1ST9A

Crystal structure of a soluble domain of resa in the oxidised form
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
137
structure length
137
Chain Sequence
EGSDAPNFVLEDTNGKRIELSDLKGKGVFLNFWGTWCEPCKKEFPYMANQYKHFKSQGVEIVAVNVGESKIAVHNFMKSYGVNFPVVLDTDRQVLDAYDVSPLPTTFLINPEGKVVKVVTGTMTESMIHDYMNLIKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Thiol-disulfide oxidoreductase resA
publication title Structural Basis of Redox-coupled Protein Substrate Selection by the Cytochrome c Biosynthesis Protein ResA.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 43
structure length 137
sequence length 137
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1st9A00
1LJRA 1M7TA 2GGTA 3A2XA 4FYUA 4MZCA 1TU7A 1YY7A 5IPGA 1GLPA 3GTUB 3NOFA 2HZEB 3HZ4A 3EC3A 5H5RA 2YWIA 5A5KA 3QAWA 4KDUA 1RQMA 3DIEA 2X99A 1ZYEA 3QPMA 3KCMA 4JU5A 5DBQA 6GSSA 2YANA 3TOUA 2VUPA 5HR1A 4JZQA 1M2AA 3ZVJA 4MF5A 4QQ7A 3ERGA 1M2DA 2H6ZA 2YZHA 5DALA 1EGOA 3EMXA 4K1FA 4EVMA 5IPHA 2M46A 1K0BA 5IMVA 2C80A 1TI1A 4KSMA 2GZZA 2VO4A 4PQ1A 2NTOA 2WULA 3A5WA 1VF1A 5ABRA 1A8YA 1HD2A 1YZXA 5IO2A 2EIRA 3KEBA 4IQAA 4FH8A 2VL9A 1CQHA 2PERA 3HD5A 1X0RA 2K9FA 4HU9A 3GMFA 1ZCPA 2GSTA 2CX4A 1F6MC 2RM6A 3A2VA 2CZ3A 1KEBA 3PR8A 4V1Ap 3LXTA 4J2FA 4AJ8A 4PX1A 4KA0A 3O76A 2R6KA 3QMXA 2WDUA 1XW5A 1GTAA 2GQMA 1GTIA 4BVYA 1PX7A 1EOHA 5CP1A 5JCWA 2H70A 5F07A 4AJ7A 5CYYA 2YJHA 2A2SA 2KUCA 1SD9A 4MJEA 3MNGA 1FB0A 3FK8A 3ZL5A 2JZTA 2B7JA 4PUAA 4MJAA 2X8GA 4ILFA 2VL2C 2HSHA 6GSYA 2IMDA 4PXOA 2VCZA 4I5QA 4HS1A 8GSSA 4RQRA 3L9SA 2YPMA 2LJKA 5DQSA 3IRAA 2VCVA 1BG5A 4LMVA 3GIXA 1ZOFA 2C3NA 3LXZA 3UOMA 1AQXA 2LNSA 2R4VA 1X9SB 4IP1A 2B7KA 2CZ2A 4MABA 4MPGA 3VI7A 3QAGA 3QAVA 2YCDA 1V57A 5CREA 4HJ2A 5GAPD 3IDVA 4ISDA 2FHEA 3U6VA 5J41A 2L57A 4NHWA 3FRCA 3M1GA 2IN3A 4L0UA 2YWNA 3GX8A 1FG4A 2HZFA 3RAZA 5D9WA 2LRCA 2NVLA 2GTUA 5ID2A 1ZZYA 5ENUA 3ZYWA 2MMOA 3DGQA 2GS3A 2LQOA 2HXKA 3O6TA 1JZOA 2B5EA 4WF5A 3Q18A 3KD0A 5HR0A 4F82A 2CQ9A 3EURA 2OBIA 3APOA 5L71A 4KSOA 2XBIA 4F03A 3FKFA 1K0DA 1GSDA 2ON5A 4KGIA 1X9WB 2IPAA 2ON7A 5IOWA 1GSQA 1GTUA 3CSIA 4ZILA 3I43A 1F9MA 4KDXA 4MZWA 2DMLA 1ACVA 2KP1A 3GKXA 3CTGA 1X5CA 3HVVA 2O85A 1VGLA 2CAIA 4ZL9A 1QFNA 3WGDA 2XPDA 1MDJA 4ECIA 2K8VA 3FZ5A 3CTFA 4GRFA 2HI7A 3K8NA 2H0HA 1B4PA 4KCEA 3CYNA 3GN3A 4G19A 3RHCA 4X1UA 2TRCP 3GH6A 3ME7A 4MA9A 3C1RA 2IMFA 1B4QA 2WCIA 4MCUA 4J57E 3VK9A 1FO5A 2BJXA 4NAXA 4BVXA 2IMIA 2KHPA 2LS5A 2VD1A 1W4VA 2VLTA 5AIVA 1TK8B 2IWTA 3G7JA 1V9WA 2P31A 2VCTA 1TRSA 2H72A 4OO5A 3TJBA 2PMTA 5EPFA 4XRDA 3UEMA 1XPVA 5G5EA 4CHSA 5D9VA 1PRXA 1ILOA 2XBQA 3GV1A 2J23A 3IOSA 3IAS2 3BBYA 1FVJA 3CRTA 1THOA 2H19A 1W89A 2VM1A 4TR0A 3IE3A 2VIMA 4F0CA 1EV4A 5D73A 4XHMA 2DJKA 1O85A 3ZFBA 2HNLA 2B1KA 2OADA 5FHIA 5B8AA 4HQZA 5GSTA 2FGXA 1AIUA 4KAEA 2MBTA 4XIHA 3LJRA 3VFIA 2DBCA 4BPYA 1M9BA 1K0OA 5ELAA 3GL5A 4IN0A 1GUHA 5A4UA 1YDKA 3HDCA 2EIQA 4ZIJA 4BWSA 4K7IA 19GSA 2MMNA 17GSA 4OD7A 3HJMA 2CA8A 1OC8A 2MBSA 5F05A 4ECCA 1BYEA 2H01A 2H74A 2VCXA 3UVHA 2QSIA 20GSA 1SU9A 3E9JB 3R2QA 1A0RP 3WT1A 1CQGA 2OBKA 3TOTA 4D73A 1T7PB 4KX4A 3L9VA 1NHOA 1QQ2A 1O6JA 3F9UA 5IMFA 1ZMAA 4K6XA 6GSVA 3ISOA 2LRNA 2V6OA 1VF2A 5IO0A 3KTLA 2VLVA 3TRPA 2D2ZA 1I5GA 3CSJA 2LUSA 3DMLA 3NIVA 1KBNA 5DQYA 5F0GA 3HJPA 5CAXA 1U6TA 1G7OA 2PVQA 1XBSA 2WJUA 5JWRB 2HSYA 4L5OA 3CBUA 1JLVA 1OC9B 3A3TA 4PNFA 5DJLA 3HY2A 5CRWA 3TKPA 3VPQA 1FW1A 4TXOB 3HVXA 2LNTA 1LBKA 3GKMA 5ECLB 3RHBA 4CW9A 2ZNMA 5DAKA 4POBA 1T4YA 4WBRD 1XIYA 2DSAA 10GSA 3IV4A 4TR1B 4LL4B 3BOAA 3F3RA 4K0GA 1EP8A 1GL8A 4GSTA 2PVOC 2EIOA 3Q74A 1GSYA 1QK8A 2GT5A 4OWYA 11GSA 1XWGA 1Q98A 1A8LA 3RPPA 1NSWA 1A2LA 3TKRA 1HQOA 3FW2A 5F06A 5KN2A 3D0ZA 2VLUA 1XOBA 4FO5A 3WYWA 3ZTLA 1IYIA 2X8CA 2PPTA 3EU3A 3LEFA 3ERFA 3G7YA 5HFKA 3ZMLA 1X5DA 2OE0A 2OACA 4KE3A 4EDYA 1O7UA 1SYRA 2VCWA 4WEYA 3HCZA 2VOCA 3TJFA 2IFQA 2IL3A 4RI7A 4Q5RA 1NHYA 2CAQA 1GH2A 4POLA 4G2EA 5COHA 1SK1A 1WOUA 2I9HA 4MPFA 3M9JA 3GTUA 3RBTA 1BAYA 2HZEA 1XWAA 3WD6A 1GUMA 1I9DA 2FA8A 2V6KA 4NHZA 3ZFLA 1V2AA 1O81A 4ACSA 4FIWA 3F6FA 2H6YA 4RUVA 5JWQB 1AC1A 3C1SA 2X8HA 2OKAA 1R4WA 5ELGA 2AB6A 1PMTA 2E7PA 2R3XA 4OFTA 4G9HA 1FHEA 1BQ7A 2RUEA 1B9YC 1V58A 2E2GA 3H4KA 3DWVA 3TGZA 3TUEA 4MK3A 3ME8A 2CVBA 3SBCA 5D8IA 2R5GA 4PGTA 1GULA 3GA4A 2L59A 4EKZA 3IK9A 3LWAA 1TI3A 2ES7A 3VPTA 5IMDA 3GX0A 3SWLA 1ML6A 3L0HA 2WB9A 3GKNA 4NMUA 2GQKA 2QGVA 3EYTA 4HOJA 1AAZA 3KH9A 2JADA 5DVBA 1A0FA 1WRYA 3QD9A 2B5YA 1YEPA 1YQ1A 4ML6A 3US3A 2KOKA 2GSQA 3CMIA 3IC4A 4YQVA 3ZIVA 1SL0B 1K0NA 3D6IA 1EGRA 3LGCA 4KH7A 3HHVA 3LFLA 2LJAA 1PA3A 1BJXA 1Z7RA 