  4EXJ A;  1KBN A;  2R0P A;  4HU9 A;  4V2L A;  3M0F A;  2I9H A;  5J3R A;  3IK7 A;  1EP7 A;  1YEP A;  2R3X A;  3ZRD A;  4OFT A;  4IHU A;  4POB A;  4AJ6 A;  4G2E A;  4L0U A;  4WBJ A;  3TCO A;  2V41 A;  5GZZ B;  5BMU A;  2PBJ A;  3GFK A;  5DCH A;  2IN3 A;  1F3B A;  2WZ9 A;  4PUF C;  3ERF A;  1NHO A;  2DJJ A;  2LST A;  3APO A;  4MP4 A;  5J4U A;  1ML6 A;  3APQ A;  5KN0 A;  1YKA A;  4BPY A;  1HYU A;  3GN3 A;  3I69 A;  2K8S A;  1JZO A;  5D8I A;  4DSR A;  2LRC A;  1QMV A;  2H6X A;  3J7Y b;  1LJR A;  4XHM A;  1GL8 A;  1ERT A;  4MZW A;  4ACS A;  2GTU A;  5G2Z A;  4NXI A;  3HYP A;  3TRX A;  1GLP A;  2JAD A;  2R0C A;  5DAL A;  5AIX A;  2H8L A;  2XC2 A;  3EU3 A;  4O5Q A;  3NZN A;  3TDG A;  1TK5 B;  1CQG A;  1GSF A;  3TRP A;  1Q98 A;  2MMN A;  2CAI A;  1ZYP A;  2HT9 A;  2VM1 A;  4MF7 A;  3OR5 A;  4V2M A;  2CVB A;  4Q5Q A;  13GS A;  3KD0 A;  2B5Y A;  5HR3 A;  4K5R A;  2J23 A;  2L59 A;  2GGT A;  1MD3 A;  2J9H A;  3CXG A;  1TI3 A;  3KMO A;  2G0F A;  3HVS A;  2CAQ A;  1W89 A;  2QC7 A;  2H71 A;  2P31 A;  2DBC A;  1MDJ A;  2AHE A;  5ECK B;  3EMX A;  2CV4 A;  1M9A A;  5ID2 B;  1M0U A;  2K18 A;  4G10 A;  1RW1 A;  3ZVJ A;  2H73 A;  5DJL A;  3LXZ A;  4FYB A;  5B6M A;  3F63 A;  4NHZ A;  3MDK A;  2C0E A;  5FHI A;  2YJ7 A;  1GSU A;  1A2L A;  2VO4 A;  5HR0 A;  5DDL A;  2K6V A;  3K8N A;  3NOF A;  1OVN A;  1ON4 A;  1SJZ A;  2VL2 A;  2PPT A;  3P8W A;  1O85 A;  3CRU A;  2O7K A;  5JCW A;  2LJA A;  2GDR A;  2QA1 A;  1ZYN A;  3A2X A;  4MK3 A;  5IIZ A;  4NHW A;  4XCS A;  2C0F A;  2HSY A;  3TJJ A;  5AIV A;  3TKR A;  2XPE A;  1TRU A;  1TP9 A;  3IAS 2;  1OC9 A;  1Z6M A;  1TW9 A;  3EPT A;  2DIZ A;  2HXK A;  4K0G A;  1I5G A;  4KW6 A;  3IC4 A;  2NPB A;  2BMX A;  2B1L A;  3I6A A;  5KN3 A;  1FO5 A;  3DYR A;  1XZO A;  4KDU A;  2VCW A;  3GUR A;  1TTZ A;  5H5S A;  4Q5F A;  2FWH A;  2I81 A;  5E59 A;  3KTL A;  3DXB A;  2HYX A;  1E6B A;  4J57 E;  1O73 A;  5ECL B;  1O8X A;  3F3R A;  5AIS A;  1F6M C;  1R5A A;  2H30 A;  1PL1 A;  3V1W A;  1NHY A;  4OO4 A;  1Z9H A;  1WRY A;  4ECJ A;  1XIY A;  4XTS A;  1T1V A;  5DAK A;  2I3Y A;  3FR9 A;  3ZL5 A;  1Y25 A;  2JSY A;  1SL0 B;  