2GS3A

Crystal structure of the selenocysteine to glycine mutant of human glutathione peroxidase 4(gpx4)
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
171
structure length
171
Chain Sequence
TENLYFQSMRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQGGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKRYGPMEEPLVIEKDLPHYF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Phospholipid hydroperoxide glutathione peroxidase
publication title Crystal structure of the selenocysteine to glycine mutant of human glutathione peroxidase 4(GPX4)
rcsb
source organism Homo sapiens
total genus 61
structure length 171
sequence length 171
ec nomenclature ec 1.11.1.12: Phospholipid-hydroperoxide glutathione peroxidase.
pdb deposition date 2006-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00255 GSHPx Glutathione peroxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2gs3A00
2AYTA 2GQKA 2P31A 1XOBA 4MK3A 2JSYA 1Q98A 1YQ1A 4EO3A 5J4UA 1SL1B 1GTIA 1AAZA 4WETA 3TOTA 1NHYA 3KXOA 1QMVA 3BBYA 2K6VA 2C8UA 3F3RA 4XIHA 4TR1A 3UBLA 1ST9A 3ISOA 3IA1A 1NW2A 3IE3A 1VF4A 1EGRA 1JZWA 3GTUA 2AV4A 1UA5A 4KDUA 4O92A 3UOMA 3FZAA 3BOAA 2FD3A 4MF5A 4ML6A 1X0RA 2AUVA 3UAPA 1FOVA 3KP9A 2H1BA 1V57A 4ZIJA 1K0DA 3L0HA 5DCHA 3IHQA 2VM1A 1PRXA 2VD1A 3UJ1A 2E0QA 4ECBA 4GF0A 3HDCA 3TKRA 5IOXA 3GH6A 5D93A 1XFLA 1ZYEA 2HFDA 1XWKA 1ZL9A 5KN2A 3D6IA 1TU8A 5EVOA 1TI1A 5B6NA 2H76A 3VLNA 4N0VA 2GSSA 1YZXA 2H6XA 2B5EA 4IQAA 4P3YB 2OE3A 1THXA 5D9TA 3G7IA 4QL9A 1GP1A 3PH9A 2H01A 2H66A 3HZ4A 4J2FA 4MPFA 3F6FA 1OKTA 2OJLA 5ECLB 3AY8A 3M0FA 1TJDA 4KX4A 5EY6A 3GA4A 2HZFA 2IMDA 3A5WA 4ZL9A 4NV5A 1KNGA 1WJKA 1U88A 3A3TA 2DBCA 1G6WA 1GSYA 4I5QA 1SK0A 3TJJA 4KB3A 3D0ZA 5IIZA 1J08A 4H86A 2RIIA 4CHSA 1UN2A 2PU9C 6GSWA 1XVWA 1MDKA 2VLTA 3VWUA 3IK9A 3EURA 5KN0A 4DSSB 4YQUA 1M99A 2I4AA 5JWQB 2OBKA 3TKSC 4G10A 3WGDA 2F3MA 4HOJA 1K3LA 5HFGA 3TKSA 5FWGA 2K9FA 1LU4A 1FG4A 2PN8A 2OA7A 4JEDA 4Q5QA 3GX8A 2H70A 1Y25A 5CO3A 1AW9A 1EOGA 2B1LA 2DJJA 1M7TA 3DVXA 1NSWA 2B6MA 3MNGA 5F07A 3GL3A 1SJ6A 5D9VA 1SENA 2PVOC 4TW5A 1XW5A 2VOCA 2WULA 5ABRA 1ABAA 3TKSE 3FRCA 3DWVA 5G1LA 5INYA 3EINA 2H30A 2VIMA 1XWCA 6GSUA 3FR6A 1S3CA 2AB6A 3ZZXA 1S3AA 2KP2A 3IDVA 4DSQA 1EZKA 5ECSA 5EL8A 2XPDA 2ALBA 4I2UA 5HR2A 4TVEA 1YEPA 2B5XA 4PNGA 3TDGA 1YKAA 3KCMA 5HR1A 1OE8A 5ECRB 1URMA 3SBCA 2RM5A 2ZCTA 4NXIA 1M2BA 3RPPA 5IMAA 1R5AA 4HQSA 1V58A 3I9V2 2HRFA 5DCGA 4EKZA 3CRUA 3QPMA 2V32A 4MDCA 1Z7RA 3TJFA 1AQXA 3G7JA 4DVCA 2C4JA 1OVNA 1K0MA 2QC7A 4HEA2 1F3AA 1B9YC 14GSA 1B48A 2I81A 5COHA 3FY7A 3IOSA 1XCCA 3FEUA 2HLSA 3MDKA 5LCZA 3BD2A 1X5EA 5F05A 5AN1A 5CAXA 4KDXA 2FA4A 5IMCA 2VUPA 3LJRA 3EVIA 2LUSA 12GSA 2H72A 5EPFA 3TRXA 1DSBA 1GSUA 4XS4A 4POBA 2L5LA 3FR3A 5D8IA 3KTBA 3UMAA 2ZNMA 1ERVA 1GSEA 3CMIA 1EP7A 1X9WB 3G7YA 4O5RA 4TR4A 1R26A 4N30A 4LMVA 2L57A 1I5GA 1EEJA 3HD5A 3CSHA 2CAIA 2IPAA 3IV4A 4IW9A 4WF4A 2RUEA 3UBKA 2JL4A 8GSSA 2KUCA 2LJRA 5ID2A 17GSA 3IR4A 4RI7A 2WRTA 5DAKA 3DRNA 3KGKA 2V6KA 5CRGA 1C72A 4Q5FA 3GTUB 3GKXA 2WCIA 1T7PB 2PBJA 2XBIA 2C3QA 1AQWA 3HVSA 3PINA 4D73A 4BWQA 2H75A 3GIXA 4YAPA 2GSQA 3FK8A 2P5QA 2WGRA 2K8VA 2YOIA 1TK5B 11GSA 4MJCA 2WDUA 4XRAA 3JCML 4OMVA 3HKRA 1EWXA 3W8SA 2DJKA 5H5SA 5G5EA 2LEGA 1B8XA 5CRDA 3RHBA 5G5FA 4KNDA 3D4MA 4KCAA 1EV4A 2K8SA 6GSXA 2LTKA 4XTSA 1JFUA 4I8BA 3KIJA 2M72A 4ZILA 1JLVA 2VAFA 5CRWA 3APQA 2VLVA 5L71A 2B7JA 3IAM2 3M3MA 4KW6A 1U87A 4GRFA 4ZBDA 1F2EA 4OFTA 1Z9HA 1ZZYA 4GSTA 1GLQA 3UVTA 4N11A 2C0DA 4POMA 3OR5A 4Q5NA 5C04A 3EYTA 5IMDA 4IKHA 4AJ8A 1DE2A 5IO2A 3E0UA 4KUNA 4IVFA 1TKDB 2X8HA 2QGVA 3DMLA 4FYUA 3EMXA 2OE1A 2DJ1A 2YZHA 3HVXA 1Z6NA 1SD9A 4JE1A 2R3XA 2A2RA 5KN3A 2L4QA 1TK8B 5G30A 3IC4A 1U6TA 5FHIA 1ACVA 5LNKe 4RUVA 2F51A 3TOUA 2VCTA 5CP1A 4YH2A 2LRCA 4L5OA 2O8VB 3WT2A 3CRTA 4BPYA 3VWWA 2C0FA 3KP8A 2DJ2A 5LD0A 2DIZA 4PGTA 1GUMA 2OBIA 3A2XA 5GAPD 2JACA 5IO0A 4QL7A 2LJAA 1OC9B 1XIYA 4KH7A 4ECCA 2YPMA 4EDYA 3BJ5A 2OKAA 3HXSA 3H8QA 1Y6EA 2RUFA 1G7EA 4PXOA 1XW6A 1SJIA 4N0ZA 3NOFA 4XRDA 1TW9A 1V9WA 3QMXA 4GSSA 2VD0A 5DQSA 1DUGA 1AQVA 4TR3A 2YWNA 1UVZA 3ZVJD 3C1RA 3LXTA 2N5FA 4KA0A 3F6DA 1KBNA 2H6ZA 3HA9A 3FHKA 5IPGA 1GWCA 4KSMA 5ECMB 2HRNA 5CRHA 3VPQA 2GSTA 4X0XA 4IQ1A 2R2JA 2YJ7A 2PERA 3KH9A 5G2ZA 3D22A 2DMLA 1K3OA 4NWYA 4MZCA 4MF6A 1F37A 2GZZA 4G19A 3CTGA 4OWYA 4HJMA 3ZIVA 1SK1A 5D9XA 2OE0A 3KMNA 1JZOA 1GTAA 2L5OA 3N9JA 3S9FA 3UEMA 4ACSA 3HY2A 4EUYA 4ULXA 2FCHA 4TRXA 3MWHA 3FZ4A 1A8YA 3LXZA 1GL8A 2R5GA 5KEJA 1TRUA 2GVPA 20GSA 4V2MA 3ME8A 5AGYA 4GSNA 2XBQA 1GTUA 4LLRA 1M2AA 3ZTLA 4WF5A 2BTOT 1SKSB 3L4NA 4DSRA 1U3IA 1FAAA 1PN9A 4K1FA 5FT3A 2JZSA 3GL5A 2I3YA 3RPNA 3ZITA 4GTUA 4XS4B 2LSTA 4EVMA 1GSQA 2KLXA 2HYXA 3L78A 5ECIB 1VRSD 2G0FA 2CAQA 1SKWB 3GMFA 1Z7PA 3GH9A 1SKRB 1F6MC 2C0EA 3LEFA 1A24A 3FZ9A 1T00A 2C1YA 3VURA 1VF2A 3TGZA 3ZVJA 1XWBA 1TRSA 3ZIJA 4L8EA 1G7OA 4E8EA 3GKKA 3N5OA 4POKA 5DAKB 3EE2A 4G9HA 4LMWA 3GSTA 5A5KA 5J3RA 2GQMA 2P0GA 2E2MA 4OCFA 4LL1B 3W6GA 2IJYA 4WXTA 5GSTA 1X9MB 2GTUA 1PL1A 2IIYA 3U5RE 3FYGA 1CQHA 1VGLA 4K9ZA 4K7IA 2CX4A 4XHMA 1A2MA 4GQFA 4ECIA 4TR0A 3C73A 1K0BA 1JLWA 4GQCA 5H5QA 3TUEA 5HFIA 1G6YA 3O76A 1GRXA 4WBJA 2P5RA 3SWLA 3HYPA 4F0CA 5H5RA 5GSSA 3MAKA 2JZTA 3FZ5A 1W89A 1ERTA 2REMA 4F0BA 1TDIA 3ZL5A 2AAWA 4ID0A 4ECJA 4MJBA 1EOHA 2R4VA 6GSVA 3IPZA 2F8FA 3EU4A 22GSA 3VFIA 5AIXA 1V40A 2VL3A 1GULA 1SYXA 2HZEB 2MMNA 4MZBA 2CVDA 3I43A 3V1WA 3D5JA 4ZB9A 5HQPA 1R4WA 3ED3A 5HR0A 2IN3A 4GLTA 5IOWA 1Z6MA 3DKSA 3GKMA 3GHAA 2H1DA 1V98A 1O8WA 1TK0B 3ZMLA 1A2JA 4O32A 5GZZB 2LNTA 3BCKA 4I2TA 1GNWA 5IQYA 5G1KA 2H0HA 4IELA 3TKPA 3TJGA 4CW9A 1BYEA 4F03A 3TJBA 2VM2A 5DALB 1VF1A 1WOUA 2FUG2 3I6AA 3K8NA 4IJ3A 4EL1A 5AIVA 4FYCA 3E9JB 3F9UA 5D73A 1A2LA 2PMTA 2A2SA 4XS1A 4N10A 1K0CA 3ME7A 2D2ZA 2H71A 4MP4A 3LG6A 3DXBA 4BVYA 4IHUA 4PQIA 1SU9A 2F9SA 1QXHA 1GUHA 1FHEA 4OFMA 4HZ4A 2X8GA 5HR3A 5B6MA 4X43A 2H6YA 2VL9A 3CSJA 6GSYA 4NPBA 4MJAA 3VK9A 1PQNA 4XS6A 2YP6A 1BG5A 1YEXA 2LQQA 4FH8A 3Q6OA 3M9JA 4BL7A 1EGOA 3IK7A 5G31A 2O7KA 5ECHB 1WP0A 2O87A 4F9ZA 3D21A 1KEBA 5JCGA 3EMPA 2WFCA 3P7XA 2J9HA 2MMOA 3GUSA 1OKDA 2HT9A 2FLSA 5ENUA 2C3NA 2PWJA 5IMFA 1PX6A 3GRXA 1AXDA 3LWAA 2AHEA 4TR1B 2FWEA 3WD6A 1SL0B 4YQVA 1PKWA 1G0TA 1F9MA 3LQ7A 5IMZA 1SYRA 3RHCA 2HI7A 3ZFBA 1TP9A 1Z5YE 4TKYA 4MJEA 1JHBA 4WEYA 1GH2A 1THOA 4NHWA 3KMOA 3QAWA 2BMXA 4DSSA 9GSSA 2F8AA 3QAGA 1QQ2A 2VCZA 1T3BA 2H74A 3Q18A 2L6CA 3GNJA 3ZMKA 3DEXA 2EIOA 1QK8A 4TN8A 3HVVA 3FKFA 4L5LA 5J41A 3H93A 2LKUA 2FY6A 2IFQA 1E6BA 1MTCA 4V2LA 4ZBAA 2E7PA 3J7Yb 5ECOB 1JZRA 4IS0A 3C71A 1HNCA 2A4VA 4MH2A 1YDKA 2CQ9A 1B4PA 4OO4A 3RBTA 3UVHA 3F8UA 1M9BA 4WBRD 3DVWA 3GX0A 1AC1A 2JSZA 3E3EA 5B7CA 3ERGA 1T1VA 2DSAA 3TRPA 2VCXA 3DIEA 3F3QA 4WR5A 4RQRA 2FWHA 2H1GA 2MZCA 5KN1A 1OAZA 4V1Ag 5JCWA 2GSRA 3I69A 4V2NA 1VF3A 5F0GA 2R6KA 4PQHA 3FR9A 2X8CA 1A0FA 1J9BA 2V41A 1UC7A 3QD9A 5GAND 4JRRA 1PGTA 2XPEA 2NTOA 1ML6A 4PURA 4JZQA 1SJZA 2CX3A 2HXKA 3KZQA 4JR4A 2Z9SA 6GSSA 3GFKA 1X5DA 5DQYA 1GTBA 2C0GA 1HQOA 2E2GA 3WGXA 4O7HA 3P8WA 3VI5A 4IJIA 1BQ7A 4K6XA 2H0IA 3L9UA 1PKZA 1YF1A 1FW1A 3G9BA 4MABA 2N5AA 2N5BA 1O7UA 5CREA 2LNSA 5IM9A 4AJ7A 5JWOB 2FHEA 4FIWA 1EEMA 3LORA 1QUWA 2AJQB 4ZB8A 3TB2A 1K3YA 2O89A 4GCIA 1A8LA 3A2WA 2XHFA 2VCWA 2YZUA 4I97A 1N2AA 1IYIA 3QFAC 2VL2A 3UARA 4LL4B 1ILOA 1B9XC 3RAZA 4MA9A 1GSDA 2JU5A 1MD4A 2C3TA 3J7Yk 2FWGA 2MBSA 2CA8A 1OE7A 3U6VA 1PMTA 1BX9A 3TJKA 1OC8A 4TXOA 5ECPB 4KCEA 2LV3A 3KEBA 1T4YA 2XC2A 2YV7A 5E59A 4HJ2A 1R7HA 2IL3A 2MYGA 5IPHA 1K0NA 4HDEA 3HHVA 2FGXA 2L4CA 3W8JA 2V2GA 3UIWA 2YJHA 3US3A 1GSSA 3P90A 3WYWA 2FNOA 2LS5A 3A2VA 3EWLA 2HE3A 2QSIA 3HJMA 2TRXA 4WR4A 4MCUA 4KDYA 4I6XA 2CVBA 3NZNA 2CVKA 2M80A 2GDRA 3DYRA 1O81A 4G2EA 5A4UA 3HJPA 5AISA 3CXGA 2H19A 19GSA 2R37A 1XWAA 3IXRA 4LA1A 2RLIA 3GSSA 2GT5A 3QAVA 2WB9A 4MZWA 4PUAA 1RK4A 2GQLA 4K0NA 1GLPA 2L6DA 1ZMAA 5ELGA 4K7NA 3ERFA 3M8NA 2G2QA 2DLXA 3C7MA 2TRCP 4JU5A 2FA8A 2LQOA 1Z3EA 2MMZA 4ILFA 5ID2B 1AUCA 4Z7XA 13GSA 2ES7A 4K8MA 2YWOA 2MBTA 4HZ2A 1ZYQB 4HS1A 3HZ8A 4ZL7A 3P2AA 3FW2A 4K2DA 2DJ3A 3HJOA 4GWRA 4EC0A 1Q4JA 5JCUA 2DIYA 1H4OA 4JR6A 3F4SA 1ERWA 3ZREA 3LSZA 2EIQA 4JBBA 2K18A 3CBUA 4TOPA 4CDOA 2X99A 3QDNA 4J57E 5J9BA 4POLA 3DGQA 2IMFA 3GYKA 1O6JA 4D73B 2GS3A 3NIVA 16GSA 1NHOA 2HNLA 2YNXA 4TXVA 1XPVA 2OADA 5F8BA 4OCEA 1WIKA 4NV2A 1B4QA 1TOFA 4K7OA 4ZXGA 2IFQB 5D96A 4FO5A 2CT6A 3H4KA 1A0RP 1TU7A 2H8LA 2IMIA 1ZGNA 3EU3A 3TRQA 1PD21 3WT1A 2B3SA 4F2IA 4L0UA 4HU9A 5J5NA 2VCVA 3IBHA 3MSZA 1OC9A 2WZ9A 2IMKA 2ON7A 1YJ6A 1TTZA 1CQGA 1XOAA 1GSFA 3UL3A 3O6TA 2KP1A 3KH7A 1FB6A 4ISDA 5ECNB 3H79A 2FWFA 3LFLA 4ZBBA 5DVBA 2DC5A 3APOA 4YQMA 1DE1A 5A4WA 4E8HA 6GSTA 5DBQA 3KTLA 1TI3A 3GURA 2I9HA 4HUAA 1O73A 4IBPA 2KOKA 4RQXA 2WJUA 5JWRB 3C8EA 1XVQA 2IWTA 2J23A 3H1NA 3QR6A 2H73A 4NAXA 4KSOA 3GKNA 2QKEA 1SL2B 1NM3A 2HSYA 1M2DA 4WKWA 4HQZA 1TRVA 10GSA 2LRNA 2YCDA 3PGTA 1WMJA 1ZCPA 4MMMA 1HNBA 4L0WA 5F06A 3GV1A 5B8BA 4MLYA 2GLRA 4ZL8A 1FVJA 4FYBA 4PNFA 1K0AA 1YF0A 1SD8A 4MH3A 1AIUA 2NPBA 4PUFC 4BVXA 3TKQA 4PQ1A 3CYNA 3APSA 1H75A 3L9VA 5J9CA 1WPIA 3LYKA 3CSIA 3IRAA 4OFNA 5ECQB 5A4VA 1MEKA 1OC3A 2YWIA 2ON5A 1O85A 2L59A 4HU7A 1XXUA 5DJLA 4OD7A 2NVLA 1MDJA 2X64A 4J56E 5D9WA 2HSHA 4GXZA 4NMUA 2LRTA 4AJ6A 1PX7A 1USBA 3VWXA 4DEJA 1WRYA 2B7KA 4K0GA 3VWVA 2CZ3A 1RW1A 4KAEA 4F82A 3Q74A 3KD0A 3ZRDA 3DD3A 4KGIA 4X1UA 1QFNA 4TXOB 2MMAA 3QOUA 4OO5A 5CNWA 3QCPA 2IMEA 1IYHA 2GT6A 2CV4A 4ZB6A 3VPTA 1W4VA 7GSSA 2PPTA 1T8EB 3ZYWA 2BJXA 4BWSA 5B8AA 1X9SB 1RQMA 3Q19A 4IP6A 3O3TA 1ZOFA 5ELAA 2H0GA 1LJRA 2EC4A 1M9AA 1U3AA 3F4RA 3F4TA 2VO4A 2RM6A 3M9KA 3D4TA 1WE0A 4EF0A 1KTEA 4PX1A 1TXXA 2H1AA 3LYPA 1I9DA 2OACA 5IMVA 4ML1A 1XWGA 3HCZA 1FVKA 4Q5RA 2KHPA 2PGTA 1PL2A 1FO5A 2V1MA 1BAYA 3GN3A 2NDOA 2PUKC 3CTFA 4AGSA 2DMMA 1HNAA 1MDIA 2B5YA 1BJXA 1F3BA 4IGJA 1WWJA 2HZEA 4AF2A 4NHZA 5DJMA 2VCQA 1YKCA 3F0IA 5ECKB 1HD2A 4IP1A 3WGEA 3TCOA 2ZUPA 5DDLA 4MF7A 3LGCA 2M46A 2GGTA 1SK2A 1S3DA 2O85A 3ZFLA 5C00A 5HFKA 3C1SA 4BA7A 1GUKA 1MD3A 3RDWA 4XCSA 1YY7A 5E4WA 4RI6A 3BCIA 3QFBC 2GZPA 2EIRA 4YAVA 1TRWA 2PVQA 5DALA 1R5PA 3EC3A 2C80A 2NBSA 4EXJA 2CZ2A 1PA3A 4IN0A 1N8JA 1PSQA 2YWMA 1V2AA 2YV9A 2VLUA 2YANA 1XZOA 1E2YA 2WS2A 2JZRA 2V6OA 4EE0A 4KE3A 3VI7A 1BEDA 2YN1A 18GSA 4QQ7A 1HYUA 4MPGA 1FB0A 1EV9A 3M1GA 1K0OA 1ERUA 2DJ0A 2B1KA 1J0FA 2VL2C 4V1Ap 1M0UA 2TIRA 3ZLPA 3ERWA 2GZYA 3L9SA 1EP8A 1GNEA 3KM6A 2LJKA 1OYJA 3F63A 3KJYA 4EDZA 1O8XA 1T4ZA 1XBSA 2I1UA 1A23A 1JZDA 1XW9A 3PR8A 1DBYA 1ON4A 2JADA 3IAS2 1LBKA 5CYYA 1X5CA 1QGVA 3R2QA 4HI7A
