4CDOA

Crystal structure of pqbp1 bound to spliceosomal u5-15kd
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
171
structure length
150
Chain Sequence
MLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMVDIIETVYRGARKGRGLVVSPKDYSPYPSPGAVLRANAEAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords THIOREDOXIN-LIKE PROTEIN 4A, POLYGLUTAMINE-BINDING PROTEIN
publication title Mutations in the Pqbp1 Gene Prevent its Interaction with the Spliceosomal Protein U5-15Kd.
pubmed doi rcsb
source organism Homo sapiens
total genus 47
structure length 150
sequence length 171
chains with identical sequence C
ec nomenclature
pdb deposition date 2013-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02966 DIM1 Mitosis protein DIM1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4cdoA00
1YDKA 5LNKe 4HOJA 4DSSA 5GAND 3LSZA 2IL3A 3W8JA 2IFQA 2TRXA 2VCTA 3W8SA 3D4TA 2VCQA 5F05A 1X5DA 1EEMA 4FYCA 2I1UA 2FA8A 4WBJA 5CRHA 1YZXA 1EGOA 3TJKA 3D4MA 5C00A 2H8LA 4D73A 3ZL5A 4GRFA 4ZIJA 5EY6A 2VL3A 1GSDA 5KN0A 1X9WB 2KP2A 2GTUA 2WFCA 1OKDA 1V9WA 2VL9A 1TP9A 2AUVA 1UC7A 1M9AA 3H4KA 2M80A 2CT6A 6GSVA 3APOA 2K18A 4PGTA 4EC0A 4BVYA 4GSSA 4OFNA 4EVMA 2YN1A 1AIUA 2H71A 5AN1A 1HNAA 1GUHA 1ACVA 2WS2A 1NHYA 4PQ1A 3IA1A 1QGVA 2QGVA 3GIXA 3QFBC 4Z7XA 1I5GA 4RI7A 3VWUA 5DDLA 1M9BA 2R5GA 3WT2A 1YJ6A 4X43A 5IPHA 2FUG2 3TRPA 5F0GA 5DBQA 2IMKA 3O6TA 4KNDA 3GYKA 1GNEA 3QDNA 3KMNA 4L0UA 4MZBA 1FW1A 2CQ9A 1S3CA 4OWYA 1K0NA 3SBCA 1OE7A 1FVJA 1G7OA 5DQYA 1WIKA 4MJAA 3LG6A 3FK8A 2DJ3A 2IMEA 4MJCA 3HY2A 1THOA 1BEDA 3TOTA 1U3IA 3ZTLA 6GSWA 2AB6A 1K3YA 1ZCPA 3QAVA 1XZOA 3VURA 3HVXA 2P5RA 2F9SA 1Z3EA 3IV4A 2I81A 2H6ZA 1DBYA 3UBLA 2C0GA 3IPZA 4LL4B 5DVBA 2KHPA 1QMVA 3WD6A 2YNXA 4BA7A 1SKRB 4FYUA 3P7XA 4YQUA 4IP6A 1K3LA 5G1KA 6GSSA 2B5EA 2EC4A 5JWOB 2GSRA 2IMDA 4KX4A 2GZZA 5G5FA 4NMUA 1XCCA 1V40A 1K0BA 3PH9A 3F63A 5CREA 4QQ7A 4XIHA 5CRDA 3F9UA 4G10A 2V32A 1ERVA 2O87A 3C73A 3UEMA 3Q18A 5DAKB 3QAWA 1A0RP 1KBNA 2ES7A 4TOPA 2OACA 4GTUA 1PSQA 5GSTA 4BVXA 2QSIA 2VCZA 2YWMA 3RBTA 3F6FA 2H6XA 5F06A 5KN2A 4NHZA 2JZTA 4Q5FA 5FWGA 3GUSA 2CVBA 2YANA 1G0TA 2OBIA 1TI1A 3FKFA 3DXBA 1R4WA 3H1NA 5IMCA 5JCUA 2GLRA 4BWSA 3RHCA 4ZILA 1XXUA 1YKAA 3UAPA 1OC9B 1XW5A 3GV1A 2H19A 3ERGA 5JCGA 1DE2A 3L0HA 4MMMA 3MSZA 1ZMAA 5HFIA 5EL8A 2IIYA 1K0AA 5IMAA 2FHEA 4KE3A 5ECPB 5JWRB 17GSA 1TXXA 3IRAA 3EYTA 4IKHA 4KDXA 1O85A 2B1KA 2Z9SA 3QAGA 1SKSB 1J9BA 4JEDA 3GKKA 4XS6A 3L78A 2NBSA 1PL2A 3E3EA 4ZBAA 2K8SA 2PPTA 3TKRA 4POMA 3FY7A 3ME8A 2H75A 3IDVA 4L8EA 1B8XA 4HS1A 2X8CA 3G7YA 1GSSA 2K8VA 3LQ7A 4RQRA 5D9TA 1JLWA 3KGKA 2I9HA 3TOUA 2LTKA 1QK8A 4TR1A 3CBUA 3WGXA 2N5AA 3DWVA 2HLSA 16GSA 5DCHA 1R5PA 3DIEA 2GDRA 3TRQA 5J5NA 2DC5A 1U87A 1EEJA 3M9JA 4Q5RA 1QFNA 1VF3A 3KTLA 5B8BA 5JWQB 2CX4A 3EU4A 2DMLA 2H0IA 2YV7A 1F9MA 4K0NA 1SENA 2XPDA 5A4WA 1QUWA 3A2VA 4AGSA 1BAYA 4KB3A 4GSTA 2WB9A 3QOUA 3LYPA 3IHQA 2YWIA 3E9JB 1LJRA 3I43A 1NM3A 2NPBA 5L71A 1RW1A 2P5QA 2J23A 1GSUA 2GVPA 1PKZA 1Z6MA 2MMZA 5AIXA 2YCDA 4X0XA 4BPYA 3TJGA 4EL1A 1K3OA 4MF7A 3KIJA 2JL4A 2L4QA 2ON5A 5J3RA 5DQSA 2GGTA 1ZGNA 3FR3A 1O73A 3KP9A 3M8NA 1T00A 3TKSE 2H1GA 3W6GA 3G9BA 4J57E 4DSQA 1X9MB 4MCUA 2V6OA 4ML1A 4K1FA 2VLTA 2DLXA 3KZQA 4DEJA 4Q5NA 3GX0A 5CRWA 2FWGA 1OE8A 4RUVA 2H74A 3TKSA 1SKWB 2F3MA 5IPGA 4ZB6A 1WOUA 4OFMA 2FWHA 3QCPA 3GN3A 2DJ1A 2CAQA 3KM6A 1EOGA 4GF0A 5G31A 4ID0A 1THXA 3M3MA 4J56E 1Z7RA 3IR4A 3BOAA 4P3YB 3TJBA 1JZDA 4YQVA 1J08A 1VF4A 1YEXA 2GZPA 5FT3A 4LA1A 4G2EA 2I3YA 4PXOA 1M2AA 1NSWA 3P2AA 1Y6EA 1AXDA 4KW6A 2FWFA 3L9VA 3GL3A 1PL1A 4GCIA 1AQVA 3Q6OA 1TK5B 2RLIA 2VM2A 4YAPA 3KH7A 3VI7A 4MDCA 3VLNA 3IK7A 1PD21 4GQCA 4IP1A 4L5OA 3P90A 1R26A 4KCEA 4MJEA 2X99A 1PX7A 2HSHA 3C71A 5HR1A 3E0UA 4HQSA 3ZREA 1S3DA 1XVWA 1PRXA 3O76A 4K7NA 4IBPA 4X1UA 2GS3A 3ZMKA 2WCIA 2E7PA 2HE3A 2YV9A 4QL7A 2LJRA 1VRSD 3TUEA 2X8GA 3GRXA 3J7Yk 4K7OA 4TR4A 1Z9HA 3M1GA 2E2MA 1M2BA 2QC7A 1ABAA 3F6DA 4AF2A 2HRNA 2DMMA 2PUKC 3D6IA 3LYKA 1TRVA 3TGZA 2H70A 2AHEA 1MD3A 5ECQB 2GT5A 4KSMA 5D9WA 2LEGA 2A2RA 4HDEA 3TDGA 4V1Ap 2DIZA 4BL7A 2F51A 3FZAA 5IOWA 1JZRA 3RPNA 1K0MA 3UIWA 1NW2A 5GSSA 3C8EA 1OC8A 4WR4A 1M7TA 1M2DA 3EVIA 1DE1A 3DRNA 4LMWA 3HVSA 4OCEA 5IO0A 4ACSA 2HFDA 4HEA2 1FAAA 4IVFA 1U3AA 2FGXA 5ENUA 2YPMA 1XWCA 2VO4A 4MK3A 3DD3A 1G6YA 2GQMA 5IMDA 2E2GA 5H5RA 1TDIA 2F8AA 3UARA 3F4TA 1Q98A 1X5EA 4TR3A 2XBQA 1HNBA 4ZL8A 2LRCA 1PGTA 3UBKA 2L5LA 2L57A 3HVVA 13GSA 4MABA 2ZUPA 3HD5A 3MWHA 2B7JA 3LJRA 2MMOA 3BCIA 1BQ7A 3HDCA 1QQ2A 4JRRA 2L4CA 5DJLA 2G0FA 2JU5A 3Q74A 2KP1A 1PA3A 1SL1B 4XTSA 4ILFA 5F07A 1Z7PA 4V1Ag 4I97A 1V98A 4OMVA 3TCOA 2R37A 2PBJA 1N2AA 1XBSA 3AY8A 2KOKA 1YQ1A 4TRXA 3GH6A 2H66A 5J9BA 5AISA 2CA8A 4FIWA 4OFTA 2VOCA 2JACA 1OC9A 2IPAA 3D21A 4ISDA 2LQOA 4ULXA 1GWCA 2A2SA 3DEXA 5IM9A 2G2QA 1MDKA 2NTOA 3HA9A 2VLVA 4ECBA 5HR2A 2JZRA 4JU5A 5B8AA 3QD9A 1T4ZA 2O8VB 4N0ZA 4V2MA 1KEBA 2L5OA 3ZIJA 4RQXA 4JBBA 1OVNA 1KTEA 5KN1A 3IK9A 5EPFA 1X9SB 1MDIA 2WULA 3P8WA 3PR8A 3U5RE 1Z6NA 3GA4A 2H72A 2M72A 4NV2A 4NAXA 2VL2A 1E6BA 2LNTA 4HZ4A 1JZOA 2L59A 2LV3A 1ERWA 4FH8A 2B3SA 5E4WA 4IW9A 2WJUA 5DALB 3UL3A 2C3NA 3C1RA 3F3QA 1URMA 5ABRA 1FHEA 2HSYA 4PURA 3TB2A 3EC3A 3Q19A 2H76A 4ZL7A 1F2EA 5JCWA 4GWRA 2HZEB 5HR3A 5G5EA 1T7PB 4N30A 1ZL9A 3ZYWA 1R7HA 3ZIVA 2LKUA 3H93A 4WXTA 1K0DA 1XW9A 4WF5A 1A2LA 1N8JA 4WETA 1RQMA 4KDYA 3F0IA 2OE3A 4F82A 3IAM2 2VLUA 1RK4A 3VI5A 5ID2B 2F8FA 1A2MA 3C7MA 2RIIA 5H5QA 4EO3A 3NZNA 2NDOA 3QFAC 5ELGA 4NWYA 3ME7A 2FLSA 5LD0A 5ECSA 2LS5A 3IAS2 3PGTA 3VFIA 4TXOB 2ALBA 3FW2A 4PUFC 7GSSA 2CAIA 3BCKA 4XS4B 5A4UA 1HNCA 2ON7A 5IMZA 2JSYA 4NHWA 4OO4A 3FR6A 1V2AA 2EIOA 4WEYA 3IC4A 1B9YC 1ZYEA 5D9VA 4K9ZA 5GZZB 3VPQA 4HU9A 1AC1A 4MZWA 4BWQA 2GQKA 2V6KA 5ECNB 2VUPA 3HJOA 1SYRA 2KLXA 2H6YA 1XWAA 1KNGA 4GSNA 4WKWA 3L9UA 3APSA 5A4VA 4KUNA 2CVDA 2HXKA 3A2WA 1AQXA 3CRTA 4PQIA 5H5SA 1PN9A 4FO5A 4ZXGA 2LNSA 4HU7A 4YH2A 3EMXA 1J0FA 2DJ2A 2TIRA 1BG5A 2DJKA 3CSHA 1TU7A 5ECMB 2IN3A 5D8IA 5HQPA 1E2YA 2B6MA 14GSA 1NHOA 1CQHA 5HR0A 2R4VA 1ZOFA 2PVQA 5G1LA 2EIQA 1ZYQB 4MJBA 3VWWA 5IMFA 4N10A 3LORA 2OADA 4EKZA 3NOFA 3WYWA 3CYNA 1S3AA 1W89A 4KAEA 5J4UA 1SK2A 1ST9A 3FEUA 4HJ2A 1FB0A 2V41A 1TTZA 1TRUA 2YZHA 4GQFA 5HFGA 1EWXA 1H4OA 3ISOA 3HKRA 1GLQA 4YAVA 1JFUA 3SWLA 4XRDA 1M0UA 4JR4A 1MDJA 1OC3A 1HQOA 2R2JA 2FA4A 3GSTA 2YOIA 4NV5A 2WGRA 1GRXA 10GSA 2O89A 2BTOT 2E0QA 1GULA 1I9DA 2M46A 1F3AA 1XPVA 2RUEA 4K0GA 1FO5A 2OE1A 4TKYA 1GSQA 5CO3A 2DJ0A 1A23A 2REMA 4OCFA 3BBYA 1EV4A 1B9XC 1O81A 3KTBA 2L6DA 3KCMA 2XPEA 4E8HA 1G7EA 1QXHA 2XC2A 2OA7A 5IO2A 1EV9A 2L6CA 5E59A 1DSBA 5D9XA 3GSSA 3EWLA 3EE2A 1F37A 1HD2A 1U6TA 1M99A 2PWJA 2HZFA 22GSA 4I6XA 5B7CA 2FD3A 3M9KA 1USBA 2H0HA 2N5BA 4EDYA 5J41A 2DIYA 4ML6A 1R5AA 1AQWA 1GUMA 2VCXA 3S9FA 3DVWA 3F8UA 1WWJA 20GSA 2OKAA 2K9FA 4EDZA 4MP4A 2P31A 2C0FA 2EIRA 1AUCA 3C1SA 3BJ5A 2HYXA 3GKXA 2YJ7A 4RI6A 4O5RA 3FYGA 3IBHA 4GXZA 12GSA 2MBTA 1EP7A 4KSOA 3ZITA 3LXZA 3QPMA 4JE1A 2QKEA 3CSIA 4J2FA 2LUSA 1TJDA 1O7UA 3UMAA 3MDKA 4EF0A 2P0GA 1PX6A 2JZSA 1WE0A 1SD9A 4K7IA 3KEBA 4I8BA 5G30A 1OYJA 1AW9A 1UVZA 1ZZYA 4ZBBA 5ELAA 5CRGA 3VPTA 3DGQA 2AV4A 5ECOB 2RM5A 1EOHA 4LLRA 2VM1A 4G19A 1JZWA 3GH9A 3PINA 3ZVJA 3FR9A 2HI7A 1XVQA 1K0OA 4JR6A 3KXOA 2YZUA 3VK9A 4HJMA 4PNGA 3CTFA 1VGLA 3I6AA 2DJJA 4Q5QA 3GTUB 2WRTA 2AAWA 3APQA 1WRYA 2CX3A 2FNOA 1ERTA 4PNFA 1WJKA 3NIVA 3DMLA 5A5KA 1V57A 3GHAA 2C3TA 4N0VA 4F03A 2N5FA 2YWNA 5ECKB 5J9CA 4TW5A 2X8HA 1T3BA 1FB6A 5KN3A 2VCVA 2IWTA 5DAKA 5F8BA 1GNWA 4DVCA 1BYEA 5EVOA 4POLA 4HQZA 4PUAA 3U6VA 5DALA 4ZB9A 3KH9A 3FHKA 1JHBA 1TK8B 3J7Yb 4HUAA 2C8UA 2OJLA 3ERFA 2HZEA 3H79A 1OKTA 4L0WA 3VWVA 1TRWA 1A8YA 3GKNA 3L9SA 2VIMA 3F4SA 2XHFA 3K8NA 3D22A 4TN8A 2YWOA 5IIZA 1JLVA 3CRUA 3FZ5A 3KP8A 2LRTA 1TOFA 4V2NA 1X5CA 3GX8A 8GSSA 4WF4A 5CP1A 3ED3A 1XOBA 3N9JA 4XCSA 5ID2A 3A2XA 3UVTA 4ZBDA 2PU9C 4POBA 5COHA 4G9HA 4POKA 1Y25A 2LSTA 1UA5A 2B5XA 3TJJA 1PKWA 3GFKA 4IQAA 3F4RA 2AJQB 4HZ2A 2CV4A 4KCAA 1UN2A 4DSSB 1WP0A 5D93A 1CQGA 4TXOA 2BMXA 3N5OA 2C1YA 2B7KA 4QL9A 2IFQB 4MH2A 3GURA 1YF0A 5G2ZA 5B6MA 4XS4A 2O85A 3EINA 3LFLA 2GSTA 2HNLA 3WGDA 4XHMA 2GSSA 1BX9A 4D73B 4LMVA 3TKQA 1SJ6A 6GSYA 1GUKA 5CNWA 3HHVA 3EMPA 1ML6A 4K8MA 4MPGA 3A5WA 3WGEA 2KUCA 11GSA 1XIYA 1ON4A 2R3XA 2LJKA 3RPPA 1T1VA 1LBKA 1XOAA 3TKSC 1W4VA 1GL8A 3LWAA 3I69A 6GSXA 4I5QA 4KH7A 5IOXA 1SL0B 1ILOA 3ZFBA 4IJIA 1H75A 1PMTA 5ECLB 1T8EB 3JCML 1B48A 2CVKA 3KMOA 2LJAA 5AIVA 3M0FA 1K0CA 3F3RA 3O3TA 4XRAA 1MD4A 2WZ9A 3UOMA 2NVLA 5IQYA 4O92A 3EU3A 4OD7A 5CYYA 1SK1A 4F2IA 3D5JA 4ZB8A 1OAZA 1YY7A 4MPFA 3H8QA 4CW9A 18GSA 2VD1A 2FWEA 1V58A 3R2QA 3CMIA 4AJ8A 2HT9A 1TI3A 1HYUA 5KEJA 2H73A 1YF1A 1C72A 2GSQA 5ECIB 1TU8A 2J9HA 5DCGA 3RDWA 3CSJA 2VAFA 4E8EA 1IYIA 1MEKA 2RUFA 2YP6A 2H1BA 2CZ2A 1SL2B 2MMNA 3ZVJD 3HYPA 2O7KA 4K6XA 1XW6A 2IJYA 1ERUA 4I2UA 1O8WA 4CDOA 1SJZA 4F0CA 2R6KA 4F9ZA 2I4AA 1GP1A 2HRFA 3US3A 4IGJA 4PX1A 4F0BA 2OBKA 4NPBA 4AJ7A 1G6WA 2MMAA 2GZYA 3GL5A 1GTAA 1TK0B 1BJXA 3RAZA 4GLTA 1O8XA 1GLPA 1SU9A 3ZFLA 3MNGA 4CHSA 3MAKA 1GH2A 3EURA 3VWXA 4KGIA 3FZ4A 3UVHA 1X0RA 2XBIA 3LXTA 3HZ8A 3HZ4A 4MLYA 1U88A 4TR0A 4N11A 2C4JA 2PN8A 4IELA 1YEPA 5CAXA 2FCHA 3LGCA 3ZMLA 3ERWA 1A24A 2IMFA 4EXJA 2TRCP 3CTGA 4MH3A 4XS1A 2PVOC 4DSRA 3ZZXA 4MA9A 4EE0A 1GSFA 3TRXA 2ZNMA 1GSEA 2MYGA 4AJ6A 1TRSA 1WMJA 2V2GA 3CXGA 3HXSA 4MF5A 1SYXA 4OO5A 2B1LA 3G7IA 2LRNA 3HJMA 4V2LA 1LU4A 19GSA 1MTCA 1SK0A 2FY6A 2LQQA 1GSYA 1WPIA 1F3BA 5ECHB 3LEFA 5INYA 4FYBA 5AGYA 3GMFA 4JZQA 1O6JA 3IXRA 5D73A 2V1MA 4KA0A 3G7JA 1EGRA 4IQ1A 1YKCA 4TVEA 1GTUA 2BJXA 2VCWA 2PGTA 6GSUA 2IMIA 2VD0A 5DJMA 4IN0A 1FVKA 1FOVA 2WDUA 3D0ZA 3FRCA 1DUGA 2OE0A 4TR1B 1Q4JA 1Z5YE 3L4NA 4K2DA 4ECIA 2K6VA 2PMTA 3ZRDA 4KDUA 5LCZA 1B4QA 4IHUA 5IMVA 3DVXA 1SJIA 1TW9A 2X64A 1FG4A 1AAZA 4ECJA 3GKMA 5B6NA 5C04A 1EP8A 2D2ZA 2DSAA 3GTUA 4NXIA 5ECRB 2H0GA 3UJ1A 2H30A 5D96A 3IE3A 1XWKA 4IJ3A 4PQHA 4O32A 1SD8A 3HJPA 1EZKA 3HCZA 3WT1A 1A2JA 4H86A 3RHBA 2RM6A 1F6MC 4L5LA 4MZCA 2C80A 4WR5A 6GSTA 2ZCTA 3A3TA 1T4YA 2C3QA 1XWGA 4MF6A 1PQNA 2C0EA 3ZLPA 3KD0A 2H1AA 1A0FA 2MBSA 3I9V2 4YQMA 4IS0A 4ZL9A 5GAPD 3KJYA 1XWBA 3TJFA 2JSZA 1TKDB 4EUYA 2VL2C 3OR5A 4O7HA 3QR6A 2PERA 1VF1A 4HI7A 2B5YA 4LL1B 1GTBA 2CZ3A 2JADA 1VF2A 1IYHA 2MZCA 2A4VA 3GNJA 3DKSA 4ECCA 3DYRA 3IOSA 5FHIA 3QMXA 2YJHA 2H01A 2GT6A 4I2TA 3FZ9A 5HFKA 4TXVA 2H1DA 1A8LA 1XFLA 3BD2A 2GQLA 2DBCA 2AYTA 4WBRD 9GSSA 1GTIA 2C0DA 1B4PA 3V1WA 3TKPA