2GS3 A;  4AF2 A;  1JHB A;  1NM3 A;  2VLT A;  4D73 A;  4TOP A;  1O7U A;  1T4Z A;  3D0Z A;  4N30 A;  3TKS E;  18GS A;  3IR4 A;  2VLV A;  1ZMA A;  4Z7X A;  1XWA A;  1X5C A;  1MDI A;  4FYC A;  4V1A g;  3WT2 A;  4ML6 A;  4WKW A;  1YEX A;  2H72 A;  5CRW A;  1A0F A;  3QAW A;  3FZ9 A;  3E0U A;  3ZRE A;  1NW2 A;  2ZCT A;  2YV7 A;  1TU7 A;  3F6D A;  1BX9 A;  1U3A A;  2REM A;  3C1R A;  5EPF A;  3QAV A;  2IPA A;  5B6N A;  1WP0 A;  2VAF A;  3DVX A;  4MA9 A;  2H1B A;  2YWO A;  3H93 A;  1KTE A;  4BVX B;  1THO A;  3ZIT A;  2OBK A;  5GST A;  1CQH A;  2H1D A;  5G1K A;  3VWU A;  5CAX A;  4F2I A;  3EU4 A;  4HS1 A;  3QOU A;  1OYJ A;  2YN1 A;  3GIX A;  5HQP A;  22GS A;  2B1K A;  4HZ4 A;  5E4W A;  1HQO A;  2R2J A;  3HD5 A;  3WD6 A;  2GVP A;  2YAN A;  2VD1 A;  1BYE A;  5HFI A;  3FMW A;  1A2J A;  1HNB A;  4Q5N A;  3P7X A;  4HOJ A;  8GSS A;  2MBS A;  2EIQ A;  2PVO C;  3VI7 A;  3BCI A;  2KP2 A;  2NTO A;  2AAW A;  1S3A A;  3QFA C;  5J9B A;  4N10 A;  1XWG A;  2TRC P;  2C80 A;  17GS A;  4YQM A;  1SJ6 A;  2WCI A;  2HNL A;  2YCD A;  2TRX A;  2K9F A;  1N8J A;  1SYX A;  1PRX A;  1Z6N A;  4NV5 A;  1UVZ A;  2X8G A;  1K0D A;  3F6F A;  3H8Q A;  2ZNM A;  1K3O A;  1XCC A;  2A4V A;  1SYR A;  2K8V A;  1R4W A;  3BD2 A;  3IXR A;  4EIQ A;  1EZK A;  2N5A A;  1GLQ A;  4ECI A;  1SK2 A;  4I5Q A;  5DCG A;  2LQQ A;  4L5L A;  4YKG A;  5DBQ A;  2LS5 A;  3NIV A;  4LMV A;  2C0G A;  1XWK A;  1SL1 B;  4OCF A;  2QSI A;  1PSQ A;  2IWT A;  3PR8 A;  2RLI A;  3H4K A;  1U88 A;  2BTO T;  3IK9 A;  3C71 A;  1VRS D;  2X64 A;  2KOK A;  1SK1 A;  3GL3 A;  3UBK A;  1VGL A;  1HD2 A;  2YNX A;  3GL5 A;  5JWO B;  1ACV A;  3QPM A;  2MYG A;  5IPH A;  4JE1 A;  4OCE A;  1PL2 A;  4IBP A;  4TR0 A;  2HZE A;  2JU5 A;  4WF4 A;  3GKM A;  1YZX A;  1X9W B;  1GWC A;  2JZR A;  2VM2 A;  4WR5 A;  4ZL9 A;  3US3 A;  4KAE A;  5GAP D;  2A2R A;  4AGS A;  1HNC A;  5ELG A;  3TGZ A;  4KCE A;  1K0O A;  1VF3 A;  2FNO A;  1K3L A;  4ULX A;  4TR1 A;  2YWI A;  3CSI A;  3D4M A;  3BOA A;  4EDZ A;  1BAY A;  3FEU A;  1FVK A;  5LCZ A;  3IHG A;  2IFQ A;  4XS4 A;  2B5X A;  3P2A A;  2VL9 A;  3FR3 A;  4MNN A;  5CRE A;  3FYG A;  2NVL