1THOA

Crystal structure of a mutant escherichia coli thioredoxin with an arginine insertion in the active site
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
109
structure length
109
Chain Sequence
SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGRPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords THIOREDOXIN
publication title Crystal Structure of a Mutant Escherichia Coli Thioredoxin with an Arginine Insertion in the Active Site
rcsb
source organism Escherichia coli
total genus 30
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 1993-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1thoA00
3F4RA 1BQ7A 5HR0A 2M80A 4K7NA 1A23A 4GWRA 1HNBA 3F0IA 3VI5A 2H66A 5AISA 5J5NA 1T1VA 2L5LA 3TJFA 2B7JA 4MABA 3W8SA 1WP0A 1QFNA 2LRTA 1K3LA 2VD1A 3DGQA 3BJ5A 3FZ9A 5IMCA 3RPPA 4TVEA 2RIIA 4L0UA 1OC9B 1LJRA 1X0RA 1WJKA 5IOWA 3GFKA 3F8UA 5J9CA 4TW5A 3RBTA 3QDNA 1XFLA 3I6AA 3VPQA 4MDCA 1M9BA 4K7IA 3L78A 3EC3A 4JBBA 3ISOA 1GLPA 2AAWA 1A0FA 1JZDA 3U5RE 4OFTA 1H75A 2L6DA 4KCAA 2H71A 1HQOA 1SKSB 4NXIA 1T4ZA 20GSA 5AGYA 2QGVA 1MDIA 3ZVJD 3D21A 2H75A 2DIZA 1GWCA 1U87A 3ZITA 3UOMA 4GQFA 4XS4B 1Y25A 1ST9A 5EVOA 2LSTA 3W8JA 3LEFA 4Z7XA 1THOA 3IAM2 3HKRA 1R5AA 2R5GA 4TXOB 3K8NA 3L9SA 5B7CA 3TOTA 5CRWA 1WRYA 1MEKA 3M8NA 1GUHA 1X9SB 1A2MA 4KDUA 3F6FA 4OMVA 1FOVA 1Z6MA 2LNSA 3KTBA 4LMWA 2YZHA 4HJMA 2CVBA 2CVKA 4LMVA 2HYXA 3HZ4A 1GSQA 4QQ7A 2A4VA 4IQAA 3CRUA 2DJJA 5ECSA 3ZZXA 3MNGA 4TR3A 5ECKB 5KEJA 5J3RA 4JE1A 1FW1A 2I4AA 3DRNA 4CHSA 1O81A 4FYUA 2V6OA 3KCMA 3IC4A 4J2FA 2MBSA 4CW9A 3RHCA 2H19A 2CZ3A 2PN8A 3GX8A 4AGSA 1TI1A 1JLWA 2GZZA 4X0XA 2MBTA 5IQYA 3IAS2 1XW6A 3DXBA 4RQRA 1EWXA 2X8HA 3KH7A 1SK2A 2FHEA 1XWBA 4I5QA 3L0HA 5AN1A 5IM9A 3FR9A 4ZIJA 5A4WA 2VLTA 2AV4A 3TJBA 1AAZA 2DBCA 1JHBA 1V40A 2CAIA 5LNKe 3M3MA 4TKYA 3GH6A 2D2ZA 2VOCA 3DVXA 1SYRA 4PQHA 5H5QA 1SD9A 4PXOA 2HZFA 5A4UA 4HOJA 4DVCA 3CTGA 1TU7A 2OADA 2PVQA 1BJXA 4PQ1A 4K9ZA 4PX1A 4N0ZA 2DSAA 4H86A 2VCVA 3S9FA 4K1FA 3W6GA 1TK0B 1A2LA 2C8UA 1SL1B 3R2QA 2ON7A 5KN2A 3IA1A 3TKQA 1TJDA 1XOAA 2GSRA 3KIJA 1NHOA 2C0FA 4MH3A 2DMLA 3CYNA 2IPAA 4MF6A 1B4QA 3C1RA 4K6XA 3TKRA 3IHQA 3GURA 2MMOA 3US3A 5EPFA 1E2YA 3HHVA 3LSZA 1X9WB 4KDXA 2GDRA 2BJXA 1TRVA 4AF2A 2ALBA 2L4CA 3CTFA 2C0EA 2B1KA 2R4VA 1YEPA 5CRGA 3ZIVA 2VUPA 2XHFA 2TRXA 3ME8A 1FO5A 2YJ7A 5CAXA 2CAQA 1B9XC 1GH2A 4G9HA 3UBKA 4I6XA 3ZVJA 1JZOA 1H4OA 3G9BA 1Z9HA 2H72A 2MMNA 2HSHA 2JADA 2JZRA 1PX6A 1ABAA 1HNCA 1K0MA 2A2RA 2DC5A 3ZREA 4ZB6A 3IE3A 4ZL8A 1PL1A 2F51A 2MYGA 3O3TA 3D22A 4JR6A 1JLVA 2ZCTA 3Q18A 4EL1A 5E59A 3GKMA 1M7TA 4WR4A 2F8AA 1XPVA 5DQYA 3LGCA 1KNGA 2QKEA 3GNJA 4MJCA 2JACA 5ABRA 1GUMA 4BL7A 1U6TA 2I3YA 2H8LA 1K3OA 1ZCPA 3P7XA 4PNGA 1VRSD 3C7MA 5HR2A 3GN3A 4JEDA 3VURA 7GSSA 3LXTA 1I5GA 3KMOA 4PUAA 1GTIA 1ERUA 1R7HA 1V2AA 1JZWA 1X5EA 3A3TA 4ML1A 4QL7A 5DVBA 5CRDA 2B5YA 1PD21 1YY7A 2F9SA 2CA8A 4IN0A 2LEGA 1OC3A 2DJ2A 2OA7A 3QFBC 1PN9A 1M9AA 4DSRA 3M9KA 4TRXA 2C0DA 1RW1A 1GSUA 4G2EA 1V9WA 3KJYA 3PINA 2AHEA 4BA7A 4F9ZA 3G7YA 4HI7A 3WGXA 2YV7A 1K0AA 1VF3A 2FUG2 2KHPA 3DVWA 1FB6A 4OO5A 5LCZA 1DBYA 3DKSA 3FW2A 3ZLPA 5B8AA 6GSTA 4ACSA 4NWYA 3UL3A 3TJJA 4JZQA 2M46A 1YEXA 4YH2A 3UVHA 2WFCA 2AJQB 2EC4A 2NDOA 3QMXA 1GULA 2VL2C 4Q5FA 3VWWA 3AY8A 3BCKA 2FWHA 2BTOT 4OO4A 2K8SA 2HFDA 4POKA 3EYTA 4KNDA 2HNLA 4K0NA 1O8XA 5J41A 1J0FA 1GTUA 3LG6A 4WETA 2P31A 2LJAA 3FKFA 2RLIA 2R37A 1TU8A 2VL3A 1TKDB 2O89A 18GSA 2VLVA 1O85A 1EEJA 4V2MA 3WT2A 5G5EA 4LLRA 3TRPA 2OBIA 2GSQA 1TI3A 3EU4A 2IJYA 5ECRB 5GSTA 3GKXA 3IDVA 3TRQA 1K0CA 5ELGA 5COHA 4ZILA 5GZZB 4HU9A 3FEUA 2E0QA 1GSDA 1HYUA 5DALA 4OD7A 1VF4A 3GL5A 3TGZA 4DSSA 2WZ9A 1WE0A 2FGXA 3FZ4A 4FIWA 1DE2A 3E9JB 2VCQA 4HZ4A 2HRNA 4KGIA 4POLA 3ZFBA 3ZL5A 1CQGA 4O32A 4K7OA 12GSA 4YQUA 22GSA 1M99A 2C0GA 1WPIA 3I9V2 2OACA 2PU9C 2KLXA 1GSEA 5CP1A 4BVXA 4IHUA 3KP8A 3EINA 2L6CA 1SKRB 1XVWA 1YJ6A 4I2TA 2P5QA 3N9JA 3UMAA 3H8QA 2FLSA 2MZCA 3GKKA 1SYXA 2IFQA 1I9DA 3UARA 3F4TA 1XW9A 3F4SA 1A2JA 3ZMLA 2O85A 3VPTA 4KH7A 4DEJA 1WMJA 4IP1A 1K0BA 1W89A 3TJGA 3CXGA 3M9JA 1B4PA 6GSVA 2E2MA 5FHIA 1Z6NA 2H30A 1AQVA 2B7KA 17GSA 4P3YB 3IPZA 1EGOA 1PGTA 3BCIA 1IYHA 4G19A 4Q5NA 4J56E 1W4VA 3KTLA 5JCUA 1PKZA 2IMEA 4I2UA 2G2QA 2L5OA 4AJ6A 1GSSA 2LQOA 2H6ZA 1A8LA 4MZBA 4NHWA 2YWOA 1NW2A 5D93A 3IK7A 3A2VA 2H1GA 4BWQA 1EEMA 5J9BA 1EZKA 4IQ1A 2N5FA 4GLTA 4TR4A 3WT1A 2C4JA 5DALB 1EV4A 1Z5YE 4DSSB 3APOA 3RHBA 3TKSE 2L57A 1XVQA 2HI7A 1A8YA 3BBYA 5CO3A 3M0FA 5H5SA 1XWKA 1K0OA 5JWQB 5JWOB 1FHEA 1X5CA 2VL2A 1VF2A 4KDYA 1AUCA 2FY6A 3HVXA 4JU5A 3KZQA 2NPBA 5DBQA 3C71A 3VK9A 4LL1B 3Q6OA 2CX4A 4CDOA 3ZIJA 1EOHA 2CZ2A 4MP4A 1UA5A 3CSJA 4RI6A 2GQKA 3WD6A 3J7Yk 4KE3A 3WYWA 4GSSA 3C73A 2YANA 2WJUA 4EUYA 4YAPA 1VF1A 4IJIA 2VCZA 4Q5RA 4RQXA 4XTSA 1PL2A 2IFQB 4EDZA 1X5DA 2FWFA 2EIOA 5G30A 1OYJA 1G0TA 2LNTA 3QOUA 4FH8A 3GRXA 1FVKA 2K9FA 4IP6A 5IMAA 2VCXA 4MJEA 3U6VA 4EKZA 2H1DA 1AQWA 1PA3A 2LRNA 2F3MA 4X43A 3TJKA 2LS5A 1ACVA 4TR1A 3APQA 2YP6A 3MWHA 4MF5A 3F6DA 1BYEA 2GT5A 1E6BA 2HXKA 1ERWA 4L5LA 3CMIA 3HJOA 1BG5A 3HVSA 3P2AA 1PKWA 4X1UA 1XWCA 2YWIA 2PWJA 4ILFA 4L8EA 1DUGA 2LKUA 3MSZA 1QK8A 2I81A 2I9HA 4YQMA 5A5KA 2X99A 4HDEA 4N10A 3V1WA 4WXTA 3QCPA 2DJ1A 1T00A 3TUEA 1JZRA 2FNOA 3WGDA 1G7EA 1R26A 1EV9A 3GHAA 4GSTA 1ZOFA 3UAPA 2IL3A 5H5RA 1SL2B 2JZSA 2DJ3A 1WWJA 3Q19A 5IMZA 2L4QA 5JCWA 4OCFA 1FG4A 3ZTLA 3HJPA 3F9UA 3DD3A 4GSNA 3QR6A 2LRCA 2TIRA 1BX9A 4MF7A 3FY7A 4MCUA 2C3NA 5G1LA 2FWGA 4LA1A 3EU3A 1MDJA 2KUCA 3RDWA 1V58A 4YAVA 1CQHA 2RUEA 1GNWA 1AW9A 2A2SA 3SBCA 5G1KA 3FRCA 2PVOC 3FR6A 5G31A 1MD4A 3EWLA 5HR1A 2VCWA 4K2DA 3G7JA 3MDKA 4F0BA 1S3DA 3GV1A 2FA8A 5KN3A 1FAAA 2MMAA 2HLSA 1ON4A 4K8MA 3FZAA 2IMFA 4F0CA 9GSSA 4EO3A 4TR1B 4ZB9A 3PR8A 3NOFA 19GSA 2IIYA 5EY6A 5ECNB 1XCCA 5ECPB 1XXUA 2PBJA 1A0RP 3N5OA 4JRRA 5ECMB 2XPEA 3E0UA 3KXOA 2K6VA 4ULXA 1A24A 2IMKA 2DJ0A 3KM6A 3RAZA 3GIXA 1M2DA 2HZEA 1GTBA 3ERGA 3HYPA 5ENUA 2ON5A 1AC1A 2O8VB 1UC7A 2V41A 4XIHA 3A5WA 6GSWA 1WIKA 2LV3A 2OJLA 4FO5A 3KGKA 3QAWA 2H1AA 2GQLA 3APSA 4ID0A 2PERA 4DSQA 1YKAA 4NV2A 1OAZA 10GSA 1YQ1A 4QL9A 1B48A 5DCGA 1JFUA 1GNEA 2QSIA 1GRXA 4RUVA 2VLUA 1VGLA 4MPGA 4N30A 4XRDA 3CSHA 2CX3A 4E8EA 4FYBA 5JCGA 3ZRDA 1F37A 3BD2A 1SKWB 1GUKA 4KUNA 4PURA 2CV4A 2KP1A 1TOFA 2V32A 2YV9A 3H93A 1SK1A 2EIQA 3HZ8A 2VL9A 3QFAC 1TRUA 3QAGA 2WDUA 3GUSA 4Q5QA 1TTZA 5GAND 2H6YA 2YNXA 2IWTA 1U88A 1AIUA 2H1BA 3D4TA 1USBA 1G6WA 3VWVA 3Q74A 2NVLA 2N5BA 4ZL7A 2XC2A 2OBKA 1ZMAA 5IO2A 1NHYA 4HU7A 3D0ZA 3GSTA 4ECJA 1SD8A 3FYGA 1YF1A 4XS6A 3GTUA 4WEYA 4EE0A 5B8BA 2B5XA 2PUKC 1SU9A 3EVIA 1BAYA 3IXRA 4TXVA 4O5RA 2B5EA 2IMDA 2E7PA 5DQSA 1T3BA 2QC7A 3G7IA 5IOXA 4WBRD 1XOBA 2CT6A 1GTAA 1K3YA 3VI7A 1S3CA 4MPFA 2I1UA 3HJMA 2GVPA 4HZ2A 1M0UA 2R2JA 3A2WA 1N8JA 3H4KA 5C04A 3QPMA 3L9VA 5IPGA 1MD3A 4POMA 1YZXA 4YQVA 1O8WA 5E4WA 1SENA 4G10A 2AB6A 4KAEA 2R6KA 2HZEB 4XRAA 3C8EA 2IN3A 2RUFA 5LD0A 3DEXA 4BPYA 2GSTA 2H0IA 1X9MB 3ME7A 1Q98A 3D6IA 4GCIA 1ML6A 3VFIA 2H74A 5J4UA 4F2IA 1Z3EA 2X64A 5HFIA 2C3QA 1S3AA 4ZL9A 4FYCA 2KOKA 1ZZYA 1OC8A 5HR3A 3F63A 5DAKA 4MJBA 3HA9A 1V98A 5D9XA 3GKNA 2C1YA 3EMPA 5HFKA 5AIXA 2GS3A 1LBKA 2O7KA 1U3IA 1G7OA 2P0GA 3LFLA 2ZNMA 1QXHA 4IJ3A 5EL8A 3L9UA 2WULA 3FHKA 2AUVA 1OE8A 3HVVA 3TB2A 1TK5B 3IR4A 3GSSA 3GX0A 2DIYA 4ZB8A 3UEMA 1KTEA 5KN0A 1PRXA 3IOSA 3GTUB 1PMTA 1TXXA 3JCML 6GSXA 2H76A 3IV4A 1XWAA 1KEBA 1AXDA 3I69A 1OKDA 2VCTA 2VIMA 2J23A 2M72A 2GTUA 2BMXA 3GA4A 4TN8A 4MZCA 3MAKA 1DSBA 1FVJA 4MH2A 1ERTA 2EIRA 1SK0A 3GMFA 4HJ2A 1EOGA 5DJMA 4MZWA 1LU4A 2MMZA 2YWNA 3WGEA 5L71A 3UVTA 3CSIA 4EVMA 5HFGA 2V1MA 4HUAA 4IKHA 3KP9A 1F9MA 2RM6A 5D9VA 4KX4A 5D73A 1QMVA 2K8VA 3ERFA 4NPBA 2E2GA 4MA9A 3EURA 3LQ7A 3EMXA 2LTKA 4O92A 4ZBDA 2DJKA 2GZPA 5D9WA 1C72A 2GGTA 5A4VA 1V57A 3TDGA 1F3AA 4D73B 4V1Ag 1OE7A 2HSYA 2V6KA 4N0VA 1SJZA 2JL4A 4BVYA 2VM1A 5GAPD 3IBHA 4IVFA 2H6XA 2R3XA 4ECIA 1WOUA 3UBLA 1QQ2A 5CNWA 5F0GA 4AJ7A 2N5AA 11GSA 3NIVA 2VO4A 5DAKB 3QD9A 2V2GA 3DWVA 1SL0B 14GSA 5B6NA 2H70A 6GSYA 5GSSA 1YF0A 4E8HA 2LJRA 3VWXA 1J9BA 2VD0A 2H73A 2PGTA 4K0GA 6GSSA 4XS1A 5DDLA 2YOIA 3QAVA 2LJKA 1HNAA 4EF0A 1GLQA 3LORA 1ILOA 4POBA 1ZGNA 3L4NA 1THXA 2YCDA 3OR5A 1U3AA 4GTUA 4HQZA 2YJHA 4V2LA 3LWAA 2DMMA 3VWUA 4WR5A 4KA0A 1K0DA 5HQPA 4ZBAA 3FZ5A 3F3RA 4XCSA 2AYTA 1YKCA 2JU5A 1AQXA 3SWLA 1RQMA 1SJIA 1TK8B 1T8EB 2HE3A 5IMDA 3UJ1A 1T4YA 1FB0A 2HT9A 4V2NA 3DMLA 2LUSA 1ZYQB 3CBUA 3BOAA 2OKAA 3H1NA 5G2ZA 4I97A 4EDYA 4LL4B 8GSSA 1J08A 4OWYA 1M2AA 4PNFA 2ZUPA 3TOUA 1GSFA 3TKSC 4JR4A 4PGTA 5AIVA 4ECBA 4GRFA 5IMVA 4ECCA 4IBPA 1GL8A 2WRTA 5DCHA 5ECIB 2GLRA 4MLYA 4OFMA 13GSA 3IRAA 1Z7RA 5B6MA 3NZNA 4IS0A 2HRFA 3PH9A 2GT6A 2WS2A 3P8WA 2VAFA 3CRTA 1ERVA 2P5RA 3M1GA 4TOPA 2Z9SA 1NM3A 3ZMKA 2GQMA 1URMA 2H0GA 2PPTA 1R5PA 3RPNA 3LYKA 4NMUA 2NBSA 2IMIA 1UN2A 2F8FA 5C00A 4GXZA 4HS1A 2XBIA 3HXSA 1F6MC 2OE3A 2NTOA 2O87A 4EC0A 2CVDA 4J57E 16GSA 3HY2A 3FR3A 3LXZA 1Y6EA 2CQ9A 1K0NA 4HQSA 2H0HA 3J7Yb 2WCIA 3E3EA 5F8BA 2X8GA 4PUFC 4WBJA 5F07A 4BWSA 1GSYA 2C80A 1EP7A 4OFNA 3ZYWA 3A2XA 1OKTA 1MTCA 2H01A 5FT3A 6GSUA 4WF4A 5CRHA 5D9TA 5KN1A 1NSWA 4GF0A 4IGJA 3HDCA 3GYKA 1G6YA 5ECLB 3TRXA 4NV5A 2FCHA 5ID2A 1RK4A 3D4MA 3TCOA 3KEBA 4KCEA 4OCEA 2C3TA 2WGRA 3UIWA 4WF5A 1TP9A 1IYIA 1N2AA 4TR0A 3O6TA 3I43A 4ML6A 2J9HA 3P90A 4V1Ap 5D8IA 2YN1A 4HEA2 1EP8A 5IMFA 3LJRA 3HCZA 4F03A 1XWGA 3TKPA 4IELA 2YWMA 1B9YC 4MK3A 2OE1A 1QUWA 1B8XA 1Q4JA 4F82A 4MJAA 1F3BA 4ZBBA 2L59A 1UVZA 2FA4A 5CYYA 3D5JA 2G0FA 1Z7PA 3C1SA 2JZTA 1XIYA 5D96A 4EXJA 4KSMA 2JSZA 1M2BA 4RI7A 2B6MA 3IK9A 3FK8A 2LQQA 4I8BA 1TDIA 4N11A 1XBSA 5F06A 2GSSA 1F2EA 1R4WA 5F05A 1OC9A 2PMTA 4KW6A 2YZUA 2ES7A 5ECOB 3F3QA 1OVNA 3H79A 1O6JA 5IIZA 1TW9A 3VLNA 2DLXA 5JWRB 2YPMA 3KH9A 2TRCP 2K18A 5ECQB 4O7HA 2GZYA 1QGVA 1PSQA 1ZYEA 5DJLA 4XHMA 1KBNA 3TKSA 2VM2A 4KB3A 4ZXGA 4ISDA 2B3SA 1XZOA 1T7PB 5G5FA 1YDKA 2RM5A 4WKWA 2FWEA 2FD3A 4L0WA 5INYA 1EGRA 4IW9A 2X8CA 1HD2A 4MMMA 2B1LA 3PGTA 5IO0A 5ECHB 4PQIA 1SJ6A 1XW5A 5ID2B 4AJ8A 2OE0A 3LYPA 1GP1A 3EE2A 1O7UA 3HD5A 3O76A 4XS4A 3ED3A 1PX7A 1ZL9A 2REMA 2XPDA 3KMNA 1DE1A 1TRSA 4GQCA 3DYRA 1O73A 2KP2A 2WB9A 4TXOA 4L5OA 5IPHA 4KSOA 3DIEA 5FWGA 3GH9A 4D73A 1PQNA 3KD0A 3ERWA 5ELAA 1BEDA 2XBQA 5CREA 4NHZA 4NAXA 2JSYA 1TRWA 3ZFLA 3GL3A 1MDKA
