2DJ0A

The solution structure of the thioredoxin domain of human thioredoxin-related transmembrane protein 2
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
137
structure length
137
Chain Sequence
GSSGSSGYIKYFNDKTIDEELERDKRVTWIVEFFANWSNDCQSFAPIYADLSLKYNCTGLNFGKVDVGRYTDVSTRYKVSTSPLTKQLPTLILFQGGKEAMRRPQIDKKGRAVSWTFSEENVIREFNLNELSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thioredoxin-related transmembrane protein 2
publication title The solution structure of the thioredoxin domain of human Thioredoxin-related transmembrane protein 2
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
total genus 23
structure length 137
sequence length 137
ec nomenclature
pdb deposition date 2006-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2dj0A01
4HQSA 1AQVA 3D4TA 3FHKA 2GVPA 4JBBA 3TDGA 3H8QA 3LYKA 2QSIA 1JLVA 3BCIA 3APQA 1GP1A 4G10A 1OC9B 4V1Ap 5HR1A 1R5AA 5FWGA 2DIZA 3WGDA 4TRXA 1THOA 2REMA 1GSSA 4EL1A 5CAXA 2RLIA 2PU9C 3KP8A 1K0AA 1ZGNA 3GV1A 1FOVA 4IBPA 3M9JA 2FY6A 4IW9A 1T7PB 1TK8B 4ISDA 3IRAA 2IWTA 4IKHA 1G7OA 1F6MC 3EU3A 2J23A 1HQOA 4EE0A 4EDZA 3IK7A 2KOKA 5CYYA 2HI7A 1OYJA 4HDEA 2JU5A 4XHMA 1B4PA 1GSFA 2VCXA 3N5OA 4EXJA 4DSRA 5F8BA 2GSSA 2PBJA 1XZOA 2JADA 3I69A 2YV9A 2WB9A 4QL7A 1PRXA 2HNLA 3O76A 3K8NA 5EY6A 2BMXA 2HRFA 2A2SA 1PGTA 3APOA 2PPTA 4N0ZA 3TKPA 5ECQB 1H4OA 1GSDA 2V41A 2FUG2 3LJRA 5F07A 5L71A 4JEDA 1PQNA 1K3OA 5D8IA 5ECMB 1XWBA 2AB6A 2CZ3A 3UVHA 2JZRA 3FY7A 1WMJA 4ZILA 4F2IA 3DIEA 5CNWA 2FWFA 4PXOA 1FB0A 3DKSA 16GSA 4E8HA 1TJDA 3DGQA 6GSSA 2RM5A 19GSA 1WWJA 1EOGA 5IO2A 3HA9A 4CW9A 4N11A 3CRUA 1GH2A 3ZVJD 2G0FA 5D96A 4ZBDA 5F05A 1EGOA 1YF0A 2AYTA 2QC7A 1AQWA 3CTGA 4YAPA 4MJAA 2MBTA 3KEBA 2EIOA 1A0FA 1T00A 2YWIA 1SD9A 2E2MA 4KNDA 1M0UA 1QMVA 2H19A 4WF5A 3W8SA 1T1VA 3VWUA 3FEUA 5G5EA 2H1DA 3MSZA 1V98A 3RBTA 4ZIJA 1M2BA 2N5FA 2YCDA 3DYRA 2HT9A 2LRCA 2C0FA 3C71A 3RHBA 1UC7A 2PVQA 1ZYQB 1KEBA 1GWCA 1ERVA 2PMTA 4MPFA 4TR4A 1T8EB 3GL3A 2CX3A 4POMA 3D22A 5H5QA 5D9TA 3A2WA 2I4AA 3NIVA 3VFIA 4K0NA 2V32A 4ML1A 5ABRA 3L9VA 2V6OA 1PKZA 2NBSA 3ZL5A 4TR1A 1OVNA 2LJAA 3FZ5A 5D9XA 5IMCA 3QAWA 3E0UA 2N5BA 4X43A 2H74A 3IDVA 5G5FA 1SU9A 3LFLA 1AW9A 3M9KA 2HLSA 2B6MA 3ZYWA 1GTIA 1SD8A 4F0BA 11GSA 1SJ6A 3VPQA 4ILFA 4BL7A 3TJKA 3BD2A 1EZKA 2O87A 4YQVA 2GS3A 4FIWA 4QL9A 2VCTA 5IMZA 1LJRA 4XTSA 3ZVJA 1EWXA 4TR1B 1A23A 3QDNA 3G7IA 2ES7A 1USBA 1Y6EA 1VGLA 2XPEA 1T4YA 2B1LA 4ZXGA 3VK9A 5IM9A 4MJBA 2H72A 4IJIA 2M80A 5DJMA 3HHVA 2GLRA 1HD2A 1JZWA 3VWVA 4AF2A 5J5NA 2DJJA 3J7Yk 2IIYA 2DMLA 1TXXA 5G2ZA 1SKRB 1O73A 4AJ7A 1XWCA 3TRQA 4ECBA 3DXBA 3IK9A 2YJHA 5CRGA 2OKAA 3AY8A 5A4UA 2FGXA 5IIZA 2C3QA 4JE1A 4K7OA 4NV5A 3F8UA 3VLNA 2PUKC 1C72A 2VM1A 3D0ZA 2VD1A 3C7MA 1BJXA 4HQZA 4J2FA 3MAKA 3EVIA 1ERUA 3IA1A 1V9WA 5FT3A 2HSYA 2HYXA 5ECOB 1WOUA 3DD3A 2YZHA 2DC5A 3VURA 1YF1A 1GUKA 1O7UA 1U3AA 2ZCTA 2H75A 1O8WA 4V2MA 5CREA 5CP1A 2FCHA 5A4VA 3VPTA 3I9V2 3GKKA 3UBLA 1TP9A 4KDXA 4IHUA 3FW2A 1DBYA 5G30A 2CZ2A 1XOAA 2YANA 5C04A 2L5OA 4EUYA 4MZBA 2IJYA 1ERTA 1QQ2A 2VLTA 1OAZA 1E6BA 4ID0A 1GRXA 4L8EA 1AXDA 2JSZA 2LTKA 4TOPA 5DCHA 3HYPA 4TR0A 2PVOC 5DVBA 1G0TA 3F6FA 1JLWA 1AUCA 5G1KA 3ZIVA 1OKTA 3G7YA 3APSA 2PN8A 4KH7A 4PGTA 3M0FA 4MCUA 5ECKB 4GSNA 5DQSA 4ECIA 3H93A 2F8FA 4CDOA 5DALA 3D4MA 3QMXA 5HQPA 2L4CA 2C0EA 3CSIA 3UIWA 3KH7A 3SWLA 4OO4A 4GWRA 3KTBA 1LU4A 4OFMA 3C8EA 1PSQA 3WD6A 1B9YC 1SYXA 4BA7A 4GF0A 1RK4A 1BEDA 1K0DA 3UVTA 2VL2A 4XS4B 4N30A 1GNEA 2DJKA 3CBUA 3DVXA 1QFNA 1Z7PA 3M3MA 1M2AA 4G9HA 4BWQA 3QAGA 4TVEA 1GSYA 4LLRA 4K0GA 3GA4A 5DALB 1G7EA 6GSVA 4WBRD 1OE7A 1NHYA 3GIXA 17GSA 3GUSA 2H1GA 1WE0A 4MF6A 6GSTA 4AJ6A 1URMA 3E3EA 2WRTA 3H1NA 2X8CA 3CXGA 5GZZB 4L0UA 4V2NA 1FHEA 2YWOA 1KTEA 1AC1A 5IPHA 1TRVA 3UOMA 1XVWA 1UN2A 4MA9A 2V1MA 3GSSA 3IAS2 3HVVA 4FH8A 1FB6A 3F0IA 2CVDA 1SK2A 2VOCA 4OMVA 3PGTA 1GUHA 1MDJA 3SBCA 2AAWA 4RI6A 2DBCA 3WGEA 4NV2A 3GSTA 3M1GA 3KD0A 4KX4A 4WXTA 4PUAA 2H6XA 5INYA 1F9MA 5KN3A 2NPBA 2JSYA 3FR9A 1B9XC 2X8HA 1ZCPA 3KIJA 2FHEA 3GNJA 3LXZA 4NWYA 1M2DA 3DWVA 3TKRA 1Z7RA 4FYBA 4FYUA 1SENA 4PQIA 2YWMA 2H0HA 3P2AA 1MD3A 1A2LA 3TJFA 5ID2A 2PGTA 2IMIA 3MNGA 4NAXA 2F9SA 13GSA 4KAEA 3TRPA 4POLA 5DQYA 3Q18A 4K2DA 3DRNA 1A2MA 3DEXA 1NW2A 3A3TA 4ECJA 2YWNA 2RIIA 4LA1A 2HRNA 1QGVA 4O92A 2H70A 1FVJA 1G6WA 3HY2A 1TRUA 3GKXA 2P5QA 2CAIA 2X64A 1M7TA 3GYKA 2AHEA 5B8AA 2VL2C 3IXRA 1YEPA 3J7Yb 5DCGA 3EC3A 1T4ZA 2VLUA 3QPMA 4MK3A 2MMOA 4EVMA 5ID2B 3F4TA 4RQRA 2H1AA 4ZL7A 4ML6A 5KN2A 5JWRB 6GSWA 5B8BA 4ZBBA 1SYRA 1PA3A 3QD9A 3RPPA 3H79A 2GQMA 4EKZA 1XWAA 1TRSA 1UVZA 4QQ7A 2XHFA 4OWYA 1GSEA 2LSTA 1XBSA 2ZUPA 2KUCA 4YQMA 4IQ1A 5J41A 2R6KA 4Q5NA 1S3AA 3ME8A 2GDRA 4NHWA 4N0VA 5HFGA 1EEMA 1X9SB 1XWKA 4DSSB 4BVYA 4MF7A 2GQLA 3BOAA 2WGRA 1ZMAA 2CA8A 3G7JA 2L6CA 3TJBA 4GTUA 2H6ZA 1SKWB 2E7PA 1ZOFA 2VAFA 1PD21 1MTCA 3A2VA 4Q5RA 3P7XA 4MABA 3TOTA 3Q19A 4HZ4A 4KW6A 3FZ4A 3PH9A 2VCQA 2FNOA 1B48A 2A2RA 3IHQA 3WT2A 2RM6A 4NMUA 2OE3A 4K9ZA 3GMFA 1WIKA 4MJCA 1K3LA 2DIYA 4O7HA 3UARA 4EC0A 1EGRA 3IE3A 1X0RA 3Q6OA 4PX1A 2I3YA 3US3A 2NDOA 1O8XA 5DBQA 1NM3A 2YN1A 3V1WA 2VO4A 3HKRA 3TJGA 4KUNA 1MD4A 1JZDA 4V2LA 2B5YA 3IV4A 5J4UA 4HU7A 4LL4B 4BWSA 2A4VA 3I6AA 5C00A 4JRRA 1N8JA 3ZLPA 3KTLA 2ON7A 2XBIA 4HS1A 20GSA 3GX0A 1OC3A 4HEA2 3HD5A 1B8XA 3KCMA 2E2GA 3F6DA 4G2EA 1HYUA 4GRFA 5HR2A 1OE8A 4AGSA 3UBKA 1G6YA 4MH3A 2QGVA 2I1UA 1SJIA 3PR8A 1ZL9A 1NHOA 3Q74A 2LJKA 3CRTA 5A4WA 2CX4A 2JZTA 2ZNMA 4ZL9A 4GSSA 2DJ1A 1HNAA 1H75A 4FO5A 4HUAA 3EURA 3WYWA 2EIQA 4X0XA 5D9WA 5AIVA 1TI3A 1SJZA 3EE2A 3KGKA 1V57A 4O32A 3TGZA 4XIHA 2PWJA 1BQ7A 1E2YA 5LD0A 4OO5A 3D5JA 5FHIA 1O85A 4J57E 4LL1B 3HCZA 2PERA 3DVWA 4BVXA 4KSOA 3EMPA 3L9SA 2C1YA 5JCUA 2GGTA 3TB2A 1VRSD 2XPDA 2OACA 4KSMA 2EC4A 3GRXA 4PNFA 1GSUA 1ABAA 2HZFA 4GQFA 2WJUA 1VF1A 2WCIA 3OR5A 1NSWA 4L5OA 1TW9A 5JCWA 2H76A 1XW6A 4JZQA 2NTOA 5AIXA 2F51A 5IMAA 1BAYA 3RDWA 3C1SA 1PN9A 1BX9A 4ULXA 4E8EA 3GH9A 2CT6A 5ELGA 1X5DA 5COHA 1FAAA 1F3BA 5GSSA 1YQ1A 1F3AA 3N9JA 4MP4A 2R4VA 1GUMA 1DUGA 4I5QA 4XCSA 3HZ4A 4K7IA 1SK0A 2WS2A 1A8LA 3EINA 3FRCA 1W89A 2GT6A 3ZIJA 3EU4A 3BBYA 4XS4A 1QK8A 3QOUA 3TCOA 1J08A 1HNBA 3C73A 1Z3EA 2P0GA 3HVXA 2V2GA 2GSQA 4PURA 4MDCA 4CHSA 3L78A 3O6TA 3QAVA 2YOIA 2KHPA 1VF4A 4K7NA 2MMNA 2GQKA 4ECCA 2FWHA 2VCZA 2L5LA 3UAPA 3IPZA 3D21A 4XS1A 3O3TA 3GN3A 5IOXA 1YJ6A 1THXA 2K8SA 1M99A 4NHZA 1LBKA 2O8VB 1HNCA 3H4KA 2DMMA 3WT1A 4OFNA 5JWOB 4IQAA 2VL3A 2ON5A 2DJ0A 3GKNA 3RHCA 1GLQA 2FD3A 1U88A 2VM2A 3LQ7A 1TTZA 1GSQA 1AQXA 1VF2A 1PX7A 3TUEA 2OJLA 3TOUA 1SKSB 4HOJA 2VL9A 4PNGA 1FG4A 1DE1A 2LNSA 5DJLA 3BCKA 2KP2A 2EIRA 4YAVA 3BJ5A 1FO5A 4IP6A 4TW5A 2M46A 3I43A 2D2ZA 2DJ3A 2IMKA 1ZYEA 1N2AA 4MMMA 5GAND 5D73A 2GZYA 1Z9HA 4OFTA 4TKYA 4WKWA 3HZ8A 1U3IA 2DLXA 1FW1A 5H5SA 5JCGA 1ERWA 3G9BA 3UL3A 2LUSA 3IR4A 4FYCA 5JWQB 2CAQA 3F9UA 1YY7A 1PKWA 2IPAA 4RUVA 4WF4A 3IBHA 1SK1A 3R2QA 5GSTA 1UA5A 3CMIA 2IMFA 2OA7A 18GSA 1TOFA 5ELAA 2MZCA 2P31A 1B4QA 2H01A 4JR6A 2WZ9A 2HFDA 2KLXA 3GTUA 2O89A 2G2QA 1KNGA 5DDLA 2FWEA 1CQHA 3ISOA 4KCEA 5E59A 4JU5A 4TXVA 2B5EA 2C8UA 4GXZA 2OBKA 3VWXA 1V58A 1WPIA 1JHBA 2M72A 5IOWA 3W8JA 1CQGA 3WGXA 4F9ZA 1ON4A 5CRWA 3ZTLA 12GSA 1K0MA 4MPGA 5ECLB 3CSJA 2K9FA 2RUEA 4IELA 1V2AA 1K0NA 3LEFA 3ME7A 2L57A 4K6XA 3ZMLA 2LEGA 2LJRA 5DAKA 1EEJA 2WDUA 5G1LA 2C3TA 1TK0B 2LS5A 3GTUB 4DSSA 2LKUA 3KZQA 4IJ3A 4WR4A 2YPMA 5E4WA 1MDKA 2X99A 1WRYA 4OCFA 1TKDB 1GTAA 1XFLA 1U87A 1A8YA 4MZCA 4LMVA 3LG6A 3TKSA 1I5GA 5B6MA 4KGIA 5CRHA 1XW5A 1GTUA 3L0HA 1K3YA 2GZZA 2E0QA 3TJJA 6GSYA 3UMAA 4I2TA 1GTBA 2H30A 5KN1A 1M9BA 4Q5QA 3F3RA 1WP0A 2C0GA 5DAKB 2OE1A 5H5RA 5ECRB 2FA4A 1ML6A 4YH2A 2H0GA 1RW1A 2GZPA 5HR3A 3GFKA 4G19A 2C4JA 1O81A 14GSA 3IAM2 1GNWA 1GULA 1KBNA 1T3BA 4I2UA 2WULA 1MDIA 1Z6NA 1Z5YE 3HJMA 1U6TA 4TR3A 1TI1A 1R4WA 2R37A 4XRAA 1EOHA 2H8LA 3QFBC 4TXOA 3LGCA 2K18A 4N10A 1GLPA 1TU7A 1XOBA 3ZRDA 3F63A 3L9UA 3GHAA 3LORA 4KA0A 5IMFA 3RPNA 4EDYA 2I9HA 4WBJA 5EVOA 1TDIA 2F8AA 3GL5A 1RQMA 4X1UA 5D93A 1IYIA 1JZOA 5IMDA 2BTOT 4DEJA 2HXKA 2C3NA 5IQYA 3QCPA 2FWGA 1F2EA 4LMWA 1JFUA 1YZXA 4XS6A 4AJ8A 4KE3A 2IFQA 3TKQA 1YEXA 2CQ9A 2VLVA 9GSSA 3GURA 1ST9A 2TRXA 4IN0A 3TKSE 2VD0A 4ZB8A 3KMNA 2H6YA 3HJOA 3ZITA 1EV4A 5ECPB 1Y25A 4TXOB 1I9DA 1X9MB 3ZZXA 1BYEA 5GAPD 2H71A 3HDCA 3A2XA 1YKAA 2WFCA 3UJ1A 4IS0A 3ED3A 1J9BA 3ERFA 2TRCP 1S3CA 5AISA 3W6GA 3KH9A 3IC4A 2CV4A 4TN8A 1ZZYA 2YJ7A 4OD7A 4POKA 1EP7A 3FK8A 5HR0A 2LRNA 2IFQB 4KDUA 1XCCA 5EPFA 5IMVA 1R5PA 5ECHB 4RQXA 1YKCA 4WR5A 2QKEA 1FVKA 2MMZA 3C1RA 2NVLA 3TKSC 1VF3A 4I6XA 3JCML 2F3MA 3NZNA 1R7HA 10GSA 4RI7A 3EWLA 2MBSA 1GL8A 1XIYA 4ZL8A 2GSTA 2IL3A 3F4SA 1DE2A 1OC8A 4POBA 5IPGA 3KXOA 4NPBA 2LQOA 3IOSA 5B6NA 2MYGA 2H1BA 3CTFA 5AN1A 2KP1A 4EF0A 1F37A 3LYPA 2R2JA 3L4NA 3FKFA 5AGYA 2GT5A 5ECIB 3PINA 1X5CA 5CO3A 2BJXA 1AIUA 3GH6A 2RUFA 1PX6A 4NXIA 5J9CA 3A5WA 3MDKA 3KP9A 2JL4A 3TRXA 5IO0A 1X9WB 6GSXA 5CRDA 2YV7A 3KM6A 4KB3A 4V1Ag 1ACVA 1IYHA 4IP1A 4L0WA 5HFKA 1EP8A 2TIRA 1M9AA 4HJ2A 5A5KA 2GSRA 1DSBA 2DJ2A 1K0CA 1S3DA 4WEYA 1V40A 3CSHA 2VIMA 4HI7A 3S9FA 4H86A 4Z7XA 4L5LA 2LRTA 4DVCA 5EL8A 1WJKA 2IMDA 3VWWA 2B1KA 4P3YB 3KJYA 2FLSA 2OBIA 1MEKA 4IGJA 4Q5FA 4PUFC 1Q4JA 2B7KA 3F3QA 3E9JB 2B5XA 4HJMA 5J9BA 1AAZA 3VI7A 2JZSA 1PL2A 22GSA 1SL0B 2L4QA 5ECNB 3LWAA 3ZFLA 4K1FA 3QR6A 2HZEA 3CYNA 3GKMA 4MF5A 4DSQA 2N5AA 3U6VA 3UEMA 5J3RA 5HFIA 7GSSA 1XW9A 4I8BA 8GSSA 2DSAA 2GTUA 1BG5A 3MWHA 4MJEA 5F06A 2R5GA 3QFAC 2CVKA 4ZBAA 4WETA 2P5RA 4PQ1A 3ZREA 4J56E 2X8GA 3ZMKA 2XC2A 1EV9A 2OADA 2B3SA 4IVFA 2O85A 1JZRA 5KEJA 2XBQA 4GQCA 4F0CA 6GSUA 4XRDA 4K8MA 4OCEA 1W4VA 1XPVA 2AUVA 5ENUA 2H66A 2IMEA 2Z9SA 4KDYA 2V6KA 3FYGA 4D73A 4YQUA 1ILOA 2HZEB 5LCZA 4GSTA 4HU9A 4KCAA 2ALBA 5F0GA 2I81A 3ERGA 1R26A 2VUPA 2VCWA 3FR6A 2L59A 1A0RP 1XXUA 1J0FA 3FZ9A 4O5RA 1OKDA 4MH2A 4BPYA 2C80A 2HSHA 2B7JA 3FR3A 5G31A 1SL2B 2C0DA 1TU8A 4JR4A 3ZFBA 2YP6A 4F03A 4GLTA 3HVSA 2O7KA 2YZUA 3RAZA 1PMTA 4D73B 1YDKA 5LNKe 2VCVA 4F82A 4HZ2A 2AV4A 3HXSA 2LV3A 3KMOA 1SL1B 2YNXA 4EO3A 3EMXA 1QUWA 1TRWA 4MZWA 1K0BA 5D9VA 2MMAA 1XVQA 2J9HA 5KN0A 4PQHA 2L6DA 2IN3A 3P90A 3ERWA 3F4RA 3HJPA 1O6JA 1A24A 2FA8A 5ECSA 2LNTA 2JACA 3FZAA 3EYTA 1XWGA 1QXHA 3LXTA 2K6VA 1OC9A 2H0IA 1Z6MA 3LSZA 2LQQA 3U5RE 4I97A 4ZB6A 1K0OA 2OE0A 2K8VA 2R3XA 3D6IA 3VI5A 4ACSA 5B7CA 2AJQB 3DMLA 1X5EA 3GX8A 4MLYA 3P8WA 3M8NA 1TK5B 2H73A 2HE3A 4ZB9A 3NOFA 1Q98A 1PL1A 1A2JA 4GCIA 2CVBA
