3F3QA

Crystal structure of the oxidised form of thioredoxin 1 from saccharomyces cerevisiae
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
109
structure length
109
Chain Sequence
HHHHHHMVTQFKTASEFDSAIAQDKLVVVDFYATWCGPCKMIAPMIEKFSEQYPQADFYKLDVDELGDVAQKNEVSAMPTLLLFKNGKEVAKVVGANPAAIKQAIAANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Thioredoxin-1
publication title Structural and kinetic analysis of Saccharomyces cerevisiae thioredoxin Trx1: implications for the catalytic mechanism of GSSG reduced by the thioredoxin system
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 32
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2008-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3f3qA00
5HFIA 3L4NA 4N0VA 3DRNA 2LNTA 3TKPA 2ES7A 2NDOA 5ECLB 4WR5A 3OR5A 3ZVJA 3HY2A 3FZ5A 3MAKA 2MBTA 4DSRA 1TI1A 2EC4A 2JSZA 2IL3A 3S9FA 3DYRA 2HLSA 3CSJA 5AGYA 2O7KA 5CRHA 4PNGA 4MDCA 2LRTA 2YV9A 3EYTA 5DAKB 3F4RA 1LBKA 1T4YA 2IN3A 4FIWA 4TR0A 1HNAA 1QFNA 3KP9A 5E59A 4X1UA 5GAPD 1XIYA 2MMAA 1U3AA 3K8NA 2VD0A 4TR3A 1EZKA 1WE0A 1SKSB 3C73A 1Z6MA 5IO0A 2GVPA 1ON4A 2HSYA 2WCIA 1GRXA 2YWIA 5J4UA 5DJMA 2CVBA 2K18A 4DSQA 1SK0A 2MMNA 3VWVA 1YF1A 3CSHA 3MSZA 4ECIA 2D2ZA 5G5EA 2DC5A 3APOA 4F2IA 5LNKe 1K3YA 4BWSA 2GZPA 1A8LA 4WKWA 4NV2A 1F3AA 3GTUB 4MK3A 2LRNA 1XZOA 1B8XA 2WB9A 2OJLA 1U87A 2FGXA 2NVLA 3LG6A 4RQXA 3LGCA 3M1GA 4TN8A 6GSWA 4HJ2A 19GSA 5G2ZA 2I4AA 2WDUA 3P90A 1AIUA 3QAGA 2GZZA 5A4UA 2A2SA 1XWKA 2G0FA 3EWLA 3FRCA 4HS1A 4LMWA 4IJIA 2YWMA 4CW9A 3L9SA 5HR2A 1X9MB 2DJJA 5CRGA 1SKRB 1MD3A 20GSA 5D9XA 2GZYA 2CQ9A 5DQSA 1ZYQB 1USBA 3RDWA 3KMNA 1JZDA 3HVXA 1ERWA 3W8SA 3APSA 2F8FA 3H8QA 1N8JA 5CP1A 4OCFA 1HYUA 3QOUA 4YQUA 5FHIA 3RAZA 1S3CA 4TR1A 3EU3A 1BQ7A 2OACA 4I2UA 6GSUA 2X8CA 2FD3A 3J7Yk 1T4ZA 2IMDA 2IWTA 1F37A 4IQAA 2L6DA 3UBKA 3ZFLA 5JCUA 2PVQA 5DAKA 2GSQA 2EIQA 1XBSA 5IMZA 4AJ6A 2R3XA 2WULA 4RI7A 4V2MA 2PN8A 1SD9A 2R37A 2V41A 1GSYA 4IS0A 3HZ4A 1RK4A 5JWRB 1ABAA 5ECQB 2PERA 3KTBA 4FYBA 2VM1A 4HUAA 2E2GA 1X5CA 4EE0A 3GMFA 2P5QA 2R4VA 3HA9A 4PXOA 4WETA 4GQCA 3FR3A 3GHAA 5A4VA 2CZ3A 1HNCA 2CVKA 2IJYA 2OE0A 5IM9A 1Z9HA 2I1UA 3SBCA 2H8LA 2BJXA 1THOA 3ED3A 4I5QA 1EGOA 2V1MA 3PINA 3DMLA 3APQA 1MEKA 3GTUA 2PWJA 1O7UA 3DEXA 2QSIA 4NHWA 1PL1A 1W4VA 3HJPA 1U6TA 4IP1A 1XWGA 2DMLA 3MNGA 3U5RE 3HVSA 2X64A 2F8AA 3O6TA 3UEMA 3ZTLA 4H86A 5CNWA 3PGTA 3UOMA 1IYHA 5KN1A 3QAWA 2VAFA 3GKKA 3LWAA 3UL3A 2OKAA 2G2QA 4EVMA 4J56E 1SD8A 4LL4B 4WXTA 2V6OA 1SKWB 1GTAA 1F9MA 3GNJA 1UC7A 1AQWA 3VURA 2O89A 2DJ3A 1VF1A 1O6JA 1VF3A 1Z6NA 4ZB6A 2B1KA 2X99A 4G9HA 4KNDA 1WMJA 2AV4A 3TJGA 4X43A 1A0FA 2AAWA 3IBHA 3EINA 1FOVA 3UAPA 5IMAA 4OFTA 3V1WA 1JLWA 1M9BA 4X0XA 2HI7A 2CX3A 2L59A 2PMTA 1Z7PA 5INYA 5J5NA 2FCHA 2L4CA 1MDIA 1A8YA 4MH3A 2LV3A 3RHCA 4MPGA 4PNFA 2IMKA 1VGLA 3WYWA 2E2MA 1TTZA 2K6VA 3F3QA 4KDUA 4G2EA 5LD0A 1A24A 3ZVJD 1G0TA 1V57A 3D4MA 1V9WA 2FNOA 4JRRA 2VIMA 2XBQA 4GSSA 2B7KA 3C1SA 1X0RA 1UN2A 3C7MA 3C71A 5AISA 4K2DA 3N9JA 2BTOT 1TXXA 2CA8A 4I97A 3A2XA 4ULXA 2YJHA 1GTUA 4DEJA 2MBSA 2QC7A 2MZCA 4MMMA 4IHUA 2CAQA 2BMXA 2FWGA 5ECPB 1MD4A 4ECJA 4WF4A 1X9WB 3G7JA 1TRVA 2GS3A 2PPTA 4K0NA 2X8GA 3GH6A 4XRDA 5B8BA 3KGKA 3D4TA 4PQIA 3TJJA 1GL8A 1GUMA 4MA9A 4XS1A 7GSSA 4KAEA 2YCDA 1O8WA 3DGQA 3KJYA 2HE3A 1T3BA 3IR4A 4PUFC 4BVYA 4GTUA 4YQMA 3ISOA 4ZL8A 1RW1A 1WRYA 2AHEA 2O8VB 1SJIA 2HZEB 5IMCA 4ECCA 3O3TA 3GUSA 2F51A 3IA1A 1XPVA 1WJKA 2Z9SA 2P0GA 1IYIA 3CRTA 3IV4A 4Z7XA 2PVOC 3HCZA 3IPZA 3QCPA 3HHVA 3L0HA 1F3BA 2YNXA 2JZRA 2YANA 2LJKA 1AAZA 4EXJA 4EO3A 1QQ2A 1ZCPA 3TRQA 3D6IA 3HDCA 4JEDA 4OCEA 3TJKA 2HRNA 3M3MA 1TU7A 3IRAA 3HVVA 3KH9A 4HOJA 4EL1A 1G7EA 2LEGA 5JCGA 2H1DA 4YH2A 3F8UA 3TGZA 2C0DA 1FW1A 2DJ0A 4JZQA 1TK5B 4HZ4A 3UBLA 5JWOB 2VO4A 2H0GA 4TVEA 1GH2A 1KBNA 3M9JA 1OYJA 1GUKA 1GULA 4KCEA 3KTLA 2DIYA 3UIWA 1PX7A 1JLVA 1SJ6A 2AYTA 2VCQA 1OKTA 1PQNA 5A5KA 2WGRA 2RM6A 3NOFA 5IMDA 2H72A 1B9XC 2ZCTA 1AQXA 2EIRA 2R6KA 1UA5A 5IO2A 1OE8A 4PURA 3ZL5A 4N0ZA 4IQ1A 2I9HA 4WF5A 1FAAA 4EC0A 1A2JA 3DKSA 4TR1B 1DE1A 2GQLA 1H4OA 5D96A 4MABA 4Q5QA 5HR1A 2PBJA 1T00A 2C80A 4PGTA 5B6MA 3HD5A 5D9VA 2VL3A 1FB0A 5DCHA 1XW6A 3FY7A 3GKNA 4CDOA 2N5FA 3HKRA 2F9SA 3VWXA 1GNWA 1I9DA 1HNBA 4L0UA 4K1FA 1YEXA 2XPDA 3H1NA 3A5WA 4NWYA 2VL9A 2PU9C 2HZEA 2REMA 5B8AA 1R5PA 4IN0A 4TOPA 4IGJA 3ZIJA 3ME7A 3IC4A 4L5LA 1XVQA 2L4QA 3ZFBA 3IXRA 3KM6A 1OC8A 1TW9A 2WZ9A 1M9AA 2KP2A 1GSEA 4ZIJA 1YEPA 2GDRA 4PX1A 1GSUA 2LKUA 2YWOA 2V6KA 5F05A 3IAS2 2L57A 3F4TA 3G7YA 5CRDA 4MCUA 4POLA 3P8WA 5ABRA 5HFKA 5GSSA 2YZUA 1TK0B 2ALBA 3I9V2 3W8JA 2DBCA 3UVTA 4KSOA 3VFIA 4IKHA 4ML6A 4DVCA 1YF0A 4D73B 2ON5A 3F63A 3FR6A 1VF2A 4AJ8A 4LLRA 2IMEA 1GSQA 3GL3A 3RHBA 2FWEA 5CYYA 3CRUA 1JZOA 5IOXA 4LA1A 1SK2A 4AF2A 3HYPA 3KCMA 4K7OA 3TUEA 1LJRA 2R2JA 1K3OA 3GSSA 1J9BA 5C04A 4DSSA 4EDYA 2DJKA 2DMMA 17GSA 3ZRDA 4KW6A 1H75A 4V2NA 2B6MA 2YPMA 3RBTA 3LYKA 5J41A 2JSYA 4RI6A 3PH9A 2B1LA 1EV9A 1GSFA 3KZQA 2IPAA 5L71A 1K0AA 1GP1A 1XW5A 2PGTA 1KTEA 4JR6A 1M7TA 3ME8A 1DSBA 4EUYA 2DIZA 1G6WA 3Q18A 5F0GA 4NPBA 2GSTA 5G5FA 2C0EA 4JE1A 3QPMA 2C3TA 4BL7A 2WFCA 4ILFA 4OD7A 1GWCA 4TKYA 1M2DA 3US3A 5ENUA 2H0HA 4IP6A 2H0IA 1KNGA 2YN1A 1ZGNA 3ZZXA 4G10A 4XCSA 1LU4A 1C72A 2M46A 2RM5A 2HRFA 3F6DA 1ERVA 3W6GA 1PA3A 1O85A 3IAM2 1GNEA 4BWQA 1JZRA 3H79A 4KA0A 2HZFA 4Q5RA 4XRAA 2K8VA 4PQHA 2ZUPA 4JR4A 5G1KA 3UARA 3GN3A 18GSA 5EVOA 2GQMA 1EP7A 4OMVA 2DLXA 1XWBA 1XXUA 1ZYEA 5FT3A 3DVXA 1W89A 1V58A 4JBBA 1XCCA 2HYXA 4IW9A 4K0GA 4CHSA 5D9WA 2B5EA 1E6BA 3L9UA 1EP8A 2NPBA 4TR4A 2GGTA 4D73A 3BCIA 1TRSA 2H30A 3QD9A 1E2YA 5CO3A 4OO5A 3G9BA 1T1VA 3KD0A 2LNSA 5JCWA 3M0FA 1NHYA 3IE3A 2O87A 2IMIA 2CX4A 1EWXA 4Q5NA 4FO5A 4HQSA 2AUVA 4HU7A 4MLYA 2GSRA 3ERFA 4HI7A 3GA4A 3IDVA 3U6VA 4QL7A 3KP8A 2LQQA 1Z7RA 5IIZA 5C00A 5J3RA 1ILOA 2L6CA 4ZILA 1HQOA 4FYCA 3FK8A 1K3LA 1X5EA 5HR0A 1EGRA 3FW2A 3ZMLA 3DWVA 2GQKA 4RQRA 3GKXA 1SL0B 4NXIA 4ECBA 2C8UA 5GSTA 4J57E 2VCWA 1PRXA 2LUSA 4MJCA 2K8SA 5ID2A 2L5OA 3D22A 1S3DA 1A2LA 3DIEA 4NMUA 2ZNMA 1V40A 1GTIA 1YKAA 4MF6A 5H5SA 3H93A 1O81A 4TXOB 22GSA 4J2FA 2JU5A 1YY7A 2NBSA 1VF4A 2H1GA 4L5OA 1GLPA 2YWNA 2KHPA 5ECOB 4POKA 2TRXA 3VLNA 1DUGA 2PUKC 4N30A 3GL5A 4ZL9A 2H19A 2VCVA 3CTFA 1TI3A 3F6FA 3I69A 2AJQB 3KXOA 1JHBA 1S3AA 1XFLA 1B9YC 3C8EA 5IMFA 3DXBA 4O32A 3ZLPA 3E0UA 3WT1A 4K8MA 4HJMA 4KCAA 1QMVA 1BEDA 1WP0A 4F03A 5B6NA 2NTOA 4KDXA 3BD2A 2CV4A 2WJUA 1URMA 1O8XA 1WPIA 2H1AA 14GSA 1NSWA 4N10A 2L5LA 4QQ7A 1U88A 3I6AA 2IMFA 1GUHA 1DE2A 1YZXA 3WGEA 3BOAA 1EV4A 3FZAA 2OADA 2GT5A 3P7XA 1A23A 1BX9A 2HFDA 3QFBC 2ON7A 4ZB8A 3GYKA 4F0CA 2FA4A 2QKEA 1OC9B 3R2QA 3FZ9A 2A2RA 2RIIA 2J23A 4TRXA 1PD21 3LEFA 4K7IA 2LJRA 4O7HA 4I8BA 1ST9A 1NHOA 5ELAA 1R4WA 4ZBBA 3P2AA 5EPFA 4MF7A 1PSQA 1TU8A 2FLSA 5CAXA 2VCTA 1R5AA 3GRXA 1GSSA 3A2WA 4OFNA 2K9FA 2B5YA 3EVIA 1FG4A 2AB6A 2DJ2A 2C4JA 1EOGA 3EE2A 4GXZA 2DSAA 3ZIVA 3CSIA 4E8EA 1XW9A 5D9TA 4KDYA 4POBA 3L9VA 5EL8A 1SK1A 2MMZA 3GURA 1RQMA 6GSSA 4HEA2 3TKRA 5DVBA 3D5JA 3C1RA 3TJBA 4TXOA 5DCGA 4GRFA 2FWHA 4BPYA 4MZCA 2M72A 1FVKA 4FYUA 1AXDA 2TRCP 4GF0A 4BA7A 2YV7A 3RPNA 4PQ1A 1NW2A 1NM3A 3A3TA 2JL4A 2RUFA 3VPTA 5CRWA 1YDKA 5F07A 4BVXA 10GSA 2M80A 4TXVA 3GV1A 2OBKA 4DSSB 3L78A 4XTSA 3CXGA 3KIJA 3D0ZA 1T8EB 4L8EA 1F6MC 3WD6A 4MZWA 2RLIA 5KN2A 5J9BA 1TKDB 3TKSE 1ERTA 1M2AA 1SYXA 1JFUA 1XWCA 3O76A 1Y6EA 2H66A 1PGTA 3VK9A 4GCIA 2QGVA 2H75A 6GSTA 5HR3A 5ECNB 2OA7A 4KH7A 5HQPA 1V2AA 3QDNA 5ELGA 1OC3A 1T7PB 5AIVA 1J0FA 5EY6A 2I81A 4P3YB 1YJ6A 3Q19A 2HXKA 5GZZB 3BJ5A 4MP4A 5F06A 3Q6OA 1CQHA 1M99A 4V1Ap 4V1Ag 4F0BA 1OC9A 4L0WA 4ID0A 1BG5A 2B5XA 2LSTA 4GLTA 2HSHA 2VCZA 2V2GA 1THXA 2H6ZA 1Y25A 5A4WA 3AY8A 4MPFA 3GH9A 1OVNA 5DDLA 2A4VA 5IOWA 5E4WA 2DJ1A 2B7JA 4XS6A 3TKSA 4EKZA 1TOFA 2C0GA 3RPPA 5KN3A 4OFMA 1ZMAA 4PUAA 3GX0A 2C0FA 3VWUA 4F9ZA 5J9CA 1GTBA 1YKCA 1K0CA 5F8BA 1M0UA 2LS5A 4ZB9A 3E3EA 3IHQA 5FWGA 4ML1A 5DBQA 2FY6A 2C3NA 4WR4A 3QR6A 2CVDA 3TB2A 2YJ7A 1R26A 3ZYWA 4O92A 2V32A 3MWHA 3G7IA 4F82A 2OE1A 2H6YA 1ZZYA 1AW9A 4FH8A 4O5RA 4KSMA 5JWQB 3A2VA 3Q74A 2CAIA 1B4PA 2B3SA 1M2BA 3BBYA 4WBRD 2OBIA 1OE7A 1G7OA 1TJDA 1XOBA 2JADA 1TP9A 2LQOA 1X5DA 3FZ4A 2I3YA 1MDJA 3FYGA 1AQVA 2RUEA 4MJAA 2VOCA 5D73A 5ID2B 4OO4A 5CREA 1PKZA 2J9HA 1FB6A 5IQYA 1A2MA 3MDKA 2VLVA 5IPHA 5KEJA 1N2AA 4MF5A 3F0IA 3JCML 3NZNA 2KUCA 4GWRA 4RUVA 1GSDA 2VM2A 3KMOA 4E8HA 3ERWA 5DALB 3FEUA 4MH2A 5AN1A 2H76A 4GSNA 4XS4B 5DQYA 3TCOA 3TJFA 4N11A 2YP6A 1ZL9A 4JU5A 1X9SB 2MYGA 3EC3A 1CQGA 2WRTA 1Q4JA 3UJ1A 1A0RP 4HZ2A 3UVHA 1I5GA 1Z5YE 3J7Yb 3DVWA 4NHZA 1U3IA 4ISDA 2GSSA 3F9UA 2VL2A 1XOAA 5DJLA 11GSA 3GX8A 5ECHB 3TKQA 5GAND 3CTGA 4I2TA 2YOIA 5ECMB 4K7NA 2H6XA 1OAZA 1AC1A 2XC2A 3TKSC 2N5BA 3LORA 3TRXA 5IMVA 3GIXA 9GSSA 1TRWA 3HJOA 5IPGA 8GSSA 3VI7A 1O73A 4LMVA 1G6YA 1B4QA 3VWWA 1SYRA 4MJBA 3LXZA 3GSTA 1ERUA 5ECKB 3I43A 3HXSA 1R7HA 2XPEA 3SWLA 2VCXA 2F3MA 4KGIA 3BCKA 3ZMKA 1QK8A 2JACA 1EOHA 5ECIB 6GSVA 5D93A 4IJ3A 3EU4A 4WBJA 1SL1B 2VLTA 1DBYA 3EURA 4YQVA 1K0DA 3KH7A 1SENA 3VI5A 1WWJA 1EEMA 4IELA 3WGDA 1BJXA 5AIXA 4V2LA 3IOSA 1J08A 2OE3A 2P31A 3FHKA 2JZSA 4HQZA 2HT9A 2C1YA 1ZOFA 3LFLA 3HJMA 2HNLA 3F4SA 4GQFA 2XHFA 4AGSA 2H74A 1QGVA 2E0QA 4XIHA 4IBPA 4K6XA 2GT6A 3CYNA 4HU9A 1BAYA 2O85A 4EDZA 2KP1A 3LQ7A 5DALA 2H73A 12GSA 4EF0A 4AJ7A 2P5RA 3IK7A 4XS4A 2YZHA 3KEBA 3UMAA 5G30A 4KB3A 2E7PA 3TOTA 1XVWA 1Z3EA 2WS2A 2X8HA 1WOUA 3GKMA 2IFQB 2LRCA 1QXHA 1OKDA 5B7CA 3PR8A 1SU9A 2KOKA 1MDKA 1HD2A 4G19A 4ZL7A 3M8NA 2GTUA 3CBUA 4KX4A 3GFKA 4YAVA 3DD3A 2VLUA 1GLQA 1FHEA 3D21A 2H71A 5H5RA 1K0BA 4IVFA 4ACSA 2JZTA 2H01A 1PMTA 2R5GA 3IK9A 6GSYA 3HZ8A 4HDEA 1FO5A 16GSA 2XBIA 4MJEA 1MTCA 2N5AA 1WIKA 13GSA 3FR9A 4XHMA 1FVJA 2CT6A 2EIOA 1PL2A 2H1BA 3TDGA 1PKWA 4KUNA 1KEBA 5D8IA 1Q98A 1TDIA 2VL2C 5ECRB 4ZBAA 1K0NA 1YQ1A 5LCZA 2IIYA 2LTKA 1PX6A 4MZBA 3VPQA 2VUPA 1TRUA 5ECSA 4K9ZA 1V98A 3EMPA 3H4KA 3QFAC 5KN0A 2LJAA 3NIVA 1ACVA 1PN9A 3CMIA 5G1LA 1SL2B 4Q5FA 4QL9A 4I6XA 1VRSD 4POMA 5H5QA 1K0OA 3EMXA 1AUCA 2FUG2 3M9KA 3F3RA 3QMXA 2CZ2A 4YAPA 6GSXA 5COHA 3FKFA 5G31A 2FWFA 4TW5A 3ZREA 4ZBDA 2KLXA 4NV5A 4NAXA 4LL1B 5HFGA 3ERGA 1BYEA 4WEYA 1F2EA 4KE3A 1JZWA 2VD1A 3WGXA 3N5OA 1B48A 3TOUA 3TRPA 3LJRA 3LYPA 2FA8A 3ZITA 4OWYA 1SJZA 1EEJA 2GLRA 3LSZA 1K0MA 1QUWA 2IFQA 3E9JB 1UVZA 4ZXGA 2TIRA 3QAVA 2H70A 1TK8B 4GSTA 2MMOA 1ML6A 3WT2A 3LXTA 1XWAA 2C3QA 2FHEA