chains in the Genus database with same CATH superfamily
3F4RA 1BQ7A 5HR0A 2M80A 4K7NA 1A23A 4GWRA 1HNBA 3F0IA 3VI5A 2H66A 5AISA 5J5NA 1T1VA 2L5LA 3TJFA 2B7JA 4MABA 3W8SA 1WP0A 1QFNA 2X4AA 2LRTA 1K3LA 2VD1A 3DGQA 1PN0A 3BJ5A 3FZ9A 5IMCA 4Z2RA 3RPPA 4TVEA 2RIIA 1M3JA 4L0UA 1OC9B 1LJRA 1X0RA 1WJKA 5IOWA 3GFKA 3F8UA 5J9CA 4TW5A 3RBTA 3QDNA 1XFLA 3I6AA 3VPQA 4MDCA 1M9BA 4K7IA 3L78A 4O5UA 3EC3A 4JBBA 3ISOA 1GLPA 2AAWA 4CY6A 1A0FA 1JZDA 3U5RE 4OFTA 1H75A 2L6DA 4KCAA 4EIQA 2H71A 1HQOA 1SKSB 4NXIA 1T4ZA 20GSA 5AGYA 2QGVA 1MDIA 3ZVJD 3D21A 2H75A 2DIZA 1GWCA 1U87A 3ZITA 3UOMA 4GQFA 4XS4B 1Y25A 1ST9A 5EVOA 2LSTA 3W8JA 3LEFA 4Z7XA 1THOA 3IAM2 3HKRA 1R5AA 2R5GA 4TXOB 3K8NA 3L9SA 5B7CA 3TOTA 5CRWA 1WRYA 1MEKA 3M8NA 1GUHA 1X9SB 1A2MA 4KDUA 3F6FA 4OMVA 1FOVA 1Z6MA 2LNSA 4A5PA 3KTBA 4LMWA 2YZHA 4HJMA 2CVBA 2CVKA 4LMVA 2HYXA 3HZ4A 1GSQA 4QQ7A 2A4VA 4IQAA 3CRUA 2DJJA 5ECSA 3ZZXA 3MNGA 4TR3A 5ECKB 5KEJA 5J3RA 4JE1A 1FW1A 2I4AA 3DRNA 4CHSA 1O81A 4FYUA 2V6OA 3KCMA 3IC4A 4J2FA 2MBSA 4CW9A 3RHCA 2H19A 2CZ3A 2PN8A 3GX8A 4AGSA 1TI1A 1JLWA 2GZZA 4X0XA 2MBTA 5IQYA 3IAS2 1XW6A 3DXBA 4RQRA 1EWXA 2X8HA 3KH7A 1SK2A 2FHEA 1XWBA 1XG8A 4I5QA 3L0HA 5AN1A 5IM9A 3FR9A 4ZIJA 5A4WA 2VLTA 2AV4A 3TJBA 1AAZA 2DBCA 1JHBA 1V40A 2CAIA 5LNKe 3M3MA 4G0KA 4TKYA 3GH6A 2HRAA 2D2ZA 2VOCA 3DVXA 1SYRA 4PQHA 5H5QA 1SD9A 4PXOA 2HZFA 5A4UA 4HOJA 1S3RA 4DVCA 3CTGA 1TU7A 2OADA 2PVQA 1BJXA 4PQ1A 4K9ZA 4PX1A 4N0ZA 2DSAA 4H86A 2VCVA 3S9FA 4K1FA 3W6GA 1TK0B 1A2LA 2C8UA 1SL1B 3R2QA 2ON7A 5KN2A 3IA1A 3TKQA 1TJDA 1XOAA 2GSRA 3KIJA 1NHOA 2C0FA 3FMWA 4MH3A 2DMLA 3CYNA 2IPAA 4MF6A 1B4QA 3C1RA 4K6XA 3MYDA 3TKRA 3IHQA 3GURA 2MMOA 3US3A 5EPFA 1E2YA 3HHVA 3MIXA 3LSZA 1X9WB 4KDXA 2GDRA 2BJXA 1TRVA 4AF2A 2ALBA 2L4CA 3CTFA 2C0EA 2B1KA 2R4VA 1YEPA 5CRGA 3ZIVA 2VUPA 2XHFA 2TRXA 3ME8A 1FO5A 2YJ7A 5CAXA 2CAQA 1B9XC 1GH2A 4G9HA 3UBKA 4I6XA 3ZVJA 1JZOA 1H4OA 3G9BA 1Z9HA 2H72A 2MMNA 2HSHA 2JADA 2JZRA 4Z2UA 1PX6A 1ABAA 1HNCA 1K0MA 2A2RA 2DC5A 3ZREA 4ZB6A 2A4HA 3IE3A 4ZL8A 1PL1A 2F51A 2MYGA 3O3TA 3D22A 4JR6A 5KOXA 1JLVA 2ZCTA 3Q18A 4EL1A 5E59A 3GKMA 1M3IA 1M7TA 4WR4A 2F8AA 1XPVA 5DQYA 3LGCA 1KNGA 2QKEA 3GNJA 4MJCA 2JACA 5ABRA 1GUMA 4BL7A 1U6TA 2I3YA 2H8LA 1K3OA 1ZCPA 3P7XA 4PNGA 1VRSD 3C7MA 5HR2A 3GN3A 4JEDA 3VURA 7GSSA 3LXTA 1I5GA 3KMOA 4PUAA 1GTIA 1ERUA 1R7HA 1V2AA 2DKIA 1JZWA 1X5EA 4Z2TA 3A3TA 4ML1A 4QL7A 5DVBA 5CRDA 2B5YA 1PD21 1YY7A 3A5IA 2F9SA 4K5RA 2CA8A 4IN0A 2A2PA 2LEGA 1OC3A 2DJ2A 2OA7A 3QFBC 1PN9A 1M9AA 4DSRA 3M9KA 4TRXA 2C0DA 1RW1A 1GSUA 4G2EA 1V9WA 3KJYA 3PINA 2AHEA 4BA7A 4F9ZA 3G7YA 4HI7A 3WGXA 2YV7A 1K0AA 1VF3A 2FUG2 2KHPA 3DVWA 1FB6A 4OO5A 5LCZA 1DBYA 3DKSA 3FW2A 3ZLPA 5B8AA 6GSTA 4ACSA 4NWYA 4YKGA 3UL3A 3TJJA 4JZQA 2M46A 1YEXA 4YH2A 3UVHA 2WFCA 2AJQB 2EC4A 2NDOA 3QMXA 1GULA 2VL2C 4Q5FA 3VWWA 3AY8A 3BCKA 2FWHA 2BTOT 4OO4A 2K8SA 2HFDA 4POKA 4X4JA 3EYTA 4KNDA 2HNLA 4K0NA 1O8XA 5J41A 1J0FA 1GTUA 4BL7B 3LG6A 4WETA 2P31A 2LJAA 3FKFA 2RLIA 2R37A 1TU8A 2VL3A 1TKDB 2O89A 18GSA 2VLVA 1O85A 1EEJA 4V2MA 3WT2A 5G5EA 4LLRA 3TRPA 3PPUA 2OBIA 2GSQA 1TI3A 3EU4A 2IJYA 5ECRB 5GSTA 3IC8A 3GKXA 3IDVA 3TRQA 1K0CA 5ELGA 5COHA 4ZILA 5GZZB 4HU9A 3FEUA 2E0QA 1GSDA 1HYUA 5DALA 4OD7A 1VF4A 3GL5A 3TGZA 4DSSA 2WZ9A 1WE0A 2FGXA 3FZ4A 4FIWA 1DE2A 3E9JB 2VCQA 4HZ4A 2HRNA 4KGIA 4POLA 3ZFBA 3ZL5A 1CQGA 4O32A 4K7OA 12GSA 4YQUA 22GSA 1M99A 2C0GA 1WPIA 3I9V2 2OACA 2PU9C 2KLXA 1GSEA 5CP1A 4BVXA 4IHUA 3KP8A 3EINA 2L6CA 1SKRB 1XVWA 1YJ6A 4I2TA 2P5QA 3N9JA 3UMAA 3H8QA 2FLSA 2MZCA 3GKKA 1SYXA 2IFQA 1I9DA 3UARA 3F4TA 1XW9A 3F4SA 1A2JA 3ZMLA 2O85A 3VPTA 4KH7A 4DEJA 1WMJA 4IP1A 1K0BA 1W89A 3TJGA 3CXGA 3M9JA 1B4PA 6GSVA 2E2MA 5FHIA 1Z6NA 2H30A 3R3EA 1AQVA 2B7KA 17GSA 4P3YB 3IPZA 1EGOA 1PGTA 3BCIA 1IYHA 4G19A 4Q5NA 4J56E 1W4VA 3KTLA 5JCUA 1PKZA 2IMEA 4I2UA 2G2QA 2L5OA 4AJ6A 1GSSA 2LQOA 2H6ZA 1A8LA 4MZBA 4NHWA 2YWOA 1NW2A 5D93A 3IK7A 3A2VA 2H1GA 4BWQA 1EEMA 5J9BA 1EZKA 4IQ1A 2N5FA 4GLTA 4TR4A 3WT1A 2C4JA 5DALB 1EV4A 1Z5YE 4DSSB 3APOA 3RHBA 3TKSE 2L57A 1XVQA 2HI7A 1A8YA 3BBYA 5CO3A 3M0FA 5H5SA 1XWKA 1K0OA 5JWQB 5JWOB 1FHEA 1X5CA 2VL2A 1VF2A 4KDYA 1AUCA 2FY6A 3HVXA 4JU5A 3KZQA 2NPBA 5DBQA 3C71A 3VK9A 4LL1B 3Q6OA 2CX4A 4CDOA 4BVXB 3ZIJA 1EOHA 2CZ2A 4MP4A 1UA5A 3CSJA 4RI6A 2GQKA 3WD6A 3J7Yk 4KE3A 3WYWA 4GSSA 3C73A 2YANA 2WJUA 4EUYA 4YAPA 1VF1A 4IJIA 2VCZA 4Q5RA 4RQXA 4XTSA 1PL2A 2IFQB 4EDZA 1X5DA 2FWFA 2EIOA 5G30A 1OYJA 1G0TA 2LNTA 3QOUA 4FH8A 3GRXA 1FVKA 2K9FA 4IP6A 5IMAA 2VCXA 5KOWA 4MJEA 3U6VA 4EKZA 2H1DA 1AQWA 1PA3A 2LRNA 2F3MA 4X43A 3TJKA 2LS5A 1ACVA 4TR1A 3APQA 2YP6A 3MWHA 4MF5A 3F6DA 1BYEA 2GT5A 1E6BA 2HXKA 1ERWA 4L5LA 3CMIA 3HJOA 1BG5A 3HVSA 3P2AA 1PKWA 4X1UA 1XWCA 2YWIA 2PWJA 4ILFA 4L8EA 1DUGA 2LKUA 3MSZA 1QK8A 2I81A 2I9HA 4YQMA 5A5KA 2X99A 4HDEA 4N10A 3V1WA 4WXTA 3QCPA 2DJ1A 1T00A 3TUEA 1JZRA 2FNOA 3WGDA 1G7EA 1R26A 1EV9A 3GHAA 4GSTA 1ZOFA 3UAPA 4CY8A 2IL3A 5H5RA 1SL2B 2JZSA 2DJ3A 1WWJA 3Q19A 5IMZA 2L4QA 5JCWA 4OCFA 1FG4A 3ZTLA 3HJPA 3F9UA 3DD3A 4GSNA 3QR6A 2LRCA 2TIRA 1BX9A 4PTSA 4G0IA 3FY7A 4MF7A 4MCUA 2C3NA 5G1LA 2FWGA 4LA1A 3EU3A 1MDJA 2KUCA 3RDWA 1V58A 4YAVA 1CQHA 2RUEA 1GNWA 1AW9A 2A2SA 3SBCA 5G1KA 3FRCA 2PVOC 3FR6A 5G31A 1MD4A 3EWLA 5HR1A 2VCWA 4K2DA 3G7JA 3MDKA 4F0BA 1S3DA 3GV1A 2FA8A 5KN3A 1FAAA 4K5SA 2MMAA 2HLSA 1ON4A 4K8MA 3FZAA 2IMFA 4F0CA 9GSSA 4EO3A 4TR1B 4ZB9A 3PR8A 3NOFA 19GSA 2IIYA 5EY6A 5ECNB 1XCCA 5ECPB 4BIKA 1XXUA 2PBJA 1A0RP 3N5OA 4JRRA 5ECMB 2XPEA 3E0UA 3KXOA 2K6VA 4ULXA 1A24A 2IMKA 3EPTA 2DJ0A 3KM6A 3RAZA 3GIXA 1M2DA 2HZEA 2UZ8A 1GTBA 3ERGA 3HYPA 5ENUA 2ON5A 1AC1A 2O8VB 1UC7A 2V41A 4XIHA 3A5WA 6GSWA 3CQFA 1WIKA 2LV3A 2OJLA 4FO5A 3KGKA 3QAWA 2H1AA 2GQLA 3APSA 4ID0A 2PERA 4DSQA 1YKAA 4NV2A 1OAZA 10GSA 1YQ1A 4QL9A 1B48A 5DCGA 1JFUA 1GNEA 2QSIA 1GRXA 4RUVA 2VLUA 1VGLA 4MPGA 4N30A 4XRDA 3CSHA 2CX3A 4E8EA 4FYBA 5JCGA 3ZRDA 1F37A 3BD2A 1SKWB 1GUKA 4KUNA 4PURA 2CV4A 2KP1A 1TOFA 2V32A 2YV9A 3H93A 1SK1A 2EIQA 3HZ8A 2VL9A 3QFAC 1TRUA 3QAGA 2WDUA 3GUSA 4Q5QA 4HSCX 1TTZA 5GAND 2H6YA 2YNXA 2IWTA 1U88A 1AIUA 2H1BA 3D4TA 1USBA 1G6WA 3VWVA 3Q74A 2NVLA 2N5BA 4ZL7A 2XC2A 2OBKA 1ZMAA 5IO2A 1NHYA 4HU7A 3D0ZA 3GSTA 4ECJA 1SD8A 3FYGA 1YF1A 4XS6A 3GTUA 4WEYA 4EE0A 5B8BA 2B5XA 2PUKC 1SU9A 3EVIA 1BAYA 3IXRA 4TXVA 4O5RA 2B5EA 2IMDA 2E7PA 5DQSA 1T3BA 2QC7A 3G7IA 5IOXA 4WBRD 1XOBA 2CT6A 1GTAA 1K3YA 3VI7A 1S3CA 4MPFA 2I1UA 3HJMA 2GVPA 4HZ2A 1M0UA 2R2JA 3A2WA 1N8JA 3H4KA 5C04A 3QPMA 3L9VA 5IPGA 1MD3A 4POMA 1YZXA 4YQVA 1O8WA 5E4WA 1SENA 4G10A 2AB6A 4KAEA 2R6KA 2HZEB 4XRAA 2R0GA 3C8EA 2IN3A 2RUFA 5LD0A 3DEXA 4BPYA 2GSTA 2H0IA 1X9MB 3ME7A 1Q98A 3D6IA 4GCIA 1ML6A 3VFIA 2H74A 5J4UA 4F2IA 1Z3EA 2X64A 5HFIA 2C3QA 1S3AA 4ZL9A 4FYCA 2KOKA 1ZZYA 1OC8A 5HR3A 3F63A 5DAKA 4MJBA 3HA9A 1V98A 5D9XA 3GKNA 2C1YA 3EMPA 5HFKA 5AIXA 2GS3A 1LBKA 2O7KA 1U3IA 1G7OA 2P0GA 3LFLA 2ZNMA 1QXHA 4IJ3A 5EL8A 3L9UA 2WULA 3FHKA 2AUVA 1OE8A 3HVVA 3TB2A 1TK5B 3IR4A 3GSSA 3GX0A 2DIYA 4ZB8A 3UEMA 1KTEA 5KN0A 1PRXA 3IOSA 3GTUB 2QA1A 1PMTA 1TXXA 2HSMA 3JCML 6GSXA 2H76A 3IV4A 1XWAA 3HVNA 1KEBA 1AXDA 3I69A 1OKDA 2VCTA 2VIMA 2J23A 2M72A 2GTUA 2BMXA 3GA4A 4TN8A 4MZCA 3MAKA 1DSBA 1FVJA 4MH2A 1ERTA 2EIRA 1SK0A 2QA2A 3GMFA 1EOGA 4HJ2A 5DJMA 4MZWA 1LU4A 2MMZA 2YWNA 3WGEA 5L71A 3UVTA 3CSIA 4EVMA 5HFGA 2V1MA 4HUAA 4IKHA 3KP9A 1F9MA 2RM6A 5D9VA 4KF9A 4KX4A 5D73A 1QMVA 2K8VA 3ERFA 4NPBA 2E2GA 4MA9A 3EURA 3LQ7A 3EMXA 2LTKA 4O92A 4ZBDA 2DJKA 2GZPA 5D9WA 1C72A 2GGTA 5A4VA 1V57A 3TDGA 1F3AA 4D73B 4V1Ag 1OE7A 2HSYA 2V6KA 4N0VA 1SJZA 2JL4A 4BVYA 2VM1A 5GAPD 3IBHA 1FOHA 4IVFA 2H6XA 2R3XA 4ECIA 1WOUA 3UBLA 1QQ2A 5CNWA 5F0GA 4AJ7A 2N5AA 3IHGA 11GSA 3NIVA 2VO4A 5DAKB 3QD9A 2V2GA 3DWVA 1SL0B 14GSA 5B6NA 2H70A 6GSYA 5GSSA 1YF0A 4E8HA 2LJRA 3VWXA 1J9BA 2VD0A 2H73A 2PGTA 4K0GA 6GSSA 4XS1A 5DDLA 2YOIA 3QAVA 2LJKA 1HNAA 4EF0A 1GLQA 3LORA 1ILOA 4POBA 1ZGNA 3L4NA 1THXA 2YCDA 3OR5A 1U3AA 4GTUA 5BRTA 4HQZA 2YJHA 4V2LA 3LWAA 2DMMA 3VWUA 4WR5A 4KA0A 1K0DA 5HQPA 4ZBAA 3FZ5A 3F3RA 4XCSA 2AYTA 1YKCA 2JU5A 1AQXA 3SWLA 1RQMA 1SJIA 1TK8B 1T8EB 2HE3A 5IMDA 3UJ1A 1T4YA 1FB0A 2HT9A 4V2NA 3DMLA 2LUSA 1ZYQB 3CBUA 3BOAA 2OKAA 3H1NA 2R0CA 5BMUA 5G2ZA 4I97A 4EDYA 4LL4B 8GSSA 1J08A 4OWYA 1M2AA 4PNFA 2ZUPA 3TOUA 1GSFA 3TKSC 4JR4A 4PGTA 5AIVA 4BVYB 4ECBA 4GRFA 5IMVA 4ECCA 4IBPA 1GL8A 2WRTA 5DCHA 5ECIB 2GLRA 4MLYA 4OFMA 13GSA 3IRAA 1Z7RA 5B6MA 3NZNA 4IS0A 2HRFA 3PH9A 2GT6A 2WS2A 3P8WA 2VAFA 3CRTA 1ERVA 2P5RA 3M1GA 4TOPA 2Z9SA 1NM3A 3ZMKA 1PFOA 2GQMA 1URMA 2H0GA 2PPTA 1R5PA 