chains in the Genus database with same CATH superfamily
1YDKA 5LNKe 4HOJA 4DSSA 5GAND 3LSZA 2IL3A 3W8JA 2IFQA 2TRXA 2VCTA 3W8SA 3D4TA 2VCQA 5F05A 1X5DA 1EEMA 4FYCA 2I1UA 2FA8A 4WBJA 5CRHA 1YZXA 1EGOA 3TJKA 3D4MA 5C00A 2H8LA 4D73A 3ZL5A 4GRFA 4ZIJA 5EY6A 2VL3A 1GSDA 5KN0A 1X9WB 2KP2A 2GTUA 2WFCA 1OKDA 1V9WA 4ICYA 2VL9A 1TP9A 2AUVA 1UC7A 1M9AA 3H4KA 2M80A 2CT6A 6GSVA 3APOA 2K18A 4PGTA 4EC0A 4BVYA 4GSSA 4OFNA 4EVMA 2YN1A 1AIUA 2H71A 5AN1A 1HNAA 1GUHA 1ACVA 2WS2A 1NHYA 4PQ1A 3IA1A 1XG8A 1QGVA 2QGVA 3GIXA 3QFBC 4Z7XA 1I5GA 4RI7A 3VWUA 5DDLA 1M9BA 2R5GA 3WT2A 1YJ6A 4X43A 5IPHA 2FUG2 3TRPA 5F0GA 5DBQA 2IMKA 3O6TA 4KNDA 3GYKA 1GNEA 3QDNA 3KMNA 4L0UA 4MZBA 1FW1A 2CQ9A 2R0CA 1S3CA 3A5IA 4OWYA 1K0NA 3SBCA 5BRTA 1OE7A 1FVJA 1G7OA 5DQYA 1WIKA 4MJAA 3LG6A 3FK8A 2DJ3A 2IMEA 4MJCA 3HY2A 1THOA 4BL7B 1BEDA 3TOTA 1U3IA 3ZTLA 6GSWA 2AB6A 1K3YA 1ZCPA 3QAVA 1XZOA 3VURA 3HVXA 2P5RA 2F9SA 1Z3EA 3IV4A 2I81A 2H6ZA 1DBYA 3UBLA 2C0GA 3IPZA 4LL4B 5DVBA 2KHPA 1QMVA 3WD6A 2YNXA 4BA7A 1SKRB 4FYUA 2R0PA 3P7XA 4YQUA 4IP6A 1K3LA 5G1KA 6GSSA 2B5EA 2EC4A 5JWOB 2GSRA 2IMDA 4KX4A 2GZZA 5G5FA 4NMUA 1XCCA 4YKGA 1V40A 1K0BA 3PH9A 3F63A 5CREA 4QQ7A 4XIHA 5CRDA 3F9UA 4G10A 2V32A 1ERVA 2O87A 3C73A 3UEMA 3Q18A 5DAKB 3QAWA 1A0RP 1KBNA 2ES7A 4TOPA 5KOXA 2OACA 4GTUA 1PSQA 5GSTA 4BVXA 2QSIA 2VCZA 2YWMA 3RBTA 3F6FA 2H6XA 2HSMA 4X4JA 5F06A 5KN2A 4NHZA 2JZTA 4Q5FA 5FWGA 3GUSA 2CVBA 2YANA 1G0TA 2OBIA 1TI1A 3FKFA 3DXBA 1R4WA 3H1NA 5IMCA 5JCUA 2GLRA 4BWSA 3RHCA 4ZILA 1XXUA 1YKAA 3UAPA 1OC9B 4YKFA 1XW5A 3GV1A 2H19A 3ERGA 5JCGA 1DE2A 3L0HA 4MMMA 3MSZA 1ZMAA 5HFIA 5EL8A 2IIYA 1K0AA 5IMAA 2FHEA 4KE3A 5ECPB 5JWRB 17GSA 1TXXA 3IRAA 3EYTA 1M3JA 4IKHA 4KDXA 1O85A 2B1KA 2Z9SA 3QAGA 1SKSB 1J9BA 4JEDA 3GKKA 4XS6A 3L78A 2NBSA 1PL2A 3E3EA 4ZBAA 2K8SA 2PPTA 3TKRA 4POMA 3FY7A 3ME8A 2H75A 3IDVA 4L8EA 1B8XA 4HS1A 2X8CA 3G7YA 1GSSA 2K8VA 3LQ7A 4RQRA 5D9TA 1JLWA 3KGKA 2I9HA 3TOUA 2LTKA 1QK8A 4TR1A 3CBUA 3WGXA 2N5AA 3DWVA 2HLSA 16GSA 3FMWA 5DCHA 1R5PA 3DIEA 4KF9A 2GDRA 3TRQA 5J5NA 2DC5A 1U87A 1EEJA 3M9JA 4Q5RA 1QFNA 1VF3A 3KTLA 5B8BA 5JWQB 2CX4A 3EU4A 2DMLA 2H0IA 2YV7A 1F9MA 4K0NA 1SENA 2XPDA 5A4WA 1QUWA 3A2VA 4AGSA 1BAYA 4KB3A 4GSTA 2WB9A 3QOUA 3LYPA 3IHQA 2YWIA 3E9JB 4Z2TA 1LJRA 3I43A 1NM3A 2NPBA 5L71A 1RW1A 2P5QA 2J23A 1GSUA 2GVPA 1PKZA 1Z6MA 2MMZA 5AIXA 2YCDA 4X0XA 4BPYA 3TJGA 4EL1A 1K3OA 4MF7A 3KIJA 2JL4A 2L4QA 2ON5A 5J3RA 5DQSA 2GGTA 1ZGNA 3FR3A 1O73A 3KP9A 3M8NA 1T00A 3TKSE 2H1GA 3W6GA 3G9BA 4J57E 4DSQA 1X9MB 4MCUA 2V6OA 4ML1A 4K1FA 2VLTA 2DLXA 3KZQA 4DEJA 4Q5NA 3GX0A 5CRWA 2FWGA 1OE8A 4RUVA 2H74A 3TKSA 1SKWB 2F3MA 5IPGA 4ZB6A 1WOUA 4OFMA 2FWHA 3QCPA 3GN3A 2DJ1A 2CAQA 3KM6A 1EOGA 4GF0A 5G31A 4ID0A 1THXA 3M3MA 4J56E 1Z7RA 3IR4A 3BOAA 2HRKA 4P3YB 3TJBA 1JZDA 4YQVA 1J08A 1VF4A 1YEXA 2GZPA 5FT3A 4LA1A 1ZYPA 4G2EA 3EPTA 2I3YA 4PXOA 1M2AA 1NSWA 4K2XA 3P2AA 1Y6EA 1AXDA 4KW6A 2FWFA 3L9VA 3GL3A 1PL1A 3IHGA 4GCIA 1AQVA 3Q6OA 1TK5B 2RLIA 2VM2A 3IC8A 4YAPA 3KH7A 3VI7A 4MDCA 3VLNA 3IK7A 1PD21 4GQCA 4IP1A 4L5OA 3P90A 1R26A 4KCEA 4MJEA 2X99A 1PX7A 2HSHA 3C71A 5HR1A 3E0UA 4HQSA 3ZREA 1S3DA 4FQUA 1XVWA 1PRXA 2A2PA 3O76A 4K7NA 4IBPA 4X1UA 2GS3A 3ZMKA 2WCIA 2E7PA 2HE3A 2YV9A 4QL7A 2LJRA 1VRSD 3TUEA 2X8GA 3GRXA 3J7Yk 4K7OA 4TR4A 1Z9HA 3M1GA 2E2MA 1M2BA 2QC7A 1ABAA 3F6DA 4AF2A 2HRNA 2DMMA 2PUKC 3D6IA 3LYKA 1TRVA 3TGZA 2H70A 2AHEA 1MD3A 2GT5A 4KSMA 5ECQB 3R3EA 5D9WA 2LEGA 4K5SA 2A2RA 4HDEA 3TDGA 4V1Ap 2DIZA 4BL7A 2F51A 3FZAA 5IOWA 1JZRA 3RPNA 1K0MA 3UIWA 1NW2A 5GSSA 3C8EA 1OC8A 4WR4A 1M7TA 1M2DA 3EVIA 1DE1A 3DRNA 4LMWA 3HVSA 4OCEA 5IO0A 2HRAA 4ACSA 2HFDA 4HEA2 1FAAA 4IVFA 1U3AA 2FGXA 5ENUA 2YPMA 1XWCA 2VO4A 4MK3A 3DD3A 1G6YA 2GQMA 5IMDA 2E2GA 5H5RA 1TDIA 2F8AA 3UARA 3F4TA 1Q98A 1X5EA 4TR3A 2XBQA 1HNBA 4ZL8A 2LRCA 1PGTA 3UBKA 2L5LA 2L57A 3HVVA 13GSA 4MABA 2ZUPA 3HD5A 4Z2UA 3MWHA 2B7JA 3LJRA 2MMOA 4USSA 3BCIA 1BQ7A 3HDCA 1QQ2A 4JRRA 2L4CA 5DJLA 2G0FA 2JU5A 3Q74A 2KP1A 1PA3A 1SL1B 4XTSA 4ILFA 5F07A 1Z7PA 4V1Ag 4I97A 1V98A 4OMVA 3TCOA 2R37A 2PBJA 1N2AA 1XBSA 3AY8A 2KOKA 1YQ1A 2QA2A 4TRXA 3GH6A 2H66A 5J9BA 5AISA 2CA8A 4FIWA 4OFTA 2VOCA 2JACA 1OC9A 2IPAA 3D21A 4ISDA 2LQOA 4ULXA 1GWCA 2A2SA 3DEXA 5IM9A 2G2QA 1PFOA 1MDKA 2NTOA 3HA9A 2VLVA 4ECBA 5HR2A 2JZRA 4JU5A 5B8AA 3QD9A 1T4ZA 2O8VB 4CY6A 4N0ZA 4V2MA 1KEBA 4K5RA 2L5OA 3ZIJA 4RQXA 4JBBA 1OVNA 1KTEA 5KN1A 3IK9A 5EPFA 1X9SB 1MDIA 2WULA 3P8WA 3PR8A 3U5RE 1Z6NA 3GA4A 2H72A 2M72A 4NV2A 4NAXA 2VL2A 1E6BA 2LNTA 4HZ4A 1JZOA 2L59A 2LV3A 1ERWA 4FH8A 2B3SA 5E4WA 4IW9A 2WJUA 5DALB 3UL3A 2C3NA 3C1RA 3F3QA 1URMA 5ABRA 1FHEA 2HSYA 4PURA 3TB2A 3EC3A 3Q19A 2H76A 4ZL7A 1F2EA 5JCWA 4GWRA 2HZEB 5HR3A 5G5EA 1T7PB 4N30A 1ZL9A 3ZYWA 1R7HA 3ZIVA 2LKUA 3H93A 4WXTA 1K0DA 1XW9A 4WF5A 1A2LA 1N8JA 4WETA 1RQMA 4KDYA 3MYDA 3F0IA 2OE3A 4F82A 3IAM2 2VLUA 1RK4A 3VI5A 5ID2B 2F8FA 1A2MA 4BIKA 3C7MA 2RIIA 5H5QA 4EO3A 3NZNA 2NDOA 3QFAC 5ELGA 4NWYA 3ME7A 2FLSA 5LD0A 2LS5A 3IAS2 5ECSA 3PGTA 3VFIA 4TXOB 2ALBA 3FW2A 4PUFC 2X4AA 7GSSA 2CAIA 3BCKA 4XS4B 5A4UA 1HNCA 2ON7A 5IMZA 2JSYA 4NHWA 4EIPA 4OO4A 3FR6A 1V2AA 2EIOA 4WEYA 3IC4A 1B9YC 1ZYEA 5D9VA 4K9ZA 5GZZB 3VPQA 4HU9A 1AC1A 4MZWA 4BWQA 2GQKA 2V6KA 5ECNB 2VUPA 1ZYNA 3HJOA 1SYRA 2KLXA 2H6YA 1XWAA 1KNGA 4GSNA 4WKWA 3L9UA 3APSA 5A4VA 4KUNA 4G0IA 2CVDA 2HXKA 3A2WA 1AQXA 3CRTA 4PQIA 5H5SA 1PN9A 4FO5A 4ZXGA 2LNSA 4HU7A 4YH2A 3EMXA 1J0FA 2DJ2A 2TIRA 1BG5A 2DJKA 3CSHA 1TU7A 5ECMB 2IN3A 5D8IA 5HQPA 1E2YA 2B6MA 14GSA 1NHOA 1CQHA 5HR0A 2R4VA 1ZOFA 2PVQA 5G1LA 2EIQA 1ZYQB 4MJBA 3VWWA 5IMFA 4N10A 3LORA 2OADA 4EKZA 3NOFA 3WYWA 3CYNA 1S3AA 1W89A 4KAEA 5J4UA 1SK2A 1ST9A 4O5UA 3FEUA 4HJ2A 1FB0A 2V41A 1TTZA 1TRUA 2YZHA 4GQFA 5HFGA 1EWXA 1H4OA 4MNNA 3ISOA 3HKRA 1GLQA 4YAVA 1JFUA 3SWLA 4XRDA 1M0UA 4JR4A 1MDJA 1OC3A 1HQOA 2R2JA 2FA4A 3GSTA 2YOIA 4NV5A 2WGRA 1GRXA 10GSA 2O89A 4CY8A 2BTOT 2E0QA 1GULA 1I9DA 2M46A 1F3AA 1XPVA 2RUEA 4K0GA 1FO5A 2OE1A 4TKYA 1GSQA 5CO3A 2DJ0A 1A23A 2REMA 4OCFA 3BBYA 1EV4A 1B9XC 1O81A 3KTBA 2L6DA 3KCMA 2XPEA 4E8HA 1G7EA 1QXHA 2XC2A 2OA7A 3LW9A 5IO2A 1EV9A 2L6CA 5E59A 1DSBA 5D9XA 3GSSA 3EWLA 3EE2A 1F37A 1HD2A 1U6TA 1M99A 2PWJA 2HZFA 22GSA 4I6XA 5B7CA 2FD3A 3M9KA 1USBA 2H0HA 2N5BA 4EDYA 5J41A 2DIYA 4G0KA 4ML6A 1R5AA 2X49A 1AQWA 1GUMA 2VCXA 3S9FA 3DVWA 3F8UA 1WWJA 20GSA 2OKAA 2K9FA 4EDZA 4MP4A 2P31A 2C0FA 2EIRA 1AUCA 3C1SA 3BJ5A 2HYXA 3GKXA 2YJ7A 4RI6A 4O5RA 3FYGA 3IBHA 4GXZA 12GSA 2MBTA 1EP7A 4KSOA 3ZITA 3LXZA 3QPMA 4JE1A 2QKEA 3CSIA 4J2FA 2LUSA 1TJDA 1O7UA 1PN0A 3UMAA 3MDKA 4EF0A 2P0GA 1PX6A 2JZSA 1WE0A 1SD9A 4K7IA 3KEBA 4I8BA 5G30A 1OYJA 1AW9A 1UVZA 2R0GA 1ZZYA 4ZBBA 5ELAA 5CRGA 3VPTA 3DGQA 2AV4A 5ECOB 2RM5A 1EOHA 4LLRA 2VM1A 4G19A 1JZWA 3GH9A 3PINA 3ZVJA 2DKHA 3FR9A 3HVNA 2HI7A 1XVQA 1K0OA 4JR6A 3KXOA 2YZUA 3VK9A 4HJMA 4PNGA 3CTFA 1VGLA 3I6AA 2DJJA 4Q5QA 3GTUB 2WRTA 2AAWA 3APQA 1WRYA 2CX3A 2FNOA 1ERTA 4PNFA 1WJKA 3NIVA 3DMLA 5A5KA 1V57A 3GHAA 2C3TA 4N0VA 4F03A 2N5FA 2YWNA 5ECKB 5J9CA 4TW5A 2X8HA 1T3BA 1FB6A 5KN3A 2VCVA 2IWTA 5DAKA 4EIQA 5F8BA 1GNWA 4DVCA 1BYEA 5EVOA 4POLA 4HQZA 4PUAA 3U6VA 5DALA 4ZB9A 3KH9A 3FHKA 1JHBA 1TK8B 3J7Yb 4HUAA 2C8UA 2OJLA 3ERFA 2HZEA 3H79A 1OKTA 4L0WA 3VWVA 1TRWA 5BMUA 1A8YA 3GKNA 3L9SA 2VIMA 3F4SA 2XHFA 3K8NA 3D22A 4TN8A 2YWOA 5IIZA 2A4HA 1JLVA 3CRUA 3FZ5A 3KP8A 2LRTA 1TOFA 4V2NA 1X5CA 3GX8A 8GSSA 4WF4A 5CP1A 3ED3A 1XOBA 3N9JA 4XCSA 5ID2A 1S3RA 3A2XA 3UVTA 4ZBDA 2PU9C 4POBA 5COHA 4G9HA 4POKA 1Y25A 2LSTA 1UA5A 2B5XA 3TJJA 1PKWA 3GFKA 4IQAA 3F4RA 2AJQB 4HZ2A 2CV4A 4KCAA 1UN2A 4DSSB 1WP0A 5D93A 1CQGA 4TXOA 2BMXA 3N5OA 2C1YA 2B7KA 4QL9A 2IFQB 4MH2A 3GURA 1YF0A 5G2ZA 5B6MA 4XS4A 2O85A 3EINA 3LFLA 2GSTA 2HNLA 3WGDA 4XHMA 2GSSA 1BX9A 4D73B 4LMVA 3TKQA 1SJ6A 6GSYA 1GUKA 5CNWA 3HHVA 3EMPA 1ML6A 4K8MA 4MPGA 3A5WA 3WGEA 2KUCA 11GSA 1XIYA 2UZ8A 1ON4A 2R3XA 2LJKA 3RPPA 1T1VA 1LBKA 1XOAA 4BVYB 3TKSC 1W4VA 1GL8A 3LWAA 3I69A 6GSXA 4I5QA 4KH7A 5IOXA 1SL0B 1ILOA 3ZFBA 4IJIA 1H75A 1PMTA 5ECLB 1T8EB 3JCML 1B48A 2CVKA 3KMOA 2LJAA 5AIVA 3M0FA 1K0CA 3F3RA 3O3TA 4XRAA 1MD4A 2WZ9A 3UOMA 2NVLA 5IQYA 4O92A 3EU3A 4OD7A 5CYYA 1SK1A 4F2IA 3D5JA 4ZB8A 1OAZA 1YY7A 4MPFA 3H8QA 4CW9A 18GSA 2VD1A 2FWEA 1V58A 3R2QA 3CMIA 4AJ8A 2HT9A 1TI3A 1HYUA 5KEJA 2H73A 1YF1A 1C72A 2GSQA 5ECIB 1TU8A 2QA1A 2J9HA 5DCGA 3RDWA 3CSJA 2VAFA 4E8EA 1IYIA 4PTSA 1MEKA 2RUFA 2YP6A 2H1BA 2CZ2A 4A5PA 