2DJ0A

The solution structure of the thioredoxin domain of human thioredoxin-related transmembrane protein 2
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
137
structure length
137
Chain Sequence
GSSGSSGYIKYFNDKTIDEELERDKRVTWIVEFFANWSNDCQSFAPIYADLSLKYNCTGLNFGKVDVGRYTDVSTRYKVSTSPLTKQLPTLILFQGGKEAMRRPQIDKKGRAVSWTFSEENVIREFNLNELSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Thioredoxin-related transmembrane protein 2
publication title The solution structure of the thioredoxin domain of human Thioredoxin-related transmembrane protein 2
rcsb
source organism Homo sapiens
total genus 23
structure length 137
sequence length 137
ec nomenclature
pdb deposition date 2006-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2dj0A01
3TKSE 2REMA 4DSSB 5ELGA 4Q5QA 2I3YA 1TI1A 3ZYWA 6GSSA 1XWBA 4FYBA 5IMZA 2B7KA 12GSA 3VWVA 3ZREA 2FUG2 1MD4A 2X8HA 3TJFA 1Z6NA 3Q18A 5ECSA 2A4VA 2LJKA 2O7KA 2H1GA 3BJ5A 2KP2A 2YZUA 3KP9A 3IA1A 3KH9A 2VL2C 1PKWA 2GSSA 1LU4A 2H19A 4LLRA 2YNXA 2HSYA 1BAYA 2DJ2A 2GSTA 5D73A 5D9TA 3VFIA 2JZTA 4JZQA 4IP6A 4OMVA 4N0VA 1PD21 3IHQA 6GSUA 2JU5A 4F2IA 4ZB9A 3TB2A 2MBSA 4MZCA 4PQHA 2HNLA 2LRTA 1GLPA 2PN8A 2PVQA 2VM1A 1F3BA 2L6CA 1PX6A 4Q5NA 3DRNA 3U5RE 5LNKe 1XOBA 2NPBA 3FKFA 2H0HA 3ZMKA 1ACVA 4TVEA 3QPMA 4HDEA 3DEXA 2LUSA 4XS4A 4NWYA 1U6TA 4KDYA 4HI7A 5IOWA 2QSIA 3KGKA 1V2AA 2JACA 3SBCA 2I4AA 5CRHA 4DSQA 5DDLA 1XVWA 4QL9A 3QD9A 4ZILA 4K7NA 1SL2B 1VF2A 2LRNA 3J7Yk 1ST9A 3BCIA 3ISOA 3LYKA 2XHFA 1QXHA 5HR3A 2B3SA 2V32A 1OE8A 2RIIA 3FR3A 4IVFA 1FB6A 4HUAA 1M2AA 4G2EA 2R2JA 1GWCA 1UC7A 6GSTA 2N5AA 3O76A 5IO0A 1FVJA 1X5DA 6GSXA 4JRRA 5H5QA 2HI7A 5ECKB 1XPVA 1B4QA 4O7HA 1QK8A 4TR3A 2CAIA 5DALA 3E0UA 4QL7A 5F07A 5LD0A 2GQLA 3ERFA 1ABAA 2B1LA 4GQFA 5F05A 4GSNA 2VCTA 2JZRA 2CQ9A 1HNBA 3WGEA 1SENA 4MABA 3TRXA 2XPDA 5ECLB 1ZGNA 3ZVJA 3GN3A 4JR4A 2PGTA 1S3CA 3E9JB 4IHUA 2YV7A 3C1RA 3L9SA 3L4NA 1G7EA 2CVBA 2MYGA 4K7OA 3GKXA 4L0WA 1AXDA 4F03A 3VURA 5D9WA 1M0UA 2M72A 3GUSA 3U6VA 3H8QA 5GSTA 1WMJA 1EV4A 1SJIA 2FCHA 5D8IA 1ZYEA 2M46A 4FYCA 2HT9A 5KN0A 1O8WA 1VF1A 1VF3A 3WYWA 3EINA 1FG4A 5J41A 1A2LA 1A2MA 1RK4A 4AGSA 2LQOA 1TK0B 4EC0A 1QMVA 1AUCA 3CMIA 1QFNA 4O92A 3LEFA 2MMZA 1XIYA 5G1KA 3FZ5A 1WIKA 2CA8A 3IE3A 1SJZA 2VOCA 2IFQB 3KTLA 4TR1B 1FW1A 4MJCA 5G30A 4V2MA 3LXZA 1YQ1A 2AV4A 1I9DA 2C1YA 4KCEA 3V1WA 4LL4B 2VUPA 1Z7PA 2YJ7A 4X43A 3ZFLA 3K8NA 5D9XA 3KP8A 2XBIA 3WD6A 1URMA 3FEUA 2F8AA 1R5PA 5JWOB 1W89A 2H70A 4ECIA 5CNWA 3VWXA 1MD3A 5FT3A 2H76A 4HEA2 3UEMA 4WF4A 2FNOA 2K8SA 3GH6A 1F3AA 3PH9A 1GSFA 1O81A 3P90A 2PPTA 4P3YB 5ECPB 1Z6MA 1FAAA 1EEMA 1YY7A 3M3MA 1CQGA 4POLA 1PQNA 2H30A 1OKTA 2DLXA 4N11A 3BCKA 1GSQA 1N2AA 1GSDA 2ON7A 4H86A 1FHEA 3GYKA 3G9BA 2OBKA 5AIXA 3ZZXA 4GF0A 3VI5A 2B5XA 3ZFBA 2C0DA 3TJKA 1GSSA 1T1VA 4D73B 4MDCA 1X5EA 3QR6A 4LMVA 1ZMAA 3WT2A 4PNGA 4HZ2A 5C04A 4ACSA 2X8GA 3G7YA 1XW6A 2H6YA 3P7XA 2WFCA 4XS1A 3PR8A 5B7CA 3F3RA 3F3QA 2JZSA 1GSUA 1B4PA 1OKDA 1TDIA 2ALBA 1E6BA 1PMTA 4FIWA 3EURA 1G6WA 4MZBA 1V98A 5DJMA 2ZUPA 1KNGA 2BJXA 3FYGA 4IKHA 4IP1A 2NBSA 1Z9HA 2K18A 3W8SA 1K0DA 4MMMA 1JZDA 1HYUA 1LJRA 3CSHA 2HZFA 5IMFA 4YQMA 5ID2A 1M9BA 2H73A 4BWQA 2V6KA 1YF1A 3TKSA 4MZWA 2R5GA 2DJKA 5B6MA 5ECNB 4XRDA 3TDGA 18GSA 2HFDA 4AJ6A 5CAXA 3LSZA 1PX7A 4I5QA 3ZMLA 4ISDA 4L0UA 3DXBA 4E8EA 1CQHA 4KB3A 1SU9A 3UOMA 3GURA 4XRAA 1AW9A 3I9V2 1DE1A 5KEJA 1Y25A 3IRAA 2E0QA 5EPFA 3C8EA 1SD9A 1WE0A 2FWEA 1WPIA 3F6DA 2P31A 1R26A 1J0FA 1K3OA 2D2ZA 2C3NA 4MF6A 4ULXA 1TKDB 1XZOA 3WGDA 4GSTA 2YOIA 2KP1A 3KD0A 5AN1A 1PN9A 3RAZA 2R37A 2I1UA 3G7JA 2IPAA 1S3AA 2HRNA 3FZAA 3MSZA 1XFLA 9GSSA 2ZNMA 1XWCA 2QC7A 5ECHB 3RDWA 4LL1B 4GSSA 1K0MA 4ZB6A 3HXSA 4LMWA 1M2DA 3KXOA 1M2BA 1T4ZA 5IO2A 1GP1A 1TP9A 3HHVA 4IW9A 1TRSA 3QAGA 1ZL9A 1T7PB 3DKSA 3C71A 3WT1A 4PUAA 3ZIVA 4OO4A 1NM3A 2GZZA 2VIMA 3RPPA 1GSEA 2LNTA 2DJ1A 1XW9A 1M99A 1GUMA 4WXTA 5DQSA 3KZQA 5H5SA 1OVNA 2IMIA 1PSQA 2EIRA 1S3DA 1GTIA 5DAKB 2CVKA 2DMLA 2CX4A 4CW9A 4YAPA 2IMKA 3N9JA 1SL1B 4OFNA 2RUEA 3LJRA 2VLUA 2CX3A 3QCPA 2IMEA 3GHAA 1SK2A 1EV9A 2OKAA 3W6GA 4AF2A 3TCOA 2I9HA 4X0XA 2IN3A 2L5LA 1HQOA 3LG6A 5CRGA 14GSA 2AUVA 2DJJA 4NMUA 1A23A 1DUGA 2AHEA 4IELA 1OC8A 1THXA 1O6JA 2EC4A 4ML6A 2LKUA 5J5NA 2B5YA 2IMFA 2YWMA 3ERWA 4GCIA 2V41A 4KGIA 3L9VA 22GSA 4WBRD 1ERTA 1X5CA 4TXOA 4LA1A 5EL8A 4J56E 2ES7A 4IJ3A 3GL3A 5F06A 1PKZA 2JSYA 1B48A 3F6FA 3F4RA 4TOPA 3GV1A 4BL7A 4WF5A 4DSRA 4AJ8A 2VL2A 4ID0A 1XW5A 2KHPA 1GSYA 5G31A 1SKSB 1GNEA 1ERUA 2KOKA 3LYPA 4KA0A 4ECBA 3A2WA 5DQYA 5FHIA 5G2ZA 3D5JA 2WZ9A 1JZOA 3LORA 5L71A 1GNWA 2K8VA 3D6IA 3MAKA 1USBA 3IOSA 3TOUA 2R4VA 3ZITA 5IOXA 1X9SB 2KUCA 2FLSA 4KCAA 2FY6A 2HE3A 3GTUB 1JLVA 3ED3A 1SL0B 1QUWA 5HQPA 1V9WA 4IN0A 1A8LA 3GSSA 4EXJA 4NAXA 3NZNA 3A3TA 5JWQB 3SWLA 3C1SA 2L5OA 4JR6A 2JADA 2MMOA 3AY8A 1V40A 4E8HA 5CP1A 5LCZA 3A5WA 4PUFC 3TRQA 3ZIJA 1RW1A 3H79A 3MNGA 3TJJA 4CHSA 3IPZA 4NHWA 1SYRA 5D93A 3ERGA 4ZL9A 2XBQA 5D96A 2HZEB 4IQ1A 5J4UA 4I2TA 5EY6A 4F9ZA 2CV4A 2IFQA 5GSSA 2OA7A 1NHOA 3HKRA 1B9XC 4KSOA 4TR1A 4GQCA 5DCHA 2QKEA 4XS4B 2AJQB 2RM5A 3EMXA 3LGCA 1K0NA 2LRCA 2MBTA 1EP8A 4N0ZA 5J3RA 4WR5A 2GVPA 3HZ4A 5AISA 5ECQB 1KBNA 16GSA 4GLTA 2HSHA 2LJAA 5DBQA 4FH8A 3FRCA 2GTUA 1GTAA 4F0BA 1A2JA 3CBUA 4WKWA 4OO5A 2I81A 3ZLPA 1YKAA 2H71A 1Y6EA 1PRXA 4TN8A 2G2QA 3UL3A 2FHEA 2XPEA 1O85A 3PINA 1V58A 4L5OA 3L78A 5JCGA 3CYNA 5IMVA 5A5KA 3DGQA 3BD2A 3OR5A 4PQIA 2GQKA 4J57E 3CSIA 2N5BA 3IK9A 1QGVA 3C73A 4EO3A 1GH2A 4GRFA 2X64A 5IMCA 5F0GA 4POKA 5C00A 1J08A 1O73A 1FVKA 5CYYA 2X8CA 3QMXA 3KMOA 1MDIA 3QFBC 1A0FA 1YF0A 2C0GA 3GFKA 2VD1A 1ILOA 2VAFA 1BQ7A 3GX8A 1KEBA 2H75A 1AIUA 4D73A 4QQ7A 3MWHA 1DE2A 2VD0A 2H8LA 3EVIA 3LWAA 3IK7A 1G7OA 4WR4A 3KMNA 1XVQA 3UMAA 4TW5A 2LSTA 3LXTA 5HFIA 2C0EA 1G0TA 3GNJA 2IJYA 1G6YA 2BMXA 1GTUA 1U3AA 3FW2A 5ECOB 2PBJA 3HVXA 2P0GA 1OC9B 2VCZA 3QOUA 5DJLA 3HDCA 5COHA 3D22A 4V1Ap 1EP7A 1H4OA 1ZZYA 3H1NA 3N5OA 2WULA 5B6NA 3HJPA 3VWUA 4MLYA 3CTGA 4MA9A 3US3A 4K8MA 4ZXGA 2DC5A 1MEKA 1LBKA 4BWSA 4V2LA 3UBKA 1B9YC 2H1DA 1UA5A 3TJBA 2F3MA 4YQUA 1EGRA 1BG5A 4RUVA 2M80A 4WETA 1TRWA 2YANA 2AAWA 4F0CA 5INYA 2FD3A 2ON5A 4HOJA 4BVXA 1HD2A 3IAS2 2OADA 3M9KA 3E3EA 3DIEA 4CDOA 2VCQA 4DVCA 1MDKA 3F4SA 2YJHA 2PU9C 2R3XA 1M9AA 1JLWA 3IC4A 2VCWA 4MF5A 4Q5RA 2L57A 3APOA 4MCUA 3UJ1A 1K0CA 2J23A 4IQAA 2YPMA 1N8JA 1EZKA 3HZ8A 3F0IA 2Z9SA 5J9BA 2IMDA 4EE0A 5HFKA 4PNFA 2R6KA 3EE2A 4HQZA 2RLIA 3DYRA 4KDUA 1GTBA 2E2GA 4TXVA 1YJ6A 2OE3A 2ZCTA 2OBIA 5CRWA 2YZHA 4POBA 5CO3A 1MTCA 1TRVA 4Q5FA 4V2NA 3O3TA 2VLVA 3EMPA 1QQ2A 2K6VA 3IBHA 1PL2A 3KIJA 4MJEA 2DMMA 4PQ1A 2WGRA 3CTFA 4K6XA 4DSSA 2KLXA 4WEYA 2YV9A 1EOHA 4MPGA 4PGTA 3TJGA 5DAKA 2NTOA 4XTSA 5IIZA 3GRXA 6GSVA 5IPGA 1Z7RA 3D21A 3P2AA 2F51A 3ME8A 5IQYA 3HY2A 4MJAA 3M8NA 1B8XA 2CZ2A 1K3YA 3HCZA 3EWLA 3Q74A 2FGXA 3TGZA 3P8WA 4RQXA 3R2QA 1NW2A 1SYXA 3FK8A 4NXIA 4TR4A 3H93A 1ERWA 1SK1A 2YP6A 2GT6A 3GIXA 2B1KA 5GZZB 2BTOT 3UIWA 2C3TA 1SKRB 4EL1A 1TU7A 5JCUA 4ZB8A 3HYPA 2JSZA 5ENUA 4MP4A 3IDVA 1Z5YE 5FWGA 5JCWA 4RQRA 3TOTA 4YH2A 2MMNA 5IM9A 3VWWA 1BYEA 4KDXA 5ABRA 1OAZA 4ILFA 1T00A 2HLSA 5KN2A 2C0FA 1OC3A 5B8BA 4ECCA 1UN2A 3LQ7A 1XOAA 4KNDA 1K3LA 3C7MA 4BVYA 5ECIB 5GAND 4ECJA 1X0RA 5F8BA 2L4QA 1XWAA 2DBCA 3NOFA 2HXKA 4G10A 3FZ9A 4KUNA 3GMFA 1SKWB 3GTUA 2V1MA 3M0FA 19GSA 3MDKA 4O5RA 3TUEA 4JE1A 1MDJA 4K2DA 1ML6A 1SK0A 2O85A 4NV2A 3IR4A 2F9SA 4ZBDA 10GSA 4GTUA 2TRXA 1HNCA 1F9MA 1TOFA 3GL5A 3RPNA 3NIVA 1BEDA 4MK3A 1J9BA 4L8EA 4YAVA 2H1AA 2GZPA 3RHCA 2H0IA 3KM6A 3Q6OA 1ZYQB 4X1UA 1K0AA 2WRTA 3HVSA 4EKZA 3TKRA 1M7TA 4EF0A 3VK9A 2L59A 2PUKC 3VLNA 1E2YA 4HS1A 1R7HA 2LQQA 2E2MA 4OCFA 2LTKA 2RM6A 2HZEA 4K9ZA 3M9JA 3CSJA 2H1BA 2LNSA 3ZVJD 3FZ4A 4PX1A 2EIQA 2O89A 4KE3A 2LS5A 4NPBA 3GKNA 2YCDA 1Q4JA 5AGYA 3RHBA 1HNAA 1YKCA 1VRSD 2IIYA 4OD7A 5H5RA 2H66A 4JU5A 1YZXA 3IXRA 1OE7A 2N5FA 3FHKA 3QDNA 2VL9A 5B8AA 1FB0A 1TJDA 3HJMA 4KSMA 3D0ZA 4TXOB 4I8BA 1I5GA 3GX0A 3DMLA 2GT5A 2C4JA 3FY7A 1AAZA 3A2XA 2EIOA 2B6MA 3ZL5A 2OJLA 1U87A 1K0OA 1BX9A 5JWRB 4G19A 5ELAA 1KTEA 4MH2A 1JHBA 4EDYA 3VPQA 4BA7A 5DCGA 3EC3A 3I43A 4G9HA 4TR0A 17GSA 1GRXA 1UVZA 3CRUA 1JZWA 2WB9A 1R4WA 4KAEA 2C8UA 2H0GA 2GGTA 5KN1A 1NSWA 3ME7A 2DIYA 4ZL7A 3FR6A 1SJ6A 2GLRA 1JZRA 2HYXA 1F6MC 3QFAC 3F9UA 2TRCP 3GKKA 3KJYA 3LFLA 2CAQA 3H4KA 4HJ2A 2A2RA 4NV5A 3EU4A 2NVLA 1XWGA 3S9FA 5CRDA 3UVTA 4MH3A 2OE0A 4PXOA 2V6OA 2VO4A 1ON4A 3KCMA 3VI7A 3Q19A 2YWIA 1EOGA 3TRPA 2WJUA 1Z3EA 2F8FA 4IGJA 4K7IA 4ML1A 3DVWA 3ZRDA 4OFMA 1TTZA 4XS6A 2CVDA 4TKYA 2VCXA 5KN3A 5DALB 1OC9A 2H74A 2C3QA 1EGOA 4EUYA 4F82A 2GQMA 5E59A 4EVMA 1WP0A 1U3IA 2E7PA 1F2EA 1PGTA 4XIHA 1WWJA 1ERVA 3GH9A 2O87A 2YWOA 5G1LA 2H01A 1U88A 5D9VA 1W4VA 3HD5A 3TKQA 1F37A 13GSA 1TU8A 2IL3A 1TXXA 4IS0A 2B5EA 3EYTA 5A4UA 4JEDA 1XWKA 3F63A 3FR9A 2H6XA 3I6AA 3L9UA 3GKMA 4OCEA 3GSTA 4HU9A 2FA8A 4IBPA 4ZL8A 1XCCA 3I69A 2JL4A 3CRTA 4EDZA 3M1GA 4HZ4A 3QAVA 3ZTLA 3APQA 4XHMA 1TI3A 3G7IA 5HR2A 1TW9A 1XBSA 4IJIA 4ZIJA 1FOVA 2DJ3A 1O8XA 1ZOFA 1NHYA 4MF7A 1WRYA 2X99A 1Q98A 2VCVA 3D4MA 2HRFA 2AB6A 4NHZA 3JCML 6GSWA 2J9HA 3EU3A 5CREA 5HR1A 2XC2A 4KH7A 3BOAA 3W8JA 4RI6A 3KH7A 3UAPA 1A8YA 4Z7XA 2B7JA 1AQVA 2P5RA 1T4YA 2FWFA 4ZBAA 3F4TA 2L6DA 2GSRA 4HJMA 5E4WA 20GSA 2CT6A 1GUHA 1WOUA 1T3BA 3O6TA 3TKSC 2GSQA 2TIRA 2G0FA 2RUFA 5IMAA 3BBYA 7GSSA 5A4VA 2K9FA 2FWGA 3IV4A 2FWHA 1IYIA 2PMTA 3HVVA 4BPYA 4K0NA 2CZ3A 1TK8B 2WCIA 1X9MB 1XXUA 2H72A 2WDUA 5IPHA 4N10A 1RQMA 5DVBA 5A4WA 4J2FA 1GL8A 2OE1A 1FO5A 5G5FA 1WJKA 3L0HA 1C72A 1PA3A 11GSA 2AYTA 1H75A 4WBJA 1AQXA 4RI7A 4I6XA 4FYUA 4O32A 2LEGA 1O7UA 2L4CA 1PL1A 1V57A 1A24A 1TRUA 2VM2A 1THOA 5EVOA 5ECRB 1YEXA 4KX4A 3UARA 1K0BA 1EWXA 4JBBA 1BJXA 4FO5A 1IYHA 4PURA 2PVOC 1AQWA 2NDOA 2WS2A 3UVHA 4ZBBA 4N30A 2V2GA 2LJRA 2H6ZA 2PERA 3UBLA 2OACA 3KTBA 4OWYA 5G5EA 4DEJA 1GLQA 1GUKA 5AIVA 2C80A 1VF4A 3PGTA 2P5QA 5HR0A 5HFGA 4TRXA 1EEJA 5J9CA 1A0RP 2QGVA 2YN1A 3CXGA 3KEBA 3HJOA 3VPTA 1JFUA 2MZCA 4YQVA 5ECMB 5IMDA 4MJBA 4GWRA 4I97A 4AJ7A 2GZYA 2IWTA 1T8EB 1DBYA 2DJ0A 3A2VA 4HQSA 3J7Yb 3GA4A 8GSSA 4I2UA 4L5LA 2DIZA 5ID2B 4XCSA 4MPFA 3APSA 1VGLA 3DVXA 3TKPA 3D4TA 1GULA 4K1FA 1YEPA 2O8VB 4GXZA 6GSYA 3DD3A 4KW6A 2DSAA 1OYJA 2VL3A 2GS3A 4K0GA 5GAPD 2YWNA 3IAM2 2PWJA 1ZCPA 3F8UA 3RBTA 3HA9A 2MMAA 2VLTA 1TK5B 1DSBA 1R5AA 3QAWA 4OFTA 1YDKA 1X9WB 1AC1A 2FA4A 1SD8A 4POMA 4V1Ag 2GDRA 3WGXA 4HU7A 2A2SA 2LV3A 3DWVA