A;  5J9C A;  1J08 A;  1T00 A;  3PIN A;  1B48 A;  2XHF A;  2H6Z A;  2GST A;  1E2Y A;  3E3E A;  3UIW A;  2P0G A;  4ZL8 A;  3UBL A;  1OC3 A;  3RPP A;  3UMA A;  2WDU A;  1YJ6 A;  2F51 A;  2H66 A;  2FA4 A;  3GKX A;  3PGT A;  1FG4 A;  4DSS B;  3GKN A;  2N5B A;  2H19 A;  5ELA A;  4JZQ A;  3FY7 A;  3EUR A;  2DJ2 A;  4K7O A;  3W6G A;  3G9B A;  2YZU A;  2XBI A;  3EWL A;  12GS A;  1M7T A;  3CSJ A;  1U6T A;  1AQX A;  4OMV A;  2KP1 A;  4JU5 A;  3TUE A;  3ERW A;  4QL7 A;  4X0X A;  4MF6 A;  2JZS A;  1HNA A;  3ED3 A;  3M9J A;  3IBH A;  2O8V B;  1QGV A;  4K5S A;  3A3T A;  1R5P A;  3KM6 A;  1FB0 A;  1F9M A;  3S9F A;  3GNJ A;  2DLX A;  4DSQ A;  5G30 A;  2L4C A;  1JLV A;  2L4Q A;  4FIW A;  2PN8 A;  3O76 A;  1ZYQ B;  3LSZ A;  1UC7 A;  4BWQ A;  1ERV A;  4K0N A;  2CZ3 A;  1OE7 A;  3MIX A;  1WOU A;  5AGY A;  5IOX A;  1QUW A;  3C73 A;  5FWG A;  4NPB A;  5A4W A;  4MJA A;  3FR6 A;  3ZIJ A;  2V1M A;  5ECO B;  5EL8 A;  2R37 A;  1V40 A;  3SBC A;  2IMK A;  4PQI A;  1ERW A;  4RI6 A;  1SL2 B;  2YOI A;  1TKD B;  5B8A A;  3GST A;  4ECB A;  3GV1 A;  2IFQ B;  3EE2 A;  5D9W A;  1NSW A;  2OJL A;  4HJM A;  2F8A A;  2C0D A;  2R5G A;  4JED A;  3HDC A;  1XWC A;  2VCQ A;  1QFN A;  5ECS A;  4TVE A;  4POM A;  1TI1 A;  4YQV A;  1TDI A;  3IPZ A;  3KEB A;  2QKE A;  3GA4 A;  4BWS A;  4N11 A;  4BVY A;  3AY8 A;  3F4T A;  4IJI A;  1LU4 A;  2F3M A;  5D93 A;  3D22 A;  2QA2 A;  3ZZX A;  1K0M A;  4MF5 A;  1OC8 A;  5KOX A;  2FWE A;  2FGX A;  1J0F A;  1GRX A;  4YAV A;  1ZGN A;  3G7I A;  4TRX A;  2DC5 A;  5CO3 A;  1X5E A;  3TRQ A;  1ILO A;  3TKS C;  1TRW A;  2FY6 A;  3M3M A;  2DJK A;  3ME8 A;  4PNG A;  1QK8 A;  2PMT A;  3QAG A;  4ECC A;  2H1A A;  2H0H A;  4NV2 A;  1GNE A;  4I2U A;  3DEX A;  4ID0 A;  2LQO A;  5KN1 A;  19GS A;  3GH6 A;  4GWR A;  5B8B A;  5IOW A;  3GHA A;  1TU8 A;  4ZXG A;  1XVW A;  3ZIV A;  4EO3 A;  1ST9 A;  3U5R E;  4EIP A;  4FQU A;  3VLN A;  2E2G A;  2E2M A;  2PU9 C;  1PN9 A;  1V58 A;  1C72 A;  5CRH A;  4GST A;  4X43 A;  3L78 A;  2H74 A;  3KP8 A;  4K1F A;  2O89 A;  4JR6 A;  2HFD A;  3R2Q A;  1PX6 A;  3KZQ A;  2JZT A;  1T4Y A;  4MPF A;  3MAK A;  1S3C A;  4X4J A;  