1SL2B 5KOWA 2MMNA 3ZVJD 3HYPA 2O7KA 4K6XA 1FOHA 3CQFA 1XW6A 2IJYA 1ERUA 4I2UA 1O8WA 4CDOA 1SJZA 4F0CA 2R6KA 3PPUA 4F9ZA 2I4AA 1GP1A 2HRFA 3US3A 4IGJA 4PX1A 4F0BA 2OBKA 4NPBA 4AJ7A 1G6WA 2MMAA 2GZYA 3GL5A 1GTAA 1TK0B 1BJXA 3RAZA 4GLTA 1O8XA 1GLPA 1SU9A 3ZFLA 3MNGA 4CHSA 3MAKA 1GH2A 3EURA 3VWXA 4KGIA 3FZ4A 3UVHA 1X0RA 2XBIA 3LXTA 3HZ8A 3HZ4A 4MLYA 1U88A 4BVXB 4TR0A 4N11A 2C4JA 2PN8A 4IELA 1YEPA 5CAXA 2FCHA 3LGCA 3ZMLA 3ERWA 1A24A 2IMFA 4EXJA 2TRCP 3CTGA 4MH3A 4XS1A 2PVOC 4DSRA 3ZZXA 4MA9A 4EE0A 1GSFA 3TRXA 2ZNMA 3MIXA 1GSEA 2MYGA 4AJ6A 1TRSA 1WMJA 2V2GA 3CXGA 3HXSA 4MF5A 1SYXA 4OO5A 2B1LA 3G7IA 2LRNA 3HJMA 4V2LA 1LU4A 19GSA 1MTCA 1SK0A 2FY6A 2LQQA 1GSYA 1WPIA 1F3BA 5ECHB 3LEFA 5INYA 4FYBA 5AGYA 3GMFA 4JZQA 1O6JA 3IXRA 5D73A 2V1MA 4KA0A 3G7JA 1EGRA 4IQ1A 1YKCA 4TVEA 1GTUA 2BJXA 2VCWA 2PGTA 6GSUA 4O5QA 2IMIA 2VD0A 5DJMA 4IN0A 1FVKA 1FOVA 2WDUA 3D0ZA 3FRCA 1DUGA 2OE0A 4TR1B 1Q4JA 1Z5YE 3L4NA 4K2DA 4ECIA 2K6VA 2PMTA 3ZRDA 4KDUA 5LCZA 2DKIA 1B4QA 4IHUA 5IMVA 3DVXA 1SJIA 1TW9A 2X64A 1FG4A 1AAZA 1M3IA 4ECJA 3GKMA 5B6NA 4G0LA 5C04A 1EP8A 2D2ZA 2DSAA 3GTUA 4NXIA 5ECRB 2H0GA 3UJ1A 2H30A 5D96A 3IE3A 1XWKA 4IJ3A 4PQHA 4O32A 1SD8A 4Z2RA 3HJPA 1EZKA 3HCZA 3WT1A 1A2JA 4H86A 3RHBA 2RM6A 1F6MC 4L5LA 4MZCA 2C80A 4WR5A 6GSTA 4HSCX 2ZCTA 3A3TA 1T4YA 2C3QA 1XWGA 4MF6A 1PQNA 2C0EA 3ZLPA 3KD0A 2H1AA 1A0FA 2MBSA 3I9V2 4YQMA 4IS0A 4ZL9A 5GAPD 3KJYA 1XWBA 3TJFA 2JSZA 1TKDB 4EUYA 2VL2C 3OR5A 4O7HA 3QR6A 2PERA 1VF1A 4HI7A 2B5YA 4LL1B 1GTBA 2CZ3A 2JADA 1VF2A 1IYHA 2MZCA 2A4VA 3GNJA 3DKSA 4ECCA 3DYRA 3IOSA 5FHIA 3QMXA 2YJHA 2H01A 2GT6A 4I2TA 3FZ9A 5HFKA 4TXVA 2H1DA 1A8LA 1XFLA 3BD2A 2GQLA 2DBCA 2AYTA 4WBRD 9GSSA 1GTIA 2C0DA 1B4PA 3V1WA 3TKPA
chains in the Genus database with same CATH topology
1YDKA 5LNKe 4HOJA 4DSSA 5GAND 3LSZA 2IL3A 3W8JA 2IFQA 2TRXA 2VCTA 3W8SA 3D4TA 2VCQA 5F05A 1X5DA 1EEMA 4FYCA 2I1UA 2FA8A 4WBJA 5CRHA 1YZXA 1EGOA 3TJKA 3D4MA 5C00A 2H8LA 4D73A 3ZL5A 4GRFA 4ZIJA 5EY6A 2VL3A 1GSDA 5KN0A 1X9WB 2KP2A 2GTUA 2WFCA 1OKDA 1V9WA 4ICYA 2VL9A 1TP9A 2AUVA 1UC7A 1M9AA 3H4KA 2M80A 2CT6A 6GSVA 3APOA 2K18A 4PGTA 4EC0A 4BVYA 4GSSA 4OFNA 4EVMA 2YN1A 1AIUA 2H71A 5AN1A 1HNAA 1GUHA 1ACVA 2WS2A 1NHYA 4PQ1A 3IA1A 1QGVA 2QGVA 3GIXA 3QFBC 4Z7XA 1I5GA 4RI7A 3VWUA 5DDLA 1M9BA 2R5GA 3WT2A 1YJ6A 4X43A 5IPHA 2FUG2 3TRPA 5F0GA 5DBQA 2IMKA 3O6TA 4KNDA 3GYKA 1GNEA 3QDNA 3KMNA 4L0UA 4MZBA 1FW1A 2CQ9A 2R0CA 1S3CA 3A5IA 4OWYA 1K0NA 3SBCA 5BRTA 1OE7A 1FVJA 1G7OA 5DQYA 1WIKA 4MJAA 3LG6A 3FK8A 2DJ3A 2IMEA 4MJCA 3HY2A 1THOA 4BL7B 1BEDA 3TOTA 1U3IA 3ZTLA 6GSWA 2AB6A 1K3YA 1ZCPA 3QAVA 1XZOA 3VURA 3HVXA 2P5RA 2F9SA 1Z3EA 3IV4A 2I81A 2H6ZA 1DBYA 3UBLA 2C0GA 3IPZA 4LL4B 5DVBA 2KHPA 1QMVA 3WD6A 2YNXA 4BA7A 1SKRB 4FYUA 2R0PA 3P7XA 4YQUA 4IP6A 1K3LA 5G1KA 6GSSA 2B5EA 2EC4A 5JWOB 2GSRA 2IMDA 4KX4A 2GZZA 5G5FA 4NMUA 1XCCA 4YKGA 1V40A 1K0BA 3PH9A 3F63A 5CREA 4QQ7A 4XIHA 5CRDA 3F9UA 4G10A 2V32A 1ERVA 2O87A 3C73A 3UEMA 3Q18A 5DAKB 3QAWA 1A0RP 1KBNA 2ES7A 4TOPA 5KOXA 2OACA 4GTUA 1PSQA 5GSTA 4BVXA 2QSIA 2VCZA 2YWMA 3RBTA 3F6FA 2H6XA 2HSMA 4X4JA 5F06A 5KN2A 4NHZA 2JZTA 4Q5FA 5FWGA 3GUSA 2CVBA 2YANA 1G0TA 2OBIA 1TI1A 3FKFA 3DXBA 1R4WA 3H1NA 5IMCA 5JCUA 2GLRA 4BWSA 3RHCA 4ZILA 1XXUA 1YKAA 3UAPA 1OC9B 4YKFA 1XW5A 3GV1A 2H19A 3ERGA 5JCGA 1DE2A 3L0HA 4MMMA 3MSZA 1ZMAA 5HFIA 5EL8A 2IIYA 1K0AA 5IMAA 2FHEA 4KE3A 5ECPB 5JWRB 17GSA 1TXXA 3IRAA 3EYTA 4IKHA 4KDXA 1O85A 2B1KA 2Z9SA 3QAGA 1SKSB 1J9BA 4JEDA 3GKKA 4XS6A 3L78A 2NBSA 1PL2A 3E3EA 4ZBAA 2K8SA 2PPTA 3TKRA 4POMA 3FY7A 3ME8A 2H75A 3IDVA 4L8EA 1B8XA 4HS1A 2X8CA 3G7YA 1GSSA 2K8VA 3LQ7A 4RQRA 5D9TA 1JLWA 3KGKA 2I9HA 3TOUA 2LTKA 1QK8A 4TR1A 3CBUA 3WGXA 2N5AA 3DWVA 2HLSA 16GSA 3FMWA 5DCHA 1R5PA 3DIEA 4KF9A 2GDRA 3TRQA 5J5NA 2DC5A 1U87A 1EEJA 3M9JA 4Q5RA 1QFNA 1VF3A 3KTLA 5B8BA 5JWQB 2CX4A 3EU4A 2DMLA 2H0IA 2YV7A 1F9MA 4K0NA 1SENA 2XPDA 5A4WA 1QUWA 3A2VA 4AGSA 1BAYA 4KB3A 4GSTA 2WB9A 3QOUA 3LYPA 3IHQA 2YWIA 3E9JB 4Z2TA 1LJRA 3I43A 1NM3A 2NPBA 5L71A 1RW1A 2P5QA 2J23A 1GSUA 2GVPA 1PKZA 1Z6MA 2MMZA 5AIXA 2YCDA 4X0XA 4BPYA 3TJGA 4EL1A 1K3OA 4MF7A 3KIJA 2JL4A 2L4QA 2ON5A 5J3RA 5DQSA 2GGTA 1ZGNA 3FR3A 1O73A 3KP9A 3M8NA 1T00A 3TKSE 2H1GA 3W6GA 3G9BA 4J57E 4DSQA 1X9MB 4MCUA 2V6OA 4ML1A 4K1FA 2VLTA 2DLXA 3KZQA 4DEJA 4Q5NA 3GX0A 5CRWA 2FWGA 1OE8A 4RUVA 2H74A 3TKSA 1SKWB 2F3MA 5IPGA 4ZB6A 1WOUA 4OFMA 2FWHA 3QCPA 3GN3A 2DJ1A 2CAQA 3KM6A 1EOGA 4GF0A 5G31A 4ID0A 1THXA 3M3MA 4J56E 1Z7RA 3IR4A 3BOAA 2HRKA 4P3YB 3TJBA 1JZDA 4YQVA 1J08A 1VF4A 1YEXA 2GZPA 5FT3A 4LA1A 1ZYPA 4G2EA 3EPTA 2I3YA 4PXOA 1M2AA 1NSWA 4K2XA 3P2AA 1Y6EA 1AXDA 4KW6A 2FWFA 3L9VA 3GL3A 1PL1A 3IHGA 4GCIA 1AQVA 3Q6OA 1TK5B 2RLIA 2VM2A 3IC8A 4YAPA 3KH7A 3VI7A 4MDCA 3VLNA 3IK7A 1PD21 4GQCA 4IP1A 4L5OA 3P90A 1R26A 4KCEA 4MJEA 2X99A 1PX7A 2HSHA 3C71A 5HR1A 3E0UA 4HQSA 3ZREA 1S3DA 4FQUA 1XVWA 1PRXA 2A2PA 3O76A 4K7NA 4IBPA 4X1UA 2GS3A 3ZMKA 2WCIA 2E7PA 2HE3A 2YV9A 4QL7A 2LJRA 1VRSD 3TUEA 2X8GA 3GRXA 3J7Yk 4K7OA 4TR4A 1Z9HA 3M1GA 2E2MA 1M2BA 2QC7A 1ABAA 3F6DA 4AF2A 2HRNA 2DMMA 2PUKC 3D6IA 3LYKA 1TRVA 3TGZA 2H70A 2AHEA 1MD3A 2GT5A 4KSMA 5ECQB 3R3EA 5D9WA 2LEGA 4K5SA 2A2RA 4HDEA 3TDGA 4V1Ap 2DIZA 4BL7A 2F51A 3FZAA 5IOWA 1JZRA 3RPNA 1K0MA 3UIWA 1NW2A 5GSSA 3C8EA 1OC8A 4WR4A 1M7TA 1M2DA 3EVIA 1DE1A 3DRNA 4LMWA 3HVSA 4OCEA 5IO0A 2HRAA 4ACSA 2HFDA 4HEA2 1FAAA 4IVFA 1U3AA 2FGXA 5ENUA 2YPMA 1XWCA 2VO4A 4MK3A 3DD3A 1G6YA 2GQMA 5IMDA 2E2GA 5H5RA 1TDIA 2F8AA 3UARA 3F4TA 1Q98A 1X5EA 4TR3A 2XBQA 1HNBA 4ZL8A 2LRCA 1PGTA 3UBKA 2L5LA 2L57A 3HVVA 13GSA 4MABA 2ZUPA 3HD5A 4Z2UA 3MWHA 2B7JA 3LJRA 2MMOA 4USSA 3BCIA 1BQ7A 3HDCA 1QQ2A 4JRRA 2L4CA 5DJLA 2G0FA 2JU5A 3Q74A 2KP1A 1PA3A 1SL1B 4XTSA 4ILFA 5F07A 1Z7PA 4V1Ag 4I97A 1V98A 4OMVA 3TCOA 2R37A 2PBJA 1N2AA 1XBSA 3AY8A 2KOKA 1YQ1A 2QA2A 4TRXA 3GH6A 2H66A 5J9BA 5AISA 2CA8A 4FIWA 4OFTA 2VOCA 2JACA 1OC9A 2IPAA 3D21A 4ISDA 2LQOA 4ULXA 1GWCA 2A2SA 3DEXA 5IM9A 2G2QA 1MDKA 2NTOA 3HA9A 2VLVA 4ECBA 5HR2A 2JZRA 4JU5A 5B8AA 3QD9A 1T4ZA 2O8VB 4CY6A 4N0ZA 4V2MA 1KEBA 4K5RA 2L5OA 3ZIJA 4RQXA 4JBBA 1OVNA 1KTEA 5KN1A 3IK9A 5EPFA 1X9SB 1MDIA 2WULA 3P8WA 3PR8A 3U5RE 1Z6NA 3GA4A 2H72A 2M72A 4NV2A 4NAXA 2VL2A 1E6BA 2LNTA 4HZ4A 1JZOA 2L59A 2LV3A 1ERWA 4FH8A 2B3SA 5E4WA 4IW9A 2WJUA 5DALB 3UL3A 2C3NA 3C1RA 3F3QA 1URMA 5ABRA 1FHEA 2HSYA 4PURA 3TB2A 3EC3A 3Q19A 2H76A 4ZL7A 1F2EA 5JCWA 4GWRA 2HZEB 5HR3A 5G5EA 1T7PB 4N30A 1ZL9A 3ZYWA 1R7HA 3ZIVA 2LKUA 3H93A 4WXTA 1K0DA 1XW9A 4WF5A 1A2LA 1N8JA 4WETA 1RQMA 4KDYA 3MYDA 3F0IA 2OE3A 4F82A 3IAM2 2VLUA 1RK4A 3VI5A 5ID2B 2F8FA 1A2MA 3C7MA 2RIIA 5H5QA 4EO3A 3NZNA 2NDOA 3QFAC 5ELGA 4NWYA 3ME7A 2FLSA 5LD0A 2LS5A 3IAS2 5ECSA 3PGTA 3VFIA 4TXOB 2ALBA 3FW2A 4PUFC 2X4AA 7GSSA 2CAIA 3BCKA 4XS4B 5A4UA 1HNCA 2ON7A 5IMZA 2JSYA 4NHWA 4EIPA 4OO4A 3FR6A 1V2AA 2EIOA 4WEYA 3IC4A 1B9YC 1ZYEA 5D9VA 4K9ZA 5GZZB 3VPQA 4HU9A 1AC1A 4MZWA 4BWQA 2GQKA 2V6KA 5ECNB 2VUPA 1ZYNA 3HJOA 1SYRA 2KLXA 2H6YA 1XWAA 1KNGA 4GSNA 4WKWA 3L9UA 3APSA 5A4VA 4KUNA 4G0IA 2CVDA 2HXKA 3A2WA 1AQXA 3CRTA 4PQIA 5H5SA 1PN9A 4FO5A 4ZXGA 2LNSA 4HU7A 4YH2A 3EMXA 1J0FA 2DJ2A 2TIRA 1BG5A 2DJKA 3CSHA 1TU7A 5ECMB 2IN3A 5D8IA 5HQPA 1E2YA 2B6MA 14GSA 1NHOA 1CQHA 5HR0A 2R4VA 1ZOFA 2PVQA 5G1LA 2EIQA 1ZYQB 4MJBA 3VWWA 5IMFA 4N10A 3LORA 2OADA 4EKZA 3NOFA 3WYWA 3CYNA 1S3AA 1W89A 4KAEA 5J4UA 1SK2A 1ST9A 4O5UA 3FEUA 4HJ2A 1FB0A 2V41A 1TTZA 1TRUA 2YZHA 4GQFA 5HFGA 1EWXA 1H4OA 4MNNA 3ISOA 3HKRA 1GLQA 4YAVA 1JFUA 3SWLA 4XRDA 1M0UA 4JR4A 1MDJA 1OC3A 1HQOA 2R2JA 2FA4A 3GSTA 2YOIA 4NV5A 2WGRA 1GRXA 10GSA 2O89A 4CY8A 2BTOT 2E0QA 1GULA 1I9DA 2M46A 1F3AA 1XPVA 2RUEA 4K0GA 1FO5A 2OE1A 4TKYA 1GSQA 5CO3A 2DJ0A 1A23A 2REMA 4OCFA 3BBYA 1EV4A 1B9XC 1O81A 3KTBA 2L6DA 3KCMA 2XPEA 4E8HA 1G7EA 1QXHA 2XC2A 2OA7A 3LW9A 5IO2A 1EV9A 2L6CA 5E59A 1DSBA 5D9XA 3GSSA 3EWLA 3EE2A 1F37A 1HD2A 1U6TA 1M99A 2PWJA 2HZFA 22GSA 4I6XA 5B7CA 2FD3A 3M9KA 1USBA 2H0HA 2N5BA 4EDYA 5J41A 2DIYA 4G0KA 4ML6A 1R5AA 2X49A 1AQWA 1GUMA 2VCXA 3S9FA 3DVWA 3F8UA 1WWJA 20GSA 2OKAA 2K9FA 4EDZA 4MP4A 2P31A 2C0FA 2EIRA 1AUCA 3C1SA 3BJ5A 2HYXA 3GKXA 2YJ7A 4RI6A 4O5RA 3FYGA 3IBHA 4GXZA 12GSA 2MBTA 1EP7A 4KSOA 3ZITA 3LXZA 3QPMA 4JE1A 2QKEA 3CSIA 4J2FA 2LUSA 1TJDA 1O7UA 1PN0A 3UMAA 3MDKA 4EF0A 2P0GA 1PX6A 2JZSA 1WE0A 1SD9A 4K7IA 3KEBA 4I8BA 5G30A 1OYJA 1AW9A 1UVZA 2R0GA 1ZZYA 4ZBBA 5ELAA 5CRGA 3VPTA 3DGQA 2AV4A 5ECOB 2RM5A 1EOHA 4LLRA 2VM1A 4G19A 1JZWA 3GH9A 3PINA 3ZVJA 2DKHA 3FR9A 2HI7A 1XVQA 1K0OA 4JR6A 3KXOA 2YZUA 3VK9A 4HJMA 4PNGA 3CTFA 1VGLA 3I6AA 2DJJA 4Q5QA 3GTUB 2WRTA 2AAWA 3APQA 1WRYA 2CX3A 2FNOA 1ERTA 4PNFA 1WJKA 3NIVA 3DMLA 5A5KA 1V57A 3GHAA 2C3TA 4N0VA 4F03A 2N5FA 2YWNA 5ECKB 5J9CA 4TW5A 2X8HA 1T3BA 1FB6A 5KN3A 2VCVA 2IWTA 5DAKA 4EIQA 5F8BA 1GNWA 4DVCA 1BYEA 5EVOA 4POLA 4HQZA 4PUAA 3U6VA 5DALA 4ZB9A 3KH9A 3FHKA 1JHBA 1TK8B 3J7Yb 4HUAA 2C8UA 2OJLA 3ERFA 2HZEA 3H79A 1OKTA 4L0WA 3VWVA 1TRWA 5BMUA 1A8YA 3GKNA 3L9SA 2VIMA 3F4SA 2XHFA 3K8NA 3D22A 4TN8A 2YWOA 5IIZA 2A4HA 1JLVA 3CRUA 3FZ5A 3KP8A 2LRTA 1TOFA 4V2NA 1X5CA 3GX8A 8GSSA 4WF4A 5CP1A 3ED3A 1XOBA 3N9JA 4XCSA 5ID2A 3A2XA 3UVTA 4ZBDA 2PU9C 4POBA 5COHA 4G9HA 4POKA 1Y25A 2LSTA 1UA5A 2B5XA 3TJJA 1PKWA 3GFKA 4IQAA 3F4RA 2AJQB 4HZ2A 2CV4A 4KCAA 1UN2A 4DSSB 1WP0A 5D93A 1CQGA 4TXOA 2BMXA 3N5OA 2C1YA 2B7KA 4QL9A 2IFQB 4MH2A 3GURA 1YF0A 5G2ZA 5B6MA 4XS4A 2O85A 3EINA 3LFLA 2GSTA 2HNLA 3WGDA 4XHMA 2GSSA 1BX9A 4D73B 4LMVA 