2YWOA 4MF7A 3FYGA 5B7CA 4TW5A 3IAM2 3EVIA 3F6DA 2H1BA 1MEKA 3QOUA 1SKSB 4IKHA 3BCIA 5A4WA 4ECBA 2RUFA 4H86A 2WS2A 3GYKA 3TKSA 4JBBA 2HRFA 3GFKA 4WETA 1Z3EA 2AJQB 3KMNA 3ED3A 1LU4A 3H8QA 3P2AA 3I6AA 1K3LA 5DDLA 1ON4A 3DRNA 1K0AA 2HE3A 1JHBA 4EF0A 4IW9A 1SYXA 2L6CA 4TXVA 2C0DA 4NXIA 1URMA 2HRNA 2XHFA 5D96A 2ALBA 1U3IA 3ZITA 2O89A 4MF6A 4MJCA 3TJGA 1OKTA 4GLTA 4HEA2 1XWBA 5GAND 5ECKB 3HVSA 4K0NA 3KZQA 4PQIA 4KUNA 2FWEA 5CRDA 4XCSA 1UC7A 2MYGA 3FZ4A 4CDOA 4TR3A 3LSZA 1SENA 4F0BA 5C04A 1SL1B 1GSEA 1EP7A 1S3AA 4DSQA 4IHUA 4KW6A 3H79A 2MZCA 4HZ2A 2QKEA 5KEJA 3GURA 4YH2A 1U3AA 1R26A 1JZDA 4KDYA 1XW6A 3E3EA 1K0CA 4YAVA 1EZKA 2HLSA 1PGTA 4XTSA 2GSRA 1HNAA 1F3AA 3LG6A 4K7OA 1GSSA 5H5QA 1T8EB 3F4TA 1C72A 5FT3A 2TIRA 2C8UA 1ERVA 3UIWA 3TJKA 1ZYQB 1YKCA 2L6DA 4NWYA 2PUKC 3L4NA 3DEXA 1X5EA 5ECQB 1KNGA 3BCKA 2F8AA 4XRAA 2YOIA 2K6VA 2BTOT 2F9SA 2VAFA 5ECRB 5KN3A 1YF1A 4E8HA 5ECPB 4NPBA 2JSZA 3QR6A 1T1VA 2ZCTA 1YKAA 1UA5A 3VLNA 1VF3A 3M9KA 4ML1A 1N8JA 1Y25A 1THXA 3FZ9A 4WR4A 3GH9A 1E6BA 5B6MA 4HJMA 1R5AA 5B8BA 3ZZXA 5CRGA 2YV7A 1XZOA 1BEDA 2Z9SA 4GCIA 3TJJA 4EL1A 4ZL7A 1VRSD 4AF2A 2X64A 4HI7A 2LQQA 3MDKA 2GVPA 2VD0A 2YNXA 22GSA 2G0FA 2LJRA 2FLSA 1ERUA 1WE0A 5IMZA 5IQYA 1ZL9A 4N11A 5HQPA 3F0IA 4OCFA 3QCPA 4EUYA 4HUAA 4GQCA 3UBKA 1M2BA 1WIKA 1GWCA 3W8JA 1TDIA 1TW9A 5G1KA 4IQ1A 3ERWA 4JEDA 1JZWA 4HDEA 5GSSA 2C1YA 4N0VA 2REMA 5E59A 2PGTA 4V1Ag 2CX3A 4I8BA 4V2NA 4Z7XA 2FWFA 4F2IA 2F3MA 3LQ7A 2PU9C 4GF0A 4ZB9A 1V98A 1A23A 2FNOA 6GSUA 5ECHB 5EVOA 4O7HA 3TDGA 5JCGA 1XWKA 1SK0A 3CSHA 4GWRA 3GRXA 4IS0A 1AW9A 2CT6A 3E0UA 5G1LA 4Q5QA 1K3OA 4KCAA 1Z7PA 2H0IA 4Q5NA 5G31A 1O8XA 1ZGNA 4O92A 1USBA 1R5PA 5D93A 2KLXA 1B8XA 4LLRA 1EEMA 6GSTA 2I1UA 3P90A 1MDIA 1OC9A 2JACA 1K3YA 4K2DA 4X43A 5HR2A 3ZVJD 3MAKA 3EE2A 3IBHA 2FWGA 1AUCA 4TXOA 2I3YA 3W8SA 1GRXA 5G5FA 2LKUA 3KIJA 4N10A 3MSZA 4BWQA 2N5FA 2CVKA 2YZUA 1J0FA 3Q19A 5LNKe 5J9CA 2R2JA 1MTCA 3HYPA 5KN1A 4TR1A 2V32A 1PX6A 2M72A 3FEUA 1GNWA 3DD3A 1GLQA 1PKWA 2DC5A 5IMAA 1TRWA 1XW9A 2H6XA 1G0TA 1ERWA 3F4SA 4L5LA 3N5OA 3TB2A 3GHAA 1M0UA 1HYUA 2H75A 2AAWA 5E4WA 4EDZA 2FWHA 2DIYA 4DSSB 5IIZA 3OR5A 2A2RA 3TKSE 4ECJA 2EC4A 2LV3A 4I2UA 2C3TA 2OE3A 1EEJA 1KTEA 1QUWA 3V1WA 5B6NA 4IJ3A 3KP9A 3GSTA 4ZB6A 3LYPA 3LYKA 2BMXA 2H73A 2IJYA 4XS4B 2I81A 3F3QA 5J3RA 1FAAA 3UJ1A 2GZYA 1PN9A 1PQNA 3C8EA 5CRHA 1O73A 3M8NA 1JLWA 3L9UA 1U87A 3N9JA 5ECNB 1GSUA 3UARA 2LEGA 1UVZA 2AYTA 2I4AA 1IYHA 1Z9HA 5ECMB 1ERTA 1H75A 2VM2A 1T3BA 3BJ5A 3IXRA 4AJ6A 3D4TA 5EY6A 4OFMA 2V2GA 9GSSA 4OO4A 3KGKA 3M0FA 3HA9A 2YWMA 2H1AA 1HNCA 4GXZA 1WMJA 2KP2A 4Q5FA 2FA4A 3EINA 3WGEA 2PBJA 4PQHA 3IPZA 1WWJA 1J08A 3I9V2 1QGVA 2LTKA 4MH2A 3S9FA 4N0ZA 2B6MA 3EWLA 3F8UA 1NW2A 1E2YA 1XVWA 1SKRB 2H30A 18GSA 5DCHA 3M3MA 1Z5YE 12GSA 1GUKA 2VL2A 4ID0A 4EXJA 1A2MA 3CRUA 3ZRDA 1O8WA 1XCCA 3KXOA 2HT9A 4L0WA 6GSXA 2FCHA 5AIXA 1OC3A 5J5NA 1GSFA 4JR4A 2L4QA 1SJZA 4V2LA 3J7Yb 2GSSA 2M80A 3TRXA 2OE1A 1JFUA 4PUFC 4LMWA 2AUVA 3FZAA 5EL8A 3UBLA 3UMAA 3RPNA 1EOGA 4ZBBA 5DALB 4PNGA 1EWXA 1Z6MA 3APSA 4P3YB 4WBJA 1YF0A 3C73A 6GSWA 1JZRA 1YJ6A 3DYRA 3GUSA 4TOPA 2J9HA 3MWHA 4GQFA 5ECSA 2NDOA 2XPEA 4ZBDA 2H76A 5JWOB 5HFGA 1XFLA 4YQMA 3ZMKA 5AN1A 5A4VA 1OE8A 4POMA 4JRRA 1ST9A 1Q4JA 1TRVA 2GQLA 1N2AA 2P5RA 1FOVA 1M99A 4LL1B 4IELA 5DJMA 5G2ZA 4X0XA 4TRXA 5DCGA 3VWXA 3GL3A 4I2TA 3HZ8A 3IHQA 4XS6A 1F37A 3G9BA 2CV4A 1XOAA 1B9XC 2E2MA 1Z6NA 2H0GA 2N5AA 3D5JA 4BL7A 2DIZA 1SL2B 2MMAA 3H1NA 2QC7A 4ZBAA 3RDWA 1S3DA 3IA1A 2H1DA 2LSTA 4IBPA 2P0GA 1R7HA 2N5BA 3P7XA 4HU7A 4I97A 2DJ3A 2DLXA 1TXXA 4QL9A 1FB6A 1B48A 1NM3A 5D9XA 5IOXA 4TKYA 2O8VB 1PKZA 3F63A 3UVTA 2L5LA 2H1GA 4MP4A 5IM9A 1T00A 3DVWA 4E8EA 5KN0A 7GSSA 4ZL8A 4TVEA 1S3CA 14GSA 1TRUA 1G6YA 2JU5A 1G7EA 4MDCA 4XS1A 2DJ1A 4G10A 1TKDB 2WRTA 3L78A 2OJLA 1XVQA 2JSYA 3VWUA 1H4OA 4GSNA 2B5XA 1HNBA 4MLYA 4YAPA 5ID2B 1TU8A 3QFBC 1TK0B 3TKSC 1GP1A 4GTUA 3C71A 4WF4A 5AISA 2AV4A 2HFDA 4TN8A 5CNWA 1X9MB 3ZREA 1MD3A 4I6XA 4EE0A 2YP6A 1A24A 5HFIA 4WKWA 4K8MA 1VF4A 4TR4A 3QDNA 4KNDA 4MZBA 2GLRA 3VURA 3FR6A 4MH3A 1DUGA 3DXBA 4OCEA 4GSSA 2NBSA 4LA1A 2C4JA 4AGSA 3EMPA 4O32A 1G6WA 1WP0A 5IMCA 5J9BA 4JR6A 2GT6A 2K8SA 1ABAA 2IIYA 3D4MA 1AQVA 2GDRA 1XXUA 2LRTA 2H8LA 4N30A 4K9ZA 5AGYA 2C0EA 2L5OA 2C0GA 1XWCA 2ZUPA 1YEXA 4O5RA 3KP8A 2IMEA 2V41A 1SJIA 3H93A 1SD8A 3CXGA 1GTBA 2H71A 2YV9A 2A4VA 3KM6A 1Y6EA 2V1MA 2PN8A 1DE1A 5HR3A 1RK4A 4JE1A 3TKQA 2MMZA 4QL7A 3APQA 3EU4A 5GZZB 4J56E 3Q6OA 2F51A 5LD0A 1GNEA 4NV2A 3UAPA 2O87A 1AXDA 3W6GA 4IJIA 5J4UA 3TCOA 1UN2A 3O3TA 2CVDA 16GSA 1A2JA 2WZ9A 5INYA 2PWJA 3ZIJA 