chains in the Genus database with same CATH superfamily
2AYTA 2GQKA 2P31A 1XOBA 4MK3A 2JSYA 1Q98A 1YQ1A 3IC8A 4EO3A 5J4UA 1SL1B 1GTIA 1AAZA 4WETA 3TOTA 1NHYA 3KXOA 1QMVA 3BBYA 2K6VA 2C8UA 3F3RA 4XIHA 4TR1A 1PN0A 3UBLA 1ST9A 3ISOA 3IA1A 1NW2A 3IE3A 1VF4A 1EGRA 1JZWA 3GTUA 2AV4A 1UA5A 4KDUA 4O92A 3UOMA 3FZAA 3BOAA 2FD3A 4MF5A 4ML6A 1X0RA 2AUVA 3UAPA 1FOVA 3KP9A 2H1BA 1V57A 4ZIJA 1K0DA 3L0HA 5DCHA 3IHQA 2VM1A 1PRXA 2VD1A 4BVYB 3UJ1A 2E0QA 4ECBA 4GF0A 3HDCA 3TKRA 5IOXA 3GH6A 5D93A 1XFLA 1ZYEA 2HFDA 1XWKA 1ZL9A 5KN2A 3D6IA 1TU8A 5EVOA 1TI1A 5B6NA 2H76A 3VLNA 4N0VA 2GSSA 1YZXA 2H6XA 2B5EA 4IQAA 4P3YB 2OE3A 1THXA 5D9TA 1M3JA 3G7IA 4QL9A 3EPTA 1GP1A 3PH9A 2H01A 4BL7B 2H66A 3HZ4A 4J2FA 4MPFA 3F6FA 1OKTA 2OJLA 5ECLB 3AY8A 3M0FA 1TJDA 4KX4A 5EY6A 3GA4A 2HZFA 2IMDA 3A5WA 4ZL9A 4NV5A 1KNGA 1WJKA 1U88A 3A3TA 2DBCA 1G6WA 1GSYA 4I5QA 1SK0A 3TJJA 4KB3A 3D0ZA 5IIZA 1J08A 4H86A 2RIIA 4CHSA 1UN2A 2PU9C 6GSWA 1XVWA 1MDKA 2VLTA 3VWUA 3IK9A 3EURA 5KN0A 4DSSB 4YQUA 1M99A 2I4AA 5JWQB 2OBKA 3TKSC 4G10A 3WGDA 2F3MA 4HOJA 1K3LA 5HFGA 3TKSA 5FWGA 2K9FA 1LU4A 1FG4A 2PN8A 2OA7A 3R3EA 4JEDA 4Q5QA 3GX8A 2H70A 1Y25A 3A5IA 5CO3A 1AW9A 1EOGA 2B1LA 2X49A 2DJJA 2HSMA 1M7TA 3DVXA 1NSWA 2B6MA 3MNGA 5F07A 3GL3A 1SJ6A 5D9VA 1SENA 2PVOC 4TW5A 1XW5A 2VOCA 2WULA 5ABRA 1ABAA 3TKSE 3FRCA 3DWVA 5G1LA 5INYA 3EINA 2H30A 2VIMA 1XWCA 6GSUA 3FR6A 4A5PA 1S3CA 2AB6A 3ZZXA 1S3AA 2KP2A 4ICYA 3IDVA 4DSQA 1EZKA 5ECSA 5EL8A 2XPDA 2ALBA 4I2UA 5HR2A 4TVEA 1YEPA 2B5XA 4PNGA 3TDGA 1YKAA 3KCMA 5HR1A 1OE8A 5ECRB 1URMA 3SBCA 2RM5A 2ZCTA 4NXIA 1M2BA 3RPPA 5IMAA 1R5AA 4HQSA 4YKGA 1V58A 3I9V2 2HRFA 5DCGA 4EKZA 3CRUA 3QPMA 2V32A 4MDCA 1Z7RA 3TJFA 2DKIA 1AQXA 3G7JA 4DVCA 2C4JA 1OVNA 1K0MA 2QC7A 4HEA2 1F3AA 1B9YC 14GSA 1B48A 2I81A 5COHA 3FY7A 3CQFA 3IOSA 1XCCA 3FEUA 2HLSA 3MDKA 5LCZA 3BD2A 1X5EA 5F05A 5AN1A 5CAXA 4KDXA 2FA4A 3HVNA 5IMCA 2VUPA 3LJRA 3EVIA 2LUSA 12GSA 2H72A 5EPFA 3TRXA 1DSBA 1GSUA 4XS4A 4POBA 2L5LA 3FR3A 5D8IA 3KTBA 3UMAA 2ZNMA 1ERVA 1GSEA 3CMIA 1EP7A 1X9WB 3G7YA 4O5RA 4TR4A 1R26A 4N30A 4LMVA 2L57A 1I5GA 1EEJA 3HD5A 3CSHA 2CAIA 2IPAA 3IV4A 4IW9A 4WF4A 2RUEA 3UBKA 2JL4A 8GSSA 2KUCA 2LJRA 5ID2A 17GSA 3IR4A 4RI7A 2WRTA 5DAKA 3DRNA 3KGKA 2V6KA 5CRGA 1C72A 4Q5FA 3GTUB 3GKXA 2WCIA 1T7PB 2PBJA 2XBIA 2C3QA 1AQWA 3HVSA 3PINA 4D73A 4BWQA 2H75A 3GIXA 4YAPA 2GSQA 3FK8A 2P5QA 2WGRA 2K8VA 2YOIA 1TK5B 11GSA 4MJCA 2WDUA 4XRAA 3JCML 4OMVA 3HKRA 1EWXA 3W8SA 2DJKA 5H5SA 5G5EA 2LEGA 1B8XA 5CRDA 3RHBA 5G5FA 4KNDA 3D4MA 4KCAA 1EV4A 2K8SA 6GSXA 2LTKA 4XTSA 1JFUA 4I8BA 3KIJA 2M72A 4ZILA 1JLVA 2VAFA 5CRWA 3APQA 2VLVA 5L71A 2B7JA 3IAM2 3M3MA 4KW6A 1U87A 4GRFA 4ZBDA 1F2EA 4OFTA 1Z9HA 1ZZYA 4GSTA 1GLQA 3UVTA 4N11A 2C0DA 4POMA 3OR5A 4Q5NA 5C04A 3EYTA 5IMDA 4IKHA 4AJ8A 1DE2A 5IO2A 3E0UA 4KUNA 4IVFA 1TKDB 2X8HA 2QGVA 3DMLA 4FYUA 3EMXA 2OE1A 2DJ1A 2YZHA 3HVXA 1Z6NA 1SD9A 4JE1A 2R3XA 2A2RA 5KN3A 2L4QA 4FQUA 1TK8B 5G30A 3IC4A 1U6TA 5FHIA 1ACVA 5LNKe 4RUVA 2F51A 3TOUA 2VCTA 5CP1A 4YH2A 2LRCA 4L5OA 2O8VB 3WT2A 3CRTA 4BPYA 3VWWA 4Z2TA 2C0FA 3KP8A 2DJ2A 5LD0A 2DIZA 4PGTA 1GUMA 2OBIA 3A2XA 5GAPD 2JACA 5IO0A 4QL7A 4YKFA 2LJAA 1OC9B 1XIYA 4KH7A 4ECCA 2YPMA 4EDYA 3BJ5A 2OKAA 3HXSA 3H8QA 3IHGA 1Y6EA 2RUFA 1G7EA 4PXOA 1XW6A 1SJIA 4N0ZA 3NOFA 4USSA 4XRDA 1TW9A 1V9WA 3QMXA 4GSSA 2VD0A 5DQSA 1DUGA 1AQVA 4TR3A 2YWNA 1UVZA 3ZVJD 3C1RA 3LXTA 4Z2UA 2N5FA 4KA0A 3F6DA 1KBNA 2H6ZA 3HA9A 3FHKA 5IPGA 1GWCA 4KSMA 5ECMB 2HRNA 5CRHA 1XG8A 3VPQA 2GSTA 4X0XA 4IQ1A 2R2JA 2YJ7A 2PERA 3KH9A 5G2ZA 3D22A 2HRAA 2DMLA 4KF9A 1K3OA 4NWYA 4MZCA 4MF6A 1F37A 2GZZA 4G19A 3CTGA 4OWYA 4HJMA 3ZIVA 1SK1A 5D9XA 2OE0A 3KMNA 1JZOA 1GTAA 2L5OA 3N9JA 3S9FA 3UEMA 4BVXB 4ACSA 3HY2A 4EUYA 4ULXA 2FCHA 4TRXA 3MWHA 3FZ4A 4MNNA 1A8YA 3LXZA 1GL8A 2R5GA 5KEJA 1TRUA 2GVPA 20GSA 4V2MA 3ME8A 5AGYA 4GSNA 2XBQA 1GTUA 4LLRA 1M2AA 3ZTLA 4WF5A 2BTOT 1SKSB 3L4NA 4DSRA 1U3IA 1FAAA 1PN9A 4K1FA 5FT3A 2JZSA 3GL5A 3PPUA 2I3YA 3RPNA 3ZITA 4GTUA 4XS4B 2LSTA 4EVMA 1GSQA 2KLXA 2HYXA 3L78A 5ECIB 1VRSD 2G0FA 2CAQA 1SKWB 3GMFA 1Z7PA 3GH9A 1SKRB 1F6MC 2C0EA 3LEFA 1A24A 3FZ9A 1T00A 2C1YA 3VURA 4K2XA 1VF2A 3TGZA 3ZVJA 1XWBA 4EIPA 1TRSA 3ZIJA 4L8EA 1G7OA 4E8EA 3GKKA 3N5OA 4POKA 5DAKB 3EE2A 4G9HA 4LMWA 3GSTA 5A5KA 5J3RA 2GQMA 2P0GA 2E2MA 4OCFA 4LL1B 3W6GA 2IJYA 4WXTA 5GSTA 1X9MB 2GTUA 1PL1A 2IIYA 3U5RE 3FYGA 1CQHA 1VGLA 4K9ZA 4K7IA 2CX4A 4XHMA 1A2MA 4GQFA 4ECIA 4TR0A 3C73A 1K0BA 1JLWA 4GQCA 5H5QA 3TUEA 5HFIA 1G6YA 3O76A 1GRXA 4WBJA 1FOHA 2P5RA 3SWLA 3HYPA 4F0CA 5H5RA 5GSSA 3MAKA 2JZTA 3FZ5A 4O5QA 1W89A 1ERTA 2REMA 4F0BA 1TDIA 3ZL5A 2AAWA 4ID0A 4ECJA 4MJBA 1EOHA 2R4VA 6GSVA 3IPZA 2F8FA 3EU4A 22GSA 3VFIA 5AIXA 1V40A 2VL3A 1GULA 1SYXA 2HZEB 2MMNA 4MZBA 2CVDA 3I43A 3V1WA 3D5JA 4ZB9A 5HQPA 1R4WA 3ED3A 5HR0A 2IN3A 4GLTA 5IOWA 1Z6MA 3DKSA 3GKMA 3GHAA 2H1DA 1V98A 1O8WA 1TK0B 3ZMLA 1A2JA 4O32A 5GZZB 2LNTA 3BCKA 4I2TA 1GNWA 1S3RA 2A2PA 5IQYA 5G1KA 2H0HA 4IELA 3TKPA 3TJGA 4CW9A 1BYEA 4F03A 1PFOA 3TJBA 2VM2A 1VF1A 5DALB 1WOUA 2FUG2 3I6AA 3K8NA 4IJ3A 4EL1A 2R0PA 5AIVA 4FYCA 3E9JB 3F9UA 5D73A 1A2LA 2PMTA 2A2SA 4XS1A 4N10A 1K0CA 3ME7A 2D2ZA 2H71A 5BRTA 4MP4A 3LG6A 3DXBA 4BVYA 4IHUA 4PQIA 1SU9A 2F9SA 1QXHA 1GUHA 1FHEA 4OFMA 4HZ4A 2X8GA 5HR3A 5B6MA 4X43A 2H6YA 2VL9A 3CSJA 6GSYA 4NPBA 4MJAA 3VK9A 1PQNA 4XS6A 2YP6A 1BG5A 1YEXA 2LQQA 4FH8A 3Q6OA 3M9JA 4BL7A 1EGOA 5KOWA 3IK7A 5G31A 2O7KA 5ECHB 1WP0A 2O87A 4F9ZA 3D21A 1KEBA 5JCGA 3EMPA 2WFCA 3P7XA 2J9HA 2MMOA 3GUSA 1OKDA 2HT9A 2FLSA 5ENUA 2C3NA 2PWJA 5IMFA 1PX6A 3GRXA 1AXDA 3LWAA 3MYDA 2AHEA 4TR1B 2FWEA 3WD6A 1SL0B 3FMWA 4YQVA 1PKWA 1G0TA 1F9MA 3LQ7A 5IMZA 1SYRA 3RHCA 2HI7A 3ZFBA 1TP9A 1Z5YE 4TKYA 4MJEA 1JHBA 4WEYA 1GH2A 1THOA 4NHWA 3KMOA 3QAWA 2BMXA 4DSSA 9GSSA 2F8AA 3QAGA 1QQ2A 2VCZA 1T3BA 2H74A 3Q18A 2L6CA 3GNJA 3ZMKA 3DEXA 2EIOA 1QK8A 4TN8A 3HVVA 3FKFA 4L5LA 5J41A 3H93A 2LKUA 2FY6A 2IFQA 1E6BA 1MTCA 4V2LA 1M3IA 4ZBAA 2E7PA 3J7Yb 5ECOB 1JZRA 4IS0A 3C71A 1HNCA 4EIQA 2A4VA 4MH2A 1YDKA 2CQ9A 1B4PA 4OO4A 3RBTA 3UVHA 3F8UA 1M9BA 4WBRD 3DVWA 3GX0A 1AC1A 2JSZA 3E3EA 5B7CA 3ERGA 1T1VA 4CY8A 2DSAA 3TRPA 2VCXA 3DIEA 3F3QA 4WR5A 4RQRA 2FWHA 2H1GA 2MZCA 5KN1A 1OAZA 4V1Ag 5JCWA 2GSRA 3I69A 4V2NA 1VF3A 5F0GA 2R6KA 4PQHA 3FR9A 2X8CA 1A0FA 1J9BA 2V41A 1UC7A 3QD9A 5GAND 4JRRA 1PGTA 2XPEA 2NTOA 1ML6A 4PURA 4JZQA 1SJZA 2CX3A 2HXKA 3KZQA 4JR4A 2Z9SA 3MIXA 6GSSA 3GFKA 1X5DA 5DQYA 1GTBA 2C0GA 1HQOA 2E2GA 3WGXA 4O7HA 3P8WA 3VI5A 4IJIA 1BQ7A 4K6XA 2H0IA 3L9UA 1PKZA 1YF1A 1FW1A 3G9BA 4MABA 2N5AA 2N5BA 1O7UA 5CREA 2LNSA 5IM9A 4AJ7A 5JWOB 2FHEA 4FIWA 1EEMA 3LORA 1QUWA 2AJQB 4ZB8A 3TB2A 1K3YA 2O89A 4GCIA 1A8LA 3A2WA 2XHFA 2VCWA 2YZUA 4I97A 1N2AA 1IYIA 2R0GA 3QFAC 2VL2A 3UARA 4LL4B 1ILOA 1B9XC 3RAZA 4MA9A 1GSDA 2JU5A 1MD4A 4BIKA 2C3TA 3J7Yk 2FWGA 2MBSA 2CA8A 1OE7A 3U6VA 1PMTA 1BX9A 3TJKA 1OC8A 4TXOA 5ECPB 4KCEA 2LV3A 3KEBA 1T4YA 2XC2A 2YV7A 5E59A 5KOXA 4HJ2A 1R7HA 2IL3A 2A4HA 2MYGA 5IPHA 1K0NA 4HDEA 3HHVA 2FGXA 2L4CA 3W8JA 2V2GA 3UIWA 2YJHA 3US3A 1GSSA 3P90A 3WYWA 2FNOA 2LS5A 3A2VA 3EWLA 2HE3A 2QSIA 3HJMA 2TRXA 4WR4A 4MCUA 4KDYA 4I6XA 2CVBA 3NZNA 2CVKA 2M80A 2GDRA 3DYRA 1O81A 4G2EA 5A4UA 3HJPA 5AISA 3CXGA 2H19A 19GSA 2R37A 1XWAA 3IXRA 4LA1A 2RLIA 3GSSA 2GT5A 3QAVA 2WB9A 4MZWA 4PUAA 1RK4A 4K5RA 2GQLA 4K0NA 1GLPA 2L6DA 1ZMAA 5ELGA 4K7NA 3ERFA 3M8NA 2G2QA 2DLXA 3C7MA 2TRCP 4JU5A 2FA8A 2LQOA 1Z3EA 2MMZA 4ILFA 5ID2B 1AUCA 4Z7XA 13GSA 2ES7A 4K8MA 2YWOA 2MBTA 4HZ2A 1ZYQB 4HS1A 3HZ8A 4ZL7A 3P2AA 3FW2A 4K2DA 2DJ3A 3HJOA 4GWRA 4EC0A 1Q4JA 5JCUA 2DIYA 1H4OA 4JR6A 3F4SA 1ERWA 3ZREA 3LSZA 2EIQA 4JBBA 4Z2RA 2K18A 3CBUA 4TOPA 4CDOA 2X99A 3QDNA 4J57E 5J9BA 4POLA 3DGQA 2IMFA 3GYKA 1O6JA 4D73B 2GS3A 3NIVA 16GSA 1NHOA 2HNLA 2YNXA 4TXVA 1XPVA 2OADA 5F8BA 4OCEA 1WIKA 4NV2A 4G0LA 1B4QA 1TOFA 4O5UA 4K7OA 4ZXGA 2IFQB 5D96A 4FO5A 2CT6A 3H4KA 1A0RP 1TU7A 2H8LA 2IMIA 1ZGNA 3EU3A 3TRQA 1PD21 3WT1A 2B3SA 4F2IA 4L0UA 4HU9A 5J5NA 2VCVA 3IBHA 3MSZA 1OC9A 2WZ9A 2IMKA 2ON7A 1YJ6A 1TTZA 1CQGA 4CY6A 1XOAA 1GSFA 3UL3A 3O6TA 2KP1A 3KH7A 1FB6A 4ISDA 5ECNB 3H79A 2FWFA 3LFLA 4ZBBA 5DVBA 4X4JA 2DC5A 3APOA 4YQMA 1DE1A 5A4WA 4E8HA 6GSTA 5DBQA 3KTLA 1TI3A 3GURA 2I9HA 4HUAA 1O73A 4IBPA 2KOKA 4RQXA 2WJUA 5JWRB 3C8EA 1XVQA 2IWTA 2J23A 3H1NA 3QR6A 2H73A 4NAXA 4KSOA 3GKNA 2QKEA 2QA1A 