chains in the Genus database with same CATH superfamily
4HQSA 1AQVA 3D4TA 3FHKA 2QA1A 2GVPA 4JBBA 3TDGA 3H8QA 3LYKA 2QSIA 1JLVA 3BCIA 3APQA 1GP1A 4G10A 1OC9B 4V1Ap 5HR1A 1R5AA 5FWGA 2DIZA 3WGDA 4TRXA 1THOA 2REMA 1GSSA 4EL1A 5CAXA 2RLIA 2PU9C 3KP8A 1K0AA 1ZGNA 3GV1A 1FOVA 4IBPA 3M9JA 2FY6A 4IW9A 1T7PB 1TK8B 4ISDA 3IRAA 2IWTA 4IKHA 1G7OA 1F6MC 3EU3A 2J23A 1HQOA 4EE0A 4EDZA 3IK7A 2KOKA 5CYYA 2HI7A 1OYJA 4HDEA 2JU5A 4XHMA 1B4PA 4KF9A 1GSFA 2VCXA 3N5OA 4EXJA 4DSRA 5F8BA 2GSSA 2PBJA 1XZOA 2JADA 3I69A 2YV9A 2WB9A 4QL7A 1PRXA 2HNLA 3O76A 3K8NA 5EY6A 2BMXA 3IC8A 2HRFA 2A2SA 1PGTA 3APOA 2PPTA 4N0ZA 3TKPA 5ECQB 1H4OA 1GSDA 2V41A 2FUG2 4K5RA 3LJRA 5F07A 5L71A 4JEDA 1PQNA 1K3OA 2HRKA 5D8IA 5ECMB 1XWBA 2AB6A 2CZ3A 3UVHA 2JZRA 3FY7A 1WMJA 4ZILA 4F2IA 3DIEA 5CNWA 2FWFA 4PXOA 1FB0A 3DKSA 16GSA 4E8HA 1TJDA 3DGQA 6GSSA 2RM5A 19GSA 1WWJA 1EOGA 5IO2A 3HA9A 4CW9A 4N11A 3CRUA 1GH2A 3ZVJD 2G0FA 5D96A 4ZBDA 5F05A 1EGOA 1YF0A 2AYTA 2QC7A 1AQWA 3CTGA 4YAPA 4O5QA 4MJAA 2MBTA 3KEBA 2EIOA 1A0FA 1T00A 2YWIA 1SD9A 2E2MA 4KNDA 1M0UA 1QMVA 2H19A 4WF5A 3W8SA 1T1VA 3VWUA 3FEUA 5G5EA 2H1DA 3MSZA 1V98A 3RBTA 4ZIJA 1M2BA 2N5FA 2YCDA 3DYRA 2HT9A 2LRCA 2C0FA 3C71A 3RHBA 1UC7A 2PVQA 1ZYQB 1KEBA 1GWCA 1ERVA 2PMTA 4MPFA 4TR4A 1T8EB 3GL3A 2CX3A 4POMA 4BVYB 3D22A 5H5QA 5D9TA 3A2WA 2I4AA 3NIVA 3VFIA 4K0NA 2V32A 4ML1A 5ABRA 3L9VA 2V6OA 2X49A 1PKZA 2NBSA 3ZL5A 4TR1A 1OVNA 2LJAA 3FZ5A 5D9XA 5IMCA 4Z2UA 3QAWA 3E0UA 2N5BA 4X43A 2H74A 3IDVA 5G5FA 1SU9A 3LFLA 1AW9A 3M9KA 2HLSA 2B6MA 3ZYWA 1GTIA 1SD8A 4F0BA 11GSA 1SJ6A 2A2PA 3VPQA 4ILFA 4BL7A 3TJKA 3BD2A 1EZKA 2O87A 4YQVA 2GS3A 4FIWA 4QL9A 2VCTA 5IMZA 1LJRA 4YKFA 4XTSA 3ZVJA 1EWXA 4TR1B 1A23A 3QDNA 3G7IA 2ES7A 1USBA 1Y6EA 1VGLA 2XPEA 1T4YA 2B1LA 4ZXGA 3VK9A 5IM9A 4MJBA 1S3RA 2H72A 4IJIA 2M80A 5DJMA 2UZ8A 3HHVA 2GLRA 1HD2A 1JZWA 3VWVA 4AF2A 5J5NA 2DJJA 3J7Yk 2IIYA 2DMLA 1TXXA 5G2ZA 1SKRB 1O73A 4AJ7A 1XWCA 3TRQA 4ECBA 3DXBA 3IK9A 2YJHA 5CRGA 2OKAA 3AY8A 5A4UA 2FGXA 5IIZA 2C3QA 4JE1A 4K7OA 4NV5A 3F8UA 4EIPA 3VLNA 2PUKC 1C72A 2VM1A 3D0ZA 2VD1A 3C7MA 1BJXA 4HQZA 4J2FA 3MAKA 3EVIA 1ERUA 3IA1A 1V9WA 5FT3A 2HSYA 2HYXA 5ECOB 1WOUA 3DD3A 2YZHA 2DC5A 3VURA 1M3IA 1YF1A 1GUKA 1O7UA 1U3AA 2ZCTA 2H75A 1O8WA 4V2MA 5CREA 5CP1A 2FCHA 5A4VA 3VPTA 3I9V2 3GKKA 3UBLA 1TP9A 4KDXA 4IHUA 3FW2A 1DBYA 5G30A 2CZ2A 1XOAA 2YANA 5C04A 2L5OA 4EUYA 4MZBA 2IJYA 1ERTA 1QQ2A 2VLTA 1OAZA 1E6BA 4ID0A 1GRXA 4L8EA 1AXDA 2JSZA 2LTKA 4TOPA 5DCHA 3HYPA 4TR0A 2PVOC 5DVBA 1G0TA 3F6FA 1JLWA 1AUCA 5G1KA 3ZIVA 1OKTA 3G7YA 3APSA 2PN8A 4KH7A 4PGTA 3M0FA 1FOHA 4MCUA 5ECKB 4GSNA 5DQSA 4ECIA 3H93A 2F8FA 4CDOA 5DALA 3D4MA 3QMXA 5HQPA 2L4CA 2C0EA 3CSIA 3EPTA 3UIWA 3A5IA 3KH7A 5KOXA 3SWLA 4OO4A 4GWRA 3KTBA 1LU4A 4OFMA 3C8EA 1PSQA 3WD6A 1B9YC 1SYXA 4BA7A 4GF0A 1RK4A 1BEDA 1K0DA 3UVTA 2VL2A 4EIQA 4XS4B 4N30A 1GNEA 2DJKA 3CBUA 3DVXA 1QFNA 1Z7PA 3M3MA 1M2AA 4G9HA 4BWQA 3QAGA 4TVEA 1GSYA 4LLRA 4K0GA 3GA4A 5DALB 1G7EA 6GSVA 4WBRD 1OE7A 1NHYA 3GIXA 17GSA 3GUSA 2H1GA 1WE0A 4MF6A 6GSTA 4AJ6A 1URMA 3E3EA 2WRTA 3H1NA 2X8CA 3CXGA 5GZZB 4L0UA 4V2NA 1FHEA 2YWOA 1KTEA 1AC1A 5IPHA 1TRVA 3UOMA 1XVWA 1UN2A 4MA9A 2V1MA 3GSSA 3IAS2 3HVVA 4FH8A 1FB6A 3F0IA 2CVDA 1SK2A 2VOCA 4OMVA 3PGTA 1GUHA 1MDJA 3SBCA 2AAWA 4RI6A 2DBCA 3WGEA 4NV2A 3GSTA 3M1GA 3KD0A 4KX4A 4WXTA 4PUAA 2H6XA 5INYA 1F9MA 5KN3A 2R0PA 2NPBA 2JSYA 3FR9A 1B9XC 2X8HA 1ZCPA 3KIJA 2FHEA 3GNJA 3LXZA 4NWYA 1M2DA 3DWVA 3TKRA 1Z7RA 4FYBA 4FYUA 1SENA 4PQIA 2YWMA 2H0HA 3P2AA 1MD3A 1A2LA 3TJFA 5ID2A 2PGTA 2IMIA 3MNGA 4NAXA 2F9SA 13GSA 4KAEA 3TRPA 4POLA 5DQYA 3Q18A 4K2DA 3DRNA 1ZYNA 3FMWA 1A2MA 3DEXA 1NW2A 3A3TA 4ECJA 2YWNA 2RIIA 4LA1A 2HRNA 1QGVA 4O92A 2H70A 1FVJA 1G6WA 3HY2A 1TRUA 3GKXA 2P5QA 2CAIA 2X64A 1M7TA 3GYKA 2AHEA 5B8AA 2VL2C 3IXRA 1YEPA 3J7Yb 5DCGA 3EC3A 1T4ZA 2VLUA 3QPMA 4MK3A 2MMOA 4EVMA 5ID2B 3F4TA 4RQRA 2H1AA 4ZL7A 4ML6A 5KN2A 5JWRB 6GSWA 5B8BA 4ZBBA 1SYRA 1PA3A 3QD9A 3RPPA 3H79A 4HSCX 2GQMA 4EKZA 1XWAA 1TRSA 1UVZA 4QQ7A 2XHFA 4OWYA 1GSEA 2LSTA 1XBSA 2ZUPA 2KUCA 4YQMA 4IQ1A 5J41A 2R6KA 4Q5NA 1S3AA 3ME8A 2GDRA 4NHWA 4N0VA 5HFGA 1EEMA 1X9SB 1XWKA 4DSSB 4BVYA 4MF7A 2GQLA 3BOAA 2WGRA 1ZMAA 2CA8A 3G7JA 2L6CA 4G0KA 3TJBA 4GTUA 2H6ZA 1SKWB 2E7PA 1ZOFA 2VAFA 1PD21 1MTCA 3A2VA 4Q5RA 3P7XA 4MABA 3TOTA 3Q19A 4HZ4A 4KW6A 3FZ4A 3PH9A 2VCQA 2FNOA 1B48A 2A2RA 3IHQA 3WT2A 4CY8A 2RM6A 4NMUA 2OE3A 4K9ZA 3GMFA 1WIKA 4MJCA 1K3LA 2DIYA 4O7HA 3UARA 4EC0A 1EGRA 3IE3A 3R3EA 1X0RA 4G0IA 3Q6OA 4PX1A 2I3YA 3US3A 2NDOA 1O8XA 5DBQA 1NM3A 2YN1A 3V1WA 2VO4A 3HKRA 3TJGA 4KUNA 1MD4A 1JZDA 4V2LA 2B5YA 3IV4A 5J4UA 4HU7A 4LL4B 4BWSA 2A4VA 3I6AA 5C00A 4JRRA 1N8JA 3ZLPA 3KTLA 2ON7A 2XBIA 4HS1A 20GSA 3GX0A 1OC3A 4HEA2 3HD5A 1B8XA 3KCMA 2E2GA 3F6DA 4G2EA 1HYUA 4GRFA 5HR2A 1OE8A 4AGSA 3UBKA 1G6YA 4MH3A 2QGVA 2I1UA 1SJIA 3PR8A 1ZL9A 1NHOA 3Q74A 2LJKA 3CRTA 5A4WA 2CX4A 2JZTA 2ZNMA 4ZL9A 4GSSA 4BIKA 2DJ1A 1HNAA 1H75A 4FO5A 4HUAA 3EURA 3WYWA 2EIQA 4X0XA 5D9WA 5AIVA 1TI3A 1SJZA 3EE2A 3KGKA 1V57A 4O32A 3TGZA 4XIHA 2PWJA 1BQ7A 1E2YA 5LD0A 4OO5A 3D5JA 5FHIA 1O85A 4YKGA 4J57E 4LL1B 3HCZA 4Z2TA 2PERA 3DVWA 4BVXA 4KSOA 3EMPA 3L9SA 2C1YA 5JCUA 2GGTA 3TB2A 1VRSD 2XPDA 2OACA 4KSMA 2EC4A 3GRXA 4PNFA 1GSUA 1ABAA 2HZFA 4GQFA 2WJUA 1VF1A 2WCIA 3OR5A 1NSWA 4L5OA 1TW9A 5JCWA 2H76A 1XW6A 4JZQA 2NTOA 5AIXA 2F51A 5IMAA 1BAYA 3RDWA 3C1SA 1PN9A 1BX9A 4ULXA 4E8EA 3GH9A 2CT6A 5ELGA 1X5DA 5COHA 1FAAA 1F3BA 5GSSA 1YQ1A 1F3AA 3N9JA 4BVXB 4MP4A 2R4VA 1GUMA 1DUGA 4I5QA 4XCSA 3HZ4A 4K7IA 1SK0A 2WS2A 1A8LA 3EINA 3FRCA 1W89A 2GT6A 3ZIJA 3EU4A 3BBYA 4XS4A 1QK8A 3QOUA 3TCOA 1J08A 1XG8A 1HNBA 3C73A 1Z3EA 2P0GA 3HVXA 2V2GA 2GSQA 4PURA 4MDCA 4CHSA 3L78A 3O6TA 3QAVA 2YOIA 2KHPA 1VF4A 4K7NA 3IHGA 2MMNA 2GQKA 4ECCA 2FWHA 2VCZA 2L5LA 3UAPA 3IPZA 3D21A 4XS1A 3O3TA 3GN3A 5IOXA 1YJ6A 1THXA 2K8SA 1M99A 4NHZA 4O5UA 1LBKA 2O8VB 1HNCA 3H4KA 2DMMA 3WT1A 4FQUA 4OFNA 5JWOB 4IQAA 2VL3A 2ON5A 2DJ0A 3GKNA 3RHCA 1GLQA 2FD3A 1U88A 2VM2A 3LQ7A 1TTZA 4K5SA 1GSQA 1AQXA 1VF2A 1PX7A 3TUEA 2OJLA 4K2XA 3TOUA 1SKSB 4HOJA 2VL9A 4PNGA 1FG4A 1DE1A 2LNSA 5DJLA 3BCKA 2KP2A 2EIRA 4YAVA 3BJ5A 1FO5A 4IP6A 4TW5A 2M46A 3I43A 2D2ZA 2DJ3A 2IMKA 4A5PA 1ZYEA 1N2AA 4MMMA 5GAND 5D73A 2GZYA 1Z9HA 4OFTA 4TKYA 4WKWA 3HZ8A 1U3IA 2DLXA 1FW1A 5H5SA 5JCGA 1ERWA 3G9BA 3UL3A 2LUSA 3IR4A 4FYCA 5JWQB 2CAQA 3F9UA 1YY7A 1PKWA 2IPAA 4RUVA 4WF4A 3IBHA 1SK1A 3R2QA 5GSTA 1UA5A 3CMIA 2IMFA 2OA7A 18GSA 1TOFA 5ELAA 2MZCA 2P31A 1B4QA 2H01A 2R0CA 4JR6A 2WZ9A 1M3JA 2HFDA 2KLXA 3GTUA 2O89A 2G2QA 1KNGA 5DDLA 2FWEA 1CQHA 3ISOA 4KCEA 5E59A 4JU5A 4TXVA 2B5EA 2C8UA 4GXZA 2OBKA 3VWXA 1V58A 1WPIA 1JHBA 4MNNA 2M72A 5IOWA 3W8JA 1CQGA 3WGXA 4F9ZA 1ON4A 5CRWA 3ZTLA 12GSA 1K0MA 4MPGA 5ECLB 3CSJA 2K9FA 2RUEA 4IELA 1V2AA 1K0NA 3LEFA 3ME7A 2L57A 4ICYA 4K6XA 3ZMLA 2LEGA 5BMUA 2LJRA 5DAKA 1EEJA 2WDUA 5G1LA 2C3TA 1TK0B 2HRAA 2LS5A 3GTUB 4DSSA 2LKUA 3KZQA 4USSA 4IJ3A 4WR4A 2YPMA 5E4WA 1MDKA 2X99A 1WRYA 4OCFA 1TKDB 1GTAA 1XFLA 1U87A 1A8YA 4MZCA 4LMVA 3LG6A 3TKSA 1I5GA 5B6MA 4KGIA 5CRHA 1XW5A 1GTUA 3L0HA 1K3YA 2GZZA 5BRTA 2E0QA 3TJJA 6GSYA 3UMAA 4I2TA 1GTBA 2H30A 5KN1A 1M9BA 4Q5QA 3F3RA 1WP0A 2C0GA 5DAKB 2OE1A 5H5RA 5ECRB 2FA4A 1ML6A 4YH2A 2H0GA 1RW1A 2GZPA 5HR3A 3GFKA 4G19A 2C4JA 1O81A 14GSA 3IAM2 1GNWA 1GULA 1KBNA 1T3BA 4I2UA 2WULA 1MDIA 1Z6NA 1Z5YE 3HJMA 1U6TA 4TR3A 1TI1A 1R4WA 2R37A 4XRAA 1EOHA 2H8LA 3QFBC 4TXOA 3LGCA 2K18A 4N10A 1GLPA 1TU7A 1XOBA 3ZRDA 3F63A 3L9UA 3GHAA 3LORA 4KA0A 5IMFA 3RPNA 4EDYA 2I9HA 4WBJA 5EVOA 1TDIA 2F8AA 3GL5A 1RQMA 4X1UA 5D93A 1IYIA 1JZOA 5IMDA 2BTOT 4DEJA 2HXKA 2C3NA 5IQYA 3QCPA 2FWGA 2A4HA 1F2EA 4LMWA 1JFUA 1YZXA 4XS6A 4AJ8A 4KE3A 2IFQA 3TKQA 1YEXA 2CQ9A 2VLVA 9GSSA 3GURA 1ST9A 2TRXA 4IN0A 3TKSE 2VD0A 4ZB8A 3KMNA 5KOWA 2H6YA 3HJOA 3ZITA 1EV4A 3MYDA 5ECPB 1Y25A 4TXOB 1I9DA 1PN0A 1X9MB 3ZZXA 1BYEA 5GAPD 2H71A 3HDCA 3A2XA 1YKAA 2WFCA 3UJ1A 4IS0A 3ED3A 1J9BA 3ERFA 2TRCP 1S3CA 5AISA 3W6GA 3KH9A 3IC4A 2CV4A 4TN8A 1ZZYA 2YJ7A 4OD7A 4POKA 1EP7A 3FK8A 5HR0A 2LRNA 2IFQB 4KDUA 1XCCA 5EPFA 5IMVA 2DKIA 1R5PA 5ECHB 4RQXA 1YKCA 4WR5A 2QKEA 1FVKA 2MMZA 3C1RA 2NVLA 3TKSC 1VF3A 4I6XA 3JCML 2F3MA 3NZNA 1R7HA 10GSA 4RI7A 3EWLA 2MBSA 1GL8A 1XIYA 4ZL8A 2GSTA 2IL3A 3F4SA 1DE2A 1OC8A 4POBA 5IPGA 3KXOA 4NPBA 2LQOA 3IOSA 5B6NA 2MYGA 2H1BA 3CTFA 5AN1A 2KP1A 4EF0A 1F37A 3LYPA 2R2JA 3L4NA 3FKFA 5AGYA 2GT5A 5ECIB 3PINA 1X5CA 5CO3A 2BJXA 1AIUA 