chains in the Genus database with same CATH superfamily
5HFIA 3L4NA 4N0VA 3DRNA 2LNTA 3TKPA 2ES7A 2NDOA 5ECLB 4WR5A 2R0GA 3OR5A 3ZVJA 1PN0A 3HY2A 3FZ5A 3MAKA 2MBTA 4DSRA 1TI1A 2EC4A 2JSZA 2IL3A 3S9FA 3DYRA 2HLSA 3CSJA 5AGYA 2O7KA 5CRHA 4PNGA 4MDCA 2LRTA 2YV9A 3EYTA 5DAKB 3F4RA 1LBKA 1T4YA 2IN3A 4FIWA 4TR0A 1HNAA 1QFNA 3KP9A 5E59A 4X1UA 5GAPD 1XIYA 2MMAA 1U3AA 3K8NA 3FMWA 2VD0A 4TR3A 1EZKA 1WE0A 1SKSB 3C73A 1Z6MA 4X4JA 5IO0A 2GVPA 1ON4A 2HSYA 2WCIA 1GRXA 2YWIA 5J4UA 5DJMA 2CVBA 2K18A 4DSQA 1SK0A 2MMNA 3VWVA 1YF1A 3CSHA 3MSZA 4ECIA 2D2ZA 1M3IA 2DC5A 5G5EA 4Z2TA 3APOA 4F2IA 5LNKe 1K3YA 4BWSA 2GZPA 1A8LA 4WKWA 4NV2A 1F3AA 3GTUB 4MK3A 2LRNA 1XZOA 1B8XA 2WB9A 2OJLA 1U87A 2FGXA 2NVLA 3LG6A 4RQXA 3LGCA 3M1GA 4TN8A 6GSWA 4HJ2A 4G0KA 19GSA 5G2ZA 2I4AA 2WDUA 3P90A 1AIUA 3QAGA 2GZZA 5A4UA 2A2SA 1XWKA 2G0FA 3EWLA 3FRCA 4HS1A 4LMWA 4IJIA 2YWMA 4CW9A 3L9SA 5HR2A 1X9MB 2DJJA 5CRGA 1SKRB 1MD3A 20GSA 5D9XA 2GZYA 2CQ9A 5DQSA 1ZYQB 1USBA 3RDWA 3KMNA 1JZDA 3HVXA 1ERWA 3W8SA 3APSA 2F8FA 3H8QA 1N8JA 5CP1A 4OCFA 1HYUA 3QOUA 4YQUA 5FHIA 3RAZA 1S3CA 4TR1A 3EU3A 1BQ7A 2OACA 4I2UA 6GSUA 2X8CA 2FD3A 3J7Yk 1T4ZA 2IMDA 2IWTA 1F37A 4IQAA 2L6DA 3UBKA 3ZFLA 5JCUA 2PVQA 5DAKA 2GSQA 2EIQA 1XBSA 5IMZA 4FQUA 4AJ6A 2R3XA 2WULA 4RI7A 4V2MA 2PN8A 1SD9A 2R37A 2V41A 1GSYA 4IS0A 3HZ4A 1RK4A 5JWRB 1ABAA 5ECQB 2PERA 3KTBA 4FYBA 2VM1A 4HUAA 2E2GA 1X5CA 4EE0A 3GMFA 2P5QA 2R4VA 3HA9A 4PXOA 4WETA 4GQCA 3FR3A 3GHAA 2DKHA 5A4VA 2CZ3A 1HNCA 2CVKA 2IJYA 2OE0A 5IM9A 1Z9HA 2I1UA 3SBCA 2H8LA 2BJXA 1THOA 3ED3A 4I5QA 1EGOA 2V1MA 3PINA 3DMLA 3APQA 1MEKA 3GTUA 2PWJA 1O7UA 3DEXA 2QSIA 4NHWA 1PL1A 1W4VA 3HJPA 1U6TA 4IP1A 1XWGA 2DMLA 3MNGA 3U5RE 3HVSA 2X64A 2F8AA 3IC8A 3O6TA 3UEMA 3ZTLA 4H86A 5CNWA 3PGTA 3UOMA 1IYHA 5KN1A 3QAWA 2VAFA 3GKKA 3LWAA 3UL3A 2OKAA 2G2QA 4EVMA 4J56E 1SD8A 4LL4B 4WXTA 2V6OA 1SKWB 1GTAA 1F9MA 3GNJA 1UC7A 1AQWA 3VURA 2O89A 2DJ3A 1VF1A 1O6JA 1VF3A 1Z6NA 4ZB6A 2B1KA 2X99A 4G9HA 4KNDA 1WMJA 2AV4A 3TJGA 4X43A 1A0FA 2AAWA 3IBHA 3EINA 1FOVA 3UAPA 5IMAA 4OFTA 3V1WA 1JLWA 1M9BA 4X0XA 2HI7A 2CX3A 2L59A 2PMTA 1Z7PA 5INYA 5J5NA 2FCHA 2L4CA 1MDIA 1A8YA 4MH3A 2LV3A 3RHCA 4MPGA 2UZ8A 4PNFA 2IMKA 1VGLA 3WYWA 2E2MA 1TTZA 2K6VA 3F3QA 4KDUA 4G2EA 5LD0A 1A24A 3ZVJD 1G0TA 1V57A 3D4MA 1V9WA 2FNOA 4JRRA 2VIMA 2XBQA 4GSSA 2B7KA 3C1SA 1X0RA 1UN2A 3C7MA 3C71A 5AISA 4K2DA 3N9JA 2BTOT 1TXXA 2CA8A 4I97A 3A2XA 4ULXA 2YJHA 1GTUA 4DEJA 2MBSA 2QC7A 4EIQA 2MZCA 4MMMA 4IHUA 2CAQA 2BMXA 2FWGA 5ECPB 1MD4A 4ECJA 4WF4A 1X9WB 3G7JA 1TRVA 2GS3A 2PPTA 4K0NA 2X8GA 4O5UA 3GH6A 4XRDA 5B8BA 3KGKA 3D4TA 4PQIA 4CY8A 3TJJA 1GL8A 1GUMA 4MA9A 4XS1A 7GSSA 4KAEA 2YCDA 1O8WA 3DGQA 3KJYA 2HE3A 1T3BA 3IR4A 4PUFC 4BVYA 4GTUA 4YQMA 3ISOA 4ZL8A 1RW1A 1WRYA 2AHEA 2O8VB 1SJIA 2HZEB 5IMCA 4ECCA 3O3TA 3GUSA 2F51A 3IA1A 1XPVA 1WJKA 2Z9SA 2P0GA 1IYIA 2R0PA 3CRTA 3IV4A 4Z7XA 2PVOC 2QA2A 3HCZA 3IPZA 3QCPA 3HHVA 3L0HA 1F3BA 2YNXA 2JZRA 2YANA 2LJKA 1AAZA 4EXJA 4EO3A 1QQ2A 1ZCPA 3TRQA 3D6IA 3HDCA 4JEDA 4OCEA 3TJKA 2HRNA 3M3MA 1TU7A 3IRAA 3HVVA 3KH9A 4YKFA 4HOJA 4EL1A 1G7EA 2LEGA 3LW9A 5JCGA 2H1DA 4YH2A 3F8UA 3TGZA 2C0DA 1FW1A 2DJ0A 4JZQA 1TK5B 4HZ4A 3UBLA 5JWOB 5KOXA 2VO4A 3PPUA 2H0GA 4TVEA 1GH2A 1KBNA 3M9JA 1OYJA 4K5SA 1GUKA 1GULA 4KCEA 3KTLA 2DIYA 3UIWA 1PX7A 1JLVA 1SJ6A 2AYTA 2VCQA 1OKTA 1PQNA 5A5KA 2WGRA 2RM6A 3NOFA 5IMDA 2H72A 1B9XC 3MIXA 2ZCTA 2R0CA 1AQXA 2EIRA 2R6KA 1UA5A 5IO2A 1OE8A 4PURA 3ZL5A 4N0ZA 4IQ1A 2I9HA 3EPTA 4WF5A 1FAAA 4EC0A 1A2JA 3DKSA 4TR1B 1DE1A 2GQLA 1H4OA 5D96A 4MABA 4Q5QA 5HR1A 4ICYA 2PBJA 1T00A 2C80A 4PGTA 5B6MA 3HD5A 5D9VA 2VL3A 1FB0A 5DCHA 1XW6A 3FY7A 3GKNA 4BL7B 4K5RA 4CDOA 2N5FA 3HKRA 2F9SA 3VWXA 1GNWA 1I9DA 1HNBA 4L0UA 4K1FA 1YEXA 2XPDA 3H1NA 3A5WA 4NWYA 2VL9A 3A5IA 2PU9C 2HZEA 2REMA 5B8AA 1R5PA 4IN0A 4TOPA 4IGJA 3ZIJA 3ME7A 3IC4A 4L5LA 1XVQA 2L4QA 3ZFBA 3IXRA 3KM6A 1OC8A 1TW9A 2WZ9A 1M9AA 2KP2A 1M3JA 1GSEA 4ZIJA 1YEPA 2GDRA 1ZYPA 4PX1A 1GSUA 2LKUA 2YWOA 2V6KA 5F05A 3IAS2 2L57A 3F4TA 3G7YA 5CRDA 4MCUA 4POLA 3P8WA 5ABRA 5HFKA 5GSSA 2YZUA 1TK0B 2ALBA 3I9V2 3W8JA 2DBCA 3UVTA 4G0LA 4KSOA 3VFIA 4IKHA 4ML6A 4DVCA 1YF0A 4D73B 2ON5A 3F63A 3FR6A 1VF2A 4AJ8A 4LLRA 2IMEA 1GSQA 3GL3A 3RHBA 2FWEA 5CYYA 3CRUA 2HRAA 1JZOA 5IOXA 4LA1A 1SK2A 4AF2A 3HYPA 3KCMA 4K7OA 3TUEA 1LJRA 2R2JA 1K3OA 3GSSA 1J9BA 5C04A 4DSSA 4EDYA 2DJKA 2DMMA 17GSA 3ZRDA 4KW6A 1H75A 4V2NA 2B6MA 2YPMA 3RBTA 3LYKA 5J41A 2HSMA 2JSYA 2X4AA 4RI6A 3PH9A 2B1LA 1EV9A 2A4HA 1GSFA 3KZQA 3R3EA 2IPAA 5L71A 1K0AA 1GP1A 1XW5A 2PGTA 1KTEA 4JR6A 1M7TA 3ME8A 1DSBA 4EUYA 2DIZA 1G6WA 3Q18A 5F0GA 4NPBA 2GSTA 5G5FA 2C0EA 4JE1A 3QPMA 2C3TA 4BL7A 2WFCA 4ILFA 4OD7A 1GWCA 4TKYA 1M2DA 3US3A 5ENUA 2H0HA 4IP6A 2H0IA 1KNGA 2YN1A 1ZGNA 3ZZXA 4G10A 4XCSA 1LU4A 1C72A 2M46A 2RM5A 2HRFA 1PFOA 3F6DA 1ERVA 3W6GA 1PA3A 1O85A 3IAM2 1GNEA 2DKIA 4BWQA 1JZRA 3H79A 4KA0A 2HZFA 4Q5RA 4XRAA 2K8VA 4PQHA 2ZUPA 4JR4A 5G1KA 3UARA 3GN3A 18GSA 5EVOA 2GQMA 1EP7A 4OMVA 4PTSA 2DLXA 1XWBA 1XXUA 1ZYEA 5FT3A 3DVXA 1W89A 1V58A 4JBBA 1XCCA 2HYXA 4IW9A 4K0GA 4CHSA 5D9WA 2B5EA 1E6BA 3L9UA 1EP8A 2NPBA 4TR4A 2GGTA 4CY6A 4D73A 3BCIA 1TRSA 2H30A 3QD9A 1E2YA 5CO3A 4OO5A 3G9BA 1T1VA 3KD0A 2LNSA 5JCWA 3M0FA 1NHYA 3IE3A 4BVYB 2O87A 2IMIA 2CX4A 1EWXA 4Q5NA 4FO5A 4HQSA 2AUVA 4HU7A 4MLYA 2GSRA 3ERFA 4HI7A 3GA4A 3IDVA 3U6VA 4QL7A 3KP8A 2LQQA 1Z7RA 2A2PA 2X49A 5IIZA 5C00A 5J3RA 1ILOA 2L6CA 4ZILA 1HQOA 4FYCA 3FK8A 1K3LA 1X5EA 5HR0A 1EGRA 3FW2A 3ZMLA 3DWVA 2GQKA 4RQRA 3GKXA 1SL0B 4NXIA 4ECBA 2C8UA 5GSTA 4J57E 2VCWA 1PRXA 2LUSA 4MJCA 2K8SA 5ID2A 2L5OA 3D22A 1S3DA 1A2LA 3DIEA 4NMUA 2ZNMA 1V40A 1GTIA 1YKAA 4MF6A 5H5SA 3H93A 1O81A 4TXOB 22GSA 4J2FA 2JU5A 1YY7A 2NBSA 1VF4A 2H1GA 4L5OA 1GLPA 2YWNA 2KHPA 5ECOB 4POKA 2TRXA 3VLNA 1DUGA 2PUKC 4N30A 3GL5A 1FOHA 2H19A 4ZL9A 2VCVA 3CTFA 1TI3A 3F6FA 3I69A 2AJQB 3KXOA 1JHBA 1S3AA 1XFLA 1B9YC 4EIPA 3C8EA 5IMFA 4YKGA 3DXBA 4O32A 3ZLPA 3E0UA 3WT1A 4K8MA 4HJMA 4KCAA 3MYDA 1QMVA 1BEDA 1WP0A 4F03A 5B6NA 2NTOA 4KDXA 3BD2A 2CV4A 2WJUA 1URMA 1O8XA 1WPIA 2H1AA 14GSA 1NSWA 4N10A 2L5LA 4QQ7A 1U88A 3I6AA 2IMFA 1GUHA 1DE2A 1YZXA 3WGEA 3BOAA 1EV4A 3FZAA 2OADA 2GT5A 3P7XA 1A23A 1BX9A 2HFDA 3QFBC 2ON7A 4ZB8A 3GYKA 4F0CA 2FA4A 2QKEA 1OC9B 3R2QA 3FZ9A 2A2RA 2RIIA 2J23A 5BRTA 4TRXA 1PD21 3LEFA 4K7IA 2LJRA 4O7HA 4I8BA 1ST9A 1NHOA 5ELAA 1R4WA 4ZBBA 3P2AA 5EPFA 3HVNA 4MF7A 1PSQA 1TU8A 2FLSA 5CAXA 2VCTA 1R5AA 3GRXA 1GSSA 3A2WA 4OFNA 2K9FA 2B5YA 3EVIA 1FG4A 2AB6A 2DJ2A 2C4JA 1EOGA 3EE2A 4GXZA 2DSAA 3ZIVA 3CSIA 4E8EA 1XW9A 5D9TA 4KDYA 2QA1A 3L9VA 4POBA 5EL8A 1SK1A 2MMZA 3GURA 1RQMA 6GSSA 4HEA2 3TKRA 5DVBA 3D5JA 3C1RA 3TJBA 4TXOA 5DCGA 4GRFA 2FWHA 4BPYA 4MZCA 2M72A 1FVKA 4FYUA 1AXDA 2TRCP 4GF0A 4BA7A 2YV7A 3RPNA 4PQ1A 1NW2A 1NM3A 3A3TA 2JL4A 2RUFA 3VPTA 5CRWA 1YDKA 5F07A 4BVXA 10GSA 2M80A 4TXVA 3GV1A 2OBKA 4DSSB 4O5QA 3L78A 4XTSA 3CXGA 3KIJA 3CQFA 3D0ZA 1T8EB 4L8EA 1F6MC 3WD6A 4MZWA 2RLIA 5KN2A 5J9BA 1TKDB 3TKSE 1ERTA 1M2AA 1SYXA 1JFUA 1XWCA 3O76A 1Y6EA 2H66A 1PGTA 3VK9A 4GCIA 2QGVA 2H75A 6GSTA 5HR3A 5ECNB 2OA7A 4KH7A 5HQPA 1V2AA 3QDNA 5ELGA 1OC3A 1T7PB 5AIVA 1J0FA 5EY6A 2I81A 4P3YB 1YJ6A 3Q19A 2HXKA 5KOWA 5GZZB 3BJ5A 4MP4A 5F06A 3Q6OA 4USSA 1CQHA 1M99A 4V1Ap 4V1Ag 4F0BA 1OC9A 4L0WA 4ID0A 1BG5A 2B5XA 2LSTA 4Z2UA 4GLTA 2HSHA 2VCZA 2V2GA 1THXA 2H6ZA 1Y25A 5A4WA 3AY8A 4MPFA 3GH9A 1OVNA 5DDLA 2A4VA 5IOWA 5E4WA 4KF9A 2DJ1A 2B7JA 4XS6A 3TKSA 4EKZA 1TOFA 2C0GA 3RPPA 5KN3A 4OFMA 1ZMAA 4PUAA 2HRKA 3GX0A 2C0FA 3VWUA 4F9ZA 5J9CA 1GTBA 1YKCA 1K0CA 5F8BA 1M0UA 2LS5A 4ZB9A 3E3EA 3IHQA 5FWGA 4ML1A 5DBQA 2FY6A 2C3NA 4WR4A 3QR6A 2CVDA 3TB2A 2YJ7A 1R26A 3ZYWA 4O92A 2V32A 3MWHA 3G7IA 4F82A 2OE1A 2H6YA 1ZYNA 1ZZYA 1AW9A 4FH8A 4O5RA 4KSMA 5JWQB 3A2VA 3Q74A 2CAIA 1B4PA 2B3SA 1M2BA 3BBYA 4WBRD 2OBIA 1OE7A 1G7OA 1TJDA 1XOBA 2JADA 1TP9A 2LQOA 1X5DA 3FZ4A 2I3YA 1MDJA 3FYGA 1AQVA 2RUEA 4MJAA 2VOCA 5D73A 5ID2B 4OO4A 5CREA 1PKZA 2J9HA 1FB6A 5IQYA 1A2MA 3MDKA 2VLVA 5IPHA 5KEJA 1N2AA 4MF5A 3F0IA 3JCML 3NZNA 2KUCA 4GWRA 4RUVA 1GSDA 2VM2A 3KMOA 4E8HA 3ERWA 5DALB 3FEUA 4MH2A 5AN1A 2H76A 4GSNA 4XS4B 5DQYA 3TCOA 3TJFA 4N11A 2YP6A 1ZL9A 4JU5A 1X9SB 2MYGA 3EC3A 1CQGA 2WRTA 1Q4JA 3UJ1A 1A0RP 4HZ2A 3UVHA 1I5GA 1Z5YE 3J7Yb 3IHGA 3DVWA 4NHZA 1U3IA 4ISDA 2GSSA 3F9UA 2VL2A 1XOAA 5DJLA 11GSA 3GX8A 5ECHB 3TKQA 5GAND 3CTGA 4I2TA 2YOIA 5ECMB 4K7NA 2H6XA 1OAZA 1AC1A 2XC2A 3TKSC 2N5BA 1XG8A 3LORA 3TRXA 5IMVA 3GIXA 9GSSA 1TRWA 3HJOA 5IPGA 