3WT2A 1EV9A 2FD3A 1RW1A 3UL3A 3PH9A 3G7IA 3KTBA 1PSQA 13GSA 4BA7A 4YQUA 1PL1A 3TRQA 2DMMA 1TJDA 3HJOA 3U5RE 2O7KA 4PURA 1DSBA 2P5QA 1SK2A 2C3QA 1WJKA 1FVKA 2WGRA 5H5SA 1PL2A 1F3BA 2TRXA 4K7NA 4IVFA 3KH7A 4EC0A 1AQWA 1QMVA 3FR3A 3JCML 1PD21 5FWGA 3D22A 2JZRA 5D9TA 2IMKA 2XC2A 2B3SA 1M9AA 3C7MA 5G30A 3A2WA 1V40A 3NZNA 3VWVA 4V2MA 3BD2A 3DVXA 4DVCA 4DSSA 1TP9A 1OAZA 4FYBA 4D73B 3LORA 4MMMA 2VL3A 3KMOA 1TTZA 2WFCA 4FYCA 3F4RA 2R37A 3I69A 3GKKA 4EO3A 4ZXGA 3HXSA 4IGJA 3FY7A 4RI6A 2C0FA 3P8WA 4XS4A 5CO3A 3ZLPA 2F8FA 3IK7A 4HQSA 1SKWB 1WPIA 3QFAC 5JCUA 4OMVA 5F8BA 4L8EA 3PGTA 3KJYA 4DSRA 3J7Yk 2RIIA 4OFNA 2YJ7A 3GSSA 3FHKA 2L4CA 4NV5A 3AY8A 3DKSA 3HKRA 3WGXA 5DAKB 5LCZA 2JZSA 5C00A 4ZB8A 1DBYA 4DEJA 2FY6A 1OVNA 2JL4A 1OKDA 1K0MA 1TOFA 1QXHA 3PINA 2FUG2 4WR5A 4MJBA 2K18A 1TK5B 3GNJA 5ECIB 2RLIA 1DE2A 2NPBA 3D21A 1BX9A 1F2EA 1OYJA 3VI5A 4IP6A 4WXTA 2HYXA 3VWWA 2GZPA 2H66A 1U88A 2VCQA 2DJ2A 3FR9A 1MD4A 4KB3A 2AHEA 4RQXA 5ECOB 2B1LA 1OE7A 2G2QA 4POKA 2E0QA 2DJJA 4F9ZA 3IR4A 4ULXA 1MDKA 1T4ZA 2OA7A 4HZ4A 2RM5A 1J9BA 2DJ0A 1SJ6A 2IFQB 2YN1A
chains in the Genus database with same CATH superfamily
1LJRA 1M7TA 2GGTA 3A2XA 4FYUA 4MZCA 1TU7A 1YY7A 5IPGA 1GLPA 3GTUB 1FOHA 3NOFA 2HZEB 3HZ4A 3EC3A 5H5RA 2YWIA 5A5KA 3QAWA 4KDUA 1RQMA 3DIEA 4HSCX 2X99A 1ZYEA 3QPMA 3KCMA 4JU5A 5DBQA 6GSSA 2YANA 3TOUA 2VUPA 5HR1A 4JZQA 1M2AA 3ZVJA 4MF5A 4QQ7A 3ERGA 1M2DA 2H6ZA 2YZHA 5DALA 1EGOA 3EMXA 4K1FA 4FQUA 4EVMA 5IPHA 2M46A 1K0BA 5IMVA 2C80A 1TI1A 4KSMA 2GZZA 2VO4A 4PQ1A 2NTOA 4YKFA 2WULA 3A5WA 1VF1A 5ABRA 1A8YA 1HD2A 1YZXA 5IO2A 2EIRA 1PFOA 3KEBA 4IQAA 4FH8A 2VL9A 1CQHA 2PERA 3HD5A 1X0RA 2K9FA 4HU9A 3GMFA 1ZCPA 2GSTA 2CX4A 1F6MC 2RM6A 3A2VA 2CZ3A 1KEBA 3PR8A 4V1Ap 3LXTA 4J2FA 4AJ8A 4PX1A 4KA0A 3O76A 2R6KA 3QMXA 2WDUA 1XW5A 1GTAA 2GQMA 1GTIA 4BVYA 1PX7A 1EOHA 5CP1A 5JCWA 2H70A 5F07A 4AJ7A 5CYYA 2YJHA 2A2SA 2KUCA 1SD9A 4MJEA 3R3EA 3MNGA 1FB0A 3FK8A 3ZL5A 2JZTA 2B7JA 4PUAA 4MJAA 2X8GA 4ILFA 2VL2C 2HSHA 6GSYA 2IMDA 4PXOA 2VCZA 4I5QA 4HS1A 8GSSA 4RQRA 3L9SA 2YPMA 2LJKA 5DQSA 3IRAA 2VCVA 1BG5A 4LMVA 3GIXA 1ZOFA 2C3NA 3LXZA 3UOMA 1AQXA 2LNSA 2R4VA 1X9SB 1PN0A 1S3RA 4IP1A 2B7KA 2CZ2A 4MABA 4MPGA 3VI7A 3QAGA 3QAVA 2YCDA 1V57A 5CREA 4HJ2A 5GAPD 3IDVA 4ISDA 2FHEA 3U6VA 5J41A 2L57A 4NHWA 3FRCA 3M1GA 2IN3A 4L0UA 2YWNA 3GX8A 1FG4A 2HZFA 3RAZA 5D9WA 2LRCA 2NVLA 2GTUA 5ID2A 1ZZYA 5ENUA 3ZYWA 2MMOA 3DGQA 2GS3A 2LQOA 2HXKA 3O6TA 1JZOA 2B5EA 4WF5A 4Z2TA 3Q18A 3KD0A 5HR0A 4F82A 2R0GA 2CQ9A 3EURA 2OBIA 3APOA 5L71A 4KSOA 2XBIA 4F03A 3FKFA 1K0DA 1GSDA 2ON5A 4KGIA 1X9WB 2IPAA 2ON7A 5IOWA 1GSQA 1GTUA 3CSIA 4ZILA 3I43A 1F9MA 4G0LA 4KDXA 4MZWA 2DMLA 1ACVA 2KP1A 4G0IA 3GKXA 3CTGA 1X5CA 3HVVA 1M3JA 2O85A 1VGLA 2CAIA 4ZL9A 1QFNA 3WGDA 2XPDA 1MDJA 4ECIA 2K8VA 3FZ5A 3CTFA 4GRFA 2HI7A 3K8NA 2H0HA 1B4PA 4KCEA 3CYNA 3GN3A 4G19A 3RHCA 4X1UA 2TRCP 3GH6A 3ME7A 4MA9A 3C1RA 2IMFA 1B4QA 2WCIA 4MCUA 4J57E 3VK9A 1FO5A 2BJXA 4NAXA 4BVXA 2IMIA 2KHPA 2LS5A 2VD1A 1W4VA 2VLTA 5AIVA 1TK8B 2IWTA 3G7JA 1V9WA 2P31A 2VCTA 1TRSA 4O5UA 2H72A 4OO5A 3TJBA 2PMTA 5EPFA 4XRDA 3UEMA 1XPVA 5G5EA 4CHSA 5D9VA 1PRXA 1ILOA 2XBQA 3GV1A 2J23A 3IOSA 3IAS2 3BBYA 1FVJA 3CRTA 1THOA 2H19A 1W89A 2VM1A 4TR0A 3IE3A 2VIMA 4F0CA 1EV4A 5D73A 4XHMA 2DJKA 1O85A 4EIQA 3ZFBA 2HNLA 2B1KA 2OADA 5FHIA 5B8AA 2HRAA 4HQZA 4G0KA 5GSTA 2FGXA 3A5IA 1AIUA 4KAEA 4YKGA 4EIPA 2MBTA 4XIHA 3LJRA 3VFIA 2DBCA 4BPYA 1M9BA 1K0OA 4MNNA 5ELAA 3GL5A 3LW9A 4IN0A 1GUHA 5A4UA 1YDKA 3HDCA 2EIQA 4ZIJA 4BWSA 4K7IA 19GSA 2MMNA 17GSA 4OD7A 3HJMA 2CA8A 1OC8A 2MBSA 5F05A 4ECCA 1BYEA 2H01A 2H74A 2VCXA 3UVHA 2QSIA 4O5QA 20GSA 1SU9A 3E9JB 3R2QA 1A0RP 3WT1A 1CQGA 2OBKA 3TOTA 4D73A 1T7PB 4KX4A 3L9VA 1NHOA 1QQ2A 1O6JA 3F9UA 4X4JA 5IMFA 1ZMAA 4K6XA 6GSVA 3ISOA 2LRNA 2V6OA 1VF2A 5IO0A 3KTLA 2VLVA 3TRPA 2D2ZA 1I5GA 3CSJA 2LUSA 3DMLA 3NIVA 1KBNA 5DQYA 5F0GA 3HJPA 5CAXA 1U6TA 1G7OA 2PVQA 1XBSA 2R0PA 2WJUA 5JWRB 2HSYA 4L5OA 3CBUA 1JLVA 1OC9B 3A3TA 4PNFA 5DJLA 3HY2A 5CRWA 3TKPA 3VPQA 1FW1A 4TXOB 3HVXA 2LNTA 1LBKA 3GKMA 5ECLB 3RHBA 4CW9A 2ZNMA 5DAKA 4POBA 2X49A 1T4YA 4WBRD 1XIYA 2DSAA 10GSA 3IV4A 4TR1B 4LL4B 3BOAA 3F3RA 4K0GA 1EP8A 1GL8A 4CY6A 4GSTA 2PVOC 2EIOA 4PTSA 3Q74A 1GSYA 1QK8A 2GT5A 4OWYA 11GSA 1XWGA 1Q98A 1A8LA 3RPPA 1NSWA 1A2LA 3TKRA 1HQOA 3FW2A 5F06A 5KN2A 3D0ZA 2VLUA 1XOBA 4FO5A 3WYWA 3ZTLA 1IYIA 2HSMA 2X8CA 2PPTA 3EU3A 3LEFA 3ERFA 3G7YA 5HFKA 3ZMLA 1X5DA 2OE0A 2OACA 2DKHA 4KE3A 4EDYA 5BRTA 1O7UA 1SYRA 2VCWA 4WEYA 3HCZA 2VOCA 3TJFA 2IFQA 2IL3A 4RI7A 4Q5RA 1NHYA 2CAQA 1GH2A 4POLA 4G2EA 5COHA 1SK1A 1WOUA 2I9HA 4MPFA 