2CX4A

Crystal structure of a bacterioferritin comigratory protein peroxiredoxin from the aeropyrum pernix k1 (form-2 crystal)
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
161
structure length
161
Chain Sequence
GLVELGEKAPDFTLPNQDFEPVNLYEVLKRGRPAVLIFFPAAFSPVCTKELCTFRDKMAQLEKANAEVLAISVDSPWCLKKFKDENRLAFNLLSDYNREVIKLYNVYHEDLKGLKMVAKRAVFIVKPDGTVAYKWVTDNPLNEPDYDEVVREANKIAGELV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords bacterioferritin comigratory protein
publication title Crystal structure of a bacterioferritin comigratory protein peroxiredoxin from the Aeropyrum pernix K1 (form-2 crystal)
rcsb
source organism Aeropyrum pernix
total genus 38
structure length 161
sequence length 161
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2005-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2cx4A00
1XWGA 16GSA 3KTBA 4F82A 3GURA 3FEUA 4IQ1A 3I9V2 4WEYA 3BCIA 2DMLA 3VK9A 4XTSA 12GSA 1OE7A 3WD6A 3FYGA 2JACA 1FB0A 4NXIA 2GSRA 1DSBA 5A4WA 2VOCA 4MMMA 3ZIVA 5ELGA 3HA9A 4JBBA 3C1RA 2FWEA 4ZB6A 2H1DA 4NV2A 1ZYQB 3M0FA 3F6FA 5DVBA 2CX4A 3GKMA 2V2GA 4HOJA 3HY2A 1PL2A 3ISOA 4XS1A 2RLIA 5G30A 2JU5A 5B8AA 2HSHA 1YKAA 3VWUA 1A0RP 4F2IA 4IKHA 1THOA 4MPFA 3MDKA 3A3TA 2L4QA 2AAWA 4L0WA 2L6CA 1H75A 5ID2B 1S3CA 1SKSB 2ZUPA 5B6NA 2X99A 4ZBBA 5G5FA 3UVTA 4PXOA 4POMA 4QL7A 1S3AA 3GL5A 2GZPA 3O6TA 1RW1A 2DC5A 4G9HA 4LA1A 2D2ZA 3TB2A 3GKXA 2EIQA 11GSA 3NIVA 4QQ7A 3FK8A 2NTOA 3H4KA 2PWJA 2LJAA 1A2MA 6GSUA 3UIWA 1T1VA 5LNKe 5GSSA 2LSTA 4GLTA 1XVWA 2CZ3A 4TR1B 2AYTA 2YCDA 1UVZA 1GL8A 3G7IA 1K0BA 4PGTA 2GQLA 1F2EA 4PQ1A 3BOAA 2I9HA 1BAYA 2VL2C 5IPHA 1EWXA 1HNCA 2CAIA 3EMXA 3O3TA 4XCSA 1XPVA 2AHEA 5CAXA 5LD0A 4J57E 5ECMB 1EZKA 1ZZYA 5IIZA 4EL1A 1AC1A 1BJXA 3P90A 3W6GA 1XBSA 1VGLA 3HJPA 1V58A 1DE1A 3QD9A 1O8XA 5EVOA 3ZMLA 5HR2A 5ENUA 4CW9A 3F3QA 3ERGA 3ZL5A 4LLRA 4DSSB 5F07A 3F9UA 1ON4A 2R3XA 2YV9A 3UL3A 4HZ2A 3TJGA 4MZBA 3C73A 1AQVA 4K7NA 1X9WB 1T4YA 1SL2B 3MWHA 1K0DA 4N0ZA 3SBCA 3F4RA 3RPNA 3MAKA 1FVJA 2GSQA 4I2TA 2QSIA 4EKZA 3U5RE 2H01A 4FIWA 2YJHA 4IP1A 3DMLA 5HFKA 1WOUA 1QGVA 5DALA 3L9UA 1Z9HA 3W8JA 3EC3A 2LEGA 3GSTA 2LS5A 3HD5A 5GSTA 5ECOB 2RUFA 1U3IA 1ERWA 3ZLPA 3EU4A 4EO3A 3HXSA 3D6IA 5A4VA 2GQKA 2TRXA 2I4AA 2CX3A 4OCEA 1RQMA 3L9VA 3L9SA 1I5GA 1GSFA 1OYJA 1ZCPA 4JU5A 4TKYA 1TRVA 2JZRA 2HFDA 4YAVA 4GSNA 2OA7A 3TKQA 1EOGA 2OACA 4ECCA 1F37A 1TXXA 3Q18A 5JWQB 2M46A 1Z6NA 1K3YA 2YJ7A 4ZXGA 1FHEA 4EC0A 2GSTA 4ID0A 1EV9A 1SK1A 3FZ5A 2XPDA 2VAFA 1SJIA 2FUG2 2F3MA 4ML6A 1EP8A 4PUFC 1M0UA 1MTCA 4TR3A 1MDJA 3F4SA 2PUKC 2AJQB 2VCXA 5E59A 1JZDA 4XIHA 2P31A 4NHZA 3P8WA 4MK3A 4ML1A 1HYUA 3HCZA 2H72A 2MZCA 4GWRA 3UBLA 4BVXA 2GDRA 2PERA 1N8JA 2L6DA 1ZGNA 1ZOFA 5J5NA 2ZNMA 2B1LA 4XS4A 3S9FA 1GWCA 3GUSA 1WIKA 3VLNA 1TRWA 1ABAA 2FD3A 3MNGA 2I81A 5ECRB 4XRAA 2LRCA 3FR9A 2VM2A 1O81A 2X8CA 3CSJA 3CSHA 4AJ7A 3PH9A 3ZRDA 1U87A 1BQ7A 1PKZA 2FWFA 1PQNA 1ERVA 2GGTA 2B7JA 1GUMA 4HU9A 2R37A 2R2JA 1GRXA 3A2VA 4F03A 3D4MA 4O32A 2F51A 5DQYA 2H0IA 5G2ZA 3F0IA 3G7YA 3KZQA 4EDYA 2N5BA 2VCWA 2H66A 2YN1A 1GSYA 2CA8A 4GRFA 3FZ4A 2B5XA 2IMEA 2VCVA 4OFMA 5ECKB 2IMDA 3KXOA 1X5CA 1O85A 1QK8A 6GSXA 3UOMA 4FO5A 3IDVA 1KTEA 1ML6A 4DSQA 5HR3A 3BJ5A 3TDGA 5ECQB 4EF0A 5D8IA 1NHYA 1JHBA 3WGDA 4Q5FA 1EV4A 2CVDA 1EEMA 3QAGA 1U3AA 1O7UA 3EMPA 5CNWA 4YQMA 5JWOB 2I3YA 20GSA 3VWWA 5IMCA 1JZRA 2OBKA 3FZAA 1A2JA 2MMNA 1X9MB 2N5AA 2K18A 3ZIJA 2IJYA 5HR1A 4K7IA 2H1AA 2H19A 4WBJA 1SJZA 1YZXA 1Q98A 3RAZA 2FA8A 2P0GA 4BA7A 2HT9A 3CYNA 3IC4A 3TKSE 5JCUA 2PN8A 4ZIJA 2M80A 2O89A 2H70A 3APQA 1F6MC 2BJXA 4TOPA 5G31A 5HR0A 1R5AA 2LRTA 3UVHA 2WULA 1ACVA 2YWMA 4MP4A 5IMFA 4KGIA 1FW1A 3E9JB 3P7XA 3CTFA 1AXDA 5CRDA 2ZCTA 3GFKA 3TRPA 5ECNB 3A2XA 2MBTA 2FA4A 4MA9A 2C3QA 4ULXA 4EVMA 5H5RA 4LMVA 1SL0B 6GSYA 1QFNA 1XCCA 14GSA 5C00A 1SD8A 4ZL7A 3FRCA 2I1UA 5DJLA 2R4VA 3KCMA 3D5JA 9GSSA 1TK0B 4X1UA 4HS1A 5ABRA 4MH2A 1UA5A 4OO5A 2KHPA 3GNJA 4G2EA 3BBYA 4XS6A 4N0VA 2WCIA 1QQ2A 3P2AA 2LQQA 4MH3A 1PA3A 5ECSA 1PGTA 3DRNA 5H5QA 3E3EA 3FR6A 4RQRA 2XPEA 1GLQA 3TUEA 5GAPD 2YWOA 3FW2A 2GZZA 2QGVA 3GYKA 4I8BA 1BG5A 1K3LA 3GH9A 6GSWA 5A5KA 2FCHA 4ZILA 1TP9A 3QPMA 1BYEA 1F3BA 3Q6OA 1GNEA 4I6XA 5CRWA 3KH9A 1O8WA 4DEJA 1QUWA 3TRXA 3VI7A 3EVIA 3C7MA 1NSWA 2LJKA 3VFIA 5J9CA 3QR6A 3EINA 3EYTA 3HDCA 4BWQA 4HU7A 2G2QA 4HUAA 6GSSA 4MDCA 3US3A 2IL3A 1XWKA 2LV3A 2IMFA 2PBJA 5G1LA 1QXHA 5IM9A 4IW9A 4WF4A 4YQUA 1G7OA 2QC7A 4TRXA 1PX6A 5D93A 1J9BA 3HJOA 1V57A 4POBA 2HRFA 1Y25A 3ZFBA 1GUHA 1M99A 3LXTA 5HFGA 10GSA 4MABA 4FH8A 5G5EA 2ON5A 2N5FA 4IHUA 2YWNA 1TK5B 4MJCA 1LJRA 4I5QA 1B9XC 3D0ZA 1UN2A 4YAPA 2C0EA 2LUSA 5EY6A 3IRAA 1T00A 1JLWA 4PQHA 3A5WA 3ERFA 4TW5A 3APOA 4G19A 1TJDA 4CHSA 5JCGA 3TJFA 1BX9A 4ECJA 4HQSA 1R7HA 2MYGA 1NM3A 2F8AA 5CO3A 2BTOT 2YOIA 3G9BA 3KIJA 1TW9A 4N10A 1B9YC 1OC8A 3LXZA 1TTZA 2B6MA 1GP1A 3CTGA 4RQXA 1VF1A 2C80A 4EUYA 2CAQA 4D73B 2DJ1A 3IK9A 1B48A 2IMIA 2LRNA 5L71A 1O73A 4NMUA 1PX7A 2PMTA 2YANA 1U88A 4HJ2A 3GV1A 4POLA 1CQHA 2JADA 2EIRA 1GSUA 1OC9A 5JCWA 5IO0A 3QCPA 4ZB8A 1GUKA 3VWVA 4BVYA 4KNDA 2VLVA 3HZ8A 4KW6A 6GSTA 2CVBA 1EEJA 2O8VB 3DVXA 1WPIA 2DIYA 2WDUA 3ZTLA 2IPAA 4KSOA 1FO5A 2OE0A 4X0XA 3J7Yk 2DJKA 4HJMA 4CDOA 2IWTA 1IYIA 2H1GA 3IAS2 1V2AA 1UC7A 4V1Ag 1B4QA 3VURA 3IA1A 4PNFA 1F9MA 6GSVA 3EURA 2XHFA 5IO2A 2GVPA 1GULA 5IPGA 3GX8A 3U6VA 2OKAA 2E7PA 1QMVA 2RUEA 3A2WA 3QOUA 4NAXA 1GH2A 2E0QA 1GSEA 3C1SA 3QAWA 1EP7A 5EL8A 1SKWB 5D9WA 4KUNA 4O7HA 5D96A 5C04A 3H8QA 4ZBAA 2KUCA 2P5QA 4K6XA 3TKRA 5DAKA 2KLXA 4EE0A 3I69A 4PURA 2DSAA 2B1KA 3HZ4A 1GTBA 3TKSA 3LORA 1A24A 3IXRA 4P3YB 2DJ3A 4L8EA 1Z7RA 19GSA 2H74A 4GSTA 3FKFA 3Q19A 1OKDA 2O87A 1M9BA 1YEPA 1WE0A 22GSA 3ZITA 1XWAA 5B7CA 4AJ6A 4J2FA 2V6KA 1YY7A 4KSMA 3H1NA 2JSZA 2FWHA 1KEBA 4OCFA 4LMWA 1XOAA 1I9DA 1GTAA 2JZSA 1T4ZA 1AQXA 2B5EA 1JZWA 3M1GA 3V1WA 4K7OA 2VM1A 2L4CA 2DIZA 2IN3A 1THXA 2PGTA 5KN2A 4WXTA 1PN9A 3BCKA 2EIOA 1V9WA 4NWYA 2QKEA 1X0RA 3GX0A 1PRXA 5B8BA 3LGCA 3ZVJA 4PX1A 5DCHA 3FR3A 3GA4A 2OJLA 2P5RA 3J7Yb 3L0HA 2L5LA 2C4JA 4KCAA 4MPGA 1PL1A 1GSDA 4JR6A 3D4TA 2LNTA 3UEMA 1EGRA 4JR4A 3RBTA 4O5RA 3HHVA 4IJIA 2WS2A 3N5OA 3H79A 1XZOA 2V32A 2VL9A 3CSIA 2R6KA 2E2MA 1VF2A 4MLYA 3HYPA 1FOVA 1Z5YE 3TJJA 3IBHA 4LL1B 2XBQA 3KD0A 1XWBA 2FHEA 3QAVA 1AUCA 4TR1A 2A2RA 2HRNA 1O6JA 2VLUA 3AY8A 3DYRA 1ILOA 3QFBC 2PU9C 4K0NA 4BWSA 3WGEA 2HZEA 2FWGA 2GLRA 2O7KA 2G0FA 1X5EA 4POKA 5IOXA 1B4PA 4X43A 2VUPA 4ILFA 5FWGA 3QDNA 1NW2A 2AUVA 7GSSA 5IMZA 3CBUA 4IN0A 2DJ2A 4GXZA 3UAPA 2LJRA 1WRYA 3DWVA 2O85A 3IOSA 1TK8B 5F06A 2NBSA 2GT6A 2R5GA 4IVFA 2VIMA 5ECLB 2H8LA 2NPBA 5CYYA 4IJ3A 2Z9SA 1TRUA 4WETA 1Q4JA 1YJ6A 5E4WA 4PNGA 4E8EA 4TXOA 5AGYA 2WFCA 1A23A 4NHWA 2X8HA 1FB6A 2H6ZA 2J9HA 1OC9B 2IMKA 4ECBA 5IMDA 1LU4A 4DSRA 1XVQA 3GRXA 3RHBA 3BD2A 2VL2A 3MSZA 2L5OA 5AIVA 1M7TA 2K8VA 1A2LA 2H0GA 3WYWA 1XW5A 2GT5A 4AJ8A 1SK0A 5DALB 3IK7A 3UARA 4EDZA 1MDKA 3EE2A 1HNAA 4MF7A 4IGJA 4HEA2 1LBKA 2WJUA 4IELA 1K0OA 1GTIA 3WGXA 4ISDA 1K0CA 2F8FA 2HYXA 2JZTA 2YNXA 3M9KA 1SJ6A 1ERUA 1TOFA 3CRTA 5IMAA 1A8LA 3RHCA 4KCEA 4AF2A 2OBIA 2VD0A 4IQAA 1HNBA 5DAKB 4XHMA 3VPTA 3DVWA 1JZOA 2YV7A 1M2BA 2C1YA 2DMMA 5KN0A 5DQSA 2VD1A 1SK2A 5B6MA 3HJMA 2H30A 1Z7PA 1Y6EA 2DJJA 3KH7A 1DBYA 1TRSA 18GSA 3ERWA 3L4NA 2CV4A 1BEDA 4DVCA 3WT2A 2K8SA 1G0TA 1KBNA 2FNOA 1G6YA 1PKWA 1ZMAA 1ZL9A 1R4WA 4GQCA 4XS4B 1TU8A 3LQ7A 5IOWA 2LQOA 4I97A 2DJ0A 2TRCP 4OD7A 3TRQA 1AQWA 1XXUA 1OVNA 1TKDB 1C72A 4IS0A 1AAZA 2C0FA 1MD4A 3ZZXA 1OKTA 1K0NA 3KMOA 2V6OA 3M9JA 3CMIA 4OO4A 1RK4A 3QMXA 4V2MA 2H0HA 2VCZA 4YH2A 2JL4A 4JEDA 4YQVA 4TR0A 1GLPA 4XRDA 3UJ1A 2VO4A 4F9ZA 3LSZA 1SYRA 2H71A 3GHAA 3JCML 8GSSA 2YP6A 1H4OA 3DXBA 2C0DA 1J08A 1USBA 3IE3A 1OC3A 4KB3A 1SENA 4FYUA 1HQOA 5EPFA 3FY7A 3UMAA 2MMAA 1YEXA 2CZ2A 4TN8A 2B3SA 4LL4B 2WRTA 3ED3A 4JZQA 2L59A 3CXGA 2H1BA 1CQGA 4MJEA 2X64A 2HI7A 2MMOA 3I6AA 1SU9A 4KAEA 1WMJA 4MCUA 3KMNA 1J0FA 2IFQA 3KGKA 3HVVA 1Z6MA 1SYXA 1XW6A 1T7PB 1PSQA 2VLTA 2E2GA 5A4UA 1F3AA 2JSYA 1AW9A 2A4VA 5COHA 5CRHA 1E6BA 3CRUA 1B8XA 4MZWA 3PINA 5J3RA 2GZYA 2WGRA 3Q74A 3F8UA 2HZEB 1EGOA 1V40A 3DGQA 17GSA 2H75A 4PQIA 2M72A 4HDEA 2LKUA 5AN1A 2H76A 1XOBA 5AIXA 2WB9A 1M9AA 3LYPA 2OADA 4Q5RA 1AIUA 5F0GA 2GSSA 2VL3A 5CRGA 3IHQA 5G1KA 2H6XA 3M8NA 2DBCA 3APSA 1GNWA 1T3BA 4V2NA 2OE3A 5CREA 1NHOA 4WBRD 1TU7A 5FHIA 4GSSA 1S3DA 3GIXA 4OMVA 5F05A 2WZ9A 1PMTA 4TVEA 5D9VA 5KN3A 2EC4A 5IMVA 2YWIA 5D73A 5IQYA 3TOUA 4RUVA 5ECPB 4NV5A 1XIYA 3GTUA 4TXOB 2H73A 5CP1A 4O92A 3WT1A 1G7EA 4GQFA 4QL9A 2HNLA 3ME7A 2YZUA 3O76A 3F3RA 3L78A 5LCZA 3LFLA 2AV4A 3RDWA 2TIRA 1K3OA 5J4UA 3GKNA 4PUAA 4MF5A 2PVOC 3I43A 2B7KA 3LG6A 3PR8A 3LJRA 4AGSA 1A0FA 2XBIA 4V1Ap 1K0MA 2C3NA 3F6DA 1PD21 2FLSA 4HZ4A 1K0AA 3TKPA 4MJBA 4V2LA 1Z3EA 1TDIA 2HE3A 1YKCA 3GMFA 3KEBA 3FHKA 4FYBA 3D22A 4RI6A 2GTUA 1JLVA 3VI5A 4JE1A 2C8UA 3K8NA 4OFTA 1WP0A 3VPQA 4Q5NA 3KJYA 2FY6A 3M3MA 3ZVJD 4TR4A 4JRRA 4I2UA 3RPPA 4G10A 5D9XA 3KTLA 1XWCA 2PVQA 4BL7A 1SKRB 1TI3A 4H86A 3W8SA 4K1FA 1A8YA 2J23A 4K9ZA 5J41A 4L5OA 1FG4A 3GL3A 2RM5A 2AB6A 1N2AA 5DCGA 4KDUA 5DJMA 5HFIA 1FAAA 2KOKA 2RIIA 3IAM2 1OE8A 4Q5QA 5FT3A 2HLSA 1VRSD 2LTKA 2LNSA 1JFUA 1YF1A 5ID2A 4L5LA 2IIYA 3C8EA 1YQ1A 2HXKA 1T8EB 3HKRA 1W4VA 1X5DA 2KP1A 1MD3A 1XW9A 4E8HA 2NDOA 13GSA 3EU3A 5KEJA 5DDLA 3KM6A 2MMZA 2CT6A 1XFLA 1HD2A 3TJKA 3HVSA 3IR4A 1KNGA 4MJAA 3EWLA 4KA0A 4RI7A 4EXJA 2XC2A 2HZFA 1ZYEA 5ELAA 3SWLA 3N9JA 1TI1A 1E2YA 1FVKA 3DD3A 1R5PA 1ERTA 1YDKA 3TOTA 3FZ9A 4IP6A 4WKWA 1URMA 2C3TA 2V1MA 2X8GA 4HQZA 3F63A 3F4TA 3VWXA 4ECIA 1WWJA 1IYHA 1MEKA 1EOHA 3ZYWA 4ZL9A 3LWAA 1U6TA 2B5YA 4F0BA 3DEXA 3G7JA 2VCTA 3QFAC 4KX4A 2IFQB 3UBKA 4K2DA 2K6VA 4OFNA 4WF5A 2DLXA 5KN1A 4J56E 3ME8A 5J9BA 4GTUA 3NZNA 5D9TA 3GN3A 3ZFLA 5HQPA 3KP9A 3LYKA 1SL1B 1GSSA 1G6WA 1GTUA 4L0UA 3OR5A 4DSSA 4MF6A 4D73A 2NVLA 2V41A 5ECIB 5F8BA 2YZHA 3KP8A 3C71A 1MDIA 4TXVA 2REMA 5INYA 3HVXA 4IBPA 4ZB9A 4ZL8A 4N30A 5ECHB 2GQMA 3GKKA 3TCOA 3DKSA 5AISA 3TKSC 1OAZA 2PPTA 4F0CA 4KE3A 2K9FA 1VF4A 2MBSA 1W89A 4WR4A 5DBQA 1ST9A 4MZCA 5GAND 4GF0A 1WJKA 4ZBDA 2L57A 1SD9A 4HI7A 4Z7XA 2CQ9A 3GTUB 5JWRB 4FYCA 4K0GA 2FGXA 1DUGA 3R2QA 3NOFA 2RM6A 3H93A 4OWYA 2A2SA 2CVKA 3GSSA 4KH7A 3TJBA 3ZMKA 3IV4A 4ACSA 2VCQA 4BPYA 4N11A 3PGTA 2BMXA 1X9SB 3GH6A 4K8MA 2KP2A 1YF0A 2GS3A 2HSYA 1DE2A 2OE1A 4KDYA 3ZREA 1GSQA 1R26A 2ON7A 3D21A 4GCIA 3IPZA 4NPBA 1V98A 1VF3A 2YPMA 2C0GA 4WR5A 5GZZB 2H6YA 3DIEA 2ES7A 5H5SA 1M2AA 2ALBA 2F9SA 3TGZA 3E0UA 4KDXA 1M2DA 3LEFA