chains in the Genus database with same CATH superfamily
3TKSE 3A5IA 2REMA 4DSSB 5ELGA 4Q5QA 2I3YA 1TI1A 3ZYWA 6GSSA 1XWBA 4FYBA 5IMZA 2B7KA 12GSA 3VWVA 3ZREA 2FUG2 1MD4A 2X8HA 3TJFA 1Z6NA 3Q18A 1XG8A 5ECSA 2A4VA 2LJKA 2O7KA 2H1GA 3BJ5A 2KP2A 2YZUA 3KP9A 3IA1A 3KH9A 2VL2C 1PKWA 2GSSA 1LU4A 2H19A 4LLRA 2YNXA 2HSYA 1BAYA 2DJ2A 2GSTA 5D73A 5D9TA 3VFIA 2JZTA 4JZQA 4IP6A 4OMVA 4N0VA 1PD21 3LW9A 3IHQA 6GSUA 2JU5A 4F2IA 4ZB9A 3TB2A 2MBSA 4MZCA 4PQHA 2HNLA 2LRTA 1GLPA 2PN8A 2PVQA 2VM1A 1F3BA 2L6CA 1PX6A 4Q5NA 3DRNA 3U5RE 5LNKe 3IC8A 1XOBA 2NPBA 3FKFA 2H0HA 3ZMKA 1ACVA 4TVEA 3QPMA 4HDEA 3DEXA 4EIQA 2LUSA 4XS4A 1PFOA 4NWYA 1U6TA 4KDYA 4HI7A 5IOWA 2QSIA 3KGKA 1V2AA 2JACA 3SBCA 2I4AA 5CRHA 4DSQA 5DDLA 1XVWA 4QL9A 3QD9A 4ZILA 4K7NA 1SL2B 1VF2A 2LRNA 3J7Yk 1ST9A 2UZ8A 3BCIA 3ISOA 3LYKA 2XHFA 1QXHA 5HR3A 2B3SA 2V32A 1OE8A 2RIIA 3FR3A 4IVFA 1FB6A 4HUAA 1M2AA 4G2EA 2R2JA 1GWCA 1UC7A 4BL7B 6GSTA 2N5AA 3O76A 5IO0A 1FVJA 1X5DA 6GSXA 4JRRA 5H5QA 2HI7A 5ECKB 1XPVA 1B4QA 4O7HA 1QK8A 4TR3A 2CAIA 5DALA 3E0UA 4QL7A 5F07A 5LD0A 2GQLA 3ERFA 1ABAA 2B1LA 4GQFA 5F05A 4GSNA 2VCTA 2JZRA 2CQ9A 1HNBA 3WGEA 1SENA 4MABA 3TRXA 2XPDA 5ECLB 1ZGNA 3ZVJA 3GN3A 4JR4A 2PGTA 1S3CA 2HRAA 3E9JB 4IHUA 2YV7A 3C1RA 3HVNA 3L9SA 3L4NA 1G7EA 2CVBA 2MYGA 4K7OA 3GKXA 4L0WA 1AXDA 4F03A 3VURA 5D9WA 1M0UA 2M72A 1M3IA 3GUSA 3U6VA 3H8QA 5GSTA 1WMJA 1EV4A 1SJIA 2FCHA 5D8IA 1ZYEA 2M46A 4FYCA 2HT9A 5KN0A 1O8WA 1VF1A 1VF3A 3WYWA 3EINA 1FG4A 5J41A 1A2LA 1A2MA 1RK4A 4AGSA 2LQOA 1TK0B 4EC0A 1QMVA 1AUCA 3CMIA 1QFNA 4O92A 3LEFA 2MMZA 1XIYA 5G1KA 3FZ5A 1WIKA 2CA8A 3IE3A 1SJZA 2VOCA 2IFQB 3KTLA 4CY6A 4TR1B 1FW1A 4MJCA 5G30A 4V2MA 3LXZA 1YQ1A 2AV4A 1I9DA 2C1YA 4KCEA 3V1WA 4LL4B 2VUPA 1Z7PA 2YJ7A 4X43A 3ZFLA 3K8NA 5D9XA 3KP8A 2XBIA 3WD6A 1URMA 3FEUA 2F8AA 1R5PA 5JWOB 1W89A 2X49A 2H70A 4ECIA 5CNWA 3VWXA 1MD3A 5FT3A 2H76A 4HEA2 3UEMA 4WF4A 2FNOA 2K8SA 3GH6A 1F3AA 3PH9A 1GSFA 1O81A 3P90A 2PPTA 4P3YB 5ECPB 1Z6MA 1FAAA 1EEMA 1YY7A 3M3MA 1CQGA 4POLA 1PQNA 2H30A 1OKTA 2DLXA 4N11A 3BCKA 1GSQA 1N2AA 1GSDA 3CQFA 2ON7A 4H86A 1FHEA 3GYKA 3G9BA 4K2XA 2OBKA 5AIXA 3ZZXA 4GF0A 3VI5A 2B5XA 3ZFBA 2C0DA 3TJKA 4ICYA 1GSSA 1T1VA 4D73B 4MDCA 1X5EA 3QR6A 4LMVA 1ZMAA 3WT2A 4PNGA 4HZ2A 5C04A 4ACSA 2X8GA 3G7YA 1XW6A 2H6YA 3P7XA 2WFCA 4XS1A 3PR8A 5B7CA 3F3RA 3F3QA 2JZSA 1GSUA 1B4PA 1OKDA 1TDIA 2ALBA 1E6BA 1PMTA 4FIWA 4YKGA 3EURA 1G6WA 4MZBA 1V98A 5DJMA 2ZUPA 1KNGA 2BJXA 3FYGA 4IKHA 4IP1A 2NBSA 1Z9HA 4G0LA 2K18A 3W8SA 1K0DA 4MMMA 1JZDA 1HYUA 1LJRA 3CSHA 2HZFA 5IMFA 4YQMA 5ID2A 1M9BA 2H73A 4BWQA 2V6KA 1YF1A 3TKSA 4MZWA 2R5GA 4PTSA 2DJKA 5B6MA 5ECNB 4XRDA 3TDGA 18GSA 2HFDA 4AJ6A 5CAXA 3LSZA 1PX7A 4I5QA 3ZMLA 4ISDA 4L0UA 3DXBA 4O5QA 4E8EA 1CQHA 4KB3A 1SU9A 3UOMA 3GURA 4XRAA 4EIPA 1AW9A 3I9V2 1DE1A 2HSMA 4BVXB 5KEJA 1Y25A 3IRAA 2E0QA 5EPFA 3C8EA 1SD9A 1WE0A 2FWEA 1WPIA 3F6DA 2P31A 5KOXA 1R26A 1J0FA 1K3OA 2D2ZA 2C3NA 4MF6A 4ULXA 1TKDB 1XZOA 3WGDA 4GSTA 2YOIA 2KP1A 3KD0A 5AN1A 1PN9A 3RAZA 2R37A 2I1UA 3G7JA 2IPAA 1S3AA 2HRNA 3FZAA 3MSZA 5KOWA 1XFLA 9GSSA 2ZNMA 1XWCA 2QC7A 5ECHB 3RDWA 4LL1B 4GSSA 1K0MA 3MIXA 4ZB6A 3HXSA 4LMWA 1M2DA 3KXOA 1M2BA 1T4ZA 5IO2A 1GP1A 1TP9A 3HHVA 4IW9A 1TRSA 3QAGA 1ZL9A 1T7PB 3DKSA 3C71A 3WT1A 4PUAA 3ZIVA 4OO4A 1NM3A 2GZZA 2VIMA 3RPPA 1GSEA 2LNTA 2DJ1A 1XW9A 1M99A 1GUMA 4WXTA 5DQSA 3KZQA 5H5SA 1OVNA 2IMIA 1PSQA 2EIRA 4FQUA 2R0PA 1S3DA 1GTIA 5DAKB 2CVKA 2DMLA 2CX4A 4CW9A 4YAPA 2IMKA 3N9JA 1SL1B 4OFNA 2RUEA 3LJRA 2VLUA 2CX3A 3QCPA 2IMEA 3GHAA 1SK2A 1EV9A 2OKAA 3W6GA 4AF2A 2DKIA 3TCOA 2I9HA 4X0XA 2IN3A 2L5LA 1HQOA 3EPTA 1PN0A 3LG6A 5CRGA 14GSA 2AUVA 2DJJA 4NMUA 1A23A 1DUGA 2AHEA 4IELA 1OC8A 1M3JA 4O5UA 1THXA 1O6JA 2EC4A 4ML6A 2LKUA 5J5NA 2B5YA 2IMFA 2YWMA 3ERWA 4GCIA 2V41A 4KGIA 3L9VA 22GSA 4WBRD 1ERTA 1X5CA 4TXOA 4LA1A 5EL8A 4J56E 2ES7A 4IJ3A 3GL3A 5F06A 1PKZA 2JSYA 1B48A 3F6FA 3F4RA 4TOPA 3GV1A 4BL7A 4WF5A 4DSRA 4AJ8A 2VL2A 4ID0A 1XW5A 2KHPA 1GSYA 5G31A 1SKSB 1GNEA 2R0CA 1ERUA 2KOKA 3LYPA 4KA0A 4ECBA 3A2WA 5DQYA 5FHIA 5G2ZA 3D5JA 2WZ9A 4BVYB 1JZOA 3LORA 5L71A 1GNWA 2K8VA 1FOHA 3D6IA 3MAKA 1USBA 3IOSA 3TOUA 2R4VA 3ZITA 5IOXA 1X9SB 2KUCA 2FLSA 4KCAA 2FY6A 2HE3A 3GTUB 1JLVA 3ED3A 1SL0B 1QUWA 5HQPA 1V9WA 1ZYPA 4IN0A 1A8LA 3GSSA 4EXJA 4NAXA 3NZNA 3A3TA 5JWQB 3SWLA 3C1SA 2L5OA 4JR6A 2JADA 2MMOA 3AY8A 1V40A 4E8HA 5CP1A 5LCZA 3A5WA 4PUFC 3TRQA 3ZIJA 1RW1A 3H79A 3MNGA 3TJJA 4CHSA 3IPZA 4NHWA 1SYRA 5D93A 3ERGA 4ZL9A 2XBQA 5D96A 2HZEB 4IQ1A 5J4UA 4I2TA 5EY6A 4F9ZA 2CV4A 2IFQA 5GSSA 2OA7A 1NHOA 3HKRA 1B9XC 4KSOA 4TR1A 4GQCA 5DCHA 2QKEA 4XS4B 2AJQB 2RM5A 3EMXA 3LGCA 1K0NA 2LRCA 2MBTA 1EP8A 4N0ZA 5J3RA 4WR5A 2GVPA 3HZ4A 5AISA 1KBNA 5ECQB 16GSA 4GLTA 2HSHA 2LJAA 5DBQA 4G0IA 4FH8A 3FRCA 2GTUA 1GTAA 2QA1A 4F0BA 1A2JA 3CBUA 4WKWA 4OO5A 2I81A 3ZLPA 1YKAA 2H71A 4K5SA 1Y6EA 1PRXA 4TN8A 2G2QA 3UL3A 2FHEA 2XPEA 1O85A 3PINA 1V58A 4L5OA 3L78A 5JCGA 3CYNA 4K5RA 5IMVA 5A5KA 3DGQA 3BD2A 4USSA 3OR5A 2GQKA 4J57E 4PQIA 3CSIA 2N5BA 3IK9A 1QGVA 3C73A 2DKHA 4EO3A 1GH2A 4GRFA 2X64A 5IMCA 5F0GA 4POKA 5C00A 3R3EA 1J08A 1O73A 1FVKA 5CYYA 2X8CA 3QMXA 3KMOA 1MDIA 3QFBC 1A0FA 1YF0A 2C0GA 3GFKA 2VD1A 1ILOA 2VAFA 1BQ7A 3GX8A 1KEBA 2H75A 1AIUA 4D73A 4QQ7A 3MWHA 1DE2A 2VD0A 2H8LA 3EVIA 3LWAA 3IK7A 1G7OA 4WR4A 3KMNA 1XVQA 3UMAA 4TW5A 2LSTA 3LXTA 5HFIA 2C0EA 1G0TA 3GNJA 2IJYA 1G6YA 2BMXA 1GTUA 1U3AA 3FW2A 5ECOB 2PBJA 3HVXA 2P0GA 1OC9B 2VCZA 3QOUA 5DJLA 4BIKA 3HDCA 5COHA 3D22A 4V1Ap 1EP7A 1H4OA 1ZZYA 3H1NA 3N5OA 2WULA 5B6NA 3HJPA 3VWUA 4MLYA 3CTGA 4MA9A 3US3A 4K8MA 4ZXGA 2DC5A 1MEKA 4YKFA 4Z2TA 1LBKA 4BWSA 4V2LA 3UBKA 1B9YC 2H1DA 1UA5A 3TJBA 2F3MA 4YQUA 1EGRA 1BG5A 4RUVA 2M80A 4WETA 1TRWA 2YANA 2AAWA 4F0CA 5INYA 2FD3A 2ON5A 4HOJA 4BVXA 1HD2A 3IAS2 2A2PA 2OADA 3M9KA 4A5PA 3E3EA 4Z2RA 3DIEA 4CDOA 2VCQA 4DVCA 1MDKA 3F4SA 4KF9A 2YJHA 2PU9C 2R3XA 1M9AA 1JLWA 3IC4A 2VCWA 4MF5A 2QA2A 4Q5RA 2L57A 3APOA 4MCUA 3UJ1A 1K0CA 2J23A 4IQAA 2YPMA 1N8JA 1EZKA 3HZ8A 3F0IA 2Z9SA 5J9BA 2IMDA 4EE0A 5HFKA 4PNFA 2R6KA 3EE2A 4HQZA 2RLIA 3DYRA 4KDUA 5BMUA 1GTBA 2E2GA 2R0GA 4TXVA 2A4HA 1YJ6A 2OE3A 2ZCTA 2OBIA 5CRWA 2YZHA 4POBA 5CO3A 1MTCA 1TRVA 4Q5FA 4V2NA 3O3TA 2VLVA 3EMPA 1QQ2A 2K6VA 3IBHA 1PL2A 3KIJA 4MJEA 2DMMA 4PQ1A 2WGRA 3CTFA 4K6XA 4DSSA 2KLXA 4WEYA 2YV9A 1EOHA 4MPGA 4PGTA 3TJGA 5DAKA 2NTOA 4XTSA 5IIZA 3GRXA 6GSVA 5IPGA 1Z7RA 3D21A 3P2AA 2F51A 3ME8A 5IQYA 3HY2A 4MJAA 2HRKA 3M8NA 1B8XA 2CZ2A 1K3YA 3HCZA 3EWLA 3Q74A 2FGXA 3TGZA 3P8WA 4RQXA 3R2QA 1NW2A 1SYXA 3FK8A 4NXIA 4TR4A 3H93A 1ERWA 4MNNA 1SK1A 2YP6A 2GT6A 3GIXA 2B1KA 5GZZB 2BTOT 3UIWA 2C3TA 1SKRB 4EL1A 1TU7A 5JCUA 4ZB8A 3HYPA 2JSZA 5ENUA 4MP4A 3IDVA 4Z2UA 1Z5YE 5FWGA 5JCWA 4RQRA 3TOTA 4YH2A 2MMNA 5IM9A 3VWWA 1BYEA 4KDXA 5ABRA 1OAZA 4ILFA 1T00A 2HLSA 5KN2A 2C0FA 1OC3A 5B8BA 4ECCA 1UN2A 3PPUA 3LQ7A 1XOAA 4KNDA 1K3LA 3C7MA 4BVYA 5ECIB 5GAND 4ECJA 1S3RA 1X0RA 5BRTA 5F8BA 2L4QA 1XWAA 2DBCA 3NOFA 2HXKA 4G10A 3FZ9A 4KUNA 3GMFA 1SKWB 3GTUA 2V1MA 3M0FA 19GSA 3MDKA 4O5RA 3TUEA 4JE1A 2X4AA 1MDJA 4K2DA 1ML6A 1SK0A 2O85A 4NV2A 3IR4A 2F9SA 4ZBDA 10GSA 4GTUA 2TRXA 1HNCA 1F9MA 1TOFA 3GL5A 3RPNA 3NIVA 1BEDA 4MK3A 1J9BA 4L8EA 4YAVA 2H1AA 2GZPA 3RHCA 2H0IA 3KM6A 3Q6OA 1ZYQB 4X1UA 1K0AA 2WRTA 3HVSA 4EKZA 3TKRA 1M7TA 4EF0A 3VK9A 2L59A 2PUKC 3VLNA 1E2YA 4HS1A 1R7HA 2LQQA 2E2MA 4OCFA 2LTKA 2RM6A 2HZEA 4K9ZA 3M9JA 3CSJA 2H1BA 2LNSA 3ZVJD 3FZ4A 4PX1A 2EIQA 2O89A 4KE3A 2LS5A 4NPBA 3GKNA 2YCDA 1Q4JA 5AGYA 3RHBA 1HNAA 1YKCA 1VRSD 2IIYA 4OD7A 5H5RA 2H66A 4JU5A 1YZXA 3IXRA 1OE7A 2N5FA 3FHKA 3QDNA 2VL9A 5B8AA 1FB0A 1TJDA 3HJMA 4KSMA 3D0ZA 4TXOB 4I8BA 1I5GA 3GX0A 3DMLA 2GT5A 2C4JA 3FY7A 1AAZA 3A2XA 2EIOA 2B6MA 3ZL5A 2OJLA 1U87A 1K0OA 1BX9A 5JWRB 4G19A 5ELAA 1KTEA 4MH2A 1JHBA 4EDYA 3VPQA 4BA7A 5DCGA 3EC3A 3I43A 4G9HA 4TR0A 17GSA 1GRXA 1UVZA 3CRUA 1JZWA 2WB9A 1R4WA 4KAEA 2C8UA 2H0GA 2GGTA 5KN1A 1NSWA 3ME7A 2DIYA 4ZL7A 3FR6A 1SJ6A 2GLRA 1JZRA 2HYXA 1F6MC 3QFAC 3F9UA 2TRCP 3GKKA 3KJYA 3LFLA 2CAQA 3H4KA 4HJ2A 2A2RA 4NV5A 3EU4A 2NVLA 1XWGA 3S9FA 5CRDA 3UVTA 4MH3A 2OE0A 4PXOA 2V6OA 2VO4A 1ON4A 3KCMA 3VI7A 3Q19A 2YWIA 1EOGA 1ZYNA 3TRPA 2WJUA 1Z3EA 2F8FA 4IGJA 4K7IA 4ML1A 3DVWA 3ZRDA 4OFMA 1TTZA 4XS6A 2CVDA 4TKYA 2VCXA 3MYDA 5KN3A 5DALB 1OC9A 2H74A 2C3QA 1EGOA 4EUYA 4F82A 2GQMA 5E59A 4EVMA 1WP0A 1U3IA 2E7PA 1F2EA 1PGTA 3IHGA 4XIHA 1WWJA 1ERVA 3GH9A 2O87A 2YWOA 5G1LA 2H01A 1U88A 5D9VA 1W4VA 3HD5A 3TKQA 1F37A 13GSA 