3M9JA 3GTUA 3RBTA 1BAYA 2HZEA 1XWAA 3WD6A 1GUMA 1I9DA 2FA8A 4A5PA 2V6KA 4NHZA 3ZFLA 4USSA 1V2AA 1O81A 4ACSA 4FIWA 3F6FA 2H6YA 4RUVA 5JWQB 1AC1A 3C1SA 2X8HA 2OKAA 1R4WA 5ELGA 2AB6A 1PMTA 2E7PA 2R3XA 4OFTA 4G9HA 1FHEA 1BQ7A 2RUEA 1B9YC 1V58A 2E2GA 3H4KA 3DWVA 3TGZA 3TUEA 4MK3A 3ME8A 2CVBA 3SBCA 5D8IA 2R5GA 4PGTA 1GULA 3GA4A 2L59A 4EKZA 3IK9A 3LWAA 1TI3A 2ES7A 3VPTA 5IMDA 3GX0A 3SWLA 1ML6A 3L0HA 2WB9A 3GKNA 4NMUA 2GQKA 2QGVA 3EYTA 4HOJA 1AAZA 3KH9A 2JADA 5DVBA 1A0FA 1WRYA 1XG8A 3QD9A 2B5YA 1YEPA 1YQ1A 4ML6A 3US3A 2KOKA 2GSQA 3CMIA 3IC4A 4YQVA 3ZIVA 1SL0B 1K0NA 3D6IA 1EGRA 3LGCA 4KH7A 3HHVA 3LFLA 2LJAA 1PA3A 1BJXA 1Z7RA 2X4AA 2YWOA 4MF7A 3FYGA 5B7CA 4TW5A 3IAM2 3EVIA 3F6DA 2H1BA 1MEKA 3QOUA 1SKSB 4IKHA 3BCIA 5A4WA 4ECBA 2RUFA 4H86A 2WS2A 3GYKA 3TKSA 4JBBA 2HRFA 3GFKA 4WETA 1Z3EA 2AJQB 3KMNA 3ED3A 1LU4A 3H8QA 3P2AA 3I6AA 1K3LA 5DDLA 1ON4A 3DRNA 1K0AA 2HE3A 1JHBA 4EF0A 4IW9A 1SYXA 2L6CA 4TXVA 2C0DA 4NXIA 1URMA 2HRNA 2XHFA 5D96A 2ALBA 1U3IA 3ZITA 2O89A 4MF6A 4MJCA 3TJGA 1OKTA 4GLTA 4HEA2 1XWBA 5GAND 5ECKB 3HVSA 4K0NA 3KZQA 4PQIA 4KUNA 2FWEA 5CRDA 4XCSA 1UC7A 2MYGA 3FZ4A 4CDOA 4TR3A 3LSZA 1SENA 4F0BA 5C04A 1SL1B 1GSEA 1EP7A 1S3AA 4BL7B 4DSQA 4IHUA 4KW6A 3H79A 2MZCA 4HZ2A 2QKEA 5KEJA 3GURA 4YH2A 1U3AA 1R26A 1JZDA 4KDYA 1XW6A 3E3EA 1K0CA 4YAVA 1EZKA 2HLSA 1PGTA 4XTSA 2GSRA 1HNAA 1F3AA 3LG6A 4K7OA 1GSSA 5H5QA 1T8EB 3F4TA 1C72A 5FT3A 2TIRA 2C8UA 1ERVA 3UIWA 3TJKA 1ZYQB 1YKCA 2L6DA 4NWYA 2PUKC 3L4NA 1ZYPA 3DEXA 1X5EA 5ECQB 1KNGA 3BCKA 2F8AA 4XRAA 2YOIA 2K6VA 2BTOT 2F9SA 2VAFA 5ECRB 5KN3A 1YF1A 4E8HA 5ECPB 4NPBA 1ZYNA 2JSZA 3QR6A 1T1VA 2ZCTA 1YKAA 1UA5A 3VLNA 1VF3A 3M9KA 4ML1A 1N8JA 1Y25A 1THXA 3FZ9A 4WR4A 5KOWA 3GH9A 1E6BA 5B6MA 4HJMA 1R5AA 5B8BA 3ZZXA 5CRGA 2YV7A 1XZOA 1BEDA 2Z9SA 4GCIA 3TJJA 4EL1A 4ZL7A 1VRSD 4AF2A 2X64A 4HI7A 2LQQA 3MDKA 2GVPA 2VD0A 2YNXA 2QA2A 22GSA 2G0FA 2LJRA 2FLSA 1ERUA 1WE0A 5IMZA 5IQYA 1ZL9A 4N11A 5HQPA 3F0IA 4OCFA 3QCPA 4EUYA 4HUAA 4GQCA 3UBKA 1M2BA 1WIKA 1GWCA 3W8JA 1TDIA 1TW9A 5G1KA 4IQ1A 3ERWA 4JEDA 1JZWA 4HDEA 5GSSA 2C1YA 4N0VA 2REMA 5E59A 2PGTA 4V1Ag 2CX3A 4I8BA 4V2NA 4Z7XA 2FWFA 4F2IA 2F3MA 3LQ7A 2PU9C 4GF0A 4ZB9A 1V98A 1A23A 2FNOA 6GSUA 5ECHB 5EVOA 4O7HA 3TDGA 5JCGA 1XWKA 1SK0A 3CSHA 4GWRA 3GRXA 4IS0A 1AW9A 2CT6A 3E0UA 5G1LA 4Q5QA 1K3OA 4KCAA 1Z7PA 2H0IA 4Q5NA 5G31A 1O8XA 1ZGNA 4O92A 1USBA 1R5PA 5D93A 2KLXA 1B8XA 4LLRA 1EEMA 6GSTA 2I1UA 3P90A 1MDIA 1OC9A 2JACA 1K3YA 4K2DA 4X43A 5HR2A 3ZVJD 3MAKA 3EE2A 3IBHA 2FWGA 1AUCA 4TXOA 2I3YA 3W8SA 1GRXA 5G5FA 2LKUA 3KIJA 4N10A 3MSZA 4BWQA 3FMWA 2N5FA 2CVKA 2YZUA 1J0FA 3IHGA 3Q19A 5LNKe 5J9CA 2R2JA 1MTCA 3HYPA 5KN1A 4TR1A 2V32A 1PX6A 2M72A 3FEUA 1GNWA 3DD3A 1GLQA 1PKWA 2DC5A 5IMAA 1TRWA 1XW9A 2H6XA 1G0TA 1ERWA 3F4SA 4L5LA 3N5OA 3TB2A 3GHAA 1M0UA 1HYUA 2H75A 2AAWA 5E4WA 4EDZA 2FWHA 2DIYA 4DSSB 5IIZA 3OR5A 2A2RA 3TKSE 4ECJA 2EC4A 2LV3A 4I2UA 2C3TA 2OE3A 1EEJA 1KTEA 1QUWA 3V1WA 5B6NA 4IJ3A 3KP9A 3GSTA 4ZB6A 3LYPA 3LYKA 2BMXA 2H73A 2IJYA 4XS4B 2I81A 3F3QA 5J3RA 1FAAA 3UJ1A 2GZYA 1PN9A 1PQNA 3C8EA 5CRHA 1O73A 3M8NA 1JLWA 3L9UA 1U87A 3N9JA 5ECNB 1GSUA 3UARA 2LEGA 1UVZA 2AYTA 2I4AA 1IYHA 3IC8A 4CY8A 1Z9HA 5ECMB 2A4HA 1ERTA 1H75A 2VM2A 1T3BA 3BJ5A 3IXRA 4AJ6A 3D4TA 5EY6A 4OFMA 2V2GA 9GSSA 5KOXA 4OO4A 3KGKA 3M0FA 3HA9A 2YWMA 2H1AA 1HNCA 4GXZA 1WMJA 2KP2A 4Q5FA 2FA4A 3EINA 3WGEA 2PBJA 4PQHA 3IPZA 1WWJA 1J08A 3I9V2 1QGVA 2LTKA 4MH2A 3S9FA 4N0ZA 2B6MA 3EWLA 3F8UA 1NW2A 1E2YA 1XVWA 1SKRB 2H30A 18GSA 5DCHA 3M3MA 1Z5YE 12GSA 1GUKA 2VL2A 4ID0A 4EXJA 1A2MA 3CRUA 3ZRDA 1O8WA 1XCCA 3HVNA 2DKIA 3KXOA 2HT9A 4L0WA 6GSXA 2FCHA 5AIXA 1OC3A 5J5NA 1GSFA 4JR4A 2L4QA 1SJZA 4V2LA 3J7Yb 2GSSA 2M80A 3TRXA 2OE1A 1JFUA 4PUFC 4LMWA 2AUVA 3FZAA 5EL8A 3UBLA 3UMAA 3RPNA 1EOGA 4ZBBA 5DALB 4PNGA 1EWXA 1Z6MA 3APSA 2R0CA 4P3YB 4WBJA 1YF0A 3C73A 6GSWA 1JZRA 1YJ6A 3DYRA 3GUSA 4TOPA 2J9HA 3MWHA 4GQFA 5ECSA 2NDOA 2XPEA 2A2PA 4ZBDA 2H76A 5JWOB 5HFGA 4KF9A 2QA1A 1XFLA 4YQMA 3ZMKA 5AN1A 5A4VA 1OE8A 4POMA 4JRRA 1ST9A 1Q4JA 1TRVA 2GQLA 1N2AA 2P5RA 1FOVA 1M99A 4LL1B 4IELA 5DJMA 5G2ZA 4X0XA 4BVYB 4TRXA 5DCGA 3VWXA 3GL3A 4I2TA 3HZ8A 3IHQA 4XS6A 1F37A 3G9BA 2CV4A 3EPTA 1XOAA 1B9XC 2E2MA 1Z6NA 2H0GA 2N5AA 3D5JA 4BL7A 2DIZA 1SL2B 2MMAA 3H1NA 2QC7A 4ZBAA 3RDWA 1S3DA 3IA1A 2H1DA 2LSTA 4IBPA 2P0GA 1R7HA 2N5BA 3P7XA 4HU7A 4I97A 2DJ3A 2DLXA 1TXXA 4QL9A 1FB6A 1B48A 1NM3A 5D9XA 5IOXA 4TKYA 2O8VB 1PKZA 3F63A 3UVTA 2L5LA 2H1GA 2HRKA 4MP4A 5IM9A 1T00A 3DVWA 4E8EA 5KN0A 7GSSA 4ZL8A 4TVEA 3PPUA 1S3CA 14GSA 1TRUA 1G6YA 2JU5A 1G7EA 4MDCA 4XS1A 2DJ1A 4G10A 1TKDB 2WRTA 3L78A 