chains in the Genus database with same CATH superfamily
1XWGA 16GSA 3KTBA 4F82A 3GURA 3FEUA 4IQ1A 3I9V2 4WEYA 3BCIA 2DMLA 3VK9A 4XTSA 12GSA 1OE7A 3WD6A 3FYGA 2JACA 1FB0A 4NXIA 2GSRA 1DSBA 5A4WA 2VOCA 4ICYA 4MMMA 3ZIVA 5ELGA 3HA9A 4BL7B 4JBBA 3C1RA 2FWEA 4ZB6A 2H1DA 4NV2A 1ZYQB 3M0FA 4KF9A 4CY8A 3F6FA 5DVBA 2CX4A 3GKMA 2V2GA 2QA2A 4HOJA 3HY2A 1PL2A 3ISOA 4XS1A 2RLIA 5G30A 2JU5A 5B8AA 2HSHA 1YKAA 3VWUA 1A0RP 4F2IA 4IKHA 1THOA 4MPFA 3MDKA 3A3TA 2L4QA 2AAWA 4L0WA 2L6CA 1H75A 5ID2B 1S3CA 1SKSB 2ZUPA 5B6NA 2X99A 4ZBBA 5G5FA 3UVTA 4PXOA 4POMA 4QL7A 1S3AA 3GL5A 4YKFA 2GZPA 3O6TA 1RW1A 2DC5A 4G9HA 4LA1A 2D2ZA 3TB2A 3GKXA 2EIQA 11GSA 3NIVA 4QQ7A 3FK8A 2NTOA 3H4KA 2PWJA 3CQFA 2LJAA 1A2MA 6GSUA 3UIWA 1T1VA 5LNKe 5GSSA 2LSTA 4GLTA 1XVWA 2CZ3A 4TR1B 2AYTA 2YCDA 1UVZA 1GL8A 3G7IA 1K0BA 4PGTA 2GQLA 1F2EA 4PQ1A 3BOAA 2I9HA 1BAYA 2VL2C 5IPHA 1EWXA 1HNCA 2CAIA 3EMXA 3O3TA 4XCSA 1XPVA 2AHEA 5CAXA 5LD0A 4J57E 5ECMB 1EZKA 1ZZYA 5IIZA 4EL1A 1AC1A 1BJXA 3P90A 3W6GA 1XBSA 1VGLA 3HJPA 1V58A 1DE1A 3QD9A 1O8XA 5EVOA 3ZMLA 5HR2A 5ENUA 4CW9A 3F3QA 3ERGA 3ZL5A 4LLRA 4DSSB 5F07A 3F9UA 1ON4A 2R3XA 2YV9A 3UL3A 4HZ2A 3TJGA 4MZBA 3C73A 1AQVA 4K7NA 1X9WB 1T4YA 1SL2B 3MWHA 1K0DA 4N0ZA 3SBCA 3F4RA 3RPNA 3MAKA 1FVJA 2GSQA 4I2TA 2QSIA 4EKZA 5KOWA 3U5RE 2H01A 4FIWA 4K5SA 2YJHA 4IP1A 3DMLA 5HFKA 1WOUA 1QGVA 5DALA 3L9UA 1Z9HA 3W8JA 1ZYNA 3EC3A 2LEGA 3GSTA 2LS5A 3HD5A 5GSTA 5ECOB 2RUFA 1U3IA 1ERWA 3ZLPA 3EU4A 4EO3A 3HXSA 3D6IA 5A4VA 2GQKA 2TRXA 2I4AA 2CX3A 4OCEA 1RQMA 3L9VA 3L9SA 1I5GA 1GSFA 1OYJA 1ZCPA 4JU5A 4TKYA 1TRVA 2JZRA 2HFDA 4YAVA 4GSNA 2OA7A 3TKQA 1EOGA 2OACA 4ECCA 1F37A 1TXXA 2A2PA 3Q18A 5JWQB 2M46A 1Z6NA 1K3YA 2YJ7A 4ZXGA 1FHEA 4EC0A 2GSTA 4ID0A 1EV9A 1SK1A 3FZ5A 2XPDA 4PTSA 2VAFA 1SJIA 2FUG2 2F3MA 4ML6A 1EP8A 4PUFC 1M0UA 1MTCA 4TR3A 1MDJA 3F4SA 2PUKC 4YKGA 2A4HA 2AJQB 2VCXA 5E59A 1JZDA 4XIHA 2P31A 4NHZA 3P8WA 4MK3A 4ML1A 1HYUA 3HCZA 2H72A 2MZCA 4GWRA 3UBLA 4BVXA 2GDRA 3EPTA 2PERA 1N8JA 2L6DA 1ZGNA 1ZOFA 5J5NA 2ZNMA 2B1LA 4XS4A 3S9FA 1GWCA 3GUSA 1WIKA 3VLNA 1TRWA 1ABAA 2FD3A 3MNGA 2I81A 5ECRB 4XRAA 2LRCA 3FR9A 2VM2A 1O81A 2X8CA 3CSJA 3CSHA 4AJ7A 3PH9A 3ZRDA 1U87A 3IHGA 1BQ7A 1PKZA 2FWFA 1PQNA 1ERVA 2GGTA 2B7JA 1GUMA 4HU9A 2R37A 2R2JA 1GRXA 3A2VA 4F03A 3D4MA 4O32A 2F51A 5DQYA 2H0IA 5G2ZA 3F0IA 3G7YA 3KZQA 4EDYA 2N5BA 2VCWA 2H66A 4FQUA 2YN1A 1GSYA 2CA8A 4GRFA 3FZ4A 2B5XA 2IMEA 3FMWA 2VCVA 4OFMA 5ECKB 2IMDA 3KXOA 1X5CA 1O85A 1QK8A 6GSXA 3UOMA 4FO5A 3IDVA 1KTEA 1ML6A 4DSQA 5HR3A 3BJ5A 3TDGA 5ECQB 4EF0A 5D8IA 1NHYA 4G0KA 1JHBA 3WGDA 4Q5FA 1EV4A 2CVDA 1EEMA 3QAGA 1U3AA 1O7UA 3EMPA 5CNWA 4YQMA 5JWOB 2I3YA 20GSA 3VWWA 5IMCA 1JZRA 2OBKA 3FZAA 1A2JA 2DKIA 2MMNA 1X9MB 2N5AA 2K18A 3ZIJA 2IJYA 3R3EA 5HR1A 4K7IA 2H1AA 2H19A 4WBJA 1SJZA 1YZXA 1Q98A 3RAZA 2FA8A 1PN0A 2P0GA 4BA7A 2HT9A 3CYNA 3IC4A 3TKSE 5JCUA 2PN8A 4ZIJA 2M80A 2O89A 2H70A 3APQA 1F6MC 2BJXA 4TOPA 5G31A 5HR0A 1R5AA 2LRTA 3UVHA 2WULA 1ACVA 2YWMA 4MP4A 5IMFA 4KGIA 1FW1A 3E9JB 3P7XA 3CTFA 1AXDA 5CRDA 2ZCTA 3GFKA 3TRPA 4O5QA 5ECNB 3A2XA 2MBTA 2FA4A 4MA9A 2C3QA 4ULXA 4EVMA 5H5RA 4LMVA 1SL0B 2R0GA 6GSYA 1QFNA 1XCCA 14GSA 5C00A 3A5IA 1SD8A 4ZL7A 3FRCA 2I1UA 5DJLA 2R4VA 3KCMA 3D5JA 9GSSA 1TK0B 4X1UA 4HS1A 5ABRA 4MH2A 1UA5A 4OO5A 2KHPA 3GNJA 4G2EA 3BBYA 4XS6A 4N0VA 2WCIA 1QQ2A 3P2AA 2LQQA 4MH3A 1PA3A 5ECSA 1PGTA 3DRNA 5H5QA 3E3EA 3FR6A 4RQRA 2XPEA 1GLQA 3TUEA 5GAPD 2YWOA 3FW2A 2GZZA 2QGVA 3GYKA 4I8BA 1BG5A 1K3LA 3GH9A 6GSWA 5A5KA 2FCHA 4ZILA 1TP9A 3QPMA 1BYEA 1F3BA 3Q6OA 1GNEA 4I6XA 5CRWA 3KH9A 1O8WA 4DEJA 1QUWA 3TRXA 3VI7A 4BVXB 3EVIA 3C7MA 1NSWA 5BMUA 2LJKA 3VFIA 5J9CA 3QR6A 3EINA 3EYTA 3HDCA 4BWQA 4HU7A 2G2QA 4HUAA 2DKHA 6GSSA 4MDCA 3US3A 2IL3A 1XWKA 2LV3A 2IMFA 2PBJA 5G1LA 1QXHA 5IM9A 4IW9A 4WF4A 4YQUA 1G7OA 2QC7A 4TRXA 1PX6A 5D93A 1J9BA 3HJOA 1V57A 4POBA 2HRFA 1Y25A 3ZFBA 1GUHA 1M99A 3LXTA 5HFGA 10GSA 2X4AA 4MABA 4FH8A 5G5EA 2ON5A 2N5FA 4IHUA 2YWNA 1M3IA 1TK5B 4MJCA 1LJRA 4I5QA 1B9XC 3D0ZA 1UN2A 4YAPA 2C0EA 2LUSA 5EY6A 3IRAA 1T00A 1JLWA 4PQHA 3A5WA 3ERFA 4TW5A 3APOA 4K2XA 4G19A 1TJDA 4CHSA 5JCGA 3TJFA 1BX9A 4ECJA 4HQSA 1R7HA 2MYGA 1NM3A 2F8AA 5CO3A 2BTOT 2YOIA 3G9BA 3KIJA 1TW9A 4N10A 1B9YC 1OC8A 3LXZA 1TTZA 2B6MA 1GP1A 3CTGA 4RQXA 1VF1A 2C80A 4EUYA 2CAQA 4Z2RA 4D73B 2DJ1A 3IK9A 1B48A 2IMIA 2LRNA 5L71A 1O73A 4NMUA 1PX7A 4MNNA 2PMTA 2YANA 1U88A 4HJ2A 3GV1A 4POLA 1CQHA 2JADA 2EIRA 1GSUA 1OC9A 5JCWA 5IO0A 3QCPA 4ZB8A 1GUKA 3VWVA 4BVYA 4KNDA 2VLVA 3HZ8A 4KW6A 6GSTA 5KOXA 2CVBA 1EEJA 2O8VB 3DVXA 1WPIA 2DIYA 2WDUA 3ZTLA 2IPAA 4KSOA 1FO5A 2OE0A 4X0XA 4BIKA 3J7Yk 2DJKA 4HJMA 3MYDA 4CDOA 2IWTA 1IYIA 2H1GA 3IAS2 1V2AA 1UC7A 4V1Ag 1B4QA 3VURA 3IA1A 4PNFA 1F9MA 6GSVA 3EURA 2XHFA 5IO2A 2GVPA 1GULA 5IPGA 3GX8A 3U6VA 2OKAA 2E7PA 1QMVA 2RUEA 3A2WA 3QOUA 4NAXA 1GH2A 2E0QA 1GSEA 3C1SA 3QAWA 1EP7A 5EL8A 1SKWB 5D9WA 4KUNA 4O7HA 5D96A 5C04A 3H8QA 4ZBAA 2KUCA 2P5QA 4K6XA 3TKRA 5DAKA 2KLXA 4EE0A 3I69A 4PURA 2DSAA 2B1KA 3HZ4A 1GTBA 3TKSA 3LORA 1A24A 3IXRA 4P3YB 2DJ3A 4L8EA 1Z7RA 19GSA 2H74A 4GSTA 3FKFA 3Q19A 1OKDA 2O87A 1M9BA 1ZYPA 1YEPA 1WE0A 22GSA 3ZITA 1XWAA 5B7CA 4AJ6A 4J2FA 2V6KA 1YY7A 4KSMA 3H1NA 2JSZA 5BRTA 2FWHA 1KEBA 4OCFA 4LMWA 1XOAA 1I9DA 1GTAA 2JZSA 1T4ZA 1AQXA 2B5EA 1JZWA 3M1GA 3V1WA 4K7OA 2VM1A 2L4CA 2DIZA 2IN3A 1THXA 2PGTA 5KN2A 4WXTA 1PN9A 3BCKA 2EIOA 1V9WA 4NWYA 2QKEA 1X0RA 3GX0A 1PRXA 5B8BA 3LGCA 3ZVJA 4PX1A 5DCHA 3FR3A 3GA4A 2OJLA 2P5RA 3J7Yb 3L0HA 2L5LA 2C4JA 4KCAA 4MPGA 1PL1A 1GSDA 4A5PA 4JR6A 3D4TA 2LNTA 3UEMA 1EGRA 4JR4A 3RBTA 4O5RA 3HHVA 4IJIA 2WS2A 3N5OA 3H79A 1XZOA 2V32A 2VL9A 3CSIA 2R6KA 2E2MA 1VF2A 4MLYA 3HYPA 1FOVA 1Z5YE 3TJJA 4CY6A 3IBHA 4LL1B 2XBQA 3KD0A 1XWBA 4Z2TA 2FHEA 3QAVA 1AUCA 4TR1A 3IC8A 2A2RA 2HRNA 1O6JA 2VLUA 3AY8A 3DYRA 1ILOA 3QFBC 2PU9C 4K0NA 4BWSA 3WGEA 2HZEA 2FWGA 2GLRA 2O7KA 2G0FA 1X5EA 4POKA 5IOXA 1B4PA 4X43A 2VUPA 4ILFA 5FWGA 3QDNA 1NW2A 2AUVA 7GSSA 5IMZA 3CBUA 4IN0A 2DJ2A 4GXZA 3UAPA 2LJRA 1WRYA 2HSMA 3DWVA 2O85A 3IOSA 1TK8B 5F06A 2NBSA 2GT6A 2R5GA 4IVFA 2VIMA 5ECLB 2H8LA 2QA1A 2NPBA 5CYYA 4IJ3A 2Z9SA 1TRUA 4WETA 1Q4JA 1YJ6A 5E4WA 4PNGA 4E8EA 4TXOA 5AGYA 2WFCA 1A23A 4NHWA 2X8HA 1FB6A 2H6ZA 2J9HA 1OC9B 2IMKA 4ECBA 5IMDA 1LU4A 4DSRA 1XVQA 3GRXA 4BVYB 3RHBA 3BD2A 2VL2A 3MSZA 2L5OA 5AIVA 1M7TA 2K8VA 1A2LA 2H0GA 3WYWA 1XW5A 2GT5A 4AJ8A 1SK0A 5DALB 3IK7A 3UARA 4EDZA 1MDKA 3EE2A 4Z2UA 1HNAA 4MF7A 4IGJA 4HEA2 1LBKA 2WJUA 4IELA 1K0OA 1GTIA 3WGXA 4ISDA 1K0CA 2F8FA 2HYXA 2JZTA 2YNXA 3M9KA 1SJ6A 1ERUA 1TOFA 3CRTA 5IMAA 1A8LA 3RHCA 4KCEA 2R0CA 4AF2A 2OBIA 2VD0A 4IQAA 1HNBA 5DAKB 4XHMA 3VPTA 3DVWA 1JZOA 2YV7A 1M2BA 2C1YA 2DMMA 5KN0A 5DQSA 2VD1A 1SK2A 5B6MA 3HJMA 2H30A 1Z7PA 1Y6EA 2DJJA 3KH7A 1DBYA 1TRSA 18GSA 3ERWA 3L4NA 2CV4A 1BEDA 4DVCA 3WT2A 2K8SA 1G0TA 1KBNA 2FNOA 1G6YA 1PKWA 1ZMAA 1ZL9A 1R4WA 4GQCA 4XS4B 1TU8A 3LQ7A 5IOWA 2LQOA 4I97A 2DJ0A 2TRCP 4OD7A 3TRQA 1AQWA 1XXUA 1OVNA 1TKDB 1C72A 4USSA 4IS0A 1AAZA 2C0FA 1MD4A 3ZZXA 1OKTA 1K0NA 3KMOA 2V6OA 3M9JA 3CMIA 4OO4A 4G0IA 1RK4A 3QMXA 4V2MA 2H0HA 2VCZA 4YH2A 2JL4A 4JEDA 4YQVA 4TR0A 1GLPA 4XRDA 3UJ1A 2VO4A 4F9ZA 3LSZA 1SYRA 2H71A 3GHAA 3JCML 8GSSA 2YP6A 1H4OA 1XG8A 3DXBA 2C0DA 1J08A 1USBA 3IE3A 1OC3A 4KB3A 1SENA 4FYUA 1HQOA 5EPFA 3FY7A 3UMAA 2MMAA 1YEXA 2CZ2A 4TN8A 4HSCX 2B3SA 4LL4B 2WRTA 3ED3A 4JZQA 2L59A 3CXGA 1M3JA 2H1BA 1CQGA 4MJEA 2X64A 2HI7A 2MMOA 3I6AA 1SU9A 4KAEA 1WMJA 4MCUA 3KMNA 1J0FA 1S3RA 2IFQA 3KGKA 3HVVA 1Z6MA 1SYXA 1XW6A 1T7PB 1PSQA 2VLTA 2E2GA 5A4UA 1F3AA 2JSYA 1AW9A 2A4VA 5COHA 5CRHA 1E6BA 3CRUA 1B8XA 4MZWA 3PINA 5J3RA 2GZYA 2WGRA 3Q74A 3F8UA 2HZEB 1EGOA 1V40A 3DGQA 17GSA 2H75A 4PQIA 2M72A 4HDEA 2LKUA 5AN1A 2H76A 1XOBA 5AIXA 2WB9A 1M9AA 3LYPA 2OADA 4Q5RA 1AIUA 5F0GA 2GSSA 2VL3A 5CRGA 3IHQA 4EIQA 5G1KA 2H6XA 3M8NA 2DBCA 3APSA 1GNWA 1T3BA 4V2NA 2OE3A 5CREA 1NHOA 1FOHA 4WBRD 1TU7A 5FHIA 4GSSA 1S3DA 3GIXA 4OMVA 5F05A 2WZ9A 1PMTA 4TVEA 5D9VA 5KN3A 2EC4A 5IMVA 2YWIA 5D73A 5IQYA 3TOUA 4RUVA 5ECPB 4NV5A 1XIYA 3GTUA 4TXOB 2H73A 5CP1A 4O92A 3WT1A 1G7EA 4GQFA 4QL9A 2HNLA 3ME7A 2YZUA 3O76A 3F3RA 3L78A 5LCZA 3LFLA 2AV4A 3PPUA 3RDWA 2TIRA 1K3OA 5J4UA 3GKNA 4PUAA 4MF5A 2PVOC 3I43A 2B7KA 3LG6A 3PR8A 3LJRA 4AGSA 1A0FA 2XBIA 4V1Ap 1K0MA 2C3NA 3F6DA 1PD21 2FLSA 4G0LA 4HZ4A 1K0AA 3TKPA 4O5UA 4MJBA 4V2LA 1Z3EA 1TDIA 2HE3A 1YKCA 3GMFA 3KEBA 3FHKA 4FYBA 