3GH6A 2RUFA 1PX6A 4NXIA 5J9CA 3A5WA 3MDKA 3KP9A 2JL4A 3TRXA 5IO0A 1X9WB 1ZYPA 6GSXA 1PFOA 5CRDA 2YV7A 3KM6A 4KB3A 4V1Ag 1ACVA 1IYHA 4IP1A 4L0WA 5HFKA 2R0GA 4BL7B 1EP8A 2TIRA 1M9AA 4HJ2A 5A5KA 2GSRA 1DSBA 2DJ2A 4G0LA 1K0CA 1S3DA 4WEYA 1V40A 3CSHA 2VIMA 4HI7A 3S9FA 4H86A 4Z7XA 4L5LA 2LRTA 4DVCA 5EL8A 1WJKA 2IMDA 3VWWA 2B1KA 4P3YB 3KJYA 2FLSA 2OBIA 1MEKA 4IGJA 4Q5FA 4PUFC 1Q4JA 2B7KA 3F3QA 3E9JB 2B5XA 4HJMA 5J9BA 1AAZA 3VI7A 2JZSA 1PL2A 22GSA 1SL0B 2L4QA 4Z2RA 5ECNB 3LWAA 3ZFLA 4K1FA 3MIXA 3QR6A 2HZEA 3CYNA 3GKMA 4MF5A 4DSQA 2N5AA 3U6VA 3UEMA 5J3RA 5HFIA 7GSSA 3LW9A 1XW9A 4I8BA 8GSSA 2DSAA 2GTUA 1BG5A 3MWHA 4MJEA 5F06A 2R5GA 3QFAC 2CVKA 4ZBAA 4WETA 2P5RA 2HSMA 4PQ1A 3ZREA 4J56E 2X8GA 3ZMKA 2XC2A 1EV9A 2OADA 2B3SA 4IVFA 2O85A 1JZRA 5KEJA 2XBQA 4GQCA 4F0CA 6GSUA 4XRDA 4K8MA 4OCEA 1W4VA 1XPVA 2AUVA 5ENUA 2H66A 2IMEA 2Z9SA 4KDYA 2V6KA 3FYGA 4D73A 4YQUA 1ILOA 2HZEB 5LCZA 4GSTA 4HU9A 4KCAA 2ALBA 5F0GA 2I81A 3ERGA 1R26A 2VUPA 2VCWA 3FR6A 2L59A 1A0RP 1XXUA 1J0FA 3FZ9A 4O5RA 1OKDA 4MH2A 4BPYA 2X4AA 2C80A 2HSHA 2B7JA 3FR3A 3CQFA 4PTSA 5G31A 2DKHA 1SL2B 2C0DA 1TU8A 4JR4A 3ZFBA 2YP6A 4F03A 4GLTA 3HVSA 2O7KA 2YZUA 3RAZA 1PMTA 4D73B 1YDKA 5LNKe 2VCVA 4F82A 4HZ2A 4CY6A 4X4JA 2AV4A 3HXSA 2LV3A 3KMOA 1SL1B 3PPUA 2YNXA 4EO3A 3EMXA 1QUWA 1TRWA 4MZWA 1K0BA 5D9VA 2MMAA 1XVQA 2J9HA 5KN0A 2QA2A 4PQHA 2L6DA 2IN3A 3P90A 3ERWA 3F4RA 3HJPA 1O6JA 1A24A 2FA8A 5ECSA 2LNTA 2JACA 3FZAA 3EYTA 1XWGA 1QXHA 3LXTA 2K6VA 1OC9A 2H0IA 1Z6MA 3LSZA 2LQQA 3U5RE 4I97A 4ZB6A 1K0OA 2OE0A 2K8VA 2R3XA 3D6IA 3VI5A 4ACSA 5B7CA 2AJQB 3DMLA 3HVNA 1X5EA 3GX8A 4MLYA 3P8WA 3M8NA 1TK5B 2H73A 2HE3A 4ZB9A 3NOFA 1Q98A 1PL1A 1A2JA 4GCIA 2CVBA
chains in the Genus database with same CATH topology
4HQSA 1AQVA 3D4TA 3FHKA 2QA1A 2GVPA 4JBBA 3TDGA 3H8QA 3LYKA 2QSIA 1JLVA 3BCIA 3APQA 1GP1A 4G10A 1OC9B 4V1Ap 5HR1A 1R5AA 5FWGA 2DIZA 3WGDA 4TRXA 1THOA 2REMA 1GSSA 4EL1A 5CAXA 2RLIA 2PU9C 3KP8A 1K0AA 1ZGNA 3GV1A 1FOVA 4IBPA 3M9JA 2FY6A 4IW9A 1T7PB 1TK8B 4ISDA 3IRAA 2IWTA 4IKHA 1G7OA 1F6MC 3EU3A 2J23A 1HQOA 4EE0A 4EDZA 3IK7A 2KOKA 5CYYA 2HI7A 1OYJA 4HDEA 2JU5A 4XHMA 1B4PA 4KF9A 1GSFA 2VCXA 3N5OA 4EXJA 4DSRA 5F8BA 2GSSA 2PBJA 1XZOA 2JADA 3I69A 2YV9A 2WB9A 4QL7A 1PRXA 2HNLA 3O76A 3K8NA 5EY6A 2BMXA 3IC8A 2HRFA 2A2SA 1PGTA 3APOA 2PPTA 4N0ZA 3TKPA 5ECQB 1H4OA 1GSDA 2V41A 2FUG2 4K5RA 3LJRA 5F07A 5L71A 4JEDA 1PQNA 1K3OA 2HRKA 5D8IA 5ECMB 1XWBA 2AB6A 2CZ3A 3UVHA 2JZRA 3FY7A 1WMJA 4ZILA 4F2IA 3DIEA 5CNWA 2FWFA 4PXOA 1FB0A 3DKSA 16GSA 4E8HA 1TJDA 3DGQA 6GSSA 2RM5A 19GSA 1WWJA 1EOGA 5IO2A 3HA9A 4CW9A 4N11A 3CRUA 1GH2A 3ZVJD 2G0FA 5D96A 4ZBDA 5F05A 1EGOA 1YF0A 2AYTA 2QC7A 1AQWA 3CTGA 4YAPA 4O5QA 4MJAA 2MBTA 3KEBA 2EIOA 1A0FA 1T00A 2YWIA 1SD9A 2E2MA 4KNDA 1M0UA 1QMVA 2H19A 4WF5A 3W8SA 1T1VA 3VWUA 3FEUA 5G5EA 2H1DA 3MSZA 1V98A 3RBTA 4ZIJA 1M2BA 2N5FA 2YCDA 3DYRA 2HT9A 2LRCA 2C0FA 3C71A 3RHBA 1UC7A 2PVQA 1ZYQB 1KEBA 1GWCA 1ERVA 2PMTA 4MPFA 4TR4A 1T8EB 3GL3A 2CX3A 4POMA 4BVYB 3D22A 5H5QA 5D9TA 3A2WA 2I4AA 3NIVA 3VFIA 4K0NA 2V32A 4ML1A 5ABRA 3L9VA 2V6OA 2X49A 1PKZA 2NBSA 3ZL5A 4TR1A 1OVNA 2LJAA 3FZ5A 5D9XA 5IMCA 4Z2UA 3QAWA 3E0UA 2N5BA 4X43A 2H74A 3IDVA 5G5FA 1SU9A 3LFLA 1AW9A 3M9KA 2HLSA 2B6MA 3ZYWA 1GTIA 1SD8A 4F0BA 11GSA 1SJ6A 2A2PA 3VPQA 4ILFA 4BL7A 3TJKA 3BD2A 1EZKA 2O87A 4YQVA 2GS3A 4FIWA 4QL9A 2VCTA 5IMZA 1LJRA 4YKFA 4XTSA 3ZVJA 1EWXA 4TR1B 1A23A 3QDNA 3G7IA 2ES7A 1USBA 1Y6EA 1VGLA 2XPEA 1T4YA 2B1LA 4ZXGA 3VK9A 5IM9A 4MJBA 2H72A 4IJIA 2M80A 5DJMA 2UZ8A 3HHVA 2GLRA 1HD2A 1JZWA 3VWVA 4AF2A 5J5NA 2DJJA 3J7Yk 2IIYA 2DMLA 1TXXA 5G2ZA 1SKRB 1O73A 4AJ7A 1XWCA 3TRQA 4ECBA 3DXBA 3IK9A 2YJHA 5CRGA 2OKAA 3AY8A 5A4UA 2FGXA 5IIZA 2C3QA 4JE1A 4K7OA 4NV5A 3F8UA 4EIPA 3VLNA 2PUKC 1C72A 2VM1A 3D0ZA 2VD1A 3C7MA 1BJXA 4HQZA 4J2FA 3MAKA 3EVIA 1ERUA 3IA1A 1V9WA 5FT3A 2HSYA 2HYXA 5ECOB 1WOUA 3DD3A 2YZHA 2DC5A 3VURA 1YF1A 1GUKA 1O7UA 1U3AA 2ZCTA 2H75A 1O8WA 4V2MA 5CREA 5CP1A 2FCHA 5A4VA 3VPTA 3I9V2 3GKKA 3UBLA 1TP9A 4KDXA 4IHUA 3FW2A 1DBYA 5G30A 2CZ2A 1XOAA 2YANA 5C04A 2L5OA 4EUYA 4MZBA 2IJYA 1ERTA 1QQ2A 2VLTA 1OAZA 1E6BA 4ID0A 1GRXA 4L8EA 1AXDA 2JSZA 2LTKA 4TOPA 5DCHA 3HYPA 4TR0A 2PVOC 5DVBA 1G0TA 3F6FA 1JLWA 1AUCA 5G1KA 3ZIVA 1OKTA 3G7YA 3APSA 2PN8A 4KH7A 4PGTA 3M0FA 1FOHA 4MCUA 5ECKB 4GSNA 5DQSA 4ECIA 3H93A 2F8FA 4CDOA 5DALA 3D4MA 3QMXA 5HQPA 2L4CA 2C0EA 3CSIA 3EPTA 3UIWA 3A5IA 3KH7A 5KOXA 3SWLA 4OO4A 4GWRA 3KTBA 1LU4A 4OFMA 3C8EA 1PSQA 3WD6A 1B9YC 1SYXA 4BA7A 4GF0A 1RK4A 1BEDA 1K0DA 3UVTA 2VL2A 4EIQA 4XS4B 4N30A 1GNEA 2DJKA 3CBUA 3DVXA 1QFNA 1Z7PA 3M3MA 1M2AA 4G9HA 4BWQA 3QAGA 4TVEA 1GSYA 4LLRA 4K0GA 3GA4A 5DALB 1G7EA 6GSVA 4WBRD 1OE7A 1NHYA 3GIXA 17GSA 3GUSA 2H1GA 1WE0A 4MF6A 6GSTA 4AJ6A 1URMA 3E3EA 2WRTA 3H1NA 2X8CA 3CXGA 5GZZB 4L0UA 4V2NA 1FHEA 2YWOA 1KTEA 1AC1A 5IPHA 1TRVA 3UOMA 1XVWA 1UN2A 4MA9A 2V1MA 3GSSA 3IAS2 3HVVA 4FH8A 1FB6A 3F0IA 2CVDA 1SK2A 2VOCA 4OMVA 3PGTA 1GUHA 1MDJA 3SBCA 2AAWA 4RI6A 2DBCA 3WGEA 4NV2A 3GSTA 3M1GA 3KD0A 4KX4A 4WXTA 4PUAA 2H6XA 5INYA 1F9MA 5KN3A 2R0PA 2NPBA 2JSYA 3FR9A 1B9XC 2X8HA 1ZCPA 3KIJA 2FHEA 3GNJA 3LXZA 4NWYA 1M2DA 3DWVA 3TKRA 1Z7RA 4FYBA 4FYUA 1SENA 4PQIA 2YWMA 2H0HA 3P2AA 1MD3A 1A2LA 3TJFA 5ID2A 2PGTA 2IMIA 3MNGA 4NAXA 2F9SA 13GSA 4KAEA 3TRPA 4POLA 5DQYA 3Q18A 4K2DA 3DRNA 1ZYNA 3FMWA 1A2MA 3DEXA 1NW2A 3A3TA 4ECJA 2YWNA 2RIIA 4LA1A 2HRNA 1QGVA 4O92A 2H70A 1FVJA 1G6WA 3HY2A 1TRUA 3GKXA 2P5QA 2CAIA 2X64A 1M7TA 3GYKA 2AHEA 5B8AA 2VL2C 3IXRA 1YEPA 3J7Yb 5DCGA 3EC3A 1T4ZA 2VLUA 3QPMA 4MK3A 2MMOA 4EVMA 5ID2B 3F4TA 4RQRA 2H1AA 4ZL7A 4ML6A 5KN2A 5JWRB 6GSWA 5B8BA 4ZBBA 1SYRA 1PA3A 3QD9A 3RPPA 3H79A 2GQMA 4EKZA 1XWAA 1TRSA 1UVZA 4QQ7A 2XHFA 4OWYA 1GSEA 2LSTA 1XBSA 2ZUPA 2KUCA 4YQMA 4IQ1A 5J41A 2R6KA 4Q5NA 1S3AA 3ME8A 2GDRA 4NHWA 4N0VA 5HFGA 1EEMA 1X9SB 1XWKA 4DSSB 4BVYA 4MF7A 2GQLA 3BOAA 2WGRA 1ZMAA 2CA8A 3G7JA 2L6CA 4G0KA 3TJBA 4GTUA 2H6ZA 1SKWB 2E7PA 1ZOFA 2VAFA 1PD21 1MTCA 3A2VA 4Q5RA 3P7XA 4MABA 3TOTA 3Q19A 4HZ4A 4KW6A 3FZ4A 3PH9A 2VCQA 2FNOA 1B48A 2A2RA 3IHQA 3WT2A 4CY8A 2RM6A 4NMUA 2OE3A 4K9ZA 3GMFA 1WIKA 4MJCA 1K3LA 2DIYA 4O7HA 3UARA 4EC0A 1EGRA 3IE3A 3R3EA 1X0RA 4G0IA 3Q6OA 4PX1A 2I3YA 3US3A 2NDOA 1O8XA 5DBQA 1NM3A 2YN1A 3V1WA 2VO4A 3HKRA 3TJGA 4KUNA 1MD4A 1JZDA 4V2LA 2B5YA 3IV4A 5J4UA 4HU7A 4LL4B 4BWSA 2A4VA 3I6AA 5C00A 4JRRA 1N8JA 3ZLPA 3KTLA 2ON7A 2XBIA 4HS1A 20GSA 3GX0A 1OC3A 4HEA2 3HD5A 1B8XA 3KCMA 2E2GA 3F6DA 4G2EA 1HYUA 4GRFA 5HR2A 1OE8A 4AGSA 3UBKA 1G6YA 4MH3A 2QGVA 2I1UA 1SJIA 3PR8A 1ZL9A 1NHOA 3Q74A 2LJKA 3CRTA 5A4WA 2CX4A 2JZTA 2ZNMA 4ZL9A 4GSSA 2DJ1A 1HNAA 1H75A 4FO5A 4HUAA 3EURA 3WYWA 2EIQA 4X0XA 5D9WA 5AIVA 1TI3A 1SJZA 3EE2A 3KGKA 1V57A 4O32A 3TGZA 4XIHA 2PWJA 1BQ7A 1E2YA 5LD0A 4OO5A 3D5JA 5FHIA 1O85A 4YKGA 4J57E 4LL1B 3HCZA 4Z2TA 2PERA 3DVWA 4BVXA 4KSOA 3EMPA 3L9SA 2C1YA 5JCUA 2GGTA 3TB2A 1VRSD 2XPDA 2OACA 4KSMA 2EC4A 3GRXA 4PNFA 1GSUA 1ABAA 2HZFA 4GQFA 2WJUA 1VF1A 2WCIA 3OR5A 1NSWA 4L5OA 1TW9A 5JCWA 2H76A 1XW6A 4JZQA 2NTOA 5AIXA 2F51A 5IMAA 1BAYA 3RDWA 3C1SA 1PN9A 1BX9A 4ULXA 4E8EA 3GH9A 2CT6A 5ELGA 1X5DA 5COHA 1FAAA 1F3BA 5GSSA 1YQ1A 1F3AA 3N9JA 4BVXB 4MP4A 2R4VA 1GUMA 1DUGA 4I5QA 4XCSA 3HZ4A 4K7IA 1SK0A 2WS2A 1A8LA 3EINA 3FRCA 1W89A 2GT6A 3ZIJA 3EU4A 3BBYA 4XS4A 1QK8A 3QOUA 3TCOA 1J08A 1HNBA 3C73A 1Z3EA 2P0GA 3HVXA 2V2GA 2GSQA 4PURA 4MDCA 4CHSA 3L78A 3O6TA 3QAVA 2YOIA 2KHPA 1VF4A 4K7NA 3IHGA 2MMNA 2GQKA 4ECCA 2FWHA 2VCZA 2L5LA 3UAPA 3IPZA 3D21A 4XS1A 3O3TA 3GN3A 5IOXA 1YJ6A 1THXA 2K8SA 1M99A 4NHZA 4O5UA 1LBKA 2O8VB 1HNCA 3H4KA 2DMMA 3WT1A 4FQUA 4OFNA 5JWOB 4IQAA 2VL3A 2ON5A 2DJ0A 3GKNA 3RHCA 1GLQA 2FD3A 1U88A 2VM2A 3LQ7A 1TTZA 4K5SA 1GSQA 1AQXA 1VF2A 1PX7A 3TUEA 2OJLA 4K2XA 3TOUA 1SKSB 4HOJA 2VL9A 4PNGA 1FG4A 1DE1A 2LNSA 5DJLA 3BCKA 2KP2A 2EIRA 4YAVA 3BJ5A 1FO5A 4IP6A 4TW5A 2M46A 3I43A 2D2ZA 2DJ3A 2IMKA 4A5PA 1ZYEA 1N2AA 4MMMA 5GAND 5D73A 2GZYA 1Z9HA 4OFTA 4TKYA 4WKWA 3HZ8A 1U3IA 2DLXA 1FW1A 5H5SA 5JCGA 1ERWA 3G9BA 3UL3A 2LUSA 3IR4A 4FYCA 5JWQB 2CAQA 3F9UA 1YY7A 1PKWA 2IPAA 4RUVA 4WF4A 3IBHA 1SK1A 3R2QA 5GSTA 1UA5A 3CMIA 2IMFA 2OA7A 18GSA 1TOFA 5ELAA 2MZCA 2P31A 1B4QA 2H01A 2R0CA 4JR6A 2WZ9A 2HFDA 2KLXA 3GTUA 2O89A 2G2QA 1KNGA 5DDLA 2FWEA 1CQHA 3ISOA 4KCEA 5E59A 4JU5A 4TXVA 2B5EA 2C8UA 4GXZA 2OBKA 3VWXA 1V58A 1WPIA 1JHBA 4MNNA 2M72A 5IOWA 3W8JA 1CQGA 3WGXA 4F9ZA 1ON4A 5CRWA 3ZTLA 12GSA 1K0MA 4MPGA 5ECLB 3CSJA 2K9FA 2RUEA 4IELA 1V2AA 1K0NA 3LEFA 3ME7A 2L57A 4ICYA 4K6XA 3ZMLA 2LEGA 5BMUA 2LJRA 5DAKA 1EEJA 2WDUA 5G1LA 2C3TA 1TK0B 2HRAA 2LS5A 3GTUB 4DSSA 2LKUA 3KZQA 4USSA 4IJ3A 4WR4A 2YPMA 5E4WA 1MDKA 2X99A 1WRYA 4OCFA 1TKDB 1GTAA 1XFLA 1U87A 1A8YA 4MZCA 4LMVA 3LG6A 3TKSA 1I5GA 5B6MA 4KGIA 5CRHA 1XW5A 1GTUA 3L0HA 1K3YA 2GZZA 5BRTA 2E0QA 3TJJA 6GSYA 3UMAA 4I2TA 1GTBA 2H30A 5KN1A 1M9BA 4Q5QA 3F3RA 1WP0A 2C0GA 5DAKB 2OE1A 5H5RA 5ECRB 2FA4A 1ML6A 4YH2A 2H0GA 1RW1A 2GZPA 5HR3A 3GFKA 4G19A 2C4JA 1O81A 14GSA 3IAM2 1GNWA 1GULA 1KBNA 1T3BA 4I2UA 2WULA 1MDIA 1Z6NA 1Z5YE 3HJMA 1U6TA 4TR3A 1TI1A 1R4WA 2R37A 4XRAA 1EOHA 2H8LA 3QFBC 4TXOA 3LGCA 2K18A 4N10A 1GLPA 1TU7A 1XOBA 3ZRDA 3F63A 3L9UA 3GHAA 3LORA 4KA0A 5IMFA 3RPNA 4EDYA 2I9HA 4WBJA 5EVOA 1TDIA 2F8AA 3GL5A 1RQMA 4X1UA 5D93A 1IYIA 1JZOA 5IMDA 2BTOT 4DEJA 2HXKA 2C3NA 5IQYA 3QCPA 2FWGA 2A4HA 1F2EA 4LMWA 1JFUA 1YZXA 4XS6A 4AJ8A 4KE3A 2IFQA 3TKQA 1YEXA 2CQ9A 2VLVA 9GSSA 3GURA 1ST9A 2TRXA 4IN0A 3TKSE 2VD0A 