4TN8 A;  3U6V A;  1KEB A;  3DML A;  4F0B A;  1A2M A;  1F2E A;  2WGR A;  3JCM L;  3L4N A;  3RPN A;  1O8W A;  5DAL B;  2VCT A;  1T8E B;  2I1U A;  1AXD A;  2KHP A;  5ECH B;  2HI7 A;  1S3D A;  4BVY B;  1DE1 A;  1SEN A;  5ECM B;  1GH2 A;  1QQ2 A;  4KX4 A;  3I9V 2;  3J7Y k;  3TKP A;  2F9S A;  3QDN A;  4G9H A;  1U3I A;  5KN2 A;  2GQM A;  3CSH A;  1WWJ A;  3HZ8 A;  4ZBB A;  1ABA A;  3LW9 A;  1VF4 A;  1SKW B;  4KA0 A;  1GTB A;  3M1G A;  2MMZ A;  5ABR A;  2JAC A;  3LG6 A;  4K9Z A;  3WGE A;  4MJC A;  3FRC A;  1RK4 A;  4YKF A;  3RHC A;  2CX3 A;  1X9M B;  3BCK A;  4XIH A;  4LMW A;  1PN0 A;  2HSH A;  4LLR A;  2MBT A;  3LOR A;  4EUY A;  2C3N A;  2OA7 A;  5JCG A;  1XVQ A;  1GP1 A;  1OKT A;  4KF9 A;  16GS A;  4KH7 A;  3LJR A;  2L6D A;  3FW2 A;  3GKK A;  1PA3 A;  5A4V A;  4POK A;  1ERU A;  2DKI A;  3IDV A;  1Z3E A;  1W4V A;  5D9V A;  3UJ1 A;  4L8E A;  1DE2 A;  1OC9 B;  2MMO A;  3MWH A;  4YQU A;  5ECR B;  1TXX A;  1MD4 A;  1GUM A;  4JBB A;  4O7H A;  2H70 A;  5F05 A;  1G7O A;  2IJY A;  2FHE A;  1B9Y C;  3CRT A;  3FKF A;  4TXO A;  2E0Q A;  4JRR A;  5JCU A;  4MMM A;  4JR4 A;  4PXO A;  1B4P A;  3IV4 A;  4IW9 A;  4XRD A;  1EV4 A;  2GT5 A;  1FOV A;  3ZTL A;  2HZF A;  4L0W A;  1FVJ A;  4PTS A;  4HQS A;  2CT6 A;  3VWX A;  4ZIJ A;  2GT6 A;  3Q19 A;  3KJY A;  1YF0 A;  4G0K A;  3KGK A;  1WMJ A;  5A4U A;  3RBT A;  4ZB6 A;  2DJ0 A;  3QD9 A;  1USB A;  4RI7 A;  3F3Q A;  4CW9 A;  5DAK B;  1X9S B;  2B3S A;  6GSU A;  4NMU A;  2HRK A;  1EV9 A;  4ZB9 A;  1Z7R A;  3BJ5 A;  5ECI B;  2RM5 A;  4D73 B;  5ECN B;  1PD2 1;  3HZ4 A;  5H5R A;  3DKS A;  1OE8 A;  4V1A p;  5JWR B;  2IMD A;  4IN0 A;  2VIM A;  4YAP A;  3TJG A;  3LGC A;  5D96 A;  2EIR A;  2LEG A;  1BED A;  4K7I A;  4MH3 A;  4BL7 A;  1G6Y A;  1V2A A;  1K0N A;  6GST A;  2FWG A;  4POL A;  3MNG A;  4CDO A;  3CMI A;  2VUP A;  2A2P A;  2LJK A;  3UEM A;  2CVK A;  1SKS B;  2X49 A;  2X8C A;  1TRS A;  1EOG A;  4E8H A;  2R0G A;  2NDO A;  3D4T A;  1PX7 A;  1AUC A;  4PQ1 A;  4E8E A;  4GF0 A;  4I2T A;  3TJF A;  1DUG A;  5D9T A;  2HLS A;  2C4J A;  1GTU A;  3DVW A;  1ZYE A;  3EC3 A;  4WF5 A;  2B7K A;  1XOA A;  1YKC A;  2FD3 