1TU8A 2IL3A 1TXXA 4IS0A 2B5EA 3EYTA 5A4UA 4JEDA 1XWKA 3F63A 3FR9A 2H6XA 3I6AA 3L9UA 3GKMA 4OCEA 3GSTA 4HU9A 2FA8A 4IBPA 4ZL8A 1XCCA 3I69A 2JL4A 3CRTA 4EDZA 3M1GA 4HZ4A 3QAVA 3ZTLA 3APQA 4XHMA 1TI3A 3G7IA 5HR2A 1TW9A 1XBSA 4IJIA 4ZIJA 1FOVA 2DJ3A 1O8XA 1ZOFA 1NHYA 4MF7A 1WRYA 2X99A 1Q98A 2VCVA 3D4MA 4G0KA 2HRFA 2AB6A 4NHZA 3JCML 6GSWA 2J9HA 3EU3A 5CREA 5HR1A 2XC2A 4KH7A 3BOAA 3W8JA 4RI6A 3KH7A 3UAPA 1A8YA 4Z7XA 2B7JA 1AQVA 2P5RA 1T4YA 2FWFA 4ZBAA 3F4TA 2L6DA 2GSRA 4HJMA 5E4WA 20GSA 2CT6A 1GUHA 1WOUA 1T3BA 3O6TA 3TKSC 2GSQA 2TIRA 2G0FA 2RUFA 5IMAA 3BBYA 7GSSA 5A4VA 2K9FA 2FWGA 3IV4A 2FWHA 1IYIA 2PMTA 3HVVA 4BPYA 4X4JA 4K0NA 2CZ3A 1TK8B 2WCIA 1X9MB 1XXUA 2H72A 2WDUA 5IPHA 4N10A 1RQMA 5DVBA 5A4WA 4J2FA 1GL8A 2OE1A 1FO5A 5G5FA 1WJKA 3L0HA 1C72A 1PA3A 11GSA 2AYTA 1H75A 4WBJA 1AQXA 4RI7A 4I6XA 4FYUA 4O32A 2LEGA 1O7UA 2L4CA 1PL1A 1V57A 4HSCX 1A24A 1TRUA 2VM2A 1THOA 5EVOA 5ECRB 1YEXA 4KX4A 3UARA 1K0BA 1EWXA 4JBBA 1BJXA 4FO5A 1IYHA 4PURA 2PVOC 1AQWA 2NDOA 2WS2A 3UVHA 4ZBBA 4N30A 2V2GA 2LJRA 2H6ZA 2PERA 3UBLA 2OACA 3KTBA 4OWYA 5G5EA 4DEJA 1GLQA 1GUKA 5AIVA 2C80A 1VF4A 3PGTA 2P5QA 5HR0A 5HFGA 4TRXA 1EEJA 5J9CA 1A0RP 2QGVA 2YN1A 3CXGA 3KEBA 3HJOA 3VPTA 1JFUA 2MZCA 4YQVA 5ECMB 5IMDA 4MJBA 4GWRA 4I97A 4AJ7A 2GZYA 2IWTA 1T8EB 1DBYA 2DJ0A 3A2VA 4HQSA 3J7Yb 3GA4A 8GSSA 4I2UA 4L5LA 2DIZA 5ID2B 4XCSA 3FMWA 4MPFA 3APSA 1VGLA 3DVXA 3TKPA 3D4TA 1GULA 4K1FA 1YEPA 2O8VB 4GXZA 4CY8A 6GSYA 3DD3A 4KW6A 2DSAA 1OYJA 2VL3A 2GS3A 4K0GA 5GAPD 2YWNA 3IAM2 2PWJA 1ZCPA 3F8UA 3RBTA 3HA9A 2MMAA 2VLTA 1TK5B 1DSBA 1R5AA 3QAWA 4OFTA 1YDKA 1X9WB 1AC1A 2FA4A 1SD8A 4POMA 4V1Ag 2GDRA 3WGXA 4HU7A 2A2SA 2LV3A 3DWVA
chains in the Genus database with same CATH topology
3TKSE 3A5IA 2REMA 4DSSB 5ELGA 4Q5QA 2I3YA 1TI1A 3ZYWA 6GSSA 1XWBA 4FYBA 5IMZA 2B7KA 12GSA 3VWVA 3ZREA 2FUG2 1MD4A 2X8HA 3TJFA 1Z6NA 3Q18A 5ECSA 2A4VA 2LJKA 2O7KA 2H1GA 3BJ5A 2KP2A 2YZUA 3KP9A 3IA1A 3KH9A 2VL2C 1PKWA 2GSSA 1LU4A 2H19A 4LLRA 2YNXA 2HSYA 1BAYA 2DJ2A 2GSTA 5D73A 5D9TA 3VFIA 2JZTA 4JZQA 4IP6A 4OMVA 4N0VA 1PD21 3LW9A 3IHQA 6GSUA 2JU5A 4F2IA 4ZB9A 3TB2A 2MBSA 4MZCA 4PQHA 2HNLA 2LRTA 1GLPA 2PN8A 2PVQA 2VM1A 1F3BA 2L6CA 1PX6A 4Q5NA 3DRNA 3U5RE 5LNKe 3IC8A 1XOBA 2NPBA 3FKFA 2H0HA 3ZMKA 1ACVA 4TVEA 3QPMA 4HDEA 3DEXA 4EIQA 2LUSA 4XS4A 4NWYA 1U6TA 4KDYA 4HI7A 5IOWA 2QSIA 3KGKA 1V2AA 2JACA 3SBCA 2I4AA 5CRHA 4DSQA 5DDLA 1XVWA 4QL9A 3QD9A 4ZILA 4K7NA 1SL2B 1VF2A 2LRNA 3J7Yk 1ST9A 2UZ8A 3BCIA 3ISOA 3LYKA 2XHFA 1QXHA 5HR3A 2B3SA 2V32A 1OE8A 2RIIA 3FR3A 4IVFA 1FB6A 4HUAA 1M2AA 4G2EA 2R2JA 1GWCA 1UC7A 4BL7B 6GSTA 2N5AA 3O76A 5IO0A 1FVJA 1X5DA 6GSXA 4JRRA 5H5QA 2HI7A 5ECKB 1XPVA 1B4QA 4O7HA 1QK8A 4TR3A 2CAIA 5DALA 3E0UA 4QL7A 5F07A 5LD0A 2GQLA 3ERFA 1ABAA 2B1LA 4GQFA 5F05A 4GSNA 2VCTA 2JZRA 2CQ9A 1HNBA 3WGEA 1SENA 4MABA 3TRXA 2XPDA 5ECLB 1ZGNA 3ZVJA 3GN3A 4JR4A 2PGTA 1S3CA 2HRAA 3E9JB 4IHUA 2YV7A 3C1RA 3L9SA 3L4NA 1G7EA 2CVBA 2MYGA 4K7OA 3GKXA 4L0WA 1AXDA 4F03A 3VURA 5D9WA 1M0UA 2M72A 3GUSA 3U6VA 3H8QA 5GSTA 1WMJA 1EV4A 1SJIA 2FCHA 5D8IA 1ZYEA 2M46A 4FYCA 2HT9A 5KN0A 1O8WA 1VF1A 1VF3A 3WYWA 3EINA 1FG4A 5J41A 1A2LA 1A2MA 1RK4A 4AGSA 2LQOA 1TK0B 4EC0A 1QMVA 1AUCA 3CMIA 1QFNA 4O92A 3LEFA 2MMZA 1XIYA 5G1KA 3FZ5A 1WIKA 2CA8A 3IE3A 1SJZA 2VOCA 2IFQB 3KTLA 4CY6A 4TR1B 1FW1A 4MJCA 5G30A 4V2MA 3LXZA 1YQ1A 2AV4A 1I9DA 2C1YA 4KCEA 3V1WA 4LL4B 2VUPA 1Z7PA 2YJ7A 4X43A 3ZFLA 3K8NA 5D9XA 3KP8A 2XBIA 3WD6A 1URMA 3FEUA 2F8AA 1R5PA 5JWOB 1W89A 2X49A 2H70A 4ECIA 5CNWA 3VWXA 1MD3A 5FT3A 2H76A 4HEA2 3UEMA 4WF4A 2FNOA 2K8SA 3GH6A 1F3AA 3PH9A 1GSFA 1O81A 3P90A 2PPTA 4P3YB 5ECPB 1Z6MA 1FAAA 1EEMA 1YY7A 3M3MA 1CQGA 4POLA 1PQNA 2H30A 1OKTA 2DLXA 4N11A 3BCKA 1GSQA 1N2AA 1GSDA 2ON7A 4H86A 1FHEA 3GYKA 3G9BA 4K2XA 2OBKA 5AIXA 3ZZXA 4GF0A 3VI5A 2B5XA 3ZFBA 2C0DA 3TJKA 4ICYA 1GSSA 1T1VA 4D73B 4MDCA 1X5EA 3QR6A 4LMVA 1ZMAA 3WT2A 4PNGA 4HZ2A 5C04A 4ACSA 2X8GA 3G7YA 1XW6A 2H6YA 3P7XA 2WFCA 4XS1A 3PR8A 5B7CA 3F3RA 3F3QA 2JZSA 1GSUA 1B4PA 1OKDA 1TDIA 2ALBA 1E6BA 1PMTA 4FIWA 4YKGA 3EURA 1G6WA 4MZBA 1V98A 5DJMA 2ZUPA 1KNGA 2BJXA 3FYGA 4IKHA 4IP1A 2NBSA 1Z9HA 4G0LA 2K18A 3W8SA 1K0DA 4MMMA 1JZDA 1HYUA 1LJRA 3CSHA 2HZFA 5IMFA 4YQMA 5ID2A 1M9BA 2H73A 4BWQA 2V6KA 1YF1A 3TKSA 4MZWA 2R5GA 4PTSA 2DJKA 5B6MA 5ECNB 4XRDA 3TDGA 18GSA 2HFDA 4AJ6A 5CAXA 3LSZA 1PX7A 4I5QA 3ZMLA 4ISDA 4L0UA 3DXBA 4O5QA 4E8EA 1CQHA 4KB3A 1SU9A 3UOMA 3GURA 4XRAA 4EIPA 1AW9A 3I9V2 1DE1A 2HSMA 4BVXB 5KEJA 1Y25A 3IRAA 2E0QA 5EPFA 3C8EA 1SD9A 1WE0A 2FWEA 1WPIA 3F6DA 2P31A 5KOXA 1R26A 1J0FA 1K3OA 2D2ZA 2C3NA 4MF6A 4ULXA 1TKDB 1XZOA 3WGDA 4GSTA 2YOIA 2KP1A 3KD0A 5AN1A 1PN9A 3RAZA 2R37A 2I1UA 3G7JA 2IPAA 1S3AA 2HRNA 3FZAA 3MSZA 5KOWA 1XFLA 9GSSA 2ZNMA 1XWCA 2QC7A 5ECHB 3RDWA 4LL1B 4GSSA 1K0MA 3MIXA 4ZB6A 3HXSA 4LMWA 1M2DA 3KXOA 1M2BA 1T4ZA 5IO2A 1GP1A 1TP9A 3HHVA 4IW9A 1TRSA 3QAGA 1ZL9A 1T7PB 3DKSA 3C71A 3WT1A 4PUAA 3ZIVA 4OO4A 1NM3A 2GZZA 2VIMA 3RPPA 1GSEA 2LNTA 2DJ1A 1XW9A 1M99A 1GUMA 4WXTA 5DQSA 3KZQA 5H5SA 1OVNA 2IMIA 1PSQA 2EIRA 4FQUA 2R0PA 1S3DA 1GTIA 5DAKB 2CVKA 2DMLA 2CX4A 4CW9A 4YAPA 2IMKA 3N9JA 1SL1B 4OFNA 2RUEA 3LJRA 2VLUA 2CX3A 3QCPA 2IMEA 3GHAA 1SK2A 1EV9A 2OKAA 3W6GA 4AF2A 2DKIA 3TCOA 2I9HA 4X0XA 2IN3A 2L5LA 1HQOA 3EPTA 1PN0A 3LG6A 5CRGA 14GSA 2AUVA 2DJJA 4NMUA 1A23A 1DUGA 2AHEA 4IELA 1OC8A 4O5UA 1THXA 1O6JA 2EC4A 4ML6A 2LKUA 5J5NA 2B5YA 2IMFA 2YWMA 3ERWA 4GCIA 2V41A 4KGIA 3L9VA 22GSA 4WBRD 1ERTA 1X5CA 4TXOA 4LA1A 5EL8A 4J56E 2ES7A 4IJ3A 3GL3A 5F06A 1PKZA 2JSYA 1B48A 3F6FA 3F4RA 4TOPA 3GV1A 4BL7A 4WF5A 4DSRA 4AJ8A 2VL2A 4ID0A 1XW5A 2KHPA 1GSYA 5G31A 1SKSB 1GNEA 2R0CA 1ERUA 2KOKA 3LYPA 4KA0A 4ECBA 3A2WA 5DQYA 5FHIA 5G2ZA 3D5JA 2WZ9A 4BVYB 1JZOA 3LORA 5L71A 1GNWA 2K8VA 1FOHA 3D6IA 3MAKA 1USBA 3IOSA 3TOUA 2R4VA 3ZITA 5IOXA 1X9SB 2KUCA 2FLSA 4KCAA 2FY6A 2HE3A 3GTUB 1JLVA 3ED3A 1SL0B 1QUWA 5HQPA 1V9WA 1ZYPA 4IN0A 1A8LA 3GSSA 4EXJA 4NAXA 3NZNA 3A3TA 5JWQB 3SWLA 3C1SA 2L5OA 4JR6A 2JADA 2MMOA 3AY8A 1V40A 4E8HA 5CP1A 5LCZA 3A5WA 4PUFC 3TRQA 3ZIJA 1RW1A 3H79A 3MNGA 3TJJA 4CHSA 3IPZA 4NHWA 1SYRA 5D93A 3ERGA 4ZL9A 2XBQA 5D96A 2HZEB 4IQ1A 5J4UA 4I2TA 5EY6A 4F9ZA 2CV4A 2IFQA 5GSSA 2OA7A 1NHOA 3HKRA 1B9XC 4KSOA 4TR1A 4GQCA 5DCHA 2QKEA 4XS4B 2AJQB 2RM5A 3EMXA 3LGCA 1K0NA 2LRCA 2MBTA 1EP8A 4N0ZA 5J3RA 4WR5A 2GVPA 3HZ4A 5AISA 1KBNA 5ECQB 16GSA 4GLTA 2HSHA 2LJAA 5DBQA 4G0IA 4FH8A 3FRCA 2GTUA 1GTAA 2QA1A 4F0BA 1A2JA 3CBUA 4WKWA 4OO5A 2I81A 3ZLPA 1YKAA 2H71A 4K5SA 1Y6EA 1PRXA 4TN8A 2G2QA 3UL3A 2FHEA 2XPEA 1O85A 3PINA 1V58A 4L5OA 3L78A 5JCGA 3CYNA 4K5RA 5IMVA 5A5KA 3DGQA 3BD2A 4USSA 3OR5A 2GQKA 4J57E 4PQIA 3CSIA 2N5BA 3IK9A 1QGVA 3C73A 2DKHA 4EO3A 1GH2A 4GRFA 2X64A 5IMCA 5F0GA 4POKA 5C00A 3R3EA 1J08A 1O73A 1FVKA 5CYYA 2X8CA 3QMXA 3KMOA 1MDIA 3QFBC 1A0FA 1YF0A 2C0GA 3GFKA 2VD1A 1ILOA 2VAFA 1BQ7A 3GX8A 1KEBA 2H75A 1AIUA 4D73A 4QQ7A 3MWHA 1DE2A 2VD0A 2H8LA 3EVIA 3LWAA 3IK7A 1G7OA 4WR4A 3KMNA 1XVQA 3UMAA 4TW5A 2LSTA 3LXTA 5HFIA 2C0EA 1G0TA 3GNJA 2IJYA 1G6YA 2BMXA 1GTUA 1U3AA 3FW2A 5ECOB 2PBJA 3HVXA 2P0GA 1OC9B 2VCZA 3QOUA 5DJLA 3HDCA 5COHA 3D22A 4V1Ap 1EP7A 1H4OA 1ZZYA 3H1NA 3N5OA 2WULA 5B6NA 3HJPA 3VWUA 4MLYA 3CTGA 4MA9A 3US3A 4K8MA 4ZXGA 2DC5A 1MEKA 4YKFA 4Z2TA 1LBKA 4BWSA 4V2LA 3UBKA 1B9YC 2H1DA 1UA5A 3TJBA 2F3MA 4YQUA 1EGRA 1BG5A 4RUVA 2M80A 4WETA 1TRWA 2YANA 2AAWA 4F0CA 5INYA 2FD3A 2ON5A 4HOJA 4BVXA 1HD2A 3IAS2 2A2PA 2OADA 3M9KA 4A5PA 3E3EA 4Z2RA 3DIEA 4CDOA 2VCQA 4DVCA 1MDKA 3F4SA 4KF9A 2YJHA 2PU9C 2R3XA 1M9AA 1JLWA 3IC4A 2VCWA 4MF5A 2QA2A 4Q5RA 2L57A 3APOA 4MCUA 3UJ1A 1K0CA 2J23A 4IQAA 2YPMA 1N8JA 1EZKA 3HZ8A 3F0IA 2Z9SA 5J9BA 2IMDA 4EE0A 5HFKA 4PNFA 2R6KA 3EE2A 4HQZA 2RLIA 3DYRA 4KDUA 5BMUA 1GTBA 2E2GA 2R0GA 4TXVA 2A4HA 1YJ6A 2OE3A 2ZCTA 2OBIA 5CRWA 2YZHA 4POBA 5CO3A 1MTCA 1TRVA 4Q5FA 4V2NA 3O3TA 2VLVA 3EMPA 1QQ2A 2K6VA 3IBHA 1PL2A 3KIJA 4MJEA 2DMMA 4PQ1A 2WGRA 3CTFA 4K6XA 4DSSA 2KLXA 4WEYA 2YV9A 1EOHA 4MPGA 4PGTA 3TJGA 5DAKA 2NTOA 4XTSA 5IIZA 3GRXA 6GSVA 5IPGA 1Z7RA 3D21A 3P2AA 2F51A 3ME8A 5IQYA 3HY2A 4MJAA 2HRKA 3M8NA 1B8XA 2CZ2A 1K3YA 3HCZA 3EWLA 3Q74A 2FGXA 3TGZA 3P8WA 4RQXA 3R2QA 1NW2A 1SYXA 3FK8A 4NXIA 4TR4A 3H93A 1ERWA 4MNNA 1SK1A 2YP6A 2GT6A 3GIXA 2B1KA 5GZZB 2BTOT 3UIWA 2C3TA 1SKRB 4EL1A 1TU7A 5JCUA 4ZB8A 3HYPA 2JSZA 5ENUA 4MP4A 3IDVA 4Z2UA 1Z5YE 5FWGA 5JCWA 4RQRA 3TOTA 4YH2A 2MMNA 5IM9A 3VWWA 1BYEA 4KDXA 5ABRA 1OAZA 4ILFA 1T00A 2HLSA 5KN2A 2C0FA 1OC3A 5B8BA 4ECCA 1UN2A 3PPUA 3LQ7A 1XOAA 4KNDA 1K3LA 3C7MA 4BVYA 5ECIB 5GAND 4ECJA 1X0RA 5BRTA 5F8BA 2L4QA 1XWAA 2DBCA 3NOFA 2HXKA 4G10A 3FZ9A 4KUNA 3GMFA 1SKWB 3GTUA 2V1MA 3M0FA 19GSA 3MDKA 4O5RA 3TUEA 4JE1A 2X4AA 1MDJA 4K2DA 1ML6A 1SK0A 2O85A 4NV2A 3IR4A 2F9SA 4ZBDA 10GSA 4GTUA 2TRXA 1HNCA 1F9MA 1TOFA 3GL5A 3RPNA 3NIVA 1BEDA 4MK3A 1J9BA 4L8EA 4YAVA 2H1AA 2GZPA 3RHCA 2H0IA 3KM6A 3Q6OA 1ZYQB 4X1UA 1K0AA 2WRTA 3HVSA 4EKZA 3TKRA 1M7TA 4EF0A 3VK9A 2L59A 2PUKC 3VLNA 1E2YA 4HS1A 1R7HA 2LQQA 2E2MA 4OCFA 2LTKA 2RM6A 2HZEA 4K9ZA 3M9JA 3CSJA 2H1BA 2LNSA 3ZVJD 3FZ4A 4PX1A 2EIQA 2O89A 4KE3A 2LS5A 4NPBA 3GKNA 2YCDA 1Q4JA 5AGYA 3RHBA 1HNAA 1YKCA 1VRSD 2IIYA 4OD7A 5H5RA 2H66A 4JU5A 1YZXA 3IXRA 1OE7A 2N5FA 3FHKA 3QDNA 2VL9A 5B8AA 1FB0A 1TJDA 3HJMA 4KSMA 3D0ZA 4TXOB 4I8BA 1I5GA 3GX0A 3DMLA 2GT5A 2C4JA 3FY7A 1AAZA 3A2XA 2EIOA 2B6MA 3ZL5A 2OJLA 1U87A 1K0OA 1BX9A 5JWRB 4G19A 5ELAA 1KTEA 4MH2A 1JHBA 4EDYA 3VPQA 4BA7A 5DCGA 3EC3A 