8GSSA 3VI7A 1O73A 4LMVA 1G6YA 1B4QA 3VWWA 4BIKA 1SYRA 4MJBA 3LXZA 3GSTA 1ERUA 5ECKB 3I43A 3HXSA 1R7HA 2XPEA 3SWLA 2VCXA 2F3MA 4KGIA 3BCKA 4MNNA 1QK8A 3ZMKA 2JACA 1EOHA 5ECIB 6GSVA 5D93A 4IJ3A 3EU4A 4WBJA 1SL1B 2VLTA 1DBYA 3EURA 4YQVA 1K0DA 3KH7A 1SENA 3VI5A 1WWJA 1EEMA 4G0IA 4IELA 3WGDA 1BJXA 5AIXA 4V2LA 3IOSA 1J08A 2OE3A 2P31A 3FHKA 2JZSA 4HQZA 2HT9A 2C1YA 1ZOFA 3LFLA 3HJMA 2HNLA 3F4SA 4GQFA 2XHFA 4AGSA 2H74A 1QGVA 2E0QA 4XIHA 4IBPA 4K6XA 2GT6A 3CYNA 4HSCX 4HU9A 1BAYA 2O85A 4EDZA 2KP1A 3LQ7A 5DALA 2H73A 4BVXB 12GSA 4EF0A 4AJ7A 2P5RA 3IK7A 4XS4A 2YZHA 3KEBA 3UMAA 5G30A 4KB3A 2E7PA 3TOTA 1XVWA 1Z3EA 2WS2A 2X8HA 1WOUA 3GKMA 2IFQB 2LRCA 1QXHA 1OKDA 5B7CA 3PR8A 1SU9A 2KOKA 1MDKA 1HD2A 4G19A 4ZL7A 3M8NA 2GTUA 3CBUA 4KX4A 3GFKA 4YAVA 3DD3A 2VLUA 1GLQA 1FHEA 3D21A 2H71A 5H5RA 1K0BA 4IVFA 4ACSA 2JZTA 2H01A 1PMTA 2R5GA 3IK9A 6GSYA 3HZ8A 4HDEA 1FO5A 16GSA 2XBIA 4MJEA 1MTCA 2N5AA 1WIKA 13GSA 4Z2RA 4A5PA 3FR9A 4XHMA 1FVJA 2CT6A 2EIOA 1PL2A 2H1BA 3TDGA 1PKWA 4KUNA 1KEBA 5D8IA 1Q98A 1TDIA 2VL2C 5ECRB 4ZBAA 1K0NA 1YQ1A 5LCZA 2IIYA 1S3RA 2LTKA 1PX6A 4MZBA 3VPQA 2VUPA 1TRUA 5ECSA 4K9ZA 1V98A 3EMPA 5BMUA 3H4KA 3QFAC 5KN0A 2LJAA 3NIVA 1ACVA 1PN9A 3CMIA 5G1LA 1SL2B 4Q5FA 4QL9A 4I6XA 1VRSD 4POMA 5H5QA 1K0OA 3EMXA 1AUCA 2FUG2 3M9KA 3F3RA 3QMXA 2CZ2A 4YAPA 6GSXA 5COHA 3FKFA 5G31A 2FWFA 4TW5A 3ZREA 4ZBDA 2KLXA 4NV5A 4NAXA 4LL1B 5HFGA 3ERGA 1BYEA 4WEYA 1F2EA 4KE3A 1JZWA 2VD1A 3WGXA 3N5OA 1B48A 3TOUA 3TRPA 4K2XA 3LJRA 3LYPA 2FA8A 3ZITA 4OWYA 1SJZA 1EEJA 2GLRA 3LSZA 1K0MA 1QUWA 2IFQA 3E9JB 1UVZA 4ZXGA 2TIRA 3QAVA 2H70A 1TK8B 4GSTA 2MMOA 1ML6A 3WT2A 3LXTA 1XWAA 2C3QA 2FHEA
chains in the Genus database with same CATH topology
5HFIA 3L4NA 4N0VA 3DRNA 2LNTA 3TKPA 2ES7A 2NDOA 5ECLB 4WR5A 2R0GA 3OR5A 3ZVJA 1PN0A 3HY2A 3FZ5A 3MAKA 2MBTA 4DSRA 1TI1A 2EC4A 2JSZA 2IL3A 3S9FA 3DYRA 2HLSA 3CSJA 5AGYA 2O7KA 5CRHA 4PNGA 4MDCA 2LRTA 2YV9A 3EYTA 5DAKB 3F4RA 1LBKA 1T4YA 2IN3A 4FIWA 4TR0A 1HNAA 1QFNA 3KP9A 5E59A 4X1UA 5GAPD 1XIYA 2MMAA 1U3AA 3K8NA 3FMWA 2VD0A 4TR3A 1EZKA 1WE0A 1SKSB 3C73A 1Z6MA 4X4JA 5IO0A 2GVPA 1ON4A 2HSYA 2WCIA 1GRXA 2YWIA 5J4UA 5DJMA 2CVBA 2K18A 4DSQA 1SK0A 2MMNA 3VWVA 1YF1A 3CSHA 3MSZA 4ECIA 2D2ZA 5G5EA 2DC5A 4Z2TA 3APOA 4F2IA 5LNKe 1K3YA 4BWSA 2GZPA 1A8LA 4WKWA 4NV2A 1F3AA 3GTUB 4MK3A 2LRNA 1XZOA 1B8XA 2WB9A 2OJLA 1U87A 2FGXA 2NVLA 3LG6A 4RQXA 3LGCA 3M1GA 4TN8A 6GSWA 4HJ2A 4G0KA 19GSA 5G2ZA 2I4AA 2WDUA 3P90A 1AIUA 3QAGA 2GZZA 5A4UA 2A2SA 1XWKA 2G0FA 3EWLA 3FRCA 4HS1A 4LMWA 4IJIA 2YWMA 4CW9A 3L9SA 5HR2A 1X9MB 2DJJA 5CRGA 1SKRB 1MD3A 20GSA 5D9XA 2GZYA 2CQ9A 5DQSA 1ZYQB 1USBA 3RDWA 3KMNA 1JZDA 3HVXA 1ERWA 3W8SA 3APSA 2F8FA 3H8QA 1N8JA 5CP1A 4OCFA 1HYUA 3QOUA 4YQUA 5FHIA 3RAZA 1S3CA 4TR1A 3EU3A 1BQ7A 2OACA 4I2UA 6GSUA 2X8CA 2FD3A 3J7Yk 1T4ZA 2IMDA 2IWTA 1F37A 4IQAA 2L6DA 3UBKA 3ZFLA 5JCUA 2PVQA 5DAKA 2GSQA 2EIQA 1XBSA 5IMZA 4FQUA 4AJ6A 2R3XA 2WULA 4RI7A 4V2MA 2PN8A 1SD9A 2R37A 2V41A 1GSYA 4IS0A 3HZ4A 1RK4A 5JWRB 1ABAA 5ECQB 2PERA 3KTBA 4FYBA 2VM1A 4HUAA 2E2GA 1X5CA 4EE0A 3GMFA 2P5QA 2R4VA 3HA9A 4PXOA 4WETA 4GQCA 3FR3A 3GHAA 2DKHA 5A4VA 2CZ3A 1HNCA 2CVKA 2IJYA 2OE0A 5IM9A 1Z9HA 2I1UA 3SBCA 2H8LA 2BJXA 1THOA 3ED3A 4I5QA 1EGOA 2V1MA 3PINA 3DMLA 3APQA 1MEKA 3GTUA 2PWJA 1O7UA 3DEXA 2QSIA 4NHWA 1PL1A 1W4VA 3HJPA 1U6TA 4IP1A 1XWGA 2DMLA 3MNGA 3U5RE 3HVSA 2X64A 2F8AA 3IC8A 3O6TA 3UEMA 3ZTLA 4H86A 5CNWA 3PGTA 3UOMA 1IYHA 5KN1A 3QAWA 2VAFA 3GKKA 3LWAA 3UL3A 2OKAA 2G2QA 4EVMA 4J56E 1SD8A 4LL4B 4WXTA 2V6OA 1SKWB 1GTAA 1F9MA 3GNJA 1UC7A 1AQWA 3VURA 2O89A 2DJ3A 1VF1A 1O6JA 1VF3A 1Z6NA 4ZB6A 2B1KA 2X99A 4G9HA 4KNDA 1WMJA 2AV4A 3TJGA 4X43A 1A0FA 2AAWA 3IBHA 3EINA 1FOVA 3UAPA 5IMAA 4OFTA 3V1WA 1JLWA 1M9BA 4X0XA 2HI7A 2CX3A 2L59A 2PMTA 1Z7PA 5INYA 5J5NA 2FCHA 2L4CA 1MDIA 1A8YA 4MH3A 2LV3A 3RHCA 4MPGA 2UZ8A 4PNFA 2IMKA 1VGLA 3WYWA 2E2MA 1TTZA 2K6VA 3F3QA 4KDUA 4G2EA 5LD0A 1A24A 3ZVJD 1G0TA 1V57A 3D4MA 1V9WA 2FNOA 4JRRA 2VIMA 2XBQA 4GSSA 2B7KA 3C1SA 1X0RA 1UN2A 3C7MA 3C71A 5AISA 4K2DA 3N9JA 2BTOT 1TXXA 2CA8A 4I97A 3A2XA 4ULXA 2YJHA 1GTUA 4DEJA 2MBSA 2QC7A 4EIQA 2MZCA 4MMMA 4IHUA 2CAQA 2BMXA 2FWGA 5ECPB 1MD4A 4ECJA 4WF4A 1X9WB 3G7JA 1TRVA 2GS3A 2PPTA 4K0NA 2X8GA 4O5UA 3GH6A 4XRDA 5B8BA 3KGKA 3D4TA 4PQIA 4CY8A 3TJJA 1GL8A 1GUMA 4MA9A 4XS1A 7GSSA 4KAEA 2YCDA 1O8WA 3DGQA 3KJYA 2HE3A 1T3BA 3IR4A 4PUFC 4BVYA 4GTUA 4YQMA 3ISOA 4ZL8A 1RW1A 1WRYA 2AHEA 2O8VB 1SJIA 2HZEB 5IMCA 4ECCA 3O3TA 3GUSA 2F51A 3IA1A 1XPVA 1WJKA 2Z9SA 2P0GA 1IYIA 2R0PA 3CRTA 3IV4A 4Z7XA 2PVOC 2QA2A 3HCZA 3IPZA 3QCPA 3HHVA 3L0HA 1F3BA 2YNXA 2JZRA 2YANA 2LJKA 1AAZA 4EXJA 4EO3A 1QQ2A 1ZCPA 3TRQA 3D6IA 3HDCA 4JEDA 4OCEA 3TJKA 2HRNA 3M3MA 1TU7A 3IRAA 3HVVA 3KH9A 4YKFA 4HOJA 4EL1A 1G7EA 2LEGA 3LW9A 5JCGA 2H1DA 4YH2A 3F8UA 3TGZA 2C0DA 1FW1A 2DJ0A 4JZQA 1TK5B 4HZ4A 3UBLA 5JWOB 5KOXA 2VO4A 3PPUA 2H0GA 4TVEA 1GH2A 1KBNA 3M9JA 1OYJA 4K5SA 1GUKA 1GULA 4KCEA 3KTLA 2DIYA 3UIWA 1PX7A 1JLVA 1SJ6A 2AYTA 2VCQA 1OKTA 1PQNA 5A5KA 2WGRA 2RM6A 3NOFA 5IMDA 2H72A 1B9XC 3MIXA 2ZCTA 2R0CA 1AQXA 2EIRA 2R6KA 1UA5A 5IO2A 1OE8A 4PURA 3ZL5A 4N0ZA 4IQ1A 2I9HA 3EPTA 4WF5A 1FAAA 4EC0A 1A2JA 3DKSA 4TR1B 1DE1A 2GQLA 1H4OA 5D96A 4MABA 4Q5QA 5HR1A 4ICYA 2PBJA 1T00A 2C80A 4PGTA 5B6MA 3HD5A 5D9VA 2VL3A 1FB0A 5DCHA 1XW6A 3FY7A 3GKNA 4BL7B 4K5RA 4CDOA 2N5FA 3HKRA 2F9SA 3VWXA 1GNWA 1I9DA 1HNBA 4L0UA 4K1FA 1YEXA 2XPDA 3H1NA 3A5WA 4NWYA 2VL9A 3A5IA 2PU9C 2HZEA 2REMA 5B8AA 1R5PA 4IN0A 4TOPA 4IGJA 3ZIJA 3ME7A 3IC4A 4L5LA 1XVQA 2L4QA 3ZFBA 3IXRA 3KM6A 1OC8A 1TW9A 2WZ9A 1M9AA 2KP2A 1GSEA 4ZIJA 1YEPA 2GDRA 1ZYPA 4PX1A 1GSUA 2LKUA 2YWOA 2V6KA 5F05A 3IAS2 2L57A 3F4TA 3G7YA 5CRDA 4MCUA 4POLA 3P8WA 5ABRA 5HFKA 5GSSA 2YZUA 1TK0B 2ALBA 3I9V2 3W8JA 2DBCA 3UVTA 4G0LA 4KSOA 3VFIA 4IKHA 4ML6A 4DVCA 1YF0A 4D73B 2ON5A 3F63A 3FR6A 1VF2A 4AJ8A 4LLRA 2IMEA 1GSQA 3GL3A 3RHBA 2FWEA 5CYYA 3CRUA 2HRAA 1JZOA 5IOXA 4LA1A 1SK2A 4AF2A 3HYPA 3KCMA 4K7OA 3TUEA 1LJRA 2R2JA 1K3OA 3GSSA 1J9BA 5C04A 4DSSA 4EDYA 2DJKA 2DMMA 17GSA 3ZRDA 4KW6A 1H75A 4V2NA 2B6MA 2YPMA 3RBTA 3LYKA 5J41A 2HSMA 2JSYA 2X4AA 4RI6A 3PH9A 2B1LA 1EV9A 2A4HA 1GSFA 3KZQA 3R3EA 2IPAA 5L71A 1K0AA 1GP1A 1XW5A 2PGTA 1KTEA 4JR6A 1M7TA 3ME8A 1DSBA 4EUYA 2DIZA 1G6WA 3Q18A 5F0GA 4NPBA 2GSTA 5G5FA 2C0EA 4JE1A 3QPMA 2C3TA 4BL7A 2WFCA 4ILFA 4OD7A 1GWCA 4TKYA 1M2DA 3US3A 5ENUA 2H0HA 4IP6A 2H0IA 1KNGA 2YN1A 1ZGNA 3ZZXA 4G10A 4XCSA 1LU4A 1C72A 2M46A 2RM5A 2HRFA 3F6DA 1ERVA 3W6GA 1PA3A 1O85A 3IAM2 1GNEA 2DKIA 4BWQA 1JZRA 3H79A 4KA0A 2HZFA 4Q5RA 4XRAA 2K8VA 4PQHA 2ZUPA 4JR4A 5G1KA 3UARA 3GN3A 18GSA 5EVOA 2GQMA 1EP7A 4OMVA 4PTSA 2DLXA 1XWBA 1XXUA 1ZYEA 5FT3A 3DVXA 1W89A 1V58A 4JBBA 1XCCA 2HYXA 4IW9A 4K0GA 4CHSA 5D9WA 2B5EA 1E6BA 3L9UA 1EP8A 2NPBA 4TR4A 2GGTA 4CY6A 4D73A 3BCIA 1TRSA 2H30A 3QD9A 1E2YA 5CO3A 4OO5A 3G9BA 1T1VA 3KD0A 2LNSA 5JCWA 3M0FA 1NHYA 3IE3A 4BVYB 2O87A 2IMIA 2CX4A 1EWXA 4Q5NA 4FO5A 4HQSA 2AUVA 4HU7A 4MLYA 2GSRA 3ERFA 4HI7A 3GA4A 3IDVA 3U6VA 4QL7A 3KP8A 2LQQA 1Z7RA 2A2PA 2X49A 5IIZA 5C00A 5J3RA 1ILOA 2L6CA 4ZILA 1HQOA 4FYCA 3FK8A 1K3LA 1X5EA 5HR0A 1EGRA 3FW2A 3ZMLA 3DWVA 2GQKA 4RQRA 3GKXA 1SL0B 4NXIA 4ECBA 2C8UA 5GSTA 4J57E 2VCWA 1PRXA 2LUSA 4MJCA 2K8SA 5ID2A 2L5OA 3D22A 1S3DA 1A2LA 3DIEA 4NMUA 2ZNMA 1V40A 1GTIA 1YKAA 4MF6A 5H5SA 3H93A 1O81A 4TXOB 22GSA 4J2FA 2JU5A 1YY7A 2NBSA 1VF4A 2H1GA 4L5OA 1GLPA 2YWNA 2KHPA 5ECOB 4POKA 2TRXA 3VLNA 1DUGA 2PUKC 4N30A 3GL5A 1FOHA 2H19A 4ZL9A 2VCVA 3CTFA 1TI3A 3F6FA 3I69A 2AJQB 3KXOA 1JHBA 1S3AA 1XFLA 1B9YC 4EIPA 3C8EA 5IMFA 4YKGA 3DXBA 4O32A 3ZLPA 3E0UA 3WT1A 4K8MA 4HJMA 4KCAA 3MYDA 1QMVA 1BEDA 1WP0A 4F03A 5B6NA 2NTOA 4KDXA 3BD2A 2CV4A 2WJUA 1URMA 1O8XA 1WPIA 2H1AA 14GSA 1NSWA 4N10A 2L5LA 4QQ7A 1U88A 3I6AA 2IMFA 1GUHA 1DE2A 1YZXA 3WGEA 3BOAA 1EV4A 3FZAA 2OADA 2GT5A 3P7XA 1A23A 1BX9A 2HFDA 3QFBC 2ON7A 4ZB8A 3GYKA 4F0CA 2FA4A 2QKEA 1OC9B 3R2QA 3FZ9A 2A2RA 2RIIA 2J23A 5BRTA 4TRXA 1PD21 3LEFA 4K7IA 2LJRA 4O7HA 4I8BA 1ST9A 1NHOA 5ELAA 1R4WA 4ZBBA 3P2AA 5EPFA 4MF7A 1PSQA 1TU8A 2FLSA 5CAXA 2VCTA 1R5AA 3GRXA 1GSSA 3A2WA 4OFNA 2K9FA 2B5YA 3EVIA 1FG4A 2AB6A 2DJ2A 2C4JA 1EOGA 3EE2A 4GXZA 2DSAA 3ZIVA 3CSIA 4E8EA 1XW9A 5D9TA 4KDYA 2QA1A 3L9VA 4POBA 5EL8A 1SK1A 2MMZA 3GURA 1RQMA 6GSSA 4HEA2 3TKRA 5DVBA 3D5JA 3C1RA 3TJBA 4TXOA 5DCGA 4GRFA 2FWHA 4BPYA 4MZCA 2M72A 1FVKA 4FYUA 1AXDA 2TRCP 4GF0A 4BA7A 2YV7A 3RPNA 4PQ1A 1NW2A 1NM3A 3A3TA 2JL4A 2RUFA 3VPTA 5CRWA 1YDKA 5F07A 4BVXA 10GSA 2M80A 4TXVA 3GV1A 2OBKA 4DSSB 4O5QA 3L78A 4XTSA 3CXGA 3KIJA 3D0ZA 1T8EB 4L8EA 1F6MC 3WD6A 4MZWA 2RLIA 5KN2A 5J9BA 1TKDB 3TKSE 1ERTA 1M2AA 1SYXA 1JFUA 1XWCA 3O76A 1Y6EA 2H66A 1PGTA 3VK9A 4GCIA 2QGVA 2H75A 6GSTA 5HR3A 5ECNB 2OA7A 4KH7A 5HQPA 1V2AA 3QDNA 5ELGA 1OC3A 1T7PB 5AIVA 1J0FA 5EY6A 2I81A 4P3YB 1YJ6A 3Q19A 2HXKA 5KOWA 5GZZB 3BJ5A 4MP4A 5F06A 3Q6OA 4USSA 1CQHA 1M99A 4V1Ap 4V1Ag 4F0BA 1OC9A 4L0WA 4ID0A 1BG5A 2B5XA 2LSTA 4Z2UA 4GLTA 2HSHA 2VCZA 2V2GA 1THXA 2H6ZA 1Y25A 5A4WA 3AY8A 4MPFA 3GH9A 1OVNA 5DDLA 2A4VA 5IOWA 5E4WA 4KF9A 2DJ1A 2B7JA 4XS6A 3TKSA 4EKZA 1TOFA 2C0GA 3RPPA 5KN3A 4OFMA 1ZMAA 4PUAA 2HRKA 3GX0A 2C0FA 3VWUA 4F9ZA 5J9CA 1GTBA 1YKCA 1K0CA 5F8BA 1M0UA 2LS5A 4ZB9A 3E3EA 3IHQA 5FWGA 4ML1A 5DBQA 2FY6A 2C3NA 4WR4A 3QR6A 2CVDA 3TB2A 2YJ7A 1R26A 3ZYWA 4O92A 2V32A 3MWHA 3G7IA 4F82A 2OE1A 2H6YA 1ZYNA 1ZZYA 1AW9A 4FH8A 4O5RA 4KSMA 5JWQB 3A2VA 3Q74A 2CAIA 1B4PA 2B3SA 1M2BA 3BBYA 