4ZB8A 3KMNA 5KOWA 2H6YA 3HJOA 3ZITA 1EV4A 3MYDA 5ECPB 1Y25A 4TXOB 1I9DA 1PN0A 1X9MB 3ZZXA 1BYEA 5GAPD 2H71A 3HDCA 3A2XA 1YKAA 2WFCA 3UJ1A 4IS0A 3ED3A 1J9BA 3ERFA 2TRCP 1S3CA 5AISA 3W6GA 3KH9A 3IC4A 2CV4A 4TN8A 1ZZYA 2YJ7A 4OD7A 4POKA 1EP7A 3FK8A 5HR0A 2LRNA 2IFQB 4KDUA 1XCCA 5EPFA 5IMVA 2DKIA 1R5PA 5ECHB 4RQXA 1YKCA 4WR5A 2QKEA 1FVKA 2MMZA 3C1RA 2NVLA 3TKSC 1VF3A 4I6XA 3JCML 2F3MA 3NZNA 1R7HA 10GSA 4RI7A 3EWLA 2MBSA 1GL8A 1XIYA 4ZL8A 2GSTA 2IL3A 3F4SA 1DE2A 1OC8A 4POBA 5IPGA 3KXOA 4NPBA 2LQOA 3IOSA 5B6NA 2MYGA 2H1BA 3CTFA 5AN1A 2KP1A 4EF0A 1F37A 3LYPA 2R2JA 3L4NA 3FKFA 5AGYA 2GT5A 5ECIB 3PINA 1X5CA 5CO3A 2BJXA 1AIUA 3GH6A 2RUFA 1PX6A 4NXIA 5J9CA 3A5WA 3MDKA 3KP9A 2JL4A 3TRXA 5IO0A 1X9WB 1ZYPA 6GSXA 5CRDA 2YV7A 3KM6A 4KB3A 4V1Ag 1ACVA 1IYHA 4IP1A 4L0WA 5HFKA 2R0GA 4BL7B 1EP8A 2TIRA 1M9AA 4HJ2A 5A5KA 2GSRA 1DSBA 2DJ2A 4G0LA 1K0CA 1S3DA 4WEYA 1V40A 3CSHA 2VIMA 4HI7A 3S9FA 4H86A 4Z7XA 4L5LA 2LRTA 4DVCA 5EL8A 1WJKA 2IMDA 3VWWA 2B1KA 4P3YB 3KJYA 2FLSA 2OBIA 1MEKA 4IGJA 4Q5FA 4PUFC 1Q4JA 2B7KA 3F3QA 3E9JB 2B5XA 4HJMA 5J9BA 1AAZA 3VI7A 2JZSA 1PL2A 22GSA 1SL0B 2L4QA 4Z2RA 5ECNB 3LWAA 3ZFLA 4K1FA 3MIXA 3QR6A 2HZEA 3CYNA 3GKMA 4MF5A 4DSQA 2N5AA 3U6VA 3UEMA 5J3RA 5HFIA 7GSSA 3LW9A 1XW9A 4I8BA 8GSSA 2DSAA 2GTUA 1BG5A 3MWHA 4MJEA 5F06A 2R5GA 3QFAC 2CVKA 4ZBAA 4WETA 2P5RA 2HSMA 4PQ1A 3ZREA 4J56E 2X8GA 3ZMKA 2XC2A 1EV9A 2OADA 2B3SA 4IVFA 2O85A 1JZRA 5KEJA 2XBQA 4GQCA 4F0CA 6GSUA 4XRDA 4K8MA 4OCEA 1W4VA 1XPVA 2AUVA 5ENUA 2H66A 2IMEA 2Z9SA 4KDYA 2V6KA 3FYGA 4D73A 4YQUA 1ILOA 2HZEB 5LCZA 4GSTA 4HU9A 4KCAA 2ALBA 5F0GA 2I81A 3ERGA 1R26A 2VUPA 2VCWA 3FR6A 2L59A 1A0RP 1XXUA 1J0FA 3FZ9A 4O5RA 1OKDA 4MH2A 4BPYA 2X4AA 2C80A 2HSHA 2B7JA 3FR3A 4PTSA 5G31A 2DKHA 1SL2B 2C0DA 1TU8A 4JR4A 3ZFBA 2YP6A 4F03A 4GLTA 3HVSA 2O7KA 2YZUA 3RAZA 1PMTA 4D73B 1YDKA 5LNKe 2VCVA 4F82A 4HZ2A 4CY6A 4X4JA 2AV4A 3HXSA 2LV3A 3KMOA 1SL1B 3PPUA 2YNXA 4EO3A 3EMXA 1QUWA 1TRWA 4MZWA 1K0BA 5D9VA 2MMAA 1XVQA 2J9HA 5KN0A 2QA2A 4PQHA 2L6DA 2IN3A 3P90A 3ERWA 3F4RA 3HJPA 1O6JA 1A24A 2FA8A 5ECSA 2LNTA 2JACA 3FZAA 3EYTA 1XWGA 1QXHA 3LXTA 2K6VA 1OC9A 2H0IA 1Z6MA 3LSZA 2LQQA 3U5RE 4I97A 4ZB6A 1K0OA 2OE0A 2K8VA 2R3XA 3D6IA 3VI5A 4ACSA 5B7CA 2AJQB 3DMLA 1X5EA 3GX8A 4MLYA 3P8WA 3M8NA 1TK5B 2H73A 2HE3A 4ZB9A 3NOFA 1Q98A 1PL1A 1A2JA 4GCIA 2CVBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HQS A;  1AQV A;  3D4T A;  3FHK A;  2GVP A;  4JBB A;  3TDG A;  3H8Q A;  3LYK A;  2QSI A;  1JLV A;  3BCI A;  3APQ A;  1GP1 A;  4G10 A;  1OC9 B;  4V1A p;  5HR1 A;  1R5A A;  5FWG A;  2DIZ A;  3WGD A;  4TRX A;  1THO A;  2REM A;  1GSS A;  4EL1 A;  5CAX A;  2RLI A;  2PU9 C;  3KP8 A;  1K0A A;  1ZGN A;  3GV1 A;  1FOV A;  4IBP A;  3M9J A;  2FY6 A;  4IW9 A;  1T7P B;  1TK8 B;  4ISD A;  3IRA A;  2IWT A;  4IKH A;  1G7O A;  1F6M C;  3EU3 A;  2J23 A;  1HQO A;  4EE0 A;  4EDZ A;  3IK7 A;  2KOK A;  5CYY A;  2HI7 A;  1OYJ A;  4HDE A;  2JU5 A;  4XHM A;  1B4P A;  1GSF A;  2VCX A;  3N5O A;  4EXJ A;  4DSR A;  5F8B A;  2GSS A;  2PBJ A;  1XZO A;  2JAD A;  3I69 A;  2YV9 A;  2WB9 A;  4QL7 A;  1PRX A;  2HNL A;  3O76 A;  3K8N A;  5EY6 A;  2BMX A;  2HRF A;  2A2S A;  1PGT A;  3APO A;  2PPT A;  4N0Z A;  3TKP A;  5ECQ B;  1H4O A;  1GSD A;  2V41 A;  2FUG 2;  3LJR A;  5F07 A;  5L71 A;  4JED A;  1PQN A;  1K3O A;  5D8I A;  5ECM B;  1XWB A;  2AB6 A;  2CZ3 A;  3UVH A;  2JZR A;  3FY7 A;  1WMJ A;  4ZIL A;  4F2I A;  3DIE A;  5CNW A;  2FWF A;  4PXO A;  1FB0 A;  3DKS A;  16GS A;  4E8H A;  1TJD A;  3DGQ A;  6GSS A;  2RM5 A;  19GS A;  1WWJ A;  1EOG A;  5IO2 A;  3HA9 A;  4CW9 A;  4N11 A;  3CRU A;  1GH2 A;  3ZVJ D;  2G0F A;  5D96 A;  4ZBD A;  5F05 A;  1EGO A;  1YF0 A;  2AYT A;  2QC7 A;  1AQW A;  3CTG A;  4YAP A;  4MJA A;  2MBT A;  3KEB A;  2EIO A;  1A0F A;  1T00 A;  2YWI A;  1SD9 A;  2E2M A;  4KND A;  1M0U A;  1QMV A;  2H19 A;  4WF5 A;  3W8S A;  1T1V A;  3VWU A;  3FEU A;  5G5E A;  2H1D A;  3MSZ A;  1V98 A;  3RBT A;  4ZIJ A;  1M2B A;  2N5F A;  2YCD A;  3DYR A;  2HT9 A;  2LRC A;  2C0F A;  3C71 A;  3RHB A;  1UC7 A;  2PVQ A;  1ZYQ B;  1KEB A;  1GWC A;  1ERV A;  2PMT A;  4MPF A;  4TR4 A;  1T8E B;  3GL3 A;  2CX3 A;  4POM A;  3D22 A;  5H5Q A;  5D9T A;  3A2W A;  2I4A A;  3NIV A;  3VFI A;  4K0N A;  2V32 A;  4ML1 A;  5ABR A;  3L9V A;  2V6O A;  1PKZ A;  2NBS A;  3ZL5 A;  4TR1 A;  1OVN A;  2LJA A;  3FZ5 A;  5D9X A;  5IMC A;  3QAW A;  3E0U A;  2N5B A;  4X43 A;  2H74 A;  3IDV A;  5G5F A;  1SU9 A;  3LFL A;  1AW9 A;  3M9K A;  2HLS A;  2B6M A;  3ZYW A;  1GTI A;  1SD8 A;  4F0B A;  11GS A;  1SJ6 A;  3VPQ A;  4ILF A;  4BL7 A;  3TJK A;  3BD2 A;  1EZK A;  2O87 A;  4YQV A;  2GS3 A;  4FIW A;  4QL9 A;  2VCT A;  5IMZ A;  1LJR A;  4XTS A;  3ZVJ A;  1EWX A;  4TR1 B;  1A23 A;  3QDN A;  3G7I A;  2ES7 A;  1USB A;  1Y6E A;  1VGL A;  2XPE A;  1T4Y A;  2B1L A;  4ZXG A;  3VK9 A;  5IM9 A;  4MJB A;  2H72 A;  4IJI A;  2M80 A;  5DJM A;  3HHV A;  2GLR A;  1HD2 A;  1JZW A;  3VWV A;  4AF2 A;  5J5N A;  2DJJ A;  3J7Y k;  2IIY A;  2DML A;  1TXX A;  5G2Z A;  1SKR B;  1O73 A;  4AJ7 A;  1XWC A;  3TRQ A;  4ECB A;  3DXB A;  3IK9 A;  2YJH A;  5CRG A;  2OKA A;  3AY8 A;  5A4U A;  2FGX A;  5IIZ A;  2C3Q A;  4JE1 A;  4K7O A;  4NV5 A;  3F8U A;  3VLN A;  2PUK C;  1C72 A;  2VM1 A;  3D0Z A;  2VD1 A;  3C7M A;  1BJX A;  4HQZ A;  4J2F A;  3MAK A;  3EVI A;  1ERU A;  3IA1 A;  1V9W A;  5FT3 A;  2HSY A;  2HYX A;  5ECO B;  1WOU A;  3DD3 A;  2YZH A;  2DC5 A;  3VUR A;  1YF1 A;  1GUK A;  1O7U A;  1U3A A;  2ZCT A;  2H75 A;  1O8W A;  4V2M A;  5CRE A;  5CP1 A;  2FCH A;  5A4V A;  3VPT A;  3I9V 2;  3GKK A;  3UBL A;  1TP9 A;  4KDX A;  4IHU A;  3FW2 A;  1DBY A;  5G30 A;  2CZ2 A;  1XOA A;  2YAN A;  5C04 A;  2L5O A;  4EUY A;  4MZB A;  2IJY A;  1ERT A;  1QQ2 A;  2VLT A;  1OAZ A;  1E6B A;  4ID0 A;  1GRX A;  4L8E A;  1AXD A;  2JSZ A;  2LTK A;  4TOP A;  5DCH A;  3HYP A;  4TR0 A;  2PVO C;  5DVB A;  1G0T A;  3F6F A;  1JLW A;  1AUC A;  5G1K A;  3ZIV A;  1OKT A;  3G7Y A;  3APS A;  2PN8 A;  4KH7 A;  4PGT A;  3M0F A;  4MCU A;  5ECK B;  4GSN A;  5DQS A;  4ECI A;  3H93 A;  2F8F A;  4CDO A;  5DAL A;  3D4M A;  3QMX A;  5HQP A;  2L4C A;  2C0E A;  3CSI A;  3UIW A;  3KH7 A;  3SWL A;  4OO4 A;  4GWR A;  3KTB A;  1LU4 A;  4OFM A;  3C8E A;  1PSQ A;  3WD6 A;  1B9Y C;  1SYX A;  4BA7 A;  4GF0 A;  1RK4 A;  1BED A;  1K0D A;  3UVT A;  2VL2 A;  4XS4 B;  4N30 A;  1GNE A;  2DJK A;  3CBU A;  3DVX A;  1QFN A;  1Z7P A;  3M3M A;  1M2A A;  4G9H A;  4BWQ A;  3QAG A;  4TVE A;  1GSY A;  4LLR A;  4K0G A;  3GA4 A;  5DAL B;  1G7E A;  6GSV A;  4WBR D;  1OE7 A;  1NHY A;  3GIX A;  17GS A;  3GUS A;  2H1G A;  1WE0 A;  4MF6 A;  6GST A;  4AJ6 A;  1URM A;  3E3E A;  2WRT A;  3H1N A;  2X8C A;  3CXG A;  5GZZ B;  4L0U A;  4V2N A;  1FHE A;  2YWO A;  1KTE A;  1AC1 A;  5IPH A;  1TRV A;  3UOM A;  1XVW A;  1UN2 A;  4MA9 A;  2V1M A;  3GSS A;  3IAS 2;  3HVV A;  4FH8 A;  1FB6 A;  3F0I A;  2CVD A;  1SK2 A;  2VOC A;  4OMV A;  3PGT A;  1GUH A;  1MDJ A;  3SBC A;  2AAW A;  4RI6 A;  2DBC A;  3WGE A;  4NV2 A;  3GST A;  3M1G A;  3KD0 A;  4KX4 A;  4WXT A;  4PUA A;  2H6X A;  5INY A;  1F9M A;  5KN3 A;  2NPB A;  2JSY A;  3FR9 A;  1B9X C;  2X8H A;  1ZCP A;  3KIJ A;  2FHE A;  3GNJ A;  3LXZ A;  4NWY A;  1M2D A;  3DWV A;  3TKR A;  1Z7R A;  4FYB A;  4FYU A;  1SEN A;  4PQI A;  2YWM A;  2H0H A;  3P2A A;  1MD3 A;  1A2L A;  3TJF A;  5ID2 A;  2PGT A;  2IMI A;  3MNG A;  4NAX A;  2F9S A;  13GS A;  4KAE A;  3TRP A;  4POL A;  5DQY A;  3Q18 A;  4K2D A;  3DRN A;  1A2M A;  3DEX A;  1NW2 A;  3A3T A;  4ECJ A;  2YWN A;  2RII A;  4LA1 A;  2HRN A;  1QGV A;  4O92 A;  2H70 A;  1FVJ A;  1G6W A;  3HY2 A;  1TRU A;  3GKX A;  2P5Q A;  2CAI A;  2X64 A;  1M7T A;  3GYK A;  2AHE A;  5B8A A;  2VL2 C;  3IXR A;  1YEP A;  3J7Y b;  5DCG A;  3EC3 A;  1T4Z A;  2VLU A;  3QPM A;  4MK3 A;  2MMO A;  4EVM A;  5ID2 B;  3F4T A;  4RQR A;  2H1A A;  4ZL7 A;  4ML6 A;  5KN2 A;  5JWR B;  6GSW A;  5B8B A;  4ZBB A;  1SYR A;  1PA3 A;  3QD9 A;  3RPP A;  3H79 A;  2GQM A;  4EKZ A;  1XWA A;  1TRS A;  1UVZ A;  4QQ7 A;  2XHF A;  4OWY A;  1GSE A;  2LST A;  1XBS A;  2ZUP A;  2KUC A;  4YQM A;  4IQ1 A;  5J41 A;  2R6K A;  4Q5N A;  1S3A A;  3ME8 A;  2GDR A;  4NHW A;  4N0V A;  5HFG A;  1EEM A;  1X9S B;  1XWK A;  4DSS B;  4BVY A;  4MF7 A;  2GQL A;  3BOA A;  2WGR A;  1ZMA A;  2CA8 A;  3G7J A;  2L6C A;  3TJB A;  4GTU A;  2H6Z A;  1SKW B;  2E7P A;  1ZOF A;  2VAF A;  1PD2 1;  1MTC A;  3A2V A;  4Q5R A;  3P7X A;  4MAB A;  3TOT A;  3Q19 A;  4HZ4 A;  4KW6 A;  3FZ4 A;  3PH9 A;  2VCQ A;  2FNO A;  1B48 A;  2A2R A;  3IHQ A;  3WT2 A;  2RM6 A;  4NMU A;  2OE3 A;  4K9Z A;  3GMF A;  1WIK A;  4MJC A;  1K3L A;  2DIY A;  4O7H A;  3UAR A;  4EC0 A;  1EGR A;  3IE3 A;  1X0R A;  3Q6O A;  4PX1 A;  2I3Y A;  3US3 A;  2NDO A;  1O8X A;  5DBQ A;  1NM3 A;  2YN1 A;  3V1W A;  2VO4 A;  3HKR A;  3TJG A;  4KUN A;  1MD4 A;  1JZD A;  4V2L A;  2B5Y A;  3IV4 A;  5J4U A;  4HU7 A;  4LL4 B;  4BWS A;  2A4V A;  3I6A A;  5C00 A;  4JRR A;  1N8J A;  3ZLP A;  3KTL A;  2ON7 A;  2XBI A;  4HS1 A;  20GS A;  3GX0 A;  1OC3 A;  4HEA 2;  3HD5 A;  1B8X A;  3KCM A;  2E2G A;  3F6D A;  4G2E A;  1HYU A;  4GRF A;  5HR2 A;  1OE8 A;  4AGS A;  3UBK A;  1G6Y A;  4MH3 A;  2QGV A;  2I1U A;  1SJI A;  3PR8 A;  1ZL9 A;  1NHO A;  3Q74 A;  2LJK A;  3CRT A;  5A4W A;  2CX4 A;  2JZT A;  2ZNM A;  4ZL9 A;  4GSS A;  2DJ1 