3RPNA 3LYKA 4NMUA 2NBSA 2IMIA 1UN2A 2F8FA 5C00A 4GXZA 4HS1A 2XBIA 3HXSA 1F6MC 2OE3A 2NTOA 2O87A 4EC0A 2CVDA 4MNNA 4YKFA 4J57E 16GSA 3HY2A 3FR3A 3LXZA 4USSA 1Y6EA 2CQ9A 1K0NA 4HQSA 2H0HA 3J7Yb 2WCIA 3E3EA 5F8BA 2X8GA 4PUFC 4WBJA 5F07A 4BWSA 1GSYA 2C80A 4FQUA 1EP7A 4OFNA 3ZYWA 3A2XA 2X49A 1OKTA 1MTCA 2H01A 5FT3A 6GSUA 4WF4A 5CRHA 5D9TA 4EIPA 5KN1A 1NSWA 4GF0A 2HRKA 2R0PA 4IGJA 3HDCA 3GYKA 1G6YA 5ECLB 3TRXA 4NV5A 2FCHA 4ICYA 5ID2A 2DKHA 1RK4A 3D4MA 3TCOA 3KEBA 4KCEA 4OCEA 2C3TA 2WGRA 3UIWA 4WF5A 1TP9A 1IYIA 1N2AA 4TR0A 3O6TA 3I43A 4ML6A 2J9HA 3P90A 4V1Ap 5D8IA 2YN1A 4HEA2 1EP8A 5IMFA 3LJRA 3HCZA 3LW9A 4F03A 1XWGA 3TKPA 4IELA 2YWMA 1B9YC 4MK3A 2OE1A 1QUWA 1B8XA 1Q4JA 4F82A 4MJAA 1F3BA 4ZBBA 2L59A 1UVZA 2FA4A 5CYYA 4O5QA 1ZYPA 3D5JA 2G0FA 1Z7PA 3C1SA 2JZTA 1XIYA 5D96A 4EXJA 4KSMA 2JSZA 1M2BA 4RI7A 2B6MA 3IK9A 3FK8A 2LQQA 4I8BA 1TDIA 4N11A 1XBSA 5F06A 2GSSA 1F2EA 1R4WA 5F05A 1OC9A 2PMTA 4KW6A 2YZUA 2ES7A 5ECOB 3F3QA 1OVNA 3H79A 1O6JA 5IIZA 1TW9A 3VLNA 2DLXA 5JWRB 2YPMA 3KH9A 2TRCP 2K18A 5ECQB 4O7HA 2GZYA 1QGVA 1PSQA 1ZYEA 5DJLA 4XHMA 1KBNA 3TKSA 2VM2A 4KB3A 4ZXGA 4ISDA 2B3SA 1XZOA 1T7PB 5G5FA 1YDKA 2RM5A 4WKWA 2FWEA 2FD3A 4L0WA 5INYA 1EGRA 4IW9A 2X8CA 4K2XA 1HD2A 4MMMA 2B1LA 3PGTA 5IO0A 5ECHB 4PQIA 1SJ6A 1XW5A 5ID2B 4AJ8A 2OE0A 3LYPA 1GP1A 3EE2A 1O7UA 3HD5A 3O76A 4XS4A 3ED3A 1PX7A 1ZL9A 2REMA 2XPDA 3KMNA 1DE1A 1TRSA 4GQCA 3DYRA 1O73A 1ZYNA 2KP2A 2WB9A 4TXOA 4L5OA 5IPHA 4KSOA 3DIEA 5FWGA 3GH9A 4D73A 1PQNA 3KD0A 3ERWA 5ELAA 1BEDA 2XBQA 5CREA 4NHZA 4NAXA 4G0LA 2JSYA 1TRWA 3ZFLA 3GL3A 1MDKA
chains in the Genus database with same CATH topology
3F4RA 1BQ7A 5HR0A 2M80A 4K7NA 1A23A 4GWRA 1HNBA 3F0IA 3VI5A 2H66A 5AISA 5J5NA 1T1VA 2L5LA 3TJFA 2B7JA 4MABA 3W8SA 1WP0A 1QFNA 2X4AA 2LRTA 1K3LA 2VD1A 3DGQA 1PN0A 3BJ5A 3FZ9A 5IMCA 4Z2RA 3RPPA 4TVEA 2RIIA 4L0UA 1OC9B 1LJRA 1X0RA 1WJKA 5IOWA 3GFKA 3F8UA 5J9CA 4TW5A 3RBTA 3QDNA 1XFLA 3I6AA 3VPQA 4MDCA 1M9BA 4K7IA 3L78A 4O5UA 3EC3A 4JBBA 3ISOA 1GLPA 2AAWA 4CY6A 1A0FA 1JZDA 3U5RE 4OFTA 1H75A 2L6DA 4KCAA 4EIQA 2H71A 1HQOA 1SKSB 4NXIA 1T4ZA 20GSA 5AGYA 2QGVA 1MDIA 3ZVJD 3D21A 2H75A 2DIZA 1GWCA 1U87A 3ZITA 3UOMA 4GQFA 4XS4B 1Y25A 1ST9A 5EVOA 2LSTA 3W8JA 3LEFA 4Z7XA 1THOA 3IAM2 3HKRA 1R5AA 2R5GA 4TXOB 3K8NA 3L9SA 5B7CA 3TOTA 5CRWA 1WRYA 1MEKA 3M8NA 1GUHA 1X9SB 1A2MA 4KDUA 3F6FA 4OMVA 1FOVA 1Z6MA 2LNSA 4A5PA 3KTBA 4LMWA 2YZHA 4HJMA 2CVBA 2CVKA 4LMVA 2HYXA 3HZ4A 1GSQA 4QQ7A 2A4VA 4IQAA 3CRUA 2DJJA 5ECSA 3ZZXA 3MNGA 4TR3A 5ECKB 5KEJA 5J3RA 4JE1A 1FW1A 2I4AA 3DRNA 4CHSA 1O81A 4FYUA 2V6OA 3KCMA 3IC4A 4J2FA 2MBSA 4CW9A 3RHCA 2H19A 2CZ3A 2PN8A 3GX8A 4AGSA 1TI1A 1JLWA 2GZZA 4X0XA 2MBTA 5IQYA 3IAS2 1XW6A 3DXBA 4RQRA 1EWXA 2X8HA 3KH7A 1SK2A 2FHEA 1XWBA 4I5QA 3L0HA 5AN1A 5IM9A 3FR9A 4ZIJA 5A4WA 2VLTA 2AV4A 3TJBA 1AAZA 2DBCA 1JHBA 1V40A 2CAIA 5LNKe 3M3MA 4G0KA 4TKYA 3GH6A 2HRAA 2D2ZA 2VOCA 3DVXA 1SYRA 4PQHA 5H5QA 1SD9A 4PXOA 2HZFA 5A4UA 4HOJA 4DVCA 3CTGA 1TU7A 2OADA 2PVQA 1BJXA 4PQ1A 4K9ZA 4PX1A 4N0ZA 2DSAA 4H86A 2VCVA 3S9FA 4K1FA 3W6GA 1TK0B 1A2LA 2C8UA 1SL1B 3R2QA 2ON7A 5KN2A 3IA1A 3TKQA 1TJDA 1XOAA 2GSRA 3KIJA 1NHOA 2C0FA 3FMWA 4MH3A 2DMLA 3CYNA 2IPAA 4MF6A 1B4QA 3C1RA 4K6XA 3MYDA 3TKRA 3IHQA 3GURA 2MMOA 3US3A 5EPFA 1E2YA 3HHVA 3MIXA 3LSZA 1X9WB 4KDXA 2GDRA 2BJXA 1TRVA 4AF2A 2ALBA 2L4CA 3CTFA 2C0EA 2B1KA 2R4VA 1YEPA 5CRGA 3ZIVA 2VUPA 2XHFA 2TRXA 3ME8A 1FO5A 2YJ7A 5CAXA 2CAQA 1B9XC 1GH2A 4G9HA 3UBKA 4I6XA 3ZVJA 1JZOA 1H4OA 3G9BA 1Z9HA 2H72A 2MMNA 2HSHA 2JADA 2JZRA 4Z2UA 1PX6A 1ABAA 1HNCA 1K0MA 2A2RA 2DC5A 3ZREA 4ZB6A 2A4HA 3IE3A 4ZL8A 1PL1A 2F51A 2MYGA 3O3TA 3D22A 4JR6A 5KOXA 1JLVA 2ZCTA 3Q18A 4EL1A 5E59A 3GKMA 1M7TA 4WR4A 2F8AA 1XPVA 5DQYA 3LGCA 1KNGA 2QKEA 3GNJA 4MJCA 2JACA 5ABRA 1GUMA 4BL7A 1U6TA 2I3YA 2H8LA 1K3OA 1ZCPA 3P7XA 4PNGA 1VRSD 3C7MA 5HR2A 3GN3A 4JEDA 3VURA 7GSSA 3LXTA 1I5GA 3KMOA 4PUAA 1GTIA 1ERUA 1R7HA 1V2AA 2DKIA 1JZWA 1X5EA 4Z2TA 3A3TA 4ML1A 4QL7A 5DVBA 5CRDA 2B5YA 1PD21 1YY7A 3A5IA 2F9SA 4K5RA 2CA8A 4IN0A 2A2PA 2LEGA 1OC3A 2DJ2A 2OA7A 3QFBC 1PN9A 1M9AA 4DSRA 3M9KA 4TRXA 2C0DA 1RW1A 1GSUA 4G2EA 1V9WA 3KJYA 3PINA 2AHEA 4BA7A 4F9ZA 3G7YA 4HI7A 3WGXA 2YV7A 1K0AA 1VF3A 2FUG2 2KHPA 3DVWA 1FB6A 4OO5A 5LCZA 1DBYA 3DKSA 3FW2A 3ZLPA 5B8AA 6GSTA 4ACSA 4NWYA 4YKGA 3UL3A 3TJJA 4JZQA 2M46A 1YEXA 4YH2A 3UVHA 2WFCA 2AJQB 2EC4A 2NDOA 3QMXA 1GULA 2VL2C 4Q5FA 3VWWA 3AY8A 3BCKA 2FWHA 2BTOT 4OO4A 2K8SA 2HFDA 4POKA 4X4JA 3EYTA 4KNDA 2HNLA 4K0NA 1O8XA 5J41A 1J0FA 1GTUA 4BL7B 3LG6A 4WETA 2P31A 2LJAA 3FKFA 2RLIA 2R37A 1TU8A 2VL3A 1TKDB 2O89A 18GSA 2VLVA 1O85A 1EEJA 4V2MA 3WT2A 5G5EA 4LLRA 3TRPA 3PPUA 2OBIA 2GSQA 1TI3A 3EU4A 2IJYA 5ECRB 5GSTA 3IC8A 3GKXA 3IDVA 3TRQA 1K0CA 5ELGA 5COHA 4ZILA 5GZZB 4HU9A 3FEUA 2E0QA 1GSDA 1HYUA 5DALA 4OD7A 1VF4A 3GL5A 3TGZA 4DSSA 2WZ9A 1WE0A 2FGXA 3FZ4A 4FIWA 1DE2A 3E9JB 2VCQA 4HZ4A 2HRNA 4KGIA 4POLA 3ZFBA 3ZL5A 1CQGA 4O32A 4K7OA 12GSA 4YQUA 22GSA 1M99A 2C0GA 1WPIA 3I9V2 2OACA 2PU9C 2KLXA 1GSEA 5CP1A 4BVXA 4IHUA 3KP8A 3EINA 2L6CA 1SKRB 1XVWA 1YJ6A 4I2TA 2P5QA 3N9JA 3UMAA 3H8QA 2FLSA 2MZCA 3GKKA 1SYXA 2IFQA 1I9DA 3UARA 3F4TA 1XW9A 3F4SA 1A2JA 3ZMLA 2O85A 3VPTA 4KH7A 4DEJA 1WMJA 4IP1A 1K0BA 1W89A 3TJGA 3CXGA 3M9JA 1B4PA 6GSVA 2E2MA 5FHIA 1Z6NA 2H30A 3R3EA 1AQVA 2B7KA 17GSA 4P3YB 3IPZA 1EGOA 1PGTA 3BCIA 1IYHA 4G19A 4Q5NA 4J56E 1W4VA 3KTLA 5JCUA 1PKZA 2IMEA 4I2UA 2G2QA 2L5OA 4AJ6A 1GSSA 2LQOA 2H6ZA 1A8LA 4MZBA 4NHWA 2YWOA 1NW2A 5D93A 3IK7A 3A2VA 2H1GA 4BWQA 1EEMA 5J9BA 1EZKA 4IQ1A 2N5FA 4GLTA 4TR4A 3WT1A 2C4JA 5DALB 1EV4A 1Z5YE 4DSSB 3APOA 3RHBA 3TKSE 2L57A 1XVQA 2HI7A 1A8YA 3BBYA 5CO3A 3M0FA 5H5SA 1XWKA 1K0OA 5JWQB 5JWOB 1FHEA 1X5CA 2VL2A 1VF2A 4KDYA 1AUCA 2FY6A 3HVXA 4JU5A 3KZQA 2NPBA 5DBQA 3C71A 3VK9A 4LL1B 3Q6OA 2CX4A 4CDOA 4BVXB 3ZIJA 1EOHA 2CZ2A 4MP4A 1UA5A 3CSJA 4RI6A 2GQKA 3WD6A 3J7Yk 4KE3A 3WYWA 4GSSA 3C73A 2YANA 2WJUA 4EUYA 4YAPA 1VF1A 4IJIA 2VCZA 4Q5RA 4RQXA 4XTSA 1PL2A 2IFQB 4EDZA 1X5DA 2FWFA 2EIOA 5G30A 1OYJA 1G0TA 2LNTA 3QOUA 4FH8A 3GRXA 1FVKA 2K9FA 4IP6A 5IMAA 2VCXA 5KOWA 4MJEA 3U6VA 4EKZA 2H1DA 1AQWA 1PA3A 2LRNA 2F3MA 4X43A 3TJKA 2LS5A 1ACVA 4TR1A 3APQA 2YP6A 3MWHA 4MF5A 3F6DA 1BYEA 2GT5A 1E6BA 2HXKA 1ERWA 4L5LA 3CMIA 3HJOA 1BG5A 3HVSA 3P2AA 1PKWA 4X1UA 1XWCA 2YWIA 2PWJA 4ILFA 4L8EA 1DUGA 2LKUA 3MSZA 1QK8A 2I81A 2I9HA 4YQMA 5A5KA 2X99A 4HDEA 4N10A 3V1WA 4WXTA 3QCPA 2DJ1A 1T00A 3TUEA 1JZRA 2FNOA 3WGDA 1G7EA 1R26A 1EV9A 3GHAA 4GSTA 1ZOFA 3UAPA 4CY8A 2IL3A 5H5RA 1SL2B 2JZSA 2DJ3A 1WWJA 3Q19A 5IMZA 2L4QA 5JCWA 4OCFA 1FG4A 3ZTLA 3HJPA 3F9UA 3DD3A 4GSNA 3QR6A 2LRCA 2TIRA 1BX9A 4PTSA 4G0IA 3FY7A 4MF7A 4MCUA 2C3NA 5G1LA 2FWGA 4LA1A 3EU3A 1MDJA 2KUCA 3RDWA 1V58A 4YAVA 1CQHA 2RUEA 1GNWA 1AW9A 2A2SA 3SBCA 5G1KA 3FRCA 2PVOC 3FR6A 5G31A 1MD4A 3EWLA 5HR1A 2VCWA 4K2DA 3G7JA 3MDKA 4F0BA 1S3DA 3GV1A 2FA8A 5KN3A 1FAAA 4K5SA 2MMAA 2HLSA 1ON4A 4K8MA 3FZAA 2IMFA 4F0CA 9GSSA 4EO3A 4TR1B 4ZB9A 3PR8A 3NOFA 19GSA 2IIYA 5EY6A 5ECNB 1XCCA 5ECPB 1XXUA 2PBJA 1A0RP 3N5OA 4JRRA 5ECMB 2XPEA 3E0UA 3KXOA 2K6VA 4ULXA 1A24A 2IMKA 3EPTA 2DJ0A 3KM6A 3RAZA 3GIXA 1M2DA 2HZEA 2UZ8A 1GTBA 3ERGA 3HYPA 5ENUA 2ON5A 1AC1A 2O8VB 1UC7A 2V41A 4XIHA 3A5WA 6GSWA 1WIKA 2LV3A 2OJLA 4FO5A 3KGKA 3QAWA 2H1AA 2GQLA 3APSA 4ID0A 2PERA 4DSQA 1YKAA 4NV2A 1OAZA 10GSA 1YQ1A 4QL9A 1B48A 5DCGA 1JFUA 1GNEA 2QSIA 1GRXA 4RUVA 2VLUA 1VGLA 4MPGA 4N30A 4XRDA 3CSHA 2CX3A 4E8EA 4FYBA 5JCGA 3ZRDA 1F37A 3BD2A 1SKWB 1GUKA 4KUNA 4PURA 2CV4A 2KP1A 1TOFA 2V32A 2YV9A 3H93A 1SK1A 2EIQA 3HZ8A 2VL9A 3QFAC 1TRUA 3QAGA 2WDUA 3GUSA 4Q5QA 1TTZA 5GAND 2H6YA 2YNXA 2IWTA 1U88A 1AIUA 2H1BA 3D4TA 1USBA 1G6WA 3VWVA 3Q74A 2NVLA 2N5BA 4ZL7A 2XC2A 2OBKA 1ZMAA 5IO2A 1NHYA 4HU7A 3D0ZA 3GSTA 4ECJA 1SD8A 3FYGA 1YF1A 4XS6A 3GTUA 4WEYA 4EE0A 5B8BA 2B5XA 2PUKC 1SU9A 3EVIA 1BAYA 3IXRA 4TXVA 4O5RA 2B5EA 2IMDA 2E7PA 5DQSA 1T3BA 2QC7A 3G7IA 5IOXA 4WBRD 1XOBA 2CT6A 1GTAA 1K3YA 3VI7A 1S3CA 4MPFA 2I1UA 3HJMA 2GVPA 4HZ2A 1M0UA 2R2JA 3A2WA 1N8JA 3H4KA 5C04A 3QPMA 3L9VA 5IPGA 1MD3A 4POMA 1YZXA 4YQVA 1O8WA 5E4WA 1SENA 4G10A 2AB6A 4KAEA 2R6KA 2HZEB 4XRAA 2R0GA 3C8EA 2IN3A 2RUFA 5LD0A 3DEXA 4BPYA 2GSTA 2H0IA 1X9MB 3ME7A 1Q98A 3D6IA 4GCIA 1ML6A 3VFIA 2H74A 5J4UA 4F2IA 1Z3EA 2X64A 5HFIA 2C3QA 1S3AA 4ZL9A 4FYCA 2KOKA 1ZZYA 1OC8A 5HR3A 3F63A 5DAKA 4MJBA 3HA9A 1V98A 5D9XA 3GKNA 2C1YA 3EMPA 5HFKA 5AIXA 2GS3A 1LBKA 2O7KA 1U3IA 1G7OA 2P0GA 3LFLA 2ZNMA 1QXHA 4IJ3A 5EL8A 3L9UA 2WULA 3FHKA 2AUVA 1OE8A 3HVVA 3TB2A 1TK5B 3IR4A 3GSSA 3GX0A 2DIYA 4ZB8A 3UEMA 1KTEA 5KN0A 1PRXA 3IOSA 3GTUB 2QA1A 1PMTA 1TXXA 2HSMA 3JCML 6GSXA 2H76A 3IV4A 1XWAA 1KEBA 1AXDA 3I69A 1OKDA 2VCTA 2VIMA 2J23A 2M72A 2GTUA 2BMXA 3GA4A 4TN8A 4MZCA 3MAKA 1DSBA 1FVJA 4MH2A 1ERTA 2EIRA 1SK0A 2QA2A 3GMFA 1EOGA 4HJ2A 5DJMA 4MZWA 1LU4A 2MMZA 2YWNA 3WGEA 5L71A 3UVTA 3CSIA 4EVMA 5HFGA 2V1MA 4HUAA 4IKHA 3KP9A 1F9MA 2RM6A 5D9VA 4KF9A 4KX4A 5D73A 1QMVA 2K8VA 3ERFA 4NPBA 2E2GA 4MA9A 3EURA 3LQ7A 3EMXA 2LTKA 4O92A 4ZBDA 2DJKA 2GZPA 5D9WA 1C72A 2GGTA 5A4VA 1V57A 3TDGA 1F3AA 4D73B 4V1Ag 1OE7A 2HSYA 2V6KA 4N0VA 1SJZA 2JL4A 4BVYA 2VM1A 5GAPD 3IBHA 1FOHA 4IVFA 2H6XA 2R3XA 4ECIA 1WOUA 3UBLA 1QQ2A 5CNWA 5F0GA 4AJ7A 2N5AA 3IHGA 11GSA 3NIVA 2VO4A 5DAKB 3QD9A 2V2GA 3DWVA 1SL0B 14GSA 5B6NA 2H70A 6GSYA 5GSSA 1YF0A 4E8HA 2LJRA 3VWXA 1J9BA 2VD0A 2H73A 2PGTA 4K0GA 6GSSA 4XS1A 5DDLA 2YOIA 3QAVA 2LJKA 1HNAA 4EF0A 1GLQA 