3TKQA 1SJ6A 6GSYA 1GUKA 5CNWA 3HHVA 3EMPA 1ML6A 4K8MA 4MPGA 3A5WA 3WGEA 2KUCA 11GSA 1XIYA 2UZ8A 1ON4A 2R3XA 2LJKA 3RPPA 1T1VA 1LBKA 1XOAA 4BVYB 3TKSC 1W4VA 1GL8A 3LWAA 3I69A 6GSXA 4I5QA 4KH7A 5IOXA 1SL0B 1ILOA 3ZFBA 4IJIA 1H75A 1PMTA 5ECLB 1T8EB 3JCML 1B48A 2CVKA 3KMOA 2LJAA 5AIVA 3M0FA 1K0CA 3F3RA 3O3TA 4XRAA 1MD4A 2WZ9A 3UOMA 2NVLA 5IQYA 4O92A 3EU3A 4OD7A 5CYYA 1SK1A 4F2IA 3D5JA 4ZB8A 1OAZA 1YY7A 4MPFA 3H8QA 4CW9A 18GSA 2VD1A 2FWEA 1V58A 3R2QA 3CMIA 4AJ8A 2HT9A 1TI3A 1HYUA 5KEJA 2H73A 1YF1A 1C72A 2GSQA 5ECIB 1TU8A 2QA1A 2J9HA 5DCGA 3RDWA 3CSJA 2VAFA 4E8EA 1IYIA 4PTSA 1MEKA 2RUFA 2YP6A 2H1BA 2CZ2A 4A5PA 1SL2B 5KOWA 2MMNA 3ZVJD 3HYPA 2O7KA 4K6XA 1FOHA 1XW6A 2IJYA 1ERUA 4I2UA 1O8WA 4CDOA 1SJZA 4F0CA 2R6KA 3PPUA 4F9ZA 2I4AA 1GP1A 2HRFA 3US3A 4IGJA 4PX1A 4F0BA 2OBKA 4NPBA 4AJ7A 1G6WA 2MMAA 2GZYA 3GL5A 1GTAA 1TK0B 1BJXA 3RAZA 4GLTA 1O8XA 1GLPA 1SU9A 3ZFLA 3MNGA 4CHSA 3MAKA 1GH2A 3EURA 3VWXA 4KGIA 3FZ4A 3UVHA 1X0RA 2XBIA 3LXTA 3HZ8A 3HZ4A 4MLYA 1U88A 4BVXB 4TR0A 4N11A 2C4JA 2PN8A 4IELA 1YEPA 5CAXA 2FCHA 3LGCA 3ZMLA 3ERWA 1A24A 2IMFA 4EXJA 2TRCP 3CTGA 4MH3A 4XS1A 2PVOC 4DSRA 3ZZXA 4MA9A 4EE0A 1GSFA 3TRXA 2ZNMA 3MIXA 1GSEA 2MYGA 4AJ6A 1TRSA 1WMJA 2V2GA 3CXGA 3HXSA 4MF5A 1SYXA 4OO5A 2B1LA 3G7IA 2LRNA 3HJMA 4V2LA 1LU4A 19GSA 1MTCA 1SK0A 2FY6A 2LQQA 1GSYA 1WPIA 1F3BA 5ECHB 3LEFA 5INYA 4FYBA 5AGYA 3GMFA 4JZQA 1O6JA 3IXRA 5D73A 2V1MA 4KA0A 3G7JA 1EGRA 4IQ1A 1YKCA 4TVEA 1GTUA 2BJXA 2VCWA 2PGTA 6GSUA 4O5QA 2IMIA 2VD0A 5DJMA 4IN0A 1FVKA 1FOVA 2WDUA 3D0ZA 3FRCA 1DUGA 2OE0A 4TR1B 1Q4JA 1Z5YE 3L4NA 4K2DA 4ECIA 2K6VA 2PMTA 3ZRDA 4KDUA 5LCZA 2DKIA 1B4QA 4IHUA 5IMVA 3DVXA 1SJIA 1TW9A 2X64A 1FG4A 1AAZA 4ECJA 3GKMA 5B6NA 4G0LA 5C04A 1EP8A 2D2ZA 2DSAA 3GTUA 4NXIA 5ECRB 2H0GA 3UJ1A 2H30A 5D96A 3IE3A 1XWKA 4IJ3A 4PQHA 4O32A 1SD8A 4Z2RA 3HJPA 1EZKA 3HCZA 3WT1A 1A2JA 4H86A 3RHBA 2RM6A 1F6MC 4L5LA 4MZCA 2C80A 4WR5A 6GSTA 2ZCTA 3A3TA 1T4YA 2C3QA 1XWGA 4MF6A 1PQNA 2C0EA 3ZLPA 3KD0A 2H1AA 1A0FA 2MBSA 3I9V2 4YQMA 4IS0A 4ZL9A 5GAPD 3KJYA 1XWBA 3TJFA 2JSZA 1TKDB 4EUYA 2VL2C 3OR5A 4O7HA 3QR6A 2PERA 1VF1A 4HI7A 2B5YA 4LL1B 1GTBA 2CZ3A 2JADA 1VF2A 1IYHA 2MZCA 2A4VA 3GNJA 3DKSA 4ECCA 3DYRA 3IOSA 5FHIA 3QMXA 2YJHA 2H01A 2GT6A 4I2TA 3FZ9A 5HFKA 4TXVA 2H1DA 1A8LA 1XFLA 3BD2A 2GQLA 2DBCA 2AYTA 4WBRD 9GSSA 1GTIA 2C0DA 1B4PA 3V1WA 3TKPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YDK A;  5LNK e;  4HOJ A;  4DSS A;  5GAN D;  3LSZ A;  2IL3 A;  3W8J A;  2IFQ A;  2TRX A;  2VCT A;  3W8S A;  3D4T A;  2VCQ A;  5F05 A;  1X5D A;  1EEM A;  4FYC A;  2I1U A;  2FA8 A;  4WBJ A;  5CRH A;  1YZX A;  1EGO A;  3TJK A;  3D4M A;  5C00 A;  2H8L A;  4D73 A;  3ZL5 A;  4GRF A;  4ZIJ A;  5EY6 A;  2VL3 A;  1GSD A;  5KN0 A;  1X9W B;  2KP2 A;  2GTU A;  2WFC A;  1OKD A;  1V9W A;  2VL9 A;  1TP9 A;  2AUV A;  1UC7 A;  1M9A A;  3H4K A;  2M80 A;  2CT6 A;  6GSV A;  3APO A;  2K18 A;  4PGT A;  4EC0 A;  4BVY A;  4GSS A;  4OFN A;  4EVM A;  2YN1 A;  1AIU A;  2H71 A;  5AN1 A;  1HNA A;  1GUH A;  1ACV A;  2WS2 A;  1NHY A;  4PQ1 A;  3IA1 A;  1QGV A;  2QGV A;  3GIX A;  3QFB C;  4Z7X A;  1I5G A;  4RI7 A;  3VWU A;  5DDL A;  1M9B A;  2R5G A;  3WT2 A;  1YJ6 A;  4X43 A;  5IPH A;  2FUG 2;  3TRP A;  5F0G A;  5DBQ A;  2IMK A;  3O6T A;  4KND A;  3GYK A;  1GNE A;  3QDN A;  3KMN A;  4L0U A;  4MZB A;  1FW1 A;  2CQ9 A;  1S3C A;  4OWY A;  1K0N A;  3SBC A;  1OE7 A;  1FVJ A;  1G7O A;  5DQY A;  1WIK A;  4MJA A;  3LG6 A;  3FK8 A;  2DJ3 A;  2IME A;  4MJC A;  3HY2 A;  1THO A;  1BED A;  3TOT A;  1U3I A;  3ZTL A;  6GSW A;  2AB6 A;  1K3Y A;  1ZCP A;  3QAV A;  1XZO A;  3VUR A;  3HVX A;  2P5R A;  2F9S A;  1Z3E A;  3IV4 A;  2I81 A;  2H6Z A;  1DBY A;  3UBL A;  2C0G A;  3IPZ A;  4LL4 B;  5DVB A;  2KHP A;  1QMV A;  3WD6 A;  2YNX A;  4BA7 A;  1SKR B;  4FYU A;  3P7X A;  4YQU A;  4IP6 A;  1K3L A;  5G1K A;  6GSS A;  2B5E A;  2EC4 A;  5JWO B;  2GSR A;  2IMD A;  4KX4 A;  2GZZ A;  5G5F A;  4NMU A;  1XCC A;  1V40 A;  1K0B A;  3PH9 A;  3F63 A;  5CRE A;  4QQ7 A;  4XIH A;  5CRD A;  3F9U A;  4G10 A;  2V32 A;  1ERV A;  2O87 A;  3C73 A;  3UEM A;  3Q18 A;  5DAK B;  3QAW A;  1A0R P;  1KBN A;  2ES7 A;  4TOP A;  2OAC A;  4GTU A;  1PSQ A;  5GST A;  4BVX A;  2QSI A;  2VCZ A;  2YWM A;  3RBT A;  3F6F A;  2H6X A;  5F06 A;  5KN2 A;  4NHZ A;  2JZT A;  4Q5F A;  5FWG A;  3GUS A;  2CVB A;  2YAN A;  1G0T A;  2OBI A;  1TI1 A;  3FKF A;  3DXB A;  1R4W A;  3H1N A;  5IMC A;  5JCU A;  2GLR A;  4BWS A;  3RHC A;  4ZIL A;  1XXU A;  1YKA A;  3UAP A;  1OC9 B;  1XW5 A;  3GV1 A;  2H19 A;  3ERG A;  5JCG A;  1DE2 A;  3L0H A;  4MMM A;  3MSZ A;  1ZMA A;  5HFI A;  5EL8 A;  2IIY A;  1K0A A;  5IMA A;  2FHE A;  4KE3 A;  5ECP B;  5JWR B;  17GS A;  1TXX A;  3IRA A;  3EYT A;  4IKH A;  4KDX A;  1O85 A;  2B1K A;  2Z9S A;  3QAG A;  1SKS B;  1J9B A;  4JED A;  3GKK A;  4XS6 A;  3L78 A;  2NBS A;  1PL2 A;  3E3E A;  4ZBA A;  2K8S A;  2PPT A;  3TKR A;  4POM A;  3FY7 A;  3ME8 A;  2H75 A;  3IDV A;  4L8E A;  1B8X A;  4HS1 A;  2X8C A;  3G7Y A;  1GSS A;  2K8V A;  3LQ7 A;  4RQR A;  5D9T A;  1JLW A;  3KGK A;  2I9H A;  3TOU A;  2LTK A;  1QK8 A;  4TR1 A;  3CBU A;  3WGX A;  2N5A A;  3DWV A;  2HLS A;  16GS A;  5DCH A;  1R5P A;  3DIE A;  2GDR A;  3TRQ A;  5J5N A;  2DC5 A;  1U87 A;  1EEJ A;  3M9J A;  4Q5R A;  1QFN A;  1VF3 A;  3KTL A;  5B8B A;  5JWQ B;  2CX4 A;  3EU4 A;  2DML A;  2H0I A;  2YV7 A;  1F9M A;  4K0N A;  1SEN A;  2XPD A;  5A4W A;  1QUW A;  3A2V A;  4AGS A;  1BAY A;  4KB3 A;  4GST A;  2WB9 A;  3QOU A;  3LYP A;  3IHQ A;  2YWI A;  3E9J B;  1LJR A;  3I43 A;  1NM3 A;  2NPB A;  5L71 A;  1RW1 A;  2P5Q A;  2J23 A;  1GSU A;  2GVP A;  1PKZ A;  1Z6M A;  2MMZ A;  5AIX A;  2YCD A;  4X0X A;  4BPY A;  3TJG A;  4EL1 A;  1K3O A;  4MF7 A;  3KIJ A;  2JL4 A;  2L4Q A;  2ON5 A;  5J3R A;  5DQS A;  2GGT A;  1ZGN A;  3FR3 A;  1O73 A;  3KP9 A;  3M8N A;  1T00 A;  3TKS E;  2H1G A;  3W6G A;  3G9B A;  4J57 E;  4DSQ A;  1X9M B;  4MCU A;  2V6O A;  4ML1 A;  4K1F A;  2VLT A;  2DLX A;  3KZQ A;  4DEJ A;  4Q5N A;  3GX0 A;  5CRW A;  2FWG A;  1OE8 A;  4RUV A;  2H74 A;  3TKS A;  1SKW B;  2F3M A;  5IPG A;  4ZB6 A;  1WOU A;  4OFM A;  2FWH A;  3QCP A;  3GN3 A;  2DJ1 A;  2CAQ A;  3KM6 A;  1EOG A;  4GF0 A;  5G31 A;  4ID0 A;  1THX A;  3M3M A;  4J56 E;  1Z7R A;  3IR4 A;  3BOA A;  4P3Y B;  3TJB A;  1JZD A;  4YQV A;  1J08 A;  1VF4 A;  1YEX A;  2GZP A;  5FT3 A;  4LA1 A;  4G2E A;  2I3Y A;  4PXO A;  1M2A A;  1NSW A;  3P2A A;  1Y6E A;  1AXD A;  4KW6 A;  2FWF A;  3L9V A;  3GL3 A;  1PL1 A;  4GCI A;  1AQV A;  3Q6O A;  1TK5 B;  2RLI A;  2VM2 A;  4YAP A;  3KH7 A;  3VI7 A;  4MDC A;  3VLN A;  3IK7 A;  1PD2 1;  4GQC A;  4IP1 A;  4L5O A;  3P90 A;  1R26 A;  4KCE A;  4MJE A;  2X99 A;  1PX7 A;  2HSH A;  3C71 A;  5HR1 A;  3E0U A;  4HQS A;  3ZRE A;  1S3D A;  1XVW A;  1PRX A;  3O76 A;  4K7N A;  4IBP A;  4X1U A;  2GS3 A;  3ZMK A;  2WCI A;  2E7P A;  2HE3 A;  2YV9 A;  4QL7 A;  2LJR A;  1VRS D;  3TUE A;  2X8G A;  3GRX A;  3J7Y k;  4K7O A;  4TR4 A;  1Z9H A;  3M1G A;  2E2M A;  1M2B A;  2QC7 A;  1ABA A;  3F6D A;  4AF2 A;  2HRN A;  2DMM A;  2PUK C;  3D6I A;  3LYK A;  1TRV A;  3TGZ A;  2H70 A;  2AHE A;  1MD3 A;  5ECQ B;  2GT5 A;  4KSM A;  5D9W A;  2LEG A;  2A2R A;  4HDE A;  3TDG A;  4V1A p;  2DIZ A;  4BL7 A;  2F51 A;  3FZA A;  5IOW A;  1JZR A;  3RPN A;  1K0M A;  3UIW A;  1NW2 A;  5GSS A;  3C8E A;  1OC8 A;  4WR4 A;  1M7T A;  1M2D A;  3EVI A;  1DE1 A;  3DRN A;  4LMW A;  3HVS A;  4OCE A;  5IO0 A;  4ACS A;  2HFD A;  4HEA 2;  1FAA A;  4IVF A;  1U3A A;  2FGX A;  5ENU A;  2YPM A;  1XWC A;  2VO4 A;  4MK3 A;  3DD3 A;  1G6Y A;  2GQM A;  5IMD A;  2E2G A;  5H5R A;  1TDI A;  2F8A A;  3UAR A;  3F4T A;  1Q98 A;  1X5E A;  4TR3 A;  2XBQ A;  1HNB A;  4ZL8 A;  2LRC A;  1PGT A;  3UBK A;  2L5L A;  2L57 A;  3HVV A;  13GS A;  4MAB A;  2ZUP A;  3HD5 A;  3MWH A;  2B7J A;  3LJR A;  2MMO A;  3BCI A;  1BQ7 A;  3HDC A;  1QQ2 A;  4JRR A;  2L4C A;  5DJL A;  2G0F A;  2JU5 A;  3Q74 A;  2KP1 A;  1PA3 A;  1SL1 B;  4XTS A;  4ILF A;  5F07 A;  1Z7P A;  4V1A g;  4I97 A;  1V98 A;  4OMV A;  3TCO A;  2R37 A;  2PBJ A;  1N2A A;  1XBS A;  3AY8 A;  2KOK A;  1YQ1 A;  4TRX A;  3GH6 A;  2H66 A;  5J9B A;  5AIS A;  2CA8 A;  4FIW A;  4OFT A;  2VOC A;  2JAC A;  1OC9 A;  2IPA A;  3D21 A;  4ISD A;  2LQO A;  4ULX A;  1GWC A;  2A2S A;  3DEX A;  5IM9 A;  2G2Q A;  1MDK A;  2NTO A;  3HA9 A;  2VLV A;  4ECB A;  5HR2 A;  2JZR A;  4JU5 A;  5B8A A;  3QD9 A;  1T4Z A;  2O8V B;  4N0Z A;  4V2M A;  1KEB A;  2L5O A;  3ZIJ A;  4RQX A;  4JBB A;  1OVN A;  1KTE A;  5KN1 A;  3IK9 A;  5EPF A;  1X9S B;  1MDI A;  2WUL A;  3P8W A;  3PR8 A;  3U5R E;  1Z6N A;  3GA4 A;  2H72 A;  2M72 A;  4NV2 A;  4NAX A;  2VL2 A;  1E6B A;  2LNT A;  4HZ4 A;  1JZO A;  2L59 A;  2LV3 A;  1ERW A;  4FH8 A;  2B3S A;  5E4W A;  4IW9 A;  2WJU A;  5DAL B;  3UL3 A;  2C3N A;  3C1R A;  3F3Q A;  1URM A;  5ABR A;  1FHE A;  2HSY A;  4PUR A;  3TB2 A;  3EC3 A;  3Q19 A;  2H76 A;  4ZL7 A;  1F2E A;  5JCW A;  4GWR A;  2HZE B;  5HR3 A;  5G5E A;  1T7P B;  4N30 A;  1ZL9 A;  3ZYW A;  1R7H A;  3ZIV A;  2LKU A;  3H93 A;  4WXT A;  1K0D A;  1XW9 A;  4WF5 A;  1A2L A;  1N8J A;  4WET A;  1RQM A;  4KDY A;  3F0I A;  2OE3 A;  4F82 A;  3IAM 2;  2VLU A;  1RK4 A;  3VI5 A;  5ID2 B;  2F8F A;  1A2M A;  3C7M A;  2RII A;  5H5Q A;  4EO3 A;  3NZN A;  2NDO A;  3QFA C;  5ELG A;  4NWY A;  3ME7 