A;  1HNA A;  1H75 A;  4FO5 A;  4HUA A;  3EUR A;  3WYW A;  2EIQ A;  4X0X A;  5D9W A;  5AIV A;  1TI3 A;  1SJZ A;  3EE2 A;  3KGK A;  1V57 A;  4O32 A;  3TGZ A;  4XIH A;  2PWJ A;  1BQ7 A;  1E2Y A;  5LD0 A;  4OO5 A;  3D5J A;  5FHI A;  1O85 A;  4J57 E;  4LL1 B;  3HCZ A;  2PER A;  3DVW A;  4BVX A;  4KSO A;  3EMP A;  3L9S A;  2C1Y A;  5JCU A;  2GGT A;  3TB2 A;  1VRS D;  2XPD A;  2OAC A;  4KSM A;  2EC4 A;  3GRX A;  4PNF A;  1GSU A;  1ABA A;  2HZF A;  4GQF A;  2WJU A;  1VF1 A;  2WCI A;  3OR5 A;  1NSW A;  4L5O A;  1TW9 A;  5JCW A;  2H76 A;  1XW6 A;  4JZQ A;  2NTO A;  5AIX A;  2F51 A;  5IMA A;  1BAY A;  3RDW A;  3C1S A;  1PN9 A;  1BX9 A;  4ULX A;  4E8E A;  3GH9 A;  2CT6 A;  5ELG A;  1X5D A;  5COH A;  1FAA A;  1F3B A;  5GSS A;  1YQ1 A;  1F3A A;  3N9J A;  4MP4 A;  2R4V A;  1GUM A;  1DUG A;  4I5Q A;  4XCS A;  3HZ4 A;  4K7I A;  1SK0 A;  2WS2 A;  1A8L A;  3EIN A;  3FRC A;  1W89 A;  2GT6 A;  3ZIJ A;  3EU4 A;  3BBY A;  4XS4 A;  1QK8 A;  3QOU A;  3TCO A;  1J08 A;  1HNB A;  3C73 A;  1Z3E A;  2P0G A;  3HVX A;  2V2G A;  2GSQ A;  4PUR A;  4MDC A;  4CHS A;  3L78 A;  3O6T A;  3QAV A;  2YOI A;  2KHP A;  1VF4 A;  4K7N A;  2MMN A;  2GQK A;  4ECC A;  2FWH A;  2VCZ A;  2L5L A;  3UAP A;  3IPZ A;  3D21 A;  4XS1 A;  3O3T A;  3GN3 A;  5IOX A;  1YJ6 A;  1THX A;  2K8S A;  1M99 A;  4NHZ A;  1LBK A;  2O8V B;  1HNC A;  3H4K A;  2DMM A;  3WT1 A;  4OFN A;  5JWO B;  4IQA A;  2VL3 A;  2ON5 A;  2DJ0 A;  3GKN A;  3RHC A;  1GLQ A;  2FD3 A;  1U88 A;  2VM2 A;  3LQ7 A;  1TTZ A;  1GSQ A;  1AQX A;  1VF2 A;  1PX7 A;  3TUE A;  2OJL A;  3TOU A;  1SKS B;  4HOJ A;  2VL9 A;  4PNG A;  1FG4 A;  1DE1 A;  2LNS A;  5DJL A;  3BCK A;  2KP2 A;  2EIR A;  4YAV A;  3BJ5 A;  1FO5 A;  4IP6 A;  4TW5 A;  2M46 A;  3I43 A;  2D2Z A;  2DJ3 A;  2IMK A;  1ZYE A;  1N2A A;  4MMM A;  5GAN D;  5D73 A;  2GZY A;  1Z9H A;  4OFT A;  4TKY A;  4WKW A;  3HZ8 A;  1U3I A;  2DLX A;  1FW1 A;  5H5S A;  5JCG A;  1ERW A;  3G9B A;  3UL3 A;  2LUS A;  3IR4 A;  4FYC A;  5JWQ B;  2CAQ A;  3F9U A;  1YY7 A;  1PKW A;  2IPA A;  4RUV A;  4WF4 A;  3IBH A;  1SK1 A;  3R2Q A;  5GST A;  1UA5 A;  3CMI A;  2IMF A;  2OA7 A;  18GS A;  1TOF A;  5ELA A;  2MZC A;  2P31 A;  1B4Q A;  2H01 A;  4JR6 A;  2WZ9 A;  2HFD A;  2KLX A;  3GTU A;  2O89 A;  2G2Q A;  1KNG A;  5DDL A;  2FWE A;  1CQH A;  3ISO A;  4KCE A;  5E59 A;  4JU5 A;  4TXV A;  2B5E A;  2C8U A;  4GXZ A;  2OBK A;  3VWX A;  1V58 A;  1WPI A;  1JHB A;  2M72 A;  5IOW A;  3W8J A;  1CQG A;  3WGX A;  4F9Z A;  1ON4 A;  5CRW A;  3ZTL A;  12GS A;  1K0M A;  4MPG A;  5ECL B;  3CSJ A;  2K9F A;  2RUE A;  4IEL A;  1V2A A;  1K0N A;  3LEF A;  3ME7 A;  2L57 A;  4K6X A;  3ZML A;  2LEG A;  2LJR A;  5DAK A;  1EEJ A;  2WDU A;  5G1L A;  2C3T A;  1TK0 B;  2LS5 A;  3GTU B;  4DSS A;  2LKU A;  3KZQ A;  4IJ3 A;  4WR4 A;  2YPM A;  5E4W A;  1MDK A;  2X99 A;  1WRY A;  4OCF A;  1TKD B;  1GTA A;  1XFL A;  1U87 A;  1A8Y A;  4MZC A;  4LMV A;  3LG6 A;  3TKS A;  1I5G A;  5B6M A;  4KGI A;  5CRH A;  1XW5 A;  1GTU A;  3L0H A;  1K3Y A;  2GZZ A;  2E0Q A;  3TJJ A;  6GSY A;  3UMA A;  4I2T A;  1GTB A;  2H30 A;  5KN1 A;  1M9B A;  4Q5Q A;  3F3R A;  1WP0 A;  2C0G A;  5DAK B;  2OE1 A;  5H5R A;  5ECR B;  2FA4 A;  1ML6 A;  4YH2 A;  2H0G A;  1RW1 A;  2GZP A;  5HR3 A;  3GFK A;  4G19 A;  2C4J A;  1O81 A;  14GS A;  3IAM 2;  1GNW A;  1GUL A;  1KBN A;  1T3B A;  4I2U A;  2WUL A;  1MDI A;  1Z6N A;  1Z5Y E;  3HJM A;  1U6T A;  4TR3 A;  1TI1 A;  1R4W A;  2R37 A;  4XRA A;  1EOH A;  2H8L A;  3QFB C;  4TXO A;  3LGC A;  2K18 A;  4N10 A;  1GLP A;  1TU7 A;  1XOB A;  3ZRD A;  3F63 A;  3L9U A;  3GHA A;  3LOR A;  4KA0 A;  5IMF A;  3RPN A;  4EDY A;  2I9H A;  4WBJ A;  5EVO A;  1TDI A;  2F8A A;  3GL5 A;  1RQM A;  4X1U A;  5D93 A;  1IYI A;  1JZO A;  5IMD A;  2BTO T;  4DEJ A;  2HXK A;  2C3N A;  5IQY A;  3QCP A;  2FWG A;  1F2E A;  4LMW A;  1JFU A;  1YZX A;  4XS6 A;  4AJ8 A;  4KE3 A;  2IFQ A;  3TKQ A;  1YEX A;  2CQ9 A;  2VLV A;  9GSS A;  3GUR A;  1ST9 A;  2TRX A;  4IN0 A;  3TKS E;  2VD0 A;  4ZB8 A;  3KMN A;  2H6Y A;  3HJO A;  3ZIT A;  1EV4 A;  5ECP B;  1Y25 A;  4TXO B;  1I9D A;  1X9M B;  3ZZX A;  1BYE A;  5GAP D;  2H71 A;  3HDC A;  3A2X A;  1YKA A;  2WFC A;  3UJ1 A;  4IS0 A;  3ED3 A;  1J9B A;  3ERF A;  2TRC P;  1S3C A;  5AIS A;  3W6G A;  3KH9 A;  3IC4 A;  2CV4 A;  4TN8 A;  1ZZY A;  2YJ7 A;  4OD7 A;  4POK A;  1EP7 A;  3FK8 A;  5HR0 A;  2LRN A;  2IFQ B;  4KDU A;  1XCC A;  5EPF A;  5IMV A;  1R5P A;  5ECH B;  4RQX A;  1YKC A;  4WR5 A;  2QKE A;  1FVK A;  2MMZ A;  3C1R A;  2NVL A;  3TKS C;  1VF3 A;  4I6X A;  3JCM L;  2F3M A;  3NZN A;  1R7H A;  10GS A;  4RI7 A;  3EWL A;  2MBS A;  1GL8 A;  1XIY A;  4ZL8 A;  2GST A;  2IL3 A;  3F4S A;  1DE2 A;  1OC8 A;  4POB A;  5IPG A;  3KXO A;  4NPB A;  2LQO A;  3IOS A;  5B6N A;  2MYG A;  2H1B A;  3CTF A;  5AN1 A;  2KP1 A;  4EF0 A;  1F37 A;  3LYP A;  2R2J A;  3L4N A;  3FKF A;  5AGY A;  2GT5 A;  5ECI B;  3PIN A;  1X5C A;  5CO3 A;  2BJX A;  1AIU A;  3GH6 A;  2RUF A;  1PX6 A;  4NXI A;  5J9C A;  3A5W A;  3MDK A;  3KP9 A;  2JL4 A;  3TRX A;  5IO0 A;  1X9W B;  6GSX A;  5CRD A;  2YV7 A;  3KM6 A;  4KB3 A;  4V1A g;  1ACV A;  1IYH A;  4IP1 A;  4L0W A;  5HFK A;  1EP8 A;  2TIR A;  1M9A A;  4HJ2 A;  5A5K A;  2GSR A;  1DSB A;  2DJ2 A;  1K0C A;  1S3D A;  4WEY A;  1V40 A;  3CSH A;  2VIM A;  4HI7 A;  3S9F A;  4H86 A;  4Z7X A;  4L5L A;  2LRT A;  4DVC A;  5EL8 A;  1WJK A;  2IMD A;  3VWW A;  2B1K A;  4P3Y B;  3KJY A;  2FLS A;  2OBI A;  1MEK A;  4IGJ A;  4Q5F A;  4PUF C;  1Q4J A;  2B7K A;  3F3Q A;  3E9J B;  2B5X A;  4HJM A;  5J9B A;  1AAZ A;  3VI7 A;  2JZS A;  1PL2 A;  22GS A;  1SL0 B;  2L4Q A;  5ECN B;  3LWA A;  3ZFL A;  4K1F A;  3QR6 A;  2HZE A;  3CYN A;  3GKM A;  4MF5 A;  4DSQ A;  2N5A A;  3U6V A;  3UEM A;  5J3R A;  5HFI A;  7GSS A;  1XW9 A;  4I8B A;  8GSS A;  2DSA A;  2GTU A;  1BG5 A;  3MWH A;  4MJE A;  5F06 A;  2R5G A;  3QFA C;  2CVK A;  4ZBA A;  4WET A;  2P5R A;  4PQ1 A;  3ZRE A;  4J56 E;  2X8G A;  3ZMK A;  2XC2 A;  1EV9 A;  2OAD A;  2B3S A;  4IVF A;  2O85 A;  1JZR A;  5KEJ A;  2XBQ A;  4GQC A;  4F0C A;  6GSU A;  4XRD A;  4K8M A;  4OCE A;  1W4V A;  1XPV A;  2AUV A;  5ENU A;  2H66 A;  2IME A;  2Z9S A;  4KDY A;  2V6K A;  3FYG A;  4D73 A;  4YQU A;  1ILO A;  2HZE B;  5LCZ A;  4GST A;  4HU9 A;  4KCA A;  2ALB A;  5F0G A;  2I81 A;  3ERG A;  1R26 A;  2VUP A;  2VCW A;  3FR6 A;  2L59 A;  1A0R P;  1XXU A;  1J0F A;  3FZ9 A;  4O5R A;  1OKD A;  4MH2 A;  4BPY A;  2C80 A;  2HSH A;  2B7J A;  3FR3 A;  5G31 A;  1SL2 B;  2C0D A;  1TU8 A;  4JR4 A;  3ZFB A;  2YP6 A;  4F03 A;  4GLT A;  3HVS A;  2O7K A;  2YZU A;  3RAZ A;  1PMT A;  4D73 B;  1YDK A;  5LNK e;  2VCV A;  4F82 A;  4HZ2 A;  2AV4 A;  3HXS A;  2LV3 A;  3KMO A;  1SL1 B;  2YNX A;  4EO3 A;  3EMX A;  1QUW A;  1TRW A;  4MZW A;  1K0B A;  5D9V A;  2MMA A;  1XVQ A;  2J9H A;  5KN0 A;  4PQH A;  2L6D A;  2IN3 A;  3P90 A;  3ERW A;  3F4R A;  3HJP A;  1O6J A;  1A24 A;  2FA8 A;  5ECS A;  2LNT A;  2JAC A;  3FZA A;  3EYT A;  1XWG A;  1QXH A;  3LXT A;  2K6V A;  1OC9 A;  2H0I A;  1Z6M A;  3LSZ A;  2LQQ A;  3U5R E;  4I97 A;  4ZB6 A;  1K0O A;  2OE0 A;  2K8V A;  2R3X A;  3D6I A;  3VI5 A;  4ACS A;  5B7C A;  2AJQ B;  3DML A;  1X5E A;  3GX8 A;  4MLY A;  3P8W A;  3M8N A;  1TK5 B;  2H73 A;  2HE3 A;  4ZB9 A;  3NOF A;  1Q98 A;  1PL1 A;  1A2J A;  4GCI A;  2CVB A; 
#chains in the Genus database with same CATH topology
 4HQS A;  1AQV A;  3D4T A;  3FHK A;  2QA1 A;  2GVP A;  4JBB A;  3TDG A;  3H8Q A;  3LYK A;  2QSI A;  1JLV A;  3BCI A;  3APQ A;  1GP1 A;  4G10 A;  1OC9 B;  4V1A p;  5HR1 A;  1R5A A;  5FWG A;  2DIZ A;  3WGD A;  4TRX A;  1THO A;  2REM A;  1GSS A;  4EL1 A;  5CAX A;  2RLI A;  2PU9 C;  3KP8 A;  1K0A A;  1ZGN A;  3GV1 A;  1FOV A;  4IBP A;  3M9J A;  2FY6 A;  4IW9 A;  1T7P B;  1TK8 B;  4ISD A;  3IRA A;  2IWT A;  4IKH A;  1G7O A;  1F6M C;  3EU3 A;  2J23 A;  1HQO A;  4EE0 A;  4EDZ A;  3IK7 A;  2KOK A;  5CYY A;  2HI7 A;  1OYJ A;  4HDE A;  2JU5 A;  4XHM A;  1B4P A;  4KF9 A;  1GSF A;  2VCX A;  3N5O A;  4EXJ A;  4DSR A;  5F8B A;  2GSS A;  2PBJ A;  1XZO A;  2JAD A;  3I69 A;  2YV9 A;  2WB9 A;  4QL7 A;  1PRX A;  2HNL A;  3O76 A;  3K8N A;  5EY6 A;  2BMX A;  3IC8 A;  2HRF A;  2A2S A;  1PGT A;  3APO A;  2PPT A;  4N0Z A;  3TKP A;  5ECQ B;  1H4O A;  1GSD A;  2V41 A;  2FUG 2;  4K5R A;  3LJR A;  5F07 A;  5L71 A;  4JED A;  1PQN A;  1K3O A;  2HRK A;  5D8I A;  5ECM B;  1XWB A;  2AB6 A;  2CZ3 A;  3UVH A;  2JZR A;  3FY7 A;  1WMJ A;  4ZIL A;  4F2I A;  3DIE A;  5CNW A;  2FWF A;  4PXO A;  1FB0 A;  3DKS A;  16GS A;  4E8H A;  1TJD A;  3DGQ A;  6GSS A;  2RM5 A;  19GS A;  1WWJ A;  1EOG A;  5IO2 A;  3HA9 A;  4CW9 A;  4N11 A;  3CRU A;  1GH2 A;  3ZVJ D;  2G0F A;  5D96 A;  4ZBD A;  5F05 A;  1EGO A;  1YF0 A;  2AYT A;  2QC7 A;  1AQW A;  3CTG A;  4YAP A;  4O5Q A;  4MJA A;  2MBT A;  3KEB A;  2EIO A;  1A0F A;  1T00 A;  2YWI A;  1SD9 A;  2E2M A;  4KND A;  1M0U A;  1QMV A;  2H19 A;  4WF5 A;  3W8S A;  1T1V A;  3VWU A;  3FEU A;  5G5E A;  2H1D A;  3MSZ A;  1V98 A;  3RBT A;  4ZIJ A;  1M2B A;  2N5F A;  2YCD A;  3DYR A;  2HT9 A;  2LRC A;  2C0F A;  3C71 A;  3RHB A;  1UC7 A;  2PVQ A;  1ZYQ B;  1KEB A;  1GWC A;  1ERV A;  2PMT A;  4MPF A;  4TR4 A;  1T8E B;  3GL3 A;  2CX3 A;  4POM A;  4BVY B;  3D22 A;  5H5Q A;  5D9T A;  3A2W A;  2I4A A;  3NIV A;  3VFI A;  4K0N A;  