2OJLA 1XVQA 2JSYA 3VWUA 1H4OA 4GSNA 2B5XA 1HNBA 4MLYA 4YAPA 5ID2B 1TU8A 3QFBC 1TK0B 3TKSC 1GP1A 4GTUA 3C71A 5BMUA 4WF4A 5AISA 2AV4A 2HFDA 4TN8A 5CNWA 1X9MB 3ZREA 1MD3A 4I6XA 4EE0A 2YP6A 1A24A 5HFIA 4WKWA 4K8MA 1VF4A 4TR4A 3QDNA 4KNDA 4MZBA 2GLRA 3VURA 3FR6A 4MH3A 1DUGA 3DXBA 4OCEA 4GSSA 2NBSA 4LA1A 2C4JA 4AGSA 3EMPA 4O32A 1G6WA 1WP0A 5IMCA 5J9BA 4JR6A 2GT6A 2K8SA 1ABAA 2IIYA 3D4MA 1AQVA 2GDRA 1XXUA 2LRTA 2H8LA 4N30A 4K9ZA 5AGYA 2C0EA 2L5OA 2C0GA 1XWCA 2ZUPA 1YEXA 4O5RA 3KP8A 2IMEA 2V41A 2UZ8A 1SJIA 3H93A 1SD8A 3CXGA 1GTBA 2H71A 2YV9A 2A4VA 3KM6A 1Y6EA 2V1MA 4BVXB 2PN8A 1DE1A 5HR3A 4Z2RA 1RK4A 4JE1A 3TKQA 2MMZA 4QL7A 3APQA 3EU4A 5GZZB 4J56E 3Q6OA 2F51A 5LD0A 1GNEA 4NV2A 3UAPA 2O87A 1AXDA 3W6GA 4IJIA 5J4UA 3TCOA 1UN2A 3O3TA 2CVDA 16GSA 1A2JA 2WZ9A 5INYA 2PWJA 3ZIJA 4K2XA 3WT2A 1EV9A 2FD3A 1RW1A 3UL3A 3PH9A 3G7IA 3KTBA 1PSQA 13GSA 4BA7A 4YQUA 1PL1A 3TRQA 2DMMA 1TJDA 3HJOA 3U5RE 2O7KA 4Z2UA 4PURA 1DSBA 2P5QA 1SK2A 2C3QA 1WJKA 1FVKA 2WGRA 5H5SA 1PL2A 1F3BA 2TRXA 4K7NA 4IVFA 3KH7A 4EC0A 1AQWA 1QMVA 3FR3A 3JCML 1PD21 5FWGA 3D22A 2JZRA 2IMKA 5D9TA 2XC2A 2B3SA 1M9AA 3C7MA 5G30A 3A2WA 1V40A 3NZNA 3VWVA 4V2MA 3BD2A 3DVXA 4DVCA 4BIKA 4DSSA 1TP9A 1OAZA 4FYBA 4K5SA 4D73B 3LORA 4MMMA 2VL3A 3KMOA 1TTZA 3CQFA 2WFCA 4FYCA 3F4RA 2R37A 3I69A 3GKKA 4EO3A 4ZXGA 3HXSA 4IGJA 3FY7A 3MYDA 4RI6A 2C0FA 4ICYA 3P8WA 4XS4A 5CO3A 3ZLPA 2F8FA 3IK7A 4HQSA 1SKWB 1WPIA 1M3IA 3QFAC 5JCUA 4OMVA 5F8BA 4L8EA 3PGTA 3KJYA 4DSRA 3J7Yk 2RIIA 4OFNA 2YJ7A 3GSSA 3FHKA 2L4CA 4K5RA 4NV5A 3AY8A 3DKSA 3HKRA 3WGXA 5DAKB 5LCZA 2JZSA 5C00A 4ZB8A 1DBYA 4DEJA 2FY6A 1OVNA 2JL4A 1OKDA 1K0MA 1TOFA 1QXHA 3PINA 2FUG2 4WR5A 4MJBA 2K18A 1TK5B 3GNJA 5ECIB 2RLIA 1DE2A 2NPBA 3D21A 1BX9A 1F2EA 1OYJA 3VI5A 4IP6A 4WXTA 2HYXA 3VWWA 2GZPA 2H66A 1U88A 2VCQA 2DJ2A 3FR9A 1MD4A 4KB3A 2AHEA 4RQXA 5ECOB 2B1LA 1OE7A 2G2QA 4POKA 2E0QA 2DJJA 4F9ZA 3IR4A 4ULXA 1MDKA 1T4ZA 2OA7A 4HZ4A 2RM5A 3MIXA 1J9BA 2DJ0A 1SJ6A 2IFQB 2YN1A
chains in the Genus database with same CATH topology
1LJRA 1M7TA 2GGTA 3A2XA 4FYUA 4MZCA 1TU7A 1YY7A 5IPGA 1GLPA 3GTUB 1FOHA 3NOFA 2HZEB 3HZ4A 3EC3A 5H5RA 2YWIA 5A5KA 3QAWA 4KDUA 1RQMA 3DIEA 2X99A 1ZYEA 3QPMA 3KCMA 4JU5A 5DBQA 6GSSA 2YANA 3TOUA 2VUPA 5HR1A 4JZQA 1M2AA 3ZVJA 4MF5A 4QQ7A 3ERGA 1M2DA 2H6ZA 2YZHA 5DALA 1EGOA 3EMXA 4K1FA 4FQUA 4EVMA 5IPHA 2M46A 1K0BA 5IMVA 2C80A 1TI1A 4KSMA 2GZZA 2VO4A 4PQ1A 2NTOA 4YKFA 2WULA 3A5WA 1VF1A 5ABRA 1A8YA 1HD2A 1YZXA 5IO2A 2EIRA 3KEBA 4IQAA 4FH8A 2VL9A 1CQHA 2PERA 3HD5A 1X0RA 2K9FA 4HU9A 3GMFA 1ZCPA 2GSTA 2CX4A 1F6MC 2RM6A 3A2VA 2CZ3A 1KEBA 3PR8A 4V1Ap 3LXTA 4J2FA 4AJ8A 4PX1A 4KA0A 3O76A 2R6KA 3QMXA 2WDUA 1XW5A 1GTAA 2GQMA 1GTIA 4BVYA 1PX7A 1EOHA 5CP1A 5JCWA 2H70A 5F07A 4AJ7A 5CYYA 2YJHA 2A2SA 2KUCA 1SD9A 4MJEA 3R3EA 3MNGA 1FB0A 3FK8A 3ZL5A 2JZTA 2B7JA 4PUAA 4MJAA 2X8GA 4ILFA 2VL2C 2HSHA 6GSYA 2IMDA 4PXOA 2VCZA 4I5QA 4HS1A 8GSSA 4RQRA 3L9SA 2YPMA 2LJKA 5DQSA 3IRAA 2VCVA 1BG5A 4LMVA 3GIXA 1ZOFA 2C3NA 3LXZA 3UOMA 1AQXA 2LNSA 2R4VA 1X9SB 1PN0A 4IP1A 2B7KA 2CZ2A 4MABA 4MPGA 3VI7A 3QAGA 3QAVA 2YCDA 1V57A 5CREA 4HJ2A 5GAPD 3IDVA 4ISDA 2FHEA 3U6VA 5J41A 2L57A 4NHWA 3FRCA 3M1GA 2IN3A 4L0UA 2YWNA 3GX8A 1FG4A 2HZFA 3RAZA 5D9WA 2LRCA 2NVLA 2GTUA 5ID2A 1ZZYA 5ENUA 3ZYWA 2MMOA 3DGQA 2GS3A 2LQOA 2HXKA 3O6TA 1JZOA 2B5EA 4WF5A 4Z2TA 3Q18A 3KD0A 5HR0A 4F82A 2R0GA 2CQ9A 3EURA 2OBIA 3APOA 5L71A 4KSOA 2XBIA 4F03A 3FKFA 1K0DA 1GSDA 2ON5A 4KGIA 1X9WB 2IPAA 2ON7A 5IOWA 1GSQA 1GTUA 3CSIA 4ZILA 3I43A 1F9MA 4G0LA 4KDXA 4MZWA 2DMLA 1ACVA 2KP1A 4G0IA 3GKXA 3CTGA 1X5CA 3HVVA 2O85A 1VGLA 2CAIA 4ZL9A 1QFNA 3WGDA 2XPDA 1MDJA 4ECIA 2K8VA 3FZ5A 3CTFA 4GRFA 2HI7A 3K8NA 2H0HA 1B4PA 4KCEA 3CYNA 3GN3A 4G19A 3RHCA 4X1UA 2TRCP 3GH6A 3ME7A 4MA9A 3C1RA 2IMFA 1B4QA 2WCIA 4MCUA 4J57E 3VK9A 1FO5A 2BJXA 4NAXA 4BVXA 2IMIA 2KHPA 2LS5A 2VD1A 1W4VA 2VLTA 5AIVA 1TK8B 2IWTA 3G7JA 1V9WA 2P31A 2VCTA 1TRSA 4O5UA 2H72A 4OO5A 3TJBA 2PMTA 5EPFA 4XRDA 3UEMA 1XPVA 5G5EA 4CHSA 5D9VA 1PRXA 1ILOA 2XBQA 3GV1A 2J23A 3IOSA 3IAS2 3BBYA 1FVJA 3CRTA 1THOA 2H19A 1W89A 2VM1A 4TR0A 3IE3A 2VIMA 4F0CA 1EV4A 5D73A 4XHMA 2DJKA 1O85A 4EIQA 3ZFBA 2HNLA 2B1KA 2OADA 5FHIA 5B8AA 2HRAA 4HQZA 4G0KA 5GSTA 2FGXA 3A5IA 1AIUA 4KAEA 4YKGA 4EIPA 2MBTA 4XIHA 3LJRA 3VFIA 2DBCA 4BPYA 1M9BA 1K0OA 4MNNA 5ELAA 3GL5A 3LW9A 4IN0A 1GUHA 5A4UA 1YDKA 3HDCA 2EIQA 4ZIJA 4BWSA 4K7IA 19GSA 2MMNA 17GSA 4OD7A 3HJMA 2CA8A 1OC8A 2MBSA 5F05A 4ECCA 1BYEA 2H01A 2H74A 2VCXA 3UVHA 2QSIA 4O5QA 20GSA 1SU9A 3E9JB 3R2QA 1A0RP 3WT1A 1CQGA 2OBKA 3TOTA 4D73A 1T7PB 4KX4A 3L9VA 1NHOA 1QQ2A 1O6JA 3F9UA 