3D22A 4RI6A 2GTUA 1JLVA 3VI5A 4JE1A 2C8UA 3K8NA 4OFTA 1WP0A 3VPQA 4Q5NA 3KJYA 2FY6A 3M3MA 3ZVJD 4TR4A 4JRRA 4I2UA 3RPPA 4G10A 5D9XA 3KTLA 2HRKA 1XWCA 2PVQA 4BL7A 1SKRB 1TI3A 4H86A 3W8SA 4K1FA 1A8YA 2J23A 4K9ZA 5J41A 4L5OA 1FG4A 3LW9A 3GL3A 2RM5A 2AB6A 1N2AA 5DCGA 4KDUA 5DJMA 5HFIA 1FAAA 2KOKA 2RIIA 3IAM2 1OE8A 4Q5QA 5FT3A 2HLSA 1VRSD 2LTKA 2LNSA 1JFUA 1YF1A 5ID2A 4L5LA 4EIPA 2IIYA 3C8EA 1YQ1A 2HXKA 1T8EB 3HKRA 1W4VA 2R0PA 1X5DA 2KP1A 2X49A 1MD3A 1XW9A 4E8HA 2NDOA 13GSA 3EU3A 5KEJA 5DDLA 3KM6A 2MMZA 2CT6A 1XFLA 1HD2A 3TJKA 3HVSA 3IR4A 1KNGA 4MJAA 3EWLA 4KA0A 4RI7A 4EXJA 2XC2A 2HZFA 1ZYEA 5ELAA 3SWLA 3N9JA 1TI1A 1E2YA 1FVKA 3DD3A 1R5PA 1ERTA 1YDKA 3TOTA 3FZ9A 4IP6A 4WKWA 1URMA 2C3TA 2V1MA 2X8GA 4HQZA 3F63A 3F4TA 3VWXA 4ECIA 1WWJA 1IYHA 1MEKA 1EOHA 3ZYWA 4X4JA 4ZL9A 4K5RA 3LWAA 1U6TA 2B5YA 4F0BA 3DEXA 3G7JA 2VCTA 1PFOA 3QFAC 2UZ8A 4KX4A 2IFQB 3UBKA 4K2DA 2K6VA 4OFNA 4WF5A 2DLXA 5KN1A 4J56E 3ME8A 5J9BA 2HRAA 4GTUA 3NZNA 5D9TA 3GN3A 3ZFLA 5HQPA 3KP9A 3LYKA 1SL1B 1GSSA 1G6WA 1GTUA 4L0UA 3OR5A 4DSSA 4MF6A 4D73A 2NVLA 2V41A 5ECIB 5F8BA 2YZHA 3KP8A 3C71A 1MDIA 4TXVA 2REMA 5INYA 3HVNA 3HVXA 4IBPA 4ZB9A 4ZL8A 4N30A 2GQMA 5ECHB 3GKKA 3TCOA 3DKSA 5AISA 3TKSC 1OAZA 2PPTA 4F0CA 4KE3A 2K9FA 1VF4A 2MBSA 3MIXA 1W89A 4WR4A 5DBQA 1ST9A 4MZCA 5GAND 4GF0A 1WJKA 4ZBDA 2L57A 1SD9A 4HI7A 4Z7XA 2CQ9A 3GTUB 5JWRB 4FYCA 4K0GA 2FGXA 1DUGA 3R2QA 3NOFA 2RM6A 3H93A 4OWYA 2A2SA 2CVKA 3GSSA 4KH7A 3TJBA 3ZMKA 3IV4A 4ACSA 2VCQA 4BPYA 4N11A 3PGTA 2BMXA 1X9SB 3GH6A 4K8MA 2KP2A 1YF0A 2GS3A 2HSYA 1DE2A 2OE1A 4KDYA 3ZREA 1GSQA 1R26A 2ON7A 3D21A 4GCIA 3IPZA 4NPBA 1V98A 1VF3A 2YPMA 2C0GA 4WR5A 5GZZB 2H6YA 3DIEA 2ES7A 5H5SA 1M2AA 2ALBA 2F9SA 3TGZA 3E0UA 4KDXA 1M2DA 3LEFA
chains in the Genus database with same CATH topology
1XWGA 16GSA 3KTBA 4F82A 3GURA 3FEUA 4IQ1A 3I9V2 4WEYA 3BCIA 2DMLA 3VK9A 4XTSA 12GSA 1OE7A 3WD6A 3FYGA 2JACA 1FB0A 4NXIA 2GSRA 1DSBA 5A4WA 2VOCA 4ICYA 4MMMA 3ZIVA 5ELGA 3HA9A 4BL7B 4JBBA 3C1RA 2FWEA 4ZB6A 2H1DA 4NV2A 1ZYQB 3M0FA 4KF9A 4CY8A 3F6FA 5DVBA 2CX4A 3GKMA 2V2GA 2QA2A 4HOJA 3HY2A 1PL2A 3ISOA 4XS1A 2RLIA 5G30A 2JU5A 5B8AA 2HSHA 1YKAA 3VWUA 1A0RP 4F2IA 4IKHA 1THOA 4MPFA 3MDKA 3A3TA 2L4QA 2AAWA 4L0WA 2L6CA 1H75A 5ID2B 1S3CA 1SKSB 2ZUPA 5B6NA 2X99A 4ZBBA 5G5FA 3UVTA 4PXOA 4POMA 4QL7A 1S3AA 3GL5A 4YKFA 2GZPA 3O6TA 1RW1A 2DC5A 4G9HA 4LA1A 2D2ZA 3TB2A 3GKXA 2EIQA 11GSA 3NIVA 4QQ7A 3FK8A 2NTOA 3H4KA 2PWJA 2LJAA 1A2MA 6GSUA 3UIWA 1T1VA 5LNKe 5GSSA 2LSTA 4GLTA 1XVWA 2CZ3A 4TR1B 2AYTA 2YCDA 1UVZA 1GL8A 3G7IA 1K0BA 4PGTA 2GQLA 1F2EA 4PQ1A 3BOAA 2I9HA 1BAYA 2VL2C 5IPHA 1EWXA 1HNCA 2CAIA 3EMXA 3O3TA 4XCSA 1XPVA 2AHEA 5CAXA 5LD0A 4J57E 5ECMB 1EZKA 1ZZYA 5IIZA 4EL1A 1AC1A 1BJXA 3P90A 3W6GA 1XBSA 1VGLA 3HJPA 1V58A 1DE1A 3QD9A 1O8XA 5EVOA 3ZMLA 5HR2A 5ENUA 4CW9A 3F3QA 3ERGA 3ZL5A 4LLRA 4DSSB 5F07A 3F9UA 1ON4A 2R3XA 2YV9A 3UL3A 4HZ2A 3TJGA 4MZBA 3C73A 1AQVA 4K7NA 1X9WB 1T4YA 1SL2B 3MWHA 1K0DA 4N0ZA 3SBCA 3F4RA 3RPNA 3MAKA 1FVJA 2GSQA 4I2TA 2QSIA 4EKZA 5KOWA 3U5RE 2H01A 4FIWA 4K5SA 2YJHA 4IP1A 3DMLA 5HFKA 1WOUA 1QGVA 5DALA 3L9UA 1Z9HA 3W8JA 1ZYNA 3EC3A 2LEGA 3GSTA 2LS5A 3HD5A 5GSTA 5ECOB 2RUFA 1U3IA 1ERWA 3ZLPA 3EU4A 4EO3A 3HXSA 3D6IA 5A4VA 2GQKA 2TRXA 2I4AA 2CX3A 4OCEA 1RQMA 3L9VA 3L9SA 1I5GA 1GSFA 1OYJA 1ZCPA 4JU5A 4TKYA 1TRVA 2JZRA 2HFDA 4YAVA 4GSNA 2OA7A 3TKQA 1EOGA 2OACA 4ECCA 1F37A 1TXXA 2A2PA 3Q18A 5JWQB 2M46A 1Z6NA 1K3YA 2YJ7A 4ZXGA 1FHEA 4EC0A 2GSTA 4ID0A 1EV9A 1SK1A 3FZ5A 2XPDA 4PTSA 2VAFA 1SJIA 2FUG2 2F3MA 4ML6A 1EP8A 4PUFC 1M0UA 1MTCA 4TR3A 1MDJA 3F4SA 2PUKC 4YKGA 2A4HA 2AJQB 2VCXA 5E59A 1JZDA 4XIHA 2P31A 4NHZA 3P8WA 4MK3A 4ML1A 1HYUA 3HCZA 2H72A 2MZCA 4GWRA 3UBLA 4BVXA 2GDRA 3EPTA 2PERA 1N8JA 2L6DA 1ZGNA 1ZOFA 5J5NA 2ZNMA 2B1LA 4XS4A 3S9FA 1GWCA 3GUSA 1WIKA 3VLNA 1TRWA 1ABAA 2FD3A 3MNGA 2I81A 5ECRB 4XRAA 2LRCA 3FR9A 2VM2A 1O81A 2X8CA 3CSJA 3CSHA 4AJ7A 3PH9A 3ZRDA 1U87A 3IHGA 1BQ7A 1PKZA 2FWFA 1PQNA 1ERVA 2GGTA 2B7JA 1GUMA 4HU9A 2R37A 2R2JA 1GRXA 3A2VA 4F03A 3D4MA 4O32A 2F51A 5DQYA 2H0IA 5G2ZA 3F0IA 3G7YA 3KZQA 4EDYA 2N5BA 2VCWA 2H66A 4FQUA 2YN1A 1GSYA 2CA8A 4GRFA 3FZ4A 2B5XA 2IMEA 3FMWA 2VCVA 4OFMA 5ECKB 2IMDA 3KXOA 1X5CA 1O85A 1QK8A 6GSXA 3UOMA 4FO5A 3IDVA 1KTEA 1ML6A 4DSQA 5HR3A 3BJ5A 3TDGA 5ECQB 4EF0A 5D8IA 1NHYA 4G0KA 1JHBA 3WGDA 4Q5FA 1EV4A 2CVDA 1EEMA 3QAGA 1U3AA 1O7UA 3EMPA 5CNWA 4YQMA 5JWOB 2I3YA 20GSA 3VWWA 5IMCA 1JZRA 2OBKA 3FZAA 1A2JA 2DKIA 2MMNA 1X9MB 2N5AA 2K18A 3ZIJA 2IJYA 3R3EA 5HR1A 4K7IA 2H1AA 2H19A 4WBJA 1SJZA 1YZXA 1Q98A 3RAZA 2FA8A 1PN0A 2P0GA 4BA7A 2HT9A 3CYNA 3IC4A 3TKSE 5JCUA 2PN8A 4ZIJA 2M80A 2O89A 2H70A 3APQA 1F6MC 2BJXA 4TOPA 5G31A 5HR0A 1R5AA 2LRTA 3UVHA 2WULA 1ACVA 2YWMA 4MP4A 5IMFA 4KGIA 1FW1A 3E9JB 3P7XA 3CTFA 1AXDA 5CRDA 2ZCTA 3GFKA 3TRPA 4O5QA 5ECNB 3A2XA 2MBTA 2FA4A 4MA9A 2C3QA 4ULXA 4EVMA 5H5RA 4LMVA 1SL0B 2R0GA 6GSYA 1QFNA 1XCCA 14GSA 5C00A 3A5IA 1SD8A 4ZL7A 3FRCA 2I1UA 5DJLA 2R4VA 3KCMA 3D5JA 9GSSA 1TK0B 4X1UA 4HS1A 5ABRA 4MH2A 1UA5A 4OO5A 2KHPA 3GNJA 4G2EA 3BBYA 4XS6A 4N0VA 2WCIA 1QQ2A 3P2AA 2LQQA 4MH3A 1PA3A 5ECSA 1PGTA 3DRNA 5H5QA 3E3EA 3FR6A 4RQRA 2XPEA 1GLQA 3TUEA 5GAPD 2YWOA 3FW2A 2GZZA 2QGVA 3GYKA 4I8BA 1BG5A 1K3LA 3GH9A 6GSWA 5A5KA 2FCHA 4ZILA 1TP9A 3QPMA 1BYEA 1F3BA 3Q6OA 1GNEA 4I6XA 5CRWA 3KH9A 1O8WA 4DEJA 1QUWA 3TRXA 3VI7A 4BVXB 3EVIA 3C7MA 1NSWA 5BMUA 2LJKA 3VFIA 5J9CA 3QR6A 3EINA 3EYTA 3HDCA 4BWQA 4HU7A 2G2QA 4HUAA 2DKHA 6GSSA 4MDCA 3US3A 2IL3A 1XWKA 2LV3A 2IMFA 2PBJA 5G1LA 1QXHA 5IM9A 4IW9A 4WF4A 4YQUA 1G7OA 2QC7A 4TRXA 1PX6A 5D93A 1J9BA 3HJOA 1V57A 4POBA 2HRFA 1Y25A 3ZFBA 1GUHA 1M99A 3LXTA 5HFGA 10GSA 2X4AA 4MABA 4FH8A 5G5EA 2ON5A 2N5FA 4IHUA 2YWNA 1TK5B 4MJCA 1LJRA 4I5QA 1B9XC 3D0ZA 1UN2A 4YAPA 2C0EA 2LUSA 5EY6A 3IRAA 1T00A 1JLWA 4PQHA 3A5WA 3ERFA 4TW5A 3APOA 4K2XA 4G19A 1TJDA 4CHSA 5JCGA 3TJFA 1BX9A 4ECJA 4HQSA 1R7HA 2MYGA 1NM3A 2F8AA 5CO3A 2BTOT 2YOIA 3G9BA 3KIJA 1TW9A 4N10A 1B9YC 1OC8A 3LXZA 1TTZA 2B6MA 1GP1A 3CTGA 4RQXA 1VF1A 2C80A 4EUYA 2CAQA 4Z2RA 4D73B 2DJ1A 3IK9A 1B48A 2IMIA 2LRNA 5L71A 1O73A 4NMUA 1PX7A 4MNNA 2PMTA 2YANA 1U88A 4HJ2A 3GV1A 4POLA 1CQHA 2JADA 2EIRA 1GSUA 1OC9A 5JCWA 5IO0A 3QCPA 4ZB8A 1GUKA 3VWVA 4BVYA 4KNDA 2VLVA 3HZ8A 4KW6A 6GSTA 5KOXA 2CVBA 1EEJA 2O8VB 3DVXA 1WPIA 2DIYA 2WDUA 3ZTLA 2IPAA 4KSOA 1FO5A 2OE0A 4X0XA 3J7Yk 2DJKA 4HJMA 3MYDA 4CDOA 2IWTA 1IYIA 2H1GA 3IAS2 1V2AA 1UC7A 4V1Ag 1B4QA 3VURA 3IA1A 4PNFA 1F9MA 6GSVA 3EURA 2XHFA 5IO2A 2GVPA 1GULA 5IPGA 3GX8A 3U6VA 2OKAA 2E7PA 1QMVA 2RUEA 3A2WA 3QOUA 4NAXA 1GH2A 2E0QA 1GSEA 3C1SA 3QAWA 1EP7A 5EL8A 1SKWB 5D9WA 4KUNA 4O7HA 5D96A 5C04A 3H8QA 4ZBAA 2KUCA 2P5QA 4K6XA 3TKRA 5DAKA 2KLXA 4EE0A 3I69A 4PURA 2DSAA 2B1KA 3HZ4A 1GTBA 3TKSA 3LORA 1A24A 3IXRA 4P3YB 2DJ3A 4L8EA 1Z7RA 19GSA 2H74A 4GSTA 3FKFA 3Q19A 1OKDA 2O87A 1M9BA 1ZYPA 1YEPA 1WE0A 22GSA 3ZITA 1XWAA 5B7CA 4AJ6A 4J2FA 2V6KA 1YY7A 4KSMA 3H1NA 2JSZA 5BRTA 2FWHA 1KEBA 4OCFA 4LMWA 1XOAA 1I9DA 1GTAA 2JZSA 1T4ZA 1AQXA 2B5EA 1JZWA 3M1GA 3V1WA 4K7OA 2VM1A 2L4CA 2DIZA 2IN3A 1THXA 2PGTA 5KN2A 4WXTA 1PN9A 3BCKA 2EIOA 1V9WA 4NWYA 2QKEA 1X0RA 3GX0A 1PRXA 5B8BA 3LGCA 3ZVJA 4PX1A 5DCHA 3FR3A 3GA4A 2OJLA 2P5RA 3J7Yb 3L0HA 2L5LA 2C4JA 4KCAA 4MPGA 1PL1A 1GSDA 4A5PA 4JR6A 3D4TA 2LNTA 3UEMA 1EGRA 4JR4A 3RBTA 4O5RA 3HHVA 4IJIA 2WS2A 3N5OA 3H79A 1XZOA 2V32A 2VL9A 3CSIA 2R6KA 2E2MA 1VF2A 4MLYA 3HYPA 1FOVA 1Z5YE 3TJJA 4CY6A 3IBHA 4LL1B 2XBQA 3KD0A 1XWBA 4Z2TA 2FHEA 3QAVA 1AUCA 4TR1A 3IC8A 2A2RA 2HRNA 1O6JA 2VLUA 3AY8A 3DYRA 1ILOA 3QFBC 2PU9C 4K0NA 4BWSA 3WGEA 2HZEA 2FWGA 2GLRA 2O7KA 2G0FA 1X5EA 4POKA 5IOXA 1B4PA 4X43A 2VUPA 4ILFA 5FWGA 3QDNA 1NW2A 2AUVA 7GSSA 5IMZA 3CBUA 4IN0A 2DJ2A 4GXZA 3UAPA 2LJRA 1WRYA 2HSMA 3DWVA 2O85A 3IOSA 1TK8B 5F06A 2NBSA 2GT6A 2R5GA 4IVFA 2VIMA 5ECLB 2H8LA 2QA1A 2NPBA 5CYYA 4IJ3A 2Z9SA 1TRUA 4WETA 1Q4JA 1YJ6A 5E4WA 4PNGA 4E8EA 4TXOA 5AGYA 2WFCA 1A23A 4NHWA 2X8HA 1FB6A 2H6ZA 2J9HA 1OC9B 2IMKA 4ECBA 5IMDA 1LU4A 4DSRA 1XVQA 3GRXA 4BVYB 3RHBA 3BD2A 2VL2A 3MSZA 2L5OA 5AIVA 1M7TA 2K8VA 1A2LA 2H0GA 3WYWA 1XW5A 2GT5A 4AJ8A 1SK0A 5DALB 3IK7A 3UARA 4EDZA 1MDKA 3EE2A 4Z2UA 1HNAA 4MF7A 4IGJA 4HEA2 1LBKA 2WJUA 4IELA 1K0OA 1GTIA 3WGXA 4ISDA 1K0CA 2F8FA 2HYXA 2JZTA 2YNXA 3M9KA 1SJ6A 1ERUA 1TOFA 3CRTA 5IMAA 1A8LA 3RHCA 4KCEA 2R0CA 4AF2A 2OBIA 2VD0A 4IQAA 1HNBA 5DAKB 4XHMA 3VPTA 3DVWA 1JZOA 2YV7A 1M2BA 2C1YA 2DMMA 5KN0A 5DQSA 2VD1A 1SK2A 5B6MA 3HJMA 2H30A 1Z7PA 1Y6EA 2DJJA 3KH7A 1DBYA 1TRSA 18GSA 3ERWA 3L4NA 2CV4A 1BEDA 4DVCA 3WT2A 2K8SA 1G0TA 1KBNA 2FNOA 1G6YA 1PKWA 1ZMAA 1ZL9A 1R4WA 4GQCA 4XS4B 1TU8A 3LQ7A 5IOWA 2LQOA 4I97A 2DJ0A 2TRCP 4OD7A 3TRQA 1AQWA 1XXUA 1OVNA 1TKDB 1C72A 4USSA 4IS0A 1AAZA 2C0FA 1MD4A 3ZZXA 1OKTA 1K0NA 3KMOA 2V6OA 3M9JA 3CMIA 4OO4A 4G0IA 1RK4A 3QMXA 4V2MA 2H0HA 2VCZA 4YH2A 2JL4A 4JEDA 4YQVA 4TR0A 1GLPA 4XRDA 3UJ1A 2VO4A 4F9ZA 3LSZA 1SYRA 2H71A 3GHAA 3JCML 8GSSA 2YP6A 1H4OA 3DXBA 2C0DA 1J08A 1USBA 3IE3A 1OC3A 4KB3A 1SENA 4FYUA 1HQOA 5EPFA 3FY7A 3UMAA 2MMAA 1YEXA 2CZ2A 4TN8A 2B3SA 4LL4B 2WRTA 3ED3A 4JZQA 2L59A 3CXGA 2H1BA 1CQGA 4MJEA 2X64A 2HI7A 2MMOA 3I6AA 1SU9A 4KAEA 1WMJA 4MCUA 3KMNA 1J0FA 2IFQA 3KGKA 3HVVA 1Z6MA 1SYXA 1XW6A 1T7PB 1PSQA 2VLTA 2E2GA 5A4UA 1F3AA 2JSYA 1AW9A 2A4VA 5COHA 5CRHA 1E6BA 3CRUA 1B8XA 4MZWA 3PINA 5J3RA 2GZYA 2WGRA 3Q74A 3F8UA 2HZEB 1EGOA 1V40A 3DGQA 17GSA 2H75A 4PQIA 2M72A 4HDEA 2LKUA 5AN1A 2H76A 1XOBA 5AIXA 2WB9A 1M9AA 