1SL2B 1NM3A 2HSYA 1M2DA 4WKWA 4HQZA 1TRVA 10GSA 2LRNA 2YCDA 3PGTA 1WMJA 1ZCPA 4MMMA 4G0KA 1HNBA 4L0WA 5F06A 3GV1A 5B8BA 4MLYA 2GLRA 4ZL8A 1FVJA 4FYBA 4PNFA 1K0AA 1YF0A 1SD8A 4MH3A 1AIUA 2NPBA 4PUFC 4BVXA 3TKQA 4PQ1A 3CYNA 3APSA 1H75A 3L9VA 5J9CA 1WPIA 3LYKA 3CSIA 3IRAA 4OFNA 5ECQB 5A4VA 1MEKA 1OC3A 2YWIA 2ON5A 1O85A 2L59A 4HU7A 1XXUA 5DJLA 4OD7A 2NVLA 1MDJA 2X64A 4J56E 5D9WA 2HSHA 4GXZA 4NMUA 2LRTA 4AJ6A 1PX7A 1USBA 3VWXA 4DEJA 1WRYA 2B7KA 4K0GA 3VWVA 2CZ3A 1RW1A 4KAEA 4HSCX 4F82A 3Q74A 3KD0A 2DKHA 3ZRDA 3DD3A 4KGIA 4X1UA 1QFNA 4TXOB 2MMAA 3QOUA 4OO5A 5CNWA 3QCPA 2IMEA 1IYHA 2GT6A 2CV4A 4ZB6A 3VPTA 1W4VA 4G0IA 4PTSA 7GSSA 1ZYNA 2PPTA 1T8EB 3ZYWA 2BJXA 4BWSA 5B8AA 1X9SB 1RQMA 3Q19A 4IP6A 3O3TA 1ZOFA 5ELAA 2H0GA 1LJRA 2EC4A 1M9AA 1U3AA 3F4RA 3F4TA 2VO4A 2RM6A 3M9KA 3D4TA 1WE0A 4EF0A 1KTEA 4PX1A 1TXXA 2H1AA 2HRKA 3LYPA 1I9DA 2OACA 5IMVA 4ML1A 2QA2A 1XWGA 3HCZA 1FVKA 4Q5RA 2KHPA 2PGTA 1PL2A 1FO5A 2V1MA 1BAYA 4K5SA 3GN3A 2NDOA 2PUKC 3CTFA 4AGSA 2DMMA 1HNAA 1MDIA 3LW9A 2B5YA 1BJXA 1F3BA 2UZ8A 4IGJA 1WWJA 2HZEA 4AF2A 4NHZA 5DJMA 2VCQA 1YKCA 3F0IA 5ECKB 1HD2A 4IP1A 3WGEA 3TCOA 2ZUPA 5DDLA 4MF7A 3LGCA 2M46A 2GGTA 1SK2A 1S3DA 2O85A 3ZFLA 5C00A 5HFKA 3C1SA 4BA7A 1GUKA 1MD3A 3RDWA 4XCSA 1YY7A 2X4AA 5E4WA 4RI6A 3BCIA 3QFBC 2GZPA 5BMUA 2EIRA 4YAVA 1TRWA 2PVQA 5DALA 1R5PA 3EC3A 2C80A 2NBSA 4EXJA 2CZ2A 1PA3A 4IN0A 1N8JA 1PSQA 2YWMA 1V2AA 2YV9A 2VLUA 2YANA 1XZOA 1E2YA 2WS2A 2JZRA 2V6OA 4EE0A 4KE3A 3VI7A 1BEDA 2YN1A 18GSA 4QQ7A 1HYUA 4MPGA 1FB0A 1EV9A 3M1GA 1K0OA 1ERUA 2DJ0A 2B1KA 1J0FA 2VL2C 4V1Ap 1M0UA 2TIRA 3ZLPA 3ERWA 2GZYA 3L9SA 1EP8A 1GNEA 3KM6A 2LJKA 1OYJA 3F63A 3KJYA 1ZYPA 4EDZA 1O8XA 1T4ZA 1XBSA 2I1UA 1A23A 1JZDA 1XW9A 3PR8A 1DBYA 1ON4A 2JADA 3IAS2 1LBKA 2R0CA 5CYYA 1X5CA 1QGVA 3R2QA 4HI7A
chains in the Genus database with same CATH topology
2AYTA 2GQKA 2P31A 1XOBA 4MK3A 2JSYA 1Q98A 1YQ1A 3IC8A 4EO3A 5J4UA 1SL1B 1GTIA 1AAZA 4WETA 3TOTA 1NHYA 3KXOA 1QMVA 3BBYA 2K6VA 2C8UA 3F3RA 4XIHA 4TR1A 1PN0A 3UBLA 1ST9A 3ISOA 3IA1A 1NW2A 3IE3A 1VF4A 1EGRA 1JZWA 3GTUA 2AV4A 1UA5A 4KDUA 4O92A 3UOMA 3FZAA 3BOAA 2FD3A 4MF5A 4ML6A 1X0RA 2AUVA 3UAPA 1FOVA 3KP9A 2H1BA 1V57A 4ZIJA 1K0DA 3L0HA 5DCHA 3IHQA 2VM1A 1PRXA 2VD1A 4BVYB 3UJ1A 2E0QA 4ECBA 4GF0A 3HDCA 3TKRA 5IOXA 3GH6A 5D93A 1XFLA 1ZYEA 2HFDA 1XWKA 1ZL9A 5KN2A 3D6IA 1TU8A 5EVOA 1TI1A 5B6NA 2H76A 3VLNA 4N0VA 2GSSA 1YZXA 2H6XA 2B5EA 4IQAA 4P3YB 2OE3A 1THXA 5D9TA 3G7IA 4QL9A 3EPTA 1GP1A 3PH9A 2H01A 4BL7B 2H66A 3HZ4A 4J2FA 4MPFA 3F6FA 1OKTA 2OJLA 5ECLB 3AY8A 3M0FA 1TJDA 4KX4A 5EY6A 3GA4A 2HZFA 2IMDA 3A5WA 4ZL9A 4NV5A 1KNGA 1WJKA 1U88A 3A3TA 2DBCA 1G6WA 1GSYA 4I5QA 1SK0A 3TJJA 4KB3A 3D0ZA 5IIZA 1J08A 4H86A 2RIIA 4CHSA 1UN2A 2PU9C 6GSWA 1XVWA 1MDKA 2VLTA 3VWUA 3IK9A 3EURA 5KN0A 4DSSB 4YQUA 1M99A 2I4AA 5JWQB 2OBKA 3TKSC 4G10A 3WGDA 2F3MA 4HOJA 1K3LA 5HFGA 3TKSA 5FWGA 2K9FA 1LU4A 1FG4A 2PN8A 2OA7A 3R3EA 4JEDA 4Q5QA 3GX8A 2H70A 1Y25A 3A5IA 5CO3A 1AW9A 1EOGA 2B1LA 2X49A 2DJJA 2HSMA 1M7TA 3DVXA 1NSWA 2B6MA 3MNGA 5F07A 3GL3A 1SJ6A 5D9VA 1SENA 2PVOC 4TW5A 1XW5A 2VOCA 2WULA 5ABRA 1ABAA 3TKSE 3FRCA 3DWVA 5G1LA 5INYA 3EINA 2H30A 2VIMA 1XWCA 6GSUA 3FR6A 4A5PA 1S3CA 2AB6A 3ZZXA 1S3AA 2KP2A 4ICYA 3IDVA 4DSQA 1EZKA 5ECSA 5EL8A 2XPDA 2ALBA 4I2UA 5HR2A 4TVEA 1YEPA 2B5XA 4PNGA 3TDGA 1YKAA 3KCMA 5HR1A 1OE8A 5ECRB 1URMA 3SBCA 2RM5A 2ZCTA 4NXIA 1M2BA 3RPPA 5IMAA 1R5AA 4HQSA 4YKGA 1V58A 3I9V2 2HRFA 5DCGA 4EKZA 3CRUA 3QPMA 2V32A 4MDCA 1Z7RA 3TJFA 2DKIA 1AQXA 3G7JA 4DVCA 2C4JA 1OVNA 1K0MA 2QC7A 4HEA2 1F3AA 1B9YC 14GSA 1B48A 2I81A 5COHA 3FY7A 3IOSA 1XCCA 3FEUA 2HLSA 3MDKA 5LCZA 3BD2A 1X5EA 5F05A 5AN1A 5CAXA 4KDXA 2FA4A 5IMCA 2VUPA 3LJRA 3EVIA 2LUSA 12GSA 2H72A 5EPFA 3TRXA 1DSBA 1GSUA 4XS4A 4POBA 2L5LA 3FR3A 5D8IA 3KTBA 3UMAA 2ZNMA 1ERVA 1GSEA 3CMIA 1EP7A 1X9WB 3G7YA 4O5RA 4TR4A 1R26A 4N30A 4LMVA 2L57A 1I5GA 1EEJA 3HD5A 3CSHA 2CAIA 2IPAA 3IV4A 4IW9A 4WF4A 2RUEA 3UBKA 2JL4A 8GSSA 2KUCA 2LJRA 5ID2A 17GSA 3IR4A 4RI7A 2WRTA 5DAKA 3DRNA 3KGKA 2V6KA 5CRGA 1C72A 4Q5FA 3GTUB 3GKXA 2WCIA 1T7PB 2PBJA 2XBIA 2C3QA 1AQWA 3HVSA 3PINA 4D73A 4BWQA 2H75A 3GIXA 4YAPA 2GSQA 3FK8A 2P5QA 2WGRA 2K8VA 2YOIA 1TK5B 11GSA 4MJCA 2WDUA 4XRAA 3JCML 4OMVA 3HKRA 1EWXA 3W8SA 2DJKA 5H5SA 5G5EA 2LEGA 1B8XA 5CRDA 3RHBA 5G5FA 4KNDA 3D4MA 4KCAA 1EV4A 2K8SA 6GSXA 2LTKA 4XTSA 1JFUA 4I8BA 3KIJA 2M72A 4ZILA 1JLVA 2VAFA 5CRWA 3APQA 2VLVA 5L71A 2B7JA 3IAM2 3M3MA 4KW6A 1U87A 4GRFA 4ZBDA 1F2EA 4OFTA 1Z9HA 1ZZYA 4GSTA 1GLQA 3UVTA 4N11A 2C0DA 4POMA 3OR5A 4Q5NA 5C04A 3EYTA 5IMDA 4IKHA 4AJ8A 1DE2A 5IO2A 3E0UA 4KUNA 4IVFA 1TKDB 2X8HA 2QGVA 3DMLA 4FYUA 3EMXA 2OE1A 2DJ1A 2YZHA 3HVXA 1Z6NA 1SD9A 4JE1A 2R3XA 2A2RA 5KN3A 2L4QA 4FQUA 1TK8B 5G30A 3IC4A 1U6TA 5FHIA 1ACVA 5LNKe 4RUVA 2F51A 3TOUA 2VCTA 5CP1A 4YH2A 2LRCA 4L5OA 2O8VB 3WT2A 3CRTA 4BPYA 3VWWA 4Z2TA 2C0FA 3KP8A 2DJ2A 5LD0A 2DIZA 4PGTA 1GUMA 2OBIA 3A2XA 5GAPD 2JACA 5IO0A 4QL7A 4YKFA 2LJAA 1OC9B 1XIYA 4KH7A 4ECCA 2YPMA 4EDYA 3BJ5A 2OKAA 3HXSA 3H8QA 3IHGA 1Y6EA 2RUFA 1G7EA 4PXOA 1XW6A 1SJIA 4N0ZA 3NOFA 4USSA 4XRDA 1TW9A 1V9WA 3QMXA 4GSSA 2VD0A 5DQSA 1DUGA 1AQVA 4TR3A 2YWNA 1UVZA 3ZVJD 3C1RA 3LXTA 4Z2UA 2N5FA 4KA0A 3F6DA 1KBNA 2H6ZA 3HA9A 3FHKA 5IPGA 1GWCA 4KSMA 5ECMB 2HRNA 5CRHA 3VPQA 2GSTA 4X0XA 4IQ1A 2R2JA 2YJ7A 2PERA 3KH9A 5G2ZA 3D22A 2HRAA 2DMLA 4KF9A 1K3OA 4NWYA 4MZCA 4MF6A 1F37A 2GZZA 4G19A 3CTGA 4OWYA 4HJMA 3ZIVA 1SK1A 5D9XA 2OE0A 3KMNA 1JZOA 1GTAA 2L5OA 3N9JA 3S9FA 3UEMA 4BVXB 4ACSA 3HY2A 4EUYA 4ULXA 2FCHA 4TRXA 3MWHA 3FZ4A 4MNNA 1A8YA 3LXZA 1GL8A 2R5GA 5KEJA 1TRUA 2GVPA 20GSA 4V2MA 3ME8A 5AGYA 4GSNA 2XBQA 1GTUA 4LLRA 1M2AA 3ZTLA 4WF5A 2BTOT 1SKSB 3L4NA 4DSRA 1U3IA 1FAAA 1PN9A 4K1FA 5FT3A 2JZSA 3GL5A 3PPUA 2I3YA 3RPNA 3ZITA 4GTUA 4XS4B 2LSTA 4EVMA 1GSQA 2KLXA 2HYXA 3L78A 5ECIB 1VRSD 2G0FA 2CAQA 1SKWB 3GMFA 1Z7PA 3GH9A 1SKRB 1F6MC 2C0EA 3LEFA 1A24A 3FZ9A 1T00A 2C1YA 3VURA 4K2XA 1VF2A 3TGZA 3ZVJA 1XWBA 4EIPA 1TRSA 3ZIJA 4L8EA 1G7OA 4E8EA 3GKKA 3N5OA 4POKA 5DAKB 3EE2A 4G9HA 4LMWA 3GSTA 5A5KA 5J3RA 2GQMA 2P0GA 2E2MA 4OCFA 4LL1B 3W6GA 2IJYA 4WXTA 5GSTA 1X9MB 2GTUA 1PL1A 2IIYA 3U5RE 3FYGA 1CQHA 1VGLA 4K9ZA 4K7IA 2CX4A 4XHMA 1A2MA 4GQFA 4ECIA 4TR0A 3C73A 1K0BA 1JLWA 4GQCA 5H5QA 3TUEA 5HFIA 1G6YA 3O76A 1GRXA 4WBJA 1FOHA 2P5RA 3SWLA 3HYPA 4F0CA 5H5RA 5GSSA 3MAKA 2JZTA 3FZ5A 4O5QA 1W89A 1ERTA 2REMA 4F0BA 1TDIA 3ZL5A 2AAWA 4ID0A 4ECJA 4MJBA 1EOHA 2R4VA 6GSVA 3IPZA 2F8FA 3EU4A 22GSA 3VFIA 5AIXA 1V40A 2VL3A 1GULA 1SYXA 2HZEB 2MMNA 4MZBA 2CVDA 3I43A 3V1WA 3D5JA 4ZB9A 5HQPA 1R4WA 3ED3A 5HR0A 2IN3A 4GLTA 5IOWA 1Z6MA 3DKSA 3GKMA 3GHAA 2H1DA 1V98A 1O8WA 1TK0B 3ZMLA 1A2JA 4O32A 5GZZB 2LNTA 3BCKA 4I2TA 1GNWA 2A2PA 5IQYA 5G1KA 2H0HA 4IELA 3TKPA 3TJGA 4CW9A 1BYEA 4F03A 3TJBA 2VM2A 1VF1A 5DALB 1WOUA 2FUG2 3I6AA 3K8NA 4IJ3A 4EL1A 2R0PA 5AIVA 4FYCA 3E9JB 3F9UA 5D73A 1A2LA 2PMTA 2A2SA 4XS1A 4N10A 1K0CA 3ME7A 2D2ZA 2H71A 5BRTA 4MP4A 3LG6A 3DXBA 4BVYA 4IHUA 4PQIA 1SU9A 2F9SA 1QXHA 1GUHA 1FHEA 4OFMA 4HZ4A 2X8GA 5HR3A 5B6MA 4X43A 2H6YA 2VL9A 3CSJA 6GSYA 4NPBA 4MJAA 3VK9A 1PQNA 4XS6A 2YP6A 1BG5A 1YEXA 2LQQA 4FH8A 3Q6OA 3M9JA 4BL7A 1EGOA 5KOWA 3IK7A 5G31A 2O7KA 5ECHB 1WP0A 2O87A 4F9ZA 3D21A 1KEBA 5JCGA 3EMPA 2WFCA 3P7XA 2J9HA 2MMOA 3GUSA 1OKDA 2HT9A 2FLSA 5ENUA 2C3NA 2PWJA 5IMFA 1PX6A 3GRXA 1AXDA 3LWAA 3MYDA 2AHEA 4TR1B 2FWEA 3WD6A 1SL0B 3FMWA 4YQVA 1PKWA 1G0TA 1F9MA 3LQ7A 5IMZA 1SYRA 3RHCA 2HI7A 3ZFBA 1TP9A 1Z5YE 4TKYA 4MJEA 1JHBA 4WEYA 1GH2A 1THOA 4NHWA 3KMOA 3QAWA 2BMXA 4DSSA 9GSSA 2F8AA 3QAGA 1QQ2A 2VCZA 1T3BA 2H74A 3Q18A 2L6CA 3GNJA 3ZMKA 3DEXA 2EIOA 1QK8A 4TN8A 3HVVA 3FKFA 4L5LA 5J41A 3H93A 2LKUA 2FY6A 2IFQA 1E6BA 1MTCA 4V2LA 4ZBAA 2E7PA 3J7Yb 5ECOB 1JZRA 4IS0A 3C71A 1HNCA 4EIQA 2A4VA 4MH2A 1YDKA 2CQ9A 1B4PA 4OO4A 3RBTA 3UVHA 3F8UA 1M9BA 4WBRD 3DVWA 3GX0A 1AC1A 2JSZA 3E3EA 5B7CA 3ERGA 1T1VA 4CY8A 2DSAA 3TRPA 2VCXA 3DIEA 3F3QA 4WR5A 4RQRA 2FWHA 2H1GA 2MZCA 5KN1A 1OAZA 4V1Ag 5JCWA 2GSRA 3I69A 4V2NA 1VF3A 5F0GA 2R6KA 4PQHA 3FR9A 2X8CA 1A0FA 1J9BA 2V41A 1UC7A 3QD9A 5GAND 4JRRA 1PGTA 2XPEA 2NTOA 1ML6A 4PURA 4JZQA 1SJZA 2CX3A 2HXKA 3KZQA 4JR4A 2Z9SA 3MIXA 6GSSA 3GFKA 1X5DA 5DQYA 1GTBA 2C0GA 1HQOA 2E2GA 3WGXA 4O7HA 3P8WA 3VI5A 4IJIA 1BQ7A 4K6XA 2H0IA 3L9UA 1PKZA 1YF1A 1FW1A 3G9BA 4MABA 2N5AA 2N5BA 1O7UA 5CREA 2LNSA 5IM9A 4AJ7A 5JWOB 2FHEA 4FIWA 1EEMA 3LORA 1QUWA 2AJQB 4ZB8A 3TB2A 1K3YA 2O89A 4GCIA 1A8LA 3A2WA 2XHFA 2VCWA 2YZUA 4I97A 1N2AA 1IYIA 2R0GA 3QFAC 2VL2A 3UARA 4LL4B 1ILOA 1B9XC 3RAZA 4MA9A 1GSDA 2JU5A 1MD4A 2C3TA 3J7Yk 2FWGA 2MBSA 2CA8A 1OE7A 3U6VA 1PMTA 1BX9A 3TJKA 1OC8A 4TXOA 5ECPB 4KCEA 2LV3A 3KEBA 1T4YA 2XC2A 2YV7A 5E59A 5KOXA 4HJ2A 1R7HA 2IL3A 2A4HA 2MYGA 5IPHA 1K0NA 4HDEA 3HHVA 2FGXA 2L4CA 3W8JA 2V2GA 3UIWA 2YJHA 3US3A 1GSSA 3P90A 3WYWA 2FNOA 2LS5A 3A2VA 3EWLA 2HE3A 2QSIA 3HJMA 2TRXA 4WR4A 4MCUA 4KDYA 4I6XA 2CVBA 3NZNA 2CVKA 2M80A 2GDRA 3DYRA 1O81A 4G2EA 5A4UA 3HJPA 5AISA 3CXGA 2H19A 19GSA 2R37A 1XWAA 3IXRA 4LA1A 2RLIA 3GSSA 2GT5A 3QAVA 2WB9A 4MZWA 4PUAA 1RK4A 4K5RA 2GQLA 4K0NA 1GLPA 2L6DA 1ZMAA 5ELGA 4K7NA 3ERFA 3M8NA 2G2QA 2DLXA 3C7MA 2TRCP 4JU5A 2FA8A 2LQOA 1Z3EA 2MMZA 4ILFA 5ID2B 1AUCA 4Z7XA 13GSA 2ES7A 4K8MA 2YWOA 2MBTA 4HZ2A 1ZYQB 4HS1A 3HZ8A 4ZL7A 3P2AA 3FW2A 4K2DA 2DJ3A 3HJOA 4GWRA 4EC0A 1Q4JA 5JCUA 2DIYA 1H4OA 4JR6A 3F4SA 1ERWA 3ZREA 3LSZA 2EIQA 4JBBA 4Z2RA 2K18A 3CBUA 4TOPA 4CDOA 2X99A 3QDNA 4J57E 5J9BA 4POLA 3DGQA 2IMFA 