3I43A 4G9HA 4TR0A 17GSA 1GRXA 1UVZA 3CRUA 1JZWA 2WB9A 1R4WA 4KAEA 2C8UA 2H0GA 2GGTA 5KN1A 1NSWA 3ME7A 2DIYA 4ZL7A 3FR6A 1SJ6A 2GLRA 1JZRA 2HYXA 1F6MC 3QFAC 3F9UA 2TRCP 3GKKA 3KJYA 3LFLA 2CAQA 3H4KA 4HJ2A 2A2RA 4NV5A 3EU4A 2NVLA 1XWGA 3S9FA 5CRDA 3UVTA 4MH3A 2OE0A 4PXOA 2V6OA 2VO4A 1ON4A 3KCMA 3VI7A 3Q19A 2YWIA 1EOGA 1ZYNA 3TRPA 2WJUA 1Z3EA 2F8FA 4IGJA 4K7IA 4ML1A 3DVWA 3ZRDA 4OFMA 1TTZA 4XS6A 2CVDA 4TKYA 2VCXA 3MYDA 5KN3A 5DALB 1OC9A 2H74A 2C3QA 1EGOA 4EUYA 4F82A 2GQMA 5E59A 4EVMA 1WP0A 1U3IA 2E7PA 1F2EA 1PGTA 3IHGA 4XIHA 1WWJA 1ERVA 3GH9A 2O87A 2YWOA 5G1LA 2H01A 1U88A 5D9VA 1W4VA 3HD5A 3TKQA 1F37A 13GSA 1TU8A 2IL3A 1TXXA 4IS0A 2B5EA 3EYTA 5A4UA 4JEDA 1XWKA 3F63A 3FR9A 2H6XA 3I6AA 3L9UA 3GKMA 4OCEA 3GSTA 4HU9A 2FA8A 4IBPA 4ZL8A 1XCCA 3I69A 2JL4A 3CRTA 4EDZA 3M1GA 4HZ4A 3QAVA 3ZTLA 3APQA 4XHMA 1TI3A 3G7IA 5HR2A 1TW9A 1XBSA 4IJIA 4ZIJA 1FOVA 2DJ3A 1O8XA 1ZOFA 1NHYA 4MF7A 1WRYA 2X99A 1Q98A 2VCVA 3D4MA 4G0KA 2HRFA 2AB6A 4NHZA 3JCML 6GSWA 2J9HA 3EU3A 5CREA 5HR1A 2XC2A 4KH7A 3BOAA 3W8JA 4RI6A 3KH7A 3UAPA 1A8YA 4Z7XA 2B7JA 1AQVA 2P5RA 1T4YA 2FWFA 4ZBAA 3F4TA 2L6DA 2GSRA 4HJMA 5E4WA 20GSA 2CT6A 1GUHA 1WOUA 1T3BA 3O6TA 3TKSC 2GSQA 2TIRA 2G0FA 2RUFA 5IMAA 3BBYA 7GSSA 5A4VA 2K9FA 2FWGA 3IV4A 2FWHA 1IYIA 2PMTA 3HVVA 4BPYA 4X4JA 4K0NA 2CZ3A 1TK8B 2WCIA 1X9MB 1XXUA 2H72A 2WDUA 5IPHA 4N10A 1RQMA 5DVBA 5A4WA 4J2FA 1GL8A 2OE1A 1FO5A 5G5FA 1WJKA 3L0HA 1C72A 1PA3A 11GSA 2AYTA 1H75A 4WBJA 1AQXA 4RI7A 4I6XA 4FYUA 4O32A 2LEGA 1O7UA 2L4CA 1PL1A 1V57A 1A24A 1TRUA 2VM2A 1THOA 5EVOA 5ECRB 1YEXA 4KX4A 3UARA 1K0BA 1EWXA 4JBBA 1BJXA 4FO5A 1IYHA 4PURA 2PVOC 1AQWA 2NDOA 2WS2A 3UVHA 4ZBBA 4N30A 2V2GA 2LJRA 2H6ZA 2PERA 3UBLA 2OACA 3KTBA 4OWYA 5G5EA 4DEJA 1GLQA 1GUKA 5AIVA 2C80A 1VF4A 3PGTA 2P5QA 5HR0A 5HFGA 4TRXA 1EEJA 5J9CA 1A0RP 2QGVA 2YN1A 3CXGA 3KEBA 3HJOA 3VPTA 1JFUA 2MZCA 4YQVA 5ECMB 5IMDA 4MJBA 4GWRA 4I97A 4AJ7A 2GZYA 2IWTA 1T8EB 1DBYA 2DJ0A 3A2VA 4HQSA 3J7Yb 3GA4A 8GSSA 4I2UA 4L5LA 2DIZA 5ID2B 4XCSA 3FMWA 4MPFA 3APSA 1VGLA 3DVXA 3TKPA 3D4TA 1GULA 4K1FA 1YEPA 2O8VB 4GXZA 4CY8A 6GSYA 3DD3A 4KW6A 2DSAA 1OYJA 2VL3A 2GS3A 4K0GA 5GAPD 2YWNA 3IAM2 2PWJA 1ZCPA 3F8UA 3RBTA 3HA9A 2MMAA 2VLTA 1TK5B 1DSBA 1R5AA 3QAWA 4OFTA 1YDKA 1X9WB 1AC1A 2FA4A 1SD8A 4POMA 4V1Ag 2GDRA 3WGXA 4HU7A 2A2SA 2LV3A 3DWVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TKS E;  2REM A;  4DSS B;  5ELG A;  4Q5Q A;  2I3Y A;  1TI1 A;  3ZYW A;  6GSS A;  1XWB A;  4FYB A;  5IMZ A;  2B7K A;  12GS A;  3VWV A;  3ZRE A;  2FUG 2;  1MD4 A;  2X8H A;  3TJF A;  1Z6N A;  3Q18 A;  5ECS A;  2A4V A;  2LJK A;  2O7K A;  2H1G A;  3BJ5 A;  2KP2 A;  2YZU A;  3KP9 A;  3IA1 A;  3KH9 A;  2VL2 C;  1PKW A;  2GSS A;  1LU4 A;  2H19 A;  4LLR A;  2YNX A;  2HSY A;  1BAY A;  2DJ2 A;  2GST A;  5D73 A;  5D9T A;  3VFI A;  2JZT A;  4JZQ A;  4IP6 A;  4OMV A;  4N0V A;  1PD2 1;  3IHQ A;  6GSU A;  2JU5 A;  4F2I A;  4ZB9 A;  3TB2 A;  2MBS A;  4MZC A;  4PQH A;  2HNL A;  2LRT A;  1GLP A;  2PN8 A;  2PVQ A;  2VM1 A;  1F3B A;  2L6C A;  1PX6 A;  4Q5N A;  3DRN A;  3U5R E;  5LNK e;  1XOB A;  2NPB A;  3FKF A;  2H0H A;  3ZMK A;  1ACV A;  4TVE A;  3QPM A;  4HDE A;  3DEX A;  2LUS A;  4XS4 A;  4NWY A;  1U6T A;  4KDY A;  4HI7 A;  5IOW A;  2QSI A;  3KGK A;  1V2A A;  2JAC A;  3SBC A;  2I4A A;  5CRH A;  4DSQ A;  5DDL A;  1XVW A;  4QL9 A;  3QD9 A;  4ZIL A;  4K7N A;  1SL2 B;  1VF2 A;  2LRN A;  3J7Y k;  1ST9 A;  3BCI A;  3ISO A;  3LYK A;  2XHF A;  1QXH A;  5HR3 A;  2B3S A;  2V32 A;  1OE8 A;  2RII A;  3FR3 A;  4IVF A;  1FB6 A;  4HUA A;  1M2A A;  4G2E A;  2R2J A;  1GWC A;  1UC7 A;  6GST A;  2N5A A;  3O76 A;  5IO0 A;  1FVJ A;  1X5D A;  6GSX A;  4JRR A;  5H5Q A;  2HI7 A;  5ECK B;  1XPV A;  1B4Q A;  4O7H A;  1QK8 A;  4TR3 A;  2CAI A;  5DAL A;  3E0U A;  4QL7 A;  5F07 A;  5LD0 A;  2GQL A;  3ERF A;  1ABA A;  2B1L A;  4GQF A;  5F05 A;  4GSN A;  2VCT A;  2JZR A;  2CQ9 A;  1HNB A;  3WGE A;  1SEN A;  4MAB A;  3TRX A;  2XPD A;  5ECL B;  1ZGN A;  3ZVJ A;  3GN3 A;  4JR4 A;  2PGT A;  1S3C A;  3E9J B;  4IHU A;  2YV7 A;  3C1R A;  3L9S A;  3L4N A;  1G7E A;  2CVB A;  2MYG A;  4K7O A;  3GKX A;  4L0W A;  1AXD A;  4F03 A;  3VUR A;  5D9W A;  1M0U A;  2M72 A;  3GUS A;  3U6V A;  3H8Q A;  5GST A;  1WMJ A;  1EV4 A;  1SJI A;  2FCH A;  5D8I A;  1ZYE A;  2M46 A;  4FYC A;  2HT9 A;  5KN0 A;  1O8W A;  1VF1 A;  1VF3 A;  3WYW A;  3EIN A;  1FG4 A;  5J41 A;  1A2L A;  1A2M A;  1RK4 A;  4AGS A;  2LQO A;  1TK0 B;  4EC0 A;  1QMV A;  1AUC A;  3CMI A;  1QFN A;  4O92 A;  3LEF A;  2MMZ A;  1XIY A;  5G1K A;  3FZ5 A;  1WIK A;  2CA8 A;  3IE3 A;  1SJZ A;  2VOC A;  2IFQ B;  3KTL A;  4TR1 B;  1FW1 A;  4MJC A;  5G30 A;  4V2M A;  3LXZ A;  1YQ1 A;  2AV4 A;  1I9D A;  2C1Y A;  4KCE A;  3V1W A;  4LL4 B;  2VUP A;  1Z7P A;  2YJ7 A;  4X43 A;  3ZFL A;  3K8N A;  5D9X A;  3KP8 A;  2XBI A;  3WD6 A;  1URM A;  3FEU A;  2F8A A;  1R5P A;  5JWO B;  1W89 A;  2H70 A;  4ECI A;  5CNW A;  3VWX A;  1MD3 A;  5FT3 A;  2H76 A;  4HEA 2;  3UEM A;  4WF4 A;  2FNO A;  2K8S A;  3GH6 A;  1F3A A;  3PH9 A;  1GSF A;  1O81 A;  3P90 A;  2PPT A;  4P3Y B;  5ECP B;  1Z6M A;  1FAA A;  1EEM A;  1YY7 A;  3M3M A;  1CQG A;  4POL A;  1PQN A;  2H30 A;  1OKT A;  2DLX A;  4N11 A;  3BCK A;  1GSQ A;  1N2A A;  1GSD A;  2ON7 A;  4H86 A;  1FHE A;  3GYK A;  3G9B A;  2OBK A;  5AIX A;  3ZZX A;  4GF0 A;  3VI5 A;  2B5X A;  3ZFB A;  2C0D A;  3TJK A;  1GSS A;  1T1V A;  4D73 B;  4MDC A;  1X5E A;  3QR6 A;  4LMV A;  1ZMA A;  3WT2 A;  4PNG A;  4HZ2 A;  5C04 A;  4ACS A;  2X8G A;  3G7Y A;  1XW6 A;  2H6Y A;  3P7X A;  2WFC A;  4XS1 A;  3PR8 A;  5B7C A;  3F3R A;  3F3Q A;  2JZS A;  1GSU A;  1B4P A;  1OKD A;  1TDI A;  2ALB A;  1E6B A;  1PMT A;  4FIW A;  3EUR A;  1G6W A;  4MZB A;  1V98 A;  5DJM A;  2ZUP A;  1KNG A;  2BJX A;  3FYG A;  4IKH A;  4IP1 A;  2NBS A;  1Z9H A;  2K18 A;  3W8S A;  1K0D A;  4MMM A;  1JZD A;  1HYU A;  1LJR A;  3CSH A;  2HZF A;  5IMF A;  4YQM A;  5ID2 A;  1M9B A;  2H73 A;  4BWQ A;  2V6K A;  1YF1 A;  3TKS A;  4MZW A;  2R5G A;  2DJK A;  5B6M A;  5ECN B;  4XRD A;  3TDG A;  18GS A;  2HFD A;  4AJ6 A;  5CAX A;  3LSZ A;  1PX7 A;  4I5Q A;  3ZML A;  4ISD A;  4L0U A;  3DXB A;  4E8E A;  1CQH A;  4KB3 A;  1SU9 A;  3UOM A;  3GUR A;  4XRA A;  1AW9 A;  3I9V 2;  1DE1 A;  5KEJ A;  1Y25 A;  3IRA A;  2E0Q A;  5EPF A;  3C8E A;  1SD9 A;  1WE0 A;  2FWE A;  1WPI A;  3F6D A;  2P31 A;  1R26 A;  1J0F A;  1K3O A;  2D2Z A;  2C3N A;  4MF6 A;  4ULX A;  1TKD B;  1XZO A;  3WGD A;  4GST A;  2YOI A;  2KP1 A;  3KD0 A;  5AN1 A;  1PN9 A;  3RAZ A;  2R37 A;  2I1U A;  3G7J A;  2IPA A;  1S3A A;  2HRN A;  3FZA A;  3MSZ A;  1XFL A;  9GSS A;  2ZNM A;  1XWC A;  2QC7 A;  5ECH B;  3RDW A;  4LL1 B;  4GSS A;  1K0M A;  4ZB6 A;  3HXS A;  4LMW A;  1M2D A;  3KXO A;  1M2B A;  1T4Z A;  5IO2 A;  1GP1 A;  1TP9 A;  3HHV A;  4IW9 A;  1TRS A;  3QAG A;  1ZL9 A;  1T7P B;  3DKS A;  3C71 A;  3WT1 A;  4PUA A;  3ZIV A;  4OO4 A;  1NM3 A;  2GZZ A;  2VIM A;  3RPP A;  1GSE A;  2LNT A;  2DJ1 A;  1XW9 A;  1M99 A;  1GUM A;  4WXT A;  5DQS A;  3KZQ A;  5H5S A;  1OVN A;  2IMI A;  1PSQ A;  2EIR A;  1S3D A;  1GTI A;  5DAK B;  2CVK A;  2DML A;  2CX4 A;  4CW9 A;  4YAP A;  2IMK A;  3N9J A;  1SL1 B;  4OFN A;  2RUE A;  3LJR A;  2VLU A;  2CX3 A;  3QCP A;  2IME A;  3GHA A;  1SK2 A;  1EV9 A;  2OKA A;  3W6G A;  4AF2 A;  3TCO A;  2I9H A;  4X0X A;  2IN3 A;  2L5L A;  1HQO A;  3LG6 A;  5CRG A;  14GS A;  2AUV A;  2DJJ A;  4NMU A;  1A23 A;  1DUG A;  2AHE A;  4IEL A;  1OC8 A;  1THX A;  1O6J A;  2EC4 A;  4ML6 A;  2LKU A;  5J5N A;  2B5Y A;  2IMF A;  2YWM A;  3ERW A;  4GCI A;  2V41 A;  4KGI A;  3L9V A;  22GS A;  4WBR D;  1ERT A;  1X5C A;  4TXO A;  4LA1 A;  5EL8 A;  4J56 E;  2ES7 A;  4IJ3 A;  3GL3 A;  5F06 A;  1PKZ A;  2JSY A;  1B48 A;  3F6F A;  3F4R A;  4TOP A;  3GV1 A;  4BL7 A;  4WF5 A;  4DSR A;  4AJ8 A;  2VL2 A;  4ID0 A;  1XW5 A;  2KHP A;  1GSY A;  5G31 A;  1SKS B;  1GNE A;  1ERU A;  2KOK A;  3LYP A;  4KA0 A;  4ECB A;  3A2W A;  5DQY A;  5FHI A;  5G2Z A;  3D5J A;  2WZ9 A;  1JZO A;  3LOR A;  5L71 A;  1GNW A;  2K8V A;  3D6I A;  3MAK A;  1USB A;  3IOS A;  3TOU A;  2R4V A;  3ZIT A;  5IOX A;  1X9S B;  2KUC A;  2FLS A;  4KCA A;  2FY6 A;  2HE3 A;  3GTU B;  1JLV A;  3ED3 A;  1SL0 B;  1QUW A;  5HQP A;  1V9W A;  4IN0 A;  1A8L A;  3GSS A;  4EXJ A;  4NAX A;  3NZN A;  3A3T A;  5JWQ B;  3SWL A;  3C1S A;  2L5O A;  4JR6 A;  2JAD A;  2MMO A;  3AY8 A;  1V40 A;  4E8H A;  5CP1 A;  5LCZ A;  3A5W A;  4PUF C;  3TRQ A;  3ZIJ A;  1RW1 A;  3H79 A;  3MNG A;  3TJJ A;  4CHS A;  3IPZ A;  4NHW A;  1SYR A;  5D93 A;  3ERG A;  4ZL9 A;  2XBQ A;  5D96 A;  2HZE B;  4IQ1 A;  5J4U A;  4I2T A;  5EY6 A;  4F9Z A;  2CV4 A;  2IFQ A;  5GSS A;  2OA7 A;  1NHO A;  3HKR A;  1B9X C;  4KSO A;  4TR1 A;  4GQC A;  5DCH A;  2QKE A;  4XS4 B;  2AJQ B;  2RM5 A;  3EMX A;  3LGC A;  1K0N A;  2LRC A;  2MBT A;  1EP8 A;  4N0Z A;  5J3R A;  4WR5 A;  2GVP A;  3HZ4 A;  5AIS A;  5ECQ B;  1KBN A;  16GS A;  4GLT A;  2HSH A;  2LJA A;  5DBQ A;  4FH8 A;  3FRC A;  2GTU A;  1GTA A;  4F0B A;  1A2J A;  3CBU A;  4WKW A;  4OO5 A;  2I81 A;  3ZLP A;  1YKA A;  2H71 A;  1Y6E A;  1PRX A;  4TN8 A;  2G2Q A;  3UL3 A;  2FHE A;  2XPE A;  1O85 A;  3PIN A;  1V58 A;  4L5O A;  3L78 A;  5JCG A;  3CYN A;  5IMV A;  5A5K A;  3DGQ A;  3BD2 A;  3OR5 A;  4PQI A;  2GQK A;  4J57 E;  3CSI A;  2N5B A;  3IK9 A;  1QGV