3LYPA 2OADA 4Q5RA 1AIUA 5F0GA 2GSSA 2VL3A 5CRGA 3IHQA 4EIQA 5G1KA 2H6XA 3M8NA 2DBCA 3APSA 1GNWA 1T3BA 4V2NA 2OE3A 5CREA 1NHOA 1FOHA 4WBRD 1TU7A 5FHIA 4GSSA 1S3DA 3GIXA 4OMVA 5F05A 2WZ9A 1PMTA 4TVEA 5D9VA 5KN3A 2EC4A 5IMVA 2YWIA 5D73A 5IQYA 3TOUA 4RUVA 5ECPB 4NV5A 1XIYA 3GTUA 4TXOB 2H73A 5CP1A 4O92A 3WT1A 1G7EA 4GQFA 4QL9A 2HNLA 3ME7A 2YZUA 3O76A 3F3RA 3L78A 5LCZA 3LFLA 2AV4A 3PPUA 3RDWA 2TIRA 1K3OA 5J4UA 3GKNA 4PUAA 4MF5A 2PVOC 3I43A 2B7KA 3LG6A 3PR8A 3LJRA 4AGSA 1A0FA 2XBIA 4V1Ap 1K0MA 2C3NA 3F6DA 1PD21 2FLSA 4G0LA 4HZ4A 1K0AA 3TKPA 4O5UA 4MJBA 4V2LA 1Z3EA 1TDIA 2HE3A 1YKCA 3GMFA 3KEBA 3FHKA 4FYBA 3D22A 4RI6A 2GTUA 1JLVA 3VI5A 4JE1A 2C8UA 3K8NA 4OFTA 1WP0A 3VPQA 4Q5NA 3KJYA 2FY6A 3M3MA 3ZVJD 4TR4A 4JRRA 4I2UA 3RPPA 4G10A 5D9XA 3KTLA 2HRKA 1XWCA 2PVQA 4BL7A 1SKRB 1TI3A 4H86A 3W8SA 4K1FA 1A8YA 2J23A 4K9ZA 5J41A 4L5OA 1FG4A 3LW9A 3GL3A 2RM5A 2AB6A 1N2AA 5DCGA 4KDUA 5DJMA 5HFIA 1FAAA 2KOKA 2RIIA 3IAM2 1OE8A 4Q5QA 5FT3A 2HLSA 1VRSD 2LTKA 2LNSA 1JFUA 1YF1A 5ID2A 4L5LA 4EIPA 2IIYA 3C8EA 1YQ1A 2HXKA 1T8EB 3HKRA 1W4VA 2R0PA 1X5DA 2KP1A 2X49A 1MD3A 1XW9A 4E8HA 2NDOA 13GSA 3EU3A 5KEJA 5DDLA 3KM6A 2MMZA 2CT6A 1XFLA 1HD2A 3TJKA 3HVSA 3IR4A 1KNGA 4MJAA 3EWLA 4KA0A 4RI7A 4EXJA 2XC2A 2HZFA 1ZYEA 5ELAA 3SWLA 3N9JA 1TI1A 1E2YA 1FVKA 3DD3A 1R5PA 1ERTA 1YDKA 3TOTA 3FZ9A 4IP6A 4WKWA 1URMA 2C3TA 2V1MA 2X8GA 4HQZA 3F63A 3F4TA 3VWXA 4ECIA 1WWJA 1IYHA 1MEKA 1EOHA 3ZYWA 4X4JA 4ZL9A 4K5RA 3LWAA 1U6TA 2B5YA 4F0BA 3DEXA 3G7JA 2VCTA 3QFAC 2UZ8A 4KX4A 2IFQB 3UBKA 4K2DA 2K6VA 4OFNA 4WF5A 2DLXA 5KN1A 4J56E 3ME8A 5J9BA 2HRAA 4GTUA 3NZNA 5D9TA 3GN3A 3ZFLA 5HQPA 3KP9A 3LYKA 1SL1B 1GSSA 1G6WA 1GTUA 4L0UA 3OR5A 4DSSA 4MF6A 4D73A 2NVLA 2V41A 5ECIB 5F8BA 2YZHA 3KP8A 3C71A 1MDIA 4TXVA 2REMA 5INYA 3HVXA 4IBPA 4ZB9A 4ZL8A 4N30A 2GQMA 5ECHB 3GKKA 3TCOA 3DKSA 5AISA 3TKSC 1OAZA 2PPTA 4F0CA 4KE3A 2K9FA 1VF4A 2MBSA 3MIXA 1W89A 4WR4A 5DBQA 1ST9A 4MZCA 5GAND 4GF0A 1WJKA 4ZBDA 2L57A 1SD9A 4HI7A 4Z7XA 2CQ9A 3GTUB 5JWRB 4FYCA 4K0GA 2FGXA 1DUGA 3R2QA 3NOFA 2RM6A 3H93A 4OWYA 2A2SA 2CVKA 3GSSA 4KH7A 3TJBA 3ZMKA 3IV4A 4ACSA 2VCQA 4BPYA 4N11A 3PGTA 2BMXA 1X9SB 3GH6A 4K8MA 2KP2A 1YF0A 2GS3A 2HSYA 1DE2A 2OE1A 4KDYA 3ZREA 1GSQA 1R26A 2ON7A 3D21A 4GCIA 3IPZA 4NPBA 1V98A 1VF3A 2YPMA 2C0GA 4WR5A 5GZZB 2H6YA 3DIEA 2ES7A 5H5SA 1M2AA 2ALBA 2F9SA 3TGZA 3E0UA 4KDXA 1M2DA 3LEFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XWG A;  16GS A;  3KTB A;  4F82 A;  3GUR A;  3FEU A;  4IQ1 A;  3I9V 2;  4WEY A;  3BCI A;  2DML A;  3VK9 A;  4XTS A;  12GS A;  1OE7 A;  3WD6 A;  3FYG A;  2JAC A;  1FB0 A;  4NXI A;  2GSR A;  1DSB A;  5A4W A;  2VOC A;  4MMM A;  3ZIV A;  5ELG A;  3HA9 A;  4JBB A;  3C1R A;  2FWE A;  4ZB6 A;  2H1D A;  4NV2 A;  1ZYQ B;  3M0F A;  3F6F A;  5DVB A;  2CX4 A;  3GKM A;  2V2G A;  4HOJ A;  3HY2 A;  1PL2 A;  3ISO A;  4XS1 A;  2RLI A;  5G30 A;  2JU5 A;  5B8A A;  2HSH A;  1YKA A;  3VWU A;  1A0R P;  4F2I A;  4IKH A;  1THO A;  4MPF A;  3MDK A;  3A3T A;  2L4Q A;  2AAW A;  4L0W A;  2L6C A;  1H75 A;  5ID2 B;  1S3C A;  1SKS B;  2ZUP A;  5B6N A;  2X99 A;  4ZBB A;  5G5F A;  3UVT A;  4PXO A;  4POM A;  4QL7 A;  1S3A A;  3GL5 A;  2GZP A;  3O6T A;  1RW1 A;  2DC5 A;  4G9H A;  4LA1 A;  2D2Z A;  3TB2 A;  3GKX A;  2EIQ A;  11GS A;  3NIV A;  4QQ7 A;  3FK8 A;  2NTO A;  3H4K A;  2PWJ A;  2LJA A;  1A2M A;  6GSU A;  3UIW A;  1T1V A;  5LNK e;  5GSS A;  2LST A;  4GLT A;  1XVW A;  2CZ3 A;  4TR1 B;  2AYT A;  2YCD A;  1UVZ A;  1GL8 A;  3G7I A;  1K0B A;  4PGT A;  2GQL A;  1F2E A;  4PQ1 A;  3BOA A;  2I9H A;  1BAY A;  2VL2 C;  5IPH A;  1EWX A;  1HNC A;  2CAI A;  3EMX A;  3O3T A;  4XCS A;  1XPV A;  2AHE A;  5CAX A;  5LD0 A;  4J57 E;  5ECM B;  1EZK A;  1ZZY A;  5IIZ A;  4EL1 A;  1AC1 A;  1BJX A;  3P90 A;  3W6G A;  1XBS A;  1VGL A;  3HJP A;  1V58 A;  1DE1 A;  3QD9 A;  1O8X A;  5EVO A;  3ZML A;  5HR2 A;  5ENU A;  4CW9 A;  3F3Q A;  3ERG A;  3ZL5 A;  4LLR A;  4DSS B;  5F07 A;  3F9U A;  1ON4 A;  2R3X A;  2YV9 A;  3UL3 A;  4HZ2 A;  3TJG A;  4MZB A;  3C73 A;  1AQV A;  4K7N A;  1X9W B;  1T4Y A;  1SL2 B;  3MWH A;  1K0D A;  4N0Z A;  3SBC A;  3F4R A;  3RPN A;  3MAK A;  1FVJ A;  2GSQ A;  4I2T A;  2QSI A;  4EKZ A;  3U5R E;  2H01 A;  4FIW A;  2YJH A;  4IP1 A;  3DML A;  5HFK A;  1WOU A;  1QGV A;  5DAL A;  3L9U A;  1Z9H A;  3W8J A;  3EC3 A;  2LEG A;  3GST A;  2LS5 A;  3HD5 A;  5GST A;  5ECO B;  2RUF A;  1U3I A;  1ERW A;  3ZLP A;  3EU4 A;  4EO3 A;  3HXS A;  3D6I A;  5A4V A;  2GQK A;  2TRX A;  2I4A A;  2CX3 A;  4OCE A;  1RQM A;  3L9V A;  3L9S A;  1I5G A;  1GSF A;  1OYJ A;  1ZCP A;  4JU5 A;  4TKY A;  1TRV A;  2JZR A;  2HFD A;  4YAV A;  4GSN A;  2OA7 A;  3TKQ A;  1EOG A;  2OAC A;  4ECC A;  1F37 A;  1TXX A;  3Q18 A;  5JWQ B;  2M46 A;  1Z6N A;  1K3Y A;  2YJ7 A;  4ZXG A;  1FHE A;  4EC0 A;  2GST A;  4ID0 A;  1EV9 A;  1SK1 A;  3FZ5 A;  2XPD A;  2VAF A;  1SJI A;  2FUG 2;  2F3M A;  4ML6 A;  1EP8 A;  4PUF C;  1M0U A;  1MTC A;  4TR3 A;  1MDJ A;  3F4S A;  2PUK C;  2AJQ B;  2VCX A;  5E59 A;  1JZD A;  4XIH A;  2P31 A;  4NHZ A;  3P8W A;  4MK3 A;  4ML1 A;  1HYU A;  3HCZ A;  2H72 A;  2MZC A;  4GWR A;  3UBL A;  4BVX A;  2GDR A;  2PER A;  1N8J A;  2L6D A;  1ZGN A;  1ZOF A;  5J5N A;  2ZNM A;  2B1L A;  4XS4 A;  3S9F A;  1GWC A;  3GUS A;  1WIK A;  3VLN A;  1TRW A;  1ABA A;  2FD3 A;  3MNG A;  2I81 A;  5ECR B;  4XRA A;  2LRC A;  3FR9 A;  2VM2 A;  1O81 A;  2X8C A;  3CSJ A;  3CSH A;  4AJ7 A;  3PH9 A;  3ZRD A;  1U87 A;  1BQ7 A;  1PKZ A;  2FWF A;  1PQN A;  1ERV A;  2GGT A;  2B7J A;  1GUM A;  4HU9 A;  2R37 A;  2R2J A;  1GRX A;  3A2V A;  4F03 A;  3D4M A;  4O32 A;  2F51 A;  5DQY A;  2H0I A;  5G2Z A;  3F0I A;  3G7Y A;  3KZQ A;  4EDY A;  2N5B A;  2VCW A;  2H66 A;  2YN1 A;  1GSY A;  2CA8 A;  4GRF A;  3FZ4 A;  2B5X A;  2IME A;  2VCV A;  4OFM A;  5ECK B;  2IMD A;  3KXO A;  1X5C A;  1O85 A;  1QK8 A;  6GSX A;  3UOM A;  4FO5 A;  3IDV A;  1KTE A;  1ML6 A;  4DSQ A;  5HR3 A;  3BJ5 A;  3TDG A;  5ECQ B;  4EF0 A;  5D8I A;  1NHY A;  1JHB A;  3WGD A;  4Q5F A;  1EV4 A;  2CVD A;  1EEM A;  3QAG A;  1U3A A;  1O7U A;  3EMP A;  5CNW A;  4YQM A;  5JWO B;  2I3Y A;  20GS A;  3VWW A;  5IMC A;  1JZR A;  2OBK A;  3FZA A;  1A2J A;  2MMN A;  1X9M B;  2N5A A;  2K18 A;  3ZIJ A;  2IJY A;  5HR1 A;  4K7I A;  2H1A A;  2H19 A;  4WBJ A;  1SJZ A;  1YZX A;  1Q98 A;  3RAZ A;  2FA8 A;  2P0G A;  4BA7 A;  2HT9 A;  3CYN A;  3IC4 A;  3TKS E;  5JCU A;  2PN8 A;  4ZIJ A;  2M80 A;  2O89 A;  2H70 A;  3APQ A;  1F6M C;  2BJX A;  4TOP A;  5G31 A;  5HR0 A;  1R5A A;  2LRT A;  3UVH A;  2WUL A;  1ACV A;  2YWM A;  4MP4 A;  5IMF A;  4KGI A;  1FW1 A;  3E9J B;  3P7X A;  3CTF A;  1AXD A;  5CRD A;  2ZCT A;  3GFK A;  3TRP A;  5ECN B;  3A2X A;  2MBT A;  2FA4 A;  4MA9 A;  2C3Q A;  4ULX A;  4EVM A;  5H5R A;  4LMV A;  1SL0 B;  6GSY A;  1QFN A;  1XCC A;  14GS A;  5C00 A;  1SD8 A;  4ZL7 A;  3FRC A;  2I1U A;  5DJL A;  2R4V A;  3KCM A;  3D5J A;  9GSS A;  1TK0 B;  4X1U A;  4HS1 A;  5ABR A;  4MH2 A;  1UA5 A;  4OO5 A;  2KHP A;  3GNJ A;  4G2E A;  3BBY A;  4XS6 A;  4N0V A;  2WCI A;  1QQ2 A;  3P2A A;  2LQQ A;  4MH3 A;  1PA3 A;  5ECS A;  1PGT A;  3DRN A;  5H5Q A;  3E3E A;  3FR6 A;  4RQR A;  2XPE A;  1GLQ A;  3TUE A;  5GAP D;  2YWO A;  3FW2 A;  2GZZ A;  2QGV A;  3GYK A;  4I8B A;  1BG5 A;  1K3L A;  3GH9 A;  6GSW A;  5A5K A;  2FCH A;  4ZIL A;  1TP9 A;  3QPM A;  1BYE A;  1F3B A;  3Q6O A;  1GNE A;  4I6X A;  5CRW A;  3KH9 A;  1O8W A;  4DEJ A;  1QUW A;  3TRX A;  3VI7 A;  3EVI A;  3C7M A;  1NSW A;  2LJK A;  3VFI A;  5J9C A;  3QR6 A;  3EIN A;  3EYT A;  3HDC A;  4BWQ A;  4HU7 A;  2G2Q A;  4HUA A;  6GSS A;  4MDC A;  3US3 A;  2IL3 A;  1XWK A;  2LV3 A;  2IMF A;  2PBJ A;  5G1L A;  1QXH A;  5IM9 A;  4IW9 A;  4WF4 A;  4YQU A;  1G7O A;  2QC7 A;  4TRX A;  1PX6 A;  5D93 A;  1J9B A;  3HJO A;  1V57 A;  4POB A;  2HRF A;  1Y25 A;  3ZFB A;  1GUH A;  1M99 A;  3LXT A;  5HFG A;  10GS A;  4MAB A;  4FH8 A;  5G5E A;  2ON5 A;  2N5F A;  4IHU A;  2YWN A;  1TK5 B;  4MJC A;  1LJR A;  4I5Q A;  1B9X C;  3D0Z A;  1UN2 A;  4YAP A;  2C0E A;  2LUS A;  5EY6 A;  3IRA A;  1T00 A;  1JLW A;  4PQH A;  3A5W A;  3ERF A;  4TW5 A;  3APO A;  4G19 A;  1TJD A;  4CHS A;  5JCG A;  3TJF A;  1BX9 A;  4ECJ A;  4HQS A;  1R7H A;  2MYG A;  1NM3 A;  2F8A A;  5CO3 A;  2BTO T;  2YOI A;  3G9B A;  3KIJ A;  1TW9 A;  4N10 A;  1B9Y C;  1OC8 A;  3LXZ A;  1TTZ A;  2B6M A;  1GP1 A;  3CTG A;  4RQX A;  1VF1 A;  2C80 A;  4EUY A;  2CAQ A;  4D73 B;  2DJ1 A;  3IK9 A;  1B48 A;  2IMI A;  2LRN A;  5L71 A;  1O73 A;  4NMU A;  1PX7 A;  2PMT A;  2YAN A;  1U88 A;  4HJ2 A;  3GV1 A;  4POL A;  1CQH A;  2JAD A;  2EIR A;  1GSU A;  1OC9 A;  5JCW A;  5IO0 A;  3QCP A;  4ZB8 A;  1GUK A;  3VWV A;  4BVY A;  4KND A;  2VLV A;  3HZ8 A;  4KW6 A;  6GST A;  2CVB A;  1EEJ A;  2O8V B;  3DVX A;  1WPI A;  2DIY A;  2WDU A;  3ZTL A;  2IPA A;  4KSO A;  1FO5 A;  2OE0 A;  4X0X A;  3J7Y k;  2DJK A;  4HJM A;  4CDO A;  2IWT A;  1IYI A;  2H1G A;  3IAS 2;  1V2A A;  1UC7 A;  4V1A g;  1B4Q A;  3VUR A;  3IA1 A;  4PNF A;  1F9M A;  6GSV A;  3EUR A;  2XHF A;  5IO2 A;  2GVP A;  1GUL A;  5IPG A;  3GX8 A;  3U6V A;  2OKA A;  2E7P A;  1QMV A;  2RUE A;  3A2W A;  3QOU A;  4NAX A;  1GH2 A;  2E0Q A;  1GSE A;  3C1S A;  3QAW A;  1EP7 A;  5EL8 A;  1SKW B;  5D9W A;  4KUN A;  4O7H A;  5D96 A;  5C04 A;  3H8Q A;  4ZBA A;  2KUC A;  2P5Q A;  4K6X A;  3TKR A;  