3LORA 1ILOA 4POBA 1ZGNA 3L4NA 1THXA 2YCDA 3OR5A 1U3AA 4GTUA 5BRTA 4HQZA 2YJHA 4V2LA 3LWAA 2DMMA 3VWUA 4WR5A 4KA0A 1K0DA 5HQPA 4ZBAA 3FZ5A 3F3RA 4XCSA 2AYTA 1YKCA 2JU5A 1AQXA 3SWLA 1RQMA 1SJIA 1TK8B 1T8EB 2HE3A 5IMDA 3UJ1A 1T4YA 1FB0A 2HT9A 4V2NA 3DMLA 2LUSA 1ZYQB 3CBUA 3BOAA 2OKAA 3H1NA 2R0CA 5BMUA 5G2ZA 4I97A 4EDYA 4LL4B 8GSSA 1J08A 4OWYA 1M2AA 4PNFA 2ZUPA 3TOUA 1GSFA 3TKSC 4JR4A 4PGTA 5AIVA 4BVYB 4ECBA 4GRFA 5IMVA 4ECCA 4IBPA 1GL8A 2WRTA 5DCHA 5ECIB 2GLRA 4MLYA 4OFMA 13GSA 3IRAA 1Z7RA 5B6MA 3NZNA 4IS0A 2HRFA 3PH9A 2GT6A 2WS2A 3P8WA 2VAFA 3CRTA 1ERVA 2P5RA 3M1GA 4TOPA 2Z9SA 1NM3A 3ZMKA 2GQMA 1URMA 2H0GA 2PPTA 1R5PA 3RPNA 3LYKA 4NMUA 2NBSA 2IMIA 1UN2A 2F8FA 5C00A 4GXZA 4HS1A 2XBIA 3HXSA 1F6MC 2OE3A 2NTOA 2O87A 4EC0A 2CVDA 4MNNA 4YKFA 4J57E 16GSA 3HY2A 3FR3A 3LXZA 4USSA 1Y6EA 2CQ9A 1K0NA 4HQSA 2H0HA 3J7Yb 2WCIA 3E3EA 5F8BA 2X8GA 4PUFC 4WBJA 5F07A 4BWSA 1GSYA 2C80A 4FQUA 1EP7A 4OFNA 3ZYWA 3A2XA 2X49A 1OKTA 1MTCA 2H01A 5FT3A 6GSUA 4WF4A 5CRHA 5D9TA 4EIPA 5KN1A 1NSWA 4GF0A 2HRKA 2R0PA 4IGJA 3HDCA 3GYKA 1G6YA 5ECLB 3TRXA 4NV5A 2FCHA 4ICYA 5ID2A 2DKHA 1RK4A 3D4MA 3TCOA 3KEBA 4KCEA 4OCEA 2C3TA 2WGRA 3UIWA 4WF5A 1TP9A 1IYIA 1N2AA 4TR0A 3O6TA 3I43A 4ML6A 2J9HA 3P90A 4V1Ap 5D8IA 2YN1A 4HEA2 1EP8A 5IMFA 3LJRA 3HCZA 3LW9A 4F03A 1XWGA 3TKPA 4IELA 2YWMA 1B9YC 4MK3A 2OE1A 1QUWA 1B8XA 1Q4JA 4F82A 4MJAA 1F3BA 4ZBBA 2L59A 1UVZA 2FA4A 5CYYA 4O5QA 1ZYPA 3D5JA 2G0FA 1Z7PA 3C1SA 2JZTA 1XIYA 5D96A 4EXJA 4KSMA 2JSZA 1M2BA 4RI7A 2B6MA 3IK9A 3FK8A 2LQQA 4I8BA 1TDIA 4N11A 1XBSA 5F06A 2GSSA 1F2EA 1R4WA 5F05A 1OC9A 2PMTA 4KW6A 2YZUA 2ES7A 5ECOB 3F3QA 1OVNA 3H79A 1O6JA 5IIZA 1TW9A 3VLNA 2DLXA 5JWRB 2YPMA 3KH9A 2TRCP 2K18A 5ECQB 4O7HA 2GZYA 1QGVA 1PSQA 1ZYEA 5DJLA 4XHMA 1KBNA 3TKSA 2VM2A 4KB3A 4ZXGA 4ISDA 2B3SA 1XZOA 1T7PB 5G5FA 1YDKA 2RM5A 4WKWA 2FWEA 2FD3A 4L0WA 5INYA 1EGRA 4IW9A 2X8CA 4K2XA 1HD2A 4MMMA 2B1LA 3PGTA 5IO0A 5ECHB 4PQIA 1SJ6A 1XW5A 5ID2B 4AJ8A 2OE0A 3LYPA 1GP1A 3EE2A 1O7UA 3HD5A 3O76A 4XS4A 3ED3A 1PX7A 1ZL9A 2REMA 2XPDA 3KMNA 1DE1A 1TRSA 4GQCA 3DYRA 1O73A 1ZYNA 2KP2A 2WB9A 4TXOA 4L5OA 5IPHA 4KSOA 3DIEA 5FWGA 3GH9A 4D73A 1PQNA 3KD0A 3ERWA 5ELAA 1BEDA 2XBQA 5CREA 4NHZA 4NAXA 4G0LA 2JSYA 1TRWA 3ZFLA 3GL3A 1MDKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F4R A;  1BQ7 A;  5HR0 A;  2M80 A;  4K7N A;  1A23 A;  4GWR A;  1HNB A;  3F0I A;  3VI5 A;  2H66 A;  5AIS A;  5J5N A;  1T1V A;  2L5L A;  3TJF A;  2B7J A;  4MAB A;  3W8S A;  1WP0 A;  1QFN A;  2LRT A;  1K3L A;  2VD1 A;  3DGQ A;  3BJ5 A;  3FZ9 A;  5IMC A;  3RPP A;  4TVE A;  2RII A;  4L0U A;  1OC9 B;  1LJR A;  1X0R A;  1WJK A;  5IOW A;  3GFK A;  3F8U A;  5J9C A;  4TW5 A;  3RBT A;  3QDN A;  1XFL A;  3I6A A;  3VPQ A;  4MDC A;  1M9B A;  4K7I A;  3L78 A;  3EC3 A;  4JBB A;  3ISO A;  1GLP A;  2AAW A;  1A0F A;  1JZD A;  3U5R E;  4OFT A;  1H75 A;  2L6D A;  4KCA A;  2H71 A;  1HQO A;  1SKS B;  4NXI A;  1T4Z A;  20GS A;  5AGY A;  2QGV A;  1MDI A;  3ZVJ D;  3D21 A;  2H75 A;  2DIZ A;  1GWC A;  1U87 A;  3ZIT A;  3UOM A;  4GQF A;  4XS4 B;  1Y25 A;  1ST9 A;  5EVO A;  2LST A;  3W8J A;  3LEF A;  4Z7X A;  1THO A;  3IAM 2;  3HKR A;  1R5A A;  2R5G A;  4TXO B;  3K8N A;  3L9S A;  5B7C A;  3TOT A;  5CRW A;  1WRY A;  1MEK A;  3M8N A;  1GUH A;  1X9S B;  1A2M A;  4KDU A;  3F6F A;  4OMV A;  1FOV A;  1Z6M A;  2LNS A;  3KTB A;  4LMW A;  2YZH A;  4HJM A;  2CVB A;  2CVK A;  4LMV A;  2HYX A;  3HZ4 A;  1GSQ A;  4QQ7 A;  2A4V A;  4IQA A;  3CRU A;  2DJJ A;  5ECS A;  3ZZX A;  3MNG A;  4TR3 A;  5ECK B;  5KEJ A;  5J3R A;  4JE1 A;  1FW1 A;  2I4A A;  3DRN A;  4CHS A;  1O81 A;  4FYU A;  2V6O A;  3KCM A;  3IC4 A;  4J2F A;  2MBS A;  4CW9 A;  3RHC A;  2H19 A;  2CZ3 A;  2PN8 A;  3GX8 A;  4AGS A;  1TI1 A;  1JLW A;  2GZZ A;  4X0X A;  2MBT A;  5IQY A;  3IAS 2;  1XW6 A;  3DXB A;  4RQR A;  1EWX A;  2X8H A;  3KH7 A;  1SK2 A;  2FHE A;  1XWB A;  4I5Q A;  3L0H A;  5AN1 A;  5IM9 A;  3FR9 A;  4ZIJ A;  5A4W A;  2VLT A;  2AV4 A;  3TJB A;  1AAZ A;  2DBC A;  1JHB A;  1V40 A;  2CAI A;  5LNK e;  3M3M A;  4TKY A;  3GH6 A;  2D2Z A;  2VOC A;  3DVX A;  1SYR A;  4PQH A;  5H5Q A;  1SD9 A;  4PXO A;  2HZF A;  5A4U A;  4HOJ A;  4DVC A;  3CTG A;  1TU7 A;  2OAD A;  2PVQ A;  1BJX A;  4PQ1 A;  4K9Z A;  4PX1 A;  4N0Z A;  2DSA A;  4H86 A;  2VCV A;  3S9F A;  4K1F A;  3W6G A;  1TK0 B;  1A2L A;  2C8U A;  1SL1 B;  3R2Q A;  2ON7 A;  5KN2 A;  3IA1 A;  3TKQ A;  1TJD A;  1XOA A;  2GSR A;  3KIJ A;  1NHO A;  2C0F A;  4MH3 A;  2DML A;  3CYN A;  2IPA A;  4MF6 A;  1B4Q A;  3C1R A;  4K6X A;  3TKR A;  3IHQ A;  3GUR A;  2MMO A;  3US3 A;  5EPF A;  1E2Y A;  3HHV A;  3LSZ A;  1X9W B;  4KDX A;  2GDR A;  2BJX A;  1TRV A;  4AF2 A;  2ALB A;  2L4C A;  3CTF A;  2C0E A;  2B1K A;  2R4V A;  1YEP A;  5CRG A;  3ZIV A;  2VUP A;  2XHF A;  2TRX A;  3ME8 A;  1FO5 A;  2YJ7 A;  5CAX A;  2CAQ A;  1B9X C;  1GH2 A;  4G9H A;  3UBK A;  4I6X A;  3ZVJ A;  1JZO A;  1H4O A;  3G9B A;  1Z9H A;  2H72 A;  2MMN A;  2HSH A;  2JAD A;  2JZR A;  1PX6 A;  1ABA A;  1HNC A;  1K0M A;  2A2R A;  2DC5 A;  3ZRE A;  4ZB6 A;  3IE3 A;  4ZL8 A;  1PL1 A;  2F51 A;  2MYG A;  3O3T A;  3D22 A;  4JR6 A;  1JLV A;  2ZCT A;  3Q18 A;  4EL1 A;  5E59 A;  3GKM A;  1M7T A;  4WR4 A;  2F8A A;  1XPV A;  5DQY A;  3LGC A;  1KNG A;  2QKE A;  3GNJ A;  4MJC A;  2JAC A;  5ABR A;  1GUM A;  4BL7 A;  1U6T A;  2I3Y A;  2H8L A;  1K3O A;  1ZCP A;  3P7X A;  4PNG A;  1VRS D;  3C7M A;  5HR2 A;  3GN3 A;  4JED A;  3VUR A;  7GSS A;  3LXT A;  1I5G A;  3KMO A;  4PUA A;  1GTI A;  1ERU A;  1R7H A;  1V2A A;  1JZW A;  1X5E A;  3A3T A;  4ML1 A;  4QL7 A;  5DVB A;  5CRD A;  2B5Y A;  1PD2 1;  1YY7 A;  2F9S A;  2CA8 A;  4IN0 A;  2LEG A;  1OC3 A;  2DJ2 A;  2OA7 A;  3QFB C;  1PN9 A;  1M9A A;  4DSR A;  3M9K A;  4TRX A;  2C0D A;  1RW1 A;  1GSU A;  4G2E A;  1V9W A;  3KJY A;  3PIN A;  2AHE A;  4BA7 A;  4F9Z A;  3G7Y A;  4HI7 A;  3WGX A;  2YV7 A;  1K0A A;  1VF3 A;  2FUG 2;  2KHP A;  3DVW A;  1FB6 A;  4OO5 A;  5LCZ A;  1DBY A;  3DKS A;  3FW2 A;  3ZLP A;  5B8A A;  6GST A;  4ACS A;  4NWY A;  3UL3 A;  3TJJ A;  4JZQ A;  2M46 A;  1YEX A;  4YH2 A;  3UVH A;  2WFC A;  2AJQ B;  2EC4 A;  2NDO A;  3QMX A;  1GUL A;  2VL2 C;  4Q5F A;  3VWW A;  3AY8 A;  3BCK A;  2FWH A;  2BTO T;  4OO4 A;  2K8S A;  2HFD A;  4POK A;  3EYT A;  4KND A;  2HNL A;  4K0N A;  1O8X A;  5J41 A;  1J0F A;  1GTU A;  3LG6 A;  4WET A;  2P31 A;  2LJA A;  3FKF A;  2RLI A;  2R37 A;  1TU8 A;  2VL3 A;  1TKD B;  2O89 A;  18GS A;  2VLV A;  1O85 A;  1EEJ A;  4V2M A;  3WT2 A;  5G5E A;  4LLR A;  3TRP A;  2OBI A;  2GSQ A;  1TI3 A;  3EU4 A;  2IJY A;  5ECR B;  5GST A;  3GKX A;  3IDV A;  3TRQ A;  1K0C A;  5ELG A;  5COH A;  4ZIL A;  5GZZ B;  4HU9 A;  3FEU A;  2E0Q A;  1GSD A;  1HYU A;  5DAL A;  4OD7 A;  1VF4 A;  3GL5 A;  3TGZ A;  4DSS A;  2WZ9 A;  1WE0 A;  2FGX A;  3FZ4 A;  4FIW A;  1DE2 A;  3E9J B;  2VCQ A;  4HZ4 A;  2HRN A;  4KGI A;  4POL A;  3ZFB A;  3ZL5 A;  1CQG A;  4O32 A;  4K7O A;  12GS A;  4YQU A;  22GS A;  1M99 A;  2C0G A;  1WPI A;  3I9V 2;  2OAC A;  2PU9 C;  2KLX A;  1GSE A;  5CP1 A;  4BVX A;  4IHU A;  3KP8 A;  3EIN A;  2L6C A;  1SKR B;  1XVW A;  1YJ6 A;  4I2T A;  2P5Q A;  3N9J A;  3UMA A;  3H8Q A;  2FLS A;  2MZC A;  3GKK A;  1SYX A;  2IFQ A;  1I9D A;  3UAR A;  3F4T A;  1XW9 A;  3F4S A;  1A2J A;  3ZML A;  2O85 A;  3VPT A;  4KH7 A;  4DEJ A;  1WMJ A;  4IP1 A;  1K0B A;  1W89 A;  3TJG A;  3CXG A;  3M9J A;  1B4P A;  6GSV A;  2E2M A;  5FHI A;  1Z6N A;  2H30 A;  1AQV A;  2B7K A;  17GS A;  4P3Y B;  3IPZ A;  1EGO A;  1PGT A;  3BCI A;  1IYH A;  4G19 A;  4Q5N A;  4J56 E;  1W4V A;  3KTL A;  5JCU A;  1PKZ A;  2IME A;  4I2U A;  2G2Q A;  2L5O A;  4AJ6 A;  1GSS A;  2LQO A;  2H6Z A;  1A8L A;  4MZB A;  4NHW A;  2YWO A;  1NW2 A;  5D93 A;  3IK7 A;  3A2V A;  2H1G A;  4BWQ A;  1EEM A;  5J9B A;  1EZK A;  4IQ1 A;  2N5F A;  4GLT A;  4TR4 A;  3WT1 A;  2C4J A;  5DAL B;  1EV4 A;  1Z5Y E;  4DSS B;  3APO A;  3RHB A;  3TKS E;  2L57 A;  1XVQ A;  2HI7 A;  1A8Y A;  3BBY A;  5CO3 A;  3M0F A;  5H5S A;  1XWK A;  1K0O A;  5JWQ B;  5JWO B;  1FHE A;  1X5C A;  2VL2 A;  1VF2 A;  4KDY A;  1AUC A;  2FY6 A;  3HVX A;  4JU5 A;  3KZQ A;  2NPB A;  5DBQ A;  3C71 A;  3VK9 A;  4LL1 B;  3Q6O A;  2CX4 A;  4CDO A;  3ZIJ A;  1EOH A;  2CZ2 A;  4MP4 A;  1UA5 A;  3CSJ A;  4RI6 A;  2GQK A;  3WD6 A;  3J7Y k;  4KE3 A;  3WYW A;  4GSS A;  3C73 A;  2YAN A;  2WJU A;  4EUY A;  4YAP A;  1VF1 A;  4IJI A;  2VCZ A;  4Q5R A;  4RQX A;  4XTS A;  1PL2 A;  2IFQ B;  4EDZ A;  1X5D A;  2FWF A;  2EIO A;  5G30 A;  1OYJ A;  1G0T A;  2LNT A;  3QOU A;  4FH8 A;  3GRX A;  1FVK A;  2K9F A;  4IP6 A;  5IMA A;  2VCX A;  4MJE A;  3U6V A;  4EKZ A;  2H1D A;  1AQW A;  1PA3 A;  2LRN A;  2F3M A;  4X43 A;  3TJK A;  2LS5 A;  1ACV A;  4TR1 A;  3APQ A;  2YP6 A;  3MWH A;  4MF5 A;  3F6D A;  1BYE A;  2GT5 A;  1E6B A;  2HXK A;  1ERW A;  4L5L A;  3CMI A;  3HJO A;  1BG5 A;  3HVS A;  3P2A A;  1PKW A;  4X1U A;  1XWC A;  2YWI A;  2PWJ A;  4ILF A;  4L8E A;  1DUG A;  2LKU A;  3MSZ A;  1QK8 A;  2I81 A;  2I9H A;  4YQM A;  5A5K A;  2X99 A;  4HDE A;  4N10 A;  3V1W A;  4WXT A;  3QCP A;  2DJ1 A;  1T00 A;  3TUE A;  1JZR A;  2FNO A;  3WGD A;  1G7E A;  1R26 A;  1EV9 A;  3GHA A;  4GST A;  1ZOF A;  3UAP A;  2IL3 A;  5H5R A;  1SL2 B;  2JZS A;  2DJ3 A;  1WWJ A;  3Q19 A;  5IMZ A;  2L4Q A;  5JCW A;  4OCF A;  1FG4 A;  