4X4JA 5IMFA 1ZMAA 4K6XA 6GSVA 3ISOA 2LRNA 2V6OA 1VF2A 5IO0A 3KTLA 2VLVA 3TRPA 2D2ZA 1I5GA 3CSJA 2LUSA 3DMLA 3NIVA 1KBNA 5DQYA 5F0GA 3HJPA 5CAXA 1U6TA 1G7OA 2PVQA 1XBSA 2R0PA 2WJUA 5JWRB 2HSYA 4L5OA 3CBUA 1JLVA 1OC9B 3A3TA 4PNFA 5DJLA 3HY2A 5CRWA 3TKPA 3VPQA 1FW1A 4TXOB 3HVXA 2LNTA 1LBKA 3GKMA 5ECLB 3RHBA 4CW9A 2ZNMA 5DAKA 4POBA 2X49A 1T4YA 4WBRD 1XIYA 2DSAA 10GSA 3IV4A 4TR1B 4LL4B 3BOAA 3F3RA 4K0GA 1EP8A 1GL8A 4CY6A 4GSTA 2PVOC 2EIOA 4PTSA 3Q74A 1GSYA 1QK8A 2GT5A 4OWYA 11GSA 1XWGA 1Q98A 1A8LA 3RPPA 1NSWA 1A2LA 3TKRA 1HQOA 3FW2A 5F06A 5KN2A 3D0ZA 2VLUA 1XOBA 4FO5A 3WYWA 3ZTLA 1IYIA 2HSMA 2X8CA 2PPTA 3EU3A 3LEFA 3ERFA 3G7YA 5HFKA 3ZMLA 1X5DA 2OE0A 2OACA 2DKHA 4KE3A 4EDYA 5BRTA 1O7UA 1SYRA 2VCWA 4WEYA 3HCZA 2VOCA 3TJFA 2IFQA 2IL3A 4RI7A 4Q5RA 1NHYA 2CAQA 1GH2A 4POLA 4G2EA 5COHA 1SK1A 1WOUA 2I9HA 4MPFA 3M9JA 3GTUA 3RBTA 1BAYA 2HZEA 1XWAA 3WD6A 1GUMA 1I9DA 2FA8A 4A5PA 2V6KA 4NHZA 3ZFLA 4USSA 1V2AA 1O81A 4ACSA 4FIWA 3F6FA 2H6YA 4RUVA 5JWQB 1AC1A 3C1SA 2X8HA 2OKAA 1R4WA 5ELGA 2AB6A 1PMTA 2E7PA 2R3XA 4OFTA 4G9HA 1FHEA 1BQ7A 2RUEA 1B9YC 1V58A 2E2GA 3H4KA 3DWVA 3TGZA 3TUEA 4MK3A 3ME8A 2CVBA 3SBCA 5D8IA 2R5GA 4PGTA 1GULA 3GA4A 2L59A 4EKZA 3IK9A 3LWAA 1TI3A 2ES7A 3VPTA 5IMDA 3GX0A 3SWLA 1ML6A 3L0HA 2WB9A 3GKNA 4NMUA 2GQKA 2QGVA 3EYTA 4HOJA 1AAZA 3KH9A 2JADA 5DVBA 1A0FA 1WRYA 3QD9A 2B5YA 1YEPA 1YQ1A 4ML6A 3US3A 2KOKA 2GSQA 3CMIA 3IC4A 4YQVA 3ZIVA 1SL0B 1K0NA 3D6IA 1EGRA 3LGCA 4KH7A 3HHVA 3LFLA 2LJAA 1PA3A 1BJXA 1Z7RA 2X4AA 2YWOA 4MF7A 3FYGA 5B7CA 4TW5A 3IAM2 3EVIA 3F6DA 2H1BA 1MEKA 3QOUA 1SKSB 4IKHA 3BCIA 5A4WA 4ECBA 2RUFA 4H86A 2WS2A 3GYKA 3TKSA 4JBBA 2HRFA 3GFKA 4WETA 1Z3EA 2AJQB 3KMNA 3ED3A 1LU4A 3H8QA 3P2AA 3I6AA 1K3LA 5DDLA 1ON4A 3DRNA 1K0AA 2HE3A 1JHBA 4EF0A 4IW9A 1SYXA 2L6CA 4TXVA 2C0DA 4NXIA 1URMA 2HRNA 2XHFA 5D96A 2ALBA 1U3IA 3ZITA 2O89A 4MF6A 4MJCA 3TJGA 1OKTA 4GLTA 4HEA2 1XWBA 5GAND 5ECKB 3HVSA 4K0NA 3KZQA 4PQIA 4KUNA 2FWEA 5CRDA 4XCSA 1UC7A 2MYGA 3FZ4A 4CDOA 4TR3A 3LSZA 1SENA 4F0BA 5C04A 1SL1B 1GSEA 1EP7A 1S3AA 4BL7B 4DSQA 4IHUA 4KW6A 3H79A 2MZCA 4HZ2A 2QKEA 5KEJA 3GURA 4YH2A 1U3AA 1R26A 1JZDA 4KDYA 1XW6A 3E3EA 1K0CA 4YAVA 1EZKA 2HLSA 1PGTA 4XTSA 2GSRA 1HNAA 1F3AA 3LG6A 4K7OA 1GSSA 5H5QA 1T8EB 3F4TA 1C72A 5FT3A 2TIRA 2C8UA 1ERVA 3UIWA 3TJKA 1ZYQB 1YKCA 2L6DA 4NWYA 2PUKC 3L4NA 1ZYPA 3DEXA 1X5EA 5ECQB 1KNGA 3BCKA 2F8AA 4XRAA 2YOIA 2K6VA 2BTOT 2F9SA 2VAFA 5ECRB 5KN3A 1YF1A 4E8HA 5ECPB 4NPBA 1ZYNA 2JSZA 3QR6A 1T1VA 2ZCTA 1YKAA 1UA5A 3VLNA 1VF3A 3M9KA 4ML1A 1N8JA 1Y25A 1THXA 3FZ9A 4WR4A 5KOWA 3GH9A 1E6BA 5B6MA 4HJMA 1R5AA 5B8BA 3ZZXA 5CRGA 2YV7A 1XZOA 1BEDA 2Z9SA 4GCIA 3TJJA 4EL1A 4ZL7A 1VRSD 4AF2A 2X64A 4HI7A 2LQQA 3MDKA 2GVPA 2VD0A 2YNXA 2QA2A 22GSA 2G0FA 2LJRA 2FLSA 1ERUA 1WE0A 5IMZA 5IQYA 1ZL9A 4N11A 5HQPA 3F0IA 4OCFA 3QCPA 4EUYA 4HUAA 4GQCA 3UBKA 1M2BA 1WIKA 1GWCA 3W8JA 1TDIA 1TW9A 5G1KA 4IQ1A 3ERWA 4JEDA 1JZWA 4HDEA 5GSSA 2C1YA 4N0VA 2REMA 5E59A 2PGTA 4V1Ag 2CX3A 4I8BA 4V2NA 4Z7XA 2FWFA 4F2IA 2F3MA 3LQ7A 2PU9C 4GF0A 4ZB9A 1V98A 1A23A 2FNOA 6GSUA 5ECHB 5EVOA 4O7HA 3TDGA 5JCGA 1XWKA 1SK0A 3CSHA 4GWRA 3GRXA 4IS0A 1AW9A 2CT6A 3E0UA 5G1LA 4Q5QA 1K3OA 4KCAA 1Z7PA 2H0IA 4Q5NA 5G31A 1O8XA 1ZGNA 4O92A 1USBA 1R5PA 5D93A 2KLXA 1B8XA 4LLRA 1EEMA 6GSTA 2I1UA 3P90A 1MDIA 1OC9A 2JACA 1K3YA 4K2DA 4X43A 5HR2A 3ZVJD 3MAKA 3EE2A 3IBHA 2FWGA 1AUCA 4TXOA 2I3YA 3W8SA 1GRXA 5G5FA 2LKUA 3KIJA 4N10A 3MSZA 4BWQA 3FMWA 2N5FA 2CVKA 2YZUA 1J0FA 3IHGA 3Q19A 5LNKe 5J9CA 2R2JA 1MTCA 3HYPA 5KN1A 4TR1A 2V32A 1PX6A 2M72A 3FEUA 1GNWA 3DD3A 1GLQA 1PKWA 2DC5A 5IMAA 1TRWA 1XW9A 2H6XA 1G0TA 1ERWA 3F4SA 4L5LA 3N5OA 3TB2A 3GHAA 1M0UA 1HYUA 2H75A 2AAWA 5E4WA 4EDZA 2FWHA 2DIYA 4DSSB 5IIZA 3OR5A 2A2RA 3TKSE 4ECJA 2EC4A 2LV3A 4I2UA 2C3TA 2OE3A 1EEJA 1KTEA 1QUWA 3V1WA 5B6NA 4IJ3A 3KP9A 3GSTA 4ZB6A 3LYPA 3LYKA 2BMXA 2H73A 2IJYA 4XS4B 2I81A 3F3QA 5J3RA 1FAAA 3UJ1A 2GZYA 1PN9A 1PQNA 3C8EA 5CRHA 1O73A 3M8NA 1JLWA 3L9UA 1U87A 3N9JA 5ECNB 1GSUA 3UARA 2LEGA 1UVZA 2AYTA 2I4AA 1IYHA 3IC8A 4CY8A 1Z9HA 5ECMB 2A4HA 1ERTA 1H75A 2VM2A 1T3BA 3BJ5A 3IXRA 4AJ6A 3D4TA 5EY6A 4OFMA 2V2GA 9GSSA 5KOXA 4OO4A 3KGKA 3M0FA 3HA9A 2YWMA 2H1AA 1HNCA 4GXZA 1WMJA 2KP2A 4Q5FA 2FA4A 3EINA 3WGEA 2PBJA 4PQHA 3IPZA 1WWJA 1J08A 3I9V2 1QGVA 2LTKA 4MH2A 3S9FA 4N0ZA 2B6MA 3EWLA 3F8UA 1NW2A 1E2YA 1XVWA 1SKRB 2H30A 18GSA 5DCHA 3M3MA 1Z5YE 12GSA 1GUKA 2VL2A 4ID0A 4EXJA 1A2MA 3CRUA 3ZRDA 1O8WA 1XCCA 2DKIA 3KXOA 2HT9A 4L0WA 6GSXA 2FCHA 5AIXA 1OC3A 5J5NA 1GSFA 4JR4A 2L4QA 1SJZA 4V2LA 3J7Yb 2GSSA 2M80A 3TRXA 2OE1A 1JFUA 4PUFC 4LMWA 2AUVA 3FZAA 5EL8A 