A;  1AIU A;  1GSS A;  1XW6 A;  2EC4 A;  2YV9 A;  2LTK A;  1JZD A;  3TJK A;  2O85 A;  3O6T A;  1H75 A;  1RQM A;  1VF1 A;  2CX4 A;  3HY2 A;  5G1L A;  2CZ2 A;  4HEA 2;  3IC8 A;  3CYN A;  3FHK A;  4KSO A;  2P5Q A;  3TJB A;  5GSS A;  2B6M A;  4KDX A;  5INY A;  2E7P A;  3LEF A;  4OFN A;  1IYI A;  4KDY A;  3RHB A;  1TJD A;  3L9S A;  2IME A;  1YY7 A;  4MJE A;  4KND A;  5IMZ A;  5LD0 A;  4RUV A;  4IP1 A;  3TKS A;  1GUH A;  3LFL A;  2DSA A;  4K2X A;  2DKH A;  5HFG A;  4O5R A;  1EEJ A;  2OE0 A;  1XXU A;  3DWV A;  6GSW A;  3VPQ A;  3KH9 A;  1GUL A;  5HR1 A;  2DJ1 A;  2M72 A;  2X4A A;  4K2D A;  1SK0 A;  4WBR D;  4IKH A;  1XWB A;  3N9J A;  4MPG A;  5ENU A;  4GCI A;  5CNW A;  3VWV A;  4H86 A;  2LUS A;  4P3Y B;  3D21 A;  3Q74 A;  1BQ7 A;  3KMN A;  1MDK A;  3RDW A;  2GSQ A;  1R7H A;  2MZC A;  2R6K A;  2KUC A;  1FAA A;  2C8U A;  4K6X A;  3CBU A;  2JSZ A;  3IAM 2;  2JL4 A;  4X1U A;  2LNS A;  3ERG A;  3UOM A;  5GAN D;  1PMT A;  2IMI A;  4XS1 A;  1AQV A;  5CYY A;  3ZVJ D;  4MLY A;  3F4S A;  5B7C A;  4KSM A;  2OAD A;  2GZP A;  2L6C A;  3VWW A;  1X0R A;  1YDK A;  3KCM A;  3GX0 A;  3UL3 A;  4ILF A;  3QFB C;  3FZA A;  2HZE B;  2VCV A;  1J9B A;  1B4Q A;  2RUE A;  3M9K A;  4K8M A;  5IMD A;  2H76 A;  4G19 A;  4PNF A;  3M8N A;  3R3E A;  2YWN A;  2YWM A;  2EIO A;  3KP9 A;  4IP6 A;  2H6Y A;  3L9V A;  5IMA A;  5CP1 A;  1UA5 A;  3G7J A;  4I6X A;  4GRF A;  4F0C A;  2DMM A;  3F0I A;  4TW5 A;  5ID2 A;  3TKQ A;  4KB3 A;  1K0B A;  1BG5 A;  1YQ1 A;  3ZMK A;  3IA1 A;  2O87 A;  4EDY A;  1GSQ A;  3A2V A;  3UVH A;  2HRA A;  4MZC A;  3APS A;  5DVB A;  5DJM A;  1B8X A;  4TR1 B;  2GSS A;  3WGD A;  4PX1 A;  2IIY A;  5F06 A;  1SKR B;  3ZFL A;  1G6W A;  1SJI A;  1AAZ A;  4XS4 B;  1ZL9 A;  4L5O A;  1K0A A;  3LQ7 A;  4GSN A;  2OAC A;  2WB9 A;  1Y6E A;  2FWF A;  4FH8 A;  2HSM A;  2AV4 A;  2ON7 A;  5BRT A;  1GNW A;  5G5E A;  4J2F A;  2FLS A;  4ZL7 A;  1OAZ A;  1GTA A;  3C1S A;  2I4A A;  3GX8 A;  1FOH A;  1JZR A;  3L9U A;  6GSV A;  2AYT A;  3GTU A;  2RUF A;  5DQY A;  1M9B A;  1XPV A;  1N2A A;  4ZBA A;  2WFC A;  1GSD A;  3HJM A;  4MJB A;  2C3T A;  3GMF A;  1XFL A;  4XRA A;  