4WBRD 2OBIA 1OE7A 1G7OA 1TJDA 1XOBA 2JADA 1TP9A 2LQOA 1X5DA 3FZ4A 2I3YA 1MDJA 3FYGA 1AQVA 2RUEA 4MJAA 2VOCA 5D73A 5ID2B 4OO4A 5CREA 1PKZA 2J9HA 1FB6A 5IQYA 1A2MA 3MDKA 2VLVA 5IPHA 5KEJA 1N2AA 4MF5A 3F0IA 3JCML 3NZNA 2KUCA 4GWRA 4RUVA 1GSDA 2VM2A 3KMOA 4E8HA 3ERWA 5DALB 3FEUA 4MH2A 5AN1A 2H76A 4GSNA 4XS4B 5DQYA 3TCOA 3TJFA 4N11A 2YP6A 1ZL9A 4JU5A 1X9SB 2MYGA 3EC3A 1CQGA 2WRTA 1Q4JA 3UJ1A 1A0RP 4HZ2A 3UVHA 1I5GA 1Z5YE 3J7Yb 3IHGA 3DVWA 4NHZA 1U3IA 4ISDA 2GSSA 3F9UA 2VL2A 1XOAA 5DJLA 11GSA 3GX8A 5ECHB 3TKQA 5GAND 3CTGA 4I2TA 2YOIA 5ECMB 4K7NA 2H6XA 1OAZA 1AC1A 2XC2A 3TKSC 2N5BA 3LORA 3TRXA 5IMVA 3GIXA 9GSSA 1TRWA 3HJOA 5IPGA 8GSSA 3VI7A 1O73A 4LMVA 1G6YA 1B4QA 3VWWA 1SYRA 4MJBA 3LXZA 3GSTA 1ERUA 5ECKB 3I43A 3HXSA 1R7HA 2XPEA 3SWLA 2VCXA 2F3MA 4KGIA 3BCKA 4MNNA 1QK8A 3ZMKA 2JACA 1EOHA 5ECIB 6GSVA 5D93A 4IJ3A 3EU4A 4WBJA 1SL1B 2VLTA 1DBYA 3EURA 4YQVA 1K0DA 3KH7A 1SENA 3VI5A 1WWJA 1EEMA 4G0IA 4IELA 3WGDA 1BJXA 5AIXA 4V2LA 3IOSA 1J08A 2OE3A 2P31A 3FHKA 2JZSA 4HQZA 2HT9A 2C1YA 1ZOFA 3LFLA 3HJMA 2HNLA 3F4SA 4GQFA 2XHFA 4AGSA 2H74A 1QGVA 2E0QA 4XIHA 4IBPA 4K6XA 2GT6A 3CYNA 4HU9A 1BAYA 2O85A 4EDZA 2KP1A 3LQ7A 5DALA 2H73A 4BVXB 12GSA 4EF0A 4AJ7A 2P5RA 3IK7A 4XS4A 2YZHA 3KEBA 3UMAA 5G30A 4KB3A 2E7PA 3TOTA 1XVWA 1Z3EA 2WS2A 2X8HA 1WOUA 3GKMA 2IFQB 2LRCA 1QXHA 1OKDA 5B7CA 3PR8A 1SU9A 2KOKA 1MDKA 1HD2A 4G19A 4ZL7A 3M8NA 2GTUA 3CBUA 4KX4A 3GFKA 4YAVA 3DD3A 2VLUA 1GLQA 1FHEA 3D21A 2H71A 5H5RA 1K0BA 4IVFA 4ACSA 2JZTA 2H01A 1PMTA 2R5GA 3IK9A 6GSYA 3HZ8A 4HDEA 1FO5A 16GSA 2XBIA 4MJEA 1MTCA 2N5AA 1WIKA 13GSA 4Z2RA 4A5PA 3FR9A 4XHMA 1FVJA 2CT6A 2EIOA 1PL2A 2H1BA 3TDGA 1PKWA 4KUNA 1KEBA 5D8IA 1Q98A 1TDIA 2VL2C 5ECRB 4ZBAA 1K0NA 1YQ1A 5LCZA 2IIYA 2LTKA 1PX6A 4MZBA 3VPQA 2VUPA 1TRUA 5ECSA 4K9ZA 1V98A 3EMPA 5BMUA 3H4KA 3QFAC 5KN0A 2LJAA 3NIVA 1ACVA 1PN9A 3CMIA 5G1LA 1SL2B 4Q5FA 4QL9A 4I6XA 1VRSD 4POMA 5H5QA 1K0OA 3EMXA 1AUCA 2FUG2 3M9KA 3F3RA 3QMXA 2CZ2A 4YAPA 6GSXA 5COHA 3FKFA 5G31A 2FWFA 4TW5A 3ZREA 4ZBDA 2KLXA 4NV5A 4NAXA 4LL1B 5HFGA 3ERGA 1BYEA 4WEYA 1F2EA 4KE3A 1JZWA 2VD1A 3WGXA 3N5OA 1B48A 3TOUA 3TRPA 4K2XA 3LJRA 3LYPA 2FA8A 3ZITA 4OWYA 1SJZA 1EEJA 2GLRA 3LSZA 1K0MA 1QUWA 2IFQA 3E9JB 1UVZA 4ZXGA 2TIRA 3QAVA 2H70A 1TK8B 4GSTA 2MMOA 1ML6A 3WT2A 3LXTA 1XWAA 2C3QA 2FHEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HFI A;  3L4N A;  4N0V A;  3DRN A;  2LNT A;  3TKP A;  2ES7 A;  2NDO A;  5ECL B;  4WR5 A;  3OR5 A;  3ZVJ A;  3HY2 A;  3FZ5 A;  3MAK A;  2MBT A;  4DSR A;  1TI1 A;  2EC4 A;  2JSZ A;  2IL3 A;  3S9F A;  3DYR A;  2HLS A;  3CSJ A;  5AGY A;  2O7K A;  5CRH A;  4PNG A;  4MDC A;  2LRT A;  2YV9 A;  3EYT A;  5DAK B;  3F4R A;  1LBK A;  1T4Y A;  2IN3 A;  4FIW A;  4TR0 A;  1HNA A;  1QFN A;  3KP9 A;  5E59 A;  4X1U A;  5GAP D;  1XIY A;  2MMA A;  1U3A A;  3K8N A;  2VD0 A;  4TR3 A;  1EZK A;  1WE0 A;  1SKS B;  3C73 A;  1Z6M A;  5IO0 A;  2GVP A;  1ON4 A;  2HSY A;  2WCI A;  1GRX A;  2YWI A;  5J4U A;  5DJM A;  2CVB A;  2K18 A;  4DSQ A;  1SK0 A;  2MMN A;  3VWV A;  1YF1 A;  3CSH A;  3MSZ A;  4ECI A;  2D2Z A;  5G5E A;  2DC5 A;  3APO A;  4F2I A;  5LNK e;  1K3Y A;  4BWS A;  2GZP A;  1A8L A;  4WKW A;  4NV2 A;  1F3A A;  3GTU B;  4MK3 A;  2LRN A;  1XZO A;  1B8X A;  2WB9 A;  2OJL A;  1U87 A;  2FGX A;  2NVL A;  3LG6 A;  4RQX A;  3LGC A;  3M1G A;  4TN8 A;  6GSW A;  4HJ2 A;  19GS A;  5G2Z A;  2I4A A;  2WDU A;  3P90 A;  1AIU A;  3QAG A;  2GZZ A;  5A4U A;  2A2S A;  1XWK A;  2G0F A;  3EWL A;  3FRC A;  4HS1 A;  4LMW A;  4IJI A;  2YWM A;  4CW9 A;  3L9S A;  5HR2 A;  1X9M B;  2DJJ A;  5CRG A;  1SKR B;  1MD3 A;  20GS A;  5D9X A;  2GZY A;  2CQ9 A;  5DQS A;  1ZYQ B;  1USB A;  3RDW A;  3KMN A;  1JZD A;  3HVX A;  1ERW A;  3W8S A;  3APS A;  2F8F A;  3H8Q A;  1N8J A;  5CP1 A;  4OCF A;  1HYU A;  3QOU A;  4YQU A;  5FHI A;  3RAZ A;  1S3C A;  4TR1 A;  3EU3 A;  1BQ7 A;  2OAC A;  4I2U A;  6GSU A;  2X8C A;  2FD3 A;  3J7Y k;  1T4Z A;  2IMD A;  2IWT A;  1F37 A;  4IQA A;  2L6D A;  3UBK A;  3ZFL A;  5JCU A;  2PVQ A;  5DAK A;  2GSQ A;  2EIQ A;  1XBS A;  5IMZ A;  4AJ6 A;  2R3X A;  2WUL A;  4RI7 A;  4V2M A;  2PN8 A;  1SD9 A;  2R37 A;  2V41 A;  1GSY A;  4IS0 A;  3HZ4 A;  1RK4 A;  5JWR B;  1ABA A;  5ECQ B;  2PER A;  3KTB A;  4FYB A;  2VM1 A;  4HUA A;  2E2G A;  1X5C A;  4EE0 A;  3GMF A;  2P5Q A;  2R4V A;  3HA9 A;  4PXO A;  4WET A;  4GQC A;  3FR3 A;  3GHA A;  5A4V A;  2CZ3 A;  1HNC A;  2CVK A;  2IJY A;  2OE0 A;  5IM9 A;  1Z9H A;  2I1U A;  3SBC A;  2H8L A;  2BJX A;  1THO A;  3ED3 A;  4I5Q A;  1EGO A;  2V1M A;  3PIN A;  3DML A;  3APQ A;  1MEK A;  3GTU A;  2PWJ A;  1O7U A;  3DEX A;  2QSI A;  4NHW A;  1PL1 A;  1W4V A;  3HJP A;  1U6T A;  4IP1 A;  1XWG A;  2DML A;  3MNG A;  3U5R E;  3HVS A;  2X64 A;  2F8A A;  3O6T A;  3UEM A;  3ZTL A;  4H86 A;  5CNW A;  3PGT A;  3UOM A;  1IYH A;  5KN1 A;  3QAW A;  2VAF A;  3GKK A;  3LWA A;  3UL3 A;  2OKA A;  2G2Q A;  4EVM A;  4J56 E;  1SD8 A;  4LL4 B;  4WXT A;  2V6O A;  1SKW B;  1GTA A;  1F9M A;  3GNJ A;  1UC7 A;  1AQW A;  3VUR A;  2O89 A;  2DJ3 A;  1VF1 A;  1O6J A;  1VF3 A;  1Z6N A;  4ZB6 A;  2B1K A;  2X99 A;  4G9H A;  4KND A;  1WMJ A;  2AV4 A;  3TJG A;  4X43 A;  1A0F A;  2AAW A;  3IBH A;  3EIN A;  1FOV A;  3UAP A;  5IMA A;  4OFT A;  3V1W A;  1JLW A;  1M9B A;  4X0X A;  2HI7 A;  2CX3 A;  2L59 A;  2PMT A;  1Z7P A;  5INY A;  5J5N A;  2FCH A;  2L4C A;  1MDI A;  1A8Y A;  4MH3 A;  2LV3 A;  3RHC A;  4MPG A;  4PNF A;  2IMK A;  1VGL A;  3WYW A;  2E2M A;  1TTZ A;  2K6V A;  3F3Q A;  4KDU A;  4G2E A;  5LD0 A;  1A24 A;  3ZVJ D;  1G0T A;  1V57 A;  3D4M A;  1V9W A;  2FNO A;  4JRR A;  2VIM A;  2XBQ A;  4GSS A;  2B7K A;  3C1S A;  1X0R A;  1UN2 A;  3C7M A;  3C71 A;  5AIS A;  4K2D A;  3N9J A;  2BTO T;  1TXX A;  2CA8 A;  4I97 A;  3A2X A;  4ULX A;  2YJH A;  1GTU A;  4DEJ A;  2MBS A;  2QC7 A;  2MZC A;  4MMM A;  4IHU A;  2CAQ A;  2BMX A;  2FWG A;  5ECP B;  1MD4 A;  4ECJ A;  4WF4 A;  1X9W B;  3G7J A;  1TRV A;  2GS3 A;  2PPT A;  4K0N A;  2X8G A;  3GH6 A;  4XRD A;  5B8B A;  3KGK A;  3D4T A;  4PQI A;  3TJJ A;  1GL8 A;  1GUM A;  4MA9 A;  4XS1 A;  7GSS A;  4KAE A;  2YCD A;  1O8W A;  3DGQ A;  3KJY A;  2HE3 A;  1T3B A;  3IR4 A;  4PUF C;  4BVY A;  4GTU A;  4YQM A;  3ISO A;  4ZL8 A;  1RW1 A;  1WRY A;  2AHE A;  2O8V B;  1SJI A;  2HZE B;  5IMC A;  4ECC A;  3O3T A;  3GUS A;  2F51 A;  3IA1 A;  1XPV A;  1WJK A;  2Z9S A;  2P0G A;  1IYI A;  3CRT A;  3IV4 A;  4Z7X A;  2PVO C;  3HCZ A;  3IPZ A;  3QCP A;  3HHV A;  3L0H A;  1F3B A;  2YNX A;  2JZR A;  2YAN A;  2LJK A;  1AAZ A;  4EXJ A;  4EO3 A;  1QQ2 A;  1ZCP A;  3TRQ A;  3D6I A;  3HDC A;  4JED A;  4OCE A;  3TJK A;  2HRN A;  3M3M A;  1TU7 A;  3IRA A;  3HVV A;  3KH9 A;  4HOJ A;  4EL1 A;  1G7E A;  2LEG A;  5JCG A;  2H1D A;  4YH2 A;  3F8U A;  3TGZ A;  2C0D A;  1FW1 A;  2DJ0 A;  4JZQ A;  1TK5 B;  4HZ4 A;  3UBL A;  5JWO B;  2VO4 A;  2H0G A;  4TVE A;  1GH2 A;  1KBN A;  3M9J A;  1OYJ A;  1GUK A;  1GUL A;  4KCE A;  3KTL A;  2DIY A;  3UIW A;  1PX7 A;  1JLV A;  1SJ6 A;  2AYT A;  2VCQ A;  1OKT A;  1PQN A;  5A5K A;  2WGR A;  2RM6 A;  3NOF A;  5IMD A;  2H72 A;  1B9X C;  2ZCT A;  1AQX A;  2EIR A;  2R6K A;  1UA5 A;  5IO2 A;  1OE8 A;  4PUR A;  3ZL5 A;  4N0Z A;  4IQ1 A;  2I9H A;  4WF5 A;  1FAA A;  4EC0 A;  1A2J A;  3DKS A;  4TR1 B;  1DE1 A;  2GQL A;  1H4O A;  5D96 A;  4MAB A;  4Q5Q A;  5HR1 A;  2PBJ A;  1T00 A;  2C80 A;  4PGT A;  5B6M A;  3HD5 A;  5D9V A;  2VL3 A;  1FB0 A;  5DCH A;  1XW6 A;  3FY7 A;  3GKN A;  4CDO A;  2N5F A;  3HKR A;  2F9S A;  3VWX A;  1GNW A;  1I9D A;  1HNB A;  4L0U A;  4K1F A;  1YEX A;  2XPD A;  3H1N A;  3A5W A;  4NWY A;  2VL9 A;  2PU9 C;  2HZE A;  2REM A;  5B8A A;  1R5P A;  4IN0 A;  4TOP A;  4IGJ A;  3ZIJ A;  3ME7 A;  3IC4 A;  4L5L A;  1XVQ A;  2L4Q A;  3ZFB A;  3IXR A;  3KM6 A;  1OC8 A;  1TW9 A;  2WZ9 A;  1M9A A;  2KP2 A;  1GSE A;  4ZIJ A;  1YEP A;  2GDR A;  4PX1 A;  1GSU A;  2LKU A;  2YWO A;  2V6K A;  5F05 A;  3IAS 2;  2L57 A;  3F4T A;  3G7Y A;  5CRD A;  4MCU A;  4POL A;  3P8W A;  5ABR A;  5HFK A;  5GSS A;  2YZU A;  1TK0 B;  2ALB A;  3I9V 2;  3W8J A;  2DBC A;  3UVT A;  4KSO A;  3VFI A;  4IKH A;  4ML6 A;  4DVC A;  1YF0 A;  4D73 B;  2ON5 A;  3F63 A;  3FR6 A;  1VF2 A;  4AJ8 A;  4LLR A;  2IME A;  1GSQ A;  3GL3 A;  3RHB A;  2FWE A;  5CYY A;  3CRU A;  1JZO A;  5IOX A;  4LA1 A;  1SK2 A;  4AF2 A;  3HYP A;  3KCM A;  4K7O A;  3TUE A;  1LJR A;  2R2J A;  1K3O A;  3GSS A;  1J9B A;  5C04 A;  4DSS A;  4EDY A;  2DJK A;  2DMM A;  17GS A;  3ZRD A;  4KW6 A;  1H75 A;  4V2N A;  2B6M A;  2YPM A;  3RBT A;  3LYK A;  5J41 A;  2JSY A;  4RI6 A;  3PH9 A;  2B1L A;  1EV9 A;  1GSF A;  3KZQ A;  2IPA A;  5L71 A;  1K0A A;  1GP1 A;  1XW5 A;  2PGT A;  1KTE A;  4JR6 A;  1M7T A;  3ME8 A;  1DSB A;  4EUY A;  2DIZ A;  1G6W A;  3Q18 A;  5F0G A;  4NPB A;  2GST A;  5G5F A;  2C0E A;  4JE1 A;  3QPM A;  2C3T A;  4BL7 A;  2WFC A;  4ILF A;  4OD7 A;  1GWC A;  4TKY A;  1M2D A;  3US3 A;  5ENU A;  2H0H A;  4IP6 A;  2H0I A;  1KNG A;  2YN1 A;  1ZGN A;  3ZZX A;  4G10 A;  4XCS A;  1LU4 A;  1C72 A;  2M46 A;  2RM5 A;  2HRF A;  3F6D A;  1ERV A;  3W6G A;  1PA3 A;  1O85 A;  3IAM 2;  1GNE A;  4BWQ A;  1JZR A;  3H79 A;  4KA0 A;  2HZF A;  4Q5R A;  4XRA A;  2K8V A;  4PQH A;  2ZUP A;  4JR4 A;  5G1K A;  3UAR A;  3GN3 A;  18GS A;  5EVO A;  2GQM A;  1EP7 A;  4OMV A;  2DLX A;  1XWB A;  1XXU A;  