3ZTL A;  3HJP A;  3F9U A;  3DD3 A;  4GSN A;  3QR6 A;  2LRC A;  2TIR A;  1BX9 A;  4MF7 A;  3FY7 A;  4MCU A;  2C3N A;  5G1L A;  2FWG A;  4LA1 A;  3EU3 A;  1MDJ A;  2KUC A;  3RDW A;  1V58 A;  4YAV A;  1CQH A;  2RUE A;  1GNW A;  1AW9 A;  2A2S A;  3SBC A;  5G1K A;  3FRC A;  2PVO C;  3FR6 A;  5G31 A;  1MD4 A;  3EWL A;  5HR1 A;  2VCW A;  4K2D A;  3G7J A;  3MDK A;  4F0B A;  1S3D A;  3GV1 A;  2FA8 A;  5KN3 A;  1FAA A;  2MMA A;  2HLS A;  1ON4 A;  4K8M A;  3FZA A;  2IMF A;  4F0C A;  9GSS A;  4EO3 A;  4TR1 B;  4ZB9 A;  3PR8 A;  3NOF A;  19GS A;  2IIY A;  5EY6 A;  5ECN B;  1XCC A;  5ECP B;  1XXU A;  2PBJ A;  1A0R P;  3N5O A;  4JRR A;  5ECM B;  2XPE A;  3E0U A;  3KXO A;  2K6V A;  4ULX A;  1A24 A;  2IMK A;  2DJ0 A;  3KM6 A;  3RAZ A;  3GIX A;  1M2D A;  2HZE A;  1GTB A;  3ERG A;  3HYP A;  5ENU A;  2ON5 A;  1AC1 A;  2O8V B;  1UC7 A;  2V41 A;  4XIH A;  3A5W A;  6GSW A;  1WIK A;  2LV3 A;  2OJL A;  4FO5 A;  3KGK A;  3QAW A;  2H1A A;  2GQL A;  3APS A;  4ID0 A;  2PER A;  4DSQ A;  1YKA A;  4NV2 A;  1OAZ A;  10GS A;  1YQ1 A;  4QL9 A;  1B48 A;  5DCG A;  1JFU A;  1GNE A;  2QSI A;  1GRX A;  4RUV A;  2VLU A;  1VGL A;  4MPG A;  4N30 A;  4XRD A;  3CSH A;  2CX3 A;  4E8E A;  4FYB A;  5JCG A;  3ZRD A;  1F37 A;  3BD2 A;  1SKW B;  1GUK A;  4KUN A;  4PUR A;  2CV4 A;  2KP1 A;  1TOF A;  2V32 A;  2YV9 A;  3H93 A;  1SK1 A;  2EIQ A;  3HZ8 A;  2VL9 A;  3QFA C;  1TRU A;  3QAG A;  2WDU A;  3GUS A;  4Q5Q A;  1TTZ A;  5GAN D;  2H6Y A;  2YNX A;  2IWT A;  1U88 A;  1AIU A;  2H1B A;  3D4T A;  1USB A;  1G6W A;  3VWV A;  3Q74 A;  2NVL A;  2N5B A;  4ZL7 A;  2XC2 A;  2OBK A;  1ZMA A;  5IO2 A;  1NHY A;  4HU7 A;  3D0Z A;  3GST A;  4ECJ A;  1SD8 A;  3FYG A;  1YF1 A;  4XS6 A;  3GTU A;  4WEY A;  4EE0 A;  5B8B A;  2B5X A;  2PUK C;  1SU9 A;  3EVI A;  1BAY A;  3IXR A;  4TXV A;  4O5R A;  2B5E A;  2IMD A;  2E7P A;  5DQS A;  1T3B A;  2QC7 A;  3G7I A;  5IOX A;  4WBR D;  1XOB A;  2CT6 A;  1GTA A;  1K3Y A;  3VI7 A;  1S3C A;  4MPF A;  2I1U A;  3HJM A;  2GVP A;  4HZ2 A;  1M0U A;  2R2J A;  3A2W A;  1N8J A;  3H4K A;  5C04 A;  3QPM A;  3L9V A;  5IPG A;  1MD3 A;  4POM A;  1YZX A;  4YQV A;  1O8W A;  5E4W A;  1SEN A;  4G10 A;  2AB6 A;  4KAE A;  2R6K A;  2HZE B;  4XRA A;  3C8E A;  2IN3 A;  2RUF A;  5LD0 A;  3DEX A;  4BPY A;  2GST A;  2H0I A;  1X9M B;  3ME7 A;  1Q98 A;  3D6I A;  4GCI A;  1ML6 A;  3VFI A;  2H74 A;  5J4U A;  4F2I A;  1Z3E A;  2X64 A;  5HFI A;  2C3Q A;  1S3A A;  4ZL9 A;  4FYC A;  2KOK A;  1ZZY A;  1OC8 A;  5HR3 A;  3F63 A;  5DAK A;  4MJB A;  3HA9 A;  1V98 A;  5D9X A;  3GKN A;  2C1Y A;  3EMP A;  5HFK A;  5AIX A;  2GS3 A;  1LBK A;  2O7K A;  1U3I A;  1G7O A;  2P0G A;  3LFL A;  2ZNM A;  1QXH A;  4IJ3 A;  5EL8 A;  3L9U A;  2WUL A;  3FHK A;  2AUV A;  1OE8 A;  3HVV A;  3TB2 A;  1TK5 B;  3IR4 A;  3GSS A;  3GX0 A;  2DIY A;  4ZB8 A;  3UEM A;  1KTE A;  5KN0 A;  1PRX A;  3IOS A;  3GTU B;  1PMT A;  1TXX A;  3JCM L;  6GSX A;  2H76 A;  3IV4 A;  1XWA A;  1KEB A;  1AXD A;  3I69 A;  1OKD A;  2VCT A;  2VIM A;  2J23 A;  2M72 A;  2GTU A;  2BMX A;  3GA4 A;  4TN8 A;  4MZC A;  3MAK A;  1DSB A;  1FVJ A;  4MH2 A;  1ERT A;  2EIR A;  1SK0 A;  3GMF A;  4HJ2 A;  1EOG A;  5DJM A;  4MZW A;  1LU4 A;  2MMZ A;  2YWN A;  3WGE A;  5L71 A;  3UVT A;  3CSI A;  4EVM A;  5HFG A;  2V1M A;  4HUA A;  4IKH A;  3KP9 A;  1F9M A;  2RM6 A;  5D9V A;  4KX4 A;  5D73 A;  1QMV A;  2K8V A;  3ERF A;  4NPB A;  2E2G A;  4MA9 A;  3EUR A;  3LQ7 A;  3EMX A;  2LTK A;  4O92 A;  4ZBD A;  2DJK A;  2GZP A;  5D9W A;  1C72 A;  2GGT A;  5A4V A;  1V57 A;  3TDG A;  1F3A A;  4D73 B;  4V1A g;  1OE7 A;  2HSY A;  2V6K A;  4N0V A;  1SJZ A;  2JL4 A;  4BVY A;  2VM1 A;  5GAP D;  3IBH A;  4IVF A;  2H6X A;  2R3X A;  4ECI A;  1WOU A;  3UBL A;  1QQ2 A;  5CNW A;  5F0G A;  4AJ7 A;  2N5A A;  11GS A;  3NIV A;  2VO4 A;  5DAK B;  3QD9 A;  2V2G A;  3DWV A;  1SL0 B;  14GS A;  5B6N A;  2H70 A;  6GSY A;  5GSS A;  1YF0 A;  4E8H A;  2LJR A;  3VWX A;  1J9B A;  2VD0 A;  2H73 A;  2PGT A;  4K0G A;  6GSS A;  4XS1 A;  5DDL A;  2YOI A;  3QAV A;  2LJK A;  1HNA A;  4EF0 A;  1GLQ A;  3LOR A;  1ILO A;  4POB A;  1ZGN A;  3L4N A;  1THX A;  2YCD A;  3OR5 A;  1U3A A;  4GTU A;  4HQZ A;  2YJH A;  4V2L A;  3LWA A;  2DMM A;  3VWU A;  4WR5 A;  4KA0 A;  1K0D A;  5HQP A;  4ZBA A;  3FZ5 A;  3F3R A;  4XCS A;  2AYT A;  1YKC A;  2JU5 A;  1AQX A;  3SWL A;  1RQM A;  1SJI A;  1TK8 B;  1T8E B;  2HE3 A;  5IMD A;  3UJ1 A;  1T4Y A;  1FB0 A;  2HT9 A;  4V2N A;  3DML A;  2LUS A;  1ZYQ B;  3CBU A;  3BOA A;  2OKA A;  3H1N A;  5G2Z A;  4I97 A;  4EDY A;  4LL4 B;  8GSS A;  1J08 A;  4OWY A;  1M2A A;  4PNF A;  2ZUP A;  3TOU A;  1GSF A;  3TKS C;  4JR4 A;  4PGT A;  5AIV A;  4ECB A;  4GRF A;  5IMV A;  4ECC A;  4IBP A;  1GL8 A;  2WRT A;  5DCH A;  5ECI B;  2GLR A;  4MLY A;  4OFM A;  13GS A;  3IRA A;  1Z7R A;  5B6M A;  3NZN A;  4IS0 A;  2HRF A;  3PH9 A;  2GT6 A;  2WS2 A;  3P8W A;  2VAF A;  3CRT A;  1ERV A;  2P5R A;  3M1G A;  4TOP A;  2Z9S A;  1NM3 A;  3ZMK A;  2GQM A;  1URM A;  2H0G A;  2PPT A;  1R5P A;  3RPN A;  3LYK A;  4NMU A;  2NBS A;  2IMI A;  1UN2 A;  2F8F A;  5C00 A;  4GXZ A;  4HS1 A;  2XBI A;  3HXS A;  1F6M C;  2OE3 A;  2NTO A;  2O87 A;  4EC0 A;  2CVD A;  4J57 E;  16GS A;  3HY2 A;  3FR3 A;  3LXZ A;  1Y6E A;  2CQ9 A;  1K0N A;  4HQS A;  2H0H A;  3J7Y b;  2WCI A;  3E3E A;  5F8B A;  2X8G A;  4PUF C;  4WBJ A;  5F07 A;  4BWS A;  1GSY A;  2C80 A;  1EP7 A;  4OFN A;  3ZYW A;  3A2X A;  1OKT A;  1MTC A;  2H01 A;  5FT3 A;  6GSU A;  4WF4 A;  5CRH A;  5D9T A;  5KN1 A;  1NSW A;  4GF0 A;  4IGJ A;  3HDC A;  3GYK A;  1G6Y A;  5ECL B;  3TRX A;  4NV5 A;  2FCH A;  5ID2 A;  1RK4 A;  3D4M A;  3TCO A;  3KEB A;  4KCE A;  4OCE A;  2C3T A;  2WGR A;  3UIW A;  4WF5 A;  1TP9 A;  1IYI A;  1N2A A;  4TR0 A;  3O6T A;  3I43 A;  4ML6 A;  2J9H A;  3P90 A;  4V1A p;  5D8I A;  2YN1 A;  4HEA 2;  1EP8 A;  5IMF A;  3LJR A;  3HCZ A;  4F03 A;  1XWG A;  3TKP A;  4IEL A;  2YWM A;  1B9Y C;  4MK3 A;  2OE1 A;  1QUW A;  1B8X A;  1Q4J A;  4F82 A;  4MJA A;  1F3B A;  4ZBB A;  2L59 A;  1UVZ A;  2FA4 A;  5CYY A;  3D5J A;  2G0F A;  1Z7P A;  3C1S A;  2JZT A;  1XIY A;  5D96 A;  4EXJ A;  4KSM A;  2JSZ A;  1M2B A;  4RI7 A;  2B6M A;  3IK9 A;  3FK8 A;  2LQQ A;  4I8B A;  1TDI A;  4N11 A;  1XBS A;  5F06 A;  2GSS A;  1F2E A;  1R4W A;  5F05 A;  1OC9 A;  2PMT A;  4KW6 A;  2YZU A;  2ES7 A;  5ECO B;  3F3Q A;  1OVN A;  3H79 A;  1O6J A;  5IIZ A;  1TW9 A;  3VLN A;  2DLX A;  5JWR B;  2YPM A;  3KH9 A;  2TRC P;  2K18 A;  5ECQ B;  4O7H A;  2GZY A;  1QGV A;  1PSQ A;  1ZYE A;  5DJL A;  4XHM A;  1KBN A;  3TKS A;  2VM2 A;  4KB3 A;  4ZXG A;  4ISD A;  2B3S A;  1XZO A;  1T7P B;  5G5F A;  1YDK A;  2RM5 A;  4WKW A;  2FWE A;  2FD3 A;  4L0W A;  5INY A;  1EGR A;  4IW9 A;  2X8C A;  1HD2 A;  4MMM A;  2B1L A;  3PGT A;  5IO0 A;  5ECH B;  4PQI A;  1SJ6 A;  1XW5 A;  5ID2 B;  4AJ8 A;  2OE0 A;  3LYP A;  1GP1 A;  3EE2 A;  1O7U A;  3HD5 A;  3O76 A;  4XS4 A;  3ED3 A;  1PX7 A;  1ZL9 A;  2REM A;  2XPD A;  3KMN A;  1DE1 A;  1TRS A;  4GQC A;  3DYR A;  1O73 A;  2KP2 A;  2WB9 A;  4TXO A;  4L5O A;  5IPH A;  4KSO A;  3DIE A;  5FWG A;  3GH9 A;  4D73 A;  1PQN A;  3KD0 A;  3ERW A;  5ELA A;  1BED A;  2XBQ A;  5CRE A;  4NHZ A;  4NAX A;  2JSY A;  1TRW A;  3ZFL A;  3GL3 A;  1MDK A; 
#chains in the Genus database with same CATH topology
 3F4R A;  1BQ7 A;  5HR0 A;  2M80 A;  4K7N A;  1A23 A;  4GWR A;  1HNB A;  3F0I A;  3VI5 A;  2H66 A;  5AIS A;  5J5N A;  1T1V A;  2L5L A;  3TJF A;  2B7J A;  4MAB A;  3W8S A;  1WP0 A;  1QFN A;  2X4A A;  2LRT A;  1K3L A;  2VD1 A;  3DGQ A;  1PN0 A;  3BJ5 A;  3FZ9 A;  5IMC A;  4Z2R A;  3RPP A;  4TVE A;  2RII A;  1M3J A;  4L0U A;  1OC9 B;  1LJR A;  1X0R A;  1WJK A;  5IOW A;  3GFK A;  3F8U A;  5J9C A;  4TW5 A;  3RBT A;  3QDN A;  1XFL A;  3I6A A;  3VPQ A;  4MDC A;  1M9B A;  4K7I A;  3L78 A;  4O5U A;  3EC3 A;  4JBB A;  3ISO A;  1GLP A;  2AAW A;  4CY6 A;  1A0F A;  1JZD A;  3U5R E;  4OFT A;  1H75 A;  2L6D A;  4KCA A;  4EIQ A;  2H71 A;  1HQO A;  1SKS B;  4NXI A;  1T4Z A;  20GS A;  5AGY A;  2QGV A;  1MDI A;  3ZVJ D;  3D21 A;  2H75 A;  2DIZ A;  1GWC A;  1U87 A;  3ZIT A;  3UOM A;  4GQF A;  4XS4 B;  1Y25 A;  1ST9 A;  5EVO A;  2LST A;  3W8J A;  3LEF A;  4Z7X A;  1THO A;  3IAM 2;  3HKR A;  1R5A A;  2R5G A;  4TXO B;  3K8N A;  3L9S A;  5B7C A;  3TOT A;  5CRW A;  1WRY A;  1MEK A;  3M8N A;  1GUH A;  1X9S B;  1A2M A;  4KDU A;  3F6F A;  4OMV A;  1FOV A;  1Z6M A;  2LNS A;  4A5P A;  3KTB A;  4LMW A;  2YZH A;  4HJM A;  2CVB A;  2CVK A;  4LMV A;  2HYX A;  3HZ4 A;  1GSQ A;  4QQ7 A;  2A4V A;  4IQA A;  3CRU A;  2DJJ A;  5ECS A;  3ZZX A;  3MNG A;  4TR3 A;  5ECK B;  5KEJ A;  5J3R A;  4JE1 A;  1FW1 A;  2I4A A;  3DRN A;  4CHS A;  1O81 A;  4FYU A;  2V6O A;  3KCM A;  3IC4 A;  4J2F A;  2MBS A;  4CW9 A;  3RHC A;  2H19 A;  2CZ3 A;  2PN8 A;  3GX8 A;  4AGS A;  1TI1 A;  1JLW A;  2GZZ A;  4X0X A;  2MBT A;  5IQY A;  3IAS 2;  1XW6 A;  3DXB A;  4RQR A;  1EWX A;  2X8H A;  3KH7 A;  1SK2 A;  2FHE A;  1XWB A;  1XG8 A;  4I5Q A;  3L0H A;  5AN1 A;  5IM9 A;  3FR9 A;  4ZIJ A;  5A4W A;  2VLT A;  2AV4 A;  3TJB A;  1AAZ A;  2DBC A;  1JHB A;  1V40 A;  2CAI A;  5LNK e;  3M3M A;  4G0K A;  4TKY A;  3GH6 A;  2HRA A;  2D2Z A;  2VOC A;  3DVX A;  1SYR A;  4PQH A;  5H5Q A;  1SD9 A;  4PXO A;  2HZF A;  5A4U A;  4HOJ A;  1S3R A;  