3UBLA 3UMAA 3RPNA 1EOGA 4ZBBA 5DALB 4PNGA 1EWXA 1Z6MA 3APSA 2R0CA 4P3YB 4WBJA 1YF0A 3C73A 6GSWA 1JZRA 1YJ6A 3DYRA 3GUSA 4TOPA 2J9HA 3MWHA 4GQFA 5ECSA 2NDOA 2XPEA 2A2PA 4ZBDA 2H76A 5JWOB 5HFGA 4KF9A 2QA1A 1XFLA 4YQMA 3ZMKA 5AN1A 5A4VA 1OE8A 4POMA 4JRRA 1ST9A 1Q4JA 1TRVA 2GQLA 1N2AA 2P5RA 1FOVA 1M99A 4LL1B 4IELA 5DJMA 5G2ZA 4X0XA 4BVYB 4TRXA 5DCGA 3VWXA 3GL3A 4I2TA 3HZ8A 3IHQA 4XS6A 1F37A 3G9BA 2CV4A 3EPTA 1XOAA 1B9XC 2E2MA 1Z6NA 2H0GA 2N5AA 3D5JA 4BL7A 2DIZA 1SL2B 2MMAA 3H1NA 2QC7A 4ZBAA 3RDWA 1S3DA 3IA1A 2H1DA 2LSTA 4IBPA 2P0GA 1R7HA 2N5BA 3P7XA 4HU7A 4I97A 2DJ3A 2DLXA 1TXXA 4QL9A 1FB6A 1B48A 1NM3A 5D9XA 5IOXA 4TKYA 2O8VB 1PKZA 3F63A 3UVTA 2L5LA 2H1GA 2HRKA 4MP4A 5IM9A 1T00A 3DVWA 4E8EA 5KN0A 7GSSA 4ZL8A 4TVEA 3PPUA 1S3CA 14GSA 1TRUA 1G6YA 2JU5A 1G7EA 4MDCA 4XS1A 2DJ1A 4G10A 1TKDB 2WRTA 3L78A 2OJLA 1XVQA 2JSYA 3VWUA 1H4OA 4GSNA 2B5XA 1HNBA 4MLYA 4YAPA 5ID2B 1TU8A 3QFBC 1TK0B 3TKSC 1GP1A 4GTUA 3C71A 5BMUA 4WF4A 5AISA 2AV4A 2HFDA 4TN8A 5CNWA 1X9MB 3ZREA 1MD3A 4I6XA 4EE0A 2YP6A 1A24A 5HFIA 4WKWA 4K8MA 1VF4A 4TR4A 3QDNA 4KNDA 4MZBA 2GLRA 3VURA 3FR6A 4MH3A 1DUGA 3DXBA 4OCEA 4GSSA 2NBSA 4LA1A 2C4JA 4AGSA 3EMPA 4O32A 1G6WA 1WP0A 5IMCA 5J9BA 4JR6A 2GT6A 2K8SA 1ABAA 2IIYA 3D4MA 1AQVA 2GDRA 1XXUA 2LRTA 2H8LA 4N30A 4K9ZA 5AGYA 2C0EA 2L5OA 2C0GA 1XWCA 2ZUPA 1YEXA 4O5RA 3KP8A 2IMEA 2V41A 2UZ8A 1SJIA 3H93A 1SD8A 3CXGA 1GTBA 2H71A 2YV9A 2A4VA 3KM6A 1Y6EA 2V1MA 4BVXB 2PN8A 1DE1A 5HR3A 4Z2RA 1RK4A 4JE1A 3TKQA 2MMZA 4QL7A 3APQA 3EU4A 5GZZB 4J56E 3Q6OA 2F51A 5LD0A 1GNEA 4NV2A 3UAPA 2O87A 1AXDA 3W6GA 4IJIA 5J4UA 3TCOA 1UN2A 3O3TA 2CVDA 16GSA 1A2JA 2WZ9A 5INYA 2PWJA 3ZIJA 4K2XA 3WT2A 1EV9A 2FD3A 1RW1A 3UL3A 3PH9A 3G7IA 3KTBA 1PSQA 13GSA 4BA7A 4YQUA 1PL1A 3TRQA 2DMMA 1TJDA 3HJOA 3U5RE 2O7KA 4Z2UA 4PURA 1DSBA 2P5QA 1SK2A 2C3QA 1WJKA 1FVKA 2WGRA 5H5SA 1PL2A 1F3BA 2TRXA 4K7NA 4IVFA 3KH7A 4EC0A 1AQWA 1QMVA 3FR3A 3JCML 1PD21 5FWGA 3D22A 2JZRA 2IMKA 5D9TA 2XC2A 2B3SA 1M9AA 3C7MA 5G30A 3A2WA 1V40A 3NZNA 3VWVA 4V2MA 3BD2A 3DVXA 4DVCA 4DSSA 1TP9A 1OAZA 4FYBA 4K5SA 4D73B 3LORA 4MMMA 2VL3A 3KMOA 1TTZA 2WFCA 4FYCA 3F4RA 2R37A 3I69A 3GKKA 4EO3A 4ZXGA 3HXSA 4IGJA 3FY7A 3MYDA 4RI6A 2C0FA 4ICYA 3P8WA 4XS4A 5CO3A 3ZLPA 2F8FA 3IK7A 4HQSA 1SKWB 1WPIA 3QFAC 5JCUA 4OMVA 5F8BA 4L8EA 3PGTA 3KJYA 4DSRA 3J7Yk 2RIIA 4OFNA 2YJ7A 3GSSA 3FHKA 2L4CA 4K5RA 4NV5A 3AY8A 3DKSA 3HKRA 3WGXA 5DAKB 5LCZA 2JZSA 5C00A 4ZB8A 1DBYA 4DEJA 2FY6A 1OVNA 2JL4A 1OKDA 1K0MA 1TOFA 1QXHA 3PINA 2FUG2 4WR5A 4MJBA 2K18A 1TK5B 3GNJA 5ECIB 2RLIA 1DE2A 2NPBA 3D21A 1BX9A 1F2EA 1OYJA 3VI5A 4IP6A 4WXTA 2HYXA 3VWWA 2GZPA 2H66A 1U88A 2VCQA 2DJ2A 3FR9A 1MD4A 4KB3A 2AHEA 4RQXA 5ECOB 2B1LA 1OE7A 2G2QA 4POKA 2E0QA 2DJJA 4F9ZA 3IR4A 4ULXA 1MDKA 1T4ZA 2OA7A 4HZ4A 2RM5A 3MIXA 1J9BA 2DJ0A 1SJ6A 2IFQB 2YN1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LJR A;  1M7T A;  2GGT A;  3A2X A;  4FYU A;  4MZC A;  1TU7 A;  1YY7 A;  5IPG A;  1GLP A;  3GTU B;  3NOF A;  2HZE B;  3HZ4 A;  3EC3 A;  5H5R A;  2YWI A;  5A5K A;  3QAW A;  4KDU A;  1RQM A;  3DIE A;  2X99 A;  1ZYE A;  3QPM A;  3KCM A;  4JU5 A;  5DBQ A;  6GSS A;  2YAN A;  3TOU A;  2VUP A;  5HR1 A;  4JZQ A;  1M2A A;  3ZVJ A;  4MF5 A;  4QQ7 A;  3ERG A;  1M2D A;  2H6Z A;  2YZH A;  5DAL A;  1EGO A;  3EMX A;  4K1F A;  4EVM A;  5IPH A;  2M46 A;  1K0B A;  5IMV A;  2C80 A;  1TI1 A;  4KSM A;  2GZZ A;  2VO4 A;  4PQ1 A;  2NTO A;  2WUL A;  3A5W A;  1VF1 A;  5ABR A;  1A8Y A;  1HD2 A;  1YZX A;  5IO2 A;  2EIR A;  3KEB A;  4IQA A;  4FH8 A;  2VL9 A;  1CQH A;  2PER A;  3HD5 A;  1X0R A;  2K9F A;  4HU9 A;  3GMF A;  1ZCP A;  2GST A;  2CX4 A;  1F6M C;  2RM6 A;  3A2V A;  2CZ3 A;  1KEB A;  3PR8 A;  4V1A p;  3LXT A;  4J2F A;  4AJ8 A;  4PX1 A;  4KA0 A;  3O76 A;  2R6K A;  3QMX A;  2WDU A;  1XW5 A;  1GTA A;  2GQM A;  1GTI A;  4BVY A;  1PX7 A;  1EOH A;  5CP1 A;  5JCW A;  2H70 A;  5F07 A;  4AJ7 A;  5CYY A;  2YJH A;  2A2S A;  2KUC A;  1SD9 A;  4MJE A;  3MNG A;  1FB0 A;  3FK8 A;  3ZL5 A;  2JZT A;  2B7J A;  4PUA A;  4MJA A;  2X8G A;  4ILF A;  2VL2 C;  2HSH A;  6GSY A;  2IMD A;  4PXO A;  2VCZ A;  4I5Q A;  4HS1 A;  8GSS A;  4RQR A;  3L9S A;  2YPM A;  2LJK A;  5DQS A;  3IRA A;  2VCV A;  1BG5 A;  4LMV A;  3GIX A;  1ZOF A;  2C3N A;  3LXZ A;  3UOM A;  1AQX A;  2LNS A;  2R4V A;  1X9S B;  4IP1 A;  2B7K A;  2CZ2 A;  4MAB A;  4MPG A;  3VI7 A;  3QAG A;  3QAV A;  2YCD A;  1V57 A;  5CRE A;  4HJ2 A;  5GAP D;  3IDV A;  4ISD A;  2FHE A;  3U6V A;  5J41 A;  2L57 A;  4NHW A;  3FRC A;  3M1G A;  2IN3 A;  4L0U A;  2YWN A;  3GX8 A;  1FG4 A;  2HZF A;  3RAZ A;  