A;  3C73 A;  4EO3 A;  1GH2 A;  4GRF A;  2X64 A;  5IMC A;  5F0G A;  4POK A;  5C00 A;  1J08 A;  1O73 A;  1FVK A;  5CYY A;  2X8C A;  3QMX A;  3KMO A;  1MDI A;  3QFB C;  1A0F A;  1YF0 A;  2C0G A;  3GFK A;  2VD1 A;  1ILO A;  2VAF A;  1BQ7 A;  3GX8 A;  1KEB A;  2H75 A;  1AIU A;  4D73 A;  4QQ7 A;  3MWH A;  1DE2 A;  2VD0 A;  2H8L A;  3EVI A;  3LWA A;  3IK7 A;  1G7O A;  4WR4 A;  3KMN A;  1XVQ A;  3UMA A;  4TW5 A;  2LST A;  3LXT A;  5HFI A;  2C0E A;  1G0T A;  3GNJ A;  2IJY A;  1G6Y A;  2BMX A;  1GTU A;  1U3A A;  3FW2 A;  5ECO B;  2PBJ A;  3HVX A;  2P0G A;  1OC9 B;  2VCZ A;  3QOU A;  5DJL A;  3HDC A;  5COH A;  3D22 A;  4V1A p;  1EP7 A;  1H4O A;  1ZZY A;  3H1N A;  3N5O A;  2WUL A;  5B6N A;  3HJP A;  3VWU A;  4MLY A;  3CTG A;  4MA9 A;  3US3 A;  4K8M A;  4ZXG A;  2DC5 A;  1MEK A;  1LBK A;  4BWS A;  4V2L A;  3UBK A;  1B9Y C;  2H1D A;  1UA5 A;  3TJB A;  2F3M A;  4YQU A;  1EGR A;  1BG5 A;  4RUV A;  2M80 A;  4WET A;  1TRW A;  2YAN A;  2AAW A;  4F0C A;  5INY A;  2FD3 A;  2ON5 A;  4HOJ A;  4BVX A;  1HD2 A;  3IAS 2;  2OAD A;  3M9K A;  3E3E A;  3DIE A;  4CDO A;  2VCQ A;  4DVC A;  1MDK A;  3F4S A;  2YJH A;  2PU9 C;  2R3X A;  1M9A A;  1JLW A;  3IC4 A;  2VCW A;  4MF5 A;  4Q5R A;  2L57 A;  3APO A;  4MCU A;  3UJ1 A;  1K0C A;  2J23 A;  4IQA A;  2YPM A;  1N8J A;  1EZK A;  3HZ8 A;  3F0I A;  2Z9S A;  5J9B A;  2IMD A;  4EE0 A;  5HFK A;  4PNF A;  2R6K A;  3EE2 A;  4HQZ A;  2RLI A;  3DYR A;  4KDU A;  1GTB A;  2E2G A;  4TXV A;  1YJ6 A;  2OE3 A;  2ZCT A;  2OBI A;  5CRW A;  2YZH A;  4POB A;  5CO3 A;  1MTC A;  1TRV A;  4Q5F A;  4V2N A;  3O3T A;  2VLV A;  3EMP A;  1QQ2 A;  2K6V A;  3IBH A;  1PL2 A;  3KIJ A;  4MJE A;  2DMM A;  4PQ1 A;  2WGR A;  3CTF A;  4K6X A;  4DSS A;  2KLX A;  4WEY A;  2YV9 A;  1EOH A;  4MPG A;  4PGT A;  3TJG A;  5DAK A;  2NTO A;  4XTS A;  5IIZ A;  3GRX A;  6GSV A;  5IPG A;  1Z7R A;  3D21 A;  3P2A A;  2F51 A;  3ME8 A;  5IQY A;  3HY2 A;  4MJA A;  3M8N A;  1B8X A;  2CZ2 A;  1K3Y A;  3HCZ A;  3EWL A;  3Q74 A;  2FGX A;  3TGZ A;  3P8W A;  4RQX A;  3R2Q A;  1NW2 A;  1SYX A;  3FK8 A;  4NXI A;  4TR4 A;  3H93 A;  1ERW A;  1SK1 A;  2YP6 A;  2GT6 A;  3GIX A;  2B1K A;  5GZZ B;  2BTO T;  3UIW A;  2C3T A;  1SKR B;  4EL1 A;  1TU7 A;  5JCU A;  4ZB8 A;  3HYP A;  2JSZ A;  5ENU A;  4MP4 A;  3IDV A;  1Z5Y E;  5FWG A;  5JCW A;  4RQR A;  3TOT A;  4YH2 A;  2MMN A;  5IM9 A;  3VWW A;  1BYE A;  4KDX A;  5ABR A;  1OAZ A;  4ILF A;  1T00 A;  2HLS A;  5KN2 A;  2C0F A;  1OC3 A;  5B8B A;  4ECC A;  1UN2 A;  3LQ7 A;  1XOA A;  4KND A;  1K3L A;  3C7M A;  4BVY A;  5ECI B;  5GAN D;  4ECJ A;  1X0R A;  5F8B A;  2L4Q A;  1XWA A;  2DBC A;  3NOF A;  2HXK A;  4G10 A;  3FZ9 A;  4KUN A;  3GMF A;  1SKW B;  3GTU A;  2V1M A;  3M0F A;  19GS A;  3MDK A;  4O5R A;  3TUE A;  4JE1 A;  1MDJ A;  4K2D A;  1ML6 A;  1SK0 A;  2O85 A;  4NV2 A;  3IR4 A;  2F9S A;  4ZBD A;  10GS A;  4GTU A;  2TRX A;  1HNC A;  1F9M A;  1TOF A;  3GL5 A;  3RPN A;  3NIV A;  1BED A;  4MK3 A;  1J9B A;  4L8E A;  4YAV A;  2H1A A;  2GZP A;  3RHC A;  2H0I A;  3KM6 A;  3Q6O A;  1ZYQ B;  4X1U A;  1K0A A;  2WRT A;  3HVS A;  4EKZ A;  3TKR A;  1M7T A;  4EF0 A;  3VK9 A;  2L59 A;  2PUK C;  3VLN A;  1E2Y A;  4HS1 A;  1R7H A;  2LQQ A;  2E2M A;  4OCF A;  2LTK A;  2RM6 A;  2HZE A;  4K9Z A;  3M9J A;  3CSJ A;  2H1B A;  2LNS A;  3ZVJ D;  3FZ4 A;  4PX1 A;  2EIQ A;  2O89 A;  4KE3 A;  2LS5 A;  4NPB A;  3GKN A;  2YCD A;  1Q4J A;  5AGY A;  3RHB A;  1HNA A;  1YKC A;  1VRS D;  2IIY A;  4OD7 A;  5H5R A;  2H66 A;  4JU5 A;  1YZX A;  3IXR A;  1OE7 A;  2N5F A;  3FHK A;  3QDN A;  2VL9 A;  5B8A A;  1FB0 A;  1TJD A;  3HJM A;  4KSM A;  3D0Z A;  4TXO B;  4I8B A;  1I5G A;  3GX0 A;  3DML A;  2GT5 A;  2C4J A;  3FY7 A;  1AAZ A;  3A2X A;  2EIO A;  2B6M A;  3ZL5 A;  2OJL A;  1U87 A;  1K0O A;  1BX9 A;  5JWR B;  4G19 A;  5ELA A;  1KTE A;  4MH2 A;  1JHB A;  4EDY A;  3VPQ A;  4BA7 A;  5DCG A;  3EC3 A;  3I43 A;  4G9H A;  4TR0 A;  17GS A;  1GRX A;  1UVZ A;  3CRU A;  1JZW A;  2WB9 A;  1R4W A;  4KAE A;  2C8U A;  2H0G A;  2GGT A;  5KN1 A;  1NSW A;  3ME7 A;  2DIY A;  4ZL7 A;  3FR6 A;  1SJ6 A;  2GLR A;  1JZR A;  2HYX A;  1F6M C;  3QFA C;  3F9U A;  2TRC P;  3GKK A;  3KJY A;  3LFL A;  2CAQ A;  3H4K A;  4HJ2 A;  2A2R A;  4NV5 A;  3EU4 A;  2NVL A;  1XWG A;  3S9F A;  5CRD A;  3UVT A;  4MH3 A;  2OE0 A;  4PXO A;  2V6O A;  2VO4 A;  1ON4 A;  3KCM A;  3VI7 A;  3Q19 A;  2YWI A;  1EOG A;  3TRP A;  2WJU A;  1Z3E A;  2F8F A;  4IGJ A;  4K7I A;  4ML1 A;  3DVW A;  3ZRD A;  4OFM A;  1TTZ A;  4XS6 A;  2CVD A;  4TKY A;  2VCX A;  5KN3 A;  5DAL B;  1OC9 A;  2H74 A;  2C3Q A;  1EGO A;  4EUY A;  4F82 A;  2GQM A;  5E59 A;  4EVM A;  1WP0 A;  1U3I A;  2E7P A;  1F2E A;  1PGT A;  4XIH A;  1WWJ A;  1ERV A;  3GH9 A;  2O87 A;  2YWO A;  5G1L A;  2H01 A;  1U88 A;  5D9V A;  1W4V A;  3HD5 A;  3TKQ A;  1F37 A;  13GS A;  1TU8 A;  2IL3 A;  1TXX A;  4IS0 A;  2B5E A;  3EYT A;  5A4U A;  4JED A;  1XWK A;  3F63 A;  3FR9 A;  2H6X A;  3I6A A;  3L9U A;  3GKM A;  4OCE A;  3GST A;  4HU9 A;  2FA8 A;  4IBP A;  4ZL8 A;  1XCC A;  3I69 A;  2JL4 A;  3CRT A;  4EDZ A;  3M1G A;  4HZ4 A;  3QAV A;  3ZTL A;  3APQ A;  4XHM A;  1TI3 A;  3G7I A;  5HR2 A;  1TW9 A;  1XBS A;  4IJI A;  4ZIJ A;  1FOV A;  2DJ3 A;  1O8X A;  1ZOF A;  1NHY A;  4MF7 A;  1WRY A;  2X99 A;  1Q98 A;  2VCV A;  3D4M A;  2HRF A;  2AB6 A;  4NHZ A;  3JCM L;  6GSW A;  2J9H A;  3EU3 A;  5CRE A;  5HR1 A;  2XC2 A;  4KH7 A;  3BOA A;  3W8J A;  4RI6 A;  3KH7 A;  3UAP A;  1A8Y A;  4Z7X A;  2B7J A;  1AQV A;  2P5R A;  1T4Y A;  2FWF A;  4ZBA A;  3F4T A;  2L6D A;  2GSR A;  4HJM A;  5E4W A;  20GS A;  2CT6 A;  1GUH A;  1WOU A;  1T3B A;  3O6T A;  3TKS C;  2GSQ A;  2TIR A;  2G0F A;  2RUF A;  5IMA A;  3BBY A;  7GSS A;  5A4V A;  2K9F A;  2FWG A;  3IV4 A;  2FWH A;  1IYI A;  2PMT A;  3HVV A;  4BPY A;  4K0N A;  2CZ3 A;  1TK8 B;  2WCI A;  1X9M B;  1XXU A;  2H72 A;  2WDU A;  5IPH A;  4N10 A;  1RQM A;  5DVB A;  5A4W A;  4J2F A;  1GL8 A;  2OE1 A;  1FO5 A;  5G5F A;  1WJK A;  3L0H A;  1C72 A;  1PA3 A;  11GS A;  2AYT A;  1H75 A;  4WBJ A;  1AQX A;  4RI7 A;  4I6X A;  4FYU A;  4O32 A;  2LEG A;  1O7U A;  2L4C A;  1PL1 A;  1V57 A;  1A24 A;  1TRU A;  2VM2 A;  1THO A;  5EVO A;  5ECR B;  1YEX A;  4KX4 A;  3UAR A;  1K0B A;  1EWX A;  4JBB A;  1BJX A;  4FO5 A;  1IYH A;  4PUR A;  2PVO C;  1AQW A;  2NDO A;  2WS2 A;  3UVH A;  4ZBB A;  4N30 A;  2V2G A;  2LJR A;  2H6Z A;  2PER A;  3UBL A;  2OAC A;  3KTB A;  4OWY A;  5G5E A;  4DEJ A;  1GLQ A;  1GUK A;  5AIV A;  2C80 A;  1VF4 A;  3PGT A;  2P5Q A;  5HR0 A;  5HFG A;  4TRX A;  1EEJ A;  5J9C A;  1A0R P;  2QGV A;  2YN1 A;  3CXG A;  3KEB A;  3HJO A;  3VPT A;  1JFU A;  2MZC A;  4YQV A;  5ECM B;  5IMD A;  4MJB A;  4GWR A;  4I97 A;  4AJ7 A;  2GZY A;  2IWT A;  1T8E B;  1DBY A;  2DJ0 A;  3A2V A;  4HQS A;  3J7Y b;  3GA4 A;  8GSS A;  4I2U A;  4L5L A;  2DIZ A;  5ID2 B;  4XCS A;  4MPF A;  3APS A;  1VGL A;  3DVX A;  3TKP A;  3D4T A;  1GUL A;  4K1F A;  1YEP A;  2O8V B;  4GXZ A;  6GSY A;  3DD3 A;  4KW6 A;  2DSA A;  1OYJ A;  2VL3 A;  2GS3 A;  4K0G A;  5GAP D;  2YWN A;  3IAM 2;  2PWJ A;  1ZCP A;  3F8U A;  3RBT A;  3HA9 A;  2MMA A;  2VLT A;  1TK5 B;  1DSB A;  1R5A A;  3QAW A;  4OFT A;  1YDK A;  1X9W B;  1AC1 A;  2FA4 A;  1SD8 A;  4POM A;  4V1A g;  2GDR A;  3WGX A;  4HU7 A;  2A2S A;  2LV3 A;  3DWV A; 
#chains in the Genus database with same CATH topology
 3TKS E;  3A5I A;  2REM A;  4DSS B;  5ELG A;  4Q5Q A;  2I3Y A;  1TI1 A;  3ZYW A;  6GSS A;  1XWB A;  4FYB A;  5IMZ A;  2B7K A;  12GS A;  3VWV A;  3ZRE A;  2FUG 2;  1MD4 A;  2X8H A;  3TJF A;  1Z6N A;  3Q18 A;  1XG8 A;  5ECS A;  2A4V A;  2LJK A;  2O7K A;  2H1G A;  3BJ5 A;  2KP2 A;  2YZU A;  3KP9 A;  3IA1 A;  3KH9 A;  2VL2 C;  1PKW A;  2GSS A;  1LU4 A;  2H19 A;  4LLR A;  2YNX A;  2HSY A;  1BAY A;  2DJ2 A;  2GST A;  5D73 A;  5D9T A;  3VFI A;  2JZT A;  4JZQ A;  4IP6 A;  4OMV A;  4N0V A;  1PD2 1;  3LW9 A;  3IHQ A;  6GSU A;  2JU5 A;  4F2I A;  4ZB9 A;  3TB2 A;  2MBS A;  4MZC A;  4PQH A;  2HNL A;  2LRT A;  1GLP A;  2PN8 A;  2PVQ A;  2VM1 A;  1F3B A;  2L6C A;  1PX6 A;  4Q5N A;  3DRN A;  3U5R E;  5LNK e;  3IC8 A;  1XOB A;  2NPB A;  3FKF A;  2H0H A;  3ZMK A;  1ACV A;  4TVE A;  3QPM A;  4HDE A;  3DEX A;  4EIQ A;  2LUS A;  4XS4 A;  1PFO A;  4NWY A;  1U6T A;  4KDY A;  4HI7 A;  5IOW A;  2QSI A;  3KGK A;  1V2A A;  2JAC A;  3SBC A;  2I4A A;  5CRH A;  4DSQ A;  5DDL A;  1XVW A;  4QL9 A;  3QD9 A;  4ZIL A;  4K7N A;  1SL2 B;  1VF2 A;  2LRN A;  3J7Y k;  1ST9 A;  2UZ8 A;  3BCI A;  3ISO A;  3LYK A;  2XHF A;  1QXH A;  5HR3 A;  2B3S A;  2V32 A;  1OE8 A;  2RII A;  3FR3 A;  4IVF A;  1FB6 A;  4HUA A;  1M2A A;  4G2E A;  2R2J A;  1GWC A;  1UC7 A;  4BL7 B;  6GST A;  2N5A A;  3O76 A;  5IO0 A;  1FVJ A;  1X5D A;  6GSX A;  4JRR A;  5H5Q A;  2HI7 A;  5ECK B;  1XPV A;  1B4Q A;  4O7H A;  1QK8 A;  4TR3 A;  2CAI A;  5DAL A;  3E0U A;  4QL7 A;  5F07 A;  5LD0 A;  2GQL A;  3ERF A;  1ABA A;  2B1L A;  4GQF A;  5F05 A;  4GSN A;  2VCT A;  2JZR A;  2CQ9 A;  1HNB A;  3WGE A;  1SEN A;  4MAB A;  3TRX A;  2XPD A;  5ECL B;  1ZGN A;  3ZVJ A;  3GN3 A;  4JR4 A;  2PGT A;  1S3C A;  2HRA A;  3E9J B;  4IHU A;  2YV7 A;  3C1R A;  3HVN A;  3L9S A;  3L4N A;  1G7E A;  2CVB A;  2MYG A;  4K7O A;  3GKX A;  4L0W A;  1AXD A;  4F03 A;  3VUR A;  5D9W A;  1M0U A;  2M72 A;  1M3I A;  3GUS A;  