2V32 A;  4ML1 A;  5ABR A;  3L9V A;  2V6O A;  2X49 A;  1PKZ A;  2NBS A;  3ZL5 A;  4TR1 A;  1OVN A;  2LJA A;  3FZ5 A;  5D9X A;  5IMC A;  4Z2U A;  3QAW A;  3E0U A;  2N5B A;  4X43 A;  2H74 A;  3IDV A;  5G5F A;  1SU9 A;  3LFL A;  1AW9 A;  3M9K A;  2HLS A;  2B6M A;  3ZYW A;  1GTI A;  1SD8 A;  4F0B A;  11GS A;  1SJ6 A;  2A2P A;  3VPQ A;  4ILF A;  4BL7 A;  3TJK A;  3BD2 A;  1EZK A;  2O87 A;  4YQV A;  2GS3 A;  4FIW A;  4QL9 A;  2VCT A;  5IMZ A;  1LJR A;  4YKF A;  4XTS A;  3ZVJ A;  1EWX A;  4TR1 B;  1A23 A;  3QDN A;  3G7I A;  2ES7 A;  1USB A;  1Y6E A;  1VGL A;  2XPE A;  1T4Y A;  2B1L A;  4ZXG A;  3VK9 A;  5IM9 A;  4MJB A;  1S3R A;  2H72 A;  4IJI A;  2M80 A;  5DJM A;  2UZ8 A;  3HHV A;  2GLR A;  1HD2 A;  1JZW A;  3VWV A;  4AF2 A;  5J5N A;  2DJJ A;  3J7Y k;  2IIY A;  2DML A;  1TXX A;  5G2Z A;  1SKR B;  1O73 A;  4AJ7 A;  1XWC A;  3TRQ A;  4ECB A;  3DXB A;  3IK9 A;  2YJH A;  5CRG A;  2OKA A;  3AY8 A;  5A4U A;  2FGX A;  5IIZ A;  2C3Q A;  4JE1 A;  4K7O A;  4NV5 A;  3F8U A;  4EIP A;  3VLN A;  2PUK C;  1C72 A;  2VM1 A;  3D0Z A;  2VD1 A;  3C7M A;  1BJX A;  4HQZ A;  4J2F A;  3MAK A;  3EVI A;  1ERU A;  3IA1 A;  1V9W A;  5FT3 A;  2HSY A;  2HYX A;  5ECO B;  1WOU A;  3DD3 A;  2YZH A;  2DC5 A;  3VUR A;  1M3I A;  1YF1 A;  1GUK A;  1O7U A;  1U3A A;  2ZCT A;  2H75 A;  1O8W A;  4V2M A;  5CRE A;  5CP1 A;  2FCH A;  5A4V A;  3VPT A;  3I9V 2;  3GKK A;  3UBL A;  1TP9 A;  4KDX A;  4IHU A;  3FW2 A;  1DBY A;  5G30 A;  2CZ2 A;  1XOA A;  2YAN A;  5C04 A;  2L5O A;  4EUY A;  4MZB A;  2IJY A;  1ERT A;  1QQ2 A;  2VLT A;  1OAZ A;  1E6B A;  4ID0 A;  1GRX A;  4L8E A;  1AXD A;  2JSZ A;  2LTK A;  4TOP A;  5DCH A;  3HYP A;  4TR0 A;  2PVO C;  5DVB A;  1G0T A;  3F6F A;  1JLW A;  1AUC A;  5G1K A;  3ZIV A;  1OKT A;  3G7Y A;  3APS A;  2PN8 A;  4KH7 A;  4PGT A;  3M0F A;  1FOH A;  4MCU A;  5ECK B;  4GSN A;  5DQS A;  4ECI A;  3H93 A;  2F8F A;  4CDO A;  5DAL A;  3D4M A;  3QMX A;  5HQP A;  2L4C A;  2C0E A;  3CSI A;  3EPT A;  3UIW A;  3A5I A;  3KH7 A;  5KOX A;  3SWL A;  4OO4 A;  4GWR A;  3KTB A;  1LU4 A;  4OFM A;  3C8E A;  1PSQ A;  3WD6 A;  1B9Y C;  1SYX A;  4BA7 A;  4GF0 A;  1RK4 A;  1BED A;  1K0D A;  3UVT A;  2VL2 A;  4EIQ A;  4XS4 B;  4N30 A;  1GNE A;  2DJK A;  3CBU A;  3DVX A;  1QFN A;  1Z7P A;  3M3M A;  1M2A A;  4G9H A;  4BWQ A;  3QAG A;  4TVE A;  1GSY A;  4LLR A;  4K0G A;  3GA4 A;  5DAL B;  1G7E A;  6GSV A;  4WBR D;  1OE7 A;  1NHY A;  3GIX A;  17GS A;  3GUS A;  2H1G A;  1WE0 A;  4MF6 A;  6GST A;  4AJ6 A;  1URM A;  3E3E A;  2WRT A;  3H1N A;  2X8C A;  3CXG A;  5GZZ B;  4L0U A;  4V2N A;  1FHE A;  2YWO A;  1KTE A;  1AC1 A;  5IPH A;  1TRV A;  3UOM A;  1XVW A;  1UN2 A;  4MA9 A;  2V1M A;  3GSS A;  3IAS 2;  3HVV A;  4FH8 A;  1FB6 A;  3F0I A;  2CVD A;  1SK2 A;  2VOC A;  4OMV A;  3PGT A;  1GUH A;  1MDJ A;  3SBC A;  2AAW A;  4RI6 A;  2DBC A;  3WGE A;  4NV2 A;  3GST A;  3M1G A;  3KD0 A;  4KX4 A;  4WXT A;  4PUA A;  2H6X A;  5INY A;  1F9M A;  5KN3 A;  2R0P A;  2NPB A;  2JSY A;  3FR9 A;  1B9X C;  2X8H A;  1ZCP A;  3KIJ A;  2FHE A;  3GNJ A;  3LXZ A;  4NWY A;  1M2D A;  3DWV A;  3TKR A;  1Z7R A;  4FYB A;  4FYU A;  1SEN A;  4PQI A;  2YWM A;  2H0H A;  3P2A A;  1MD3 A;  1A2L A;  3TJF A;  5ID2 A;  2PGT A;  2IMI A;  3MNG A;  4NAX A;  2F9S A;  13GS A;  4KAE A;  3TRP A;  4POL A;  5DQY A;  3Q18 A;  4K2D A;  3DRN A;  1ZYN A;  3FMW A;  1A2M A;  3DEX A;  1NW2 A;  3A3T A;  4ECJ A;  2YWN A;  2RII A;  4LA1 A;  2HRN A;  1QGV A;  4O92 A;  2H70 A;  1FVJ A;  1G6W A;  3HY2 A;  1TRU A;  3GKX A;  2P5Q A;  2CAI A;  2X64 A;  1M7T A;  3GYK A;  2AHE A;  5B8A A;  2VL2 C;  3IXR A;  1YEP A;  3J7Y b;  5DCG A;  3EC3 A;  1T4Z A;  2VLU A;  3QPM A;  4MK3 A;  2MMO A;  4EVM A;  5ID2 B;  3F4T A;  4RQR A;  2H1A A;  4ZL7 A;  4ML6 A;  5KN2 A;  5JWR B;  6GSW A;  5B8B A;  4ZBB A;  1SYR A;  1PA3 A;  3QD9 A;  3RPP A;  3H79 A;  4HSC X;  2GQM A;  4EKZ A;  1XWA A;  1TRS A;  1UVZ A;  4QQ7 A;  2XHF A;  4OWY A;  1GSE A;  2LST A;  1XBS A;  2ZUP A;  2KUC A;  4YQM A;  4IQ1 A;  5J41 A;  2R6K A;  4Q5N A;  1S3A A;  3ME8 A;  2GDR A;  4NHW A;  4N0V A;  5HFG A;  1EEM A;  1X9S B;  1XWK A;  4DSS B;  4BVY A;  4MF7 A;  2GQL A;  3BOA A;  2WGR A;  1ZMA A;  2CA8 A;  3G7J A;  2L6C A;  4G0K A;  3TJB A;  4GTU A;  2H6Z A;  1SKW B;  2E7P A;  1ZOF A;  2VAF A;  1PD2 1;  1MTC A;  3A2V A;  4Q5R A;  3P7X A;  4MAB A;  3TOT A;  3Q19 A;  4HZ4 A;  4KW6 A;  3FZ4 A;  3PH9 A;  2VCQ A;  2FNO A;  1B48 A;  2A2R A;  3IHQ A;  3WT2 A;  4CY8 A;  2RM6 A;  4NMU A;  2OE3 A;  4K9Z A;  3GMF A;  1WIK A;  4MJC A;  1K3L A;  2DIY A;  4O7H A;  3UAR A;  4EC0 A;  1EGR A;  3IE3 A;  3R3E A;  1X0R A;  4G0I A;  3Q6O A;  4PX1 A;  2I3Y A;  3US3 A;  2NDO A;  1O8X A;  5DBQ A;  1NM3 A;  2YN1 A;  3V1W A;  2VO4 A;  3HKR A;  3TJG A;  4KUN A;  1MD4 A;  1JZD A;  4V2L A;  2B5Y A;  3IV4 A;  5J4U A;  4HU7 A;  4LL4 B;  4BWS A;  2A4V A;  3I6A A;  5C00 A;  4JRR A;  1N8J A;  3ZLP A;  3KTL A;  2ON7 A;  2XBI A;  4HS1 A;  20GS A;  3GX0 A;  1OC3 A;  4HEA 2;  3HD5 A;  1B8X A;  3KCM A;  2E2G A;  3F6D A;  4G2E A;  1HYU A;  4GRF A;  5HR2 A;  1OE8 A;  4AGS A;  3UBK A;  1G6Y A;  4MH3 A;  2QGV A;  2I1U A;  1SJI A;  3PR8 A;  1ZL9 A;  1NHO A;  3Q74 A;  2LJK A;  3CRT A;  5A4W A;  2CX4 A;  2JZT A;  2ZNM A;  4ZL9 A;  4GSS A;  4BIK A;  2DJ1 A;  1HNA A;  1H75 A;  4FO5 A;  4HUA A;  3EUR A;  3WYW A;  2EIQ A;  4X0X A;  5D9W A;  5AIV A;  1TI3 A;  1SJZ A;  3EE2 A;  3KGK A;  1V57 A;  4O32 A;  3TGZ A;  4XIH A;  2PWJ A;  1BQ7 A;  1E2Y A;  5LD0 A;  4OO5 A;  3D5J A;  5FHI A;  1O85 A;  4YKG A;  4J57 E;  4LL1 B;  3HCZ A;  4Z2T A;  2PER A;  3DVW A;  4BVX A;  4KSO A;  3EMP A;  3L9S A;  2C1Y A;  5JCU A;  2GGT A;  3TB2 A;  1VRS D;  2XPD A;  2OAC A;  4KSM A;  2EC4 A;  3GRX A;  4PNF A;  1GSU A;  1ABA A;  2HZF A;  4GQF A;  2WJU A;  1VF1 A;  2WCI A;  3OR5 A;  1NSW A;  4L5O A;  1TW9 A;  5JCW A;  2H76 A;  1XW6 A;  4JZQ A;  2NTO A;  5AIX A;  2F51 A;  5IMA A;  1BAY A;  3RDW A;  3C1S A;  1PN9 A;  1BX9 A;  4ULX A;  4E8E A;  3GH9 A;  2CT6 A;  5ELG A;  1X5D A;  5COH A;  1FAA A;  1F3B A;  5GSS A;  1YQ1 A;  1F3A A;  3N9J A;  4BVX B;  4MP4 A;  2R4V A;  1GUM A;  1DUG A;  4I5Q A;  4XCS A;  3HZ4 A;  4K7I A;  1SK0 A;  2WS2 A;  1A8L A;  3EIN A;  3FRC A;  1W89 A;  2GT6 A;  3ZIJ A;  3EU4 A;  3BBY A;  4XS4 A;  1QK8 A;  3QOU A;  3TCO A;  1J08 A;  1XG8 A;  1HNB A;  3C73 A;  1Z3E A;  2P0G A;  3HVX A;  2V2G A;  2GSQ A;  4PUR A;  4MDC A;  4CHS A;  3L78 A;  3O6T A;  3QAV A;  2YOI A;  2KHP A;  1VF4 A;  4K7N A;  3IHG A;  2MMN A;  2GQK A;  4ECC A;  2FWH A;  2VCZ A;  2L5L A;  3UAP A;  3IPZ A;  3D21 A;  4XS1 A;  3O3T A;  3GN3 A;  5IOX A;  1YJ6 A;  1THX A;  2K8S A;  1M99 A;  4NHZ A;  4O5U A;  1LBK A;  2O8V B;  1HNC A;  3H4K A;  2DMM A;  3WT1 A;  4FQU A;  4OFN A;  5JWO B;  4IQA A;  2VL3 A;  2ON5 A;  2DJ0 A;  3GKN A;  3RHC A;  1GLQ A;  2FD3 A;  1U88 A;  2VM2 A;  3LQ7 A;  1TTZ A;  4K5S A;  1GSQ A;  1AQX A;  1VF2 A;  1PX7 A;  3TUE A;  2OJL A;  4K2X A;  3TOU A;  1SKS B;  4HOJ A;  2VL9 A;  4PNG A;  1FG4 A;  1DE1 A;  2LNS A;  5DJL A;  3BCK A;  2KP2 A;  2EIR A;  4YAV A;  3BJ5 A;  1FO5 A;  4IP6 A;  4TW5 A;  2M46 A;  3I43 A;  2D2Z A;  2DJ3 A;  2IMK A;  4A5P A;  1ZYE A;  1N2A A;  4MMM A;  5GAN D;  5D73 A;  2GZY A;  1Z9H A;  4OFT A;  4TKY A;  4WKW A;  3HZ8 A;  1U3I A;  2DLX A;  1FW1 A;  5H5S A;  5JCG A;  1ERW A;  3G9B A;  3UL3 A;  2LUS A;  3IR4 A;  4FYC A;  5JWQ B;  2CAQ A;  3F9U A;  1YY7 A;  1PKW A;  2IPA A;  4RUV A;  4WF4 A;  3IBH A;  1SK1 A;  3R2Q A;  5GST A;  1UA5 A;  3CMI A;  2IMF A;  2OA7 A;  18GS A;  1TOF A;  5ELA A;  2MZC A;  2P31 A;  1B4Q A;  2H01 A;  2R0C A;  4JR6 A;  2WZ9 A;  1M3J A;  2HFD A;  2KLX A;  3GTU A;  2O89 A;  2G2Q A;  1KNG A;  5DDL A;  2FWE A;  1CQH A;  3ISO A;  4KCE A;  5E59 A;  4JU5 A;  4TXV A;  2B5E A;  2C8U A;  4GXZ A;  2OBK A;  3VWX A;  1V58 A;  1WPI A;  1JHB A;  4MNN A;  2M72 A;  5IOW A;  3W8J A;  1CQG A;  3WGX A;  4F9Z A;  1ON4 A;  5CRW A;  3ZTL A;  12GS A;  1K0M A;  4MPG A;  5ECL B;  3CSJ A;  2K9F A;  2RUE A;  4IEL A;  1V2A A;  1K0N A;  3LEF A;  3ME7 A;  2L57 A;  4ICY A;  4K6X A;  3ZML A;  2LEG A;  5BMU A;  2LJR A;  5DAK A;  1EEJ A;  2WDU A;  5G1L A;  2C3T A;  1TK0 B;  2HRA A;  2LS5 A;  3GTU B;  4DSS A;  2LKU A;  3KZQ A;  4USS A;  4IJ3 A;  4WR4 A;  2YPM A;  5E4W A;  1MDK A;  2X99 A;  1WRY A;  4OCF A;  1TKD B;  1GTA A;  1XFL A;  1U87 A;  1A8Y A;  4MZC A;  4LMV A;  3LG6 A;  3TKS A;  1I5G A;  5B6M A;  4KGI A;  5CRH A;  1XW5 A;  1GTU A;  3L0H A;  1K3Y A;  2GZZ A;  5BRT A;  2E0Q A;  3TJJ A;  6GSY A;  3UMA A;  4I2T A;  1GTB A;  2H30 A;  5KN1 A;  1M9B A;  4Q5Q A;  3F3R A;  1WP0 A;  2C0G A;  5DAK B;  2OE1 A;  5H5R A;  5ECR B;  2FA4 A;  1ML6 A;  4YH2 A;  2H0G A;  1RW1 A;  2GZP A;  5HR3 A;  3GFK A;  4G19 A;  2C4J A;  1O81 A;  14GS A;  3IAM 2;  1GNW A;  1GUL A;  1KBN A;  1T3B A;  4I2U A;  2WUL A;  1MDI A;  1Z6N A;  1Z5Y E;  3HJM A;  1U6T A;  4TR3 A;  1TI1 A;  1R4W A;  2R37 A;  4XRA A;  1EOH A;  2H8L A;  3QFB C;  4TXO A;  3LGC A;  2K18 A;  4N10 A;  1GLP A;  1TU7 A;  1XOB A;  3ZRD A;  3F63 A;  3L9U A;  3GHA A;  3LOR A;  4KA0 A;  5IMF A;  3RPN A;  4EDY A;  2I9H A;  4WBJ A;  5EVO A;  1TDI A;  2F8A A;  3GL5 A;  1RQM A;  4X1U A;  5D93 A;  1IYI A;  1JZO A;  5IMD A;  2BTO T;  4DEJ A;  2HXK A;  2C3N A;  5IQY A;  3QCP A;  2FWG A;  2A4H A;  1F2E A;  4LMW A;  