1ZYE A;  5FT3 A;  3DVX A;  1W89 A;  1V58 A;  4JBB A;  1XCC A;  2HYX A;  4IW9 A;  4K0G A;  4CHS A;  5D9W A;  2B5E A;  1E6B A;  3L9U A;  1EP8 A;  2NPB A;  4TR4 A;  2GGT A;  4D73 A;  3BCI A;  1TRS A;  2H30 A;  3QD9 A;  1E2Y A;  5CO3 A;  4OO5 A;  3G9B A;  1T1V A;  3KD0 A;  2LNS A;  5JCW A;  3M0F A;  1NHY A;  3IE3 A;  2O87 A;  2IMI A;  2CX4 A;  1EWX A;  4Q5N A;  4FO5 A;  4HQS A;  2AUV A;  4HU7 A;  4MLY A;  2GSR A;  3ERF A;  4HI7 A;  3GA4 A;  3IDV A;  3U6V A;  4QL7 A;  3KP8 A;  2LQQ A;  1Z7R A;  5IIZ A;  5C00 A;  5J3R A;  1ILO A;  2L6C A;  4ZIL A;  1HQO A;  4FYC A;  3FK8 A;  1K3L A;  1X5E A;  5HR0 A;  1EGR A;  3FW2 A;  3ZML A;  3DWV A;  2GQK A;  4RQR A;  3GKX A;  1SL0 B;  4NXI A;  4ECB A;  2C8U A;  5GST A;  4J57 E;  2VCW A;  1PRX A;  2LUS A;  4MJC A;  2K8S A;  5ID2 A;  2L5O A;  3D22 A;  1S3D A;  1A2L A;  3DIE A;  4NMU A;  2ZNM A;  1V40 A;  1GTI A;  1YKA A;  4MF6 A;  5H5S A;  3H93 A;  1O81 A;  4TXO B;  22GS A;  4J2F A;  2JU5 A;  1YY7 A;  2NBS A;  1VF4 A;  2H1G A;  4L5O A;  1GLP A;  2YWN A;  2KHP A;  5ECO B;  4POK A;  2TRX A;  3VLN A;  1DUG A;  2PUK C;  4N30 A;  3GL5 A;  4ZL9 A;  2H19 A;  2VCV A;  3CTF A;  1TI3 A;  3F6F A;  3I69 A;  2AJQ B;  3KXO A;  1JHB A;  1S3A A;  1XFL A;  1B9Y C;  3C8E A;  5IMF A;  3DXB A;  4O32 A;  3ZLP A;  3E0U A;  3WT1 A;  4K8M A;  4HJM A;  4KCA A;  1QMV A;  1BED A;  1WP0 A;  4F03 A;  5B6N A;  2NTO A;  4KDX A;  3BD2 A;  2CV4 A;  2WJU A;  1URM A;  1O8X A;  1WPI A;  2H1A A;  14GS A;  1NSW A;  4N10 A;  2L5L A;  4QQ7 A;  1U88 A;  3I6A A;  2IMF A;  1GUH A;  1DE2 A;  1YZX A;  3WGE A;  3BOA A;  1EV4 A;  3FZA A;  2OAD A;  2GT5 A;  3P7X A;  1A23 A;  1BX9 A;  2HFD A;  3QFB C;  2ON7 A;  4ZB8 A;  3GYK A;  4F0C A;  2FA4 A;  2QKE A;  1OC9 B;  3R2Q A;  3FZ9 A;  2A2R A;  2RII A;  2J23 A;  4TRX A;  1PD2 1;  3LEF A;  4K7I A;  2LJR A;  4O7H A;  4I8B A;  1ST9 A;  1NHO A;  5ELA A;  1R4W A;  4ZBB A;  3P2A A;  5EPF A;  4MF7 A;  1PSQ A;  1TU8 A;  2FLS A;  5CAX A;  2VCT A;  1R5A A;  3GRX A;  1GSS A;  3A2W A;  4OFN A;  2K9F A;  2B5Y A;  3EVI A;  1FG4 A;  2AB6 A;  2DJ2 A;  2C4J A;  1EOG A;  3EE2 A;  4GXZ A;  2DSA A;  3ZIV A;  3CSI A;  4E8E A;  1XW9 A;  5D9T A;  4KDY A;  4POB A;  3L9V A;  5EL8 A;  1SK1 A;  2MMZ A;  3GUR A;  1RQM A;  6GSS A;  4HEA 2;  3TKR A;  5DVB A;  3D5J A;  3C1R A;  3TJB A;  4TXO A;  5DCG A;  4GRF A;  2FWH A;  4BPY A;  4MZC A;  2M72 A;  1FVK A;  4FYU A;  1AXD A;  2TRC P;  4GF0 A;  4BA7 A;  2YV7 A;  3RPN A;  4PQ1 A;  1NW2 A;  1NM3 A;  3A3T A;  2JL4 A;  2RUF A;  3VPT A;  5CRW A;  1YDK A;  5F07 A;  4BVX A;  10GS A;  2M80 A;  4TXV A;  3GV1 A;  2OBK A;  4DSS B;  3L78 A;  4XTS A;  3CXG A;  3KIJ A;  3D0Z A;  1T8E B;  4L8E A;  1F6M C;  3WD6 A;  4MZW A;  2RLI A;  5KN2 A;  5J9B A;  1TKD B;  3TKS E;  1ERT A;  1M2A A;  1SYX A;  1JFU A;  1XWC A;  3O76 A;  1Y6E A;  2H66 A;  1PGT A;  3VK9 A;  4GCI A;  2QGV A;  2H75 A;  6GST A;  5HR3 A;  5ECN B;  2OA7 A;  4KH7 A;  5HQP A;  1V2A A;  3QDN A;  5ELG A;  1OC3 A;  1T7P B;  5AIV A;  1J0F A;  5EY6 A;  2I81 A;  4P3Y B;  1YJ6 A;  3Q19 A;  2HXK A;  5GZZ B;  3BJ5 A;  4MP4 A;  5F06 A;  3Q6O A;  1CQH A;  1M99 A;  4V1A p;  4V1A g;  4F0B A;  1OC9 A;  4L0W A;  4ID0 A;  1BG5 A;  2B5X A;  2LST A;  4GLT A;  2HSH A;  2VCZ A;  2V2G A;  1THX A;  2H6Z A;  1Y25 A;  5A4W A;  3AY8 A;  4MPF A;  3GH9 A;  1OVN A;  5DDL A;  2A4V A;  5IOW A;  5E4W A;  2DJ1 A;  2B7J A;  4XS6 A;  3TKS A;  4EKZ A;  1TOF A;  2C0G A;  3RPP A;  5KN3 A;  4OFM A;  1ZMA A;  4PUA A;  3GX0 A;  2C0F A;  3VWU A;  4F9Z A;  5J9C A;  1GTB A;  1YKC A;  1K0C A;  5F8B A;  1M0U A;  2LS5 A;  4ZB9 A;  3E3E A;  3IHQ A;  5FWG A;  4ML1 A;  5DBQ A;  2FY6 A;  2C3N A;  4WR4 A;  3QR6 A;  2CVD A;  3TB2 A;  2YJ7 A;  1R26 A;  3ZYW A;  4O92 A;  2V32 A;  3MWH A;  3G7I A;  4F82 A;  2OE1 A;  2H6Y A;  1ZZY A;  1AW9 A;  4FH8 A;  4O5R A;  4KSM A;  5JWQ B;  3A2V A;  3Q74 A;  2CAI A;  1B4P A;  2B3S A;  1M2B A;  3BBY A;  4WBR D;  2OBI A;  1OE7 A;  1G7O A;  1TJD A;  1XOB A;  2JAD A;  1TP9 A;  2LQO A;  1X5D A;  3FZ4 A;  2I3Y A;  1MDJ A;  3FYG A;  1AQV A;  2RUE A;  4MJA A;  2VOC A;  5D73 A;  5ID2 B;  4OO4 A;  5CRE A;  1PKZ A;  2J9H A;  1FB6 A;  5IQY A;  1A2M A;  3MDK A;  2VLV A;  5IPH A;  5KEJ A;  1N2A A;  4MF5 A;  3F0I A;  3JCM L;  3NZN A;  2KUC A;  4GWR A;  4RUV A;  1GSD A;  2VM2 A;  3KMO A;  4E8H A;  3ERW A;  5DAL B;  3FEU A;  4MH2 A;  5AN1 A;  2H76 A;  4GSN A;  4XS4 B;  5DQY A;  3TCO A;  3TJF A;  4N11 A;  2YP6 A;  1ZL9 A;  4JU5 A;  1X9S B;  2MYG A;  3EC3 A;  1CQG A;  2WRT A;  1Q4J A;  3UJ1 A;  1A0R P;  4HZ2 A;  3UVH A;  1I5G A;  1Z5Y E;  3J7Y b;  3DVW A;  4NHZ A;  1U3I A;  4ISD A;  2GSS A;  3F9U A;  2VL2 A;  1XOA A;  5DJL A;  11GS A;  3GX8 A;  5ECH B;  3TKQ A;  5GAN D;  3CTG A;  4I2T A;  2YOI A;  5ECM B;  4K7N A;  2H6X A;  1OAZ A;  1AC1 A;  2XC2 A;  3TKS C;  2N5B A;  3LOR A;  3TRX A;  5IMV A;  3GIX A;  9GSS A;  1TRW A;  3HJO A;  5IPG A;  8GSS A;  3VI7 A;  1O73 A;  4LMV A;  1G6Y A;  1B4Q A;  3VWW A;  1SYR A;  4MJB A;  3LXZ A;  3GST A;  1ERU A;  5ECK B;  3I43 A;  3HXS A;  1R7H A;  2XPE A;  3SWL A;  2VCX A;  2F3M A;  4KGI A;  3BCK A;  3ZMK A;  1QK8 A;  2JAC A;  1EOH A;  5ECI B;  6GSV A;  5D93 A;  4IJ3 A;  3EU4 A;  4WBJ A;  1SL1 B;  2VLT A;  1DBY A;  3EUR A;  4YQV A;  1K0D A;  3KH7 A;  1SEN A;  3VI5 A;  1WWJ A;  1EEM A;  4IEL A;  3WGD A;  1BJX A;  5AIX A;  4V2L A;  3IOS A;  1J08 A;  2OE3 A;  2P31 A;  3FHK A;  2JZS A;  4HQZ A;  2HT9 A;  2C1Y A;  1ZOF A;  3LFL A;  3HJM A;  2HNL A;  3F4S A;  4GQF A;  2XHF A;  4AGS A;  2H74 A;  1QGV A;  2E0Q A;  4XIH A;  4IBP A;  4K6X A;  2GT6 A;  3CYN A;  4HU9 A;  1BAY A;  2O85 A;  4EDZ A;  2KP1 A;  3LQ7 A;  5DAL A;  2H73 A;  12GS A;  4EF0 A;  4AJ7 A;  2P5R A;  3IK7 A;  4XS4 A;  2YZH A;  3KEB A;  3UMA A;  5G30 A;  4KB3 A;  2E7P A;  3TOT A;  1XVW A;  1Z3E A;  2WS2 A;  2X8H A;  1WOU A;  3GKM A;  2IFQ B;  2LRC A;  1QXH A;  1OKD A;  5B7C A;  3PR8 A;  1SU9 A;  2KOK A;  1MDK A;  1HD2 A;  4G19 A;  4ZL7 A;  3M8N A;  2GTU A;  3CBU A;  4KX4 A;  3GFK A;  4YAV A;  3DD3 A;  2VLU A;  1GLQ A;  1FHE A;  3D21 A;  2H71 A;  5H5R A;  1K0B A;  4IVF A;  4ACS A;  2JZT A;  2H01 A;  1PMT A;  2R5G A;  3IK9 A;  6GSY A;  3HZ8 A;  4HDE A;  1FO5 A;  16GS A;  2XBI A;  4MJE A;  1MTC A;  2N5A A;  1WIK A;  13GS A;  3FR9 A;  4XHM A;  1FVJ A;  2CT6 A;  2EIO A;  1PL2 A;  2H1B A;  3TDG A;  1PKW A;  4KUN A;  1KEB A;  5D8I A;  1Q98 A;  1TDI A;  2VL2 C;  5ECR B;  4ZBA A;  1K0N A;  1YQ1 A;  5LCZ A;  2IIY A;  2LTK A;  1PX6 A;  4MZB A;  3VPQ A;  2VUP A;  1TRU A;  5ECS A;  4K9Z A;  1V98 A;  3EMP A;  3H4K A;  3QFA C;  5KN0 A;  2LJA A;  3NIV A;  1ACV A;  1PN9 A;  3CMI A;  5G1L A;  1SL2 B;  4Q5F A;  4QL9 A;  4I6X A;  1VRS D;  4POM A;  5H5Q A;  1K0O A;  3EMX A;  1AUC A;  2FUG 2;  3M9K A;  3F3R A;  3QMX A;  2CZ2 A;  4YAP A;  6GSX A;  5COH A;  3FKF A;  5G31 A;  2FWF A;  4TW5 A;  3ZRE A;  4ZBD A;  2KLX A;  4NV5 A;  4NAX A;  4LL1 B;  5HFG A;  3ERG A;  1BYE A;  4WEY A;  1F2E A;  4KE3 A;  1JZW A;  2VD1 A;  3WGX A;  3N5O A;  1B48 A;  3TOU A;  3TRP A;  3LJR A;  3LYP A;  2FA8 A;  3ZIT A;  4OWY A;  1SJZ A;  1EEJ A;  2GLR A;  3LSZ A;  1K0M A;  1QUW A;  2IFQ A;  3E9J B;  1UVZ A;  4ZXG A;  2TIR A;  3QAV A;  2H70 A;  1TK8 B;  4GST A;  2MMO A;  1ML6 A;  3WT2 A;  3LXT A;  1XWA A;  2C3Q A;  2FHE A; 
#chains in the Genus database with same CATH topology
 5HFI A;  3L4N A;  4N0V A;  3DRN A;  2LNT A;  3TKP A;  2ES7 A;  2NDO A;  5ECL B;  4WR5 A;  2R0G A;  3OR5 A;  3ZVJ A;  1PN0 A;  3HY2 A;  3FZ5 A;  3MAK A;  2MBT A;  4DSR A;  1TI1 A;  2EC4 A;  2JSZ A;  2IL3 A;  3S9F A;  3DYR A;  2HLS A;  3CSJ A;  5AGY A;  2O7K A;  5CRH A;  4PNG A;  4MDC A;  2LRT A;  2YV9 A;  3EYT A;  5DAK B;  3F4R A;  1LBK A;  1T4Y A;  2IN3 A;  4FIW A;  4TR0 A;  1HNA A;  1QFN A;  3KP9 A;  5E59 A;  4X1U A;  5GAP D;  1XIY A;  2MMA A;  1U3A A;  3K8N A;  3FMW A;  2VD0 A;  4TR3 A;  1EZK A;  1WE0 A;  1SKS B;  3C73 A;  1Z6M A;  4X4J A;  5IO0 A;  2GVP A;  1ON4 A;  2HSY A;  2WCI A;  1GRX A;  2YWI A;  5J4U A;  5DJM A;  2CVB A;  2K18 A;  4DSQ A;  1SK0 A;  2MMN A;  3VWV A;  1YF1 A;  3CSH A;  3MSZ A;  4ECI A;  2D2Z A;  1M3I A;  2DC5 A;  5G5E A;  4Z2T A;  3APO A;  4F2I A;  5LNK e;  1K3Y A;  4BWS A;  2GZP A;  1A8L A;  4WKW A;  4NV2 A;  1F3A A;  3GTU B;  4MK3 A;  2LRN A;  1XZO A;  1B8X A;  2WB9 A;  2OJL A;  1U87 A;  2FGX A;  2NVL A;  3LG6 A;  4RQX A;  3LGC A;  3M1G A;  4TN8 A;  6GSW A;  4HJ2 A;  4G0K A;  19GS A;  5G2Z A;  2I4A A;  2WDU A;  3P90 A;  1AIU A;  3QAG A;  2GZZ A;  5A4U A;  2A2S A;  1XWK A;  2G0F A;  3EWL A;  3FRC A;  4HS1 A;  4LMW A;  4IJI A;  2YWM A;  4CW9 A;  3L9S A;  5HR2 A;  1X9M B;  2DJJ A;  5CRG A;  1SKR B;  1MD3 A;  20GS A;  5D9X A;  2GZY A;  2CQ9 A;  5DQS A;  1ZYQ B;  1USB A;  3RDW A;  3KMN A;  1JZD A;  3HVX A;  1ERW A;  3W8S A;  3APS A;  2F8F A;  3H8Q A;  1N8J A;  5CP1 A;  4OCF A;  1HYU A;  3QOU A;  4YQU A;  5FHI A;  3RAZ A;  1S3C A;  4TR1 A;  3EU3 A;  1BQ7 A;  2OAC A;  4I2U A;  6GSU A;  2X8C A;  2FD3 A;  3J7Y k;  1T4Z A;  2IMD A;  2IWT A;  1F37 A;  4IQA A;  2L6D A;  3UBK A;  3ZFL A;  5JCU A;  2PVQ A;  5DAK A;  2GSQ A;  2EIQ A;  1XBS A;  5IMZ A;  4FQU A;  4AJ6 A;  2R3X A;  2WUL A;  4RI7 A;  4V2M A;  2PN8 A;  1SD9 A;  2R37 A;  2V41 A;  1GSY A;  4IS0 A;  3HZ4 A;  1RK4 A;  5JWR B;  1ABA A;  5ECQ B;  2PER A;  