4DVC A;  3CTG A;  1TU7 A;  2OAD A;  2PVQ A;  1BJX A;  4PQ1 A;  4K9Z A;  4PX1 A;  4N0Z A;  2DSA A;  4H86 A;  2VCV A;  3S9F A;  4K1F A;  3W6G A;  1TK0 B;  1A2L A;  2C8U A;  1SL1 B;  3R2Q A;  2ON7 A;  5KN2 A;  3IA1 A;  3TKQ A;  1TJD A;  1XOA A;  2GSR A;  3KIJ A;  1NHO A;  2C0F A;  3FMW A;  4MH3 A;  2DML A;  3CYN A;  2IPA A;  4MF6 A;  1B4Q A;  3C1R A;  4K6X A;  3MYD A;  3TKR A;  3IHQ A;  3GUR A;  2MMO A;  3US3 A;  5EPF A;  1E2Y A;  3HHV A;  3MIX A;  3LSZ A;  1X9W B;  4KDX A;  2GDR A;  2BJX A;  1TRV A;  4AF2 A;  2ALB A;  2L4C A;  3CTF A;  2C0E A;  2B1K A;  2R4V A;  1YEP A;  5CRG A;  3ZIV A;  2VUP A;  2XHF A;  2TRX A;  3ME8 A;  1FO5 A;  2YJ7 A;  5CAX A;  2CAQ A;  1B9X C;  1GH2 A;  4G9H A;  3UBK A;  4I6X A;  3ZVJ A;  1JZO A;  1H4O A;  3G9B A;  1Z9H A;  2H72 A;  2MMN A;  2HSH A;  2JAD A;  2JZR A;  4Z2U A;  1PX6 A;  1ABA A;  1HNC A;  1K0M A;  2A2R A;  2DC5 A;  3ZRE A;  4ZB6 A;  2A4H A;  3IE3 A;  4ZL8 A;  1PL1 A;  2F51 A;  2MYG A;  3O3T A;  3D22 A;  4JR6 A;  5KOX A;  1JLV A;  2ZCT A;  3Q18 A;  4EL1 A;  5E59 A;  3GKM A;  1M3I A;  1M7T A;  4WR4 A;  2F8A A;  1XPV A;  5DQY A;  3LGC A;  1KNG A;  2QKE A;  3GNJ A;  4MJC A;  2JAC A;  5ABR A;  1GUM A;  4BL7 A;  1U6T A;  2I3Y A;  2H8L A;  1K3O A;  1ZCP A;  3P7X A;  4PNG A;  1VRS D;  3C7M A;  5HR2 A;  3GN3 A;  4JED A;  3VUR A;  7GSS A;  3LXT A;  1I5G A;  3KMO A;  4PUA A;  1GTI A;  1ERU A;  1R7H A;  1V2A A;  2DKI A;  1JZW A;  1X5E A;  4Z2T A;  3A3T A;  4ML1 A;  4QL7 A;  5DVB A;  5CRD A;  2B5Y A;  1PD2 1;  1YY7 A;  3A5I A;  2F9S A;  4K5R A;  2CA8 A;  4IN0 A;  2A2P A;  2LEG A;  1OC3 A;  2DJ2 A;  2OA7 A;  3QFB C;  1PN9 A;  1M9A A;  4DSR A;  3M9K A;  4TRX A;  2C0D A;  1RW1 A;  1GSU A;  4G2E A;  1V9W A;  3KJY A;  3PIN A;  2AHE A;  4BA7 A;  4F9Z A;  3G7Y A;  4HI7 A;  3WGX A;  2YV7 A;  1K0A A;  1VF3 A;  2FUG 2;  2KHP A;  3DVW A;  1FB6 A;  4OO5 A;  5LCZ A;  1DBY A;  3DKS A;  3FW2 A;  3ZLP A;  5B8A A;  6GST A;  4ACS A;  4NWY A;  4YKG A;  3UL3 A;  3TJJ A;  4JZQ A;  2M46 A;  1YEX A;  4YH2 A;  3UVH A;  2WFC A;  2AJQ B;  2EC4 A;  2NDO A;  3QMX A;  1GUL A;  2VL2 C;  4Q5F A;  3VWW A;  3AY8 A;  3BCK A;  2FWH A;  2BTO T;  4OO4 A;  2K8S A;  2HFD A;  4POK A;  4X4J A;  3EYT A;  4KND A;  2HNL A;  4K0N A;  1O8X A;  5J41 A;  1J0F A;  1GTU A;  4BL7 B;  3LG6 A;  4WET A;  2P31 A;  2LJA A;  3FKF A;  2RLI A;  2R37 A;  1TU8 A;  2VL3 A;  1TKD B;  2O89 A;  18GS A;  2VLV A;  1O85 A;  1EEJ A;  4V2M A;  3WT2 A;  5G5E A;  4LLR A;  3TRP A;  3PPU A;  2OBI A;  2GSQ A;  1TI3 A;  3EU4 A;  2IJY A;  5ECR B;  5GST A;  3IC8 A;  3GKX A;  3IDV A;  3TRQ A;  1K0C A;  5ELG A;  5COH A;  4ZIL A;  5GZZ B;  4HU9 A;  3FEU A;  2E0Q A;  1GSD A;  1HYU A;  5DAL A;  4OD7 A;  1VF4 A;  3GL5 A;  3TGZ A;  4DSS A;  2WZ9 A;  1WE0 A;  2FGX A;  3FZ4 A;  4FIW A;  1DE2 A;  3E9J B;  2VCQ A;  4HZ4 A;  2HRN A;  4KGI A;  4POL A;  3ZFB A;  3ZL5 A;  1CQG A;  4O32 A;  4K7O A;  12GS A;  4YQU A;  22GS A;  1M99 A;  2C0G A;  1WPI A;  3I9V 2;  2OAC A;  2PU9 C;  2KLX A;  1GSE A;  5CP1 A;  4BVX A;  4IHU A;  3KP8 A;  3EIN A;  2L6C A;  1SKR B;  1XVW A;  1YJ6 A;  4I2T A;  2P5Q A;  3N9J A;  3UMA A;  3H8Q A;  2FLS A;  2MZC A;  3GKK A;  1SYX A;  2IFQ A;  1I9D A;  3UAR A;  3F4T A;  1XW9 A;  3F4S A;  1A2J A;  3ZML A;  2O85 A;  3VPT A;  4KH7 A;  4DEJ A;  1WMJ A;  4IP1 A;  1K0B A;  1W89 A;  3TJG A;  3CXG A;  3M9J A;  1B4P A;  6GSV A;  2E2M A;  5FHI A;  1Z6N A;  2H30 A;  3R3E A;  1AQV A;  2B7K A;  17GS A;  4P3Y B;  3IPZ A;  1EGO A;  1PGT A;  3BCI A;  1IYH A;  4G19 A;  4Q5N A;  4J56 E;  1W4V A;  3KTL A;  5JCU A;  1PKZ A;  2IME A;  4I2U A;  2G2Q A;  2L5O A;  4AJ6 A;  1GSS A;  2LQO A;  2H6Z A;  1A8L A;  4MZB A;  4NHW A;  2YWO A;  1NW2 A;  5D93 A;  3IK7 A;  3A2V A;  2H1G A;  4BWQ A;  1EEM A;  5J9B A;  1EZK A;  4IQ1 A;  2N5F A;  4GLT A;  4TR4 A;  3WT1 A;  2C4J A;  5DAL B;  1EV4 A;  1Z5Y E;  4DSS B;  3APO A;  3RHB A;  3TKS E;  2L57 A;  1XVQ A;  2HI7 A;  1A8Y A;  3BBY A;  5CO3 A;  3M0F A;  5H5S A;  1XWK A;  1K0O A;  5JWQ B;  5JWO B;  1FHE A;  1X5C A;  2VL2 A;  1VF2 A;  4KDY A;  1AUC A;  2FY6 A;  3HVX A;  4JU5 A;  3KZQ A;  2NPB A;  5DBQ A;  3C71 A;  3VK9 A;  4LL1 B;  3Q6O A;  2CX4 A;  4CDO A;  4BVX B;  3ZIJ A;  1EOH A;  2CZ2 A;  4MP4 A;  1UA5 A;  3CSJ A;  4RI6 A;  2GQK A;  3WD6 A;  3J7Y k;  4KE3 A;  3WYW A;  4GSS A;  3C73 A;  2YAN A;  2WJU A;  4EUY A;  4YAP A;  1VF1 A;  4IJI A;  2VCZ A;  4Q5R A;  4RQX A;  4XTS A;  1PL2 A;  2IFQ B;  4EDZ A;  1X5D A;  2FWF A;  2EIO A;  5G30 A;  1OYJ A;  1G0T A;  2LNT A;  3QOU A;  4FH8 A;  3GRX A;  1FVK A;  2K9F A;  4IP6 A;  5IMA A;  2VCX A;  5KOW A;  4MJE A;  3U6V A;  4EKZ A;  2H1D A;  1AQW A;  1PA3 A;  2LRN A;  2F3M A;  4X43 A;  3TJK A;  2LS5 A;  1ACV A;  4TR1 A;  3APQ A;  2YP6 A;  3MWH A;  4MF5 A;  3F6D A;  1BYE A;  2GT5 A;  1E6B A;  2HXK A;  1ERW A;  4L5L A;  3CMI A;  3HJO A;  1BG5 A;  3HVS A;  3P2A A;  1PKW A;  4X1U A;  1XWC A;  2YWI A;  2PWJ A;  4ILF A;  4L8E A;  1DUG A;  2LKU A;  3MSZ A;  1QK8 A;  2I81 A;  2I9H A;  4YQM A;  5A5K A;  2X99 A;  4HDE A;  4N10 A;  3V1W A;  4WXT A;  3QCP A;  2DJ1 A;  1T00 A;  3TUE A;  1JZR A;  2FNO A;  3WGD A;  1G7E A;  1R26 A;  1EV9 A;  3GHA A;  4GST A;  1ZOF A;  3UAP A;  4CY8 A;  2IL3 A;  5H5R A;  1SL2 B;  2JZS A;  2DJ3 A;  1WWJ A;  3Q19 A;  5IMZ A;  2L4Q A;  5JCW A;  4OCF A;  1FG4 A;  3ZTL A;  3HJP A;  3F9U A;  3DD3 A;  4GSN A;  3QR6 A;  2LRC A;  2TIR A;  1BX9 A;  4PTS A;  4G0I A;  3FY7 A;  4MF7 A;  4MCU A;  2C3N A;  5G1L A;  2FWG A;  4LA1 A;  3EU3 A;  1MDJ A;  2KUC A;  3RDW A;  1V58 A;  4YAV A;  1CQH A;  2RUE A;  1GNW A;  1AW9 A;  2A2S A;  3SBC A;  5G1K A;  3FRC A;  2PVO C;  3FR6 A;  5G31 A;  1MD4 A;  3EWL A;  5HR1 A;  2VCW A;  4K2D A;  3G7J A;  3MDK A;  4F0B A;  1S3D A;  3GV1 A;  2FA8 A;  5KN3 A;  1FAA A;  4K5S A;  2MMA A;  2HLS A;  1ON4 A;  4K8M A;  3FZA A;  2IMF A;  4F0C A;  9GSS A;  4EO3 A;  4TR1 B;  4ZB9 A;  3PR8 A;  3NOF A;  19GS A;  2IIY A;  5EY6 A;  5ECN B;  1XCC A;  5ECP B;  4BIK A;  1XXU A;  2PBJ A;  1A0R P;  3N5O A;  4JRR A;  5ECM B;  2XPE A;  3E0U A;  3KXO A;  2K6V A;  4ULX A;  1A24 A;  2IMK A;  3EPT A;  2DJ0 A;  3KM6 A;  3RAZ A;  3GIX A;  1M2D A;  2HZE A;  2UZ8 A;  1GTB A;  3ERG A;  3HYP A;  5ENU A;  2ON5 A;  1AC1 A;  2O8V B;  1UC7 A;  2V41 A;  4XIH A;  3A5W A;  6GSW A;  3CQF A;  1WIK A;  2LV3 A;  2OJL A;  4FO5 A;  3KGK A;  3QAW A;  2H1A A;  2GQL A;  3APS A;  4ID0 A;  2PER A;  4DSQ A;  1YKA A;  4NV2 A;  1OAZ A;  10GS A;  1YQ1 A;  4QL9 A;  1B48 A;  5DCG A;  1JFU A;  1GNE A;  2QSI A;  1GRX A;  4RUV A;  2VLU A;  1VGL A;  4MPG A;  4N30 A;  4XRD A;  3CSH A;  2CX3 A;  4E8E A;  4FYB A;  5JCG A;  3ZRD A;  1F37 A;  3BD2 A;  1SKW B;  1GUK A;  4KUN A;  4PUR A;  2CV4 A;  2KP1 A;  1TOF A;  2V32 A;  2YV9 A;  3H93 A;  1SK1 A;  2EIQ A;  3HZ8 A;  2VL9 A;  3QFA C;  1TRU A;  3QAG A;  2WDU A;  3GUS A;  4Q5Q A;  4HSC X;  1TTZ A;  5GAN D;  2H6Y A;  2YNX A;  2IWT A;  1U88 A;  1AIU A;  2H1B A;  3D4T A;  1USB A;  1G6W A;  3VWV A;  3Q74 A;  2NVL A;  2N5B A;  4ZL7 A;  2XC2 A;  2OBK A;  1ZMA A;  5IO2 A;  1NHY A;  4HU7 A;  3D0Z A;  3GST A;  4ECJ A;  1SD8 A;  3FYG A;  1YF1 A;  4XS6 A;  3GTU A;  4WEY A;  4EE0 A;  5B8B A;  2B5X A;  2PUK C;  1SU9 A;  3EVI A;  1BAY A;  3IXR A;  4TXV A;  4O5R A;  2B5E A;  2IMD A;  2E7P A;  5DQS A;  1T3B A;  2QC7 A;  3G7I A;  5IOX A;  4WBR D;  1XOB A;  2CT6 A;  1GTA A;  1K3Y A;  3VI7 A;  1S3C A;  4MPF A;  2I1U A;  3HJM A;  2GVP A;  4HZ2 A;  1M0U A;  2R2J A;  3A2W A;  1N8J A;  3H4K A;  5C04 A;  3QPM A;  3L9V A;  5IPG A;  1MD3 A;  4POM A;  1YZX A;  4YQV A;  1O8W A;  5E4W A;  1SEN A;  4G10 A;  2AB6 A;  4KAE A;  2R6K A;  2HZE B;  4XRA A;  2R0G A;  3C8E A;  2IN3 A;  2RUF A;  5LD0 A;  3DEX A;  4BPY A;  2GST A;  2H0I A;  1X9M B;  3ME7 A;  1Q98 A;  3D6I A;  4GCI A;  1ML6 A;  3VFI A;  2H74 A;  5J4U A;  4F2I A;  1Z3E A;  2X64 A;  5HFI A;  2C3Q A;  1S3A A;  4ZL9 A;  4FYC A;  2KOK A;  1ZZY A;  1OC8 A;  5HR3 A;  3F63 A;  5DAK A;  4MJB A;  3HA9 A;  1V98 A;  5D9X A;  3GKN A;  2C1Y A;  3EMP A;  5HFK A;  5AIX A;  2GS3 A;  1LBK A;  2O7K A;  1U3I A;  1G7O A;  2P0G A;  3LFL A;  2ZNM A;  1QXH A;  4IJ3 A;  5EL8 A;  3L9U A;  2WUL A;  3FHK A;  2AUV A;  1OE8 A;  3HVV A;  3TB2 A;  1TK5 B;  3IR4 A;  3GSS A;  3GX0 A;  2DIY A;  4ZB8 A;  3UEM A;  1KTE A;  5KN0 A;  1PRX A;  3IOS A;  3GTU B;  2QA1 A;  1PMT A;  1TXX A;  2HSM A;  3JCM L;  6GSX A;  2H76 A;  3IV4 A;  1XWA A;  3HVN A;  1KEB A;  1AXD A;  3I69 A;  1OKD A;  2VCT A;  2VIM A;  2J23 A;  2M72 A;  2GTU A;  2BMX A;  3GA4 A;  4TN8 A;  4MZC A;  3MAK A;  1DSB A;  1FVJ A;  4MH2 A;  1ERT A;  2EIR A;  1SK0 A;  2QA2 A;  3GMF A;  1EOG A;  4HJ2 A;  5DJM A;  4MZW A;  1LU4 A;  2MMZ A;  2YWN A;  3WGE A;  5L71 A;  3UVT A;  3CSI A;  4EVM A;  5HFG A;  2V1M A;  4HUA A;  4IKH A;  3KP9 A;  1F9M A;  2RM6 A;  5D9V A;  4KF9 A;  4KX4 A;  5D73 A;  1QMV A;  2K8V A;  3ERF A;  4NPB A;  2E2G A;  4MA9 A;  3EUR A;  3LQ7 A;  3EMX A;  2LTK A;  4O92 A;  4ZBD A;  2DJK A;  2GZP A;  5D9W A;  1C72 A;  2GGT A;  5A4V A;  1V57 A;  3TDG A;  1F3A A;  4D73 B;  4V1A g;  1OE7 A;  2HSY A;  2V6K A;  4N0V A;  1SJZ A;  2JL4 A;  4BVY A;  2VM1 A;  5GAP D;  3IBH A;  1FOH A;  4IVF A;  2H6X A;  2R3X A;  4ECI A;  1WOU A;  3UBL A;  1QQ2 A;  5CNW A;  5F0G A;  4AJ7 A;  2N5A A;  3IHG A;  11GS A;  3NIV A;  