A;  2FLS A;  5LD0 A;  5ECS A;  2LS5 A;  3IAS 2;  3PGT A;  3VFI A;  4TXO B;  2ALB A;  3FW2 A;  4PUF C;  7GSS A;  2CAI A;  3BCK A;  4XS4 B;  5A4U A;  1HNC A;  2ON7 A;  5IMZ A;  2JSY A;  4NHW A;  4OO4 A;  3FR6 A;  1V2A A;  2EIO A;  4WEY A;  3IC4 A;  1B9Y C;  1ZYE A;  5D9V A;  4K9Z A;  5GZZ B;  3VPQ A;  4HU9 A;  1AC1 A;  4MZW A;  4BWQ A;  2GQK A;  2V6K A;  5ECN B;  2VUP A;  3HJO A;  1SYR A;  2KLX A;  2H6Y A;  1XWA A;  1KNG A;  4GSN A;  4WKW A;  3L9U A;  3APS A;  5A4V A;  4KUN A;  2CVD A;  2HXK A;  3A2W A;  1AQX A;  3CRT A;  4PQI A;  5H5S A;  1PN9 A;  4FO5 A;  4ZXG A;  2LNS A;  4HU7 A;  4YH2 A;  3EMX A;  1J0F A;  2DJ2 A;  2TIR A;  1BG5 A;  2DJK A;  3CSH A;  1TU7 A;  5ECM B;  2IN3 A;  5D8I A;  5HQP A;  1E2Y A;  2B6M A;  14GS A;  1NHO A;  1CQH A;  5HR0 A;  2R4V A;  1ZOF A;  2PVQ A;  5G1L A;  2EIQ A;  1ZYQ B;  4MJB A;  3VWW A;  5IMF A;  4N10 A;  3LOR A;  2OAD A;  4EKZ A;  3NOF A;  3WYW A;  3CYN A;  1S3A A;  1W89 A;  4KAE A;  5J4U A;  1SK2 A;  1ST9 A;  3FEU A;  4HJ2 A;  1FB0 A;  2V41 A;  1TTZ A;  1TRU A;  2YZH A;  4GQF A;  5HFG A;  1EWX A;  1H4O A;  3ISO A;  3HKR A;  1GLQ A;  4YAV A;  1JFU A;  3SWL A;  4XRD A;  1M0U A;  4JR4 A;  1MDJ A;  1OC3 A;  1HQO A;  2R2J A;  2FA4 A;  3GST A;  2YOI A;  4NV5 A;  2WGR A;  1GRX A;  10GS A;  2O89 A;  2BTO T;  2E0Q A;  1GUL A;  1I9D A;  2M46 A;  1F3A A;  1XPV A;  2RUE A;  4K0G A;  1FO5 A;  2OE1 A;  4TKY A;  1GSQ A;  5CO3 A;  2DJ0 A;  1A23 A;  2REM A;  4OCF A;  3BBY A;  1EV4 A;  1B9X C;  1O81 A;  3KTB A;  2L6D A;  3KCM A;  2XPE A;  4E8H A;  1G7E A;  1QXH A;  2XC2 A;  2OA7 A;  5IO2 A;  1EV9 A;  2L6C A;  5E59 A;  1DSB A;  5D9X A;  3GSS A;  3EWL A;  3EE2 A;  1F37 A;  1HD2 A;  1U6T A;  1M99 A;  2PWJ A;  2HZF A;  22GS A;  4I6X A;  5B7C A;  2FD3 A;  3M9K A;  1USB A;  2H0H A;  2N5B A;  4EDY A;  5J41 A;  2DIY A;  4ML6 A;  1R5A A;  1AQW A;  1GUM A;  2VCX A;  3S9F A;  3DVW A;  3F8U A;  1WWJ A;  20GS A;  2OKA A;  2K9F A;  4EDZ A;  4MP4 A;  2P31 A;  2C0F A;  2EIR A;  1AUC A;  3C1S A;  3BJ5 A;  2HYX A;  3GKX A;  2YJ7 A;  4RI6 A;  4O5R A;  3FYG A;  3IBH A;  4GXZ A;  12GS A;  2MBT A;  1EP7 A;  4KSO A;  3ZIT A;  3LXZ A;  3QPM A;  4JE1 A;  2QKE A;  3CSI A;  4J2F A;  2LUS A;  1TJD A;  1O7U A;  3UMA A;  3MDK A;  4EF0 A;  2P0G A;  1PX6 A;  2JZS A;  1WE0 A;  1SD9 A;  4K7I A;  3KEB A;  4I8B A;  5G30 A;  1OYJ A;  1AW9 A;  1UVZ A;  1ZZY A;  4ZBB A;  5ELA A;  5CRG A;  3VPT A;  3DGQ A;  2AV4 A;  5ECO B;  2RM5 A;  1EOH A;  4LLR A;  2VM1 A;  4G19 A;  1JZW A;  3GH9 A;  3PIN A;  3ZVJ A;  3FR9 A;  2HI7 A;  1XVQ A;  1K0O A;  4JR6 A;  3KXO A;  2YZU A;  3VK9 A;  4HJM A;  4PNG A;  3CTF A;  1VGL A;  3I6A A;  2DJJ A;  4Q5Q A;  3GTU B;  2WRT A;  2AAW A;  3APQ A;  1WRY A;  2CX3 A;  2FNO A;  1ERT A;  4PNF A;  1WJK A;  3NIV A;  3DML A;  5A5K A;  1V57 A;  3GHA A;  2C3T A;  4N0V A;  4F03 A;  2N5F A;  2YWN A;  5ECK B;  5J9C A;  4TW5 A;  2X8H A;  1T3B A;  1FB6 A;  5KN3 A;  2VCV A;  2IWT A;  5DAK A;  5F8B A;  1GNW A;  4DVC A;  1BYE A;  5EVO A;  4POL A;  4HQZ A;  4PUA A;  3U6V A;  5DAL A;  4ZB9 A;  3KH9 A;  3FHK A;  1JHB A;  1TK8 B;  3J7Y b;  4HUA A;  2C8U A;  2OJL A;  3ERF A;  2HZE A;  3H79 A;  1OKT A;  4L0W A;  3VWV A;  1TRW A;  1A8Y A;  3GKN A;  3L9S A;  2VIM A;  3F4S A;  2XHF A;  3K8N A;  3D22 A;  4TN8 A;  2YWO A;  5IIZ A;  1JLV A;  3CRU A;  3FZ5 A;  3KP8 A;  2LRT A;  1TOF A;  4V2N A;  1X5C A;  3GX8 A;  8GSS A;  4WF4 A;  5CP1 A;  3ED3 A;  1XOB A;  3N9J A;  4XCS A;  5ID2 A;  3A2X A;  3UVT A;  4ZBD A;  2PU9 C;  4POB A;  5COH A;  4G9H A;  4POK A;  1Y25 A;  2LST A;  1UA5 A;  2B5X A;  3TJJ A;  1PKW A;  3GFK A;  4IQA A;  3F4R A;  2AJQ B;  4HZ2 A;  2CV4 A;  4KCA A;  1UN2 A;  4DSS B;  1WP0 A;  5D93 A;  1CQG A;  4TXO A;  2BMX A;  3N5O A;  2C1Y A;  2B7K A;  4QL9 A;  2IFQ B;  4MH2 A;  3GUR A;  1YF0 A;  5G2Z A;  5B6M A;  4XS4 A;  2O85 A;  3EIN A;  3LFL A;  2GST A;  2HNL A;  3WGD A;  4XHM A;  2GSS A;  1BX9 A;  4D73 B;  4LMV A;  3TKQ A;  1SJ6 A;  6GSY A;  1GUK A;  5CNW A;  3HHV A;  3EMP A;  1ML6 A;  4K8M A;  4MPG A;  3A5W A;  3WGE A;  2KUC A;  11GS A;  1XIY A;  1ON4 A;  2R3X A;  2LJK A;  3RPP A;  1T1V A;  1LBK A;  1XOA A;  3TKS C;  1W4V A;  1GL8 A;  3LWA A;  3I69 A;  6GSX A;  4I5Q A;  4KH7 A;  5IOX A;  1SL0 B;  1ILO A;  3ZFB A;  4IJI A;  1H75 A;  1PMT A;  5ECL B;  1T8E B;  3JCM L;  1B48 A;  2CVK A;  3KMO A;  2LJA A;  5AIV A;  3M0F A;  1K0C A;  3F3R A;  3O3T A;  4XRA A;  1MD4 A;  2WZ9 A;  3UOM A;  2NVL A;  5IQY A;  4O92 A;  3EU3 A;  4OD7 A;  5CYY A;  1SK1 A;  4F2I A;  3D5J A;  4ZB8 A;  1OAZ A;  1YY7 A;  4MPF A;  3H8Q A;  4CW9 A;  18GS A;  2VD1 A;  2FWE A;  1V58 A;  3R2Q A;  3CMI A;  4AJ8 A;  2HT9 A;  1TI3 A;  1HYU A;  5KEJ A;  2H73 A;  1YF1 A;  1C72 A;  2GSQ A;  5ECI B;  1TU8 A;  2J9H A;  5DCG A;  3RDW A;  3CSJ A;  2VAF A;  4E8E A;  1IYI A;  1MEK A;  2RUF A;  2YP6 A;  2H1B A;  2CZ2 A;  1SL2 B;  2MMN A;  3ZVJ D;  3HYP A;  2O7K A;  4K6X A;  1XW6 A;  2IJY A;  1ERU A;  4I2U A;  1O8W A;  4CDO A;  1SJZ A;  4F0C A;  2R6K A;  4F9Z A;  2I4A A;  1GP1 A;  2HRF A;  3US3 A;  4IGJ A;  4PX1 A;  4F0B A;  2OBK A;  4NPB A;  4AJ7 A;  1G6W A;  2MMA A;  2GZY A;  3GL5 A;  1GTA A;  1TK0 B;  1BJX A;  3RAZ A;  4GLT A;  1O8X A;  1GLP A;  1SU9 A;  3ZFL A;  3MNG A;  4CHS A;  3MAK A;  1GH2 A;  3EUR A;  3VWX A;  4KGI A;  3FZ4 A;  3UVH A;  1X0R A;  2XBI A;  3LXT A;  3HZ8 A;  3HZ4 A;  4MLY A;  1U88 A;  4TR0 A;  4N11 A;  2C4J A;  2PN8 A;  4IEL A;  1YEP A;  5CAX A;  2FCH A;  3LGC A;  3ZML A;  3ERW A;  1A24 A;  2IMF A;  4EXJ A;  2TRC P;  3CTG A;  4MH3 A;  4XS1 A;  2PVO C;  4DSR A;  3ZZX A;  4MA9 A;  4EE0 A;  1GSF A;  3TRX A;  2ZNM A;  1GSE A;  2MYG A;  4AJ6 A;  1TRS A;  1WMJ A;  2V2G A;  3CXG A;  3HXS A;  4MF5 A;  1SYX A;  4OO5 A;  2B1L A;  3G7I A;  2LRN A;  3HJM A;  4V2L A;  1LU4 A;  19GS A;  1MTC A;  1SK0 A;  2FY6 A;  2LQQ A;  1GSY A;  1WPI A;  1F3B A;  5ECH B;  3LEF A;  5INY A;  4FYB A;  5AGY A;  3GMF A;  4JZQ A;  1O6J A;  3IXR A;  5D73 A;  2V1M A;  4KA0 A;  3G7J A;  1EGR A;  4IQ1 A;  1YKC A;  4TVE A;  1GTU A;  2BJX A;  2VCW A;  2PGT A;  6GSU A;  2IMI A;  2VD0 A;  5DJM A;  4IN0 A;  1FVK A;  1FOV A;  2WDU A;  3D0Z A;  3FRC A;  1DUG A;  2OE0 A;  4TR1 B;  1Q4J A;  1Z5Y E;  3L4N A;  4K2D A;  4ECI A;  2K6V A;  2PMT A;  3ZRD A;  4KDU A;  5LCZ A;  1B4Q A;  4IHU A;  5IMV A;  3DVX A;  1SJI A;  1TW9 A;  2X64 A;  1FG4 A;  1AAZ A;  4ECJ A;  3GKM A;  5B6N A;  5C04 A;  1EP8 A;  2D2Z A;  2DSA A;  3GTU A;  4NXI A;  5ECR B;  2H0G A;  3UJ1 A;  2H30 A;  5D96 A;  3IE3 A;  1XWK A;  4IJ3 A;  4PQH A;  4O32 A;  1SD8 A;  3HJP A;  1EZK A;  3HCZ A;  3WT1 A;  1A2J A;  4H86 A;  3RHB A;  2RM6 A;  1F6M C;  4L5L A;  4MZC A;  2C80 A;  4WR5 A;  6GST A;  2ZCT A;  3A3T A;  1T4Y A;  2C3Q A;  1XWG A;  4MF6 A;  1PQN A;  2C0E A;  3ZLP A;  3KD0 A;  2H1A A;  1A0F A;  2MBS A;  3I9V 2;  4YQM A;  4IS0 A;  4ZL9 A;  5GAP D;  3KJY A;  1XWB A;  3TJF A;  2JSZ A;  1TKD B;  4EUY A;  2VL2 C;  3OR5 A;  4O7H A;  3QR6 A;  2PER A;  1VF1 A;  4HI7 A;  2B5Y A;  4LL1 B;  1GTB A;  2CZ3 A;  2JAD A;  1VF2 A;  1IYH A;  2MZC A;  2A4V A;  3GNJ A;  3DKS A;  4ECC A;  3DYR A;  3IOS A;  5FHI A;  3QMX A;  2YJH A;  2H01 A;  2GT6 A;  4I2T A;  3FZ9 A;  5HFK A;  4TXV A;  2H1D A;  1A8L A;  1XFL A;  3BD2 A;  2GQL A;  2DBC A;  2AYT A;  4WBR D;  9GSS A;  1GTI A;  2C0D A;  1B4P A;  3V1W A;  3TKP A; 
#chains in the Genus database with same CATH topology
 1YDK A;  5LNK e;  4HOJ A;  4DSS A;  5GAN D;  3LSZ A;  2IL3 A;  3W8J A;  2IFQ A;  2TRX A;  2VCT A;  3W8S A;  3D4T A;  2VCQ A;  5F05 A;  1X5D A;  1EEM A;  4FYC A;  2I1U A;  2FA8 A;  4WBJ A;  5CRH A;  1YZX A;  1EGO A;  3TJK A;  3D4M A;  5C00 A;  2H8L A;  4D73 A;  3ZL5 A;  4GRF A;  4ZIJ A;  5EY6 A;  2VL3 A;  1GSD A;  5KN0 A;  1X9W B;  2KP2 A;  2GTU A;  2WFC A;  1OKD A;  1V9W A;  4ICY A;  2VL9 A;  1TP9 A;  2AUV A;  1UC7 A;  1M9A A;  3H4K A;  2M80 A;  2CT6 A;  6GSV A;  3APO A;  2K18 A;  4PGT A;  4EC0 A;  4BVY A;  4GSS A;  4OFN A;  4EVM A;  2YN1 A;  1AIU A;  2H71 A;  5AN1 A;  1HNA A;  1GUH A;  1ACV A;  2WS2 A;  1NHY A;  4PQ1 A;  3IA1 A;  1XG8 A;  1QGV A;  2QGV A;  3GIX A;  3QFB C;  4Z7X A;  1I5G A;  4RI7 A;  3VWU A;  5DDL A;  1M9B A;  2R5G A;  3WT2 A;  1YJ6 A;  4X43 A;  5IPH A;  2FUG 2;  3TRP A;  5F0G A;  5DBQ A;  2IMK A;  3O6T A;  4KND A;  3GYK A;  1GNE A;  3QDN A;  3KMN A;  4L0U A;  4MZB A;  1FW1 A;  2CQ9 A;  2R0C A;  1S3C A;  3A5I A;  4OWY A;  1K0N A;  3SBC A;  5BRT A;  1OE7 A;  1FVJ A;  1G7O A;  5DQY A;  1WIK A;  4MJA A;  3LG6 A;  3FK8 A;  2DJ3 A;  2IME A;  4MJC A;  3HY2 A;  1THO A;  4BL7 B;  1BED A;  3TOT A;  1U3I A;  3ZTL A;  6GSW A;  2AB6 A;  1K3Y A;  1ZCP A;  3QAV A;  1XZO A;  3VUR A;  3HVX A;  2P5R A;  2F9S A;  1Z3E A;  3IV4 A;  2I81 A;  2H6Z A;  1DBY A;  3UBL A;  2C0G A;  3IPZ A;  4LL4 B;  5DVB A;  2KHP A;  1QMV A;  3WD6 A;  2YNX A;  4BA7 A;  1SKR B;  4FYU A;  2R0P A;  3P7X A;  4YQU A;  4IP6 A;  1K3L A;  5G1K A;  6GSS A;  2B5E A;  2EC4 A;  5JWO B;  2GSR A;  2IMD A;  4KX4 A;  2GZZ A;  5G5F A;  4NMU A;  1XCC A;  4YKG A;  1V40 A;  1K0B A;  3PH9 A;  3F63 A;  5CRE A;  4QQ7 A;  4XIH A;  5CRD A;  3F9U A;  4G10 A;  2V32 A;  1ERV A;  2O87 A;  3C73 A;  3UEM A;  3Q18 A;  5DAK B;  3QAW A;  1A0R P;  1KBN A;  2ES7 A;  4TOP A;  5KOX A;  2OAC A;  4GTU A;  1PSQ A;  5GST A;  4BVX A;  2QSI A;  2VCZ A;  2YWM