3GYKA 1O6JA 4D73B 2GS3A 3NIVA 16GSA 1NHOA 2HNLA 2YNXA 4TXVA 1XPVA 2OADA 5F8BA 4OCEA 1WIKA 4NV2A 4G0LA 1B4QA 1TOFA 4O5UA 4K7OA 4ZXGA 2IFQB 5D96A 4FO5A 2CT6A 3H4KA 1A0RP 1TU7A 2H8LA 2IMIA 1ZGNA 3EU3A 3TRQA 1PD21 3WT1A 2B3SA 4F2IA 4L0UA 4HU9A 5J5NA 2VCVA 3IBHA 3MSZA 1OC9A 2WZ9A 2IMKA 2ON7A 1YJ6A 1TTZA 1CQGA 4CY6A 1XOAA 1GSFA 3UL3A 3O6TA 2KP1A 3KH7A 1FB6A 4ISDA 5ECNB 3H79A 2FWFA 3LFLA 4ZBBA 5DVBA 4X4JA 2DC5A 3APOA 4YQMA 1DE1A 5A4WA 4E8HA 6GSTA 5DBQA 3KTLA 1TI3A 3GURA 2I9HA 4HUAA 1O73A 4IBPA 2KOKA 4RQXA 2WJUA 5JWRB 3C8EA 1XVQA 2IWTA 2J23A 3H1NA 3QR6A 2H73A 4NAXA 4KSOA 3GKNA 2QKEA 2QA1A 1SL2B 1NM3A 2HSYA 1M2DA 4WKWA 4HQZA 1TRVA 10GSA 2LRNA 2YCDA 3PGTA 1WMJA 1ZCPA 4MMMA 4G0KA 1HNBA 4L0WA 5F06A 3GV1A 5B8BA 4MLYA 2GLRA 4ZL8A 1FVJA 4FYBA 4PNFA 1K0AA 1YF0A 1SD8A 4MH3A 1AIUA 2NPBA 4PUFC 4BVXA 3TKQA 4PQ1A 3CYNA 3APSA 1H75A 3L9VA 5J9CA 1WPIA 3LYKA 3CSIA 3IRAA 4OFNA 5ECQB 5A4VA 1MEKA 1OC3A 2YWIA 2ON5A 1O85A 2L59A 4HU7A 1XXUA 5DJLA 4OD7A 2NVLA 1MDJA 2X64A 4J56E 5D9WA 2HSHA 4GXZA 4NMUA 2LRTA 4AJ6A 1PX7A 1USBA 3VWXA 4DEJA 1WRYA 2B7KA 4K0GA 3VWVA 2CZ3A 1RW1A 4KAEA 4F82A 3Q74A 3KD0A 2DKHA 3ZRDA 3DD3A 4KGIA 4X1UA 1QFNA 4TXOB 2MMAA 3QOUA 4OO5A 5CNWA 3QCPA 2IMEA 1IYHA 2GT6A 2CV4A 4ZB6A 3VPTA 1W4VA 4G0IA 4PTSA 7GSSA 1ZYNA 2PPTA 1T8EB 3ZYWA 2BJXA 4BWSA 5B8AA 1X9SB 1RQMA 3Q19A 4IP6A 3O3TA 1ZOFA 5ELAA 2H0GA 1LJRA 2EC4A 1M9AA 1U3AA 3F4RA 3F4TA 2VO4A 2RM6A 3M9KA 3D4TA 1WE0A 4EF0A 1KTEA 4PX1A 1TXXA 2H1AA 2HRKA 3LYPA 1I9DA 2OACA 5IMVA 4ML1A 2QA2A 1XWGA 3HCZA 1FVKA 4Q5RA 2KHPA 2PGTA 1PL2A 1FO5A 2V1MA 1BAYA 4K5SA 3GN3A 2NDOA 2PUKC 3CTFA 4AGSA 2DMMA 1HNAA 1MDIA 3LW9A 2B5YA 1BJXA 1F3BA 2UZ8A 4IGJA 1WWJA 2HZEA 4AF2A 4NHZA 5DJMA 2VCQA 1YKCA 3F0IA 5ECKB 1HD2A 4IP1A 3WGEA 3TCOA 2ZUPA 5DDLA 4MF7A 3LGCA 2M46A 2GGTA 1SK2A 1S3DA 2O85A 3ZFLA 5C00A 5HFKA 3C1SA 4BA7A 1GUKA 1MD3A 3RDWA 4XCSA 1YY7A 2X4AA 5E4WA 4RI6A 3BCIA 3QFBC 2GZPA 5BMUA 2EIRA 4YAVA 1TRWA 2PVQA 5DALA 1R5PA 3EC3A 2C80A 2NBSA 4EXJA 2CZ2A 1PA3A 4IN0A 1N8JA 1PSQA 2YWMA 1V2AA 2YV9A 2VLUA 2YANA 1XZOA 1E2YA 2WS2A 2JZRA 2V6OA 4EE0A 4KE3A 3VI7A 1BEDA 2YN1A 18GSA 4QQ7A 1HYUA 4MPGA 1FB0A 1EV9A 3M1GA 1K0OA 1ERUA 2DJ0A 2B1KA 1J0FA 2VL2C 4V1Ap 1M0UA 2TIRA 3ZLPA 3ERWA 2GZYA 3L9SA 1EP8A 1GNEA 3KM6A 2LJKA 1OYJA 3F63A 3KJYA 1ZYPA 4EDZA 1O8XA 1T4ZA 1XBSA 2I1UA 1A23A 1JZDA 1XW9A 3PR8A 1DBYA 1ON4A 2JADA 3IAS2 1LBKA 2R0CA 5CYYA 1X5CA 1QGVA 3R2QA 4HI7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AYT A;  2GQK A;  2P31 A;  1XOB A;  4MK3 A;  2JSY A;  1Q98 A;  1YQ1 A;  4EO3 A;  5J4U A;  1SL1 B;  1GTI A;  1AAZ A;  4WET A;  3TOT A;  1NHY A;  3KXO A;  1QMV A;  3BBY A;  2K6V A;  2C8U A;  3F3R A;  4XIH A;  4TR1 A;  3UBL A;  1ST9 A;  3ISO A;  3IA1 A;  1NW2 A;  3IE3 A;  1VF4 A;  1EGR A;  1JZW A;  3GTU A;  2AV4 A;  1UA5 A;  4KDU A;  4O92 A;  3UOM A;  3FZA A;  3BOA A;  2FD3 A;  4MF5 A;  4ML6 A;  1X0R A;  2AUV A;  3UAP A;  1FOV A;  3KP9 A;  2H1B A;  1V57 A;  4ZIJ A;  1K0D A;  3L0H A;  5DCH A;  3IHQ A;  2VM1 A;  1PRX A;  2VD1 A;  3UJ1 A;  2E0Q A;  4ECB A;  4GF0 A;  3HDC A;  3TKR A;  5IOX A;  3GH6 A;  5D93 A;  1XFL A;  1ZYE A;  2HFD A;  1XWK A;  1ZL9 A;  5KN2 A;  3D6I A;  1TU8 A;  5EVO A;  1TI1 A;  5B6N A;  2H76 A;  3VLN A;  4N0V A;  2GSS A;  1YZX A;  2H6X A;  2B5E A;  4IQA A;  4P3Y B;  2OE3 A;  1THX A;  5D9T A;  3G7I A;  4QL9 A;  1GP1 A;  3PH9 A;  2H01 A;  2H66 A;  3HZ4 A;  4J2F A;  4MPF A;  3F6F A;  1OKT A;  2OJL A;  5ECL B;  3AY8 A;  3M0F A;  1TJD A;  4KX4 A;  5EY6 A;  3GA4 A;  2HZF A;  2IMD A;  3A5W A;  4ZL9 A;  4NV5 A;  1KNG A;  1WJK A;  1U88 A;  3A3T A;  2DBC A;  1G6W A;  1GSY A;  4I5Q A;  1SK0 A;  3TJJ A;  4KB3 A;  3D0Z A;  5IIZ A;  1J08 A;  4H86 A;  2RII A;  4CHS A;  1UN2 A;  2PU9 C;  6GSW A;  1XVW A;  1MDK A;  2VLT A;  3VWU A;  3IK9 A;  3EUR A;  5KN0 A;  4DSS B;  4YQU A;  1M99 A;  2I4A A;  5JWQ B;  2OBK A;  3TKS C;  4G10 A;  3WGD A;  2F3M A;  4HOJ A;  1K3L A;  5HFG A;  3TKS A;  5FWG A;  2K9F A;  1LU4 A;  1FG4 A;  2PN8 A;  2OA7 A;  4JED A;  4Q5Q A;  3GX8 A;  2H70 A;  1Y25 A;  5CO3 A;  1AW9 A;  1EOG A;  2B1L A;  2DJJ A;  1M7T A;  3DVX A;  1NSW A;  2B6M A;  3MNG A;  5F07 A;  3GL3 A;  1SJ6 A;  5D9V A;  1SEN A;  2PVO C;  4TW5 A;  1XW5 A;  2VOC A;  2WUL A;  5ABR A;  1ABA A;  3TKS E;  3FRC A;  3DWV A;  5G1L A;  5INY A;  3EIN A;  2H30 A;  2VIM A;  1XWC A;  6GSU A;  3FR6 A;  1S3C A;  2AB6 A;  3ZZX A;  1S3A A;  2KP2 A;  3IDV A;  4DSQ A;  1EZK A;  5ECS A;  5EL8 A;  2XPD A;  2ALB A;  4I2U A;  5HR2 A;  4TVE A;  1YEP A;  2B5X A;  4PNG A;  3TDG A;  1YKA A;  3KCM A;  5HR1 A;  1OE8 A;  5ECR B;  1URM A;  3SBC A;  2RM5 A;  2ZCT A;  4NXI A;  1M2B A;  3RPP A;  5IMA A;  1R5A A;  4HQS A;  1V58 A;  3I9V 2;  2HRF A;  5DCG A;  4EKZ A;  3CRU A;  3QPM A;  2V32 A;  4MDC A;  1Z7R A;  3TJF A;  1AQX A;  3G7J A;  4DVC A;  2C4J A;  1OVN A;  1K0M A;  2QC7 A;  4HEA 2;  1F3A A;  1B9Y C;  14GS A;  1B48 A;  2I81 A;  5COH A;  3FY7 A;  3IOS A;  1XCC A;  3FEU A;  2HLS A;  3MDK A;  5LCZ A;  3BD2 A;  1X5E A;  5F05 A;  5AN1 A;  5CAX A;  4KDX A;  2FA4 A;  5IMC A;  2VUP A;  3LJR A;  3EVI A;  2LUS A;  12GS A;  2H72 A;  5EPF A;  3TRX A;  1DSB A;  1GSU A;  4XS4 A;  4POB A;  2L5L A;  3FR3 A;  5D8I A;  3KTB A;  3UMA A;  2ZNM A;  1ERV A;  1GSE A;  3CMI A;  1EP7 A;  1X9W B;  3G7Y A;  4O5R A;  4TR4 A;  1R26 A;  4N30 A;  4LMV A;  2L57 A;  1I5G A;  1EEJ A;  3HD5 A;  3CSH A;  2CAI A;  2IPA A;  3IV4 A;  4IW9 A;  4WF4 A;  2RUE A;  3UBK A;  2JL4 A;  8GSS A;  2KUC A;  2LJR A;  5ID2 A;  17GS A;  3IR4 A;  4RI7 A;  2WRT A;  5DAK A;  3DRN A;  3KGK A;  2V6K A;  5CRG A;  1C72 A;  4Q5F A;  3GTU B;  3GKX A;  2WCI A;  1T7P B;  2PBJ A;  2XBI A;  2C3Q A;  1AQW A;  3HVS A;  3PIN A;  4D73 A;  4BWQ A;  2H75 A;  3GIX A;  4YAP A;  2GSQ A;  3FK8 A;  2P5Q A;  2WGR A;  2K8V A;  2YOI A;  1TK5 B;  11GS A;  4MJC A;  2WDU A;  4XRA A;  3JCM L;  4OMV A;  3HKR A;  1EWX A;  3W8S A;  2DJK A;  5H5S A;  5G5E A;  2LEG A;  1B8X A;  5CRD A;  3RHB A;  5G5F A;  4KND A;  3D4M A;  4KCA A;  1EV4 A;  2K8S A;  6GSX A;  2LTK A;  4XTS A;  1JFU A;  4I8B A;  3KIJ A;  2M72 A;  4ZIL A;  1JLV A;  2VAF A;  5CRW A;  3APQ A;  2VLV A;  5L71 A;  2B7J A;  3IAM 2;  3M3M A;  4KW6 A;  1U87 A;  4GRF A;  4ZBD A;  1F2E A;  4OFT A;  1Z9H A;  1ZZY A;  4GST A;  1GLQ A;  3UVT A;  4N11 A;  2C0D A;  4POM A;  3OR5 A;  4Q5N A;  5C04 A;  3EYT A;  5IMD A;  4IKH A;  4AJ8 A;  1DE2 A;  5IO2 A;  3E0U A;  4KUN A;  4IVF A;  1TKD B;  2X8H A;  2QGV A;  3DML A;  4FYU A;  3EMX A;  2OE1 A;  2DJ1 A;  2YZH A;  3HVX A;  1Z6N A;  1SD9 A;  4JE1 A;  2R3X A;  2A2R A;  5KN3 A;  2L4Q A;  1TK8 B;  5G30 A;  3IC4 A;  1U6T A;  5FHI A;  1ACV A;  5LNK e;  4RUV A;  2F51 A;  3TOU A;  2VCT A;  5CP1 A;  4YH2 A;  2LRC A;  4L5O A;  2O8V B;  3WT2 A;  3CRT A;  4BPY A;  3VWW A;  2C0F A;  3KP8 A;  2DJ2 A;  5LD0 A;  2DIZ A;  4PGT A;  1GUM A;  2OBI A;  3A2X A;  5GAP D;  2JAC A;  5IO0 A;  4QL7 A;  2LJA A;  1OC9 B;  1XIY A;  4KH7 A;  4ECC A;  2YPM A;  4EDY A;  3BJ5 A;  2OKA A;  3HXS A;  3H8Q A;  1Y6E A;  2RUF A;  1G7E A;  4PXO A;  1XW6 A;  1SJI A;  4N0Z A;  3NOF A;  4XRD A;  1TW9 A;  1V9W A;  3QMX A;  4GSS A;  2VD0 A;  5DQS A;  1DUG A;  1AQV A;  4TR3 A;  2YWN A;  1UVZ A;  3ZVJ D;  3C1R A;  3LXT A;  2N5F A;  4KA0 A;  3F6D A;  1KBN A;  2H6Z A;  3HA9 A;  3FHK A;  5IPG A;  1GWC A;  4KSM A;  5ECM B;  2HRN A;  5CRH A;  3VPQ A;  2GST A;  4X0X A;  4IQ1 A;  2R2J A;  2YJ7 A;  2PER A;  3KH9 A;  5G2Z A;  3D22 A;  2DML A;  1K3O A;  4NWY A;  4MZC A;  4MF6 A;  1F37 A;  2GZZ A;  4G19 A;  3CTG A;  4OWY A;  4HJM A;  3ZIV A;  1SK1 A;  5D9X A;  2OE0 A;  3KMN A;  1JZO A;  1GTA A;  2L5O A;  3N9J A;  3S9F A;  3UEM A;  4ACS A;  3HY2 A;  4EUY A;  4ULX A;  2FCH A;  4TRX A;  3MWH A;  3FZ4 A;  1A8Y A;  3LXZ A;  1GL8 A;  2R5G A;  5KEJ A;  1TRU A;  2GVP A;  20GS A;  4V2M A;  3ME8 A;  5AGY A;  4GSN A;  2XBQ A;  1GTU A;  4LLR A;  1M2A A;  3ZTL A;  4WF5 A;  2BTO T;  1SKS B;  3L4N A;  4DSR A;  1U3I A;  1FAA A;  1PN9 A;  4K1F A;  5FT3 A;  2JZS A;  3GL5 A;  2I3Y A;  3RPN A;  3ZIT A;  4GTU A;  4XS4 B;  2LST A;  4EVM A;  1GSQ A;  2KLX A;  2HYX A;  3L78 A;  5ECI B;  1VRS D;  2G0F A;  2CAQ A;  1SKW B;  3GMF A;  1Z7P A;  3GH9 A;  1SKR B;  1F6M C;  2C0E A;  3LEF A;  1A24 A;  3FZ9 A;  1T00 A;  2C1Y A;  3VUR A;  1VF2 A;  3TGZ A;  3ZVJ A;  1XWB A;  1TRS A;  3ZIJ A;  4L8E A;  1G7O A;  4E8E A;  3GKK A;  3N5O A;  4POK A;  5DAK B;  3EE2 A;  4G9H A;  4LMW A;  3GST A;  5A5K A;  5J3R A;  2GQM A;  2P0G A;  2E2M A;  4OCF A;  4LL1 B;  3W6G A;  2IJY A;  4WXT A;  5GST A;  1X9M B;  2GTU A;  1PL1 A;  2IIY A;  3U5R E;  3FYG A;  1CQH A;  1VGL A;  4K9Z A;  4K7I A;  2CX4 A;  4XHM A;  1A2M A;  4GQF A;  4ECI A;  4TR0 A;  3C73 A;  1K0B A;  1JLW A;  4GQC A;  5H5Q A;  3TUE A;  5HFI A;  1G6Y A;  3O76 A;  1GRX A;  4WBJ A;  2P5R A;  3SWL A;  3HYP A;  4F0C A;  5H5R A;  5GSS A;  3MAK A;  2JZT A;  3FZ5 A;  1W89 A;  1ERT A;  2REM A;  4F0B A;  1TDI A;  3ZL5 A;  2AAW A;  4ID0 A;  4ECJ A;  4MJB A;  1EOH A;  2R4V A;  6GSV A;  3IPZ A;  2F8F A;  3EU4 A;  22GS A;  3VFI A;  5AIX A;  1V40 A;  2VL3 A;  1GUL A;  1SYX A;  2HZE B;  2MMN A;  4MZB A;  2CVD A;  3I43 A;  3V1W A;  3D5J A;  4ZB9 A;  5HQP A;  1R4W A;  3ED3 A;  5HR0 A;  2IN3 A;  4GLT A;  5IOW A;  1Z6M A;  3DKS A;  3GKM A;  3GHA A;  2H1D A;  1V98 A;  1O8W A;  1TK0 B;  3ZML A;  1A2J A;  4O32 A;  5GZZ B;  