5DAK A;  2KLX A;  4EE0 A;  3I69 A;  4PUR A;  2DSA A;  2B1K A;  3HZ4 A;  1GTB A;  3TKS A;  3LOR A;  1A24 A;  3IXR A;  4P3Y B;  2DJ3 A;  4L8E A;  1Z7R A;  19GS A;  2H74 A;  4GST A;  3FKF A;  3Q19 A;  1OKD A;  2O87 A;  1M9B A;  1YEP A;  1WE0 A;  22GS A;  3ZIT A;  1XWA A;  5B7C A;  4AJ6 A;  4J2F A;  2V6K A;  1YY7 A;  4KSM A;  3H1N A;  2JSZ A;  2FWH A;  1KEB A;  4OCF A;  4LMW A;  1XOA A;  1I9D A;  1GTA A;  2JZS A;  1T4Z A;  1AQX A;  2B5E A;  1JZW A;  3M1G A;  3V1W A;  4K7O A;  2VM1 A;  2L4C A;  2DIZ A;  2IN3 A;  1THX A;  2PGT A;  5KN2 A;  4WXT A;  1PN9 A;  3BCK A;  2EIO A;  1V9W A;  4NWY A;  2QKE A;  1X0R A;  3GX0 A;  1PRX A;  5B8B A;  3LGC A;  3ZVJ A;  4PX1 A;  5DCH A;  3FR3 A;  3GA4 A;  2OJL A;  2P5R A;  3J7Y b;  3L0H A;  2L5L A;  2C4J A;  4KCA A;  4MPG A;  1PL1 A;  1GSD A;  4JR6 A;  3D4T A;  2LNT A;  3UEM A;  1EGR A;  4JR4 A;  3RBT A;  4O5R A;  3HHV A;  4IJI A;  2WS2 A;  3N5O A;  3H79 A;  1XZO A;  2V32 A;  2VL9 A;  3CSI A;  2R6K A;  2E2M A;  1VF2 A;  4MLY A;  3HYP A;  1FOV A;  1Z5Y E;  3TJJ A;  3IBH A;  4LL1 B;  2XBQ A;  3KD0 A;  1XWB A;  2FHE A;  3QAV A;  1AUC A;  4TR1 A;  2A2R A;  2HRN A;  1O6J A;  2VLU A;  3AY8 A;  3DYR A;  1ILO A;  3QFB C;  2PU9 C;  4K0N A;  4BWS A;  3WGE A;  2HZE A;  2FWG A;  2GLR A;  2O7K A;  2G0F A;  1X5E A;  4POK A;  5IOX A;  1B4P A;  4X43 A;  2VUP A;  4ILF A;  5FWG A;  3QDN A;  1NW2 A;  2AUV A;  7GSS A;  5IMZ A;  3CBU A;  4IN0 A;  2DJ2 A;  4GXZ A;  3UAP A;  2LJR A;  1WRY A;  3DWV A;  2O85 A;  3IOS A;  1TK8 B;  5F06 A;  2NBS A;  2GT6 A;  2R5G A;  4IVF A;  2VIM A;  5ECL B;  2H8L A;  2NPB A;  5CYY A;  4IJ3 A;  2Z9S A;  1TRU A;  4WET A;  1Q4J A;  1YJ6 A;  5E4W A;  4PNG A;  4E8E A;  4TXO A;  5AGY A;  2WFC A;  1A23 A;  4NHW A;  2X8H A;  1FB6 A;  2H6Z A;  2J9H A;  1OC9 B;  2IMK A;  4ECB A;  5IMD A;  1LU4 A;  4DSR A;  1XVQ A;  3GRX A;  3RHB A;  3BD2 A;  2VL2 A;  3MSZ A;  2L5O A;  5AIV A;  1M7T A;  2K8V A;  1A2L A;  2H0G A;  3WYW A;  1XW5 A;  2GT5 A;  4AJ8 A;  1SK0 A;  5DAL B;  3IK7 A;  3UAR A;  4EDZ A;  1MDK A;  3EE2 A;  1HNA A;  4MF7 A;  4IGJ A;  4HEA 2;  1LBK A;  2WJU A;  4IEL A;  1K0O A;  1GTI A;  3WGX A;  4ISD A;  1K0C A;  2F8F A;  2HYX A;  2JZT A;  2YNX A;  3M9K A;  1SJ6 A;  1ERU A;  1TOF A;  3CRT A;  5IMA A;  1A8L A;  3RHC A;  4KCE A;  4AF2 A;  2OBI A;  2VD0 A;  4IQA A;  1HNB A;  5DAK B;  4XHM A;  3VPT A;  3DVW A;  1JZO A;  2YV7 A;  1M2B A;  2C1Y A;  2DMM A;  5KN0 A;  5DQS A;  2VD1 A;  1SK2 A;  5B6M A;  3HJM A;  2H30 A;  1Z7P A;  1Y6E A;  2DJJ A;  3KH7 A;  1DBY A;  1TRS A;  18GS A;  3ERW A;  3L4N A;  2CV4 A;  1BED A;  4DVC A;  3WT2 A;  2K8S A;  1G0T A;  1KBN A;  2FNO A;  1G6Y A;  1PKW A;  1ZMA A;  1ZL9 A;  1R4W A;  4GQC A;  4XS4 B;  1TU8 A;  3LQ7 A;  5IOW A;  2LQO A;  4I97 A;  2DJ0 A;  2TRC P;  4OD7 A;  3TRQ A;  1AQW A;  1XXU A;  1OVN A;  1TKD B;  1C72 A;  4IS0 A;  1AAZ A;  2C0F A;  1MD4 A;  3ZZX A;  1OKT A;  1K0N A;  3KMO A;  2V6O A;  3M9J A;  3CMI A;  4OO4 A;  1RK4 A;  3QMX A;  4V2M A;  2H0H A;  2VCZ A;  4YH2 A;  2JL4 A;  4JED A;  4YQV A;  4TR0 A;  1GLP A;  4XRD A;  3UJ1 A;  2VO4 A;  4F9Z A;  3LSZ A;  1SYR A;  2H71 A;  3GHA A;  3JCM L;  8GSS A;  2YP6 A;  1H4O A;  3DXB A;  2C0D A;  1J08 A;  1USB A;  3IE3 A;  1OC3 A;  4KB3 A;  1SEN A;  4FYU A;  1HQO A;  5EPF A;  3FY7 A;  3UMA A;  2MMA A;  1YEX A;  2CZ2 A;  4TN8 A;  2B3S A;  4LL4 B;  2WRT A;  3ED3 A;  4JZQ A;  2L59 A;  3CXG A;  2H1B A;  1CQG A;  4MJE A;  2X64 A;  2HI7 A;  2MMO A;  3I6A A;  1SU9 A;  4KAE A;  1WMJ A;  4MCU A;  3KMN A;  1J0F A;  2IFQ A;  3KGK A;  3HVV A;  1Z6M A;  1SYX A;  1XW6 A;  1T7P B;  1PSQ A;  2VLT A;  2E2G A;  5A4U A;  1F3A A;  2JSY A;  1AW9 A;  2A4V A;  5COH A;  5CRH A;  1E6B A;  3CRU A;  1B8X A;  4MZW A;  3PIN A;  5J3R A;  2GZY A;  2WGR A;  3Q74 A;  3F8U A;  2HZE B;  1EGO A;  1V40 A;  3DGQ A;  17GS A;  2H75 A;  4PQI A;  2M72 A;  4HDE A;  2LKU A;  5AN1 A;  2H76 A;  1XOB A;  5AIX A;  2WB9 A;  1M9A A;  3LYP A;  2OAD A;  4Q5R A;  1AIU A;  5F0G A;  2GSS A;  2VL3 A;  5CRG A;  3IHQ A;  5G1K A;  2H6X A;  3M8N A;  2DBC A;  3APS A;  1GNW A;  1T3B A;  4V2N A;  2OE3 A;  5CRE A;  1NHO A;  4WBR D;  1TU7 A;  5FHI A;  4GSS A;  1S3D A;  3GIX A;  4OMV A;  5F05 A;  2WZ9 A;  1PMT A;  4TVE A;  5D9V A;  5KN3 A;  2EC4 A;  5IMV A;  2YWI A;  5D73 A;  5IQY A;  3TOU A;  4RUV A;  5ECP B;  4NV5 A;  1XIY A;  3GTU A;  4TXO B;  2H73 A;  5CP1 A;  4O92 A;  3WT1 A;  1G7E A;  4GQF A;  4QL9 A;  2HNL A;  3ME7 A;  2YZU A;  3O76 A;  3F3R A;  3L78 A;  5LCZ A;  3LFL A;  2AV4 A;  3RDW A;  2TIR A;  1K3O A;  5J4U A;  3GKN A;  4PUA A;  4MF5 A;  2PVO C;  3I43 A;  2B7K A;  3LG6 A;  3PR8 A;  3LJR A;  4AGS A;  1A0F A;  2XBI A;  4V1A p;  1K0M A;  2C3N A;  3F6D A;  1PD2 1;  2FLS A;  4HZ4 A;  1K0A A;  3TKP A;  4MJB A;  4V2L A;  1Z3E A;  1TDI A;  2HE3 A;  1YKC A;  3GMF A;  3KEB A;  3FHK A;  4FYB A;  3D22 A;  4RI6 A;  2GTU A;  1JLV A;  3VI5 A;  4JE1 A;  2C8U A;  3K8N A;  4OFT A;  1WP0 A;  3VPQ A;  4Q5N A;  3KJY A;  2FY6 A;  3M3M A;  3ZVJ D;  4TR4 A;  4JRR A;  4I2U A;  3RPP A;  4G10 A;  5D9X A;  3KTL A;  1XWC A;  2PVQ A;  4BL7 A;  1SKR B;  1TI3 A;  4H86 A;  3W8S A;  4K1F A;  1A8Y A;  2J23 A;  4K9Z A;  5J41 A;  4L5O A;  1FG4 A;  3GL3 A;  2RM5 A;  2AB6 A;  1N2A A;  5DCG A;  4KDU A;  5DJM A;  5HFI A;  1FAA A;  2KOK A;  2RII A;  3IAM 2;  1OE8 A;  4Q5Q A;  5FT3 A;  2HLS A;  1VRS D;  2LTK A;  2LNS A;  1JFU A;  1YF1 A;  5ID2 A;  4L5L A;  2IIY A;  3C8E A;  1YQ1 A;  2HXK A;  1T8E B;  3HKR A;  1W4V A;  1X5D A;  2KP1 A;  1MD3 A;  1XW9 A;  4E8H A;  2NDO A;  13GS A;  3EU3 A;  5KEJ A;  5DDL A;  3KM6 A;  2MMZ A;  2CT6 A;  1XFL A;  1HD2 A;  3TJK A;  3HVS A;  3IR4 A;  1KNG A;  4MJA A;  3EWL A;  4KA0 A;  4RI7 A;  4EXJ A;  2XC2 A;  2HZF A;  1ZYE A;  5ELA A;  3SWL A;  3N9J A;  1TI1 A;  1E2Y A;  1FVK A;  3DD3 A;  1R5P A;  1ERT A;  1YDK A;  3TOT A;  3FZ9 A;  4IP6 A;  4WKW A;  1URM A;  2C3T A;  2V1M A;  2X8G A;  4HQZ A;  3F63 A;  3F4T A;  3VWX A;  4ECI A;  1WWJ A;  1IYH A;  1MEK A;  1EOH A;  3ZYW A;  4ZL9 A;  3LWA A;  1U6T A;  2B5Y A;  4F0B A;  3DEX A;  3G7J A;  2VCT A;  3QFA C;  4KX4 A;  2IFQ B;  3UBK A;  4K2D A;  2K6V A;  4OFN A;  4WF5 A;  2DLX A;  5KN1 A;  4J56 E;  3ME8 A;  5J9B A;  4GTU A;  3NZN A;  5D9T A;  3GN3 A;  3ZFL A;  5HQP A;  3KP9 A;  3LYK A;  1SL1 B;  1GSS A;  1G6W A;  1GTU A;  4L0U A;  3OR5 A;  4DSS A;  4MF6 A;  4D73 A;  2NVL A;  2V41 A;  5ECI B;  5F8B A;  2YZH A;  3KP8 A;  3C71 A;  1MDI A;  4TXV A;  2REM A;  5INY A;  3HVX A;  4IBP A;  4ZB9 A;  4ZL8 A;  4N30 A;  5ECH B;  2GQM A;  3GKK A;  3TCO A;  3DKS A;  5AIS A;  3TKS C;  1OAZ A;  2PPT A;  4F0C A;  4KE3 A;  2K9F A;  1VF4 A;  2MBS A;  1W89 A;  4WR4 A;  5DBQ A;  1ST9 A;  4MZC A;  5GAN D;  4GF0 A;  1WJK A;  4ZBD A;  2L57 A;  1SD9 A;  4HI7 A;  4Z7X A;  2CQ9 A;  3GTU B;  5JWR B;  4FYC A;  4K0G A;  2FGX A;  1DUG A;  3R2Q A;  3NOF A;  2RM6 A;  3H93 A;  4OWY A;  2A2S A;  2CVK A;  3GSS A;  4KH7 A;  3TJB A;  3ZMK A;  3IV4 A;  4ACS A;  2VCQ A;  4BPY A;  4N11 A;  3PGT A;  2BMX A;  1X9S B;  3GH6 A;  4K8M A;  2KP2 A;  1YF0 A;  2GS3 A;  2HSY A;  1DE2 A;  2OE1 A;  4KDY A;  3ZRE A;  1GSQ A;  1R26 A;  2ON7 A;  3D21 A;  4GCI A;  3IPZ A;  4NPB A;  1V98 A;  1VF3 A;  2YPM A;  2C0G A;  4WR5 A;  5GZZ B;  2H6Y A;  3DIE A;  2ES7 A;  5H5S A;  1M2A A;  2ALB A;  2F9S A;  3TGZ A;  3E0U A;  4KDX A;  1M2D A;  3LEF A; 
#chains in the Genus database with same CATH topology
 1XWG A;  16GS A;  3KTB A;  4F82 A;  3GUR A;  3FEU A;  4IQ1 A;  3I9V 2;  4WEY A;  3BCI A;  2DML A;  3VK9 A;  4XTS A;  12GS A;  1OE7 A;  3WD6 A;  3FYG A;  2JAC A;  1FB0 A;  4NXI A;  2GSR A;  1DSB A;  5A4W A;  2VOC A;  4ICY A;  4MMM A;  3ZIV A;  5ELG A;  3HA9 A;  4BL7 B;  4JBB A;  3C1R A;  2FWE A;  4ZB6 A;  2H1D A;  4NV2 A;  1ZYQ B;  3M0F A;  4KF9 A;  4CY8 A;  3F6F A;  5DVB A;  2CX4 A;  3GKM A;  2V2G A;  2QA2 A;  4HOJ A;  3HY2 A;  1PL2 A;  3ISO A;  4XS1 A;  2RLI A;  5G30 A;  2JU5 A;  5B8A A;  2HSH A;  1YKA A;  3VWU A;  1A0R P;  4F2I A;  4IKH A;  1THO A;  4MPF A;  3MDK A;  3A3T A;  2L4Q A;  2AAW A;  4L0W A;  2L6C A;  1H75 A;  5ID2 B;  1S3C A;  1SKS B;  2ZUP A;  5B6N A;  2X99 A;  4ZBB A;  5G5F A;  3UVT A;  4PXO A;  4POM A;  4QL7 A;  1S3A A;  3GL5 A;  4YKF A;  2GZP A;  3O6T A;  1RW1 A;  2DC5 A;  4G9H A;  4LA1 A;  2D2Z A;  3TB2 A;  3GKX A;  2EIQ A;  11GS A;  3NIV A;  4QQ7 A;  3FK8 A;  2NTO A;  3H4K A;  2PWJ A;  3CQF A;  2LJA A;  1A2M A;  6GSU A;  3UIW A;  1T1V A;  5LNK e;  5GSS A;  2LST A;  4GLT A;  1XVW A;  2CZ3 A;  4TR1 B;  2AYT A;  2YCD A;  1UVZ A;  1GL8 A;  3G7I A;  1K0B A;  4PGT A;  2GQL A;  1F2E A;  4PQ1 A;  3BOA A;  2I9H A;  1BAY A;  2VL2 C;  5IPH A;  1EWX A;  1HNC A;  2CAI A;  3EMX A;  3O3T A;  4XCS A;  1XPV A;  2AHE A;  5CAX A;  5LD0 A;  4J57 E;  5ECM B;  1EZK A;  1ZZY A;  5IIZ A;  4EL1 A;  1AC1 A;  1BJX A;  3P90 A;  3W6G A;  1XBS A;  1VGL A;  3HJP A;  1V58 A;  1DE1 A;  3QD9 A;  1O8X A;  5EVO A;  3ZML A;  5HR2 A;  5ENU A;  4CW9 A;  3F3Q A;  3ERG A;  3ZL5 A;  4LLR A;  4DSS B;  5F07 A;  3F9U A;  1ON4 A;  2R3X A;  2YV9 A;  3UL3 A;  4HZ2 A;  3TJG A;  4MZB A;  3C73 A;  1AQV A;  4K7N A;  1X9W B;  1T4Y A;  1SL2 B;  3MWH A;  1K0D A;  4N0Z A;  3SBC A;  3F4R A;  3RPN A;  3MAK A;  1FVJ A;  2GSQ A;  4I2T A;  2QSI A;  4EKZ A;  5KOW A;  3U5R E;  2H01 A;  4FIW A;  4K5S A;  2YJH A;  4IP1 A;  3DML