A;  3RBT A;  3F6F A;  2H6X A;  2HSM A;  4X4J A;  5F06 A;  5KN2 A;  4NHZ A;  2JZT A;  4Q5F A;  5FWG A;  3GUS A;  2CVB A;  2YAN A;  1G0T A;  2OBI A;  1TI1 A;  3FKF A;  3DXB A;  1R4W A;  3H1N A;  5IMC A;  5JCU A;  2GLR A;  4BWS A;  3RHC A;  4ZIL A;  1XXU A;  1YKA A;  3UAP A;  1OC9 B;  4YKF A;  1XW5 A;  3GV1 A;  2H19 A;  3ERG A;  5JCG A;  1DE2 A;  3L0H A;  4MMM A;  3MSZ A;  1ZMA A;  5HFI A;  5EL8 A;  2IIY A;  1K0A A;  5IMA A;  2FHE A;  4KE3 A;  5ECP B;  5JWR B;  17GS A;  1TXX A;  3IRA A;  3EYT A;  1M3J A;  4IKH A;  4KDX A;  1O85 A;  2B1K A;  2Z9S A;  3QAG A;  1SKS B;  1J9B A;  4JED A;  3GKK A;  4XS6 A;  3L78 A;  2NBS A;  1PL2 A;  3E3E A;  4ZBA A;  2K8S A;  2PPT A;  3TKR A;  4POM A;  3FY7 A;  3ME8 A;  2H75 A;  3IDV A;  4L8E A;  1B8X A;  4HS1 A;  2X8C A;  3G7Y A;  1GSS A;  2K8V A;  3LQ7 A;  4RQR A;  5D9T A;  1JLW A;  3KGK A;  2I9H A;  3TOU A;  2LTK A;  1QK8 A;  4TR1 A;  3CBU A;  3WGX A;  2N5A A;  3DWV A;  2HLS A;  16GS A;  3FMW A;  5DCH A;  1R5P A;  3DIE A;  4KF9 A;  2GDR A;  3TRQ A;  5J5N A;  2DC5 A;  1U87 A;  1EEJ A;  3M9J A;  4Q5R A;  1QFN A;  1VF3 A;  3KTL A;  5B8B A;  5JWQ B;  2CX4 A;  3EU4 A;  2DML A;  2H0I A;  2YV7 A;  1F9M A;  4K0N A;  1SEN A;  2XPD A;  5A4W A;  1QUW A;  3A2V A;  4AGS A;  1BAY A;  4KB3 A;  4GST A;  2WB9 A;  3QOU A;  3LYP A;  3IHQ A;  2YWI A;  3E9J B;  4Z2T A;  1LJR A;  3I43 A;  1NM3 A;  2NPB A;  5L71 A;  1RW1 A;  2P5Q A;  2J23 A;  1GSU A;  2GVP A;  1PKZ A;  1Z6M A;  2MMZ A;  5AIX A;  2YCD A;  4X0X A;  4BPY A;  3TJG A;  4EL1 A;  1K3O A;  4MF7 A;  3KIJ A;  2JL4 A;  2L4Q A;  2ON5 A;  5J3R A;  5DQS A;  2GGT A;  1ZGN A;  3FR3 A;  1O73 A;  3KP9 A;  3M8N A;  1T00 A;  3TKS E;  2H1G A;  3W6G A;  3G9B A;  4J57 E;  4DSQ A;  1X9M B;  4MCU A;  2V6O A;  4ML1 A;  4K1F A;  2VLT A;  2DLX A;  3KZQ A;  4DEJ A;  4Q5N A;  3GX0 A;  5CRW A;  2FWG A;  1OE8 A;  4RUV A;  2H74 A;  3TKS A;  1SKW B;  2F3M A;  5IPG A;  4ZB6 A;  1WOU A;  4OFM A;  2FWH A;  3QCP A;  3GN3 A;  2DJ1 A;  2CAQ A;  3KM6 A;  1EOG A;  4GF0 A;  5G31 A;  4ID0 A;  1THX A;  3M3M A;  4J56 E;  1Z7R A;  3IR4 A;  3BOA A;  2HRK A;  4P3Y B;  3TJB A;  1JZD A;  4YQV A;  1J08 A;  1VF4 A;  1YEX A;  2GZP A;  5FT3 A;  4LA1 A;  1ZYP A;  4G2E A;  3EPT A;  2I3Y A;  4PXO A;  1M2A A;  1NSW A;  4K2X A;  3P2A A;  1Y6E A;  1AXD A;  4KW6 A;  2FWF A;  3L9V A;  3GL3 A;  1PL1 A;  3IHG A;  4GCI A;  1AQV A;  3Q6O A;  1TK5 B;  2RLI A;  2VM2 A;  3IC8 A;  4YAP A;  3KH7 A;  3VI7 A;  4MDC A;  3VLN A;  3IK7 A;  1PD2 1;  4GQC A;  4IP1 A;  4L5O A;  3P90 A;  1R26 A;  4KCE A;  4MJE A;  2X99 A;  1PX7 A;  2HSH A;  3C71 A;  5HR1 A;  3E0U A;  4HQS A;  3ZRE A;  1S3D A;  4FQU A;  1XVW A;  1PRX A;  2A2P A;  3O76 A;  4K7N A;  4IBP A;  4X1U A;  2GS3 A;  3ZMK A;  2WCI A;  2E7P A;  2HE3 A;  2YV9 A;  4QL7 A;  2LJR A;  1VRS D;  3TUE A;  2X8G A;  3GRX A;  3J7Y k;  4K7O A;  4TR4 A;  1Z9H A;  3M1G A;  2E2M A;  1M2B A;  2QC7 A;  1ABA A;  3F6D A;  4AF2 A;  2HRN A;  2DMM A;  2PUK C;  3D6I A;  3LYK A;  1TRV A;  3TGZ A;  2H70 A;  2AHE A;  1MD3 A;  2GT5 A;  4KSM A;  5ECQ B;  3R3E A;  5D9W A;  2LEG A;  4K5S A;  2A2R A;  4HDE A;  3TDG A;  4V1A p;  2DIZ A;  4BL7 A;  2F51 A;  3FZA A;  5IOW A;  1JZR A;  3RPN A;  1K0M A;  3UIW A;  1NW2 A;  5GSS A;  3C8E A;  1OC8 A;  4WR4 A;  1M7T A;  1M2D A;  3EVI A;  1DE1 A;  3DRN A;  4LMW A;  3HVS A;  4OCE A;  5IO0 A;  2HRA A;  4ACS A;  2HFD A;  4HEA 2;  1FAA A;  4IVF A;  1U3A A;  2FGX A;  5ENU A;  2YPM A;  1XWC A;  2VO4 A;  4MK3 A;  3DD3 A;  1G6Y A;  2GQM A;  5IMD A;  2E2G A;  5H5R A;  1TDI A;  2F8A A;  3UAR A;  3F4T A;  1Q98 A;  1X5E A;  4TR3 A;  2XBQ A;  1HNB A;  4ZL8 A;  2LRC A;  1PGT A;  3UBK A;  2L5L A;  2L57 A;  3HVV A;  13GS A;  4MAB A;  2ZUP A;  3HD5 A;  4Z2U A;  3MWH A;  2B7J A;  3LJR A;  2MMO A;  4USS A;  3BCI A;  1BQ7 A;  3HDC A;  1QQ2 A;  4JRR A;  2L4C A;  5DJL A;  2G0F A;  2JU5 A;  3Q74 A;  2KP1 A;  1PA3 A;  1SL1 B;  4XTS A;  4ILF A;  5F07 A;  1Z7P A;  4V1A g;  4I97 A;  1V98 A;  4OMV A;  3TCO A;  2R37 A;  2PBJ A;  1N2A A;  1XBS A;  3AY8 A;  2KOK A;  1YQ1 A;  2QA2 A;  4TRX A;  3GH6 A;  2H66 A;  5J9B A;  5AIS A;  2CA8 A;  4FIW A;  4OFT A;  2VOC A;  2JAC A;  1OC9 A;  2IPA A;  3D21 A;  4ISD A;  2LQO A;  4ULX A;  1GWC A;  2A2S A;  3DEX A;  5IM9 A;  2G2Q A;  1PFO A;  1MDK A;  2NTO A;  3HA9 A;  2VLV A;  4ECB A;  5HR2 A;  2JZR A;  4JU5 A;  5B8A A;  3QD9 A;  1T4Z A;  2O8V B;  4CY6 A;  4N0Z A;  4V2M A;  1KEB A;  4K5R A;  2L5O A;  3ZIJ A;  4RQX A;  4JBB A;  1OVN A;  1KTE A;  5KN1 A;  3IK9 A;  5EPF A;  1X9S B;  1MDI A;  2WUL A;  3P8W A;  3PR8 A;  3U5R E;  1Z6N A;  3GA4 A;  2H72 A;  2M72 A;  4NV2 A;  4NAX A;  2VL2 A;  1E6B A;  2LNT A;  4HZ4 A;  1JZO A;  2L59 A;  2LV3 A;  1ERW A;  4FH8 A;  2B3S A;  5E4W A;  4IW9 A;  2WJU A;  5DAL B;  3UL3 A;  2C3N A;  3C1R A;  3F3Q A;  1URM A;  5ABR A;  1FHE A;  2HSY A;  4PUR A;  3TB2 A;  3EC3 A;  3Q19 A;  2H76 A;  4ZL7 A;  1F2E A;  5JCW A;  4GWR A;  2HZE B;  5HR3 A;  5G5E A;  1T7P B;  4N30 A;  1ZL9 A;  3ZYW A;  1R7H A;  3ZIV A;  2LKU A;  3H93 A;  4WXT A;  1K0D A;  1XW9 A;  4WF5 A;  1A2L A;  1N8J A;  4WET A;  1RQM A;  4KDY A;  3MYD A;  3F0I A;  2OE3 A;  4F82 A;  3IAM 2;  2VLU A;  1RK4 A;  3VI5 A;  5ID2 B;  2F8F A;  1A2M A;  4BIK A;  3C7M A;  2RII A;  5H5Q A;  4EO3 A;  3NZN A;  2NDO A;  3QFA C;  5ELG A;  4NWY A;  3ME7 A;  2FLS A;  5LD0 A;  2LS5 A;  3IAS 2;  5ECS A;  3PGT A;  3VFI A;  4TXO B;  2ALB A;  3FW2 A;  4PUF C;  2X4A A;  7GSS A;  2CAI A;  3BCK A;  4XS4 B;  5A4U A;  1HNC A;  2ON7 A;  5IMZ A;  2JSY A;  4NHW A;  4EIP A;  4OO4 A;  3FR6 A;  1V2A A;  2EIO A;  4WEY A;  3IC4 A;  1B9Y C;  1ZYE A;  5D9V A;  4K9Z A;  5GZZ B;  3VPQ A;  4HU9 A;  1AC1 A;  4MZW A;  4BWQ A;  2GQK A;  2V6K A;  5ECN B;  2VUP A;  1ZYN A;  3HJO A;  1SYR A;  2KLX A;  2H6Y A;  1XWA A;  1KNG A;  4GSN A;  4WKW A;  3L9U A;  3APS A;  5A4V A;  4KUN A;  4G0I A;  2CVD A;  2HXK A;  3A2W A;  1AQX A;  3CRT A;  4PQI A;  5H5S A;  1PN9 A;  4FO5 A;  4ZXG A;  2LNS A;  4HU7 A;  4YH2 A;  3EMX A;  1J0F A;  2DJ2 A;  2TIR A;  1BG5 A;  2DJK A;  3CSH A;  1TU7 A;  5ECM B;  2IN3 A;  5D8I A;  5HQP A;  1E2Y A;  2B6M A;  14GS A;  1NHO A;  1CQH A;  5HR0 A;  2R4V A;  1ZOF A;  2PVQ A;  5G1L A;  2EIQ A;  1ZYQ B;  4MJB A;  3VWW A;  5IMF A;  4N10 A;  3LOR A;  2OAD A;  4EKZ A;  3NOF A;  3WYW A;  3CYN A;  1S3A A;  1W89 A;  4KAE A;  5J4U A;  1SK2 A;  1ST9 A;  4O5U A;  3FEU A;  4HJ2 A;  1FB0 A;  2V41 A;  1TTZ A;  1TRU A;  2YZH A;  4GQF A;  5HFG A;  1EWX A;  1H4O A;  4MNN A;  3ISO A;  3HKR A;  1GLQ A;  4YAV A;  1JFU A;  3SWL A;  4XRD A;  1M0U A;  4JR4 A;  1MDJ A;  1OC3 A;  1HQO A;  2R2J A;  2FA4 A;  3GST A;  2YOI A;  4NV5 A;  2WGR A;  1GRX A;  10GS A;  2O89 A;  4CY8 A;  2BTO T;  2E0Q A;  1GUL A;  1I9D A;  2M46 A;  1F3A A;  1XPV A;  2RUE A;  4K0G A;  1FO5 A;  2OE1 A;  4TKY A;  1GSQ A;  5CO3 A;  2DJ0 A;  1A23 A;  2REM A;  4OCF A;  3BBY A;  1EV4 A;  1B9X C;  1O81 A;  3KTB A;  2L6D A;  3KCM A;  2XPE A;  4E8H A;  1G7E A;  1QXH A;  2XC2 A;  2OA7 A;  3LW9 A;  5IO2 A;  1EV9 A;  2L6C A;  5E59 A;  1DSB A;  5D9X A;  3GSS A;  3EWL A;  3EE2 A;  1F37 A;  1HD2 A;  1U6T A;  1M99 A;  2PWJ A;  2HZF A;  22GS A;  4I6X A;  5B7C A;  2FD3 A;  3M9K A;  1USB A;  2H0H A;  2N5B A;  4EDY A;  5J41 A;  2DIY A;  4G0K A;  4ML6 A;  1R5A A;  2X49 A;  1AQW A;  1GUM A;  2VCX A;  3S9F A;  3DVW A;  3F8U A;  1WWJ A;  20GS A;  2OKA A;  2K9F A;  4EDZ A;  4MP4 A;  2P31 A;  2C0F A;  2EIR A;  1AUC A;  3C1S A;  3BJ5 A;  2HYX A;  3GKX A;  2YJ7 A;  4RI6 A;  4O5R A;  3FYG A;  3IBH A;  4GXZ A;  12GS A;  2MBT A;  1EP7 A;  4KSO A;  3ZIT A;  3LXZ A;  3QPM A;  4JE1 A;  2QKE A;  3CSI A;  4J2F A;  2LUS A;  1TJD A;  1O7U A;  1PN0 A;  3UMA A;  3MDK A;  4EF0 A;  2P0G A;  1PX6 A;  2JZS A;  1WE0 A;  1SD9 A;  4K7I A;  3KEB A;  4I8B A;  5G30 A;  1OYJ A;  1AW9 A;  1UVZ A;  2R0G A;  1ZZY A;  4ZBB A;  5ELA A;  5CRG A;  3VPT A;  3DGQ A;  2AV4 A;  5ECO B;  2RM5 A;  1EOH A;  4LLR A;  2VM1 A;  4G19 A;  1JZW A;  3GH9 A;  3PIN A;  3ZVJ A;  2DKH A;  3FR9 A;  3HVN A;  2HI7 A;  1XVQ A;  1K0O A;  4JR6 A;  3KXO A;  2YZU A;  3VK9 A;  4HJM A;  4PNG A;  3CTF A;  1VGL A;  3I6A A;  2DJJ A;  4Q5Q A;  3GTU B;  2WRT A;  2AAW A;  3APQ A;  1WRY A;  2CX3 A;  2FNO A;  1ERT A;  4PNF A;  1WJK A;  3NIV A;  3DML A;  5A5K A;  1V57 A;  3GHA A;  2C3T A;  4N0V A;  4F03 A;  2N5F A;  2YWN A;  5ECK B;  5J9C A;  4TW5 A;  2X8H A;  1T3B A;  1FB6 A;  5KN3 A;  2VCV A;  2IWT A;  5DAK A;  4EIQ A;  5F8B A;  1GNW A;  4DVC A;  1BYE A;  5EVO A;  4POL A;  4HQZ A;  4PUA A;  3U6V A;  5DAL A;  4ZB9 A;  3KH9 A;  3FHK A;  1JHB A;  1TK8 B;  3J7Y b;  4HUA A;  2C8U A;  2OJL A;  3ERF A;  2HZE A;  3H79 A;  1OKT A;  4L0W A;  3VWV A;  1TRW A;  5BMU A;  1A8Y A;  3GKN A;  3L9S A;  2VIM A;  3F4S A;  2XHF A;  3K8N A;  3D22 A;  4TN8 A;  2YWO A;  5IIZ A;  2A4H A;  1JLV A;  3CRU A;  3FZ5 A;  3KP8 A;  2LRT A;  1TOF A;  4V2N A;  1X5C A;  3GX8 A;  8GSS A;  4WF4 A;  5CP1 A;  3ED3 A;  1XOB A;  3N9J A;  4XCS A;  5ID2 A;  1S3R A;  3A2X A;  3UVT A;  4ZBD A;  2PU9 C;  4POB A;  5COH A;  4G9H A;  4POK A;  1Y25 A;  2LST A;  1UA5 A;  2B5X A;  3TJJ A;  1PKW A;  3GFK A;  4IQA A;  3F4R A;  2AJQ B;  4HZ2 A;  2CV4 A;  4KCA A;  1UN2 A;  4DSS B;  1WP0 A;  5D93 A;  1CQG A;  4TXO A;  2BMX A;  3N5O A;  2C1Y A;  2B7K A;  4QL9 A;  2IFQ B;  4MH2 A;  3GUR A;  