3U6V A;  3H8Q A;  5GST A;  1WMJ A;  1EV4 A;  1SJI A;  2FCH A;  5D8I A;  1ZYE A;  2M46 A;  4FYC A;  2HT9 A;  5KN0 A;  1O8W A;  1VF1 A;  1VF3 A;  3WYW A;  3EIN A;  1FG4 A;  5J41 A;  1A2L A;  1A2M A;  1RK4 A;  4AGS A;  2LQO A;  1TK0 B;  4EC0 A;  1QMV A;  1AUC A;  3CMI A;  1QFN A;  4O92 A;  3LEF A;  2MMZ A;  1XIY A;  5G1K A;  3FZ5 A;  1WIK A;  2CA8 A;  3IE3 A;  1SJZ A;  2VOC A;  2IFQ B;  3KTL A;  4CY6 A;  4TR1 B;  1FW1 A;  4MJC A;  5G30 A;  4V2M A;  3LXZ A;  1YQ1 A;  2AV4 A;  1I9D A;  2C1Y A;  4KCE A;  3V1W A;  4LL4 B;  2VUP A;  1Z7P A;  2YJ7 A;  4X43 A;  3ZFL A;  3K8N A;  5D9X A;  3KP8 A;  2XBI A;  3WD6 A;  1URM A;  3FEU A;  2F8A A;  1R5P A;  5JWO B;  1W89 A;  2X49 A;  2H70 A;  4ECI A;  5CNW A;  3VWX A;  1MD3 A;  5FT3 A;  2H76 A;  4HEA 2;  3UEM A;  4WF4 A;  2FNO A;  2K8S A;  3GH6 A;  1F3A A;  3PH9 A;  1GSF A;  1O81 A;  3P90 A;  2PPT A;  4P3Y B;  5ECP B;  1Z6M A;  1FAA A;  1EEM A;  1YY7 A;  3M3M A;  1CQG A;  4POL A;  1PQN A;  2H30 A;  1OKT A;  2DLX A;  4N11 A;  3BCK A;  1GSQ A;  1N2A A;  1GSD A;  3CQF A;  2ON7 A;  4H86 A;  1FHE A;  3GYK A;  3G9B A;  4K2X A;  2OBK A;  5AIX A;  3ZZX A;  4GF0 A;  3VI5 A;  2B5X A;  3ZFB A;  2C0D A;  3TJK A;  4ICY A;  1GSS A;  1T1V A;  4D73 B;  4MDC A;  1X5E A;  3QR6 A;  4LMV A;  1ZMA A;  3WT2 A;  4PNG A;  4HZ2 A;  5C04 A;  4ACS A;  2X8G A;  3G7Y A;  1XW6 A;  2H6Y A;  3P7X A;  2WFC A;  4XS1 A;  3PR8 A;  5B7C A;  3F3R A;  3F3Q A;  2JZS A;  1GSU A;  1B4P A;  1OKD A;  1TDI A;  2ALB A;  1E6B A;  1PMT A;  4FIW A;  4YKG A;  3EUR A;  1G6W A;  4MZB A;  1V98 A;  5DJM A;  2ZUP A;  1KNG A;  2BJX A;  3FYG A;  4IKH A;  4IP1 A;  2NBS A;  1Z9H A;  4G0L A;  2K18 A;  3W8S A;  1K0D A;  4MMM A;  1JZD A;  1HYU A;  1LJR A;  3CSH A;  2HZF A;  5IMF A;  4YQM A;  5ID2 A;  1M9B A;  2H73 A;  4BWQ A;  2V6K A;  1YF1 A;  3TKS A;  4MZW A;  2R5G A;  4PTS A;  2DJK A;  5B6M A;  5ECN B;  4XRD A;  3TDG A;  18GS A;  2HFD A;  4AJ6 A;  5CAX A;  3LSZ A;  1PX7 A;  4I5Q A;  3ZML A;  4ISD A;  4L0U A;  3DXB A;  4O5Q A;  4E8E A;  1CQH A;  4KB3 A;  1SU9 A;  3UOM A;  3GUR A;  4XRA A;  4EIP A;  1AW9 A;  3I9V 2;  1DE1 A;  2HSM A;  4BVX B;  5KEJ A;  1Y25 A;  3IRA A;  2E0Q A;  5EPF A;  3C8E A;  1SD9 A;  1WE0 A;  2FWE A;  1WPI A;  3F6D A;  2P31 A;  5KOX A;  1R26 A;  1J0F A;  1K3O A;  2D2Z A;  2C3N A;  4MF6 A;  4ULX A;  1TKD B;  1XZO A;  3WGD A;  4GST A;  2YOI A;  2KP1 A;  3KD0 A;  5AN1 A;  1PN9 A;  3RAZ A;  2R37 A;  2I1U A;  3G7J A;  2IPA A;  1S3A A;  2HRN A;  3FZA A;  3MSZ A;  5KOW A;  1XFL A;  9GSS A;  2ZNM A;  1XWC A;  2QC7 A;  5ECH B;  3RDW A;  4LL1 B;  4GSS A;  1K0M A;  3MIX A;  4ZB6 A;  3HXS A;  4LMW A;  1M2D A;  3KXO A;  1M2B A;  1T4Z A;  5IO2 A;  1GP1 A;  1TP9 A;  3HHV A;  4IW9 A;  1TRS A;  3QAG A;  1ZL9 A;  1T7P B;  3DKS A;  3C71 A;  3WT1 A;  4PUA A;  3ZIV A;  4OO4 A;  1NM3 A;  2GZZ A;  2VIM A;  3RPP A;  1GSE A;  2LNT A;  2DJ1 A;  1XW9 A;  1M99 A;  1GUM A;  4WXT A;  5DQS A;  3KZQ A;  5H5S A;  1OVN A;  2IMI A;  1PSQ A;  2EIR A;  4FQU A;  2R0P A;  1S3D A;  1GTI A;  5DAK B;  2CVK A;  2DML A;  2CX4 A;  4CW9 A;  4YAP A;  2IMK A;  3N9J A;  1SL1 B;  4OFN A;  2RUE A;  3LJR A;  2VLU A;  2CX3 A;  3QCP A;  2IME A;  3GHA A;  1SK2 A;  1EV9 A;  2OKA A;  3W6G A;  4AF2 A;  2DKI A;  3TCO A;  2I9H A;  4X0X A;  2IN3 A;  2L5L A;  1HQO A;  3EPT A;  1PN0 A;  3LG6 A;  5CRG A;  14GS A;  2AUV A;  2DJJ A;  4NMU A;  1A23 A;  1DUG A;  2AHE A;  4IEL A;  1OC8 A;  1M3J A;  4O5U A;  1THX A;  1O6J A;  2EC4 A;  4ML6 A;  2LKU A;  5J5N A;  2B5Y A;  2IMF A;  2YWM A;  3ERW A;  4GCI A;  2V41 A;  4KGI A;  3L9V A;  22GS A;  4WBR D;  1ERT A;  1X5C A;  4TXO A;  4LA1 A;  5EL8 A;  4J56 E;  2ES7 A;  4IJ3 A;  3GL3 A;  5F06 A;  1PKZ A;  2JSY A;  1B48 A;  3F6F A;  3F4R A;  4TOP A;  3GV1 A;  4BL7 A;  4WF5 A;  4DSR A;  4AJ8 A;  2VL2 A;  4ID0 A;  1XW5 A;  2KHP A;  1GSY A;  5G31 A;  1SKS B;  1GNE A;  2R0C A;  1ERU A;  2KOK A;  3LYP A;  4KA0 A;  4ECB A;  3A2W A;  5DQY A;  5FHI A;  5G2Z A;  3D5J A;  2WZ9 A;  4BVY B;  1JZO A;  3LOR A;  5L71 A;  1GNW A;  2K8V A;  1FOH A;  3D6I A;  3MAK A;  1USB A;  3IOS A;  3TOU A;  2R4V A;  3ZIT A;  5IOX A;  1X9S B;  2KUC A;  2FLS A;  4KCA A;  2FY6 A;  2HE3 A;  3GTU B;  1JLV A;  3ED3 A;  1SL0 B;  1QUW A;  5HQP A;  1V9W A;  1ZYP A;  4IN0 A;  1A8L A;  3GSS A;  4EXJ A;  4NAX A;  3NZN A;  3A3T A;  5JWQ B;  3SWL A;  3C1S A;  2L5O A;  4JR6 A;  2JAD A;  2MMO A;  3AY8 A;  1V40 A;  4E8H A;  5CP1 A;  5LCZ A;  3A5W A;  4PUF C;  3TRQ A;  3ZIJ A;  1RW1 A;  3H79 A;  3MNG A;  3TJJ A;  4CHS A;  3IPZ A;  4NHW A;  1SYR A;  5D93 A;  3ERG A;  4ZL9 A;  2XBQ A;  5D96 A;  2HZE B;  4IQ1 A;  5J4U A;  4I2T A;  5EY6 A;  4F9Z A;  2CV4 A;  2IFQ A;  5GSS A;  2OA7 A;  1NHO A;  3HKR A;  1B9X C;  4KSO A;  4TR1 A;  4GQC A;  5DCH A;  2QKE A;  4XS4 B;  2AJQ B;  2RM5 A;  3EMX A;  3LGC A;  1K0N A;  2LRC A;  2MBT A;  1EP8 A;  4N0Z A;  5J3R A;  4WR5 A;  2GVP A;  3HZ4 A;  5AIS A;  1KBN A;  5ECQ B;  16GS A;  4GLT A;  2HSH A;  2LJA A;  5DBQ A;  4G0I A;  4FH8 A;  3FRC A;  2GTU A;  1GTA A;  2QA1 A;  4F0B A;  1A2J A;  3CBU A;  4WKW A;  4OO5 A;  2I81 A;  3ZLP A;  1YKA A;  2H71 A;  4K5S A;  1Y6E A;  1PRX A;  4TN8 A;  2G2Q A;  3UL3 A;  2FHE A;  2XPE A;  1O85 A;  3PIN A;  1V58 A;  4L5O A;  3L78 A;  5JCG A;  3CYN A;  4K5R A;  5IMV A;  5A5K A;  3DGQ A;  3BD2 A;  4USS A;  3OR5 A;  2GQK A;  4J57 E;  4PQI A;  3CSI A;  2N5B A;  3IK9 A;  1QGV A;  3C73 A;  2DKH A;  4EO3 A;  1GH2 A;  4GRF A;  2X64 A;  5IMC A;  5F0G A;  4POK A;  5C00 A;  3R3E A;  1J08 A;  1O73 A;  1FVK A;  5CYY A;  2X8C A;  3QMX A;  3KMO A;  1MDI A;  3QFB C;  1A0F A;  1YF0 A;  2C0G A;  3GFK A;  2VD1 A;  1ILO A;  2VAF A;  1BQ7 A;  3GX8 A;  1KEB A;  2H75 A;  1AIU A;  4D73 A;  4QQ7 A;  3MWH A;  1DE2 A;  2VD0 A;  2H8L A;  3EVI A;  3LWA A;  3IK7 A;  1G7O A;  4WR4 A;  3KMN A;  1XVQ A;  3UMA A;  4TW5 A;  2LST A;  3LXT A;  5HFI A;  2C0E A;  1G0T A;  3GNJ A;  2IJY A;  1G6Y A;  2BMX A;  1GTU A;  1U3A A;  3FW2 A;  5ECO B;  2PBJ A;  3HVX A;  2P0G A;  1OC9 B;  2VCZ A;  3QOU A;  5DJL A;  4BIK A;  3HDC A;  5COH A;  3D22 A;  4V1A p;  1EP7 A;  1H4O A;  1ZZY A;  3H1N A;  3N5O A;  2WUL A;  5B6N A;  3HJP A;  3VWU A;  4MLY A;  3CTG A;  4MA9 A;  3US3 A;  4K8M A;  4ZXG A;  2DC5 A;  1MEK A;  4YKF A;  4Z2T A;  1LBK A;  4BWS A;  4V2L A;  3UBK A;  1B9Y C;  2H1D A;  1UA5 A;  3TJB A;  2F3M A;  4YQU A;  1EGR A;  1BG5 A;  4RUV A;  2M80 A;  4WET A;  1TRW A;  2YAN A;  2AAW A;  4F0C A;  5INY A;  2FD3 A;  2ON5 A;  4HOJ A;  4BVX A;  1HD2 A;  3IAS 2;  2A2P A;  2OAD A;  3M9K A;  4A5P A;  3E3E A;  4Z2R A;  3DIE A;  4CDO A;  2VCQ A;  4DVC A;  1MDK A;  3F4S A;  4KF9 A;  2YJH A;  2PU9 C;  2R3X A;  1M9A A;  1JLW A;  3IC4 A;  2VCW A;  4MF5 A;  2QA2 A;  4Q5R A;  2L57 A;  3APO A;  4MCU A;  3UJ1 A;  1K0C A;  2J23 A;  4IQA A;  2YPM A;  1N8J A;  1EZK A;  3HZ8 A;  3F0I A;  2Z9S A;  5J9B A;  2IMD A;  4EE0 A;  5HFK A;  4PNF A;  2R6K A;  3EE2 A;  4HQZ A;  2RLI A;  3DYR A;  4KDU A;  5BMU A;  1GTB A;  2E2G A;  2R0G A;  4TXV A;  2A4H A;  1YJ6 A;  2OE3 A;  2ZCT A;  2OBI A;  5CRW A;  2YZH A;  4POB A;  5CO3 A;  1MTC A;  1TRV A;  4Q5F A;  4V2N A;  3O3T A;  2VLV A;  3EMP A;  1QQ2 A;  2K6V A;  3IBH A;  1PL2 A;  3KIJ A;  4MJE A;  2DMM A;  4PQ1 A;  2WGR A;  3CTF A;  4K6X A;  4DSS A;  2KLX A;  4WEY A;  2YV9 A;  1EOH A;  4MPG A;  4PGT A;  3TJG A;  5DAK A;  2NTO A;  4XTS A;  5IIZ A;  3GRX A;  6GSV A;  5IPG A;  1Z7R A;  3D21 A;  3P2A A;  2F51 A;  3ME8 A;  5IQY A;  3HY2 A;  4MJA A;  2HRK A;  3M8N A;  1B8X A;  2CZ2 A;  1K3Y A;  3HCZ A;  3EWL A;  3Q74 A;  2FGX A;  3TGZ A;  3P8W A;  4RQX A;  3R2Q A;  1NW2 A;  1SYX A;  3FK8 A;  4NXI A;  4TR4 A;  3H93 A;  1ERW A;  4MNN A;  1SK1 A;  2YP6 A;  2GT6 A;  3GIX A;  2B1K A;  5GZZ B;  2BTO T;  3UIW A;  2C3T A;  1SKR B;  4EL1 A;  1TU7 A;  5JCU A;  4ZB8 A;  3HYP A;  2JSZ A;  5ENU A;  4MP4 A;  3IDV A;  4Z2U A;  1Z5Y E;  5FWG A;  5JCW A;  4RQR A;  3TOT A;  4YH2 A;  2MMN A;  5IM9 A;  3VWW A;  1BYE A;  4KDX A;  5ABR A;  1OAZ A;  4ILF A;  1T00 A;  2HLS A;  5KN2 A;  2C0F A;  1OC3 A;  5B8B A;  4ECC A;  1UN2 A;  3PPU A;  3LQ7 A;  1XOA A;  4KND A;  1K3L A;  3C7M A;  4BVY A;  5ECI B;  5GAN D;  4ECJ A;  1S3R A;  1X0R A;  5BRT A;  5F8B A;  2L4Q A;  1XWA A;  2DBC A;  3NOF A;  2HXK A;  4G10 A;  3FZ9 A;  4KUN A;  3GMF A;  1SKW B;  3GTU A;  2V1M A;  3M0F A;  19GS A;  3MDK A;  4O5R A;  3TUE A;  4JE1 A;  2X4A A;  1MDJ A;  4K2D A;  1ML6 A;  1SK0 A;  2O85 A;  4NV2 A;  3IR4 A;  2F9S A;  4ZBD A;  10GS A;  4GTU A;  2TRX A;  1HNC A;  1F9M A;  1TOF A;  3GL5 A;  3RPN A;  3NIV A;  1BED A;  4MK3 A;  1J9B A;  4L8E A;  4YAV A;  2H1A A;  2GZP A;  3RHC A;  2H0I A;  3KM6 A;  3Q6O A;  1ZYQ B;  4X1U A;  1K0A A;  2WRT A;  3HVS A;  4EKZ A;  3TKR A;  1M7T A;  4EF0 A;  3VK9 A;  2L59 A;  2PUK C;  3VLN A;  1E2Y A;  4HS1 A;  1R7H A;  2LQQ A;  2E2M A;  4OCF A;  2LTK A;  2RM6 A;  2HZE A;  4K9Z A;  3M9J A;  3CSJ A;  2H1B A;  2LNS A;  3ZVJ D;  3FZ4 A;  4PX1 A;  2EIQ A;  2O89 A;  4KE3 A;  2LS5 A;  4NPB A;  3GKN A;  2YCD A;  1Q4J A;  5AGY A;  3RHB A;  1HNA A;  1YKC A;  1VRS D;  2IIY A;  4OD7 A;  5H5R A;  2H66 A;  4JU5 A;  1YZX A;  3IXR A;  1OE7 A;  2N5F A;  3FHK A;  3QDN A;  2VL9 A;  5B8A A;  1FB0 A;  1TJD A;  3HJM A;  4KSM A;  3D0Z A;  4TXO B;  4I8B A;  1I5G A;  3GX0 A;  3DML A;  2GT5 A;  2C4J A;  3FY7 