A;  5HFK A;  1WOU A;  1QGV A;  5DAL A;  3L9U A;  1Z9H A;  3W8J A;  1ZYN A;  3EC3 A;  2LEG A;  3GST A;  2LS5 A;  3HD5 A;  5GST A;  5ECO B;  2RUF A;  1U3I A;  1ERW A;  3ZLP A;  3EU4 A;  4EO3 A;  3HXS A;  3D6I A;  5A4V A;  2GQK A;  2TRX A;  2I4A A;  2CX3 A;  4OCE A;  1RQM A;  3L9V A;  3L9S A;  1I5G A;  1GSF A;  1OYJ A;  1ZCP A;  4JU5 A;  4TKY A;  1TRV A;  2JZR A;  2HFD A;  4YAV A;  4GSN A;  2OA7 A;  3TKQ A;  1EOG A;  2OAC A;  4ECC A;  1F37 A;  1TXX A;  2A2P A;  3Q18 A;  5JWQ B;  2M46 A;  1Z6N A;  1K3Y A;  2YJ7 A;  4ZXG A;  1FHE A;  4EC0 A;  2GST A;  4ID0 A;  1EV9 A;  1SK1 A;  3FZ5 A;  2XPD A;  4PTS A;  2VAF A;  1SJI A;  2FUG 2;  2F3M A;  4ML6 A;  1EP8 A;  4PUF C;  1M0U A;  1MTC A;  4TR3 A;  1MDJ A;  3F4S A;  2PUK C;  4YKG A;  2A4H A;  2AJQ B;  2VCX A;  5E59 A;  1JZD A;  4XIH A;  2P31 A;  4NHZ A;  3P8W A;  4MK3 A;  4ML1 A;  1HYU A;  3HCZ A;  2H72 A;  2MZC A;  4GWR A;  3UBL A;  4BVX A;  2GDR A;  3EPT A;  2PER A;  1N8J A;  2L6D A;  1ZGN A;  1ZOF A;  5J5N A;  2ZNM A;  2B1L A;  4XS4 A;  3S9F A;  1GWC A;  3GUS A;  1WIK A;  3VLN A;  1TRW A;  1ABA A;  2FD3 A;  3MNG A;  2I81 A;  5ECR B;  4XRA A;  2LRC A;  3FR9 A;  2VM2 A;  1O81 A;  2X8C A;  3CSJ A;  3CSH A;  4AJ7 A;  3PH9 A;  3ZRD A;  1U87 A;  3IHG A;  1BQ7 A;  1PKZ A;  2FWF A;  1PQN A;  1ERV A;  2GGT A;  2B7J A;  1GUM A;  4HU9 A;  2R37 A;  2R2J A;  1GRX A;  3A2V A;  4F03 A;  3D4M A;  4O32 A;  2F51 A;  5DQY A;  2H0I A;  5G2Z A;  3F0I A;  3G7Y A;  3KZQ A;  4EDY A;  2N5B A;  2VCW A;  2H66 A;  4FQU A;  2YN1 A;  1GSY A;  2CA8 A;  4GRF A;  3FZ4 A;  2B5X A;  2IME A;  3FMW A;  2VCV A;  4OFM A;  5ECK B;  2IMD A;  3KXO A;  1X5C A;  1O85 A;  1QK8 A;  6GSX A;  3UOM A;  4FO5 A;  3IDV A;  1KTE A;  1ML6 A;  4DSQ A;  5HR3 A;  3BJ5 A;  3TDG A;  5ECQ B;  4EF0 A;  5D8I A;  1NHY A;  4G0K A;  1JHB A;  3WGD A;  4Q5F A;  1EV4 A;  2CVD A;  1EEM A;  3QAG A;  1U3A A;  1O7U A;  3EMP A;  5CNW A;  4YQM A;  5JWO B;  2I3Y A;  20GS A;  3VWW A;  5IMC A;  1JZR A;  2OBK A;  3FZA A;  1A2J A;  2DKI A;  2MMN A;  1X9M B;  2N5A A;  2K18 A;  3ZIJ A;  2IJY A;  3R3E A;  5HR1 A;  4K7I A;  2H1A A;  2H19 A;  4WBJ A;  1SJZ A;  1YZX A;  1Q98 A;  3RAZ A;  2FA8 A;  1PN0 A;  2P0G A;  4BA7 A;  2HT9 A;  3CYN A;  3IC4 A;  3TKS E;  5JCU A;  2PN8 A;  4ZIJ A;  2M80 A;  2O89 A;  2H70 A;  3APQ A;  1F6M C;  2BJX A;  4TOP A;  5G31 A;  5HR0 A;  1R5A A;  2LRT A;  3UVH A;  2WUL A;  1ACV A;  2YWM A;  4MP4 A;  5IMF A;  4KGI A;  1FW1 A;  3E9J B;  3P7X A;  3CTF A;  1AXD A;  5CRD A;  2ZCT A;  3GFK A;  3TRP A;  4O5Q A;  5ECN B;  3A2X A;  2MBT A;  2FA4 A;  4MA9 A;  2C3Q A;  4ULX A;  4EVM A;  5H5R A;  4LMV A;  1SL0 B;  2R0G A;  6GSY A;  1QFN A;  1XCC A;  14GS A;  5C00 A;  3A5I A;  1SD8 A;  4ZL7 A;  3FRC A;  2I1U A;  5DJL A;  2R4V A;  3KCM A;  3D5J A;  9GSS A;  1TK0 B;  4X1U A;  4HS1 A;  5ABR A;  4MH2 A;  1UA5 A;  4OO5 A;  2KHP A;  3GNJ A;  4G2E A;  3BBY A;  4XS6 A;  4N0V A;  2WCI A;  1QQ2 A;  3P2A A;  2LQQ A;  4MH3 A;  1PA3 A;  5ECS A;  1PGT A;  3DRN A;  5H5Q A;  3E3E A;  3FR6 A;  4RQR A;  2XPE A;  1GLQ A;  3TUE A;  5GAP D;  2YWO A;  3FW2 A;  2GZZ A;  2QGV A;  3GYK A;  4I8B A;  1BG5 A;  1K3L A;  3GH9 A;  6GSW A;  5A5K A;  2FCH A;  4ZIL A;  1TP9 A;  3QPM A;  1BYE A;  1F3B A;  3Q6O A;  1GNE A;  4I6X A;  5CRW A;  3KH9 A;  1O8W A;  4DEJ A;  1QUW A;  3TRX A;  3VI7 A;  4BVX B;  3EVI A;  3C7M A;  1NSW A;  5BMU A;  2LJK A;  3VFI A;  5J9C A;  3QR6 A;  3EIN A;  3EYT A;  3HDC A;  4BWQ A;  4HU7 A;  2G2Q A;  4HUA A;  2DKH A;  6GSS A;  4MDC A;  3US3 A;  2IL3 A;  1XWK A;  2LV3 A;  2IMF A;  2PBJ A;  5G1L A;  1QXH A;  5IM9 A;  4IW9 A;  4WF4 A;  4YQU A;  1G7O A;  2QC7 A;  4TRX A;  1PX6 A;  5D93 A;  1J9B A;  3HJO A;  1V57 A;  4POB A;  2HRF A;  1Y25 A;  3ZFB A;  1GUH A;  1M99 A;  3LXT A;  5HFG A;  10GS A;  2X4A A;  4MAB A;  4FH8 A;  5G5E A;  2ON5 A;  2N5F A;  4IHU A;  2YWN A;  1M3I A;  1TK5 B;  4MJC A;  1LJR A;  4I5Q A;  1B9X C;  3D0Z A;  1UN2 A;  4YAP A;  2C0E A;  2LUS A;  5EY6 A;  3IRA A;  1T00 A;  1JLW A;  4PQH A;  3A5W A;  3ERF A;  4TW5 A;  3APO A;  4K2X A;  4G19 A;  1TJD A;  4CHS A;  5JCG A;  3TJF A;  1BX9 A;  4ECJ A;  4HQS A;  1R7H A;  2MYG A;  1NM3 A;  2F8A A;  5CO3 A;  2BTO T;  2YOI A;  3G9B A;  3KIJ A;  1TW9 A;  4N10 A;  1B9Y C;  1OC8 A;  3LXZ A;  1TTZ A;  2B6M A;  1GP1 A;  3CTG A;  4RQX A;  1VF1 A;  2C80 A;  4EUY A;  2CAQ A;  4Z2R A;  4D73 B;  2DJ1 A;  3IK9 A;  1B48 A;  2IMI A;  2LRN A;  5L71 A;  1O73 A;  4NMU A;  1PX7 A;  4MNN A;  2PMT A;  2YAN A;  1U88 A;  4HJ2 A;  3GV1 A;  4POL A;  1CQH A;  2JAD A;  2EIR A;  1GSU A;  1OC9 A;  5JCW A;  5IO0 A;  3QCP A;  4ZB8 A;  1GUK A;  3VWV A;  4BVY A;  4KND A;  2VLV A;  3HZ8 A;  4KW6 A;  6GST A;  5KOX A;  2CVB A;  1EEJ A;  2O8V B;  3DVX A;  1WPI A;  2DIY A;  2WDU A;  3ZTL A;  2IPA A;  4KSO A;  1FO5 A;  2OE0 A;  4X0X A;  4BIK A;  3J7Y k;  2DJK A;  4HJM A;  3MYD A;  4CDO A;  2IWT A;  1IYI A;  2H1G A;  3IAS 2;  1V2A A;  1UC7 A;  4V1A g;  1B4Q A;  3VUR A;  3IA1 A;  4PNF A;  1F9M A;  6GSV A;  3EUR A;  2XHF A;  5IO2 A;  2GVP A;  1GUL A;  5IPG A;  3GX8 A;  3U6V A;  2OKA A;  2E7P A;  1QMV A;  2RUE A;  3A2W A;  3QOU A;  4NAX A;  1GH2 A;  2E0Q A;  1GSE A;  3C1S A;  3QAW A;  1EP7 A;  5EL8 A;  1SKW B;  5D9W A;  4KUN A;  4O7H A;  5D96 A;  5C04 A;  3H8Q A;  4ZBA A;  2KUC A;  2P5Q A;  4K6X A;  3TKR A;  5DAK A;  2KLX A;  4EE0 A;  3I69 A;  4PUR A;  2DSA A;  2B1K A;  3HZ4 A;  1GTB A;  3TKS A;  3LOR A;  1A24 A;  3IXR A;  4P3Y B;  2DJ3 A;  4L8E A;  1Z7R A;  19GS A;  2H74 A;  4GST A;  3FKF A;  3Q19 A;  1OKD A;  2O87 A;  1M9B A;  1ZYP A;  1YEP A;  1WE0 A;  22GS A;  3ZIT A;  1XWA A;  5B7C A;  4AJ6 A;  4J2F A;  2V6K A;  1YY7 A;  4KSM A;  3H1N A;  2JSZ A;  5BRT A;  2FWH A;  1KEB A;  4OCF A;  4LMW A;  1XOA A;  1I9D A;  1GTA A;  2JZS A;  1T4Z A;  1AQX A;  2B5E A;  1JZW A;  3M1G A;  3V1W A;  4K7O A;  2VM1 A;  2L4C A;  2DIZ A;  2IN3 A;  1THX A;  2PGT A;  5KN2 A;  4WXT A;  1PN9 A;  3BCK A;  2EIO A;  1V9W A;  4NWY A;  2QKE A;  1X0R A;  3GX0 A;  1PRX A;  5B8B A;  3LGC A;  3ZVJ A;  4PX1 A;  5DCH A;  3FR3 A;  3GA4 A;  2OJL A;  2P5R A;  3J7Y b;  3L0H A;  2L5L A;  2C4J A;  4KCA A;  4MPG A;  1PL1 A;  1GSD A;  4A5P A;  4JR6 A;  3D4T A;  2LNT A;  3UEM A;  1EGR A;  4JR4 A;  3RBT A;  4O5R A;  3HHV A;  4IJI A;  2WS2 A;  3N5O A;  3H79 A;  1XZO A;  2V32 A;  2VL9 A;  3CSI A;  2R6K A;  2E2M A;  1VF2 A;  4MLY A;  3HYP A;  1FOV A;  1Z5Y E;  3TJJ A;  4CY6 A;  3IBH A;  4LL1 B;  2XBQ A;  3KD0 A;  1XWB A;  4Z2T A;  2FHE A;  3QAV A;  1AUC A;  4TR1 A;  3IC8 A;  2A2R A;  2HRN A;  1O6J A;  2VLU A;  3AY8 A;  3DYR A;  1ILO A;  3QFB C;  2PU9 C;  4K0N A;  4BWS A;  3WGE A;  2HZE A;  2FWG A;  2GLR A;  2O7K A;  2G0F A;  1X5E A;  4POK A;  5IOX A;  1B4P A;  4X43 A;  2VUP A;  4ILF A;  5FWG A;  3QDN A;  1NW2 A;  2AUV A;  7GSS A;  5IMZ A;  3CBU A;  4IN0 A;  2DJ2 A;  4GXZ A;  3UAP A;  2LJR A;  1WRY A;  2HSM A;  3DWV A;  2O85 A;  3IOS A;  1TK8 B;  5F06 A;  2NBS A;  2GT6 A;  2R5G A;  4IVF A;  2VIM A;  5ECL B;  2H8L A;  2QA1 A;  2NPB A;  5CYY A;  4IJ3 A;  2Z9S A;  1TRU A;  4WET A;  1Q4J A;  1YJ6 A;  5E4W A;  4PNG A;  4E8E A;  4TXO A;  5AGY A;  2WFC A;  1A23 A;  4NHW A;  2X8H A;  1FB6 A;  2H6Z A;  2J9H A;  1OC9 B;  2IMK A;  4ECB A;  5IMD A;  1LU4 A;  4DSR A;  1XVQ A;  3GRX A;  4BVY B;  3RHB A;  3BD2 A;  2VL2 A;  3MSZ A;  2L5O A;  5AIV A;  1M7T A;  2K8V A;  1A2L A;  2H0G A;  3WYW A;  1XW5 A;  2GT5 A;  4AJ8 A;  1SK0 A;  5DAL B;  3IK7 A;  3UAR A;  4EDZ A;  1MDK A;  3EE2 A;  4Z2U A;  1HNA A;  4MF7 A;  4IGJ A;  4HEA 2;  1LBK A;  2WJU A;  4IEL A;  1K0O A;  1GTI A;  3WGX A;  4ISD A;  1K0C A;  2F8F A;  2HYX A;  2JZT A;  2YNX A;  3M9K A;  1SJ6 A;  1ERU A;  1TOF A;  3CRT A;  5IMA A;  1A8L A;  3RHC A;  4KCE A;  2R0C A;  4AF2 A;  2OBI A;  2VD0 A;  4IQA A;  1HNB A;  5DAK B;  4XHM A;  3VPT A;  3DVW A;  1JZO A;  2YV7 A;  1M2B A;  2C1Y A;  2DMM A;  5KN0 A;  5DQS A;  2VD1 A;  1SK2 A;  5B6M A;  3HJM A;  2H30 A;  1Z7P A;  1Y6E A;  2DJJ A;  3KH7 A;  1DBY A;  1TRS A;  18GS A;  3ERW A;  3L4N A;  2CV4 A;  1BED A;  4DVC A;  3WT2 A;  2K8S A;  1G0T A;  1KBN A;  2FNO A;  1G6Y A;  1PKW A;  1ZMA A;  1ZL9 A;  1R4W A;  4GQC A;  4XS4 B;  1TU8 A;  3LQ7 A;  5IOW A;  2LQO A;  4I97 A;  2DJ0 A;  2TRC P;  4OD7 A;  3TRQ A;  1AQW A;  1XXU A;  1OVN A;  1TKD B;  1C72 A;  4USS A;  4IS0 A;  1AAZ A;  2C0F A;  1MD4 A;  3ZZX A;  1OKT A;  1K0N A;  3KMO A;  2V6O A;  3M9J A;  3CMI A;  4OO4 A;  4G0I A;  1RK4 A;  3QMX A;  4V2M A;  2H0H A;  2VCZ A;  4YH2 A;  2JL4 A;  4JED A;  4YQV A;  4TR0 A;  1GLP A;  4XRD A;  3UJ1 A;  2VO4 A;  4F9Z A;  3LSZ A;  1SYR A;  2H71 A;  3GHA A;  3JCM L;  8GSS A;  2YP6 A;  1H4O A;  1XG8 A;  3DXB A;  2C0D A;  1J08 A;  1USB A;  3IE3 A;  1OC3 A;  4KB3 A;  1SEN A;  4FYU A;  1HQO A;  5EPF A;  3FY7 A;  3UMA A;  2MMA A;  1YEX A;  2CZ2 A;  4TN8 A;  4HSC X;  2B3S A;  4LL4 B;  2WRT A;  3ED3 A;  4JZQ A;  2L59 A;  3CXG A;  1M3J A;  2H1B A;  1CQG A;  4MJE A;  2X64 A;  2HI7 A;  2MMO A;  3I6A A;  1SU9 A;  4KAE A;  1WMJ A;  4MCU A;  3KMN A;  1J0F A;  1S3R A;  2IFQ A;  3KGK A;  3HVV A;  1Z6M A;  1SYX A;  1XW6 A;  1T7P B;  1PSQ A;  2VLT A;  2E2G A;  5A4U A;  1F3A A;  2JSY A;  1AW9 A;  2A4V A;  5COH A;  5CRH A;  1E6B A;  3CRU A;  1B8X A;  4MZW A;  3PIN A;  5J3R A;  2GZY A;  2WGR A;  3Q74 A;  3F8U A;  2HZE B;  1EGO A;  1V40 