2VO4 A;  5DAK B;  3QD9 A;  2V2G A;  3DWV A;  1SL0 B;  14GS A;  5B6N A;  2H70 A;  6GSY A;  5GSS A;  1YF0 A;  4E8H A;  2LJR A;  3VWX A;  1J9B A;  2VD0 A;  2H73 A;  2PGT A;  4K0G A;  6GSS A;  4XS1 A;  5DDL A;  2YOI A;  3QAV A;  2LJK A;  1HNA A;  4EF0 A;  1GLQ A;  3LOR A;  1ILO A;  4POB A;  1ZGN A;  3L4N A;  1THX A;  2YCD A;  3OR5 A;  1U3A A;  4GTU A;  5BRT A;  4HQZ A;  2YJH A;  4V2L A;  3LWA A;  2DMM A;  3VWU A;  4WR5 A;  4KA0 A;  1K0D A;  5HQP A;  4ZBA A;  3FZ5 A;  3F3R A;  4XCS A;  2AYT A;  1YKC A;  2JU5 A;  1AQX A;  3SWL A;  1RQM A;  1SJI A;  1TK8 B;  1T8E B;  2HE3 A;  5IMD A;  3UJ1 A;  1T4Y A;  1FB0 A;  2HT9 A;  4V2N A;  3DML A;  2LUS A;  1ZYQ B;  3CBU A;  3BOA A;  2OKA A;  3H1N A;  2R0C A;  5BMU A;  5G2Z A;  4I97 A;  4EDY A;  4LL4 B;  8GSS A;  1J08 A;  4OWY A;  1M2A A;  4PNF A;  2ZUP A;  3TOU A;  1GSF A;  3TKS C;  4JR4 A;  4PGT A;  5AIV A;  4BVY B;  4ECB A;  4GRF A;  5IMV A;  4ECC A;  4IBP A;  1GL8 A;  2WRT A;  5DCH A;  5ECI B;  2GLR A;  4MLY A;  4OFM A;  13GS A;  3IRA A;  1Z7R A;  5B6M A;  3NZN A;  4IS0 A;  2HRF A;  3PH9 A;  2GT6 A;  2WS2 A;  3P8W A;  2VAF A;  3CRT A;  1ERV A;  2P5R A;  3M1G A;  4TOP A;  2Z9S A;  1NM3 A;  3ZMK A;  1PFO A;  2GQM A;  1URM A;  2H0G A;  2PPT A;  1R5P A;  3RPN A;  3LYK A;  4NMU A;  2NBS A;  2IMI A;  1UN2 A;  2F8F A;  5C00 A;  4GXZ A;  4HS1 A;  2XBI A;  3HXS A;  1F6M C;  2OE3 A;  2NTO A;  2O87 A;  4EC0 A;  2CVD A;  4MNN A;  4YKF A;  4J57 E;  16GS A;  3HY2 A;  3FR3 A;  3LXZ A;  4USS A;  1Y6E A;  2CQ9 A;  1K0N A;  4HQS A;  2H0H A;  3J7Y b;  2WCI A;  3E3E A;  5F8B A;  2X8G A;  4PUF C;  4WBJ A;  5F07 A;  4BWS A;  1GSY A;  2C80 A;  4FQU A;  1EP7 A;  4OFN A;  3ZYW A;  3A2X A;  2X49 A;  1OKT A;  1MTC A;  2H01 A;  5FT3 A;  6GSU A;  4WF4 A;  5CRH A;  5D9T A;  4EIP A;  5KN1 A;  1NSW A;  4GF0 A;  2HRK A;  2R0P A;  4IGJ A;  3HDC A;  3GYK A;  1G6Y A;  5ECL B;  3TRX A;  4NV5 A;  2FCH A;  4ICY A;  5ID2 A;  2DKH A;  1RK4 A;  3D4M A;  3TCO A;  3KEB A;  4KCE A;  4OCE A;  2C3T A;  2WGR A;  3UIW A;  4WF5 A;  1TP9 A;  1IYI A;  1N2A A;  4TR0 A;  3O6T A;  3I43 A;  4ML6 A;  2J9H A;  3P90 A;  4V1A p;  5D8I A;  2YN1 A;  4HEA 2;  1EP8 A;  5IMF A;  3LJR A;  3HCZ A;  3LW9 A;  4F03 A;  1XWG A;  3TKP A;  4IEL A;  2YWM A;  1B9Y C;  4MK3 A;  2OE1 A;  1QUW A;  1B8X A;  1Q4J A;  4F82 A;  4MJA A;  1F3B A;  4ZBB A;  2L59 A;  1UVZ A;  2FA4 A;  5CYY A;  4O5Q A;  1ZYP A;  3D5J A;  2G0F A;  1Z7P A;  3C1S A;  2JZT A;  1XIY A;  5D96 A;  4EXJ A;  4KSM A;  2JSZ A;  1M2B A;  4RI7 A;  2B6M A;  3IK9 A;  3FK8 A;  2LQQ A;  4I8B A;  1TDI A;  4N11 A;  1XBS A;  5F06 A;  2GSS A;  1F2E A;  1R4W A;  5F05 A;  1OC9 A;  2PMT A;  4KW6 A;  2YZU A;  2ES7 A;  5ECO B;  3F3Q A;  1OVN A;  3H79 A;  1O6J A;  5IIZ A;  1TW9 A;  3VLN A;  2DLX A;  5JWR B;  2YPM A;  3KH9 A;  2TRC P;  2K18 A;  5ECQ B;  4O7H A;  2GZY A;  1QGV A;  1PSQ A;  1ZYE A;  5DJL A;  4XHM A;  1KBN A;  3TKS A;  2VM2 A;  4KB3 A;  4ZXG A;  4ISD A;  2B3S A;  1XZO A;  1T7P B;  5G5F A;  1YDK A;  2RM5 A;  4WKW A;  2FWE A;  2FD3 A;  4L0W A;  5INY A;  1EGR A;  4IW9 A;  2X8C A;  4K2X A;  1HD2 A;  4MMM A;  2B1L A;  3PGT A;  5IO0 A;  5ECH B;  4PQI A;  1SJ6 A;  1XW5 A;  5ID2 B;  4AJ8 A;  2OE0 A;  3LYP A;  1GP1 A;  3EE2 A;  1O7U A;  3HD5 A;  3O76 A;  4XS4 A;  3ED3 A;  1PX7 A;  1ZL9 A;  2REM A;  2XPD A;  3KMN A;  1DE1 A;  1TRS A;  4GQC A;  3DYR A;  1O73 A;  1ZYN A;  2KP2 A;  2WB9 A;  4TXO A;  4L5O A;  5IPH A;  4KSO A;  3DIE A;  5FWG A;  3GH9 A;  4D73 A;  1PQN A;  3KD0 A;  3ERW A;  5ELA A;  1BED A;  2XBQ A;  5CRE A;  4NHZ A;  4NAX A;  4G0L A;  2JSY A;  1TRW A;  3ZFL A;  3GL3 A;  1MDK A; 
#chains in the Genus database with same CATH homology
 3F4R A;  1BQ7 A;  5HR0 A;  2M80 A;  4K7N A;  1A23 A;  4GWR A;  1HNB A;  3F0I A;  3VI5 A;  2H66 A;  5AIS A;  5J5N A;  1T1V A;  2L5L A;  3TJF A;  2B7J A;  4MAB A;  3W8S A;  1WP0 A;  1QFN A;  2X4A A;  2LRT A;  1K3L A;  2VD1 A;  3DGQ A;  1PN0 A;  3BJ5 A;  3FZ9 A;  5IMC A;  4Z2R A;  3RPP A;  4TVE A;  2RII A;  4L0U A;  1OC9 B;  1LJR A;  1X0R A;  1WJK A;  5IOW A;  3GFK A;  3F8U A;  5J9C A;  4TW5 A;  3RBT A;  3QDN A;  1XFL A;  3I6A A;  3VPQ A;  4MDC A;  1M9B A;  4K7I A;  3L78 A;  4O5U A;  3EC3 A;  4JBB A;  3ISO A;  1GLP A;  2AAW A;  4CY6 A;  1A0F A;  1JZD A;  3U5R E;  4OFT A;  1H75 A;  2L6D A;  4KCA A;  4EIQ A;  2H71 A;  1HQO A;  1SKS B;  4NXI A;  1T4Z A;  20GS A;  5AGY A;  2QGV A;  1MDI A;  3ZVJ D;  3D21 A;  2H75 A;  2DIZ A;  1GWC A;  1U87 A;  3ZIT A;  3UOM A;  4GQF A;  4XS4 B;  1Y25 A;  1ST9 A;  5EVO A;  2LST A;  3W8J A;  3LEF A;  4Z7X A;  1THO A;  3IAM 2;  3HKR A;  1R5A A;  2R5G A;  4TXO B;  3K8N A;  3L9S A;  5B7C A;  3TOT A;  5CRW A;  1WRY A;  1MEK A;  3M8N A;  1GUH A;  1X9S B;  1A2M A;  4KDU A;  3F6F A;  4OMV A;  1FOV A;  1Z6M A;  2LNS A;  4A5P A;  3KTB A;  4LMW A;  2YZH A;  4HJM A;  2CVB A;  2CVK A;  4LMV A;  2HYX A;  3HZ4 A;  1GSQ A;  4QQ7 A;  2A4V A;  4IQA A;  3CRU A;  2DJJ A;  5ECS A;  3ZZX A;  3MNG A;  4TR3 A;  5ECK B;  5KEJ A;  5J3R A;  4JE1 A;  1FW1 A;  2I4A A;  3DRN A;  4CHS A;  1O81 A;  4FYU A;  2V6O A;  3KCM A;  3IC4 A;  4J2F A;  2MBS A;  4CW9 A;  3RHC A;  2H19 A;  2CZ3 A;  2PN8 A;  3GX8 A;  4AGS A;  1TI1 A;  1JLW A;  2GZZ A;  4X0X A;  2MBT A;  5IQY A;  3IAS 2;  1XW6 A;  3DXB A;  4RQR A;  1EWX A;  2X8H A;  3KH7 A;  1SK2 A;  2FHE A;  1XWB A;  4I5Q A;  3L0H A;  5AN1 A;  5IM9 A;  3FR9 A;  4ZIJ A;  5A4W A;  2VLT A;  2AV4 A;  3TJB A;  1AAZ A;  2DBC A;  1JHB A;  1V40 A;  2CAI A;  5LNK e;  3M3M A;  4G0K A;  4TKY A;  3GH6 A;  2HRA A;  2D2Z A;  2VOC A;  3DVX A;  1SYR A;  4PQH A;  5H5Q A;  1SD9 A;  4PXO A;  2HZF A;  5A4U A;  4HOJ A;  4DVC A;  3CTG A;  1TU7 A;  2OAD A;  2PVQ A;  1BJX A;  4PQ1 A;  4K9Z A;  4PX1 A;  4N0Z A;  2DSA A;  4H86 A;  2VCV A;  3S9F A;  4K1F A;  3W6G A;  1TK0 B;  1A2L A;  2C8U A;  1SL1 B;  3R2Q A;  2ON7 A;  5KN2 A;  3IA1 A;  3TKQ A;  1TJD A;  1XOA A;  2GSR A;  3KIJ A;  1NHO A;  2C0F A;  3FMW A;  4MH3 A;  2DML A;  3CYN A;  2IPA A;  4MF6 A;  1B4Q A;  3C1R A;  4K6X A;  3MYD A;  3TKR A;  3IHQ A;  3GUR A;  2MMO A;  3US3 A;  5EPF A;  1E2Y A;  3HHV A;  3MIX A;  3LSZ A;  1X9W B;  4KDX A;  2GDR A;  2BJX A;  1TRV A;  4AF2 A;  2ALB A;  2L4C A;  3CTF A;  2C0E A;  2B1K A;  2R4V A;  1YEP A;  5CRG A;  3ZIV A;  2VUP A;  2XHF A;  2TRX A;  3ME8 A;  1FO5 A;  2YJ7 A;  5CAX A;  2CAQ A;  1B9X C;  1GH2 A;  4G9H A;  3UBK A;  4I6X A;  3ZVJ A;  1JZO A;  1H4O A;  3G9B A;  1Z9H A;  2H72 A;  2MMN A;  2HSH A;  2JAD A;  2JZR A;  4Z2U A;  1PX6 A;  1ABA A;  1HNC A;  1K0M A;  2A2R A;  2DC5 A;  3ZRE A;  4ZB6 A;  2A4H A;  3IE3 A;  4ZL8 A;  1PL1 A;  2F51 A;  2MYG A;  3O3T A;  3D22 A;  4JR6 A;  5KOX A;  1JLV A;  2ZCT A;  3Q18 A;  4EL1 A;  5E59 A;  3GKM A;  1M7T A;  4WR4 A;  2F8A A;  1XPV A;  5DQY A;  3LGC A;  1KNG A;  2QKE A;  3GNJ A;  4MJC A;  2JAC A;  5ABR A;  1GUM A;  4BL7 A;  1U6T A;  2I3Y A;  2H8L A;  1K3O A;  1ZCP A;  3P7X A;  4PNG A;  1VRS D;  3C7M A;  5HR2 A;  3GN3 A;  4JED A;  3VUR A;  7GSS A;  3LXT A;  1I5G A;  3KMO A;  4PUA A;  1GTI A;  1ERU A;  1R7H A;  1V2A A;  2DKI A;  1JZW A;  1X5E A;  4Z2T A;  3A3T A;  4ML1 A;  4QL7 A;  5DVB A;  5CRD A;  2B5Y A;  1PD2 1;  1YY7 A;  3A5I A;  2F9S A;  4K5R A;  2CA8 A;  4IN0 A;  2A2P A;  2LEG A;  1OC3 A;  2DJ2 A;  2OA7 A;  3QFB C;  1PN9 A;  1M9A A;  4DSR A;  3M9K A;  4TRX A;  2C0D A;  1RW1 A;  1GSU A;  4G2E A;  1V9W A;  3KJY A;  3PIN A;  2AHE A;  4BA7 A;  4F9Z A;  3G7Y A;  4HI7 A;  3WGX A;  2YV7 A;  1K0A A;  1VF3 A;  2FUG 2;  2KHP A;  3DVW A;  1FB6 A;  4OO5 A;  5LCZ A;  1DBY A;  3DKS A;  3FW2 A;  3ZLP A;  5B8A A;  6GST A;  4ACS A;  4NWY A;  4YKG A;  3UL3 A;  3TJJ A;  4JZQ A;  2M46 A;  1YEX A;  4YH2 A;  3UVH A;  2WFC A;  2AJQ B;  2EC4 A;  2NDO A;  3QMX A;  1GUL A;  2VL2 C;  4Q5F A;  3VWW A;  3AY8 A;  3BCK A;  2FWH A;  2BTO T;  4OO4 A;  2K8S A;  2HFD A;  4POK A;  4X4J A;  3EYT A;  4KND A;  2HNL A;  4K0N A;  1O8X A;  5J41 A;  1J0F A;  1GTU A;  4BL7 B;  3LG6 A;  4WET A;  2P31 A;  2LJA A;  3FKF A;  2RLI A;  2R37 A;  1TU8 A;  2VL3 A;  1TKD B;  2O89 A;  18GS A;  2VLV A;  1O85 A;  1EEJ A;  4V2M A;  3WT2 A;  5G5E A;  4LLR A;  3TRP A;  3PPU A;  2OBI A;  2GSQ A;  1TI3 A;  3EU4 A;  2IJY A;  5ECR B;  5GST A;  3IC8 A;  3GKX A;  3IDV A;  3TRQ A;  1K0C A;  5ELG A;  5COH A;  4ZIL A;  5GZZ B;  4HU9 A;  3FEU A;  2E0Q A;  1GSD A;  1HYU A;  5DAL A;  4OD7 A;  1VF4 A;  3GL5 A;  3TGZ A;  4DSS A;  2WZ9 A;  1WE0 A;  2FGX A;  3FZ4 A;  4FIW A;  1DE2 A;  3E9J B;  2VCQ A;  4HZ4 A;  2HRN A;  4KGI A;  4POL A;  3ZFB A;  3ZL5 A;  1CQG A;  4O32 A;  4K7O A;  12GS A;  4YQU A;  22GS A;  1M99 A;  2C0G A;  1WPI A;  3I9V 2;  2OAC A;  2PU9 C;  2KLX A;  1GSE A;  5CP1 A;  4BVX A;  4IHU A;  3KP8 A;  3EIN A;  2L6C A;  1SKR B;  1XVW A;  1YJ6 A;  4I2T A;  2P5Q A;  3N9J A;  3UMA A;  3H8Q A;  2FLS A;  2MZC A;  3GKK A;  1SYX A;  2IFQ A;  1I9D A;  3UAR A;  3F4T A;  1XW9 A;  3F4S A;  1A2J A;  3ZML A;  2O85 A;  3VPT A;  4KH7 A;  4DEJ A;  1WMJ A;  4IP1 A;  1K0B A;  1W89 A;  3TJG A;  3CXG A;  3M9J A;  1B4P A;  6GSV A;  2E2M A;  5FHI A;  1Z6N A;  2H30 A;  3R3E A;  1AQV A;  2B7K A;  17GS A;  4P3Y B;  3IPZ A;  1EGO A;  1PGT A;  3BCI A;  1IYH A;  4G19 A;  4Q5N A;  4J56 E;  1W4V A;  3KTL A;  5JCU A;  1PKZ A;  2IME A;  4I2U A;  2G2Q A;  2L5O A;  4AJ6 A;  1GSS