1YF0 A;  5G2Z A;  5B6M A;  4XS4 A;  2O85 A;  3EIN A;  3LFL A;  2GST A;  2HNL A;  3WGD A;  4XHM A;  2GSS A;  1BX9 A;  4D73 B;  4LMV A;  3TKQ A;  1SJ6 A;  6GSY A;  1GUK A;  5CNW A;  3HHV A;  3EMP A;  1ML6 A;  4K8M A;  4MPG A;  3A5W A;  3WGE A;  2KUC A;  11GS A;  1XIY A;  2UZ8 A;  1ON4 A;  2R3X A;  2LJK A;  3RPP A;  1T1V A;  1LBK A;  1XOA A;  4BVY B;  3TKS C;  1W4V A;  1GL8 A;  3LWA A;  3I69 A;  6GSX A;  4I5Q A;  4KH7 A;  5IOX A;  1SL0 B;  1ILO A;  3ZFB A;  4IJI A;  1H75 A;  1PMT A;  5ECL B;  1T8E B;  3JCM L;  1B48 A;  2CVK A;  3KMO A;  2LJA A;  5AIV A;  3M0F A;  1K0C A;  3F3R A;  3O3T A;  4XRA A;  1MD4 A;  2WZ9 A;  3UOM A;  2NVL A;  5IQY A;  4O92 A;  3EU3 A;  4OD7 A;  5CYY A;  1SK1 A;  4F2I A;  3D5J A;  4ZB8 A;  1OAZ A;  1YY7 A;  4MPF A;  3H8Q A;  4CW9 A;  18GS A;  2VD1 A;  2FWE A;  1V58 A;  3R2Q A;  3CMI A;  4AJ8 A;  2HT9 A;  1TI3 A;  1HYU A;  5KEJ A;  2H73 A;  1YF1 A;  1C72 A;  2GSQ A;  5ECI B;  1TU8 A;  2QA1 A;  2J9H A;  5DCG A;  3RDW A;  3CSJ A;  2VAF A;  4E8E A;  1IYI A;  4PTS A;  1MEK A;  2RUF A;  2YP6 A;  2H1B A;  2CZ2 A;  4A5P A;  1SL2 B;  5KOW A;  2MMN A;  3ZVJ D;  3HYP A;  2O7K A;  4K6X A;  1FOH A;  3CQF A;  1XW6 A;  2IJY A;  1ERU A;  4I2U A;  1O8W A;  4CDO A;  1SJZ A;  4F0C A;  2R6K A;  3PPU A;  4F9Z A;  2I4A A;  1GP1 A;  2HRF A;  3US3 A;  4IGJ A;  4PX1 A;  4F0B A;  2OBK A;  4NPB A;  4AJ7 A;  1G6W A;  2MMA A;  2GZY A;  3GL5 A;  1GTA A;  1TK0 B;  1BJX A;  3RAZ A;  4GLT A;  1O8X A;  1GLP A;  1SU9 A;  3ZFL A;  3MNG A;  4CHS A;  3MAK A;  1GH2 A;  3EUR A;  3VWX A;  4KGI A;  3FZ4 A;  3UVH A;  1X0R A;  2XBI A;  3LXT A;  3HZ8 A;  3HZ4 A;  4MLY A;  1U88 A;  4BVX B;  4TR0 A;  4N11 A;  2C4J A;  2PN8 A;  4IEL A;  1YEP A;  5CAX A;  2FCH A;  3LGC A;  3ZML A;  3ERW A;  1A24 A;  2IMF A;  4EXJ A;  2TRC P;  3CTG A;  4MH3 A;  4XS1 A;  2PVO C;  4DSR A;  3ZZX A;  4MA9 A;  4EE0 A;  1GSF A;  3TRX A;  2ZNM A;  3MIX A;  1GSE A;  2MYG A;  4AJ6 A;  1TRS A;  1WMJ A;  2V2G A;  3CXG A;  3HXS A;  4MF5 A;  1SYX A;  4OO5 A;  2B1L A;  3G7I A;  2LRN A;  3HJM A;  4V2L A;  1LU4 A;  19GS A;  1MTC A;  1SK0 A;  2FY6 A;  2LQQ A;  1GSY A;  1WPI A;  1F3B A;  5ECH B;  3LEF A;  5INY A;  4FYB A;  5AGY A;  3GMF A;  4JZQ A;  1O6J A;  3IXR A;  5D73 A;  2V1M A;  4KA0 A;  3G7J A;  1EGR A;  4IQ1 A;  1YKC A;  4TVE A;  1GTU A;  2BJX A;  2VCW A;  2PGT A;  6GSU A;  4O5Q A;  2IMI A;  2VD0 A;  5DJM A;  4IN0 A;  1FVK A;  1FOV A;  2WDU A;  3D0Z A;  3FRC A;  1DUG A;  2OE0 A;  4TR1 B;  1Q4J A;  1Z5Y E;  3L4N A;  4K2D A;  4ECI A;  2K6V A;  2PMT A;  3ZRD A;  4KDU A;  5LCZ A;  2DKI A;  1B4Q A;  4IHU A;  5IMV A;  3DVX A;  1SJI A;  1TW9 A;  2X64 A;  1FG4 A;  1AAZ A;  1M3I A;  4ECJ A;  3GKM A;  5B6N A;  4G0L A;  5C04 A;  1EP8 A;  2D2Z A;  2DSA A;  3GTU A;  4NXI A;  5ECR B;  2H0G A;  3UJ1 A;  2H30 A;  5D96 A;  3IE3 A;  1XWK A;  4IJ3 A;  4PQH A;  4O32 A;  1SD8 A;  4Z2R A;  3HJP A;  1EZK A;  3HCZ A;  3WT1 A;  1A2J A;  4H86 A;  3RHB A;  2RM6 A;  1F6M C;  4L5L A;  4MZC A;  2C80 A;  4WR5 A;  6GST A;  4HSC X;  2ZCT A;  3A3T A;  1T4Y A;  2C3Q A;  1XWG A;  4MF6 A;  1PQN A;  2C0E A;  3ZLP A;  3KD0 A;  2H1A A;  1A0F A;  2MBS A;  3I9V 2;  4YQM A;  4IS0 A;  4ZL9 A;  5GAP D;  3KJY A;  1XWB A;  3TJF A;  2JSZ A;  1TKD B;  4EUY A;  2VL2 C;  3OR5 A;  4O7H A;  3QR6 A;  2PER A;  1VF1 A;  4HI7 A;  2B5Y A;  4LL1 B;  1GTB A;  2CZ3 A;  2JAD A;  1VF2 A;  1IYH A;  2MZC A;  2A4V A;  3GNJ A;  3DKS A;  4ECC A;  3DYR A;  3IOS A;  5FHI A;  3QMX A;  2YJH A;  2H01 A;  2GT6 A;  4I2T A;  3FZ9 A;  5HFK A;  4TXV A;  2H1D A;  1A8L A;  1XFL A;  3BD2 A;  2GQL A;  2DBC A;  2AYT A;  4WBR D;  9GSS A;  1GTI A;  2C0D A;  1B4P A;  3V1W A;  3TKP A; 
#chains in the Genus database with same CATH homology
 1YDK A;  5LNK e;  4HOJ A;  4DSS A;  5GAN D;  3LSZ A;  2IL3 A;  3W8J A;  2IFQ A;  2TRX A;  2VCT A;  3W8S A;  3D4T A;  2VCQ A;  5F05 A;  1X5D A;  1EEM A;  4FYC A;  2I1U A;  2FA8 A;  4WBJ A;  5CRH A;  1YZX A;  1EGO A;  3TJK A;  3D4M A;  5C00 A;  2H8L A;  4D73 A;  3ZL5 A;  4GRF A;  4ZIJ A;  5EY6 A;  2VL3 A;  1GSD A;  5KN0 A;  1X9W B;  2KP2 A;  2GTU A;  2WFC A;  1OKD A;  1V9W A;  4ICY A;  2VL9 A;  1TP9 A;  2AUV A;  1UC7 A;  1M9A A;  3H4K A;  2M80 A;  2CT6 A;  6GSV A;  3APO A;  2K18 A;  4PGT A;  4EC0 A;  4BVY A;  4GSS A;  4OFN A;  4EVM A;  2YN1 A;  1AIU A;  2H71 A;  5AN1 A;  1HNA A;  1GUH A;  1ACV A;  2WS2 A;  1NHY A;  4PQ1 A;  3IA1 A;  1QGV A;  2QGV A;  3GIX A;  3QFB C;  4Z7X A;  1I5G A;  4RI7 A;  3VWU A;  5DDL A;  1M9B A;  2R5G A;  3WT2 A;  1YJ6 A;  4X43 A;  5IPH A;  2FUG 2;  3TRP A;  5F0G A;  5DBQ A;  2IMK A;  3O6T A;  4KND A;  3GYK A;  1GNE A;  3QDN A;  3KMN A;  4L0U A;  4MZB A;  1FW1 A;  2CQ9 A;  2R0C A;  1S3C A;  3A5I A;  4OWY A;  1K0N A;  3SBC A;  5BRT A;  1OE7 A;  1FVJ A;  1G7O A;  5DQY A;  1WIK A;  4MJA A;  3LG6 A;  3FK8 A;  2DJ3 A;  2IME A;  4MJC A;  3HY2 A;  1THO A;  4BL7 B;  1BED A;  3TOT A;  1U3I A;  3ZTL A;  6GSW A;  2AB6 A;  1K3Y A;  1ZCP A;  3QAV A;  1XZO A;  3VUR A;  3HVX A;  2P5R A;  2F9S A;  1Z3E A;  3IV4 A;  2I81 A;  2H6Z A;  1DBY A;  3UBL A;  2C0G A;  3IPZ A;  4LL4 B;  5DVB A;  2KHP A;  1QMV A;  3WD6 A;  2YNX A;  4BA7 A;  1SKR B;  4FYU A;  2R0P A;  3P7X A;  4YQU A;  4IP6 A;  1K3L A;  5G1K A;  6GSS A;  2B5E A;  2EC4 A;  5JWO B;  2GSR A;  2IMD A;  4KX4 A;  2GZZ A;  5G5F A;  4NMU A;  1XCC A;  4YKG A;  1V40 A;  1K0B A;  3PH9 A;  3F63 A;  5CRE A;  4QQ7 A;  4XIH A;  5CRD A;  3F9U A;  4G10 A;  2V32 A;  1ERV A;  2O87 A;  3C73 A;  3UEM A;  3Q18 A;  5DAK B;  3QAW A;  1A0R P;  1KBN A;  2ES7 A;  4TOP A;  5KOX A;  2OAC A;  4GTU A;  1PSQ A;  5GST A;  4BVX A;  2QSI A;  2VCZ A;  2YWM A;  3RBT A;  3F6F A;  2H6X A;  2HSM A;  4X4J A;  5F06 A;  5KN2 A;  4NHZ A;  2JZT A;  4Q5F A;  5FWG A;  3GUS A;  2CVB A;  2YAN A;  1G0T A;  2OBI A;  1TI1 A;  3FKF A;  3DXB A;  1R4W A;  3H1N A;  5IMC A;  5JCU A;  2GLR A;  4BWS A;  3RHC A;  4ZIL A;  1XXU A;  1YKA A;  3UAP A;  1OC9 B;  4YKF A;  1XW5 A;  3GV1 A;  2H19 A;  3ERG A;  5JCG A;  1DE2 A;  3L0H A;  4MMM A;  3MSZ A;  1ZMA A;  5HFI A;  5EL8 A;  2IIY A;  1K0A A;  5IMA A;  2FHE A;  4KE3 A;  5ECP B;  5JWR B;  17GS A;  1TXX A;  3IRA A;  3EYT A;  4IKH A;  4KDX A;  1O85 A;  2B1K A;  2Z9S A;  3QAG A;  1SKS B;  1J9B A;  4JED A;  3GKK A;  4XS6 A;  3L78 A;  2NBS A;  1PL2 A;  3E3E A;  4ZBA A;  2K8S A;  2PPT A;  3TKR A;  4POM A;  3FY7 A;  3ME8 A;  2H75 A;  3IDV A;  4L8E A;  1B8X A;  4HS1 A;  2X8C A;  3G7Y A;  1GSS A;  2K8V A;  3LQ7 A;  4RQR A;  5D9T A;  1JLW A;  3KGK A;  2I9H A;  3TOU A;  2LTK A;  1QK8 A;  4TR1 A;  3CBU A;  3WGX A;  2N5A A;  3DWV A;  2HLS A;  16GS A;  3FMW A;  5DCH A;  1R5P A;  3DIE A;  4KF9 A;  2GDR A;  3TRQ A;  5J5N A;  2DC5 A;  1U87 A;  1EEJ A;  3M9J A;  4Q5R A;  1QFN A;  1VF3 A;  3KTL A;  5B8B A;  5JWQ B;  2CX4 A;  3EU4 A;  2DML A;  2H0I A;  2YV7 A;  1F9M A;  4K0N A;  1SEN A;  2XPD A;  5A4W A;  1QUW A;  3A2V A;  4AGS A;  1BAY A;  4KB3 A;  4GST A;  2WB9 A;  3QOU A;  3LYP A;  3IHQ A;  2YWI A;  3E9J B;  4Z2T A;  1LJR A;  3I43 A;  1NM3 A;  2NPB A;  5L71 A;  1RW1 A;  2P5Q A;  2J23 A;  1GSU A;  2GVP A;  1PKZ A;  1Z6M A;  2MMZ A;  5AIX A;  2YCD A;  4X0X A;  4BPY A;  3TJG A;  4EL1 A;  1K3O A;  4MF7 A;  3KIJ A;  2JL4 A;  2L4Q A;  2ON5 A;  5J3R A;  5DQS A;  2GGT A;  1ZGN A;  3FR3 A;  1O73 A;  3KP9 A;  3M8N A;  1T00 A;  3TKS E;  2H1G A;  3W6G A;  3G9B A;  4J57 E;  4DSQ A;  1X9M B;  4MCU A;  2V6O A;  4ML1 A;  4K1F A;  2VLT A;  2DLX A;  3KZQ A;  4DEJ A;  4Q5N A;  3GX0 A;  5CRW A;  2FWG A;  1OE8 A;  4RUV A;  2H74 A;  3TKS A;  1SKW B;  2F3M A;  5IPG A;  4ZB6 A;  1WOU A;  4OFM A;  2FWH A;  3QCP A;  3GN3 A;  2DJ1 A;  2CAQ A;  3KM6 A;  1EOG A;  4GF0 A;  5G31 A;  4ID0 A;  1THX A;  3M3M A;  4J56 E;  1Z7R A;  3IR4 A;  3BOA A;  2HRK A;  4P3Y B;  3TJB A;  1JZD A;  4YQV A;  1J08 A;  1VF4 A;  1YEX A;  2GZP A;  5FT3 A;  4LA1 A;  1ZYP A;  4G2E A;  3EPT A;  2I3Y A;  4PXO A;  1M2A A;  1NSW A;  4K2X A;  3P2A A;  1Y6E A;  1AXD A;  4KW6 A;  2FWF A;  3L9V A;  3GL3 A;  1PL1 A;  3IHG A;  4GCI A;  1AQV A;  3Q6O A;  1TK5 B;  2RLI A;  2VM2 A;  3IC8 A;  4YAP A;  3KH7 A;  3VI7 A;  4MDC A;  3VLN A;  3IK7 A;  1PD2 1;  4GQC A;  4IP1 A;  4L5O A;  3P90 A;  1R26 A;  4KCE A;  4MJE A;  2X99 A;  1PX7 A;  2HSH A;  3C71 A;  5HR1 A;  3E0U A;  4HQS A;  3ZRE A;  1S3D A;  4FQU A;  1XVW A;  1PRX A;  2A2P A;  3O76 A;  4K7N A;  4IBP A;  4X1U A;  2GS3 A;  3ZMK A;  2WCI A;  2E7P A;  2HE3 A;  2YV9 A;  4QL7 A;  2LJR A;  1VRS D;  3TUE A;  2X8G A;  3GRX A;  3J7Y k;  4K7O A;  4TR4 A;  1Z9H A;  3M1G A;  2E2M A;  1M2B A;  2QC7 A;  1ABA A;  3F6D A;  4AF2 A;  2HRN A;  2DMM A;  2PUK C;  3D6I A;  3LYK A;  1TRV A;  3TGZ A;  2H70 A;  2AHE A;  1MD3 A;  2GT5 A;  4KSM A;  5ECQ B;  3R3E A;  5D9W A;  2LEG A;  4K5S A;  2A2R A;  4HDE A;  3TDG A;  4V1A p;  2DIZ A;  4BL7 A;  2F51 A;  3FZA A;  5IOW A;  1JZR A;  3RPN A;  1K0M A;  3UIW A;  1NW2 A;  5GSS A;  3C8E A;  1OC8 A;  4WR4 A;  1M7T A;  1M2D A;  3EVI A;  1DE1 A;  3DRN A;  4LMW A;  3HVS A;  4OCE A;  5IO0 A;  2HRA A;  4ACS A;  2HFD A;  4HEA 2;  1FAA A;  4IVF A;  1U3A A;  2FGX A;  5ENU A;  2YPM A;  1XWC A;  2VO4 A;  4MK3 A;  3DD3 A;  1G6Y A;  2GQM A;  5IMD A;  2E2G A;  5H5R A;  1TDI A;  2F8A A;  3UAR A;  3F4T A;  1Q98 A;  1X5E A;  4TR3 A;  2XBQ A;  1HNB A;  4ZL8 A;  2LRC A;  1PGT A;  3UBK A;  2L5L