A;  1AAZ A;  3A2X A;  2EIO A;  2B6M A;  3ZL5 A;  2OJL A;  1U87 A;  1K0O A;  1BX9 A;  5JWR B;  4G19 A;  5ELA A;  1KTE A;  4MH2 A;  1JHB A;  4EDY A;  3VPQ A;  4BA7 A;  5DCG A;  3EC3 A;  3I43 A;  4G9H A;  4TR0 A;  17GS A;  1GRX A;  1UVZ A;  3CRU A;  1JZW A;  2WB9 A;  1R4W A;  4KAE A;  2C8U A;  2H0G A;  2GGT A;  5KN1 A;  1NSW A;  3ME7 A;  2DIY A;  4ZL7 A;  3FR6 A;  1SJ6 A;  2GLR A;  1JZR A;  2HYX A;  1F6M C;  3QFA C;  3F9U A;  2TRC P;  3GKK A;  3KJY A;  3LFL A;  2CAQ A;  3H4K A;  4HJ2 A;  2A2R A;  4NV5 A;  3EU4 A;  2NVL A;  1XWG A;  3S9F A;  5CRD A;  3UVT A;  4MH3 A;  2OE0 A;  4PXO A;  2V6O A;  2VO4 A;  1ON4 A;  3KCM A;  3VI7 A;  3Q19 A;  2YWI A;  1EOG A;  1ZYN A;  3TRP A;  2WJU A;  1Z3E A;  2F8F A;  4IGJ A;  4K7I A;  4ML1 A;  3DVW A;  3ZRD A;  4OFM A;  1TTZ A;  4XS6 A;  2CVD A;  4TKY A;  2VCX A;  3MYD A;  5KN3 A;  5DAL B;  1OC9 A;  2H74 A;  2C3Q A;  1EGO A;  4EUY A;  4F82 A;  2GQM A;  5E59 A;  4EVM A;  1WP0 A;  1U3I A;  2E7P A;  1F2E A;  1PGT A;  3IHG A;  4XIH A;  1WWJ A;  1ERV A;  3GH9 A;  2O87 A;  2YWO A;  5G1L A;  2H01 A;  1U88 A;  5D9V A;  1W4V A;  3HD5 A;  3TKQ A;  1F37 A;  13GS A;  1TU8 A;  2IL3 A;  1TXX A;  4IS0 A;  2B5E A;  3EYT A;  5A4U A;  4JED A;  1XWK A;  3F63 A;  3FR9 A;  2H6X A;  3I6A A;  3L9U A;  3GKM A;  4OCE A;  3GST A;  4HU9 A;  2FA8 A;  4IBP A;  4ZL8 A;  1XCC A;  3I69 A;  2JL4 A;  3CRT A;  4EDZ A;  3M1G A;  4HZ4 A;  3QAV A;  3ZTL A;  3APQ A;  4XHM A;  1TI3 A;  3G7I A;  5HR2 A;  1TW9 A;  1XBS A;  4IJI A;  4ZIJ A;  1FOV A;  2DJ3 A;  1O8X A;  1ZOF A;  1NHY A;  4MF7 A;  1WRY A;  2X99 A;  1Q98 A;  2VCV A;  3D4M A;  4G0K A;  2HRF A;  2AB6 A;  4NHZ A;  3JCM L;  6GSW A;  2J9H A;  3EU3 A;  5CRE A;  5HR1 A;  2XC2 A;  4KH7 A;  3BOA A;  3W8J A;  4RI6 A;  3KH7 A;  3UAP A;  1A8Y A;  4Z7X A;  2B7J A;  1AQV A;  2P5R A;  1T4Y A;  2FWF A;  4ZBA A;  3F4T A;  2L6D A;  2GSR A;  4HJM A;  5E4W A;  20GS A;  2CT6 A;  1GUH A;  1WOU A;  1T3B A;  3O6T A;  3TKS C;  2GSQ A;  2TIR A;  2G0F A;  2RUF A;  5IMA A;  3BBY A;  7GSS A;  5A4V A;  2K9F A;  2FWG A;  3IV4 A;  2FWH A;  1IYI A;  2PMT A;  3HVV A;  4BPY A;  4X4J A;  4K0N A;  2CZ3 A;  1TK8 B;  2WCI A;  1X9M B;  1XXU A;  2H72 A;  2WDU A;  5IPH A;  4N10 A;  1RQM A;  5DVB A;  5A4W A;  4J2F A;  1GL8 A;  2OE1 A;  1FO5 A;  5G5F A;  1WJK A;  3L0H A;  1C72 A;  1PA3 A;  11GS A;  2AYT A;  1H75 A;  4WBJ A;  1AQX A;  4RI7 A;  4I6X A;  4FYU A;  4O32 A;  2LEG A;  1O7U A;  2L4C A;  1PL1 A;  1V57 A;  4HSC X;  1A24 A;  1TRU A;  2VM2 A;  1THO A;  5EVO A;  5ECR B;  1YEX A;  4KX4 A;  3UAR A;  1K0B A;  1EWX A;  4JBB A;  1BJX A;  4FO5 A;  1IYH A;  4PUR A;  2PVO C;  1AQW A;  2NDO A;  2WS2 A;  3UVH A;  4ZBB A;  4N30 A;  2V2G A;  2LJR A;  2H6Z A;  2PER A;  3UBL A;  2OAC A;  3KTB A;  4OWY A;  5G5E A;  4DEJ A;  1GLQ A;  1GUK A;  5AIV A;  2C80 A;  1VF4 A;  3PGT A;  2P5Q A;  5HR0 A;  5HFG A;  4TRX A;  1EEJ A;  5J9C A;  1A0R P;  2QGV A;  2YN1 A;  3CXG A;  3KEB A;  3HJO A;  3VPT A;  1JFU A;  2MZC A;  4YQV A;  5ECM B;  5IMD A;  4MJB A;  4GWR A;  4I97 A;  4AJ7 A;  2GZY A;  2IWT A;  1T8E B;  1DBY A;  2DJ0 A;  3A2V A;  4HQS A;  3J7Y b;  3GA4 A;  8GSS A;  4I2U A;  4L5L A;  2DIZ A;  5ID2 B;  4XCS A;  3FMW A;  4MPF A;  3APS A;  1VGL A;  3DVX A;  3TKP A;  3D4T A;  1GUL A;  4K1F A;  1YEP A;  2O8V B;  4GXZ A;  4CY8 A;  6GSY A;  3DD3 A;  4KW6 A;  2DSA A;  1OYJ A;  2VL3 A;  2GS3 A;  4K0G A;  5GAP D;  2YWN A;  3IAM 2;  2PWJ A;  1ZCP A;  3F8U A;  3RBT A;  3HA9 A;  2MMA A;  2VLT A;  1TK5 B;  1DSB A;  1R5A A;  3QAW A;  4OFT A;  1YDK A;  1X9W B;  1AC1 A;  2FA4 A;  1SD8 A;  4POM A;  4V1A g;  2GDR A;  3WGX A;  4HU7 A;  2A2S A;  2LV3 A;  3DWV A; 
#chains in the Genus database with same CATH homology
 3TKS E;  3A5I A;  2REM A;  4DSS B;  5ELG A;  4Q5Q A;  2I3Y A;  1TI1 A;  3ZYW A;  6GSS A;  1XWB A;  4FYB A;  5IMZ A;  2B7K A;  12GS A;  3VWV A;  3ZRE A;  2FUG 2;  1MD4 A;  2X8H A;  3TJF A;  1Z6N A;  3Q18 A;  5ECS A;  2A4V A;  2LJK A;  2O7K A;  2H1G A;  3BJ5 A;  2KP2 A;  2YZU A;  3KP9 A;  3IA1 A;  3KH9 A;  2VL2 C;  1PKW A;  2GSS A;  1LU4 A;  2H19 A;  4LLR A;  2YNX A;  2HSY A;  1BAY A;  2DJ2 A;  2GST A;  5D73 A;  5D9T A;  3VFI A;  2JZT A;  4JZQ A;  4IP6 A;  4OMV A;  4N0V A;  1PD2 1;  3LW9 A;  3IHQ A;  6GSU A;  2JU5 A;  4F2I A;  4ZB9 A;  3TB2 A;  2MBS A;  4MZC A;  4PQH A;  2HNL A;  2LRT A;  1GLP A;  2PN8 A;  2PVQ A;  2VM1 A;  1F3B A;  2L6C A;  1PX6 A;  4Q5N A;  3DRN A;  3U5R E;  5LNK e;  3IC8 A;  1XOB A;  2NPB A;  3FKF A;  2H0H A;  3ZMK A;  1ACV A;  4TVE A;  3QPM A;  4HDE A;  3DEX A;  4EIQ A;  2LUS A;  4XS4 A;  4NWY A;  1U6T A;  4KDY A;  4HI7 A;  5IOW A;  2QSI A;  3KGK A;  1V2A A;  2JAC A;  3SBC A;  2I4A A;  5CRH A;  4DSQ A;  5DDL A;  1XVW A;  4QL9 A;  3QD9 A;  4ZIL A;  4K7N A;  1SL2 B;  1VF2 A;  2LRN A;  3J7Y k;  1ST9 A;  2UZ8 A;  3BCI A;  3ISO A;  3LYK A;  2XHF A;  1QXH A;  5HR3 A;  2B3S A;  2V32 A;  1OE8 A;  2RII A;  3FR3 A;  4IVF A;  1FB6 A;  4HUA A;  1M2A A;  4G2E A;  2R2J A;  1GWC A;  1UC7 A;  4BL7 B;  6GST A;  2N5A A;  3O76 A;  5IO0 A;  1FVJ A;  1X5D A;  6GSX A;  4JRR A;  5H5Q A;  2HI7 A;  5ECK B;  1XPV A;  1B4Q A;  4O7H A;  1QK8 A;  4TR3 A;  2CAI A;  5DAL A;  3E0U A;  4QL7 A;  5F07 A;  5LD0 A;  2GQL A;  3ERF A;  1ABA A;  2B1L A;  4GQF A;  5F05 A;  4GSN A;  2VCT A;  2JZR A;  2CQ9 A;  1HNB A;  3WGE A;  1SEN A;  4MAB A;  3TRX A;  2XPD A;  5ECL B;  1ZGN A;  3ZVJ A;  3GN3 A;  4JR4 A;  2PGT A;  1S3C A;  2HRA A;  3E9J B;  4IHU A;  2YV7 A;  3C1R A;  3L9S A;  3L4N A;  1G7E A;  2CVB A;  2MYG A;  4K7O A;  3GKX A;  4L0W A;  1AXD A;  4F03 A;  3VUR A;  5D9W A;  1M0U A;  2M72 A;  3GUS A;  3U6V A;  3H8Q A;  5GST A;  1WMJ A;  1EV4 A;  1SJI A;  2FCH A;  5D8I A;  1ZYE A;  2M46 A;  4FYC A;  2HT9 A;  5KN0 A;  1O8W A;  1VF1 A;  1VF3 A;  3WYW A;  3EIN A;  1FG4 A;  5J41 A;  1A2L A;  1A2M A;  1RK4 A;  4AGS A;  2LQO A;  1TK0 B;  4EC0 A;  1QMV A;  1AUC A;  3CMI A;  1QFN A;  4O92 A;  3LEF A;  2MMZ A;  1XIY A;  5G1K A;  3FZ5 A;  1WIK A;  2CA8 A;  3IE3 A;  1SJZ A;  2VOC A;  2IFQ B;  3KTL A;  4CY6 A;  4TR1 B;  1FW1 A;  4MJC A;  5G30 A;  4V2M A;  3LXZ A;  1YQ1 A;  2AV4 A;  1I9D A;  2C1Y A;  4KCE A;  3V1W A;  4LL4 B;  2VUP A;  1Z7P A;  2YJ7 A;  4X43 A;  3ZFL A;  3K8N A;  5D9X A;  3KP8 A;  2XBI A;  3WD6 A;  1URM A;  3FEU A;  2F8A A;  1R5P A;  5JWO B;  1W89 A;  2X49 A;  2H70 A;  4ECI A;  5CNW A;  3VWX A;  1MD3 A;  5FT3 A;  2H76 A;  4HEA 2;  3UEM A;  4WF4 A;  2FNO A;  2K8S A;  3GH6 A;  1F3A A;  3PH9 A;  1GSF A;  1O81 A;  3P90 A;  2PPT A;  4P3Y B;  5ECP B;  1Z6M A;  1FAA A;  1EEM A;  1YY7 A;  3M3M A;  1CQG A;  4POL A;  1PQN A;  2H30 A;  1OKT A;  2DLX A;  4N11 A;  3BCK A;  1GSQ A;  1N2A A;  1GSD A;  2ON7 A;  4H86 A;  1FHE A;  3GYK A;  3G9B A;  4K2X A;  2OBK A;  5AIX A;  3ZZX A;  4GF0 A;  3VI5 A;  2B5X A;  3ZFB A;  2C0D A;  3TJK A;  4ICY A;  1GSS A;  1T1V A;  4D73 B;  4MDC A;  1X5E A;  3QR6 A;  4LMV A;  1ZMA A;  3WT2 A;  4PNG A;  4HZ2 A;  5C04 A;  4ACS A;  2X8G A;  3G7Y A;  1XW6 A;  2H6Y A;  3P7X A;  2WFC A;  4XS1 A;  3PR8 A;  5B7C A;  3F3R A;  3F3Q A;  2JZS A;  1GSU A;  1B4P A;  1OKD A;  1TDI A;  2ALB A;  1E6B A;  1PMT A;  4FIW A;  4YKG A;  3EUR A;  1G6W A;  4MZB A;  1V98 A;  5DJM A;  2ZUP A;  1KNG A;  2BJX A;  3FYG A;  4IKH A;  4IP1 A;  2NBS A;  1Z9H A;  4G0L A;  2K18 A;  3W8S A;  1K0D A;  4MMM A;  1JZD A;  1HYU A;  1LJR A;  3CSH A;  2HZF A;  5IMF A;  4YQM A;  5ID2 A;  1M9B A;  2H73 A;  4BWQ A;  2V6K A;  1YF1 A;  3TKS A;  4MZW A;  2R5G A;  4PTS A;  2DJK A;  5B6M A;  5ECN B;  4XRD A;  3TDG A;  18GS A;  2HFD A;  4AJ6 A;  5CAX A;  3LSZ A;  1PX7 A;  4I5Q A;  3ZML A;  4ISD A;  4L0U A;  3DXB A;  4O5Q A;  4E8E A;  1CQH A;  4KB3 A;  1SU9 A;  3UOM A;  3GUR A;  4XRA A;  4EIP A;  1AW9 A;  3I9V 2;  1DE1 A;  2HSM A;  4BVX B;  5KEJ A;  1Y25 A;  3IRA A;  2E0Q A;  5EPF A;  3C8E A;  1SD9 A;  1WE0 A;  2FWE A;  1WPI A;  3F6D A;  2P31 A;  5KOX A;  1R26 A;  1J0F A;  1K3O A;  2D2Z A;  2C3N A;  4MF6 A;  4ULX A;  1TKD B;  1XZO A;  3WGD A;  4GST A;  2YOI A;  2KP1 A;  3KD0 A;  5AN1 A;  1PN9 A;  3RAZ A;  2R37 A;  2I1U A;  3G7J A;  2IPA A;  1S3A A;  2HRN A;  3FZA A;  3MSZ A;  5KOW A;  1XFL A;  9GSS A;  2ZNM A;  1XWC A;  2QC7 A;  5ECH B;  3RDW A;  4LL1 B;  4GSS A;  1K0M A;  3MIX A;  4ZB6 A;  3HXS A;  4LMW A;  1M2D A;  3KXO A;  1M2B A;  1T4Z A;  5IO2 A;  1GP1 A;  1TP9 A;  3HHV A;  4IW9 A;  1TRS A;  3QAG A;  1ZL9 A;  1T7P B;  3DKS A;  3C71 A;  3WT1 A;  4PUA A;  3ZIV A;  4OO4 A;  1NM3 A;  2GZZ A;  2VIM A;  3RPP A;  1GSE A;  2LNT A;  2DJ1 A;  1XW9 A;  1M99 A;  1GUM A;  4WXT A;  5DQS A;  3KZQ A;  5H5S A;  1OVN A;  2IMI A;  1PSQ A;  2EIR A;  4FQU A;  2R0P A;  1S3D A;  1GTI A;  5DAK B;  2CVK A;  2DML A;  2CX4 A;  4CW9 A;  4YAP A;  2IMK A;  3N9J A;  1SL1 B;  4OFN A;  2RUE A;  3LJR A;  2VLU A;  2CX3 A;  3QCP A;  2IME A;  3GHA A;  1SK2 A;  1EV9 A;  2OKA A;  3W6G A;  4AF2 A;  2DKI A;  3TCO A;  2I9H A;  4X0X A;  2IN3 A;  2L5L A;  1HQO A;  3EPT A;  1PN0 A;  3LG6 A;  5CRG A;  14GS A;  2AUV A;  2DJJ A;  4NMU A;  1A23 A;  1DUG A;  2AHE A;  4IEL A;  1OC8 A;  4O5U A;  1THX A;  1O6J A;  2EC4 A;  4ML6 A;  2LKU A;  5J5N A;  2B5Y A;  2IMF A;  2YWM A;  3ERW A;  4GCI A;  2V41 A;  4KGI A;  3L9V A;  22GS A;  4WBR D;  1ERT A;  1X5C A;  4TXO A;  4LA1 A;  5EL8 A;  4J56 E;  2ES7 A;  4IJ3 A;  3GL3 A;  