3KTB A;  4FYB A;  2VM1 A;  4HUA A;  2E2G A;  1X5C A;  4EE0 A;  3GMF A;  2P5Q A;  2R4V A;  3HA9 A;  4PXO A;  4WET A;  4GQC A;  3FR3 A;  3GHA A;  2DKH A;  5A4V A;  2CZ3 A;  1HNC A;  2CVK A;  2IJY A;  2OE0 A;  5IM9 A;  1Z9H A;  2I1U A;  3SBC A;  2H8L A;  2BJX A;  1THO A;  3ED3 A;  4I5Q A;  1EGO A;  2V1M A;  3PIN A;  3DML A;  3APQ A;  1MEK A;  3GTU A;  2PWJ A;  1O7U A;  3DEX A;  2QSI A;  4NHW A;  1PL1 A;  1W4V A;  3HJP A;  1U6T A;  4IP1 A;  1XWG A;  2DML A;  3MNG A;  3U5R E;  3HVS A;  2X64 A;  2F8A A;  3IC8 A;  3O6T A;  3UEM A;  3ZTL A;  4H86 A;  5CNW A;  3PGT A;  3UOM A;  1IYH A;  5KN1 A;  3QAW A;  2VAF A;  3GKK A;  3LWA A;  3UL3 A;  2OKA A;  2G2Q A;  4EVM A;  4J56 E;  1SD8 A;  4LL4 B;  4WXT A;  2V6O A;  1SKW B;  1GTA A;  1F9M A;  3GNJ A;  1UC7 A;  1AQW A;  3VUR A;  2O89 A;  2DJ3 A;  1VF1 A;  1O6J A;  1VF3 A;  1Z6N A;  4ZB6 A;  2B1K A;  2X99 A;  4G9H A;  4KND A;  1WMJ A;  2AV4 A;  3TJG A;  4X43 A;  1A0F A;  2AAW A;  3IBH A;  3EIN A;  1FOV A;  3UAP A;  5IMA A;  4OFT A;  3V1W A;  1JLW A;  1M9B A;  4X0X A;  2HI7 A;  2CX3 A;  2L59 A;  2PMT A;  1Z7P A;  5INY A;  5J5N A;  2FCH A;  2L4C A;  1MDI A;  1A8Y A;  4MH3 A;  2LV3 A;  3RHC A;  4MPG A;  2UZ8 A;  4PNF A;  2IMK A;  1VGL A;  3WYW A;  2E2M A;  1TTZ A;  2K6V A;  3F3Q A;  4KDU A;  4G2E A;  5LD0 A;  1A24 A;  3ZVJ D;  1G0T A;  1V57 A;  3D4M A;  1V9W A;  2FNO A;  4JRR A;  2VIM A;  2XBQ A;  4GSS A;  2B7K A;  3C1S A;  1X0R A;  1UN2 A;  3C7M A;  3C71 A;  5AIS A;  4K2D A;  3N9J A;  2BTO T;  1TXX A;  2CA8 A;  4I97 A;  3A2X A;  4ULX A;  2YJH A;  1GTU A;  4DEJ A;  2MBS A;  2QC7 A;  4EIQ A;  2MZC A;  4MMM A;  4IHU A;  2CAQ A;  2BMX A;  2FWG A;  5ECP B;  1MD4 A;  4ECJ A;  4WF4 A;  1X9W B;  3G7J A;  1TRV A;  2GS3 A;  2PPT A;  4K0N A;  2X8G A;  4O5U A;  3GH6 A;  4XRD A;  5B8B A;  3KGK A;  3D4T A;  4PQI A;  4CY8 A;  3TJJ A;  1GL8 A;  1GUM A;  4MA9 A;  4XS1 A;  7GSS A;  4KAE A;  2YCD A;  1O8W A;  3DGQ A;  3KJY A;  2HE3 A;  1T3B A;  3IR4 A;  4PUF C;  4BVY A;  4GTU A;  4YQM A;  3ISO A;  4ZL8 A;  1RW1 A;  1WRY A;  2AHE A;  2O8V B;  1SJI A;  2HZE B;  5IMC A;  4ECC A;  3O3T A;  3GUS A;  2F51 A;  3IA1 A;  1XPV A;  1WJK A;  2Z9S A;  2P0G A;  1IYI A;  2R0P A;  3CRT A;  3IV4 A;  4Z7X A;  2PVO C;  2QA2 A;  3HCZ A;  3IPZ A;  3QCP A;  3HHV A;  3L0H A;  1F3B A;  2YNX A;  2JZR A;  2YAN A;  2LJK A;  1AAZ A;  4EXJ A;  4EO3 A;  1QQ2 A;  1ZCP A;  3TRQ A;  3D6I A;  3HDC A;  4JED A;  4OCE A;  3TJK A;  2HRN A;  3M3M A;  1TU7 A;  3IRA A;  3HVV A;  3KH9 A;  4YKF A;  4HOJ A;  4EL1 A;  1G7E A;  2LEG A;  3LW9 A;  5JCG A;  2H1D A;  4YH2 A;  3F8U A;  3TGZ A;  2C0D A;  1FW1 A;  2DJ0 A;  4JZQ A;  1TK5 B;  4HZ4 A;  3UBL A;  5JWO B;  5KOX A;  2VO4 A;  3PPU A;  2H0G A;  4TVE A;  1GH2 A;  1KBN A;  3M9J A;  1OYJ A;  4K5S A;  1GUK A;  1GUL A;  4KCE A;  3KTL A;  2DIY A;  3UIW A;  1PX7 A;  1JLV A;  1SJ6 A;  2AYT A;  2VCQ A;  1OKT A;  1PQN A;  5A5K A;  2WGR A;  2RM6 A;  3NOF A;  5IMD A;  2H72 A;  1B9X C;  3MIX A;  2ZCT A;  2R0C A;  1AQX A;  2EIR A;  2R6K A;  1UA5 A;  5IO2 A;  1OE8 A;  4PUR A;  3ZL5 A;  4N0Z A;  4IQ1 A;  2I9H A;  3EPT A;  4WF5 A;  1FAA A;  4EC0 A;  1A2J A;  3DKS A;  4TR1 B;  1DE1 A;  2GQL A;  1H4O A;  5D96 A;  4MAB A;  4Q5Q A;  5HR1 A;  4ICY A;  2PBJ A;  1T00 A;  2C80 A;  4PGT A;  5B6M A;  3HD5 A;  5D9V A;  2VL3 A;  1FB0 A;  5DCH A;  1XW6 A;  3FY7 A;  3GKN A;  4BL7 B;  4K5R A;  4CDO A;  2N5F A;  3HKR A;  2F9S A;  3VWX A;  1GNW A;  1I9D A;  1HNB A;  4L0U A;  4K1F A;  1YEX A;  2XPD A;  3H1N A;  3A5W A;  4NWY A;  2VL9 A;  3A5I A;  2PU9 C;  2HZE A;  2REM A;  5B8A A;  1R5P A;  4IN0 A;  4TOP A;  4IGJ A;  3ZIJ A;  3ME7 A;  3IC4 A;  4L5L A;  1XVQ A;  2L4Q A;  3ZFB A;  3IXR A;  3KM6 A;  1OC8 A;  1TW9 A;  2WZ9 A;  1M9A A;  2KP2 A;  1M3J A;  1GSE A;  4ZIJ A;  1YEP A;  2GDR A;  1ZYP A;  4PX1 A;  1GSU A;  2LKU A;  2YWO A;  2V6K A;  5F05 A;  3IAS 2;  2L57 A;  3F4T A;  3G7Y A;  5CRD A;  4MCU A;  4POL A;  3P8W A;  5ABR A;  5HFK A;  5GSS A;  2YZU A;  1TK0 B;  2ALB A;  3I9V 2;  3W8J A;  2DBC A;  3UVT A;  4G0L A;  4KSO A;  3VFI A;  4IKH A;  4ML6 A;  4DVC A;  1YF0 A;  4D73 B;  2ON5 A;  3F63 A;  3FR6 A;  1VF2 A;  4AJ8 A;  4LLR A;  2IME A;  1GSQ A;  3GL3 A;  3RHB A;  2FWE A;  5CYY A;  3CRU A;  2HRA A;  1JZO A;  5IOX A;  4LA1 A;  1SK2 A;  4AF2 A;  3HYP A;  3KCM A;  4K7O A;  3TUE A;  1LJR A;  2R2J A;  1K3O A;  3GSS A;  1J9B A;  5C04 A;  4DSS A;  4EDY A;  2DJK A;  2DMM A;  17GS A;  3ZRD A;  4KW6 A;  1H75 A;  4V2N A;  2B6M A;  2YPM A;  3RBT A;  3LYK A;  5J41 A;  2HSM A;  2JSY A;  2X4A A;  4RI6 A;  3PH9 A;  2B1L A;  1EV9 A;  2A4H A;  1GSF A;  3KZQ A;  3R3E A;  2IPA A;  5L71 A;  1K0A A;  1GP1 A;  1XW5 A;  2PGT A;  1KTE A;  4JR6 A;  1M7T A;  3ME8 A;  1DSB A;  4EUY A;  2DIZ A;  1G6W A;  3Q18 A;  5F0G A;  4NPB A;  2GST A;  5G5F A;  2C0E A;  4JE1 A;  3QPM A;  2C3T A;  4BL7 A;  2WFC A;  4ILF A;  4OD7 A;  1GWC A;  4TKY A;  1M2D A;  3US3 A;  5ENU A;  2H0H A;  4IP6 A;  2H0I A;  1KNG A;  2YN1 A;  1ZGN A;  3ZZX A;  4G10 A;  4XCS A;  1LU4 A;  1C72 A;  2M46 A;  2RM5 A;  2HRF A;  1PFO A;  3F6D A;  1ERV A;  3W6G A;  1PA3 A;  1O85 A;  3IAM 2;  1GNE A;  2DKI A;  4BWQ A;  1JZR A;  3H79 A;  4KA0 A;  2HZF A;  4Q5R A;  4XRA A;  2K8V A;  4PQH A;  2ZUP A;  4JR4 A;  5G1K A;  3UAR A;  3GN3 A;  18GS A;  5EVO A;  2GQM A;  1EP7 A;  4OMV A;  4PTS A;  2DLX A;  1XWB A;  1XXU A;  1ZYE A;  5FT3 A;  3DVX A;  1W89 A;  1V58 A;  4JBB A;  1XCC A;  2HYX A;  4IW9 A;  4K0G A;  4CHS A;  5D9W A;  2B5E A;  1E6B A;  3L9U A;  1EP8 A;  2NPB A;  4TR4 A;  2GGT A;  4CY6 A;  4D73 A;  3BCI A;  1TRS A;  2H30 A;  3QD9 A;  1E2Y A;  5CO3 A;  4OO5 A;  3G9B A;  1T1V A;  3KD0 A;  2LNS A;  5JCW A;  3M0F A;  1NHY A;  3IE3 A;  4BVY B;  2O87 A;  2IMI A;  2CX4 A;  1EWX A;  4Q5N A;  4FO5 A;  4HQS A;  2AUV A;  4HU7 A;  4MLY A;  2GSR A;  3ERF A;  4HI7 A;  3GA4 A;  3IDV A;  3U6V A;  4QL7 A;  3KP8 A;  2LQQ A;  1Z7R A;  2A2P A;  2X49 A;  5IIZ A;  5C00 A;  5J3R A;  1ILO A;  2L6C A;  4ZIL A;  1HQO A;  4FYC A;  3FK8 A;  1K3L A;  1X5E A;  5HR0 A;  1EGR A;  3FW2 A;  3ZML A;  3DWV A;  2GQK A;  4RQR A;  3GKX A;  1SL0 B;  4NXI A;  4ECB A;  2C8U A;  5GST A;  4J57 E;  2VCW A;  1PRX A;  2LUS A;  4MJC A;  2K8S A;  5ID2 A;  2L5O A;  3D22 A;  1S3D A;  1A2L A;  3DIE A;  4NMU A;  2ZNM A;  1V40 A;  1GTI A;  1YKA A;  4MF6 A;  5H5S A;  3H93 A;  1O81 A;  4TXO B;  22GS A;  4J2F A;  2JU5 A;  1YY7 A;  2NBS A;  1VF4 A;  2H1G A;  4L5O A;  1GLP A;  2YWN A;  2KHP A;  5ECO B;  4POK A;  2TRX A;  3VLN A;  1DUG A;  2PUK C;  4N30 A;  3GL5 A;  1FOH A;  2H19 A;  4ZL9 A;  2VCV A;  3CTF A;  1TI3 A;  3F6F A;  3I69 A;  2AJQ B;  3KXO A;  1JHB A;  1S3A A;  1XFL A;  1B9Y C;  4EIP A;  3C8E A;  5IMF A;  4YKG A;  3DXB A;  4O32 A;  3ZLP A;  3E0U A;  3WT1 A;  4K8M A;  4HJM A;  4KCA A;  3MYD A;  1QMV A;  1BED A;  1WP0 A;  4F03 A;  5B6N A;  2NTO A;  4KDX A;  3BD2 A;  2CV4 A;  2WJU A;  1URM A;  1O8X A;  1WPI A;  2H1A A;  14GS A;  1NSW A;  4N10 A;  2L5L A;  4QQ7 A;  1U88 A;  3I6A A;  2IMF A;  1GUH A;  1DE2 A;  1YZX A;  3WGE A;  3BOA A;  1EV4 A;  3FZA A;  2OAD A;  2GT5 A;  3P7X A;  1A23 A;  1BX9 A;  2HFD A;  3QFB C;  2ON7 A;  4ZB8 A;  3GYK A;  4F0C A;  2FA4 A;  2QKE A;  1OC9 B;  3R2Q A;  3FZ9 A;  2A2R A;  2RII A;  2J23 A;  5BRT A;  4TRX A;  1PD2 1;  3LEF A;  4K7I A;  2LJR A;  4O7H A;  4I8B A;  1ST9 A;  1NHO A;  5ELA A;  1R4W A;  4ZBB A;  3P2A A;  5EPF A;  3HVN A;  4MF7 A;  1PSQ A;  1TU8 A;  2FLS A;  5CAX A;  2VCT A;  1R5A A;  3GRX A;  1GSS A;  3A2W A;  4OFN A;  2K9F A;  2B5Y A;  3EVI A;  1FG4 A;  2AB6 A;  2DJ2 A;  2C4J A;  1EOG A;  3EE2 A;  4GXZ A;  2DSA A;  3ZIV A;  3CSI A;  4E8E A;  1XW9 A;  5D9T A;  4KDY A;  2QA1 A;  3L9V A;  4POB A;  5EL8 A;  1SK1 A;  2MMZ A;  3GUR A;  1RQM A;  6GSS A;  4HEA 2;  3TKR A;  5DVB A;  3D5J A;  3C1R A;  3TJB A;  4TXO A;  5DCG A;  4GRF A;  2FWH A;  4BPY A;  4MZC A;  2M72 A;  1FVK A;  4FYU A;  1AXD A;  2TRC P;  4GF0 A;  4BA7 A;  2YV7 A;  3RPN A;  4PQ1 A;  1NW2 A;  1NM3 A;  3A3T A;  2JL4 A;  2RUF A;  3VPT A;  5CRW A;  1YDK A;  5F07 A;  4BVX A;  10GS A;  2M80 A;  4TXV A;  3GV1 A;  2OBK A;  4DSS B;  4O5Q A;  3L78 A;  4XTS A;  3CXG A;  3KIJ A;  3CQF A;  3D0Z A;  1T8E B;  4L8E A;  1F6M C;  3WD6 A;  4MZW A;  2RLI A;  5KN2 A;  5J9B A;  1TKD B;  3TKS E;  1ERT A;  1M2A A;  1SYX A;  1JFU A;  1XWC A;  3O76 A;  1Y6E A;  2H66 A;  1PGT A;  3VK9 A;  4GCI A;  2QGV A;  2H75 A;  6GST A;  5HR3 A;  5ECN B;  2OA7 A;  4KH7 A;  5HQP A;  1V2A A;  3QDN A;  5ELG A;  1OC3 A;  1T7P B;  5AIV A;  1J0F A;  5EY6 A;  2I81 A;  4P3Y B;  1YJ6 A;  3Q19 A;  2HXK A;  5KOW A;  5GZZ B;  3BJ5 A;  4MP4 A;  5F06 A;  3Q6O A;  4USS A;  1CQH A;  1M99 A;  4V1A p;  4V1A g;  4F0B A;  1OC9 A;  4L0W A;  4ID0 A;  1BG5 A;  2B5X A;  2LST A;  4Z2U A;  4GLT A;  2HSH A;  2VCZ A;  2V2G A;  1THX A;  2H6Z A;  1Y25 A;  5A4W A;  3AY8 A;  4MPF A;  3GH9 A;  1OVN A;  5DDL A;  2A4V A;  5IOW A;  5E4W A;  4KF9 A;  2DJ1 A;  2B7J A;  4XS6 A;  3TKS A;  4EKZ A;  1TOF A;  2C0G A;  3RPP A;  5KN3 A;  4OFM A;  1ZMA A;  4PUA A;  2HRK A;  3GX0 A;  2C0F A;  3VWU A;  4F9Z A;  5J9C A;  1GTB A;  1YKC A;  1K0C A;  5F8B A;  1M0U A;  2LS5 A;  4ZB9 A;  3E3E A;  3IHQ A;  5FWG A;  4ML1 A;  5DBQ A;  2FY6 A;  2C3N A;  4WR4 A;  3QR6 A;  2CVD A;  3TB2 A;  2YJ7 A;  1R26 A;  3ZYW A;  4O92 A;  2V32 