2LNT A;  3BCK A;  4I2T A;  1GNW A;  5IQY A;  5G1K A;  2H0H A;  4IEL A;  3TKP A;  3TJG A;  4CW9 A;  1BYE A;  4F03 A;  3TJB A;  2VM2 A;  5DAL B;  1VF1 A;  1WOU A;  2FUG 2;  3I6A A;  3K8N A;  4IJ3 A;  4EL1 A;  5AIV A;  4FYC A;  3E9J B;  3F9U A;  5D73 A;  1A2L A;  2PMT A;  2A2S A;  4XS1 A;  4N10 A;  1K0C A;  3ME7 A;  2D2Z A;  2H71 A;  4MP4 A;  3LG6 A;  3DXB A;  4BVY A;  4IHU A;  4PQI A;  1SU9 A;  2F9S A;  1QXH A;  1GUH A;  1FHE A;  4OFM A;  4HZ4 A;  2X8G A;  5HR3 A;  5B6M A;  4X43 A;  2H6Y A;  2VL9 A;  3CSJ A;  6GSY A;  4NPB A;  4MJA A;  3VK9 A;  1PQN A;  4XS6 A;  2YP6 A;  1BG5 A;  1YEX A;  2LQQ A;  4FH8 A;  3Q6O A;  3M9J A;  4BL7 A;  1EGO A;  3IK7 A;  5G31 A;  2O7K A;  5ECH B;  1WP0 A;  2O87 A;  4F9Z A;  3D21 A;  1KEB A;  5JCG A;  3EMP A;  2WFC A;  3P7X A;  2J9H A;  2MMO A;  3GUS A;  1OKD A;  2HT9 A;  2FLS A;  5ENU A;  2C3N A;  2PWJ A;  5IMF A;  1PX6 A;  3GRX A;  1AXD A;  3LWA A;  2AHE A;  4TR1 B;  2FWE A;  3WD6 A;  1SL0 B;  4YQV A;  1PKW A;  1G0T A;  1F9M A;  3LQ7 A;  5IMZ A;  1SYR A;  3RHC A;  2HI7 A;  3ZFB A;  1TP9 A;  1Z5Y E;  4TKY A;  4MJE A;  1JHB A;  4WEY A;  1GH2 A;  1THO A;  4NHW A;  3KMO A;  3QAW A;  2BMX A;  4DSS A;  9GSS A;  2F8A A;  3QAG A;  1QQ2 A;  2VCZ A;  1T3B A;  2H74 A;  3Q18 A;  2L6C A;  3GNJ A;  3ZMK A;  3DEX A;  2EIO A;  1QK8 A;  4TN8 A;  3HVV A;  3FKF A;  4L5L A;  5J41 A;  3H93 A;  2LKU A;  2FY6 A;  2IFQ A;  1E6B A;  1MTC A;  4V2L A;  4ZBA A;  2E7P A;  3J7Y b;  5ECO B;  1JZR A;  4IS0 A;  3C71 A;  1HNC A;  2A4V A;  4MH2 A;  1YDK A;  2CQ9 A;  1B4P A;  4OO4 A;  3RBT A;  3UVH A;  3F8U A;  1M9B A;  4WBR D;  3DVW A;  3GX0 A;  1AC1 A;  2JSZ A;  3E3E A;  5B7C A;  3ERG A;  1T1V A;  2DSA A;  3TRP A;  2VCX A;  3DIE A;  3F3Q A;  4WR5 A;  4RQR A;  2FWH A;  2H1G A;  2MZC A;  5KN1 A;  1OAZ A;  4V1A g;  5JCW A;  2GSR A;  3I69 A;  4V2N A;  1VF3 A;  5F0G A;  2R6K A;  4PQH A;  3FR9 A;  2X8C A;  1A0F A;  1J9B A;  2V41 A;  1UC7 A;  3QD9 A;  5GAN D;  4JRR A;  1PGT A;  2XPE A;  2NTO A;  1ML6 A;  4PUR A;  4JZQ A;  1SJZ A;  2CX3 A;  2HXK A;  3KZQ A;  4JR4 A;  2Z9S A;  6GSS A;  3GFK A;  1X5D A;  5DQY A;  1GTB A;  2C0G A;  1HQO A;  2E2G A;  3WGX A;  4O7H A;  3P8W A;  3VI5 A;  4IJI A;  1BQ7 A;  4K6X A;  2H0I A;  3L9U A;  1PKZ A;  1YF1 A;  1FW1 A;  3G9B A;  4MAB A;  2N5A A;  2N5B A;  1O7U A;  5CRE A;  2LNS A;  5IM9 A;  4AJ7 A;  5JWO B;  2FHE A;  4FIW A;  1EEM A;  3LOR A;  1QUW A;  2AJQ B;  4ZB8 A;  3TB2 A;  1K3Y A;  2O89 A;  4GCI A;  1A8L A;  3A2W A;  2XHF A;  2VCW A;  2YZU A;  4I97 A;  1N2A A;  1IYI A;  3QFA C;  2VL2 A;  3UAR A;  4LL4 B;  1ILO A;  1B9X C;  3RAZ A;  4MA9 A;  1GSD A;  2JU5 A;  1MD4 A;  2C3T A;  3J7Y k;  2FWG A;  2MBS A;  2CA8 A;  1OE7 A;  3U6V A;  1PMT A;  1BX9 A;  3TJK A;  1OC8 A;  4TXO A;  5ECP B;  4KCE A;  2LV3 A;  3KEB A;  1T4Y A;  2XC2 A;  2YV7 A;  5E59 A;  4HJ2 A;  1R7H A;  2IL3 A;  2MYG A;  5IPH A;  1K0N A;  4HDE A;  3HHV A;  2FGX A;  2L4C A;  3W8J A;  2V2G A;  3UIW A;  2YJH A;  3US3 A;  1GSS A;  3P90 A;  3WYW A;  2FNO A;  2LS5 A;  3A2V A;  3EWL A;  2HE3 A;  2QSI A;  3HJM A;  2TRX A;  4WR4 A;  4MCU A;  4KDY A;  4I6X A;  2CVB A;  3NZN A;  2CVK A;  2M80 A;  2GDR A;  3DYR A;  1O81 A;  4G2E A;  5A4U A;  3HJP A;  5AIS A;  3CXG A;  2H19 A;  19GS A;  2R37 A;  1XWA A;  3IXR A;  4LA1 A;  2RLI A;  3GSS A;  2GT5 A;  3QAV A;  2WB9 A;  4MZW A;  4PUA A;  1RK4 A;  2GQL A;  4K0N A;  1GLP A;  2L6D A;  1ZMA A;  5ELG A;  4K7N A;  3ERF A;  3M8N A;  2G2Q A;  2DLX A;  3C7M A;  2TRC P;  4JU5 A;  2FA8 A;  2LQO A;  1Z3E A;  2MMZ A;  4ILF A;  5ID2 B;  1AUC A;  4Z7X A;  13GS A;  2ES7 A;  4K8M A;  2YWO A;  2MBT A;  4HZ2 A;  1ZYQ B;  4HS1 A;  3HZ8 A;  4ZL7 A;  3P2A A;  3FW2 A;  4K2D A;  2DJ3 A;  3HJO A;  4GWR A;  4EC0 A;  1Q4J A;  5JCU A;  2DIY A;  1H4O A;  4JR6 A;  3F4S A;  1ERW A;  3ZRE A;  3LSZ A;  2EIQ A;  4JBB A;  2K18 A;  3CBU A;  4TOP A;  4CDO A;  2X99 A;  3QDN A;  4J57 E;  5J9B A;  4POL A;  3DGQ A;  2IMF A;  3GYK A;  1O6J A;  4D73 B;  2GS3 A;  3NIV A;  16GS A;  1NHO A;  2HNL A;  2YNX A;  4TXV A;  1XPV A;  2OAD A;  5F8B A;  4OCE A;  1WIK A;  4NV2 A;  1B4Q A;  1TOF A;  4K7O A;  4ZXG A;  2IFQ B;  5D96 A;  4FO5 A;  2CT6 A;  3H4K A;  1A0R P;  1TU7 A;  2H8L A;  2IMI A;  1ZGN A;  3EU3 A;  3TRQ A;  1PD2 1;  3WT1 A;  2B3S A;  4F2I A;  4L0U A;  4HU9 A;  5J5N A;  2VCV A;  3IBH A;  3MSZ A;  1OC9 A;  2WZ9 A;  2IMK A;  2ON7 A;  1YJ6 A;  1TTZ A;  1CQG A;  1XOA A;  1GSF A;  3UL3 A;  3O6T A;  2KP1 A;  3KH7 A;  1FB6 A;  4ISD A;  5ECN B;  3H79 A;  2FWF A;  3LFL A;  4ZBB A;  5DVB A;  2DC5 A;  3APO A;  4YQM A;  1DE1 A;  5A4W A;  4E8H A;  6GST A;  5DBQ A;  3KTL A;  1TI3 A;  3GUR A;  2I9H A;  4HUA A;  1O73 A;  4IBP A;  2KOK A;  4RQX A;  2WJU A;  5JWR B;  3C8E A;  1XVQ A;  2IWT A;  2J23 A;  3H1N A;  3QR6 A;  2H73 A;  4NAX A;  4KSO A;  3GKN A;  2QKE A;  1SL2 B;  1NM3 A;  2HSY A;  1M2D A;  4WKW A;  4HQZ A;  1TRV A;  10GS A;  2LRN A;  2YCD A;  3PGT A;  1WMJ A;  1ZCP A;  4MMM A;  1HNB A;  4L0W A;  5F06 A;  3GV1 A;  5B8B A;  4MLY A;  2GLR A;  4ZL8 A;  1FVJ A;  4FYB A;  4PNF A;  1K0A A;  1YF0 A;  1SD8 A;  4MH3 A;  1AIU A;  2NPB A;  4PUF C;  4BVX A;  3TKQ A;  4PQ1 A;  3CYN A;  3APS A;  1H75 A;  3L9V A;  5J9C A;  1WPI A;  3LYK A;  3CSI A;  3IRA A;  4OFN A;  5ECQ B;  5A4V A;  1MEK A;  1OC3 A;  2YWI A;  2ON5 A;  1O85 A;  2L59 A;  4HU7 A;  1XXU A;  5DJL A;  4OD7 A;  2NVL A;  1MDJ A;  2X64 A;  4J56 E;  5D9W A;  2HSH A;  4GXZ A;  4NMU A;  2LRT A;  4AJ6 A;  1PX7 A;  1USB A;  3VWX A;  4DEJ A;  1WRY A;  2B7K A;  4K0G A;  3VWV A;  2CZ3 A;  1RW1 A;  4KAE A;  4F82 A;  3Q74 A;  3KD0 A;  3ZRD A;  3DD3 A;  4KGI A;  4X1U A;  1QFN A;  4TXO B;  2MMA A;  3QOU A;  4OO5 A;  5CNW A;  3QCP A;  2IME A;  1IYH A;  2GT6 A;  2CV4 A;  4ZB6 A;  3VPT A;  1W4V A;  7GSS A;  2PPT A;  1T8E B;  3ZYW A;  2BJX A;  4BWS A;  5B8A A;  1X9S B;  1RQM A;  3Q19 A;  4IP6 A;  3O3T A;  1ZOF A;  5ELA A;  2H0G A;  1LJR A;  2EC4 A;  1M9A A;  1U3A A;  3F4R A;  3F4T A;  2VO4 A;  2RM6 A;  3M9K A;  3D4T A;  1WE0 A;  4EF0 A;  1KTE A;  4PX1 A;  1TXX A;  2H1A A;  3LYP A;  1I9D A;  2OAC A;  5IMV A;  4ML1 A;  1XWG A;  3HCZ A;  1FVK A;  4Q5R A;  2KHP A;  2PGT A;  1PL2 A;  1FO5 A;  2V1M A;  1BAY A;  3GN3 A;  2NDO A;  2PUK C;  3CTF A;  4AGS A;  2DMM A;  1HNA A;  1MDI A;  2B5Y A;  1BJX A;  1F3B A;  4IGJ A;  1WWJ A;  2HZE A;  4AF2 A;  4NHZ A;  5DJM A;  2VCQ A;  1YKC A;  3F0I A;  5ECK B;  1HD2 A;  4IP1 A;  3WGE A;  3TCO A;  2ZUP A;  5DDL A;  4MF7 A;  3LGC A;  2M46 A;  2GGT A;  1SK2 A;  1S3D A;  2O85 A;  3ZFL A;  5C00 A;  5HFK A;  3C1S A;  4BA7 A;  1GUK A;  1MD3 A;  3RDW A;  4XCS A;  1YY7 A;  5E4W A;  4RI6 A;  3BCI A;  3QFB C;  2GZP A;  2EIR A;  4YAV A;  1TRW A;  2PVQ A;  5DAL A;  1R5P A;  3EC3 A;  2C80 A;  2NBS A;  4EXJ A;  2CZ2 A;  1PA3 A;  4IN0 A;  1N8J A;  1PSQ A;  2YWM A;  1V2A A;  2YV9 A;  2VLU A;  2YAN A;  1XZO A;  1E2Y A;  2WS2 A;  2JZR A;  2V6O A;  4EE0 A;  4KE3 A;  3VI7 A;  1BED A;  2YN1 A;  18GS A;  4QQ7 A;  1HYU A;  4MPG A;  1FB0 A;  1EV9 A;  3M1G A;  1K0O A;  1ERU A;  2DJ0 A;  2B1K A;  1J0F A;  2VL2 C;  4V1A p;  1M0U A;  2TIR A;  3ZLP A;  3ERW A;  2GZY A;  3L9S A;  1EP8 A;  1GNE A;  3KM6 A;  2LJK A;  1OYJ A;  3F63 A;  3KJY A;  4EDZ A;  1O8X A;  1T4Z A;  1XBS A;  2I1U A;  1A23 A;  1JZD A;  1XW9 A;  3PR8 A;  1DBY A;  1ON4 A;  2JAD A;  3IAS 2;  1LBK A;  5CYY A;  1X5C A;  1QGV A;  3R2Q A;  4HI7 A; 
#chains in the Genus database with same CATH topology
 2AYT A;  2GQK A;  2P31 A;  1XOB A;  4MK3 A;  2JSY A;  1Q98 A;  1YQ1 A;  3IC8 A;  4EO3 A;  5J4U A;  1SL1 B;  1GTI A;  1AAZ A;  4WET A;  3TOT A;  1NHY A;  3KXO A;  1QMV A;  3BBY A;  2K6V A;  2C8U A;  3F3R A;  4XIH A;  4TR1 A;  1PN0 A;  3UBL A;  1ST9 A;  3ISO A;  3IA1 A;  1NW2 A;  3IE3 A;  1VF4 A;  1EGR A;  1JZW A;  3GTU A;  2AV4 A;  1UA5 A;  4KDU A;  4O92 A;  3UOM A;  3FZA A;  3BOA A;  2FD3 A;  4MF5 A;  4ML6 A;  1X0R A;  2AUV A;  3UAP A;  1FOV A;  3KP9 A;  2H1B A;  1V57 A;  4ZIJ A;  1K0D A;  3L0H A;  5DCH A;  3IHQ A;  2VM1 A;  1PRX A;  2VD1 A;  4BVY B;  3UJ1 A;  2E0Q A;  4ECB A;  4GF0 A;  3HDC A;  3TKR A;  5IOX A;  3GH6 A;  5D93 A;  1XFL A;  1ZYE A;  2HFD A;  1XWK A;  1ZL9 A;  5KN2 A;  3D6I A;  1TU8 A;  5EVO A;  1TI1 A;  5B6N A;  2H76 A;  3VLN A;  4N0V A;  2GSS A;  1YZX A;  2H6X A;  2B5E A;  4IQA A;  4P3Y B;  2OE3 A;  1THX A;  5D9T A;  1M3J A;  3G7I A;  4QL9 A;  3EPT A;  1GP1 A;  3PH9 A;  2H01 A;  4BL7 B;  2H66 A;  3HZ4 A;  4J2F A;  4MPF A;  3F6F A;  1OKT A;  2OJL A;  5ECL B;  3AY8 A;  3M0F A;  1TJD A;  4KX4 A;  5EY6 A;  3GA4 A;  2HZF A;  2IMD A;  3A5W A;  4ZL9 A;  4NV5 A;  1KNG A;  1WJK A;  1U88 A;  3A3T A;  2DBC A;  1G6W A;  1GSY A;  4I5Q A;  1SK0 A;  3TJJ A;  4KB3 A;  3D0Z A;  5IIZ A;  1J08 A;  4H86 A;  2RII A;  4CHS A;  1UN2 A;  2PU9 C;  6GSW A;  1XVW A;  1MDK A;  2VLT A;  3VWU A;  3IK9 A;  3EUR A;  5KN0 A;  4DSS B;  4YQU A;  1M99 A;  2I4A A;  5JWQ B;  2OBK A;  3TKS C;  4G10 A;  3WGD A;  2F3M A;  4HOJ A;  1K3L A;  5HFG A;  3TKS A;  5FWG A;  2K9F A;  1LU4 A;  1FG4 A;  2PN8 A;  2OA7 A;  3R3E A;  4JED A;  4Q5Q A;  3GX8 A;  2H70 A;  1Y25 A;  3A5I A;  5CO3 A;  1AW9 A;  1EOG A;  2B1L A;  2X49 A;  2DJJ A;  2HSM A;  1M7T A;  3DVX A;  1NSW A;  2B6M A;  3MNG A;  5F07 A;  3GL3 A;  1SJ6 A;  5D9V A;  1SEN A;  2PVO C;  4TW5 A;  1XW5 A;  2VOC A;  2WUL A;  5ABR A;  1ABA A;  3TKS E;  3FRC A;  3DWV A;  5G1L A;  5INY A;  3EIN A;  2H30 A;  2VIM A;  1XWC A;  6GSU A;  3FR6 A;  4A5P A;  1S3C A;  2AB6 A;  3ZZX A;  1S3A A;  2KP2 A;  4ICY A;  3IDV A;  4DSQ A;  1EZK A;  5ECS A;  5EL8 A;  2XPD A;  2ALB A;  4I2U A;  5HR2 A;  4TVE A;  1YEP A;  2B5X A;  4PNG A;  3TDG A;  1YKA A;  3KCM A;  5HR1 A;  1OE8 A;  5ECR B;  1URM A;  3SBC A;  2RM5 A;  2ZCT A;  4NXI A;  1M2B A;  3RPP A;  5IMA A;  1R5A A;  4HQS A;  4YKG A;  1V58 A;  3I9V 2;  2HRF A;  5DCG A;  4EKZ A;  3CRU A;  3QPM A;  2V32 A;  4MDC A;  1Z7R A;  3TJF A;  2DKI A;  1AQX A;  3G7J A;  4DVC A;  2C4J A;  1OVN A;  1K0M A;  2QC7 A;  4HEA 2;  1F3A A;  1B9Y C;  14GS A;  1B48 A;  2I81 A;  5COH A;  3FY7 A;  3CQF A;  3IOS A;  1XCC A;  3FEU A;  2HLS A;  3MDK A;  5LCZ A;  3BD2 A;  1X5E A;  5F05 A;  5AN1 A;  5CAX A;  4KDX A;  2FA4 A;  3HVN A;  5IMC A;  2VUP A;  3LJR A;  3EVI A;  2LUS A;  12GS A;  2H72 A;  5EPF A;  3TRX A;  1DSB A;  1GSU A;  4XS4 A;  4POB A;  2L5L A;  3FR3 A;  5D8I A;  3KTB A;  3UMA A;  2ZNM A;  1ERV A;  1GSE A;  3CMI A;  1EP7 A;  1X9W B;  3G7Y A;  4O5R A;  4TR4 A;  1R26 A;  4N30 A;  4LMV A;  2L57 A;  1I5G A;  1EEJ A;  3HD5 A;  3CSH A;  2CAI A;  2IPA A;  3IV4 A;  4IW9 A;  4WF4 A;  2RUE A;  3UBK A;  2JL4 A;  8GSS A;  2KUC A;  2LJR A;  5ID2 A;  17GS A;  3IR4 A;  4RI7 A;  2WRT A;  5DAK A;  3DRN A;  3KGK A;  2V6K A;  5CRG A;  1C72 A;  4Q5F A;  3GTU B;  3GKX A;  2WCI A;  1T7P B;  2PBJ A;  2XBI A;  2C3Q A;  1AQW A;  3HVS A;  3PIN A;  4D73 A;  4BWQ A;  2H75 A;  3GIX A;  4YAP A;  2GSQ A;  3FK8 A;  2P5Q A;  2WGR A;  2K8V A;  2YOI A;  1TK5 B;  11GS A;  4MJC A;  2WDU A;  4XRA A;  3JCM L;  4OMV A;  3HKR A;  1EWX A;  3W8S A;  2DJK A;  5H5S A;  5G5E A;  2LEG A;  1B8X A;  5CRD A;  3RHB A;  5G5F A;  4KND A;  3D4M A;  4KCA A;  1EV4 A;  2K8S A;  6GSX A;  2LTK A;  4XTS A;  1JFU A;  4I8B A;  3KIJ A;  2M72 A;  4ZIL A;  1JLV A;  2VAF A;  5CRW A;  3APQ A;  2VLV A;  5L71 A;  2B7J A;  3IAM 2;  3M3M A;  4KW6 A;  1U87 A;  4GRF A;  4ZBD A;  1F2E A;  4OFT A;  1Z9H A;  1ZZY A;  4GST A;  1GLQ A;  3UVT A;  4N11 A;  2C0D A;  4POM A;  3OR5 A;  4Q5N A;  5C04 A;  3EYT A;  5IMD A;  4IKH A;  4AJ8 A;  1DE2 A;  5IO2 A;  3E0U A;  4KUN A;  4IVF A;  1TKD B;  2X8H A;  2QGV A;  3DML A;  4FYU A;  3EMX A;  2OE1 A;  2DJ1 A;  2YZH A;  3HVX A;  1Z6N A;  1SD9 A;  4JE1 A;  2R3X A;  2A2R A;  5KN3 A;  2L4Q A;  4FQU A;  1TK8 B;  5G30 A;  3IC4 A;  1U6T A;  5FHI A;  1ACV A;  5LNK e;  4RUV A;  2F51 A;  3TOU A;  2VCT A;  5CP1 A;  4YH2 A;  2LRC A;  4L5O A;  2O8V B;  3WT2 A;  3CRT A;  4BPY A;  3VWW A;  4Z2T A;  2C0F A;  3KP8 A;  2DJ2 A;  5LD0 A;  2DIZ A;  4PGT A;  1GUM A;  2OBI A;  3A2X A;  5GAP D;  2JAC A;  5IO0 A;  4QL7 A;  4YKF A;  2LJA A;  1OC9 B;  1XIY A;  4KH7 A;  4ECC A;  2YPM A;  4EDY A;  3BJ5 A;  2OKA A;  3HXS A;  3H8Q A;  3IHG A;  1Y6E A;  2RUF A;  1G7E A;  4PXO A;  1XW6 A;  1SJI A;  4N0Z A;  3NOF A;  4USS A;  4XRD A;  1TW9 A;  1V9W A;  3QMX A;  4GSS A;  2VD0 A;  5DQS A;  1DUG A;  1AQV A;  4TR3 A;  2YWN A;  1UVZ A;  3ZVJ D;  3C1R A;  3LXT A;  4Z2U A;  2N5F A;  4KA0 A;  3F6D A;  1KBN A;  2H6Z A;  3HA9 A;  3FHK A;  5IPG A;  1GWC A;  4KSM A;  5ECM B;  2HRN A;  5CRH A;  1XG8 A;  3VPQ A;  2GST A;  4X0X A;  4IQ1 A;  2R2J A;  2YJ7 A;  2PER A;  3KH9 A;  5G2Z A;  3D22 A;  2HRA A;  2DML A;  4KF9 A;  1K3O A;  4NWY A;  4MZC A;  4MF6 A;  1F37 A;  2GZZ A;  4G19 A;  3CTG A;  4OWY A;  4HJM A;  3ZIV A;  1SK1 A;  5D9X A;  2OE0 A;  3KMN A;  1JZO A;  1GTA A;  2L5O A;  3N9J A;  3S9F A;  3UEM A;  4BVX B;  4ACS A;  3HY2 A;  4EUY A;  4ULX A;  2FCH A;  4TRX A;  3MWH A;  3FZ4 A;  4MNN A;  1A8Y A;  3LXZ A;  1GL8 A;  2R5G A;  5KEJ A;  1TRU A;  2GVP A;  20GS A;  4V2M A;  3ME8 A;  5AGY A;  4GSN A;  2XBQ A;  1GTU A;  4LLR A;  1M2A A;  3ZTL A;  4WF5 A;  2BTO T;  1SKS B;  3L4N A;  4DSR A;  1U3I A;  1FAA A;  1PN9 A;  4K1F A;  5FT3 A;  2JZS A;  3GL5 A;  3PPU A;  2I3Y A;  3RPN A;  3ZIT A;  4GTU A;  4XS4 B;  2LST A;  4EVM A;  1GSQ A;  2KLX A;  2HYX A;  3L78 A;  5ECI B;  1VRS D;  2G0F A;  2CAQ A;  1SKW B;  3GMF A;  1Z7P A;  3GH9 A;  1SKR B;  1F6M C;  2C0E A;  3LEF A;  1A24 A;  3FZ9 A;  1T00 A;  2C1Y A;  3VUR A;  4K2X A;  1VF2 A;  3TGZ A;  3ZVJ A;  1XWB A;  4EIP A;  1TRS A;  3ZIJ A;  4L8E A;  1G7O A;  4E8E A;  3GKK A;  3N5O A;  4POK A;  5DAK B;  3EE2 A;  4G9H A;  4LMW A;  3GST A;  5A5K A;  5J3R A;  2GQM A;  2P0G A;  2E2M A;  4OCF A;  4LL1 B;  3W6G A;  2IJY A;  4WXT A;  5GST A;  1X9M B;  2GTU A;  1PL1 A;  2IIY A;  3U5R E;  3FYG A;  1CQH A;  1VGL A;  4K9Z A;  4K7I A;  2CX4 A;  4XHM A;  1A2M A;  4GQF A;  4ECI A;  4TR0 A;  3C73 A;  1K0B A;  1JLW A;  4GQC A;  5H5Q A;  3TUE A;  5HFI A;  1G6Y A;  3O76 A;  1GRX A;  4WBJ A;  1FOH A;  2P5R A;  3SWL A;  3HYP A;  4F0C A;  5H5R A;  5GSS A;  3MAK A;  2JZT A;  3FZ5 A;  4O5Q A;  1W89 A;  1ERT A;  2REM A;  4F0B A;  1TDI A;  3ZL5 A;  2AAW A;  4ID0 A;  4ECJ A;  4MJB A;  1EOH A;  2R4V A;  6GSV A;  3IPZ A;  2F8F A;  3EU4 A;  22GS A;  3VFI A;  5AIX A;  1V40 A;  2VL3 A;  1GUL A;  1SYX A;  2HZE B;  2MMN A;  4MZB A;  2CVD A;  3I43 A;  3V1W A;  3D5J A;  4ZB9 A;  5HQP A;  1R4W A;  3ED3 A;  5HR0 A;  2IN3 A;  4GLT A;  5IOW A;  1Z6M A;  3DKS A;  3GKM A;  3GHA A;  2H1D A;  1V98 A;  1O8W A;  1TK0 B;  3ZML A;  1A2J A;  4O32 A;  5GZZ B;  2LNT A;  3BCK A;  4I2T A;  1GNW A;  1S3R A;  2A2P A;  5IQY A;  5G1K A;  2H0H A;  4IEL A;  3TKP A;  3TJG A;  4CW9 A;  1BYE A;  4F03 A;  1PFO A;  3TJB A;  2VM2 A;  1VF1 A;  5DAL B;  1WOU A;  2FUG 2;  3I6A A;  3K8N A;  4IJ3 A;  4EL1 A;  2R0P A;  5AIV A;  4FYC A;  3E9J B;  3F9U A;  5D73 A;  1A2L A;  2PMT A;  2A2S A;  4XS1 A;  4N10 A;  1K0C A;  3ME7 A;  2D2Z A;  2H71 A;  5BRT A;  4MP4 A;  3LG6 A;  3DXB A;  4BVY A;  4IHU A;  4PQI A;  1SU9 A;  2F9S A;  1QXH A;  1GUH A;  1FHE A;  4OFM A;  4HZ4 A;  2X8G A;  5HR3 A;  5B6M A;  4X43 A;  2H6Y A;  2VL9 A;  3CSJ A;  6GSY A;  4NPB A;  4MJA A;  3VK9 A;  1PQN A;  4XS6 A;  2YP6 A;  1BG5 A;  1YEX A;  2LQQ A;  4FH8 A;  3Q6O A;  3M9J A;  4BL7 A;  1EGO A;  5KOW A;  3IK7 A;  5G31 A;  2O7K A;  5ECH B;  1WP0 A;  2O87 A;  4F9Z A;  3D21 A;  1KEB A;  5JCG A;  3EMP A;  2WFC A;  3P7X A;  2J9H A;  2MMO A;  3GUS A;  1OKD A;  2HT9 A;  2FLS A;  5ENU A;  2C3N A;  2PWJ A;  5IMF A;  1PX6 A;  3GRX A;  1AXD A;  3LWA A;  3MYD A;  2AHE A;  4TR1 B;  2FWE A;  3WD6 A;  1SL0 B;  3FMW A;  4YQV A;  1PKW A;  1G0T A;  1F9M A;  3LQ7 A;  5IMZ A;  1SYR A;  3RHC A;  2HI7 A;  3ZFB A;  1TP9 A;  1Z5Y E;  4TKY A;  4MJE A;  1JHB A;  4WEY A;  1GH2 A;  1THO A;  4NHW A;  3KMO A;  3QAW A;  2BMX A;  4DSS A;  9GSS A;  2F8A A;  3QAG A;  1QQ2 A;  2VCZ A;  1T3B A;  2H74 A;  3Q18 A;  2L6C A;  3GNJ A;  3ZMK A;  3DEX A;  2EIO A;  1QK8 A;  4TN8 A;  3HVV A;  3FKF A;  4L5L A;  5J41 A;  3H93 A;  2LKU A;  2FY6 A;  2IFQ A;  1E6B A;  1MTC A;  4V2L A;  1M3I A;  4ZBA A;  2E7P A;  3J7Y b;  5ECO B;  1JZR A;  4IS0 A;  3C71 A;  1HNC A;  4EIQ A;  2A4V A;  4MH2 A;  1YDK A;  2CQ9 A;  1B4P A;  4OO4 A;  3RBT A;  3UVH A;  3F8U A;  1M9B A;  4WBR D;  3DVW A;  3GX0 A;  1AC1 A;  2JSZ A;  3E3E A;  5B7C A;  3ERG A;  1T1V A;  4CY8 A;  2DSA A;  3TRP A;  2VCX A;  3DIE A;  3F3Q A;  4WR5 A;  4RQR A;  2FWH A;  2H1G A;  2MZC A;  5KN1 A;  1OAZ A;  4V1A g;  5JCW A;  2GSR A;  3I69 A;  4V2N A;  1VF3 A;  5F0G A;  2R6K A;  4PQH A;  3FR9 A;  2X8C A;  1A0F A;  1J9B A;  2V41 A;  1UC7 A;  3QD9 A;  5GAN D;  4JRR A;  1PGT A;  2XPE A;  2NTO A;  1ML6 A;  4PUR A;  4JZQ A;  1SJZ A;  2CX3 A;  2HXK A;  3KZQ A;  4JR4 A;  2Z9S A;  3MIX A;  6GSS A;  3GFK A;  1X5D A;  5DQY A;  1GTB A;  2C0G A;  1HQO A;  2E2G A;  3WGX A;  4O7H A;  3P8W A;  3VI5 A;  4IJI A;  1BQ7 A;  4K6X A;  2H0I A;  3L9U A;  1PKZ A;  1YF1 A;  1FW1 A;  3G9B A;  4MAB A;  2N5A A;  2N5B A;  1O7U A;  5CRE A;  2LNS A;  5IM9 A;  4AJ7 A;  5JWO B;  2FHE A;  4FIW A;  1EEM A;  3LOR A;  1QUW A;  2AJQ B;  4ZB8 A;  3TB2 A;  1K3Y A;  2O89 A;  4GCI A;  1A8L A;  3A2W A;  2XHF A;  2VCW A;  2YZU A;  4I97 A;  1N2A A;  1IYI A;  2R0G A;  3QFA C;  2VL2 A;  3UAR A;  4LL4 B;  1ILO A;  1B9X C;  3RAZ A;  4MA9 A;  1GSD A;  2JU5 A;  1MD4 A;  4BIK A;  2C3T A;  3J7Y k;  2FWG A;  2MBS A;  2CA8 A;  1OE7 A;  3U6V A;  1PMT A;  1BX9 A;  3TJK A;  1OC8 A;  4TXO A;  5ECP B;  4KCE A;  2LV3 A;  3KEB A;  1T4Y A;  2XC2 A;  2YV7 A;  5E59 A;  5KOX A;  4HJ2 A;  1R7H A;  2IL3 A;  2A4H A;  2MYG A;  5IPH A;  1K0N A;  4HDE A;  3HHV A;  2FGX A;  2L4C A;  3W8J A;  2V2G A;  3UIW A;  2YJH A;  3US3 A;  1GSS A;  3P90 A;  3WYW A;  2FNO A;  2LS5 A;  3A2V A;  3EWL A;  2HE3 A;  2QSI A;  3HJM A;  2TRX A;  4WR4 A;  4MCU A;  4KDY A;  4I6X A;  2CVB A;  3NZN A;  2CVK A;  2M80 A;  2GDR A;  3DYR A;  1O81 A;  4G2E A;  5A4U A;  3HJP A;  5AIS A;  3CXG A;  2H19 A;  19GS A;  2R37 A;  1XWA A;  3IXR A;  4LA1 A;  2RLI A;  3GSS A;  2GT5 A;  3QAV A;  2WB9 A;  4MZW A;  4PUA A;  1RK4 A;  4K5R A;  2GQL A;  4K0N A;  1GLP A;  2L6D A;  1ZMA A;  5ELG A;  4K7N A;  3ERF A;  3M8N A;  2G2Q A;  2DLX A;  3C7M A;  2TRC P;  4JU5 A;  2FA8 A;  2LQO A;  1Z3E A;  2MMZ A;  4ILF A;  5ID2 B;  1AUC A;  4Z7X A;  13GS A;  2ES7 A;  4K8M A;  2YWO A;  2MBT A;  4HZ2 A;  1ZYQ B;  4HS1 A;  3HZ8 A;  4ZL7 A;  3P2A A;  3FW2 A;  4K2D A;  2DJ3 A;  3HJO A;  4GWR A;  4EC0 A;  1Q4J A;  5JCU A;  2DIY A;  1H4O A;  4JR6 A;  3F4S A;  1ERW A;  3ZRE A;  3LSZ A;  2EIQ A;  4JBB A;  4Z2R A;  2K18 A;  3CBU