5F06 A;  1PKZ A;  2JSY A;  1B48 A;  3F6F A;  3F4R A;  4TOP A;  3GV1 A;  4BL7 A;  4WF5 A;  4DSR A;  4AJ8 A;  2VL2 A;  4ID0 A;  1XW5 A;  2KHP A;  1GSY A;  5G31 A;  1SKS B;  1GNE A;  2R0C A;  1ERU A;  2KOK A;  3LYP A;  4KA0 A;  4ECB A;  3A2W A;  5DQY A;  5FHI A;  5G2Z A;  3D5J A;  2WZ9 A;  4BVY B;  1JZO A;  3LOR A;  5L71 A;  1GNW A;  2K8V A;  1FOH A;  3D6I A;  3MAK A;  1USB A;  3IOS A;  3TOU A;  2R4V A;  3ZIT A;  5IOX A;  1X9S B;  2KUC A;  2FLS A;  4KCA A;  2FY6 A;  2HE3 A;  3GTU B;  1JLV A;  3ED3 A;  1SL0 B;  1QUW A;  5HQP A;  1V9W A;  1ZYP A;  4IN0 A;  1A8L A;  3GSS A;  4EXJ A;  4NAX A;  3NZN A;  3A3T A;  5JWQ B;  3SWL A;  3C1S A;  2L5O A;  4JR6 A;  2JAD A;  2MMO A;  3AY8 A;  1V40 A;  4E8H A;  5CP1 A;  5LCZ A;  3A5W A;  4PUF C;  3TRQ A;  3ZIJ A;  1RW1 A;  3H79 A;  3MNG A;  3TJJ A;  4CHS A;  3IPZ A;  4NHW A;  1SYR A;  5D93 A;  3ERG A;  4ZL9 A;  2XBQ A;  5D96 A;  2HZE B;  4IQ1 A;  5J4U A;  4I2T A;  5EY6 A;  4F9Z A;  2CV4 A;  2IFQ A;  5GSS A;  2OA7 A;  1NHO A;  3HKR A;  1B9X C;  4KSO A;  4TR1 A;  4GQC A;  5DCH A;  2QKE A;  4XS4 B;  2AJQ B;  2RM5 A;  3EMX A;  3LGC A;  1K0N A;  2LRC A;  2MBT A;  1EP8 A;  4N0Z A;  5J3R A;  4WR5 A;  2GVP A;  3HZ4 A;  5AIS A;  1KBN A;  5ECQ B;  16GS A;  4GLT A;  2HSH A;  2LJA A;  5DBQ A;  4G0I A;  4FH8 A;  3FRC A;  2GTU A;  1GTA A;  2QA1 A;  4F0B A;  1A2J A;  3CBU A;  4WKW A;  4OO5 A;  2I81 A;  3ZLP A;  1YKA A;  2H71 A;  4K5S A;  1Y6E A;  1PRX A;  4TN8 A;  2G2Q A;  3UL3 A;  2FHE A;  2XPE A;  1O85 A;  3PIN A;  1V58 A;  4L5O A;  3L78 A;  5JCG A;  3CYN A;  4K5R A;  5IMV A;  5A5K A;  3DGQ A;  3BD2 A;  4USS A;  3OR5 A;  2GQK A;  4J57 E;  4PQI A;  3CSI A;  2N5B A;  3IK9 A;  1QGV A;  3C73 A;  2DKH A;  4EO3 A;  1GH2 A;  4GRF A;  2X64 A;  5IMC A;  5F0G A;  4POK A;  5C00 A;  3R3E A;  1J08 A;  1O73 A;  1FVK A;  5CYY A;  2X8C A;  3QMX A;  3KMO A;  1MDI A;  3QFB C;  1A0F A;  1YF0 A;  2C0G A;  3GFK A;  2VD1 A;  1ILO A;  2VAF A;  1BQ7 A;  3GX8 A;  1KEB A;  2H75 A;  1AIU A;  4D73 A;  4QQ7 A;  3MWH A;  1DE2 A;  2VD0 A;  2H8L A;  3EVI A;  3LWA A;  3IK7 A;  1G7O A;  4WR4 A;  3KMN A;  1XVQ A;  3UMA A;  4TW5 A;  2LST A;  3LXT A;  5HFI A;  2C0E A;  1G0T A;  3GNJ A;  2IJY A;  1G6Y A;  2BMX A;  1GTU A;  1U3A A;  3FW2 A;  5ECO B;  2PBJ A;  3HVX A;  2P0G A;  1OC9 B;  2VCZ A;  3QOU A;  5DJL A;  3HDC A;  5COH A;  3D22 A;  4V1A p;  1EP7 A;  1H4O A;  1ZZY A;  3H1N A;  3N5O A;  2WUL A;  5B6N A;  3HJP A;  3VWU A;  4MLY A;  3CTG A;  4MA9 A;  3US3 A;  4K8M A;  4ZXG A;  2DC5 A;  1MEK A;  4YKF A;  4Z2T A;  1LBK A;  4BWS A;  4V2L A;  3UBK A;  1B9Y C;  2H1D A;  1UA5 A;  3TJB A;  2F3M A;  4YQU A;  1EGR A;  1BG5 A;  4RUV A;  2M80 A;  4WET A;  1TRW A;  2YAN A;  2AAW A;  4F0C A;  5INY A;  2FD3 A;  2ON5 A;  4HOJ A;  4BVX A;  1HD2 A;  3IAS 2;  2A2P A;  2OAD A;  3M9K A;  4A5P A;  3E3E A;  4Z2R A;  3DIE A;  4CDO A;  2VCQ A;  4DVC A;  1MDK A;  3F4S A;  4KF9 A;  2YJH A;  2PU9 C;  2R3X A;  1M9A A;  1JLW A;  3IC4 A;  2VCW A;  4MF5 A;  2QA2 A;  4Q5R A;  2L57 A;  3APO A;  4MCU A;  3UJ1 A;  1K0C A;  2J23 A;  4IQA A;  2YPM A;  1N8J A;  1EZK A;  3HZ8 A;  3F0I A;  2Z9S A;  5J9B A;  2IMD A;  4EE0 A;  5HFK A;  4PNF A;  2R6K A;  3EE2 A;  4HQZ A;  2RLI A;  3DYR A;  4KDU A;  5BMU A;  1GTB A;  2E2G A;  2R0G A;  4TXV A;  2A4H A;  1YJ6 A;  2OE3 A;  2ZCT A;  2OBI A;  5CRW A;  2YZH A;  4POB A;  5CO3 A;  1MTC A;  1TRV A;  4Q5F A;  4V2N A;  3O3T A;  2VLV A;  3EMP A;  1QQ2 A;  2K6V A;  3IBH A;  1PL2 A;  3KIJ A;  4MJE A;  2DMM A;  4PQ1 A;  2WGR A;  3CTF A;  4K6X A;  4DSS A;  2KLX A;  4WEY A;  2YV9 A;  1EOH A;  4MPG A;  4PGT A;  3TJG A;  5DAK A;  2NTO A;  4XTS A;  5IIZ A;  3GRX A;  6GSV A;  5IPG A;  1Z7R A;  3D21 A;  3P2A A;  2F51 A;  3ME8 A;  5IQY A;  3HY2 A;  4MJA A;  2HRK A;  3M8N A;  1B8X A;  2CZ2 A;  1K3Y A;  3HCZ A;  3EWL A;  3Q74 A;  2FGX A;  3TGZ A;  3P8W A;  4RQX A;  3R2Q A;  1NW2 A;  1SYX A;  3FK8 A;  4NXI A;  4TR4 A;  3H93 A;  1ERW A;  4MNN A;  1SK1 A;  2YP6 A;  2GT6 A;  3GIX A;  2B1K A;  5GZZ B;  2BTO T;  3UIW A;  2C3T A;  1SKR B;  4EL1 A;  1TU7 A;  5JCU A;  4ZB8 A;  3HYP A;  2JSZ A;  5ENU A;  4MP4 A;  3IDV A;  4Z2U A;  1Z5Y E;  5FWG A;  5JCW A;  4RQR A;  3TOT A;  4YH2 A;  2MMN A;  5IM9 A;  3VWW A;  1BYE A;  4KDX A;  5ABR A;  1OAZ A;  4ILF A;  1T00 A;  2HLS A;  5KN2 A;  2C0F A;  1OC3 A;  5B8B A;  4ECC A;  1UN2 A;  3PPU A;  3LQ7 A;  1XOA A;  4KND A;  1K3L A;  3C7M A;  4BVY A;  5ECI B;  5GAN D;  4ECJ A;  1X0R A;  5BRT A;  5F8B A;  2L4Q A;  1XWA A;  2DBC A;  3NOF A;  2HXK A;  4G10 A;  3FZ9 A;  4KUN A;  3GMF A;  1SKW B;  3GTU A;  2V1M A;  3M0F A;  19GS A;  3MDK A;  4O5R A;  3TUE A;  4JE1 A;  2X4A A;  1MDJ A;  4K2D A;  1ML6 A;  1SK0 A;  2O85 A;  4NV2 A;  3IR4 A;  2F9S A;  4ZBD A;  10GS A;  4GTU A;  2TRX A;  1HNC A;  1F9M A;  1TOF A;  3GL5 A;  3RPN A;  3NIV A;  1BED A;  4MK3 A;  1J9B A;  4L8E A;  4YAV A;  2H1A A;  2GZP A;  3RHC A;  2H0I A;  3KM6 A;  3Q6O A;  1ZYQ B;  4X1U A;  1K0A A;  2WRT A;  3HVS A;  4EKZ A;  3TKR A;  1M7T A;  4EF0 A;  3VK9 A;  2L59 A;  2PUK C;  3VLN A;  1E2Y A;  4HS1 A;  1R7H A;  2LQQ A;  2E2M A;  4OCF A;  2LTK A;  2RM6 A;  2HZE A;  4K9Z A;  3M9J A;  3CSJ A;  2H1B A;  2LNS A;  3ZVJ D;  3FZ4 A;  4PX1 A;  2EIQ A;  2O89 A;  4KE3 A;  2LS5 A;  4NPB A;  3GKN A;  2YCD A;  1Q4J A;  5AGY A;  3RHB A;  1HNA A;  1YKC A;  1VRS D;  2IIY A;  4OD7 A;  5H5R A;  2H66 A;  4JU5 A;  1YZX A;  3IXR A;  1OE7 A;  2N5F A;  3FHK A;  3QDN A;  2VL9 A;  5B8A A;  1FB0 A;  1TJD A;  3HJM A;  4KSM A;  3D0Z A;  4TXO B;  4I8B A;  1I5G A;  3GX0 A;  3DML A;  2GT5 A;  2C4J A;  3FY7 A;  1AAZ A;  3A2X A;  2EIO A;  2B6M A;  3ZL5 A;  2OJL A;  1U87 A;  1K0O A;  1BX9 A;  5JWR B;  4G19 A;  5ELA A;  1KTE A;  4MH2 A;  1JHB A;  4EDY A;  3VPQ A;  4BA7 A;  5DCG A;  3EC3 A;  3I43 A;  4G9H A;  4TR0 A;  17GS A;  1GRX A;  1UVZ A;  3CRU A;  1JZW A;  2WB9 A;  1R4W A;  4KAE A;  2C8U A;  2H0G A;  2GGT A;  5KN1 A;  1NSW A;  3ME7 A;  2DIY A;  4ZL7 A;  3FR6 A;  1SJ6 A;  2GLR A;  1JZR A;  2HYX A;  1F6M C;  3QFA C;  3F9U A;  2TRC P;  3GKK A;  3KJY A;  3LFL A;  2CAQ A;  3H4K A;  4HJ2 A;  2A2R A;  4NV5 A;  3EU4 A;  2NVL A;  1XWG A;  3S9F A;  5CRD A;  3UVT A;  4MH3 A;  2OE0 A;  4PXO A;  2V6O A;  2VO4 A;  1ON4 A;  3KCM A;  3VI7 A;  3Q19 A;  2YWI A;  1EOG A;  1ZYN A;  3TRP A;  2WJU A;  1Z3E A;  2F8F A;  4IGJ A;  4K7I A;  4ML1 A;  3DVW A;  3ZRD A;  4OFM A;  1TTZ A;  4XS6 A;  2CVD A;  4TKY A;  2VCX A;  3MYD A;  5KN3 A;  5DAL B;  1OC9 A;  2H74 A;  2C3Q A;  1EGO A;  4EUY A;  4F82 A;  2GQM A;  5E59 A;  4EVM A;  1WP0 A;  1U3I A;  2E7P A;  1F2E A;  1PGT A;  3IHG A;  4XIH A;  1WWJ A;  1ERV A;  3GH9 A;  2O87 A;  2YWO A;  5G1L A;  2H01 A;  1U88 A;  5D9V A;  1W4V A;  3HD5 A;  3TKQ A;  1F37 A;  13GS A;  1TU8 A;  2IL3 A;  1TXX A;  4IS0 A;  2B5E A;  3EYT A;  5A4U A;  4JED A;  1XWK A;  3F63 A;  3FR9 A;  2H6X A;  3I6A A;  3L9U A;  3GKM A;  4OCE A;  3GST A;  4HU9 A;  2FA8 A;  4IBP A;  4ZL8 A;  1XCC A;  3I69 A;  2JL4 A;  3CRT A;  4EDZ A;  3M1G A;  4HZ4 A;  3QAV A;  3ZTL A;  3APQ A;  4XHM A;  1TI3 A;  3G7I A;  5HR2 A;  1TW9 A;  1XBS A;  4IJI A;  4ZIJ A;  1FOV A;  2DJ3 A;  1O8X A;  1ZOF A;  1NHY A;  4MF7 A;  1WRY A;  2X99 A;  1Q98 A;  2VCV A;  3D4M A;  4G0K A;  2HRF A;  2AB6 A;  4NHZ A;  3JCM L;  6GSW A;  2J9H A;  3EU3 A;  5CRE A;  5HR1 A;  2XC2 A;  4KH7 A;  3BOA A;  3W8J A;  4RI6 A;  3KH7 A;  3UAP A;  1A8Y A;  4Z7X A;  2B7J A;  1AQV A;  2P5R A;  1T4Y A;  2FWF A;  4ZBA A;  3F4T A;  2L6D A;  2GSR A;  4HJM A;  5E4W A;  20GS A;  2CT6 A;  1GUH A;  1WOU A;  1T3B A;  3O6T A;  3TKS C;  2GSQ A;  2TIR A;  2G0F A;  2RUF A;  5IMA A;  3BBY A;  7GSS A;  5A4V A;  2K9F A;  2FWG A;  3IV4 A;  2FWH A;  1IYI A;  2PMT A;  3HVV A;  4BPY A;  4X4J A;  4K0N A;  2CZ3 A;  1TK8 B;  2WCI A;  1X9M B;  1XXU A;  2H72 A;  2WDU A;  5IPH A;  4N10 A;  1RQM A;  5DVB A;  5A4W A;  4J2F A;  1GL8 A;  2OE1 A;  1FO5 A;  5G5F A;  1WJK A;  3L0H A;  1C72 A;  1PA3 A;  11GS A;  2AYT A;  1H75 A;  4WBJ A;  1AQX A;  4RI7 A;  4I6X A;  4FYU A;  4O32 A;  2LEG A;  1O7U A;  2L4C A;  1PL1 A;  1V57 A;  1A24 A;  1TRU A;  2VM2 A;  1THO A;  5EVO A;  5ECR B;  1YEX A;  4KX4 A;  3UAR A;  1K0B A;  1EWX A;  4JBB A;  1BJX A;  4FO5 A;  1IYH A;  4PUR A;  2PVO C;  1AQW A;  2NDO A;  2WS2 A;  3UVH A;  4ZBB A;  4N30 A;  2V2G A;  2LJR A;  2H6Z A;  2PER A;  3UBL A;  2OAC A;  3KTB A;  4OWY A;  5G5E A;  4DEJ A;  1GLQ A;  1GUK A;  5AIV A;  2C80 A;  1VF4 A;  3PGT A;  2P5Q A;  5HR0 A;  5HFG A;  4TRX A;  1EEJ A;  5J9C A;  1A0R P;  2QGV A;  2YN1 A;  3CXG A;  3KEB A;  3HJO A;  3VPT A;  1JFU A;  2MZC A;  4YQV A;  5ECM B;  5IMD A;  4MJB A;  4GWR A;  4I97 A;  4AJ7 A;  2GZY A;  2IWT A;  1T8E B;  1DBY A;  2DJ0 A;  3A2V A;  4HQS A;  3J7Y b;  3GA4 A;  8GSS A;  4I2U A;  4L5L A;  2DIZ A;  5ID2 B;  4XCS A;  3FMW A;  4MPF A;  3APS A;  1VGL A;  3DVX A;  3TKP A;  3D4T A;  1GUL A;  4K1F A;  1YEP A;  2O8V B;  4GXZ A;  4CY8 A;  6GSY A;  3DD3 A;  4KW6 A;  2DSA A;  1OYJ A;  2VL3 A;  2GS3 A;  4K0G A;  5GAP D;  2YWN A;  3IAM 2;  2PWJ A;  1ZCP A;  3F8U A;  3RBT A;  3HA9 A;  2MMA A;  2VLT A;  1TK5 B;  1DSB A;  1R5A A;  3QAW A;  4OFT A;  1YDK A;  1X9W B;  1AC1 A;  2FA4 A;  1SD8 A;  4POM A;  4V1A g;  2GDR A;  3WGX A;  4HU7 A;  2A2S A;  2LV3 A;  3DWV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...