1JFU A;  1YZX A;  4XS6 A;  4AJ8 A;  4KE3 A;  2IFQ A;  3TKQ A;  1YEX A;  2CQ9 A;  2VLV A;  9GSS A;  3GUR A;  1ST9 A;  2TRX A;  4IN0 A;  3TKS E;  2VD0 A;  4ZB8 A;  3KMN A;  5KOW A;  2H6Y A;  3HJO A;  3ZIT A;  1EV4 A;  3MYD A;  5ECP B;  1Y25 A;  4TXO B;  1I9D A;  1PN0 A;  1X9M B;  3ZZX A;  1BYE A;  5GAP D;  2H71 A;  3HDC A;  3A2X A;  1YKA A;  2WFC A;  3UJ1 A;  4IS0 A;  3ED3 A;  1J9B A;  3ERF A;  2TRC P;  1S3C A;  5AIS A;  3W6G A;  3KH9 A;  3IC4 A;  2CV4 A;  4TN8 A;  1ZZY A;  2YJ7 A;  4OD7 A;  4POK A;  1EP7 A;  3FK8 A;  5HR0 A;  2LRN A;  2IFQ B;  4KDU A;  1XCC A;  5EPF A;  5IMV A;  2DKI A;  1R5P A;  5ECH B;  4RQX A;  1YKC A;  4WR5 A;  2QKE A;  1FVK A;  2MMZ A;  3C1R A;  2NVL A;  3TKS C;  1VF3 A;  4I6X A;  3JCM L;  2F3M A;  3NZN A;  1R7H A;  10GS A;  4RI7 A;  3EWL A;  2MBS A;  1GL8 A;  1XIY A;  4ZL8 A;  2GST A;  2IL3 A;  3F4S A;  1DE2 A;  1OC8 A;  4POB A;  5IPG A;  3KXO A;  4NPB A;  2LQO A;  3IOS A;  5B6N A;  2MYG A;  2H1B A;  3CTF A;  5AN1 A;  2KP1 A;  4EF0 A;  1F37 A;  3LYP A;  2R2J A;  3L4N A;  3FKF A;  5AGY A;  2GT5 A;  5ECI B;  3PIN A;  1X5C A;  5CO3 A;  2BJX A;  1AIU A;  3GH6 A;  2RUF A;  1PX6 A;  4NXI A;  5J9C A;  3A5W A;  3MDK A;  3KP9 A;  2JL4 A;  3TRX A;  5IO0 A;  1X9W B;  1ZYP A;  6GSX A;  1PFO A;  5CRD A;  2YV7 A;  3KM6 A;  4KB3 A;  4V1A g;  1ACV A;  1IYH A;  4IP1 A;  4L0W A;  5HFK A;  2R0G A;  4BL7 B;  1EP8 A;  2TIR A;  1M9A A;  4HJ2 A;  5A5K A;  2GSR A;  1DSB A;  2DJ2 A;  4G0L A;  1K0C A;  1S3D A;  4WEY A;  1V40 A;  3CSH A;  2VIM A;  4HI7 A;  3S9F A;  4H86 A;  4Z7X A;  4L5L A;  2LRT A;  4DVC A;  5EL8 A;  1WJK A;  2IMD A;  3VWW A;  2B1K A;  4P3Y B;  3KJY A;  2FLS A;  2OBI A;  1MEK A;  4IGJ A;  4Q5F A;  4PUF C;  1Q4J A;  2B7K A;  3F3Q A;  3E9J B;  2B5X A;  4HJM A;  5J9B A;  1AAZ A;  3VI7 A;  2JZS A;  1PL2 A;  22GS A;  1SL0 B;  2L4Q A;  4Z2R A;  5ECN B;  3LWA A;  3ZFL A;  4K1F A;  3MIX A;  3QR6 A;  2HZE A;  3CYN A;  3GKM A;  4MF5 A;  4DSQ A;  2N5A A;  3U6V A;  3UEM A;  5J3R A;  5HFI A;  7GSS A;  3LW9 A;  1XW9 A;  4I8B A;  8GSS A;  2DSA A;  2GTU A;  1BG5 A;  3MWH A;  4MJE A;  5F06 A;  2R5G A;  3QFA C;  2CVK A;  4ZBA A;  4WET A;  2P5R A;  2HSM A;  4PQ1 A;  3ZRE A;  4J56 E;  2X8G A;  3ZMK A;  2XC2 A;  1EV9 A;  2OAD A;  2B3S A;  4IVF A;  2O85 A;  1JZR A;  5KEJ A;  2XBQ A;  4GQC A;  4F0C A;  6GSU A;  4XRD A;  4K8M A;  4OCE A;  1W4V A;  1XPV A;  2AUV A;  5ENU A;  2H66 A;  2IME A;  2Z9S A;  4KDY A;  2V6K A;  3FYG A;  4D73 A;  4YQU A;  1ILO A;  2HZE B;  5LCZ A;  4GST A;  4HU9 A;  4KCA A;  2ALB A;  5F0G A;  2I81 A;  3ERG A;  1R26 A;  2VUP A;  2VCW A;  3FR6 A;  2L59 A;  1A0R P;  1XXU A;  1J0F A;  3FZ9 A;  4O5R A;  1OKD A;  4MH2 A;  4BPY A;  2X4A A;  2C80 A;  2HSH A;  2B7J A;  3FR3 A;  3CQF A;  4PTS A;  5G31 A;  2DKH A;  1SL2 B;  2C0D A;  1TU8 A;  4JR4 A;  3ZFB A;  2YP6 A;  4F03 A;  4GLT A;  3HVS A;  2O7K A;  2YZU A;  3RAZ A;  1PMT A;  4D73 B;  1YDK A;  5LNK e;  2VCV A;  4F82 A;  4HZ2 A;  4CY6 A;  4X4J A;  2AV4 A;  3HXS A;  2LV3 A;  3KMO A;  1SL1 B;  3PPU A;  2YNX A;  4EO3 A;  3EMX A;  1QUW A;  1TRW A;  4MZW A;  1K0B A;  5D9V A;  2MMA A;  1XVQ A;  2J9H A;  5KN0 A;  2QA2 A;  4PQH A;  2L6D A;  2IN3 A;  3P90 A;  3ERW A;  3F4R A;  3HJP A;  1O6J A;  1A24 A;  2FA8 A;  5ECS A;  2LNT A;  2JAC A;  3FZA A;  3EYT A;  1XWG A;  1QXH A;  3LXT A;  2K6V A;  1OC9 A;  2H0I A;  1Z6M A;  3LSZ A;  2LQQ A;  3U5R E;  4I97 A;  4ZB6 A;  1K0O A;  2OE0 A;  2K8V A;  2R3X A;  3D6I A;  3VI5 A;  4ACS A;  5B7C A;  2AJQ B;  3DML A;  3HVN A;  1X5E A;  3GX8 A;  4MLY A;  3P8W A;  3M8N A;  1TK5 B;  2H73 A;  2HE3 A;  4ZB9 A;  3NOF A;  1Q98 A;  1PL1 A;  1A2J A;  4GCI A;  2CVB A; 
#chains in the Genus database with same CATH homology
 4HQS A;  1AQV A;  3D4T A;  3FHK A;  2QA1 A;  2GVP A;  4JBB A;  3TDG A;  3H8Q A;  3LYK A;  2QSI A;  1JLV A;  3BCI A;  3APQ A;  1GP1 A;  4G10 A;  1OC9 B;  4V1A p;  5HR1 A;  1R5A A;  5FWG A;  2DIZ A;  3WGD A;  4TRX A;  1THO A;  2REM A;  1GSS A;  4EL1 A;  5CAX A;  2RLI A;  2PU9 C;  3KP8 A;  1K0A A;  1ZGN A;  3GV1 A;  1FOV A;  4IBP A;  3M9J A;  2FY6 A;  4IW9 A;  1T7P B;  1TK8 B;  4ISD A;  3IRA A;  2IWT A;  4IKH A;  1G7O A;  1F6M C;  3EU3 A;  2J23 A;  1HQO A;  4EE0 A;  4EDZ A;  3IK7 A;  2KOK A;  5CYY A;  2HI7 A;  1OYJ A;  4HDE A;  2JU5 A;  4XHM A;  1B4P A;  4KF9 A;  1GSF A;  2VCX A;  3N5O A;  4EXJ A;  4DSR A;  5F8B A;  2GSS A;  2PBJ A;  1XZO A;  2JAD A;  3I69 A;  2YV9 A;  2WB9 A;  4QL7 A;  1PRX A;  2HNL A;  3O76 A;  3K8N A;  5EY6 A;  2BMX A;  3IC8 A;  2HRF A;  2A2S A;  1PGT A;  3APO A;  2PPT A;  4N0Z A;  3TKP A;  5ECQ B;  1H4O A;  1GSD A;  2V41 A;  2FUG 2;  4K5R A;  3LJR A;  5F07 A;  5L71 A;  4JED A;  1PQN A;  1K3O A;  2HRK A;  5D8I A;  5ECM B;  1XWB A;  2AB6 A;  2CZ3 A;  3UVH A;  2JZR A;  3FY7 A;  1WMJ A;  4ZIL A;  4F2I A;  3DIE A;  5CNW A;  2FWF A;  4PXO A;  1FB0 A;  3DKS A;  16GS A;  4E8H A;  1TJD A;  3DGQ A;  6GSS A;  2RM5 A;  19GS A;  1WWJ A;  1EOG A;  5IO2 A;  3HA9 A;  4CW9 A;  4N11 A;  3CRU A;  1GH2 A;  3ZVJ D;  2G0F A;  5D96 A;  4ZBD A;  5F05 A;  1EGO A;  1YF0 A;  2AYT A;  2QC7 A;  1AQW A;  3CTG A;  4YAP A;  4O5Q A;  4MJA A;  2MBT A;  3KEB A;  2EIO A;  1A0F A;  1T00 A;  2YWI A;  1SD9 A;  2E2M A;  4KND A;  1M0U A;  1QMV A;  2H19 A;  4WF5 A;  3W8S A;  1T1V A;  3VWU A;  3FEU A;  5G5E A;  2H1D A;  3MSZ A;  1V98 A;  3RBT A;  4ZIJ A;  1M2B A;  2N5F A;  2YCD A;  3DYR A;  2HT9 A;  2LRC A;  2C0F A;  3C71 A;  3RHB A;  1UC7 A;  2PVQ A;  1ZYQ B;  1KEB A;  1GWC A;  1ERV A;  2PMT A;  4MPF A;  4TR4 A;  1T8E B;  3GL3 A;  2CX3 A;  4POM A;  4BVY B;  3D22 A;  5H5Q A;  5D9T A;  3A2W A;  2I4A A;  3NIV A;  3VFI A;  4K0N A;  2V32 A;  4ML1 A;  5ABR A;  3L9V A;  2V6O A;  2X49 A;  1PKZ A;  2NBS A;  3ZL5 A;  4TR1 A;  1OVN A;  2LJA A;  3FZ5 A;  5D9X A;  5IMC A;  4Z2U A;  3QAW A;  3E0U A;  2N5B A;  4X43 A;  2H74 A;  3IDV A;  5G5F A;  1SU9 A;  3LFL A;  1AW9 A;  3M9K A;  2HLS A;  2B6M A;  3ZYW A;  1GTI A;  1SD8 A;  4F0B A;  11GS A;  1SJ6 A;  2A2P A;  3VPQ A;  4ILF A;  4BL7 A;  3TJK A;  3BD2 A;  1EZK A;  2O87 A;  4YQV A;  2GS3 A;  4FIW A;  4QL9 A;  2VCT A;  5IMZ A;  1LJR A;  4YKF A;  4XTS A;  3ZVJ A;  1EWX A;  4TR1 B;  1A23 A;  3QDN A;  3G7I A;  2ES7 A;  1USB A;  1Y6E A;  1VGL A;  2XPE A;  1T4Y A;  2B1L A;  4ZXG A;  3VK9 A;  5IM9 A;  4MJB A;  2H72 A;  4IJI A;  2M80 A;  5DJM A;  2UZ8 A;  3HHV A;  2GLR A;  1HD2 A;  1JZW A;  3VWV A;  4AF2 A;  5J5N A;  2DJJ A;  3J7Y k;  2IIY A;  2DML A;  1TXX A;  5G2Z A;  1SKR B;  1O73 A;  4AJ7 A;  1XWC A;  3TRQ A;  4ECB A;  3DXB A;  3IK9 A;  2YJH A;  5CRG A;  2OKA A;  3AY8 A;  5A4U A;  2FGX A;  5IIZ A;  2C3Q A;  4JE1 A;  4K7O A;  4NV5 A;  3F8U A;  4EIP A;  3VLN A;  2PUK C;  1C72 A;  2VM1 A;  3D0Z A;  2VD1 A;  3C7M A;  1BJX A;  4HQZ A;  4J2F A;  3MAK A;  3EVI A;  1ERU A;  3IA1 A;  1V9W A;  5FT3 A;  2HSY A;  2HYX A;  5ECO B;  1WOU A;  3DD3 A;  2YZH A;  2DC5 A;  3VUR A;  1YF1 A;  1GUK A;  1O7U A;  1U3A A;  2ZCT A;  2H75 A;  1O8W A;  4V2M A;  5CRE A;  5CP1 A;  2FCH A;  5A4V A;  3VPT A;  3I9V 2;  3GKK A;  3UBL A;  1TP9 A;  4KDX A;  4IHU A;  3FW2 A;  1DBY A;  5G30 A;  2CZ2 A;  1XOA A;  2YAN A;  5C04 A;  2L5O A;  4EUY A;  4MZB A;  2IJY A;  1ERT A;  1QQ2 A;  2VLT A;  1OAZ A;  1E6B A;  4ID0 A;  1GRX A;  4L8E A;  1AXD A;  2JSZ A;  2LTK A;  4TOP A;  5DCH A;  3HYP A;  4TR0 A;  2PVO C;  5DVB A;  1G0T A;  3F6F A;  1JLW A;  1AUC A;  5G1K A;  3ZIV A;  1OKT A;  3G7Y A;  3APS A;  2PN8 A;  4KH7 A;  4PGT A;  3M0F A;  1FOH A;  4MCU A;  5ECK B;  4GSN A;  5DQS A;  4ECI A;  3H93 A;  2F8F A;  4CDO A;  5DAL A;  3D4M A;  3QMX A;  5HQP A;  2L4C A;  2C0E A;  3CSI A;  3EPT A;  3UIW A;  3A5I A;  3KH7 A;  5KOX A;  3SWL A;  4OO4 A;  4GWR A;  3KTB A;  1LU4 A;  4OFM A;  3C8E A;  1PSQ A;  3WD6 A;  1B9Y C;  1SYX A;  4BA7 A;  4GF0 A;  1RK4 A;  1BED A;  1K0D A;  3UVT A;  2VL2 A;  4EIQ A;  4XS4 B;  4N30 A;  1GNE A;  2DJK A;  3CBU A;  3DVX A;  1QFN A;  1Z7P A;  3M3M A;  1M2A A;  4G9H A;  4BWQ A;  3QAG A;  4TVE A;  1GSY A;  4LLR A;  4K0G A;  3GA4 A;  5DAL B;  1G7E A;  6GSV A;  4WBR D;  1OE7 A;  1NHY A;  3GIX A;  17GS A;  3GUS A;  2H1G A;  1WE0 A;  4MF6 A;  6GST A;  4AJ6 A;  1URM A;  3E3E A;  2WRT A;  3H1N A;  2X8C A;  3CXG A;  5GZZ B;  4L0U A;  4V2N A;  1FHE A;  2YWO A;  1KTE A;  1AC1 A;  5IPH A;  1TRV A;  3UOM A;  1XVW A;  1UN2 A;  4MA9 A;  2V1M A;  3GSS A;  3IAS 2;  3HVV A;  4FH8 A;  1FB6 A;  3F0I A;  2CVD A;  1SK2 A;  2VOC A;  4OMV A;  3PGT A;  1GUH A;  1MDJ A;  3SBC A;  2AAW A;  4RI6 A;  2DBC A;  3WGE A;  4NV2 A;  3GST A;  3M1G A;  3KD0 A;  4KX4 A;  4WXT A;  4PUA A;  2H6X A;  5INY A;  1F9M A;  5KN3 A;  2R0P A;  2NPB A;  2JSY A;  3FR9 A;  1B9X C;  2X8H A;  1ZCP A;  3KIJ A;  2FHE A;  3GNJ A;  3LXZ A;  4NWY A;  1M2D A;  3DWV A;  3TKR A;  1Z7R A;  4FYB A;  4FYU A;  1SEN A;  4PQI A;  2YWM A;  2H0H A;  3P2A A;  1MD3 A;  1A2L A;  3TJF A;  5ID2 A;  2PGT A;  2IMI A;  3MNG A;  4NAX A;  2F9S A;  13GS A;  4KAE A;  3TRP A;  4POL A;  5DQY A;  3Q18 A;  4K2D A;  3DRN A;  1ZYN A;  3FMW A;  1A2M A;  3DEX A;  1NW2 A;  3A3T A;  4ECJ A;  2YWN A;  2RII A;  4LA1 A;  2HRN A;  1QGV A;  4O92 A;  2H70 A;  1FVJ A;  1G6W A;  3HY2 A;  1TRU A;  3GKX A;  2P5Q A;  2CAI A;  2X64 A;  1M7T A;  3GYK A;  2AHE A;  5B8A A;  2VL2 C;  3IXR A;  1YEP A;  3J7Y b;  5DCG A;  3EC3 A;  1T4Z A;  