A;  4TOP A;  4CDO A;  2X99 A;  3QDN A;  4J57 E;  5J9B A;  4POL A;  3DGQ A;  2IMF A;  3GYK A;  1O6J A;  4D73 B;  2GS3 A;  3NIV A;  16GS A;  1NHO A;  2HNL A;  2YNX A;  4TXV A;  1XPV A;  2OAD A;  5F8B A;  4OCE A;  1WIK A;  4NV2 A;  4G0L A;  1B4Q A;  1TOF A;  4O5U A;  4K7O A;  4ZXG A;  2IFQ B;  5D96 A;  4FO5 A;  2CT6 A;  3H4K A;  1A0R P;  1TU7 A;  2H8L A;  2IMI A;  1ZGN A;  3EU3 A;  3TRQ A;  1PD2 1;  3WT1 A;  2B3S A;  4F2I A;  4L0U A;  4HU9 A;  5J5N A;  2VCV A;  3IBH A;  3MSZ A;  1OC9 A;  2WZ9 A;  2IMK A;  2ON7 A;  1YJ6 A;  1TTZ A;  1CQG A;  4CY6 A;  1XOA A;  1GSF A;  3UL3 A;  3O6T A;  2KP1 A;  3KH7 A;  1FB6 A;  4ISD A;  5ECN B;  3H79 A;  2FWF A;  3LFL A;  4ZBB A;  5DVB A;  4X4J A;  2DC5 A;  3APO A;  4YQM A;  1DE1 A;  5A4W A;  4E8H A;  6GST A;  5DBQ A;  3KTL A;  1TI3 A;  3GUR A;  2I9H A;  4HUA A;  1O73 A;  4IBP A;  2KOK A;  4RQX A;  2WJU A;  5JWR B;  3C8E A;  1XVQ A;  2IWT A;  2J23 A;  3H1N A;  3QR6 A;  2H73 A;  4NAX A;  4KSO A;  3GKN A;  2QKE A;  2QA1 A;  1SL2 B;  1NM3 A;  2HSY A;  1M2D A;  4WKW A;  4HQZ A;  1TRV A;  10GS A;  2LRN A;  2YCD A;  3PGT A;  1WMJ A;  1ZCP A;  4MMM A;  4G0K A;  1HNB A;  4L0W A;  5F06 A;  3GV1 A;  5B8B A;  4MLY A;  2GLR A;  4ZL8 A;  1FVJ A;  4FYB A;  4PNF A;  1K0A A;  1YF0 A;  1SD8 A;  4MH3 A;  1AIU A;  2NPB A;  4PUF C;  4BVX A;  3TKQ A;  4PQ1 A;  3CYN A;  3APS A;  1H75 A;  3L9V A;  5J9C A;  1WPI A;  3LYK A;  3CSI A;  3IRA A;  4OFN A;  5ECQ B;  5A4V A;  1MEK A;  1OC3 A;  2YWI A;  2ON5 A;  1O85 A;  2L59 A;  4HU7 A;  1XXU A;  5DJL A;  4OD7 A;  2NVL A;  1MDJ A;  2X64 A;  4J56 E;  5D9W A;  2HSH A;  4GXZ A;  4NMU A;  2LRT A;  4AJ6 A;  1PX7 A;  1USB A;  3VWX A;  4DEJ A;  1WRY A;  2B7K A;  4K0G A;  3VWV A;  2CZ3 A;  1RW1 A;  4KAE A;  4HSC X;  4F82 A;  3Q74 A;  3KD0 A;  2DKH A;  3ZRD A;  3DD3 A;  4KGI A;  4X1U A;  1QFN A;  4TXO B;  2MMA A;  3QOU A;  4OO5 A;  5CNW A;  3QCP A;  2IME A;  1IYH A;  2GT6 A;  2CV4 A;  4ZB6 A;  3VPT A;  1W4V A;  4G0I A;  4PTS A;  7GSS A;  1ZYN A;  2PPT A;  1T8E B;  3ZYW A;  2BJX A;  4BWS A;  5B8A A;  1X9S B;  1RQM A;  3Q19 A;  4IP6 A;  3O3T A;  1ZOF A;  5ELA A;  2H0G A;  1LJR A;  2EC4 A;  1M9A A;  1U3A A;  3F4R A;  3F4T A;  2VO4 A;  2RM6 A;  3M9K A;  3D4T A;  1WE0 A;  4EF0 A;  1KTE A;  4PX1 A;  1TXX A;  2H1A A;  2HRK A;  3LYP A;  1I9D A;  2OAC A;  5IMV A;  4ML1 A;  2QA2 A;  1XWG A;  3HCZ A;  1FVK A;  4Q5R A;  2KHP A;  2PGT A;  1PL2 A;  1FO5 A;  2V1M A;  1BAY A;  4K5S A;  3GN3 A;  2NDO A;  2PUK C;  3CTF A;  4AGS A;  2DMM A;  1HNA A;  1MDI A;  3LW9 A;  2B5Y A;  1BJX A;  1F3B A;  2UZ8 A;  4IGJ A;  1WWJ A;  2HZE A;  4AF2 A;  4NHZ A;  5DJM A;  2VCQ A;  1YKC A;  3F0I A;  5ECK B;  1HD2 A;  4IP1 A;  3WGE A;  3TCO A;  2ZUP A;  5DDL A;  4MF7 A;  3LGC A;  2M46 A;  2GGT A;  1SK2 A;  1S3D A;  2O85 A;  3ZFL A;  5C00 A;  5HFK A;  3C1S A;  4BA7 A;  1GUK A;  1MD3 A;  3RDW A;  4XCS A;  1YY7 A;  2X4A A;  5E4W A;  4RI6 A;  3BCI A;  3QFB C;  2GZP A;  5BMU A;  2EIR A;  4YAV A;  1TRW A;  2PVQ A;  5DAL A;  1R5P A;  3EC3 A;  2C80 A;  2NBS A;  4EXJ A;  2CZ2 A;  1PA3 A;  4IN0 A;  1N8J A;  1PSQ A;  2YWM A;  1V2A A;  2YV9 A;  2VLU A;  2YAN A;  1XZO A;  1E2Y A;  2WS2 A;  2JZR A;  2V6O A;  4EE0 A;  4KE3 A;  3VI7 A;  1BED A;  2YN1 A;  18GS A;  4QQ7 A;  1HYU A;  4MPG A;  1FB0 A;  1EV9 A;  3M1G A;  1K0O A;  1ERU A;  2DJ0 A;  2B1K A;  1J0F A;  2VL2 C;  4V1A p;  1M0U A;  2TIR A;  3ZLP A;  3ERW A;  2GZY A;  3L9S A;  1EP8 A;  1GNE A;  3KM6 A;  2LJK A;  1OYJ A;  3F63 A;  3KJY A;  1ZYP A;  4EDZ A;  1O8X A;  1T4Z A;  1XBS A;  2I1U A;  1A23 A;  1JZD A;  1XW9 A;  3PR8 A;  1DBY A;  1ON4 A;  2JAD A;  3IAS 2;  1LBK A;  2R0C A;  5CYY A;  1X5C A;  1QGV A;  3R2Q A;  4HI7 A; 
#chains in the Genus database with same CATH homology
 2AYT A;  2GQK A;  2P31 A;  1XOB A;  4MK3 A;  2JSY A;  1Q98 A;  1YQ1 A;  3IC8 A;  4EO3 A;  5J4U A;  1SL1 B;  1GTI A;  1AAZ A;  4WET A;  3TOT A;  1NHY A;  3KXO A;  1QMV A;  3BBY A;  2K6V A;  2C8U A;  3F3R A;  4XIH A;  4TR1 A;  1PN0 A;  3UBL A;  1ST9 A;  3ISO A;  3IA1 A;  1NW2 A;  3IE3 A;  1VF4 A;  1EGR A;  1JZW A;  3GTU A;  2AV4 A;  1UA5 A;  4KDU A;  4O92 A;  3UOM A;  3FZA A;  3BOA A;  2FD3 A;  4MF5 A;  4ML6 A;  1X0R A;  2AUV A;  3UAP A;  1FOV A;  3KP9 A;  2H1B A;  1V57 A;  4ZIJ A;  1K0D A;  3L0H A;  5DCH A;  3IHQ A;  2VM1 A;  1PRX A;  2VD1 A;  4BVY B;  3UJ1 A;  2E0Q A;  4ECB A;  4GF0 A;  3HDC A;  3TKR A;  5IOX A;  3GH6 A;  5D93 A;  1XFL A;  1ZYE A;  2HFD A;  1XWK A;  1ZL9 A;  5KN2 A;  3D6I A;  1TU8 A;  5EVO A;  1TI1 A;  5B6N A;  2H76 A;  3VLN A;  4N0V A;  2GSS A;  1YZX A;  2H6X A;  2B5E A;  4IQA A;  4P3Y B;  2OE3 A;  1THX A;  5D9T A;  3G7I A;  4QL9 A;  3EPT A;  1GP1 A;  3PH9 A;  2H01 A;  4BL7 B;  2H66 A;  3HZ4 A;  4J2F A;  4MPF A;  3F6F A;  1OKT A;  2OJL A;  5ECL B;  3AY8 A;  3M0F A;  1TJD A;  4KX4 A;  5EY6 A;  3GA4 A;  2HZF A;  2IMD A;  3A5W A;  4ZL9 A;  4NV5 A;  1KNG A;  1WJK A;  1U88 A;  3A3T A;  2DBC A;  1G6W A;  1GSY A;  4I5Q A;  1SK0 A;  3TJJ A;  4KB3 A;  3D0Z A;  5IIZ A;  1J08 A;  4H86 A;  2RII A;  4CHS A;  1UN2 A;  2PU9 C;  6GSW A;  1XVW A;  1MDK A;  2VLT A;  3VWU A;  3IK9 A;  3EUR A;  5KN0 A;  4DSS B;  4YQU A;  1M99 A;  2I4A A;  5JWQ B;  2OBK A;  3TKS C;  4G10 A;  3WGD A;  2F3M A;  4HOJ A;  1K3L A;  5HFG A;  3TKS A;  5FWG A;  2K9F A;  1LU4 A;  1FG4 A;  2PN8 A;  2OA7 A;  3R3E A;  4JED A;  4Q5Q A;  3GX8 A;  2H70 A;  1Y25 A;  3A5I A;  5CO3 A;  1AW9 A;  1EOG A;  2B1L A;  2X49 A;  2DJJ A;  2HSM A;  1M7T A;  3DVX A;  1NSW A;  2B6M A;  3MNG A;  5F07 A;  3GL3 A;  1SJ6 A;  5D9V A;  1SEN A;  2PVO C;  4TW5 A;  1XW5 A;  2VOC A;  2WUL A;  5ABR A;  1ABA A;  3TKS E;  3FRC A;  3DWV A;  5G1L A;  5INY A;  3EIN A;  2H30 A;  2VIM A;  1XWC A;  6GSU A;  3FR6 A;  4A5P A;  1S3C A;  2AB6 A;  3ZZX A;  1S3A A;  2KP2 A;  4ICY A;  3IDV A;  4DSQ A;  1EZK A;  5ECS A;  5EL8 A;  2XPD A;  2ALB A;  4I2U A;  5HR2 A;  4TVE A;  1YEP A;  2B5X A;  4PNG A;  3TDG A;  1YKA A;  3KCM A;  5HR1 A;  1OE8 A;  5ECR B;  1URM A;  3SBC A;  2RM5 A;  2ZCT A;  4NXI A;  1M2B A;  3RPP A;  5IMA A;  1R5A A;  4HQS A;  4YKG A;  1V58 A;  3I9V 2;  2HRF A;  5DCG A;  4EKZ A;  3CRU A;  3QPM A;  2V32 A;  4MDC A;  1Z7R A;  3TJF A;  2DKI A;  1AQX A;  3G7J A;  4DVC A;  2C4J A;  1OVN A;  1K0M A;  2QC7 A;  4HEA 2;  1F3A A;  1B9Y C;  14GS A;  1B48 A;  2I81 A;  5COH A;  3FY7 A;  3IOS A;  1XCC A;  3FEU A;  2HLS A;  3MDK A;  5LCZ A;  3BD2 A;  1X5E A;  5F05 A;  5AN1 A;  5CAX A;  4KDX A;  2FA4 A;  5IMC A;  2VUP A;  3LJR A;  3EVI A;  2LUS A;  12GS A;  2H72 A;  5EPF A;  3TRX A;  1DSB A;  1GSU A;  4XS4 A;  4POB A;  2L5L A;  3FR3 A;  5D8I A;  3KTB A;  3UMA A;  2ZNM A;  1ERV A;  1GSE A;  3CMI A;  1EP7 A;  1X9W B;  3G7Y A;  4O5R A;  4TR4 A;  1R26 A;  4N30 A;  4LMV A;  2L57 A;  1I5G A;  1EEJ A;  3HD5 A;  3CSH A;  2CAI A;  2IPA A;  3IV4 A;  4IW9 A;  4WF4 A;  2RUE A;  3UBK A;  2JL4 A;  8GSS A;  2KUC A;  2LJR A;  5ID2 A;  17GS A;  3IR4 A;  4RI7 A;  2WRT A;  5DAK A;  3DRN A;  3KGK A;  2V6K A;  5CRG A;  1C72 A;  4Q5F A;  3GTU B;  3GKX A;  2WCI A;  1T7P B;  2PBJ A;  2XBI A;  2C3Q A;  1AQW A;  3HVS A;  3PIN A;  4D73 A;  4BWQ A;  2H75 A;  3GIX A;  4YAP A;  2GSQ A;  3FK8 A;  2P5Q A;  2WGR A;  2K8V A;  2YOI A;  1TK5 B;  11GS A;  4MJC A;  2WDU A;  4XRA A;  3JCM L;  4OMV A;  3HKR A;  1EWX A;  3W8S A;  2DJK A;  5H5S A;  5G5E A;  2LEG A;  1B8X A;  5CRD A;  3RHB A;  5G5F A;  4KND A;  3D4M A;  4KCA A;  1EV4 A;  2K8S A;  6GSX A;  2LTK A;  4XTS A;  1JFU A;  4I8B A;  3KIJ A;  2M72 A;  4ZIL A;  1JLV A;  2VAF A;  5CRW A;  3APQ A;  2VLV A;  5L71 A;  2B7J A;  3IAM 2;  3M3M A;  4KW6 A;  1U87 A;  4GRF A;  4ZBD A;  1F2E A;  4OFT A;  1Z9H A;  1ZZY A;  4GST A;  1GLQ A;  3UVT A;  4N11 A;  2C0D A;  4POM A;  3OR5 A;  4Q5N A;  5C04 A;  3EYT A;  5IMD A;  4IKH A;  4AJ8 A;  1DE2 A;  5IO2 A;  3E0U A;  4KUN A;  4IVF A;  1TKD B;  2X8H A;  2QGV A;  3DML A;  4FYU A;  3EMX A;  2OE1 A;  2DJ1 A;  2YZH A;  3HVX A;  1Z6N A;  1SD9 A;  4JE1 A;  2R3X A;  2A2R A;  5KN3 A;  2L4Q A;  4FQU A;  1TK8 B;  5G30 A;  3IC4 A;  1U6T A;  5FHI A;  1ACV A;  5LNK e;  4RUV A;  2F51 A;  3TOU A;  2VCT A;  5CP1 A;  4YH2 A;  2LRC A;  4L5O A;  2O8V B;  3WT2 A;  3CRT A;  4BPY A;  3VWW A;  4Z2T A;  2C0F A;  3KP8 A;  2DJ2 A;  5LD0 A;  2DIZ A;  4PGT A;  1GUM A;  2OBI A;  3A2X A;  5GAP D;  2JAC A;  5IO0 A;  4QL7 A;  4YKF A;  2LJA A;  1OC9 B;  1XIY A;  4KH7 A;  4ECC A;  2YPM A;  4EDY A;  3BJ5 A;  2OKA A;  3HXS A;  3H8Q A;  3IHG A;  1Y6E A;  2RUF A;  1G7E A;  4PXO A;  1XW6 A;  1SJI A;  4N0Z A;  3NOF A;  4USS A;  4XRD A;  1TW9 A;  1V9W A;  3QMX A;  4GSS A;  2VD0 A;  5DQS A;  1DUG A;  1AQV A;  4TR3 A;  2YWN A;  1UVZ A;  3ZVJ D;  3C1R A;  3LXT A;  4Z2U A;  2N5F A;  4KA0 A;  3F6D A;  1KBN A;  2H6Z A;  3HA9 A;  3FHK A;  5IPG A;  1GWC A;  4KSM A;  5ECM B;  2HRN A;  5CRH A;  3VPQ A;  2GST A;  4X0X A;  4IQ1 A;  2R2J A;  2YJ7 A;  2PER A;  3KH9 A;  5G2Z A;  3D22 A;  2HRA A;  2DML A;  4KF9 A;  1K3O A;  4NWY A;  4MZC A;  4MF6 A;  1F37 A;  2GZZ A;  4G19 A;  3CTG A;  4OWY A;  4HJM A;  3ZIV A;  1SK1 A;  5D9X A;  2OE0 A;  3KMN A;  1JZO A;  1GTA A;  2L5O A;  3N9J A;  3S9F A;  3UEM A;  4BVX B;  4ACS A;  3HY2 A;  4EUY A;  4ULX A;  2FCH A;  4TRX A;  3MWH A;  3FZ4 A;  4MNN A;  1A8Y A;  3LXZ A;  1GL8 A;  2R5G A;  5KEJ A;  1TRU A;  2GVP A;  20GS A;  4V2M A;  3ME8 A;  