A;  3DGQ A;  17GS A;  2H75 A;  4PQI A;  2M72 A;  4HDE A;  2LKU A;  5AN1 A;  2H76 A;  1XOB A;  5AIX A;  2WB9 A;  1M9A A;  3LYP A;  2OAD A;  4Q5R A;  1AIU A;  5F0G A;  2GSS A;  2VL3 A;  5CRG A;  3IHQ A;  4EIQ A;  5G1K A;  2H6X A;  3M8N A;  2DBC A;  3APS A;  1GNW A;  1T3B A;  4V2N A;  2OE3 A;  5CRE A;  1NHO A;  1FOH A;  4WBR D;  1TU7 A;  5FHI A;  4GSS A;  1S3D A;  3GIX A;  4OMV A;  5F05 A;  2WZ9 A;  1PMT A;  4TVE A;  5D9V A;  5KN3 A;  2EC4 A;  5IMV A;  2YWI A;  5D73 A;  5IQY A;  3TOU A;  4RUV A;  5ECP B;  4NV5 A;  1XIY A;  3GTU A;  4TXO B;  2H73 A;  5CP1 A;  4O92 A;  3WT1 A;  1G7E A;  4GQF A;  4QL9 A;  2HNL A;  3ME7 A;  2YZU A;  3O76 A;  3F3R A;  3L78 A;  5LCZ A;  3LFL A;  2AV4 A;  3PPU A;  3RDW A;  2TIR A;  1K3O A;  5J4U A;  3GKN A;  4PUA A;  4MF5 A;  2PVO C;  3I43 A;  2B7K A;  3LG6 A;  3PR8 A;  3LJR A;  4AGS A;  1A0F A;  2XBI A;  4V1A p;  1K0M A;  2C3N A;  3F6D A;  1PD2 1;  2FLS A;  4G0L A;  4HZ4 A;  1K0A A;  3TKP A;  4O5U A;  4MJB A;  4V2L A;  1Z3E A;  1TDI A;  2HE3 A;  1YKC A;  3GMF A;  3KEB A;  3FHK A;  4FYB A;  3D22 A;  4RI6 A;  2GTU A;  1JLV A;  3VI5 A;  4JE1 A;  2C8U A;  3K8N A;  4OFT A;  1WP0 A;  3VPQ A;  4Q5N A;  3KJY A;  2FY6 A;  3M3M A;  3ZVJ D;  4TR4 A;  4JRR A;  4I2U A;  3RPP A;  4G10 A;  5D9X A;  3KTL A;  2HRK A;  1XWC A;  2PVQ A;  4BL7 A;  1SKR B;  1TI3 A;  4H86 A;  3W8S A;  4K1F A;  1A8Y A;  2J23 A;  4K9Z A;  5J41 A;  4L5O A;  1FG4 A;  3LW9 A;  3GL3 A;  2RM5 A;  2AB6 A;  1N2A A;  5DCG A;  4KDU A;  5DJM A;  5HFI A;  1FAA A;  2KOK A;  2RII A;  3IAM 2;  1OE8 A;  4Q5Q A;  5FT3 A;  2HLS A;  1VRS D;  2LTK A;  2LNS A;  1JFU A;  1YF1 A;  5ID2 A;  4L5L A;  4EIP A;  2IIY A;  3C8E A;  1YQ1 A;  2HXK A;  1T8E B;  3HKR A;  1W4V A;  2R0P A;  1X5D A;  2KP1 A;  2X49 A;  1MD3 A;  1XW9 A;  4E8H A;  2NDO A;  13GS A;  3EU3 A;  5KEJ A;  5DDL A;  3KM6 A;  2MMZ A;  2CT6 A;  1XFL A;  1HD2 A;  3TJK A;  3HVS A;  3IR4 A;  1KNG A;  4MJA A;  3EWL A;  4KA0 A;  4RI7 A;  4EXJ A;  2XC2 A;  2HZF A;  1ZYE A;  5ELA A;  3SWL A;  3N9J A;  1TI1 A;  1E2Y A;  1FVK A;  3DD3 A;  1R5P A;  1ERT A;  1YDK A;  3TOT A;  3FZ9 A;  4IP6 A;  4WKW A;  1URM A;  2C3T A;  2V1M A;  2X8G A;  4HQZ A;  3F63 A;  3F4T A;  3VWX A;  4ECI A;  1WWJ A;  1IYH A;  1MEK A;  1EOH A;  3ZYW A;  4X4J A;  4ZL9 A;  4K5R A;  3LWA A;  1U6T A;  2B5Y A;  4F0B A;  3DEX A;  3G7J A;  2VCT A;  1PFO A;  3QFA C;  2UZ8 A;  4KX4 A;  2IFQ B;  3UBK A;  4K2D A;  2K6V A;  4OFN A;  4WF5 A;  2DLX A;  5KN1 A;  4J56 E;  3ME8 A;  5J9B A;  2HRA A;  4GTU A;  3NZN A;  5D9T A;  3GN3 A;  3ZFL A;  5HQP A;  3KP9 A;  3LYK A;  1SL1 B;  1GSS A;  1G6W A;  1GTU A;  4L0U A;  3OR5 A;  4DSS A;  4MF6 A;  4D73 A;  2NVL A;  2V41 A;  5ECI B;  5F8B A;  2YZH A;  3KP8 A;  3C71 A;  1MDI A;  4TXV A;  2REM A;  5INY A;  3HVN A;  3HVX A;  4IBP A;  4ZB9 A;  4ZL8 A;  4N30 A;  2GQM A;  5ECH B;  3GKK A;  3TCO A;  3DKS A;  5AIS A;  3TKS C;  1OAZ A;  2PPT A;  4F0C A;  4KE3 A;  2K9F A;  1VF4 A;  2MBS A;  3MIX A;  1W89 A;  4WR4 A;  5DBQ A;  1ST9 A;  4MZC A;  5GAN D;  4GF0 A;  1WJK A;  4ZBD A;  2L57 A;  1SD9 A;  4HI7 A;  4Z7X A;  2CQ9 A;  3GTU B;  5JWR B;  4FYC A;  4K0G A;  2FGX A;  1DUG A;  3R2Q A;  3NOF A;  2RM6 A;  3H93 A;  4OWY A;  2A2S A;  2CVK A;  3GSS A;  4KH7 A;  3TJB A;  3ZMK A;  3IV4 A;  4ACS A;  2VCQ A;  4BPY A;  4N11 A;  3PGT A;  2BMX A;  1X9S B;  3GH6 A;  4K8M A;  2KP2 A;  1YF0 A;  2GS3 A;  2HSY A;  1DE2 A;  2OE1 A;  4KDY A;  3ZRE A;  1GSQ A;  1R26 A;  2ON7 A;  3D21 A;  4GCI A;  3IPZ A;  4NPB A;  1V98 A;  1VF3 A;  2YPM A;  2C0G A;  4WR5 A;  5GZZ B;  2H6Y A;  3DIE A;  2ES7 A;  5H5S A;  1M2A A;  2ALB A;  2F9S A;  3TGZ A;  3E0U A;  4KDX A;  1M2D A;  3LEF A; 
#chains in the Genus database with same CATH homology
 1XWG A;  16GS A;  3KTB A;  4F82 A;  3GUR A;  3FEU A;  4IQ1 A;  3I9V 2;  4WEY A;  3BCI A;  2DML A;  3VK9 A;  4XTS A;  12GS A;  1OE7 A;  3WD6 A;  3FYG A;  2JAC A;  1FB0 A;  4NXI A;  2GSR A;  1DSB A;  5A4W A;  2VOC A;  4ICY A;  4MMM A;  3ZIV A;  5ELG A;  3HA9 A;  4BL7 B;  4JBB A;  3C1R A;  2FWE A;  4ZB6 A;  2H1D A;  4NV2 A;  1ZYQ B;  3M0F A;  4KF9 A;  4CY8 A;  3F6F A;  5DVB A;  2CX4 A;  3GKM A;  2V2G A;  2QA2 A;  4HOJ A;  3HY2 A;  1PL2 A;  3ISO A;  4XS1 A;  2RLI A;  5G30 A;  2JU5 A;  5B8A A;  2HSH A;  1YKA A;  3VWU A;  1A0R P;  4F2I A;  4IKH A;  1THO A;  4MPF A;  3MDK A;  3A3T A;  2L4Q A;  2AAW A;  4L0W A;  2L6C A;  1H75 A;  5ID2 B;  1S3C A;  1SKS B;  2ZUP A;  5B6N A;  2X99 A;  4ZBB A;  5G5F A;  3UVT A;  4PXO A;  4POM A;  4QL7 A;  1S3A A;  3GL5 A;  4YKF A;  2GZP A;  3O6T A;  1RW1 A;  2DC5 A;  4G9H A;  4LA1 A;  2D2Z A;  3TB2 A;  3GKX A;  2EIQ A;  11GS A;  3NIV A;  4QQ7 A;  3FK8 A;  2NTO A;  3H4K A;  2PWJ A;  2LJA A;  1A2M A;  6GSU A;  3UIW A;  1T1V A;  5LNK e;  5GSS A;  2LST A;  4GLT A;  1XVW A;  2CZ3 A;  4TR1 B;  2AYT A;  2YCD A;  1UVZ A;  1GL8 A;  3G7I A;  1K0B A;  4PGT A;  2GQL A;  1F2E A;  4PQ1 A;  3BOA A;  2I9H A;  1BAY A;  2VL2 C;  5IPH A;  1EWX A;  1HNC A;  2CAI A;  3EMX A;  3O3T A;  4XCS A;  1XPV A;  2AHE A;  5CAX A;  5LD0 A;  4J57 E;  5ECM B;  1EZK A;  1ZZY A;  5IIZ A;  4EL1 A;  1AC1 A;  1BJX A;  3P90 A;  3W6G A;  1XBS A;  1VGL A;  3HJP A;  1V58 A;  1DE1 A;  3QD9 A;  1O8X A;  5EVO A;  3ZML A;  5HR2 A;  5ENU A;  4CW9 A;  3F3Q A;  3ERG A;  3ZL5 A;  4LLR A;  4DSS B;  5F07 A;  3F9U A;  1ON4 A;  2R3X A;  2YV9 A;  3UL3 A;  4HZ2 A;  3TJG A;  4MZB A;  3C73 A;  1AQV A;  4K7N A;  1X9W B;  1T4Y A;  1SL2 B;  3MWH A;  1K0D A;  4N0Z A;  3SBC A;  3F4R A;  3RPN A;  3MAK A;  1FVJ A;  2GSQ A;  4I2T A;  2QSI A;  4EKZ A;  5KOW A;  3U5R E;  2H01 A;  4FIW A;  4K5S A;  2YJH A;  4IP1 A;  3DML A;  5HFK A;  1WOU A;  1QGV A;  5DAL A;  3L9U A;  1Z9H A;  3W8J A;  1ZYN A;  3EC3 A;  2LEG A;  3GST A;  2LS5 A;  3HD5 A;  5GST A;  5ECO B;  2RUF A;  1U3I A;  1ERW A;  3ZLP A;  3EU4 A;  4EO3 A;  3HXS A;  3D6I A;  5A4V A;  2GQK A;  2TRX A;  2I4A A;  2CX3 A;  4OCE A;  1RQM A;  3L9V A;  3L9S A;  1I5G A;  1GSF A;  1OYJ A;  1ZCP A;  4JU5 A;  4TKY A;  1TRV A;  2JZR A;  2HFD A;  4YAV A;  4GSN A;  2OA7 A;  3TKQ A;  1EOG A;  2OAC A;  4ECC A;  1F37 A;  1TXX A;  2A2P A;  3Q18 A;  5JWQ B;  2M46 A;  1Z6N A;  1K3Y A;  2YJ7 A;  4ZXG A;  1FHE A;  4EC0 A;  2GST A;  4ID0 A;  1EV9 A;  1SK1 A;  3FZ5 A;  2XPD A;  4PTS A;  2VAF A;  1SJI A;  2FUG 2;  2F3M A;  4ML6 A;  1EP8 A;  4PUF C;  1M0U A;  1MTC A;  4TR3 A;  1MDJ A;  3F4S A;  2PUK C;  4YKG A;  2A4H A;  2AJQ B;  2VCX A;  5E59 A;  1JZD A;  4XIH A;  2P31 A;  4NHZ A;  3P8W A;  4MK3 A;  4ML1 A;  1HYU A;  3HCZ A;  2H72 A;  2MZC A;  4GWR A;  3UBL A;  4BVX A;  2GDR A;  3EPT A;  2PER A;  1N8J A;  2L6D A;  1ZGN A;  1ZOF A;  5J5N A;  2ZNM A;  2B1L A;  4XS4 A;  3S9F A;  1GWC A;  3GUS A;  1WIK A;  3VLN A;  1TRW A;  1ABA A;  2FD3 A;  3MNG A;  2I81 A;  5ECR B;  4XRA A;  2LRC A;  3FR9 A;  2VM2 A;  1O81 A;  2X8C A;  3CSJ A;  3CSH A;  4AJ7 A;  3PH9 A;  3ZRD A;  1U87 A;  3IHG A;  1BQ7 A;  1PKZ A;  2FWF A;  1PQN A;  1ERV A;  2GGT A;  2B7J A;  1GUM A;  4HU9 A;  2R37 A;  2R2J A;  1GRX A;  3A2V A;  4F03 A;  3D4M A;  4O32 A;  2F51 A;  5DQY A;  2H0I A;  5G2Z A;  3F0I A;  3G7Y A;  3KZQ A;  4EDY A;  2N5B A;  2VCW A;  2H66 A;  4FQU A;  2YN1 A;  1GSY A;  2CA8 A;  4GRF A;  3FZ4 A;  2B5X A;  2IME A;  3FMW A;  2VCV A;  4OFM A;  5ECK B;  2IMD A;  3KXO A;  1X5C A;  1O85 A;  1QK8 A;  6GSX A;  3UOM A;  4FO5 A;  3IDV A;  1KTE A;  1ML6 A;  4DSQ A;  5HR3 A;  3BJ5 A;  3TDG A;  5ECQ B;  4EF0 A;  5D8I A;  1NHY A;  4G0K A;  1JHB A;  3WGD A;  4Q5F A;  1EV4 A;  2CVD A;  1EEM A;  3QAG A;  1U3A A;  1O7U A;  3EMP A;  5CNW A;  4YQM A;  5JWO B;  2I3Y A;  20GS A;  3VWW A;  5IMC A;  1JZR A;  2OBK A;  3FZA A;  1A2J A;  2DKI A;  2MMN A;  1X9M B;  2N5A A;  2K18 A;  3ZIJ A;  2IJY A;  3R3E A;  5HR1 A;  4K7I A;  2H1A A;  2H19 A;  4WBJ A;  1SJZ A;  1YZX A;  1Q98 A;  3RAZ A;  2FA8 A;  1PN0 A;  2P0G A;  4BA7 A;  2HT9 A;  3CYN A;  3IC4 A;  3TKS E;  5JCU A;  2PN8 A;  4ZIJ A;  2M80 A;  2O89 A;  2H70 A;  3APQ A;  1F6M C;  2BJX A;  4TOP A;  5G31 A;  5HR0 A;  1R5A A;  2LRT A;  3UVH A;  2WUL A;  1ACV A;  2YWM A;  4MP4 A;  5IMF A;  4KGI A;  1FW1 A;  3E9J B;  3P7X A;  3CTF A;  1AXD A;  5CRD A;  2ZCT A;  3GFK A;  3TRP A;  4O5Q A;  5ECN B;  3A2X A;  2MBT A;  2FA4 A;  4MA9 A;  2C3Q A;  4ULX A;  4EVM A;  5H5R A;  4LMV A;  1SL0 B;  2R0G A;  6GSY A;  1QFN A;  1XCC A;  14GS A;  5C00 A;  3A5I A;  1SD8 A;  4ZL7 A;  3FRC A;  2I1U A;  5DJL A;  2R4V A;  3KCM A;  3D5J A;  9GSS A;  1TK0 B;  4X1U A;  4HS1 A;  5ABR A;  4MH2 A;  1UA5 A;  4OO5 A;  2KHP A;  3GNJ A;  4G2E A;  3BBY A;  4XS6 A;  4N0V A;  2WCI A;  1QQ2 A;  3P2A A;  2LQQ A;  4MH3 A;  1PA3 A;  5ECS A;  1PGT A;  3DRN A;  5H5Q A;  3E3E A;  3FR6 A;  4RQR A;  2XPE A;  1GLQ A;  3TUE A;  5GAP D;  2YWO A;  3FW2 A;  2GZZ A;  2QGV A;  3GYK A;  4I8B A;  1BG5 A;  1K3L A;  3GH9 A;  6GSW A;  5A5K A;  2FCH A;  4ZIL A;  1TP9 A;  3QPM A;  1BYE A;  1F3B A;  3Q6O A;  1GNE A;  4I6X A;  5CRW A;  3KH9 A;  1O8W A;  4DEJ A;  1QUW A;  3TRX A;  3VI7 A;  4BVX B;  3EVI A;  3C7M A;  1NSW A;  5BMU A;  2LJK A;  3VFI A;  5J9C A;  3QR6 A;  3EIN A;  3EYT A;  3HDC A;  4BWQ A;  4HU7 A;  2G2Q A;  4HUA A;  2DKH A;  6GSS A;  4MDC A;  3US3 A;  2IL3 A;  1XWK A;  2LV3 A;  2IMF A;  2PBJ A;  5G1L A;  1QXH A;  5IM9 A;  4IW9 A;  4WF4 A;  4YQU A;  1G7O A;  2QC7 A;  4TRX A;  