A;  2L57 A;  3HVV A;  13GS A;  4MAB A;  2ZUP A;  3HD5 A;  4Z2U A;  3MWH A;  2B7J A;  3LJR A;  2MMO A;  4USS A;  3BCI A;  1BQ7 A;  3HDC A;  1QQ2 A;  4JRR A;  2L4C A;  5DJL A;  2G0F A;  2JU5 A;  3Q74 A;  2KP1 A;  1PA3 A;  1SL1 B;  4XTS A;  4ILF A;  5F07 A;  1Z7P A;  4V1A g;  4I97 A;  1V98 A;  4OMV A;  3TCO A;  2R37 A;  2PBJ A;  1N2A A;  1XBS A;  3AY8 A;  2KOK A;  1YQ1 A;  2QA2 A;  4TRX A;  3GH6 A;  2H66 A;  5J9B A;  5AIS A;  2CA8 A;  4FIW A;  4OFT A;  2VOC A;  2JAC A;  1OC9 A;  2IPA A;  3D21 A;  4ISD A;  2LQO A;  4ULX A;  1GWC A;  2A2S A;  3DEX A;  5IM9 A;  2G2Q A;  1MDK A;  2NTO A;  3HA9 A;  2VLV A;  4ECB A;  5HR2 A;  2JZR A;  4JU5 A;  5B8A A;  3QD9 A;  1T4Z A;  2O8V B;  4CY6 A;  4N0Z A;  4V2M A;  1KEB A;  4K5R A;  2L5O A;  3ZIJ A;  4RQX A;  4JBB A;  1OVN A;  1KTE A;  5KN1 A;  3IK9 A;  5EPF A;  1X9S B;  1MDI A;  2WUL A;  3P8W A;  3PR8 A;  3U5R E;  1Z6N A;  3GA4 A;  2H72 A;  2M72 A;  4NV2 A;  4NAX A;  2VL2 A;  1E6B A;  2LNT A;  4HZ4 A;  1JZO A;  2L59 A;  2LV3 A;  1ERW A;  4FH8 A;  2B3S A;  5E4W A;  4IW9 A;  2WJU A;  5DAL B;  3UL3 A;  2C3N A;  3C1R A;  3F3Q A;  1URM A;  5ABR A;  1FHE A;  2HSY A;  4PUR A;  3TB2 A;  3EC3 A;  3Q19 A;  2H76 A;  4ZL7 A;  1F2E A;  5JCW A;  4GWR A;  2HZE B;  5HR3 A;  5G5E A;  1T7P B;  4N30 A;  1ZL9 A;  3ZYW A;  1R7H A;  3ZIV A;  2LKU A;  3H93 A;  4WXT A;  1K0D A;  1XW9 A;  4WF5 A;  1A2L A;  1N8J A;  4WET A;  1RQM A;  4KDY A;  3MYD A;  3F0I A;  2OE3 A;  4F82 A;  3IAM 2;  2VLU A;  1RK4 A;  3VI5 A;  5ID2 B;  2F8F A;  1A2M A;  3C7M A;  2RII A;  5H5Q A;  4EO3 A;  3NZN A;  2NDO A;  3QFA C;  5ELG A;  4NWY A;  3ME7 A;  2FLS A;  5LD0 A;  2LS5 A;  3IAS 2;  5ECS A;  3PGT A;  3VFI A;  4TXO B;  2ALB A;  3FW2 A;  4PUF C;  2X4A A;  7GSS A;  2CAI A;  3BCK A;  4XS4 B;  5A4U A;  1HNC A;  2ON7 A;  5IMZ A;  2JSY A;  4NHW A;  4EIP A;  4OO4 A;  3FR6 A;  1V2A A;  2EIO A;  4WEY A;  3IC4 A;  1B9Y C;  1ZYE A;  5D9V A;  4K9Z A;  5GZZ B;  3VPQ A;  4HU9 A;  1AC1 A;  4MZW A;  4BWQ A;  2GQK A;  2V6K A;  5ECN B;  2VUP A;  1ZYN A;  3HJO A;  1SYR A;  2KLX A;  2H6Y A;  1XWA A;  1KNG A;  4GSN A;  4WKW A;  3L9U A;  3APS A;  5A4V A;  4KUN A;  4G0I A;  2CVD A;  2HXK A;  3A2W A;  1AQX A;  3CRT A;  4PQI A;  5H5S A;  1PN9 A;  4FO5 A;  4ZXG A;  2LNS A;  4HU7 A;  4YH2 A;  3EMX A;  1J0F A;  2DJ2 A;  2TIR A;  1BG5 A;  2DJK A;  3CSH A;  1TU7 A;  5ECM B;  2IN3 A;  5D8I A;  5HQP A;  1E2Y A;  2B6M A;  14GS A;  1NHO A;  1CQH A;  5HR0 A;  2R4V A;  1ZOF A;  2PVQ A;  5G1L A;  2EIQ A;  1ZYQ B;  4MJB A;  3VWW A;  5IMF A;  4N10 A;  3LOR A;  2OAD A;  4EKZ A;  3NOF A;  3WYW A;  3CYN A;  1S3A A;  1W89 A;  4KAE A;  5J4U A;  1SK2 A;  1ST9 A;  4O5U A;  3FEU A;  4HJ2 A;  1FB0 A;  2V41 A;  1TTZ A;  1TRU A;  2YZH A;  4GQF A;  5HFG A;  1EWX A;  1H4O A;  4MNN A;  3ISO A;  3HKR A;  1GLQ A;  4YAV A;  1JFU A;  3SWL A;  4XRD A;  1M0U A;  4JR4 A;  1MDJ A;  1OC3 A;  1HQO A;  2R2J A;  2FA4 A;  3GST A;  2YOI A;  4NV5 A;  2WGR A;  1GRX A;  10GS A;  2O89 A;  4CY8 A;  2BTO T;  2E0Q A;  1GUL A;  1I9D A;  2M46 A;  1F3A A;  1XPV A;  2RUE A;  4K0G A;  1FO5 A;  2OE1 A;  4TKY A;  1GSQ A;  5CO3 A;  2DJ0 A;  1A23 A;  2REM A;  4OCF A;  3BBY A;  1EV4 A;  1B9X C;  1O81 A;  3KTB A;  2L6D A;  3KCM A;  2XPE A;  4E8H A;  1G7E A;  1QXH A;  2XC2 A;  2OA7 A;  3LW9 A;  5IO2 A;  1EV9 A;  2L6C A;  5E59 A;  1DSB A;  5D9X A;  3GSS A;  3EWL A;  3EE2 A;  1F37 A;  1HD2 A;  1U6T A;  1M99 A;  2PWJ A;  2HZF A;  22GS A;  4I6X A;  5B7C A;  2FD3 A;  3M9K A;  1USB A;  2H0H A;  2N5B A;  4EDY A;  5J41 A;  2DIY A;  4G0K A;  4ML6 A;  1R5A A;  2X49 A;  1AQW A;  1GUM A;  2VCX A;  3S9F A;  3DVW A;  3F8U A;  1WWJ A;  20GS A;  2OKA A;  2K9F A;  4EDZ A;  4MP4 A;  2P31 A;  2C0F A;  2EIR A;  1AUC A;  3C1S A;  3BJ5 A;  2HYX A;  3GKX A;  2YJ7 A;  4RI6 A;  4O5R A;  3FYG A;  3IBH A;  4GXZ A;  12GS A;  2MBT A;  1EP7 A;  4KSO A;  3ZIT A;  3LXZ A;  3QPM A;  4JE1 A;  2QKE A;  3CSI A;  4J2F A;  2LUS A;  1TJD A;  1O7U A;  1PN0 A;  3UMA A;  3MDK A;  4EF0 A;  2P0G A;  1PX6 A;  2JZS A;  1WE0 A;  1SD9 A;  4K7I A;  3KEB A;  4I8B A;  5G30 A;  1OYJ A;  1AW9 A;  1UVZ A;  2R0G A;  1ZZY A;  4ZBB A;  5ELA A;  5CRG A;  3VPT A;  3DGQ A;  2AV4 A;  5ECO B;  2RM5 A;  1EOH A;  4LLR A;  2VM1 A;  4G19 A;  1JZW A;  3GH9 A;  3PIN A;  3ZVJ A;  2DKH A;  3FR9 A;  2HI7 A;  1XVQ A;  1K0O A;  4JR6 A;  3KXO A;  2YZU A;  3VK9 A;  4HJM A;  4PNG A;  3CTF A;  1VGL A;  3I6A A;  2DJJ A;  4Q5Q A;  3GTU B;  2WRT A;  2AAW A;  3APQ A;  1WRY A;  2CX3 A;  2FNO A;  1ERT A;  4PNF A;  1WJK A;  3NIV A;  3DML A;  5A5K A;  1V57 A;  3GHA A;  2C3T A;  4N0V A;  4F03 A;  2N5F A;  2YWN A;  5ECK B;  5J9C A;  4TW5 A;  2X8H A;  1T3B A;  1FB6 A;  5KN3 A;  2VCV A;  2IWT A;  5DAK A;  4EIQ A;  5F8B A;  1GNW A;  4DVC A;  1BYE A;  5EVO A;  4POL A;  4HQZ A;  4PUA A;  3U6V A;  5DAL A;  4ZB9 A;  3KH9 A;  3FHK A;  1JHB A;  1TK8 B;  3J7Y b;  4HUA A;  2C8U A;  2OJL A;  3ERF A;  2HZE A;  3H79 A;  1OKT A;  4L0W A;  3VWV A;  1TRW A;  5BMU A;  1A8Y A;  3GKN A;  3L9S A;  2VIM A;  3F4S A;  2XHF A;  3K8N A;  3D22 A;  4TN8 A;  2YWO A;  5IIZ A;  2A4H A;  1JLV A;  3CRU A;  3FZ5 A;  3KP8 A;  2LRT A;  1TOF A;  4V2N A;  1X5C A;  3GX8 A;  8GSS A;  4WF4 A;  5CP1 A;  3ED3 A;  1XOB A;  3N9J A;  4XCS A;  5ID2 A;  3A2X A;  3UVT A;  4ZBD A;  2PU9 C;  4POB A;  5COH A;  4G9H A;  4POK A;  1Y25 A;  2LST A;  1UA5 A;  2B5X A;  3TJJ A;  1PKW A;  3GFK A;  4IQA A;  3F4R A;  2AJQ B;  4HZ2 A;  2CV4 A;  4KCA A;  1UN2 A;  4DSS B;  1WP0 A;  5D93 A;  1CQG A;  4TXO A;  2BMX A;  3N5O A;  2C1Y A;  2B7K A;  4QL9 A;  2IFQ B;  4MH2 A;  3GUR A;  1YF0 A;  5G2Z A;  5B6M A;  4XS4 A;  2O85 A;  3EIN A;  3LFL A;  2GST A;  2HNL A;  3WGD A;  4XHM A;  2GSS A;  1BX9 A;  4D73 B;  4LMV A;  3TKQ A;  1SJ6 A;  6GSY A;  1GUK A;  5CNW A;  3HHV A;  3EMP A;  1ML6 A;  4K8M A;  4MPG A;  3A5W A;  3WGE A;  2KUC A;  11GS A;  1XIY A;  2UZ8 A;  1ON4 A;  2R3X A;  2LJK A;  3RPP A;  1T1V A;  1LBK A;  1XOA A;  4BVY B;  3TKS C;  1W4V A;  1GL8 A;  3LWA A;  3I69 A;  6GSX A;  4I5Q A;  4KH7 A;  5IOX A;  1SL0 B;  1ILO A;  3ZFB A;  4IJI A;  1H75 A;  1PMT A;  5ECL B;  1T8E B;  3JCM L;  1B48 A;  2CVK A;  3KMO A;  2LJA A;  5AIV A;  3M0F A;  1K0C A;  3F3R A;  3O3T A;  4XRA A;  1MD4 A;  2WZ9 A;  3UOM A;  2NVL A;  5IQY A;  4O92 A;  3EU3 A;  4OD7 A;  5CYY A;  1SK1 A;  4F2I A;  3D5J A;  4ZB8 A;  1OAZ A;  1YY7 A;  4MPF A;  3H8Q A;  4CW9 A;  18GS A;  2VD1 A;  2FWE A;  1V58 A;  3R2Q A;  3CMI A;  4AJ8 A;  2HT9 A;  1TI3 A;  1HYU A;  5KEJ A;  2H73 A;  1YF1 A;  1C72 A;  2GSQ A;  5ECI B;  1TU8 A;  2QA1 A;  2J9H A;  5DCG A;  3RDW A;  3CSJ A;  2VAF A;  4E8E A;  1IYI A;  4PTS A;  1MEK A;  2RUF A;  2YP6 A;  2H1B A;  2CZ2 A;  4A5P A;  1SL2 B;  5KOW A;  2MMN A;  3ZVJ D;  3HYP A;  2O7K A;  4K6X A;  1FOH A;  1XW6 A;  2IJY A;  1ERU A;  4I2U A;  1O8W A;  4CDO A;  1SJZ A;  4F0C A;  2R6K A;  3PPU A;  4F9Z A;  2I4A A;  1GP1 A;  2HRF A;  3US3 A;  4IGJ A;  4PX1 A;  4F0B A;  2OBK A;  4NPB A;  4AJ7 A;  1G6W A;  2MMA A;  2GZY A;  3GL5 A;  1GTA A;  1TK0 B;  1BJX A;  3RAZ A;  4GLT A;  1O8X A;  1GLP A;  1SU9 A;  3ZFL A;  3MNG A;  4CHS A;  3MAK A;  1GH2 A;  3EUR A;  3VWX A;  4KGI A;  3FZ4 A;  3UVH A;  1X0R A;  2XBI A;  3LXT A;  3HZ8 A;  3HZ4 A;  4MLY A;  1U88 A;  4BVX B;  4TR0 A;  4N11 A;  2C4J A;  2PN8 A;  4IEL A;  1YEP A;  5CAX A;  2FCH A;  3LGC A;  3ZML A;  3ERW A;  1A24 A;  2IMF A;  4EXJ A;  2TRC P;  3CTG A;  4MH3 A;  4XS1 A;  2PVO C;  4DSR A;  3ZZX A;  4MA9 A;  4EE0 A;  1GSF A;  3TRX A;  2ZNM A;  3MIX A;  1GSE A;  2MYG A;  4AJ6 A;  1TRS A;  1WMJ A;  2V2G A;  3CXG A;  3HXS A;  4MF5 A;  1SYX A;  4OO5 A;  2B1L A;  3G7I A;  2LRN A;  3HJM A;  4V2L A;  1LU4 A;  19GS A;  1MTC A;  1SK0 A;  2FY6 A;  2LQQ A;  1GSY A;  1WPI A;  1F3B A;  5ECH B;  3LEF A;  5INY A;  4FYB A;  5AGY A;  3GMF A;  4JZQ A;  1O6J A;  3IXR A;  5D73 A;  2V1M A;  4KA0 A;  3G7J A;  1EGR A;  4IQ1 A;  1YKC A;  4TVE A;  1GTU A;  2BJX A;  2VCW A;  2PGT A;  6GSU A;  4O5Q A;  2IMI A;  2VD0 A;  5DJM A;  4IN0 A;  1FVK A;  1FOV A;  2WDU A;  3D0Z A;  3FRC A;  1DUG A;  2OE0 A;  4TR1 B;  1Q4J A;  1Z5Y E;  3L4N A;  4K2D A;  4ECI A;  2K6V A;  2PMT A;  3ZRD A;  4KDU A;  5LCZ A;  2DKI A;  1B4Q A;  4IHU A;  5IMV A;  3DVX A;  1SJI A;  1TW9 A;  2X64 A;  1FG4 A;  1AAZ A;  4ECJ A;  3GKM A;  5B6N A;  4G0L A;  5C04 A;  1EP8 A;  2D2Z A;  2DSA A;  3GTU A;  4NXI A;  5ECR B;  2H0G A;  3UJ1 A;  2H30 A;  5D96 A;  3IE3 A;  1XWK A;  4IJ3 A;  4PQH A;  4O32 A;  1SD8 A;  4Z2R A;  3HJP A;  1EZK A;  3HCZ A;  3WT1 A;  1A2J A;  4H86 A;  3RHB A;  2RM6 A;  1F6M C;  4L5L A;  4MZC A;  2C80 A;  4WR5 A;  6GST A;  2ZCT A;  3A3T A;  1T4Y A;  2C3Q A;  1XWG A;  4MF6 A;  1PQN A;  2C0E A;  3ZLP A;  3KD0 A;  2H1A A;  1A0F A;  2MBS A;  3I9V 2;  4YQM A;  4IS0 A;  4ZL9 A;  5GAP D;  3KJY A;  1XWB A;  3TJF A;  2JSZ A;  1TKD B;  4EUY A;  2VL2 C;  3OR5 A;  4O7H A;  3QR6 A;  2PER A;  1VF1 A;  4HI7 A;  2B5Y A;  4LL1 B;  1GTB A;  2CZ3 A;  2JAD A;  1VF2 A;  1IYH A;  2MZC A;  2A4V A;  3GNJ A;  3DKS A;  4ECC A;  3DYR A;  3IOS A;  5FHI A;  3QMX A;  2YJH A;  2H01 A;  2GT6 A;  4I2T A;  3FZ9 A;  5HFK A;  4TXV A;  2H1D A;  1A8L A;  1XFL A;  3BD2 A;  2GQL A;  2DBC A;  2AYT A;  4WBR D;  9GSS A;  1GTI A;  2C0D A;  1B4P A;  3V1W A;  3TKP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...