5AGY A;  4GSN A;  2XBQ A;  1GTU A;  4LLR A;  1M2A A;  3ZTL A;  4WF5 A;  2BTO T;  1SKS B;  3L4N A;  4DSR A;  1U3I A;  1FAA A;  1PN9 A;  4K1F A;  5FT3 A;  2JZS A;  3GL5 A;  3PPU A;  2I3Y A;  3RPN A;  3ZIT A;  4GTU A;  4XS4 B;  2LST A;  4EVM A;  1GSQ A;  2KLX A;  2HYX A;  3L78 A;  5ECI B;  1VRS D;  2G0F A;  2CAQ A;  1SKW B;  3GMF A;  1Z7P A;  3GH9 A;  1SKR B;  1F6M C;  2C0E A;  3LEF A;  1A24 A;  3FZ9 A;  1T00 A;  2C1Y A;  3VUR A;  4K2X A;  1VF2 A;  3TGZ A;  3ZVJ A;  1XWB A;  4EIP A;  1TRS A;  3ZIJ A;  4L8E A;  1G7O A;  4E8E A;  3GKK A;  3N5O A;  4POK A;  5DAK B;  3EE2 A;  4G9H A;  4LMW A;  3GST A;  5A5K A;  5J3R A;  2GQM A;  2P0G A;  2E2M A;  4OCF A;  4LL1 B;  3W6G A;  2IJY A;  4WXT A;  5GST A;  1X9M B;  2GTU A;  1PL1 A;  2IIY A;  3U5R E;  3FYG A;  1CQH A;  1VGL A;  4K9Z A;  4K7I A;  2CX4 A;  4XHM A;  1A2M A;  4GQF A;  4ECI A;  4TR0 A;  3C73 A;  1K0B A;  1JLW A;  4GQC A;  5H5Q A;  3TUE A;  5HFI A;  1G6Y A;  3O76 A;  1GRX A;  4WBJ A;  1FOH A;  2P5R A;  3SWL A;  3HYP A;  4F0C A;  5H5R A;  5GSS A;  3MAK A;  2JZT A;  3FZ5 A;  4O5Q A;  1W89 A;  1ERT A;  2REM A;  4F0B A;  1TDI A;  3ZL5 A;  2AAW A;  4ID0 A;  4ECJ A;  4MJB A;  1EOH A;  2R4V A;  6GSV A;  3IPZ A;  2F8F A;  3EU4 A;  22GS A;  3VFI A;  5AIX A;  1V40 A;  2VL3 A;  1GUL A;  1SYX A;  2HZE B;  2MMN A;  4MZB A;  2CVD A;  3I43 A;  3V1W A;  3D5J A;  4ZB9 A;  5HQP A;  1R4W A;  3ED3 A;  5HR0 A;  2IN3 A;  4GLT A;  5IOW A;  1Z6M A;  3DKS A;  3GKM A;  3GHA A;  2H1D A;  1V98 A;  1O8W A;  1TK0 B;  3ZML A;  1A2J A;  4O32 A;  5GZZ B;  2LNT A;  3BCK A;  4I2T A;  1GNW A;  2A2P A;  5IQY A;  5G1K A;  2H0H A;  4IEL A;  3TKP A;  3TJG A;  4CW9 A;  1BYE A;  4F03 A;  3TJB A;  2VM2 A;  1VF1 A;  5DAL B;  1WOU A;  2FUG 2;  3I6A A;  3K8N A;  4IJ3 A;  4EL1 A;  2R0P A;  5AIV A;  4FYC A;  3E9J B;  3F9U A;  5D73 A;  1A2L A;  2PMT A;  2A2S A;  4XS1 A;  4N10 A;  1K0C A;  3ME7 A;  2D2Z A;  2H71 A;  5BRT A;  4MP4 A;  3LG6 A;  3DXB A;  4BVY A;  4IHU A;  4PQI A;  1SU9 A;  2F9S A;  1QXH A;  1GUH A;  1FHE A;  4OFM A;  4HZ4 A;  2X8G A;  5HR3 A;  5B6M A;  4X43 A;  2H6Y A;  2VL9 A;  3CSJ A;  6GSY A;  4NPB A;  4MJA A;  3VK9 A;  1PQN A;  4XS6 A;  2YP6 A;  1BG5 A;  1YEX A;  2LQQ A;  4FH8 A;  3Q6O A;  3M9J A;  4BL7 A;  1EGO A;  5KOW A;  3IK7 A;  5G31 A;  2O7K A;  5ECH B;  1WP0 A;  2O87 A;  4F9Z A;  3D21 A;  1KEB A;  5JCG A;  3EMP A;  2WFC A;  3P7X A;  2J9H A;  2MMO A;  3GUS A;  1OKD A;  2HT9 A;  2FLS A;  5ENU A;  2C3N A;  2PWJ A;  5IMF A;  1PX6 A;  3GRX A;  1AXD A;  3LWA A;  3MYD A;  2AHE A;  4TR1 B;  2FWE A;  3WD6 A;  1SL0 B;  3FMW A;  4YQV A;  1PKW A;  1G0T A;  1F9M A;  3LQ7 A;  5IMZ A;  1SYR A;  3RHC A;  2HI7 A;  3ZFB A;  1TP9 A;  1Z5Y E;  4TKY A;  4MJE A;  1JHB A;  4WEY A;  1GH2 A;  1THO A;  4NHW A;  3KMO A;  3QAW A;  2BMX A;  4DSS A;  9GSS A;  2F8A A;  3QAG A;  1QQ2 A;  2VCZ A;  1T3B A;  2H74 A;  3Q18 A;  2L6C A;  3GNJ A;  3ZMK A;  3DEX A;  2EIO A;  1QK8 A;  4TN8 A;  3HVV A;  3FKF A;  4L5L A;  5J41 A;  3H93 A;  2LKU A;  2FY6 A;  2IFQ A;  1E6B A;  1MTC A;  4V2L A;  4ZBA A;  2E7P A;  3J7Y b;  5ECO B;  1JZR A;  4IS0 A;  3C71 A;  1HNC A;  4EIQ A;  2A4V A;  4MH2 A;  1YDK A;  2CQ9 A;  1B4P A;  4OO4 A;  3RBT A;  3UVH A;  3F8U A;  1M9B A;  4WBR D;  3DVW A;  3GX0 A;  1AC1 A;  2JSZ A;  3E3E A;  5B7C A;  3ERG A;  1T1V A;  4CY8 A;  2DSA A;  3TRP A;  2VCX A;  3DIE A;  3F3Q A;  4WR5 A;  4RQR A;  2FWH A;  2H1G A;  2MZC A;  5KN1 A;  1OAZ A;  4V1A g;  5JCW A;  2GSR A;  3I69 A;  4V2N A;  1VF3 A;  5F0G A;  2R6K A;  4PQH A;  3FR9 A;  2X8C A;  1A0F A;  1J9B A;  2V41 A;  1UC7 A;  3QD9 A;  5GAN D;  4JRR A;  1PGT A;  2XPE A;  2NTO A;  1ML6 A;  4PUR A;  4JZQ A;  1SJZ A;  2CX3 A;  2HXK A;  3KZQ A;  4JR4 A;  2Z9S A;  3MIX A;  6GSS A;  3GFK A;  1X5D A;  5DQY A;  1GTB A;  2C0G A;  1HQO A;  2E2G A;  3WGX A;  4O7H A;  3P8W A;  3VI5 A;  4IJI A;  1BQ7 A;  4K6X A;  2H0I A;  3L9U A;  1PKZ A;  1YF1 A;  1FW1 A;  3G9B A;  4MAB A;  2N5A A;  2N5B A;  1O7U A;  5CRE A;  2LNS A;  5IM9 A;  4AJ7 A;  5JWO B;  2FHE A;  4FIW A;  1EEM A;  3LOR A;  1QUW A;  2AJQ B;  4ZB8 A;  3TB2 A;  1K3Y A;  2O89 A;  4GCI A;  1A8L A;  3A2W A;  2XHF A;  2VCW A;  2YZU A;  4I97 A;  1N2A A;  1IYI A;  2R0G A;  3QFA C;  2VL2 A;  3UAR A;  4LL4 B;  1ILO A;  1B9X C;  3RAZ A;  4MA9 A;  1GSD A;  2JU5 A;  1MD4 A;  2C3T A;  3J7Y k;  2FWG A;  2MBS A;  2CA8 A;  1OE7 A;  3U6V A;  1PMT A;  1BX9 A;  3TJK A;  1OC8 A;  4TXO A;  5ECP B;  4KCE A;  2LV3 A;  3KEB A;  1T4Y A;  2XC2 A;  2YV7 A;  5E59 A;  5KOX A;  4HJ2 A;  1R7H A;  2IL3 A;  2A4H A;  2MYG A;  5IPH A;  1K0N A;  4HDE A;  3HHV A;  2FGX A;  2L4C A;  3W8J A;  2V2G A;  3UIW A;  2YJH A;  3US3 A;  1GSS A;  3P90 A;  3WYW A;  2FNO A;  2LS5 A;  3A2V A;  3EWL A;  2HE3 A;  2QSI A;  3HJM A;  2TRX A;  4WR4 A;  4MCU A;  4KDY A;  4I6X A;  2CVB A;  3NZN A;  2CVK A;  2M80 A;  2GDR A;  3DYR A;  1O81 A;  4G2E A;  5A4U A;  3HJP A;  5AIS A;  3CXG A;  2H19 A;  19GS A;  2R37 A;  1XWA A;  3IXR A;  4LA1 A;  2RLI A;  3GSS A;  2GT5 A;  3QAV A;  2WB9 A;  4MZW A;  4PUA A;  1RK4 A;  4K5R A;  2GQL A;  4K0N A;  1GLP A;  2L6D A;  1ZMA A;  5ELG A;  4K7N A;  3ERF A;  3M8N A;  2G2Q A;  2DLX A;  3C7M A;  2TRC P;  4JU5 A;  2FA8 A;  2LQO A;  1Z3E A;  2MMZ A;  4ILF A;  5ID2 B;  1AUC A;  4Z7X A;  13GS A;  2ES7 A;  4K8M A;  2YWO A;  2MBT A;  4HZ2 A;  1ZYQ B;  4HS1 A;  3HZ8 A;  4ZL7 A;  3P2A A;  3FW2 A;  4K2D A;  2DJ3 A;  3HJO A;  4GWR A;  4EC0 A;  1Q4J A;  5JCU A;  2DIY A;  1H4O A;  4JR6 A;  3F4S A;  1ERW A;  3ZRE A;  3LSZ A;  2EIQ A;  4JBB A;  4Z2R A;  2K18 A;  3CBU A;  4TOP A;  4CDO A;  2X99 A;  3QDN A;  4J57 E;  5J9B A;  4POL A;  3DGQ A;  2IMF A;  3GYK A;  1O6J A;  4D73 B;  2GS3 A;  3NIV A;  16GS A;  1NHO A;  2HNL A;  2YNX A;  4TXV A;  1XPV A;  2OAD A;  5F8B A;  4OCE A;  1WIK A;  4NV2 A;  4G0L A;  1B4Q A;  1TOF A;  4O5U A;  4K7O A;  4ZXG A;  2IFQ B;  5D96 A;  4FO5 A;  2CT6 A;  3H4K A;  1A0R P;  1TU7 A;  2H8L A;  2IMI A;  1ZGN A;  3EU3 A;  3TRQ A;  1PD2 1;  3WT1 A;  2B3S A;  4F2I A;  4L0U A;  4HU9 A;  5J5N A;  2VCV A;  3IBH A;  3MSZ A;  1OC9 A;  2WZ9 A;  2IMK A;  2ON7 A;  1YJ6 A;  1TTZ A;  1CQG A;  4CY6 A;  1XOA A;  1GSF A;  3UL3 A;  3O6T A;  2KP1 A;  3KH7 A;  1FB6 A;  4ISD A;  5ECN B;  3H79 A;  2FWF A;  3LFL A;  4ZBB A;  5DVB A;  4X4J A;  2DC5 A;  3APO A;  4YQM A;  1DE1 A;  5A4W A;  4E8H A;  6GST A;  5DBQ A;  3KTL A;  1TI3 A;  3GUR A;  2I9H A;  4HUA A;  1O73 A;  4IBP A;  2KOK A;  4RQX A;  2WJU A;  5JWR B;  3C8E A;  1XVQ A;  2IWT A;  2J23 A;  3H1N A;  3QR6 A;  2H73 A;  4NAX A;  4KSO A;  3GKN A;  2QKE A;  2QA1 A;  1SL2 B;  1NM3 A;  2HSY A;  1M2D A;  4WKW A;  4HQZ A;  1TRV A;  10GS A;  2LRN A;  2YCD A;  3PGT A;  1WMJ A;  1ZCP A;  4MMM A;  4G0K A;  1HNB A;  4L0W A;  5F06 A;  3GV1 A;  5B8B A;  4MLY A;  2GLR A;  4ZL8 A;  1FVJ A;  4FYB A;  4PNF A;  1K0A A;  1YF0 A;  1SD8 A;  4MH3 A;  1AIU A;  2NPB A;  4PUF C;  4BVX A;  3TKQ A;  4PQ1 A;  3CYN A;  3APS A;  1H75 A;  3L9V A;  5J9C A;  1WPI A;  3LYK A;  3CSI A;  3IRA A;  4OFN A;  5ECQ B;  5A4V A;  1MEK A;  1OC3 A;  2YWI A;  2ON5 A;  1O85 A;  2L59 A;  4HU7 A;  1XXU A;  5DJL A;  4OD7 A;  2NVL A;  1MDJ A;  2X64 A;  4J56 E;  5D9W A;  2HSH A;  4GXZ A;  4NMU A;  2LRT A;  4AJ6 A;  1PX7 A;  1USB A;  3VWX A;  4DEJ A;  1WRY A;  2B7K A;  4K0G A;  3VWV A;  2CZ3 A;  1RW1 A;  4KAE A;  4F82 A;  3Q74 A;  3KD0 A;  2DKH A;  3ZRD A;  3DD3 A;  4KGI A;  4X1U A;  1QFN A;  4TXO B;  2MMA A;  3QOU A;  4OO5 A;  5CNW A;  3QCP A;  2IME A;  1IYH A;  2GT6 A;  2CV4 A;  4ZB6 A;  3VPT A;  1W4V A;  4G0I A;  4PTS A;  7GSS A;  1ZYN A;  2PPT A;  1T8E B;  3ZYW A;  2BJX A;  4BWS A;  5B8A A;  1X9S B;  1RQM A;  3Q19 A;  4IP6 A;  3O3T A;  1ZOF A;  5ELA A;  2H0G A;  1LJR A;  2EC4 A;  1M9A A;  1U3A A;  3F4R A;  3F4T A;  2VO4 A;  2RM6 A;  3M9K A;  3D4T A;  1WE0 A;  4EF0 A;  1KTE A;  4PX1 A;  1TXX A;  2H1A A;  2HRK A;  3LYP A;  1I9D A;  2OAC A;  5IMV A;  4ML1 A;  2QA2 A;  1XWG A;  3HCZ A;  1FVK A;  4Q5R A;  2KHP A;  2PGT A;  1PL2 A;  1FO5 A;  2V1M A;  1BAY A;  4K5S A;  3GN3 A;  2NDO A;  2PUK C;  3CTF A;  4AGS A;  2DMM A;  1HNA A;  1MDI A;  3LW9 A;  2B5Y A;  1BJX A;  1F3B A;  2UZ8 A;  4IGJ A;  1WWJ A;  2HZE A;  4AF2 A;  4NHZ A;  5DJM A;  2VCQ A;  1YKC A;  3F0I A;  5ECK B;  1HD2 A;  4IP1 A;  3WGE A;  3TCO A;  2ZUP A;  5DDL A;  4MF7 A;  3LGC A;  2M46 A;  2GGT A;  1SK2 A;  1S3D A;  2O85 A;  3ZFL A;  5C00 A;  5HFK A;  3C1S A;  4BA7 A;  1GUK A;  1MD3 A;  3RDW A;  4XCS A;  1YY7 A;  2X4A A;  5E4W A;  4RI6 A;  3BCI A;  3QFB C;  2GZP A;  5BMU A;  2EIR A;  4YAV A;  1TRW A;  2PVQ A;  5DAL A;  1R5P A;  3EC3 A;  2C80 A;  2NBS A;  4EXJ A;  2CZ2 A;  1PA3 A;  4IN0 A;  1N8J A;  1PSQ A;  2YWM A;  1V2A A;  2YV9 A;  2VLU A;  2YAN A;  1XZO A;  1E2Y A;  2WS2 A;  2JZR A;  2V6O A;  4EE0 A;  4KE3 A;  3VI7 A;  1BED A;  2YN1 A;  18GS A;  4QQ7 A;  1HYU A;  4MPG A;  1FB0 A;  1EV9 A;  3M1G A;  1K0O A;  1ERU A;  2DJ0 A;  2B1K A;  1J0F A;  2VL2 C;  4V1A p;  1M0U A;  2TIR A;  3ZLP A;  3ERW A;  2GZY A;  3L9S A;  1EP8 A;  1GNE A;  3KM6 A;  2LJK A;  1OYJ A;  3F63 A;  3KJY A;  1ZYP A;  4EDZ A;  1O8X A;  1T4Z A;  1XBS A;  2I1U A;  1A23 A;  1JZD A;  1XW9 A;  3PR8 A;  1DBY A;  1ON4 A;  2JAD A;  3IAS 2;  1LBK A;  2R0C A;  5CYY A;  1X5C A;  1QGV A;  3R2Q A;  4HI7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...