1PX6 A;  5D93 A;  1J9B A;  3HJO A;  1V57 A;  4POB A;  2HRF A;  1Y25 A;  3ZFB A;  1GUH A;  1M99 A;  3LXT A;  5HFG A;  10GS A;  2X4A A;  4MAB A;  4FH8 A;  5G5E A;  2ON5 A;  2N5F A;  4IHU A;  2YWN A;  1TK5 B;  4MJC A;  1LJR A;  4I5Q A;  1B9X C;  3D0Z A;  1UN2 A;  4YAP A;  2C0E A;  2LUS A;  5EY6 A;  3IRA A;  1T00 A;  1JLW A;  4PQH A;  3A5W A;  3ERF A;  4TW5 A;  3APO A;  4K2X A;  4G19 A;  1TJD A;  4CHS A;  5JCG A;  3TJF A;  1BX9 A;  4ECJ A;  4HQS A;  1R7H A;  2MYG A;  1NM3 A;  2F8A A;  5CO3 A;  2BTO T;  2YOI A;  3G9B A;  3KIJ A;  1TW9 A;  4N10 A;  1B9Y C;  1OC8 A;  3LXZ A;  1TTZ A;  2B6M A;  1GP1 A;  3CTG A;  4RQX A;  1VF1 A;  2C80 A;  4EUY A;  2CAQ A;  4Z2R A;  4D73 B;  2DJ1 A;  3IK9 A;  1B48 A;  2IMI A;  2LRN A;  5L71 A;  1O73 A;  4NMU A;  1PX7 A;  4MNN A;  2PMT A;  2YAN A;  1U88 A;  4HJ2 A;  3GV1 A;  4POL A;  1CQH A;  2JAD A;  2EIR A;  1GSU A;  1OC9 A;  5JCW A;  5IO0 A;  3QCP A;  4ZB8 A;  1GUK A;  3VWV A;  4BVY A;  4KND A;  2VLV A;  3HZ8 A;  4KW6 A;  6GST A;  5KOX A;  2CVB A;  1EEJ A;  2O8V B;  3DVX A;  1WPI A;  2DIY A;  2WDU A;  3ZTL A;  2IPA A;  4KSO A;  1FO5 A;  2OE0 A;  4X0X A;  3J7Y k;  2DJK A;  4HJM A;  3MYD A;  4CDO A;  2IWT A;  1IYI A;  2H1G A;  3IAS 2;  1V2A A;  1UC7 A;  4V1A g;  1B4Q A;  3VUR A;  3IA1 A;  4PNF A;  1F9M A;  6GSV A;  3EUR A;  2XHF A;  5IO2 A;  2GVP A;  1GUL A;  5IPG A;  3GX8 A;  3U6V A;  2OKA A;  2E7P A;  1QMV A;  2RUE A;  3A2W A;  3QOU A;  4NAX A;  1GH2 A;  2E0Q A;  1GSE A;  3C1S A;  3QAW A;  1EP7 A;  5EL8 A;  1SKW B;  5D9W A;  4KUN A;  4O7H A;  5D96 A;  5C04 A;  3H8Q A;  4ZBA A;  2KUC A;  2P5Q A;  4K6X A;  3TKR A;  5DAK A;  2KLX A;  4EE0 A;  3I69 A;  4PUR A;  2DSA A;  2B1K A;  3HZ4 A;  1GTB A;  3TKS A;  3LOR A;  1A24 A;  3IXR A;  4P3Y B;  2DJ3 A;  4L8E A;  1Z7R A;  19GS A;  2H74 A;  4GST A;  3FKF A;  3Q19 A;  1OKD A;  2O87 A;  1M9B A;  1ZYP A;  1YEP A;  1WE0 A;  22GS A;  3ZIT A;  1XWA A;  5B7C A;  4AJ6 A;  4J2F A;  2V6K A;  1YY7 A;  4KSM A;  3H1N A;  2JSZ A;  5BRT A;  2FWH A;  1KEB A;  4OCF A;  4LMW A;  1XOA A;  1I9D A;  1GTA A;  2JZS A;  1T4Z A;  1AQX A;  2B5E A;  1JZW A;  3M1G A;  3V1W A;  4K7O A;  2VM1 A;  2L4C A;  2DIZ A;  2IN3 A;  1THX A;  2PGT A;  5KN2 A;  4WXT A;  1PN9 A;  3BCK A;  2EIO A;  1V9W A;  4NWY A;  2QKE A;  1X0R A;  3GX0 A;  1PRX A;  5B8B A;  3LGC A;  3ZVJ A;  4PX1 A;  5DCH A;  3FR3 A;  3GA4 A;  2OJL A;  2P5R A;  3J7Y b;  3L0H A;  2L5L A;  2C4J A;  4KCA A;  4MPG A;  1PL1 A;  1GSD A;  4A5P A;  4JR6 A;  3D4T A;  2LNT A;  3UEM A;  1EGR A;  4JR4 A;  3RBT A;  4O5R A;  3HHV A;  4IJI A;  2WS2 A;  3N5O A;  3H79 A;  1XZO A;  2V32 A;  2VL9 A;  3CSI A;  2R6K A;  2E2M A;  1VF2 A;  4MLY A;  3HYP A;  1FOV A;  1Z5Y E;  3TJJ A;  4CY6 A;  3IBH A;  4LL1 B;  2XBQ A;  3KD0 A;  1XWB A;  4Z2T A;  2FHE A;  3QAV A;  1AUC A;  4TR1 A;  3IC8 A;  2A2R A;  2HRN A;  1O6J A;  2VLU A;  3AY8 A;  3DYR A;  1ILO A;  3QFB C;  2PU9 C;  4K0N A;  4BWS A;  3WGE A;  2HZE A;  2FWG A;  2GLR A;  2O7K A;  2G0F A;  1X5E A;  4POK A;  5IOX A;  1B4P A;  4X43 A;  2VUP A;  4ILF A;  5FWG A;  3QDN A;  1NW2 A;  2AUV A;  7GSS A;  5IMZ A;  3CBU A;  4IN0 A;  2DJ2 A;  4GXZ A;  3UAP A;  2LJR A;  1WRY A;  2HSM A;  3DWV A;  2O85 A;  3IOS A;  1TK8 B;  5F06 A;  2NBS A;  2GT6 A;  2R5G A;  4IVF A;  2VIM A;  5ECL B;  2H8L A;  2QA1 A;  2NPB A;  5CYY A;  4IJ3 A;  2Z9S A;  1TRU A;  4WET A;  1Q4J A;  1YJ6 A;  5E4W A;  4PNG A;  4E8E A;  4TXO A;  5AGY A;  2WFC A;  1A23 A;  4NHW A;  2X8H A;  1FB6 A;  2H6Z A;  2J9H A;  1OC9 B;  2IMK A;  4ECB A;  5IMD A;  1LU4 A;  4DSR A;  1XVQ A;  3GRX A;  4BVY B;  3RHB A;  3BD2 A;  2VL2 A;  3MSZ A;  2L5O A;  5AIV A;  1M7T A;  2K8V A;  1A2L A;  2H0G A;  3WYW A;  1XW5 A;  2GT5 A;  4AJ8 A;  1SK0 A;  5DAL B;  3IK7 A;  3UAR A;  4EDZ A;  1MDK A;  3EE2 A;  4Z2U A;  1HNA A;  4MF7 A;  4IGJ A;  4HEA 2;  1LBK A;  2WJU A;  4IEL A;  1K0O A;  1GTI A;  3WGX A;  4ISD A;  1K0C A;  2F8F A;  2HYX A;  2JZT A;  2YNX A;  3M9K A;  1SJ6 A;  1ERU A;  1TOF A;  3CRT A;  5IMA A;  1A8L A;  3RHC A;  4KCE A;  2R0C A;  4AF2 A;  2OBI A;  2VD0 A;  4IQA A;  1HNB A;  5DAK B;  4XHM A;  3VPT A;  3DVW A;  1JZO A;  2YV7 A;  1M2B A;  2C1Y A;  2DMM A;  5KN0 A;  5DQS A;  2VD1 A;  1SK2 A;  5B6M A;  3HJM A;  2H30 A;  1Z7P A;  1Y6E A;  2DJJ A;  3KH7 A;  1DBY A;  1TRS A;  18GS A;  3ERW A;  3L4N A;  2CV4 A;  1BED A;  4DVC A;  3WT2 A;  2K8S A;  1G0T A;  1KBN A;  2FNO A;  1G6Y A;  1PKW A;  1ZMA A;  1ZL9 A;  1R4W A;  4GQC A;  4XS4 B;  1TU8 A;  3LQ7 A;  5IOW A;  2LQO A;  4I97 A;  2DJ0 A;  2TRC P;  4OD7 A;  3TRQ A;  1AQW A;  1XXU A;  1OVN A;  1TKD B;  1C72 A;  4USS A;  4IS0 A;  1AAZ A;  2C0F A;  1MD4 A;  3ZZX A;  1OKT A;  1K0N A;  3KMO A;  2V6O A;  3M9J A;  3CMI A;  4OO4 A;  4G0I A;  1RK4 A;  3QMX A;  4V2M A;  2H0H A;  2VCZ A;  4YH2 A;  2JL4 A;  4JED A;  4YQV A;  4TR0 A;  1GLP A;  4XRD A;  3UJ1 A;  2VO4 A;  4F9Z A;  3LSZ A;  1SYR A;  2H71 A;  3GHA A;  3JCM L;  8GSS A;  2YP6 A;  1H4O A;  3DXB A;  2C0D A;  1J08 A;  1USB A;  3IE3 A;  1OC3 A;  4KB3 A;  1SEN A;  4FYU A;  1HQO A;  5EPF A;  3FY7 A;  3UMA A;  2MMA A;  1YEX A;  2CZ2 A;  4TN8 A;  2B3S A;  4LL4 B;  2WRT A;  3ED3 A;  4JZQ A;  2L59 A;  3CXG A;  2H1B A;  1CQG A;  4MJE A;  2X64 A;  2HI7 A;  2MMO A;  3I6A A;  1SU9 A;  4KAE A;  1WMJ A;  4MCU A;  3KMN A;  1J0F A;  2IFQ A;  3KGK A;  3HVV A;  1Z6M A;  1SYX A;  1XW6 A;  1T7P B;  1PSQ A;  2VLT A;  2E2G A;  5A4U A;  1F3A A;  2JSY A;  1AW9 A;  2A4V A;  5COH A;  5CRH A;  1E6B A;  3CRU A;  1B8X A;  4MZW A;  3PIN A;  5J3R A;  2GZY A;  2WGR A;  3Q74 A;  3F8U A;  2HZE B;  1EGO A;  1V40 A;  3DGQ A;  17GS A;  2H75 A;  4PQI A;  2M72 A;  4HDE A;  2LKU A;  5AN1 A;  2H76 A;  1XOB A;  5AIX A;  2WB9 A;  1M9A A;  3LYP A;  2OAD A;  4Q5R A;  1AIU A;  5F0G A;  2GSS A;  2VL3 A;  5CRG A;  3IHQ A;  4EIQ A;  5G1K A;  2H6X A;  3M8N A;  2DBC A;  3APS A;  1GNW A;  1T3B A;  4V2N A;  2OE3 A;  5CRE A;  1NHO A;  1FOH A;  4WBR D;  1TU7 A;  5FHI A;  4GSS A;  1S3D A;  3GIX A;  4OMV A;  5F05 A;  2WZ9 A;  1PMT A;  4TVE A;  5D9V A;  5KN3 A;  2EC4 A;  5IMV A;  2YWI A;  5D73 A;  5IQY A;  3TOU A;  4RUV A;  5ECP B;  4NV5 A;  1XIY A;  3GTU A;  4TXO B;  2H73 A;  5CP1 A;  4O92 A;  3WT1 A;  1G7E A;  4GQF A;  4QL9 A;  2HNL A;  3ME7 A;  2YZU A;  3O76 A;  3F3R A;  3L78 A;  5LCZ A;  3LFL A;  2AV4 A;  3PPU A;  3RDW A;  2TIR A;  1K3O A;  5J4U A;  3GKN A;  4PUA A;  4MF5 A;  2PVO C;  3I43 A;  2B7K A;  3LG6 A;  3PR8 A;  3LJR A;  4AGS A;  1A0F A;  2XBI A;  4V1A p;  1K0M A;  2C3N A;  3F6D A;  1PD2 1;  2FLS A;  4G0L A;  4HZ4 A;  1K0A A;  3TKP A;  4O5U A;  4MJB A;  4V2L A;  1Z3E A;  1TDI A;  2HE3 A;  1YKC A;  3GMF A;  3KEB A;  3FHK A;  4FYB A;  3D22 A;  4RI6 A;  2GTU A;  1JLV A;  3VI5 A;  4JE1 A;  2C8U A;  3K8N A;  4OFT A;  1WP0 A;  3VPQ A;  4Q5N A;  3KJY A;  2FY6 A;  3M3M A;  3ZVJ D;  4TR4 A;  4JRR A;  4I2U A;  3RPP A;  4G10 A;  5D9X A;  3KTL A;  2HRK A;  1XWC A;  2PVQ A;  4BL7 A;  1SKR B;  1TI3 A;  4H86 A;  3W8S A;  4K1F A;  1A8Y A;  2J23 A;  4K9Z A;  5J41 A;  4L5O A;  1FG4 A;  3LW9 A;  3GL3 A;  2RM5 A;  2AB6 A;  1N2A A;  5DCG A;  4KDU A;  5DJM A;  5HFI A;  1FAA A;  2KOK A;  2RII A;  3IAM 2;  1OE8 A;  4Q5Q A;  5FT3 A;  2HLS A;  1VRS D;  2LTK A;  2LNS A;  1JFU A;  1YF1 A;  5ID2 A;  4L5L A;  4EIP A;  2IIY A;  3C8E A;  1YQ1 A;  2HXK A;  1T8E B;  3HKR A;  1W4V A;  2R0P A;  1X5D A;  2KP1 A;  2X49 A;  1MD3 A;  1XW9 A;  4E8H A;  2NDO A;  13GS A;  3EU3 A;  5KEJ A;  5DDL A;  3KM6 A;  2MMZ A;  2CT6 A;  1XFL A;  1HD2 A;  3TJK A;  3HVS A;  3IR4 A;  1KNG A;  4MJA A;  3EWL A;  4KA0 A;  4RI7 A;  4EXJ A;  2XC2 A;  2HZF A;  1ZYE A;  5ELA A;  3SWL A;  3N9J A;  1TI1 A;  1E2Y A;  1FVK A;  3DD3 A;  1R5P A;  1ERT A;  1YDK A;  3TOT A;  3FZ9 A;  4IP6 A;  4WKW A;  1URM A;  2C3T A;  2V1M A;  2X8G A;  4HQZ A;  3F63 A;  3F4T A;  3VWX A;  4ECI A;  1WWJ A;  1IYH A;  1MEK A;  1EOH A;  3ZYW A;  4X4J A;  4ZL9 A;  4K5R A;  3LWA A;  1U6T A;  2B5Y A;  4F0B A;  3DEX A;  3G7J A;  2VCT A;  3QFA C;  2UZ8 A;  4KX4 A;  2IFQ B;  3UBK A;  4K2D A;  2K6V A;  4OFN A;  4WF5 A;  2DLX A;  5KN1 A;  4J56 E;  3ME8 A;  5J9B A;  2HRA A;  4GTU A;  3NZN A;  5D9T A;  3GN3 A;  3ZFL A;  5HQP A;  3KP9 A;  3LYK A;  1SL1 B;  1GSS A;  1G6W A;  1GTU A;  4L0U A;  3OR5 A;  4DSS A;  4MF6 A;  4D73 A;  2NVL A;  2V41 A;  5ECI B;  5F8B A;  2YZH A;  3KP8 A;  3C71 A;  1MDI A;  4TXV A;  2REM A;  5INY A;  3HVX A;  4IBP A;  4ZB9 A;  4ZL8 A;  4N30 A;  2GQM A;  5ECH B;  3GKK A;  3TCO A;  3DKS A;  5AIS A;  3TKS C;  1OAZ A;  2PPT A;  4F0C A;  4KE3 A;  2K9F A;  1VF4 A;  2MBS A;  3MIX A;  1W89 A;  4WR4 A;  5DBQ A;  1ST9 A;  4MZC A;  5GAN D;  4GF0 A;  1WJK A;  4ZBD A;  2L57 A;  1SD9 A;  4HI7 A;  4Z7X A;  2CQ9 A;  3GTU B;  5JWR B;  4FYC A;  4K0G A;  2FGX A;  1DUG A;  3R2Q A;  3NOF A;  2RM6 A;  3H93 A;  4OWY A;  2A2S A;  2CVK A;  3GSS A;  4KH7 A;  3TJB A;  3ZMK A;  3IV4 A;  4ACS A;  2VCQ A;  4BPY A;  4N11 A;  3PGT A;  2BMX A;  1X9S B;  3GH6 A;  4K8M A;  2KP2 A;  1YF0 A;  2GS3 A;  2HSY A;  1DE2 A;  2OE1 A;  4KDY A;  3ZRE A;  1GSQ A;  1R26 A;  2ON7 A;  3D21 A;  4GCI A;  3IPZ A;  4NPB A;  1V98 A;  1VF3 A;  2YPM A;  2C0G A;  4WR5 A;  5GZZ B;  2H6Y A;  3DIE A;  2ES7 A;  5H5S A;  1M2A A;  2ALB A;  2F9S A;  3TGZ A;  3E0U A;  4KDX A;  1M2D A;  3LEF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...