A;  3MWH A;  3G7I A;  4F82 A;  2OE1 A;  2H6Y A;  1ZYN A;  1ZZY A;  1AW9 A;  4FH8 A;  4O5R A;  4KSM A;  5JWQ B;  3A2V A;  3Q74 A;  2CAI A;  1B4P A;  2B3S A;  1M2B A;  3BBY A;  4WBR D;  2OBI A;  1OE7 A;  1G7O A;  1TJD A;  1XOB A;  2JAD A;  1TP9 A;  2LQO A;  1X5D A;  3FZ4 A;  2I3Y A;  1MDJ A;  3FYG A;  1AQV A;  2RUE A;  4MJA A;  2VOC A;  5D73 A;  5ID2 B;  4OO4 A;  5CRE A;  1PKZ A;  2J9H A;  1FB6 A;  5IQY A;  1A2M A;  3MDK A;  2VLV A;  5IPH A;  5KEJ A;  1N2A A;  4MF5 A;  3F0I A;  3JCM L;  3NZN A;  2KUC A;  4GWR A;  4RUV A;  1GSD A;  2VM2 A;  3KMO A;  4E8H A;  3ERW A;  5DAL B;  3FEU A;  4MH2 A;  5AN1 A;  2H76 A;  4GSN A;  4XS4 B;  5DQY A;  3TCO A;  3TJF A;  4N11 A;  2YP6 A;  1ZL9 A;  4JU5 A;  1X9S B;  2MYG A;  3EC3 A;  1CQG A;  2WRT A;  1Q4J A;  3UJ1 A;  1A0R P;  4HZ2 A;  3UVH A;  1I5G A;  1Z5Y E;  3J7Y b;  3IHG A;  3DVW A;  4NHZ A;  1U3I A;  4ISD A;  2GSS A;  3F9U A;  2VL2 A;  1XOA A;  5DJL A;  11GS A;  3GX8 A;  5ECH B;  3TKQ A;  5GAN D;  3CTG A;  4I2T A;  2YOI A;  5ECM B;  4K7N A;  2H6X A;  1OAZ A;  1AC1 A;  2XC2 A;  3TKS C;  2N5B A;  1XG8 A;  3LOR A;  3TRX A;  5IMV A;  3GIX A;  9GSS A;  1TRW A;  3HJO A;  5IPG A;  8GSS A;  3VI7 A;  1O73 A;  4LMV A;  1G6Y A;  1B4Q A;  3VWW A;  4BIK A;  1SYR A;  4MJB A;  3LXZ A;  3GST A;  1ERU A;  5ECK B;  3I43 A;  3HXS A;  1R7H A;  2XPE A;  3SWL A;  2VCX A;  2F3M A;  4KGI A;  3BCK A;  4MNN A;  1QK8 A;  3ZMK A;  2JAC A;  1EOH A;  5ECI B;  6GSV A;  5D93 A;  4IJ3 A;  3EU4 A;  4WBJ A;  1SL1 B;  2VLT A;  1DBY A;  3EUR A;  4YQV A;  1K0D A;  3KH7 A;  1SEN A;  3VI5 A;  1WWJ A;  1EEM A;  4G0I A;  4IEL A;  3WGD A;  1BJX A;  5AIX A;  4V2L A;  3IOS A;  1J08 A;  2OE3 A;  2P31 A;  3FHK A;  2JZS A;  4HQZ A;  2HT9 A;  2C1Y A;  1ZOF A;  3LFL A;  3HJM A;  2HNL A;  3F4S A;  4GQF A;  2XHF A;  4AGS A;  2H74 A;  1QGV A;  2E0Q A;  4XIH A;  4IBP A;  4K6X A;  2GT6 A;  3CYN A;  4HSC X;  4HU9 A;  1BAY A;  2O85 A;  4EDZ A;  2KP1 A;  3LQ7 A;  5DAL A;  2H73 A;  4BVX B;  12GS A;  4EF0 A;  4AJ7 A;  2P5R A;  3IK7 A;  4XS4 A;  2YZH A;  3KEB A;  3UMA A;  5G30 A;  4KB3 A;  2E7P A;  3TOT A;  1XVW A;  1Z3E A;  2WS2 A;  2X8H A;  1WOU A;  3GKM A;  2IFQ B;  2LRC A;  1QXH A;  1OKD A;  5B7C A;  3PR8 A;  1SU9 A;  2KOK A;  1MDK A;  1HD2 A;  4G19 A;  4ZL7 A;  3M8N A;  2GTU A;  3CBU A;  4KX4 A;  3GFK A;  4YAV A;  3DD3 A;  2VLU A;  1GLQ A;  1FHE A;  3D21 A;  2H71 A;  5H5R A;  1K0B A;  4IVF A;  4ACS A;  2JZT A;  2H01 A;  1PMT A;  2R5G A;  3IK9 A;  6GSY A;  3HZ8 A;  4HDE A;  1FO5 A;  16GS A;  2XBI A;  4MJE A;  1MTC A;  2N5A A;  1WIK A;  13GS A;  4Z2R A;  4A5P A;  3FR9 A;  4XHM A;  1FVJ A;  2CT6 A;  2EIO A;  1PL2 A;  2H1B A;  3TDG A;  1PKW A;  4KUN A;  1KEB A;  5D8I A;  1Q98 A;  1TDI A;  2VL2 C;  5ECR B;  4ZBA A;  1K0N A;  1YQ1 A;  5LCZ A;  2IIY A;  1S3R A;  2LTK A;  1PX6 A;  4MZB A;  3VPQ A;  2VUP A;  1TRU A;  5ECS A;  4K9Z A;  1V98 A;  3EMP A;  5BMU A;  3H4K A;  3QFA C;  5KN0 A;  2LJA A;  3NIV A;  1ACV A;  1PN9 A;  3CMI A;  5G1L A;  1SL2 B;  4Q5F A;  4QL9 A;  4I6X A;  1VRS D;  4POM A;  5H5Q A;  1K0O A;  3EMX A;  1AUC A;  2FUG 2;  3M9K A;  3F3R A;  3QMX A;  2CZ2 A;  4YAP A;  6GSX A;  5COH A;  3FKF A;  5G31 A;  2FWF A;  4TW5 A;  3ZRE A;  4ZBD A;  2KLX A;  4NV5 A;  4NAX A;  4LL1 B;  5HFG A;  3ERG A;  1BYE A;  4WEY A;  1F2E A;  4KE3 A;  1JZW A;  2VD1 A;  3WGX A;  3N5O A;  1B48 A;  3TOU A;  3TRP A;  4K2X A;  3LJR A;  3LYP A;  2FA8 A;  3ZIT A;  4OWY A;  1SJZ A;  1EEJ A;  2GLR A;  3LSZ A;  1K0M A;  1QUW A;  2IFQ A;  3E9J B;  1UVZ A;  4ZXG A;  2TIR A;  3QAV A;  2H70 A;  1TK8 B;  4GST A;  2MMO A;  1ML6 A;  3WT2 A;  3LXT A;  1XWA A;  2C3Q A;  2FHE A; 
#chains in the Genus database with same CATH homology
 5HFI A;  3L4N A;  4N0V A;  3DRN A;  2LNT A;  3TKP A;  2ES7 A;  2NDO A;  5ECL B;  4WR5 A;  2R0G A;  3OR5 A;  3ZVJ A;  1PN0 A;  3HY2 A;  3FZ5 A;  3MAK A;  2MBT A;  4DSR A;  1TI1 A;  2EC4 A;  2JSZ A;  2IL3 A;  3S9F A;  3DYR A;  2HLS A;  3CSJ A;  5AGY A;  2O7K A;  5CRH A;  4PNG A;  4MDC A;  2LRT A;  2YV9 A;  3EYT A;  5DAK B;  3F4R A;  1LBK A;  1T4Y A;  2IN3 A;  4FIW A;  4TR0 A;  1HNA A;  1QFN A;  3KP9 A;  5E59 A;  4X1U A;  5GAP D;  1XIY A;  2MMA A;  1U3A A;  3K8N A;  3FMW A;  2VD0 A;  4TR3 A;  1EZK A;  1WE0 A;  1SKS B;  3C73 A;  1Z6M A;  4X4J A;  5IO0 A;  2GVP A;  1ON4 A;  2HSY A;  2WCI A;  1GRX A;  2YWI A;  5J4U A;  5DJM A;  2CVB A;  2K18 A;  4DSQ A;  1SK0 A;  2MMN A;  3VWV A;  1YF1 A;  3CSH A;  3MSZ A;  4ECI A;  2D2Z A;  5G5E A;  2DC5 A;  4Z2T A;  3APO A;  4F2I A;  5LNK e;  1K3Y A;  4BWS A;  2GZP A;  1A8L A;  4WKW A;  4NV2 A;  1F3A A;  3GTU B;  4MK3 A;  2LRN A;  1XZO A;  1B8X A;  2WB9 A;  2OJL A;  1U87 A;  2FGX A;  2NVL A;  3LG6 A;  4RQX A;  3LGC A;  3M1G A;  4TN8 A;  6GSW A;  4HJ2 A;  4G0K A;  19GS A;  5G2Z A;  2I4A A;  2WDU A;  3P90 A;  1AIU A;  3QAG A;  2GZZ A;  5A4U A;  2A2S A;  1XWK A;  2G0F A;  3EWL A;  3FRC A;  4HS1 A;  4LMW A;  4IJI A;  2YWM A;  4CW9 A;  3L9S A;  5HR2 A;  1X9M B;  2DJJ A;  5CRG A;  1SKR B;  1MD3 A;  20GS A;  5D9X A;  2GZY A;  2CQ9 A;  5DQS A;  1ZYQ B;  1USB A;  3RDW A;  3KMN A;  1JZD A;  3HVX A;  1ERW A;  3W8S A;  3APS A;  2F8F A;  3H8Q A;  1N8J A;  5CP1 A;  4OCF A;  1HYU A;  3QOU A;  4YQU A;  5FHI A;  3RAZ A;  1S3C A;  4TR1 A;  3EU3 A;  1BQ7 A;  2OAC A;  4I2U A;  6GSU A;  2X8C A;  2FD3 A;  3J7Y k;  1T4Z A;  2IMD A;  2IWT A;  1F37 A;  4IQA A;  2L6D A;  3UBK A;  3ZFL A;  5JCU A;  2PVQ A;  5DAK A;  2GSQ A;  2EIQ A;  1XBS A;  5IMZ A;  4FQU A;  4AJ6 A;  2R3X A;  2WUL A;  4RI7 A;  4V2M A;  2PN8 A;  1SD9 A;  2R37 A;  2V41 A;  1GSY A;  4IS0 A;  3HZ4 A;  1RK4 A;  5JWR B;  1ABA A;  5ECQ B;  2PER A;  3KTB A;  4FYB A;  2VM1 A;  4HUA A;  2E2G A;  1X5C A;  4EE0 A;  3GMF A;  2P5Q A;  2R4V A;  3HA9 A;  4PXO A;  4WET A;  4GQC A;  3FR3 A;  3GHA A;  2DKH A;  5A4V A;  2CZ3 A;  1HNC A;  2CVK A;  2IJY A;  2OE0 A;  5IM9 A;  1Z9H A;  2I1U A;  3SBC A;  2H8L A;  2BJX A;  1THO A;  3ED3 A;  4I5Q A;  1EGO A;  2V1M A;  3PIN A;  3DML A;  3APQ A;  1MEK A;  3GTU A;  2PWJ A;  1O7U A;  3DEX A;  2QSI A;  4NHW A;  1PL1 A;  1W4V A;  3HJP A;  1U6T A;  4IP1 A;  1XWG A;  2DML A;  3MNG A;  3U5R E;  3HVS A;  2X64 A;  2F8A A;  3IC8 A;  3O6T A;  3UEM A;  3ZTL A;  4H86 A;  5CNW A;  3PGT A;  3UOM A;  1IYH A;  5KN1 A;  3QAW A;  2VAF A;  3GKK A;  3LWA A;  3UL3 A;  2OKA A;  2G2Q A;  4EVM A;  4J56 E;  1SD8 A;  4LL4 B;  4WXT A;  2V6O A;  1SKW B;  1GTA A;  1F9M A;  3GNJ A;  1UC7 A;  1AQW A;  3VUR A;  2O89 A;  2DJ3 A;  1VF1 A;  1O6J A;  1VF3 A;  1Z6N A;  4ZB6 A;  2B1K A;  2X99 A;  4G9H A;  4KND A;  1WMJ A;  2AV4 A;  3TJG A;  4X43 A;  1A0F A;  2AAW A;  3IBH A;  3EIN A;  1FOV A;  3UAP A;  5IMA A;  4OFT A;  3V1W A;  1JLW A;  1M9B A;  4X0X A;  2HI7 A;  2CX3 A;  2L59 A;  2PMT A;  1Z7P A;  5INY A;  5J5N A;  2FCH A;  2L4C A;  1MDI A;  1A8Y A;  4MH3 A;  2LV3 A;  3RHC A;  4MPG A;  2UZ8 A;  4PNF A;  2IMK A;  1VGL A;  3WYW A;  2E2M A;  1TTZ A;  2K6V A;  3F3Q A;  4KDU A;  4G2E A;  5LD0 A;  1A24 A;  3ZVJ D;  1G0T A;  1V57 A;  3D4M A;  1V9W A;  2FNO A;  4JRR A;  2VIM A;  2XBQ A;  4GSS A;  2B7K A;  3C1S A;  1X0R A;  1UN2 A;  3C7M A;  3C71 A;  5AIS A;  4K2D A;  3N9J A;  2BTO T;  1TXX A;  2CA8 A;  4I97 A;  3A2X A;  4ULX A;  2YJH A;  1GTU A;  4DEJ A;  2MBS A;  2QC7 A;  4EIQ A;  2MZC A;  4MMM A;  4IHU A;  2CAQ A;  2BMX A;  2FWG A;  5ECP B;  1MD4 A;  4ECJ A;  4WF4 A;  1X9W B;  3G7J A;  1TRV A;  2GS3 A;  2PPT A;  4K0N A;  2X8G A;  4O5U A;  3GH6 A;  4XRD A;  5B8B A;  3KGK A;  3D4T A;  4PQI A;  4CY8 A;  3TJJ A;  1GL8 A;  1GUM A;  4MA9 A;  4XS1 A;  7GSS A;  4KAE A;  2YCD A;  1O8W A;  3DGQ A;  3KJY A;  2HE3 A;  1T3B A;  3IR4 A;  4PUF C;  4BVY A;  4GTU A;  4YQM A;  3ISO A;  4ZL8 A;  1RW1 A;  1WRY A;  2AHE A;  2O8V B;  1SJI A;  2HZE B;  5IMC A;  4ECC A;  3O3T A;  3GUS A;  2F51 A;  3IA1 A;  1XPV A;  1WJK A;  2Z9S A;  2P0G A;  1IYI A;  2R0P A;  3CRT A;  3IV4 A;  4Z7X A;  2PVO C;  2QA2 A;  3HCZ A;  3IPZ A;  3QCP A;  3HHV A;  3L0H A;  1F3B A;  2YNX A;  2JZR A;  2YAN A;  2LJK A;  1AAZ A;  4EXJ A;  4EO3 A;  1QQ2 A;  1ZCP A;  3TRQ A;  3D6I A;  3HDC A;  4JED A;  4OCE A;  3TJK A;  2HRN A;  3M3M A;  1TU7 A;  3IRA A;  3HVV A;  3KH9 A;  4YKF A;  4HOJ A;  4EL1 A;  1G7E A;  2LEG A;  3LW9 A;  5JCG A;  2H1D A;  4YH2 A;  3F8U A;  3TGZ A;  2C0D A;  1FW1 A;  2DJ0 A;  4JZQ A;  1TK5 B;  4HZ4 A;  3UBL A;  5JWO B;  5KOX A;  2VO4 A;  3PPU A;  2H0G A;  4TVE A;  1GH2 A;  1KBN A;  3M9J A;  1OYJ A;  4K5S A;  1GUK A;  1GUL A;  4KCE A;  3KTL A;  2DIY A;  3UIW A;  1PX7 A;  1JLV A;  1SJ6 A;  2AYT A;  2VCQ A;  1OKT A;  1PQN A;  5A5K A;  2WGR A;  2RM6 A;  3NOF A;  5IMD A;  2H72 A;  1B9X C;  3MIX A;  2ZCT A;  2R0C A;  1AQX A;  2EIR A;  2R6K A;  1UA5 A;  5IO2 A;  1OE8 A;  4PUR A;  3ZL5 A;  4N0Z A;  4IQ1 A;  2I9H A;  3EPT A;  4WF5 A;  1FAA A;  4EC0 A;  1A2J A;  3DKS A;  4TR1 B;  1DE1 A;  2GQL A;  1H4O A;  5D96 A;  4MAB A;  4Q5Q A;  5HR1 A;  4ICY A;  2PBJ A;  1T00 A;  2C80 A;  4PGT A;  5B6M A;  3HD5 A;  5D9V A;  2VL3 A;  1FB0 A;  5DCH A;  1XW6 A;  3FY7 A;  3GKN A;  4BL7 B;  4K5R A;  4CDO A;  2N5F A;  3HKR A;  2F9S A;  3VWX A;  1GNW A;  1I9D A;  1HNB A;  4L0U A;  4K1F A;  1YEX A;  2XPD A;  3H1N A;  3A5W A;  4NWY A;  2VL9 A;  3A5I A;  2PU9 C;  2HZE A;  2REM A;  5B8A A;  1R5P A;  4IN0 A;  4TOP A;  4IGJ A;  3ZIJ A;  3ME7 A;  3IC4 A;  4L5L A;  1XVQ A;  2L4Q A;  3ZFB A;  3IXR A;  3KM6 A;  1OC8 A;  1TW9 A;  2WZ9 A;  1M9A A;  2KP2 A;  1GSE A;  4ZIJ A;  1YEP A;  2GDR A;  1ZYP A;  4PX1 A;  1GSU A;  2LKU A;  2YWO A;  2V6K A;  5F05 A;  3IAS 2;  2L57 A;  3F4T A;  3G7Y A;  5CRD A;  4MCU A;  4POL A;  3P8W A;  5ABR A;  5HFK A;  5GSS A;  2YZU A;  1TK0 B;  2ALB A;  3I9V 2;  3W8J A;  2DBC A;  3UVT A;  4G0L A;  4KSO A;  3VFI A;  4IKH A;  4ML6 A;  4DVC A;  1YF0 A;  4D73 B;  2ON5 A;  3F63 A;  3FR6 A;  1VF2 A;  4AJ8 A;  4LLR A;  2IME A;  1GSQ A;  3GL3 A;  3RHB A;  2FWE A;  5CYY A;  3CRU A;  2HRA A;  1JZO A;  5IOX A;  4LA1 A;  1SK2 A;  4AF2 A;  3HYP A;  3KCM A;  4K7O A;  3TUE A;  1LJR A;  2R2J A;  1K3O A;  3GSS A;  1J9B A;  5C04 A;  4DSS A;  4EDY A;  2DJK A;  2DMM A;  17GS A;  3ZRD A;  4KW6 A;  1H75 A;  4V2N A;  2B6M A;  2YPM A;  3RBT A;  3LYK A;  5J41 A;  2HSM A;  2JSY A;  2X4A A;  4RI6 A;  3PH9 A;  2B1L A;  1EV9 A;  2A4H A;  1GSF A;  3KZQ A;  3R3E A;  2IPA A;  5L71 A;  1K0A A;  1GP1 A;  1XW5 A;  2PGT A;  1KTE A;  4JR6 A;  1M7T A;  3ME8 A;  1DSB A;  4EUY A;  2DIZ A;  1G6W A;  3Q18 A;  5F0G A;  4NPB A;  2GST A;  5G5F A;  2C0E A;  4JE1 A;  3QPM A;  2C3T A;  4BL7 A;  2WFC A;  4ILF A;  4OD7 A;  1GWC A;  4TKY A;  1M2D A;  3US3 A;  5ENU A;  2H0H A;  4IP6 A;  2H0I A;  1KNG A;  2YN1 A;  1ZGN A;  3ZZX A;  4G10 A;  4XCS A;  1LU4 A;  1C72 A;  2M46 A;  2RM5 A;  2HRF A;  3F6D A;  1ERV A;  3W6G A;  1PA3 A;  1O85 A;  3IAM 2;  1GNE A;  2DKI A;  4BWQ A;  1JZR A;  3H79 A;  4KA0 A;  2HZF A;  4Q5R A;  4XRA A;  2K8V A;  4PQH A;  2ZUP A;  4JR4 A;  5G1K A;  3UAR A;  3GN3 A;  18GS A;  5EVO A;  2GQM A;  1EP7 A;  4OMV A;  4PTS A;  2DLX A;  1XWB A;  1XXU A;  1ZYE A;  5FT3 A;  3DVX A;  1W89 A;  1V58 A;  4JBB A;  1XCC A;  2HYX A;  4IW9 A;  4K0G A;  4CHS A;  5D9W A;  2B5E A;  1E6B A;  3L9U A;  1EP8 A;  2NPB A;  4TR4 A;  2GGT A;  4CY6 A;  4D73 A;  3BCI A;  1TRS A;  2H30 A;  3QD9 A;  1E2Y A;  5CO3 A;  4OO5 A;  3G9B A;  1T1V A;  3KD0 A;  2LNS A;  5JCW A;  3M0F A;  1NHY A;  3IE3 A;  4BVY B;  2O87 A;  2IMI A;  2CX4 A;  1EWX A;  4Q5N A;  4FO5 A;  4HQS A;  2AUV A;  4HU7 A;  4MLY A;  2GSR A;  3ERF A;  4HI7 A;  3GA4 A;  3IDV A;  3U6V A;  4QL7 A;  3KP8 A;  2LQQ A;  1Z7R A;  2A2P A;  2X49 A;  5IIZ A;  5C00 A;  5J3R A;  1ILO A;  2L6C A;  4ZIL A;  1HQO A;  4FYC A;  3FK8 A;  1K3L A;  1X5E A;  5HR0 A;  1EGR A;  3FW2 A;  3ZML A;  3DWV A;  2GQK A;  4RQR A;  3GKX A;  1SL0 B;  4NXI A;  4ECB A;  2C8U A;  5GST A;  4J57 E;  2VCW A;  1PRX A;  2LUS A;  4MJC A;  2K8S A;  5ID2 A;  2L5O A;  3D22 A;  1S3D A;  1A2L A;  3DIE A;  4NMU A;  2ZNM A;  1V40 A;  1GTI A;  1YKA A;  4MF6 A;  5H5S A;  3H93 A;  1O81 A;  4TXO B;  22GS A;  4J2F A;  2JU5 A;  1YY7 A;  2NBS A;  1VF4 A;  2H1G A;  4L5O A;  1GLP A;  2YWN A;  2KHP A;  5ECO B;  4POK A;  2TRX A;  3VLN A;  1DUG A;  2PUK C;  4N30 A;  3GL5 A;  1FOH A;  2H19 A;  4ZL9 A;  2VCV A;  3CTF A;  1TI3 A;  3F6F A;  3I69 A;  2AJQ B;  3KXO A;  1JHB A;  1S3A A;  1XFL A;  1B9Y C;  4EIP A;  3C8E A;  5IMF A;  4YKG A;  3DXB A;  4O32 A;  3ZLP A;  3E0U A;  3WT1 A;  4K8M A;  4HJM A;  4KCA A;  3MYD A;  1QMV A;  1BED A;  1WP0 A;  4F03 A;  5B6N A;  2NTO A;  4KDX A;  3BD2 A;  2CV4 A;  2WJU A;  1URM A;  1O8X A;  1WPI A;  2H1A A;  14GS A;  1NSW A;  4N10 A;  2L5L A;  4QQ7 A;  1U88 A;  3I6A A;  2IMF A;  1GUH A;  1DE2 A;  1YZX A;  3WGE A;  3BOA A;  1EV4 A;  3FZA A;  2OAD A;  2GT5 A;  3P7X A;  1A23 A;  1BX9 A;  2HFD A;  3QFB C;  2ON7 A;  4ZB8 A;  3GYK A;  4F0C A;  2FA4 A;  2QKE A;  1OC9 B;  3R2Q A;  3FZ9 A;  2A2R A;  2RII A;  2J23 A;  5BRT A;  4TRX A;  1PD2 1;  3LEF A;  4K7I A;  2LJR A;  4O7H A;  4I8B A;  1ST9 A;  1NHO A;  5ELA A;  1R4W A;  4ZBB A;  3P2A A;  5EPF A;  4MF7 A;  1PSQ A;  1TU8 A;  2FLS A;  5CAX A;  2VCT A;  1R5A A;  3GRX A;  1GSS A;  3A2W A;  4OFN A;  2K9F A;  2B5Y A;  3EVI A;  1FG4 A;  2AB6 A;  2DJ2 A;  2C4J A;  1EOG A;  3EE2 A;  4GXZ A;  2DSA A;  3ZIV A;  3CSI A;  4E8E A;  1XW9 A;  5D9T A;  4KDY A;  2QA1 A;  3L9V A;  4POB A;  5EL8 A;  1SK1 A;  2MMZ A;  3GUR A;  1RQM A;  6GSS A;  4HEA 2;  3TKR A;  5DVB A;  3D5J A;  3C1R A;  3TJB A;  4TXO A;  5DCG A;  4GRF A;  2FWH A;  4BPY A;  4MZC A;  2M72 A;  1FVK A;  4FYU A;  1AXD A;  2TRC P;  4GF0 A;  4BA7 A;  2YV7 A;  3RPN A;  4PQ1 A;  1NW2 A;  1NM3 A;  3A3T A;  2JL4 A;  2RUF A;  3VPT A;  5CRW A;  1YDK A;  5F07 A;  4BVX A;  10GS A;  2M80 A;  4TXV A;  3GV1 A;  2OBK A;  4DSS B;  4O5Q A;  3L78 A;  4XTS A;  3CXG A;  3KIJ A;  3D0Z A;  1T8E B;  4L8E A;  1F6M C;  3WD6 A;  4MZW A;  2RLI A;  5KN2 A;  5J9B A;  1TKD B;  3TKS E;  1ERT A;  1M2A A;  1SYX A;  1JFU A;  1XWC A;  3O76 A;  1Y6E A;  2H66 A;  1PGT A;  3VK9 A;  4GCI A;  2QGV A;  2H75 A;  6GST A;  5HR3 A;  5ECN B;  2OA7 A;  4KH7 A;  5HQP A;  1V2A A;  3QDN A;  5ELG A;  1OC3 A;  1T7P B;  5AIV A;  1J0F A;  5EY6 A;  2I81 A;  4P3Y B;  1YJ6 A;  3Q19 A;  2HXK A;  5KOW A;  5GZZ B;  3BJ5 A;  4MP4 A;  5F06 A;  3Q6O A;  4USS A;  1CQH A;  1M99 A;  4V1A p;  4V1A g;  4F0B A;  1OC9 A;  4L0W A;  4ID0 A;  1BG5 A;  2B5X A;  2LST A;  4Z2U A;  4GLT A;  2HSH A;  2VCZ A;  2V2G A;  1THX A;  2H6Z A;  1Y25 A;  5A4W A;  3AY8 A;  4MPF A;  3GH9 A;  1OVN A;  5DDL A;  2A4V A;  5IOW A;  5E4W A;  4KF9 A;  2DJ1 A;  2B7J A;  4XS6 A;  3TKS A;  4EKZ A;  1TOF A;  2C0G A;  3RPP A;  5KN3 A;  4OFM A;  1ZMA A;  4PUA A;  2HRK A;  3GX0 A;  2C0F A;  3VWU A;  4F9Z A;  5J9C A;  1GTB A;  1YKC A;  1K0C A;  5F8B A;  1M0U A;  2LS5 A;  4ZB9 A;  3E3E A;  3IHQ A;  5FWG A;  4ML1 A;  5DBQ A;  2FY6 A;  2C3N A;  4WR4 A;  3QR6 A;  2CVD A;  3TB2 A;  2YJ7 A;  1R26 A;  3ZYW A;  4O92 A;  2V32 A;  3MWH A;  3G7I A;  4F82 A;  2OE1 A;  2H6Y A;  1ZYN A;  1ZZY A;  1AW9 A;  4FH8 A;  4O5R A;  4KSM A;  5JWQ B;  3A2V A;  3Q74 A;  2CAI A;  1B4P A;  2B3S A;  1M2B A;  3BBY A;  4WBR D;  2OBI A;  1OE7 A;  1G7O A;  1TJD A;  1XOB A;  2JAD A;  1TP9 A;  2LQO A;  1X5D A;  3FZ4 A;  2I3Y A;  1MDJ A;  3FYG A;  1AQV A;  2RUE A;  4MJA A;  2VOC A;  5D73 A;  5ID2 B;  4OO4 A;  5CRE A;  1PKZ A;  2J9H A;  1FB6 A;  5IQY A;  1A2M A;  3MDK A;  2VLV A;  5IPH A;  5KEJ A;  1N2A A;  4MF5 A;  3F0I A;  3JCM L;  3NZN A;  2KUC A;  4GWR A;  4RUV A;  1GSD A;  2VM2 A;  3KMO A;  4E8H A;  3ERW A;  5DAL B;  3FEU A;  4MH2 A;  5AN1 A;  2H76 A;  4GSN A;  4XS4 B;  5DQY A;  3TCO A;  3TJF A;  4N11 A;  2YP6 A;  1ZL9 A;  4JU5 A;  1X9S B;  2MYG A;  3EC3 A;  1CQG A;  2WRT A;  1Q4J A;  3UJ1 A;  1A0R P;  4HZ2 A;  3UVH A;  1I5G A;  1Z5Y E;  3J7Y b;  3IHG A;  3DVW A;  4NHZ A;  1U3I A;  4ISD A;  2GSS A;  3F9U A;  2VL2 A;  1XOA A;  5DJL A;  11GS A;  3GX8 A;  5ECH B;  3TKQ A;  5GAN D;  3CTG A;  4I2T A;  2YOI A;  5ECM B;  4K7N A;  2H6X A;  1OAZ A;  1AC1 A;  2XC2 A;  3TKS C;  2N5B A;  3LOR A;  3TRX A;  5IMV A;  3GIX A;  9GSS A;  1TRW A;  3HJO A;  5IPG A;  8GSS A;  3VI7 A;  1O73 A;  4LMV A;  1G6Y A;  1B4Q A;  3VWW A;  1SYR A;  4MJB A;  3LXZ A;  3GST A;  1ERU A;  5ECK B;  3I43 A;  3HXS A;  1R7H A;  2XPE A;  3SWL A;  2VCX A;  2F3M A;  4KGI A;  3BCK A;  4MNN A;  1QK8 A;  3ZMK A;  2JAC A;  1EOH A;  5ECI B;  6GSV A;  5D93 A;  4IJ3 A;  3EU4 A;  4WBJ A;  1SL1 B;  2VLT A;  1DBY A;  3EUR A;  4YQV A;  1K0D A;  3KH7 A;  1SEN A;  3VI5 A;  1WWJ A;  1EEM A;  4G0I A;  4IEL A;  3WGD A;  1BJX A;  5AIX A;  4V2L A;  3IOS A;  1J08 A;  2OE3 A;  2P31 A;  3FHK A;  2JZS A;  4HQZ A;  2HT9 A;  2C1Y A;  1ZOF A;  3LFL A;  3HJM A;  2HNL A;  3F4S A;  4GQF A;  2XHF A;  4AGS A;  2H74 A;  1QGV A;  2E0Q A;  4XIH A;  4IBP A;  4K6X A;  2GT6 A;  3CYN A;  4HU9 A;  1BAY A;  2O85 A;  4EDZ A;  2KP1 A;  3LQ7 A;  5DAL A;  2H73 A;  4BVX B;  12GS A;  4EF0 A;  4AJ7 A;  2P5R A;  3IK7 A;  4XS4 A;  2YZH A;  3KEB A;  3UMA A;  5G30 A;  4KB3 A;  2E7P A;  3TOT A;  1XVW A;  1Z3E A;  2WS2 A;  2X8H A;  1WOU A;  3GKM A;  2IFQ B;  2LRC A;  1QXH A;  1OKD A;  5B7C A;  3PR8 A;  1SU9 A;  2KOK A;  1MDK A;  1HD2 A;  4G19 A;  4ZL7 A;  3M8N A;  2GTU A;  3CBU A;  4KX4 A;  3GFK A;  4YAV A;  3DD3 A;  2VLU A;  1GLQ A;  1FHE A;  3D21 A;  2H71 A;  5H5R A;  1K0B A;  4IVF A;  4ACS A;  2JZT A;  2H01 A;  1PMT A;  2R5G A;  3IK9 A;  6GSY A;  3HZ8 A;  4HDE A;  1FO5 A;  16GS A;  2XBI A;  4MJE A;  1MTC A;  2N5A A;  1WIK A;  13GS A;  4Z2R A;  4A5P A;  3FR9 A;  4XHM A;  1FVJ A;  2CT6 A;  2EIO A;  1PL2 A;  2H1B A;  3TDG A;  1PKW A;  4KUN A;  1KEB A;  5D8I A;  1Q98 A;  1TDI A;  2VL2 C;  5ECR B;  4ZBA A;  1K0N A;  1YQ1 A;  5LCZ A;  2IIY A;  2LTK A;  1PX6 A;  4MZB A;  3VPQ A;  2VUP A;  1TRU A;  5ECS A;  4K9Z A;  1V98 A;  3EMP A;  5BMU A;  3H4K A;  3QFA C;  5KN0 A;  2LJA A;  3NIV A;  1ACV A;  1PN9 A;  3CMI A;  5G1L A;  1SL2 B;  4Q5F A;  4QL9 A;  4I6X A;  1VRS D;  4POM A;  5H5Q A;  1K0O A;  3EMX A;  1AUC A;  2FUG 2;  3M9K A;  3F3R A;  3QMX A;  2CZ2 A;  4YAP A;  6GSX A;  5COH A;  3FKF A;  5G31 A;  2FWF A;  4TW5 A;  3ZRE A;  4ZBD A;  2KLX A;  4NV5 A;  4NAX A;  4LL1 B;  5HFG A;  3ERG A;  1BYE A;  4WEY A;  1F2E A;  4KE3 A;  1JZW A;  2VD1 A;  3WGX A;  3N5O A;  1B48 A;  3TOU A;  3TRP A;  4K2X A;  3LJR A;  3LYP A;  2FA8 A;  3ZIT A;  4OWY A;  1SJZ A;  1EEJ A;  2GLR A;  3LSZ A;  1K0M A;  1QUW A;  2IFQ A;  3E9J B;  1UVZ A;  4ZXG A;  2TIR A;  3QAV A;  2H70 A;  1TK8 B;  4GST A;  2MMO A;  1ML6 A;  3WT2 A;  3LXT A;  1XWA A;  2C3Q A;  2FHE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...