5IMF A;  9GSS A;  5A5K A;  4TR3 A;  2H0I A;  3CTF A;  3Q6O A;  1MTC A;  3D6I A;  4Q5R A;  1VF2 A;  3HJP A;  2KLX A;  2P5R A;  3QR6 A;  1QXH A;  1URM A;  1SD9 A;  2AB6 A;  3A2W A;  3DGQ A;  1DSB A;  3FZ5 A;  4TXV A;  2FCH A;  4GQC A;  2FA8 A;  3WT1 A;  1ZZY A;  5CRD A;  5HR2 A;  4QL9 A;  2PGT A;  3HKR A;  2WUL A;  1B9X C;  3VFI A;  5ECQ B;  4IQ1 A;  1JZW A;  4HI7 A;  2X99 A;  1V98 A;  5DQS A;  5IPG A;  1M99 A;  4LL4 B;  3EIN A;  5IO0 A;  4ML1 A;  3A5I A;  3DD3 A;  1GSY A;  5G5F A;  4TKY A;  3ZML A;  4MDC A;  2GZY A;  5L71 A;  4KE3 A;  5J5N A;  2VCZ A;  6GSY A;  2BJX A;  3H79 A;  1MEK A;  3ZYW A;  1A0R P;  3C8E A;  3L0H A;  4GQF A;  2ON5 A;  1EEM A;  4WXT A;  1I9D A;  3W8J A;  4IS0 A;  4BVX A;  4CHS A;  5F8B A;  4NWY A;  2VCX A;  2TIR A;  1TK8 B;  3DIE A;  3VUR A;  1TOF A;  2DJ3 A;  3UAR A;  1O6J A;  3GTU B;  3KH7 A;  1TRV A;  2ALB A;  1GUK A;  2H1G A;  3KXO A;  5HFK A;  2AJQ B;  4N0Z A;  6GSX A;  4OWY A;  1M2B A;  2H75 A;  4IQA A;  4O5U A;  4AJ7 A;  4FO5 A;  2VD0 A;  2HRN A;  4KCA A;  4PUR A;  3IRA A;  2XPD A;  2C1Y A;  1AQW A;  1K0C A;  2V2G A;  4XS6 A;  3GH9 A;  3ZLP A;  1U87 A;  5LNK e;  3LXT A;  1XW9 A;  5G31 A;  5IMC A;  4ISD A;  2VL3 A;  7GSS A;  1ZOF A;  4LL1 B;  3TB2 A;  1GSE A;  1KNG A;  2HRF A;  3F4R A;  5F07 A;  3FK8 A;  1UN2 A;  5H5Q A;  2L5O A;  2N5F A;  1SD8 A;  5FT3 A;  3HVX A;  4GXZ A;  1X5D A;  1Z7P A;  2IMF A;  4MZB A;  2LKU A;  4K7N A;  2Z9S A;  2IL3 A;  4I8B A;  3VPT A;  4MAB A;  4I97 A;  4Z2T A;  2XBQ A;  4EVM A;  4EE0 A;  2PWJ A;  4MH2 A;  4KGI A;  3UAP A;  3C7M A;  5EVO A;  1A23 A;  2WJU A;  4OO5 A;  4HZ2 A;  4EL1 A;  4WR4 A;  4LA1 A;  2RII A;  5CRG A;  2NBS A;  4PQH A;  5ECP B;  4EKZ A;  5C00 A;  3LWA A;  1R26 A;  3HXS A;  2OE3 A;  5JWQ B;  4ZB8 A;  2GSR A;  3HHV A;  3HA9 A;  1LBK A;  3HVV A;  4F9Z A;  4DEJ A;  14GS A;  1TK0 B;  2LJR A;  4N0V A;  4V2N A;  4USS A;  2CA8 A;  1IYH A;  1EOH A;  5F0G A;  1PGT A;  2A2S A;  1H4O A;  2AUV A;  1PKZ A;  4G0I A;  2OKA A;  5EY6 A;  4FYU A;  2VL2 C;  10GS A;  3Q18 A;  3BBY A;  1WIK A;  1Z5Y E;  2GZZ A;  2L5L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...