2VLU A;  3QPM A;  4MK3 A;  2MMO A;  4EVM A;  5ID2 B;  3F4T A;  4RQR A;  2H1A A;  4ZL7 A;  4ML6 A;  5KN2 A;  5JWR B;  6GSW A;  5B8B A;  4ZBB A;  1SYR A;  1PA3 A;  3QD9 A;  3RPP A;  3H79 A;  2GQM A;  4EKZ A;  1XWA A;  1TRS A;  1UVZ A;  4QQ7 A;  2XHF A;  4OWY A;  1GSE A;  2LST A;  1XBS A;  2ZUP A;  2KUC A;  4YQM A;  4IQ1 A;  5J41 A;  2R6K A;  4Q5N A;  1S3A A;  3ME8 A;  2GDR A;  4NHW A;  4N0V A;  5HFG A;  1EEM A;  1X9S B;  1XWK A;  4DSS B;  4BVY A;  4MF7 A;  2GQL A;  3BOA A;  2WGR A;  1ZMA A;  2CA8 A;  3G7J A;  2L6C A;  4G0K A;  3TJB A;  4GTU A;  2H6Z A;  1SKW B;  2E7P A;  1ZOF A;  2VAF A;  1PD2 1;  1MTC A;  3A2V A;  4Q5R A;  3P7X A;  4MAB A;  3TOT A;  3Q19 A;  4HZ4 A;  4KW6 A;  3FZ4 A;  3PH9 A;  2VCQ A;  2FNO A;  1B48 A;  2A2R A;  3IHQ A;  3WT2 A;  4CY8 A;  2RM6 A;  4NMU A;  2OE3 A;  4K9Z A;  3GMF A;  1WIK A;  4MJC A;  1K3L A;  2DIY A;  4O7H A;  3UAR A;  4EC0 A;  1EGR A;  3IE3 A;  3R3E A;  1X0R A;  4G0I A;  3Q6O A;  4PX1 A;  2I3Y A;  3US3 A;  2NDO A;  1O8X A;  5DBQ A;  1NM3 A;  2YN1 A;  3V1W A;  2VO4 A;  3HKR A;  3TJG A;  4KUN A;  1MD4 A;  1JZD A;  4V2L A;  2B5Y A;  3IV4 A;  5J4U A;  4HU7 A;  4LL4 B;  4BWS A;  2A4V A;  3I6A A;  5C00 A;  4JRR A;  1N8J A;  3ZLP A;  3KTL A;  2ON7 A;  2XBI A;  4HS1 A;  20GS A;  3GX0 A;  1OC3 A;  4HEA 2;  3HD5 A;  1B8X A;  3KCM A;  2E2G A;  3F6D A;  4G2E A;  1HYU A;  4GRF A;  5HR2 A;  1OE8 A;  4AGS A;  3UBK A;  1G6Y A;  4MH3 A;  2QGV A;  2I1U A;  1SJI A;  3PR8 A;  1ZL9 A;  1NHO A;  3Q74 A;  2LJK A;  3CRT A;  5A4W A;  2CX4 A;  2JZT A;  2ZNM A;  4ZL9 A;  4GSS A;  2DJ1 A;  1HNA A;  1H75 A;  4FO5 A;  4HUA A;  3EUR A;  3WYW A;  2EIQ A;  4X0X A;  5D9W A;  5AIV A;  1TI3 A;  1SJZ A;  3EE2 A;  3KGK A;  1V57 A;  4O32 A;  3TGZ A;  4XIH A;  2PWJ A;  1BQ7 A;  1E2Y A;  5LD0 A;  4OO5 A;  3D5J A;  5FHI A;  1O85 A;  4YKG A;  4J57 E;  4LL1 B;  3HCZ A;  4Z2T A;  2PER A;  3DVW A;  4BVX A;  4KSO A;  3EMP A;  3L9S A;  2C1Y A;  5JCU A;  2GGT A;  3TB2 A;  1VRS D;  2XPD A;  2OAC A;  4KSM A;  2EC4 A;  3GRX A;  4PNF A;  1GSU A;  1ABA A;  2HZF A;  4GQF A;  2WJU A;  1VF1 A;  2WCI A;  3OR5 A;  1NSW A;  4L5O A;  1TW9 A;  5JCW A;  2H76 A;  1XW6 A;  4JZQ A;  2NTO A;  5AIX A;  2F51 A;  5IMA A;  1BAY A;  3RDW A;  3C1S A;  1PN9 A;  1BX9 A;  4ULX A;  4E8E A;  3GH9 A;  2CT6 A;  5ELG A;  1X5D A;  5COH A;  1FAA A;  1F3B A;  5GSS A;  1YQ1 A;  1F3A A;  3N9J A;  4BVX B;  4MP4 A;  2R4V A;  1GUM A;  1DUG A;  4I5Q A;  4XCS A;  3HZ4 A;  4K7I A;  1SK0 A;  2WS2 A;  1A8L A;  3EIN A;  3FRC A;  1W89 A;  2GT6 A;  3ZIJ A;  3EU4 A;  3BBY A;  4XS4 A;  1QK8 A;  3QOU A;  3TCO A;  1J08 A;  1HNB A;  3C73 A;  1Z3E A;  2P0G A;  3HVX A;  2V2G A;  2GSQ A;  4PUR A;  4MDC A;  4CHS A;  3L78 A;  3O6T A;  3QAV A;  2YOI A;  2KHP A;  1VF4 A;  4K7N A;  3IHG A;  2MMN A;  2GQK A;  4ECC A;  2FWH A;  2VCZ A;  2L5L A;  3UAP A;  3IPZ A;  3D21 A;  4XS1 A;  3O3T A;  3GN3 A;  5IOX A;  1YJ6 A;  1THX A;  2K8S A;  1M99 A;  4NHZ A;  4O5U A;  1LBK A;  2O8V B;  1HNC A;  3H4K A;  2DMM A;  3WT1 A;  4FQU A;  4OFN A;  5JWO B;  4IQA A;  2VL3 A;  2ON5 A;  2DJ0 A;  3GKN A;  3RHC A;  1GLQ A;  2FD3 A;  1U88 A;  2VM2 A;  3LQ7 A;  1TTZ A;  4K5S A;  1GSQ A;  1AQX A;  1VF2 A;  1PX7 A;  3TUE A;  2OJL A;  4K2X A;  3TOU A;  1SKS B;  4HOJ A;  2VL9 A;  4PNG A;  1FG4 A;  1DE1 A;  2LNS A;  5DJL A;  3BCK A;  2KP2 A;  2EIR A;  4YAV A;  3BJ5 A;  1FO5 A;  4IP6 A;  4TW5 A;  2M46 A;  3I43 A;  2D2Z A;  2DJ3 A;  2IMK A;  4A5P A;  1ZYE A;  1N2A A;  4MMM A;  5GAN D;  5D73 A;  2GZY A;  1Z9H A;  4OFT A;  4TKY A;  4WKW A;  3HZ8 A;  1U3I A;  2DLX A;  1FW1 A;  5H5S A;  5JCG A;  1ERW A;  3G9B A;  3UL3 A;  2LUS A;  3IR4 A;  4FYC A;  5JWQ B;  2CAQ A;  3F9U A;  1YY7 A;  1PKW A;  2IPA A;  4RUV A;  4WF4 A;  3IBH A;  1SK1 A;  3R2Q A;  5GST A;  1UA5 A;  3CMI A;  2IMF A;  2OA7 A;  18GS A;  1TOF A;  5ELA A;  2MZC A;  2P31 A;  1B4Q A;  2H01 A;  2R0C A;  4JR6 A;  2WZ9 A;  2HFD A;  2KLX A;  3GTU A;  2O89 A;  2G2Q A;  1KNG A;  5DDL A;  2FWE A;  1CQH A;  3ISO A;  4KCE A;  5E59 A;  4JU5 A;  4TXV A;  2B5E A;  2C8U A;  4GXZ A;  2OBK A;  3VWX A;  1V58 A;  1WPI A;  1JHB A;  4MNN A;  2M72 A;  5IOW A;  3W8J A;  1CQG A;  3WGX A;  4F9Z A;  1ON4 A;  5CRW A;  3ZTL A;  12GS A;  1K0M A;  4MPG A;  5ECL B;  3CSJ A;  2K9F A;  2RUE A;  4IEL A;  1V2A A;  1K0N A;  3LEF A;  3ME7 A;  2L57 A;  4ICY A;  4K6X A;  3ZML A;  2LEG A;  5BMU A;  2LJR A;  5DAK A;  1EEJ A;  2WDU A;  5G1L A;  2C3T A;  1TK0 B;  2HRA A;  2LS5 A;  3GTU B;  4DSS A;  2LKU A;  3KZQ A;  4USS A;  4IJ3 A;  4WR4 A;  2YPM A;  5E4W A;  1MDK A;  2X99 A;  1WRY A;  4OCF A;  1TKD B;  1GTA A;  1XFL A;  1U87 A;  1A8Y A;  4MZC A;  4LMV A;  3LG6 A;  3TKS A;  1I5G A;  5B6M A;  4KGI A;  5CRH A;  1XW5 A;  1GTU A;  3L0H A;  1K3Y A;  2GZZ A;  5BRT A;  2E0Q A;  3TJJ A;  6GSY A;  3UMA A;  4I2T A;  1GTB A;  2H30 A;  5KN1 A;  1M9B A;  4Q5Q A;  3F3R A;  1WP0 A;  2C0G A;  5DAK B;  2OE1 A;  5H5R A;  5ECR B;  2FA4 A;  1ML6 A;  4YH2 A;  2H0G A;  1RW1 A;  2GZP A;  5HR3 A;  3GFK A;  4G19 A;  2C4J A;  1O81 A;  14GS A;  3IAM 2;  1GNW A;  1GUL A;  1KBN A;  1T3B A;  4I2U A;  2WUL A;  1MDI A;  1Z6N A;  1Z5Y E;  3HJM A;  1U6T A;  4TR3 A;  1TI1 A;  1R4W A;  2R37 A;  4XRA A;  1EOH A;  2H8L A;  3QFB C;  4TXO A;  3LGC A;  2K18 A;  4N10 A;  1GLP A;  1TU7 A;  1XOB A;  3ZRD A;  3F63 A;  3L9U A;  3GHA A;  3LOR A;  4KA0 A;  5IMF A;  3RPN A;  4EDY A;  2I9H A;  4WBJ A;  5EVO A;  1TDI A;  2F8A A;  3GL5 A;  1RQM A;  4X1U A;  5D93 A;  1IYI A;  1JZO A;  5IMD A;  2BTO T;  4DEJ A;  2HXK A;  2C3N A;  5IQY A;  3QCP A;  2FWG A;  2A4H A;  1F2E A;  4LMW A;  1JFU A;  1YZX A;  4XS6 A;  4AJ8 A;  4KE3 A;  2IFQ A;  3TKQ A;  1YEX A;  2CQ9 A;  2VLV A;  9GSS A;  3GUR A;  1ST9 A;  2TRX A;  4IN0 A;  3TKS E;  2VD0 A;  4ZB8 A;  3KMN A;  5KOW A;  2H6Y A;  3HJO A;  3ZIT A;  1EV4 A;  3MYD A;  5ECP B;  1Y25 A;  4TXO B;  1I9D A;  1PN0 A;  1X9M B;  3ZZX A;  1BYE A;  5GAP D;  2H71 A;  3HDC A;  3A2X A;  1YKA A;  2WFC A;  3UJ1 A;  4IS0 A;  3ED3 A;  1J9B A;  3ERF A;  2TRC P;  1S3C A;  5AIS A;  3W6G A;  3KH9 A;  3IC4 A;  2CV4 A;  4TN8 A;  1ZZY A;  2YJ7 A;  4OD7 A;  4POK A;  1EP7 A;  3FK8 A;  5HR0 A;  2LRN A;  2IFQ B;  4KDU A;  1XCC A;  5EPF A;  5IMV A;  2DKI A;  1R5P A;  5ECH B;  4RQX A;  1YKC A;  4WR5 A;  2QKE A;  1FVK A;  2MMZ A;  3C1R A;  2NVL A;  3TKS C;  1VF3 A;  4I6X A;  3JCM L;  2F3M A;  3NZN A;  1R7H A;  10GS A;  4RI7 A;  3EWL A;  2MBS A;  1GL8 A;  1XIY A;  4ZL8 A;  2GST A;  2IL3 A;  3F4S A;  1DE2 A;  1OC8 A;  4POB A;  5IPG A;  3KXO A;  4NPB A;  2LQO A;  3IOS A;  5B6N A;  2MYG A;  2H1B A;  3CTF A;  5AN1 A;  2KP1 A;  4EF0 A;  1F37 A;  3LYP A;  2R2J A;  3L4N A;  3FKF A;  5AGY A;  2GT5 A;  5ECI B;  3PIN A;  1X5C A;  5CO3 A;  2BJX A;  1AIU A;  3GH6 A;  2RUF A;  1PX6 A;  4NXI A;  5J9C A;  3A5W A;  3MDK A;  3KP9 A;  2JL4 A;  3TRX A;  5IO0 A;  1X9W B;  1ZYP A;  6GSX A;  5CRD A;  2YV7 A;  3KM6 A;  4KB3 A;  4V1A g;  1ACV A;  1IYH A;  4IP1 A;  4L0W A;  5HFK A;  2R0G A;  4BL7 B;  1EP8 A;  2TIR A;  1M9A A;  4HJ2 A;  5A5K A;  2GSR A;  1DSB A;  2DJ2 A;  4G0L A;  1K0C A;  1S3D A;  4WEY A;  1V40 A;  3CSH A;  2VIM A;  4HI7 A;  3S9F A;  4H86 A;  4Z7X A;  4L5L A;  2LRT A;  4DVC A;  5EL8 A;  1WJK A;  2IMD A;  3VWW A;  2B1K A;  4P3Y B;  3KJY A;  2FLS A;  2OBI A;  1MEK A;  4IGJ A;  4Q5F A;  4PUF C;  1Q4J A;  2B7K A;  3F3Q A;  3E9J B;  2B5X A;  4HJM A;  5J9B A;  1AAZ A;  3VI7 A;  2JZS A;  1PL2 A;  22GS A;  1SL0 B;  2L4Q A;  4Z2R A;  5ECN B;  3LWA A;  3ZFL A;  4K1F A;  3MIX A;  3QR6 A;  2HZE A;  3CYN A;  3GKM A;  4MF5 A;  4DSQ A;  2N5A A;  3U6V A;  3UEM A;  5J3R A;  5HFI A;  7GSS A;  3LW9 A;  1XW9 A;  4I8B A;  8GSS A;  2DSA A;  2GTU A;  1BG5 A;  3MWH A;  4MJE A;  5F06 A;  2R5G A;  3QFA C;  2CVK A;  4ZBA A;  4WET A;  2P5R A;  2HSM A;  4PQ1 A;  3ZRE A;  4J56 E;  2X8G A;  3ZMK A;  2XC2 A;  1EV9 A;  2OAD A;  2B3S A;  4IVF A;  2O85 A;  1JZR A;  5KEJ A;  2XBQ A;  4GQC A;  4F0C A;  6GSU A;  4XRD A;  4K8M A;  4OCE A;  1W4V A;  1XPV A;  2AUV A;  5ENU A;  2H66 A;  2IME A;  2Z9S A;  4KDY A;  2V6K A;  3FYG A;  4D73 A;  4YQU A;  1ILO A;  2HZE B;  5LCZ A;  4GST A;  4HU9 A;  4KCA A;  2ALB A;  5F0G A;  2I81 A;  3ERG A;  1R26 A;  2VUP A;  2VCW A;  3FR6 A;  2L59 A;  1A0R P;  1XXU A;  1J0F A;  3FZ9 A;  4O5R A;  1OKD A;  4MH2 A;  4BPY A;  2X4A A;  2C80 A;  2HSH A;  2B7J A;  3FR3 A;  4PTS A;  5G31 A;  2DKH A;  1SL2 B;  2C0D A;  1TU8 A;  4JR4 A;  3ZFB A;  2YP6 A;  4F03 A;  4GLT A;  3HVS A;  2O7K A;  2YZU A;  3RAZ A;  1PMT A;  4D73 B;  1YDK A;  5LNK e;  2VCV A;  4F82 A;  4HZ2 A;  4CY6 A;  4X4J A;  2AV4 A;  3HXS A;  2LV3 A;  3KMO A;  1SL1 B;  3PPU A;  2YNX A;  4EO3 A;  3EMX A;  1QUW A;  1TRW A;  4MZW A;  1K0B A;  5D9V A;  2MMA A;  1XVQ A;  2J9H A;  5KN0 A;  2QA2 A;  4PQH A;  2L6D A;  2IN3 A;  3P90 A;  3ERW A;  3F4R A;  3HJP A;  1O6J A;  1A24 A;  2FA8 A;  5ECS A;  2LNT A;  2JAC A;  3FZA A;  3EYT A;  1XWG A;  1QXH A;  3LXT A;  2K6V A;  1OC9 A;  2H0I A;  1Z6M A;  3LSZ A;  2LQQ A;  3U5R E;  4I97 A;  4ZB6 A;  1K0O A;  2OE0 A;  2K8V A;  2R3X A;  3D6I A;  3VI5 A;  4ACS A;  5B7C A;  2AJQ B;  3DML A;  1X5E A;  3GX8 A;  4MLY A;  3P8W A;  3M8N A;  1TK5 B;  2H73 A;  2HE3 A;  4ZB9 A;  3NOF A;  1Q98 A;  1PL1 A;  1A2J A;  4GCI A;  2CVB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...