A;  2LQO A;  2H6Z A;  1A8L A;  4MZB A;  4NHW A;  2YWO A;  1NW2 A;  5D93 A;  3IK7 A;  3A2V A;  2H1G A;  4BWQ A;  1EEM A;  5J9B A;  1EZK A;  4IQ1 A;  2N5F A;  4GLT A;  4TR4 A;  3WT1 A;  2C4J A;  5DAL B;  1EV4 A;  1Z5Y E;  4DSS B;  3APO A;  3RHB A;  3TKS E;  2L57 A;  1XVQ A;  2HI7 A;  1A8Y A;  3BBY A;  5CO3 A;  3M0F A;  5H5S A;  1XWK A;  1K0O A;  5JWQ B;  5JWO B;  1FHE A;  1X5C A;  2VL2 A;  1VF2 A;  4KDY A;  1AUC A;  2FY6 A;  3HVX A;  4JU5 A;  3KZQ A;  2NPB A;  5DBQ A;  3C71 A;  3VK9 A;  4LL1 B;  3Q6O A;  2CX4 A;  4CDO A;  4BVX B;  3ZIJ A;  1EOH A;  2CZ2 A;  4MP4 A;  1UA5 A;  3CSJ A;  4RI6 A;  2GQK A;  3WD6 A;  3J7Y k;  4KE3 A;  3WYW A;  4GSS A;  3C73 A;  2YAN A;  2WJU A;  4EUY A;  4YAP A;  1VF1 A;  4IJI A;  2VCZ A;  4Q5R A;  4RQX A;  4XTS A;  1PL2 A;  2IFQ B;  4EDZ A;  1X5D A;  2FWF A;  2EIO A;  5G30 A;  1OYJ A;  1G0T A;  2LNT A;  3QOU A;  4FH8 A;  3GRX A;  1FVK A;  2K9F A;  4IP6 A;  5IMA A;  2VCX A;  5KOW A;  4MJE A;  3U6V A;  4EKZ A;  2H1D A;  1AQW A;  1PA3 A;  2LRN A;  2F3M A;  4X43 A;  3TJK A;  2LS5 A;  1ACV A;  4TR1 A;  3APQ A;  2YP6 A;  3MWH A;  4MF5 A;  3F6D A;  1BYE A;  2GT5 A;  1E6B A;  2HXK A;  1ERW A;  4L5L A;  3CMI A;  3HJO A;  1BG5 A;  3HVS A;  3P2A A;  1PKW A;  4X1U A;  1XWC A;  2YWI A;  2PWJ A;  4ILF A;  4L8E A;  1DUG A;  2LKU A;  3MSZ A;  1QK8 A;  2I81 A;  2I9H A;  4YQM A;  5A5K A;  2X99 A;  4HDE A;  4N10 A;  3V1W A;  4WXT A;  3QCP A;  2DJ1 A;  1T00 A;  3TUE A;  1JZR A;  2FNO A;  3WGD A;  1G7E A;  1R26 A;  1EV9 A;  3GHA A;  4GST A;  1ZOF A;  3UAP A;  4CY8 A;  2IL3 A;  5H5R A;  1SL2 B;  2JZS A;  2DJ3 A;  1WWJ A;  3Q19 A;  5IMZ A;  2L4Q A;  5JCW A;  4OCF A;  1FG4 A;  3ZTL A;  3HJP A;  3F9U A;  3DD3 A;  4GSN A;  3QR6 A;  2LRC A;  2TIR A;  1BX9 A;  4PTS A;  4G0I A;  3FY7 A;  4MF7 A;  4MCU A;  2C3N A;  5G1L A;  2FWG A;  4LA1 A;  3EU3 A;  1MDJ A;  2KUC A;  3RDW A;  1V58 A;  4YAV A;  1CQH A;  2RUE A;  1GNW A;  1AW9 A;  2A2S A;  3SBC A;  5G1K A;  3FRC A;  2PVO C;  3FR6 A;  5G31 A;  1MD4 A;  3EWL A;  5HR1 A;  2VCW A;  4K2D A;  3G7J A;  3MDK A;  4F0B A;  1S3D A;  3GV1 A;  2FA8 A;  5KN3 A;  1FAA A;  4K5S A;  2MMA A;  2HLS A;  1ON4 A;  4K8M A;  3FZA A;  2IMF A;  4F0C A;  9GSS A;  4EO3 A;  4TR1 B;  4ZB9 A;  3PR8 A;  3NOF A;  19GS A;  2IIY A;  5EY6 A;  5ECN B;  1XCC A;  5ECP B;  1XXU A;  2PBJ A;  1A0R P;  3N5O A;  4JRR A;  5ECM B;  2XPE A;  3E0U A;  3KXO A;  2K6V A;  4ULX A;  1A24 A;  2IMK A;  3EPT A;  2DJ0 A;  3KM6 A;  3RAZ A;  3GIX A;  1M2D A;  2HZE A;  2UZ8 A;  1GTB A;  3ERG A;  3HYP A;  5ENU A;  2ON5 A;  1AC1 A;  2O8V B;  1UC7 A;  2V41 A;  4XIH A;  3A5W A;  6GSW A;  1WIK A;  2LV3 A;  2OJL A;  4FO5 A;  3KGK A;  3QAW A;  2H1A A;  2GQL A;  3APS A;  4ID0 A;  2PER A;  4DSQ A;  1YKA A;  4NV2 A;  1OAZ A;  10GS A;  1YQ1 A;  4QL9 A;  1B48 A;  5DCG A;  1JFU A;  1GNE A;  2QSI A;  1GRX A;  4RUV A;  2VLU A;  1VGL A;  4MPG A;  4N30 A;  4XRD A;  3CSH A;  2CX3 A;  4E8E A;  4FYB A;  5JCG A;  3ZRD A;  1F37 A;  3BD2 A;  1SKW B;  1GUK A;  4KUN A;  4PUR A;  2CV4 A;  2KP1 A;  1TOF A;  2V32 A;  2YV9 A;  3H93 A;  1SK1 A;  2EIQ A;  3HZ8 A;  2VL9 A;  3QFA C;  1TRU A;  3QAG A;  2WDU A;  3GUS A;  4Q5Q A;  1TTZ A;  5GAN D;  2H6Y A;  2YNX A;  2IWT A;  1U88 A;  1AIU A;  2H1B A;  3D4T A;  1USB A;  1G6W A;  3VWV A;  3Q74 A;  2NVL A;  2N5B A;  4ZL7 A;  2XC2 A;  2OBK A;  1ZMA A;  5IO2 A;  1NHY A;  4HU7 A;  3D0Z A;  3GST A;  4ECJ A;  1SD8 A;  3FYG A;  1YF1 A;  4XS6 A;  3GTU A;  4WEY A;  4EE0 A;  5B8B A;  2B5X A;  2PUK C;  1SU9 A;  3EVI A;  1BAY A;  3IXR A;  4TXV A;  4O5R A;  2B5E A;  2IMD A;  2E7P A;  5DQS A;  1T3B A;  2QC7 A;  3G7I A;  5IOX A;  4WBR D;  1XOB A;  2CT6 A;  1GTA A;  1K3Y A;  3VI7 A;  1S3C A;  4MPF A;  2I1U A;  3HJM A;  2GVP A;  4HZ2 A;  1M0U A;  2R2J A;  3A2W A;  1N8J A;  3H4K A;  5C04 A;  3QPM A;  3L9V A;  5IPG A;  1MD3 A;  4POM A;  1YZX A;  4YQV A;  1O8W A;  5E4W A;  1SEN A;  4G10 A;  2AB6 A;  4KAE A;  2R6K A;  2HZE B;  4XRA A;  2R0G A;  3C8E A;  2IN3 A;  2RUF A;  5LD0 A;  3DEX A;  4BPY A;  2GST A;  2H0I A;  1X9M B;  3ME7 A;  1Q98 A;  3D6I A;  4GCI A;  1ML6 A;  3VFI A;  2H74 A;  5J4U A;  4F2I A;  1Z3E A;  2X64 A;  5HFI A;  2C3Q A;  1S3A A;  4ZL9 A;  4FYC A;  2KOK A;  1ZZY A;  1OC8 A;  5HR3 A;  3F63 A;  5DAK A;  4MJB A;  3HA9 A;  1V98 A;  5D9X A;  3GKN A;  2C1Y A;  3EMP A;  5HFK A;  5AIX A;  2GS3 A;  1LBK A;  2O7K A;  1U3I A;  1G7O A;  2P0G A;  3LFL A;  2ZNM A;  1QXH A;  4IJ3 A;  5EL8 A;  3L9U A;  2WUL A;  3FHK A;  2AUV A;  1OE8 A;  3HVV A;  3TB2 A;  1TK5 B;  3IR4 A;  3GSS A;  3GX0 A;  2DIY A;  4ZB8 A;  3UEM A;  1KTE A;  5KN0 A;  1PRX A;  3IOS A;  3GTU B;  2QA1 A;  1PMT A;  1TXX A;  2HSM A;  3JCM L;  6GSX A;  2H76 A;  3IV4 A;  1XWA A;  1KEB A;  1AXD A;  3I69 A;  1OKD A;  2VCT A;  2VIM A;  2J23 A;  2M72 A;  2GTU A;  2BMX A;  3GA4 A;  4TN8 A;  4MZC A;  3MAK A;  1DSB A;  1FVJ A;  4MH2 A;  1ERT A;  2EIR A;  1SK0 A;  2QA2 A;  3GMF A;  1EOG A;  4HJ2 A;  5DJM A;  4MZW A;  1LU4 A;  2MMZ A;  2YWN A;  3WGE A;  5L71 A;  3UVT A;  3CSI A;  4EVM A;  5HFG A;  2V1M A;  4HUA A;  4IKH A;  3KP9 A;  1F9M A;  2RM6 A;  5D9V A;  4KF9 A;  4KX4 A;  5D73 A;  1QMV A;  2K8V A;  3ERF A;  4NPB A;  2E2G A;  4MA9 A;  3EUR A;  3LQ7 A;  3EMX A;  2LTK A;  4O92 A;  4ZBD A;  2DJK A;  2GZP A;  5D9W A;  1C72 A;  2GGT A;  5A4V A;  1V57 A;  3TDG A;  1F3A A;  4D73 B;  4V1A g;  1OE7 A;  2HSY A;  2V6K A;  4N0V A;  1SJZ A;  2JL4 A;  4BVY A;  2VM1 A;  5GAP D;  3IBH A;  1FOH A;  4IVF A;  2H6X A;  2R3X A;  4ECI A;  1WOU A;  3UBL A;  1QQ2 A;  5CNW A;  5F0G A;  4AJ7 A;  2N5A A;  3IHG A;  11GS A;  3NIV A;  2VO4 A;  5DAK B;  3QD9 A;  2V2G A;  3DWV A;  1SL0 B;  14GS A;  5B6N A;  2H70 A;  6GSY A;  5GSS A;  1YF0 A;  4E8H A;  2LJR A;  3VWX A;  1J9B A;  2VD0 A;  2H73 A;  2PGT A;  4K0G A;  6GSS A;  4XS1 A;  5DDL A;  2YOI A;  3QAV A;  2LJK A;  1HNA A;  4EF0 A;  1GLQ A;  3LOR A;  1ILO A;  4POB A;  1ZGN A;  3L4N A;  1THX A;  2YCD A;  3OR5 A;  1U3A A;  4GTU A;  5BRT A;  4HQZ A;  2YJH A;  4V2L A;  3LWA A;  2DMM A;  3VWU A;  4WR5 A;  4KA0 A;  1K0D A;  5HQP A;  4ZBA A;  3FZ5 A;  3F3R A;  4XCS A;  2AYT A;  1YKC A;  2JU5 A;  1AQX A;  3SWL A;  1RQM A;  1SJI A;  1TK8 B;  1T8E B;  2HE3 A;  5IMD A;  3UJ1 A;  1T4Y A;  1FB0 A;  2HT9 A;  4V2N A;  3DML A;  2LUS A;  1ZYQ B;  3CBU A;  3BOA A;  2OKA A;  3H1N A;  2R0C A;  5BMU A;  5G2Z A;  4I97 A;  4EDY A;  4LL4 B;  8GSS A;  1J08 A;  4OWY A;  1M2A A;  4PNF A;  2ZUP A;  3TOU A;  1GSF A;  3TKS C;  4JR4 A;  4PGT A;  5AIV A;  4BVY B;  4ECB A;  4GRF A;  5IMV A;  4ECC A;  4IBP A;  1GL8 A;  2WRT A;  5DCH A;  5ECI B;  2GLR A;  4MLY A;  4OFM A;  13GS A;  3IRA A;  1Z7R A;  5B6M A;  3NZN A;  4IS0 A;  2HRF A;  3PH9 A;  2GT6 A;  2WS2 A;  3P8W A;  2VAF A;  3CRT A;  1ERV A;  2P5R A;  3M1G A;  4TOP A;  2Z9S A;  1NM3 A;  3ZMK A;  2GQM A;  1URM A;  2H0G A;  2PPT A;  1R5P A;  3RPN A;  3LYK A;  4NMU A;  2NBS A;  2IMI A;  1UN2 A;  2F8F A;  5C00 A;  4GXZ A;  4HS1 A;  2XBI A;  3HXS A;  1F6M C;  2OE3 A;  2NTO A;  2O87 A;  4EC0 A;  2CVD A;  4MNN A;  4YKF A;  4J57 E;  16GS A;  3HY2 A;  3FR3 A;  3LXZ A;  4USS A;  1Y6E A;  2CQ9 A;  1K0N A;  4HQS A;  2H0H A;  3J7Y b;  2WCI A;  3E3E A;  5F8B A;  2X8G A;  4PUF C;  4WBJ A;  5F07 A;  4BWS A;  1GSY A;  2C80 A;  4FQU A;  1EP7 A;  4OFN A;  3ZYW A;  3A2X A;  2X49 A;  1OKT A;  1MTC A;  2H01 A;  5FT3 A;  6GSU A;  4WF4 A;  5CRH A;  5D9T A;  4EIP A;  5KN1 A;  1NSW A;  4GF0 A;  2HRK A;  2R0P A;  4IGJ A;  3HDC A;  3GYK A;  1G6Y A;  5ECL B;  3TRX A;  4NV5 A;  2FCH A;  4ICY A;  5ID2 A;  2DKH A;  1RK4 A;  3D4M A;  3TCO A;  3KEB A;  4KCE A;  4OCE A;  2C3T A;  2WGR A;  3UIW A;  4WF5 A;  1TP9 A;  1IYI A;  1N2A A;  4TR0 A;  3O6T A;  3I43 A;  4ML6 A;  2J9H A;  3P90 A;  4V1A p;  5D8I A;  2YN1 A;  4HEA 2;  1EP8 A;  5IMF A;  3LJR A;  3HCZ A;  3LW9 A;  4F03 A;  1XWG A;  3TKP A;  4IEL A;  2YWM A;  1B9Y C;  4MK3 A;  2OE1 A;  1QUW A;  1B8X A;  1Q4J A;  4F82 A;  4MJA A;  1F3B A;  4ZBB A;  2L59 A;  1UVZ A;  2FA4 A;  5CYY A;  4O5Q A;  1ZYP A;  3D5J A;  2G0F A;  1Z7P A;  3C1S A;  2JZT A;  1XIY A;  5D96 A;  4EXJ A;  4KSM A;  2JSZ A;  1M2B A;  4RI7 A;  2B6M A;  3IK9 A;  3FK8 A;  2LQQ A;  4I8B A;  1TDI A;  4N11 A;  1XBS A;  5F06 A;  2GSS A;  1F2E A;  1R4W A;  5F05 A;  1OC9 A;  2PMT A;  4KW6 A;  2YZU A;  2ES7 A;  5ECO B;  3F3Q A;  1OVN A;  3H79 A;  1O6J A;  5IIZ A;  1TW9 A;  3VLN A;  2DLX A;  5JWR B;  2YPM A;  3KH9 A;  2TRC P;  2K18 A;  5ECQ B;  4O7H A;  2GZY A;  1QGV A;  1PSQ A;  1ZYE A;  5DJL A;  4XHM A;  1KBN A;  3TKS A;  2VM2 A;  4KB3 A;  4ZXG A;  4ISD A;  2B3S A;  1XZO A;  1T7P B;  5G5F A;  1YDK A;  2RM5 A;  4WKW A;  2FWE A;  2FD3 A;  4L0W A;  5INY A;  1EGR A;  4IW9 A;  2X8C A;  4K2X A;  1HD2 A;  4MMM A;  2B1L A;  3PGT A;  5IO0 A;  5ECH B;  4PQI A;  1SJ6 A;  1XW5 A;  5ID2 B;  4AJ8 A;  2OE0 A;  3LYP A;  1GP1 A;  3EE2 A;  1O7U A;  3HD5 A;  3O76 A;  4XS4 A;  3ED3 A;  1PX7 A;  1ZL9 A;  2REM A;  2XPD A;  3KMN A;  1DE1 A;  1TRS A;  4GQC A;  3DYR A;  1O73 A;  1ZYN A;  2KP2 A;  2WB9 A;  4TXO A;  4L5O A;  5IPH A;  4KSO A;  3DIE A;  5FWG A;  3GH9 A;  4D73 A;  1PQN A;  3KD0 A;  3ERW A;  5ELA A;  1BED A;  2XBQ A;  5CRE A;  4NHZ A;  4NAX A;  4G0L A;  2JSY A;  1TRW A;  3ZFL A;  3GL3 A;  1MDK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...