5D9W A;  2LRC A;  2NVL A;  2GTU A;  5ID2 A;  1ZZY A;  5ENU A;  3ZYW A;  2MMO A;  3DGQ A;  2GS3 A;  2LQO A;  2HXK A;  3O6T A;  1JZO A;  2B5E A;  4WF5 A;  3Q18 A;  3KD0 A;  5HR0 A;  4F82 A;  2CQ9 A;  3EUR A;  2OBI A;  3APO A;  5L71 A;  4KSO A;  2XBI A;  4F03 A;  3FKF A;  1K0D A;  1GSD A;  2ON5 A;  4KGI A;  1X9W B;  2IPA A;  2ON7 A;  5IOW A;  1GSQ A;  1GTU A;  3CSI A;  4ZIL A;  3I43 A;  1F9M A;  4KDX A;  4MZW A;  2DML A;  1ACV A;  2KP1 A;  3GKX A;  3CTG A;  1X5C A;  3HVV A;  2O85 A;  1VGL A;  2CAI A;  4ZL9 A;  1QFN A;  3WGD A;  2XPD A;  1MDJ A;  4ECI A;  2K8V A;  3FZ5 A;  3CTF A;  4GRF A;  2HI7 A;  3K8N A;  2H0H A;  1B4P A;  4KCE A;  3CYN A;  3GN3 A;  4G19 A;  3RHC A;  4X1U A;  2TRC P;  3GH6 A;  3ME7 A;  4MA9 A;  3C1R A;  2IMF A;  1B4Q A;  2WCI A;  4MCU A;  4J57 E;  3VK9 A;  1FO5 A;  2BJX A;  4NAX A;  4BVX A;  2IMI A;  2KHP A;  2LS5 A;  2VD1 A;  1W4V A;  2VLT A;  5AIV A;  1TK8 B;  2IWT A;  3G7J A;  1V9W A;  2P31 A;  2VCT A;  1TRS A;  2H72 A;  4OO5 A;  3TJB A;  2PMT A;  5EPF A;  4XRD A;  3UEM A;  1XPV A;  5G5E A;  4CHS A;  5D9V A;  1PRX A;  1ILO A;  2XBQ A;  3GV1 A;  2J23 A;  3IOS A;  3IAS 2;  3BBY A;  1FVJ A;  3CRT A;  1THO A;  2H19 A;  1W89 A;  2VM1 A;  4TR0 A;  3IE3 A;  2VIM A;  4F0C A;  1EV4 A;  5D73 A;  4XHM A;  2DJK A;  1O85 A;  3ZFB A;  2HNL A;  2B1K A;  2OAD A;  5FHI A;  5B8A A;  4HQZ A;  5GST A;  2FGX A;  1AIU A;  4KAE A;  2MBT A;  4XIH A;  3LJR A;  3VFI A;  2DBC A;  4BPY A;  1M9B A;  1K0O A;  5ELA A;  3GL5 A;  4IN0 A;  1GUH A;  5A4U A;  1YDK A;  3HDC A;  2EIQ A;  4ZIJ A;  4BWS A;  4K7I A;  19GS A;  2MMN A;  17GS A;  4OD7 A;  3HJM A;  2CA8 A;  1OC8 A;  2MBS A;  5F05 A;  4ECC A;  1BYE A;  2H01 A;  2H74 A;  2VCX A;  3UVH A;  2QSI A;  20GS A;  1SU9 A;  3E9J B;  3R2Q A;  1A0R P;  3WT1 A;  1CQG A;  2OBK A;  3TOT A;  4D73 A;  1T7P B;  4KX4 A;  3L9V A;  1NHO A;  1QQ2 A;  1O6J A;  3F9U A;  5IMF A;  1ZMA A;  4K6X A;  6GSV A;  3ISO A;  2LRN A;  2V6O A;  1VF2 A;  5IO0 A;  3KTL A;  2VLV A;  3TRP A;  2D2Z A;  1I5G A;  3CSJ A;  2LUS A;  3DML A;  3NIV A;  1KBN A;  5DQY A;  5F0G A;  3HJP A;  5CAX A;  1U6T A;  1G7O A;  2PVQ A;  1XBS A;  2WJU A;  5JWR B;  2HSY A;  4L5O A;  3CBU A;  1JLV A;  1OC9 B;  3A3T A;  4PNF A;  5DJL A;  3HY2 A;  5CRW A;  3TKP A;  3VPQ A;  1FW1 A;  4TXO B;  3HVX A;  2LNT A;  1LBK A;  3GKM A;  5ECL B;  3RHB A;  4CW9 A;  2ZNM A;  5DAK A;  4POB A;  1T4Y A;  4WBR D;  1XIY A;  2DSA A;  10GS A;  3IV4 A;  4TR1 B;  4LL4 B;  3BOA A;  3F3R A;  4K0G A;  1EP8 A;  1GL8 A;  4GST A;  2PVO C;  2EIO A;  3Q74 A;  1GSY A;  1QK8 A;  2GT5 A;  4OWY A;  11GS A;  1XWG A;  1Q98 A;  1A8L A;  3RPP A;  1NSW A;  1A2L A;  3TKR A;  1HQO A;  3FW2 A;  5F06 A;  5KN2 A;  3D0Z A;  2VLU A;  1XOB A;  4FO5 A;  3WYW A;  3ZTL A;  1IYI A;  2X8C A;  2PPT A;  3EU3 A;  3LEF A;  3ERF A;  3G7Y A;  5HFK A;  3ZML A;  1X5D A;  2OE0 A;  2OAC A;  4KE3 A;  4EDY A;  1O7U A;  1SYR A;  2VCW A;  4WEY A;  3HCZ A;  2VOC A;  3TJF A;  2IFQ A;  2IL3 A;  4RI7 A;  4Q5R A;  1NHY A;  2CAQ A;  1GH2 A;  4POL A;  4G2E A;  5COH A;  1SK1 A;  1WOU A;  2I9H A;  4MPF A;  3M9J A;  3GTU A;  3RBT A;  1BAY A;  2HZE A;  1XWA A;  3WD6 A;  1GUM A;  1I9D A;  2FA8 A;  2V6K A;  4NHZ A;  3ZFL A;  1V2A A;  1O81 A;  4ACS A;  4FIW A;  3F6F A;  2H6Y A;  4RUV A;  5JWQ B;  1AC1 A;  3C1S A;  2X8H A;  2OKA A;  1R4W A;  5ELG A;  2AB6 A;  1PMT A;  2E7P A;  2R3X A;  4OFT A;  4G9H A;  1FHE A;  1BQ7 A;  2RUE A;  1B9Y C;  1V58 A;  2E2G A;  3H4K A;  3DWV A;  3TGZ A;  3TUE A;  4MK3 A;  3ME8 A;  2CVB A;  3SBC A;  5D8I A;  2R5G A;  4PGT A;  1GUL A;  3GA4 A;  2L59 A;  4EKZ A;  3IK9 A;  3LWA A;  1TI3 A;  2ES7 A;  3VPT A;  5IMD A;  3GX0 A;  3SWL A;  1ML6 A;  3L0H A;  2WB9 A;  3GKN A;  4NMU A;  2GQK A;  2QGV A;  3EYT A;  4HOJ A;  1AAZ A;  3KH9 A;  2JAD A;  5DVB A;  1A0F A;  1WRY A;  3QD9 A;  2B5Y A;  1YEP A;  1YQ1 A;  4ML6 A;  3US3 A;  2KOK A;  2GSQ A;  3CMI A;  3IC4 A;  4YQV A;  3ZIV A;  1SL0 B;  1K0N A;  3D6I A;  1EGR A;  3LGC A;  4KH7 A;  3HHV A;  3LFL A;  2LJA A;  1PA3 A;  1BJX A;  1Z7R A;  2YWO A;  4MF7 A;  3FYG A;  5B7C A;  4TW5 A;  3IAM 2;  3EVI A;  3F6D A;  2H1B A;  1MEK A;  3QOU A;  1SKS B;  4IKH A;  3BCI A;  5A4W A;  4ECB A;  2RUF A;  4H86 A;  2WS2 A;  3GYK A;  3TKS A;  4JBB A;  2HRF A;  3GFK A;  4WET A;  1Z3E A;  2AJQ B;  3KMN A;  3ED3 A;  1LU4 A;  3H8Q A;  3P2A A;  3I6A A;  1K3L A;  5DDL A;  1ON4 A;  3DRN A;  1K0A A;  2HE3 A;  1JHB A;  4EF0 A;  4IW9 A;  1SYX A;  2L6C A;  4TXV A;  2C0D A;  4NXI A;  1URM A;  2HRN A;  2XHF A;  5D96 A;  2ALB A;  1U3I A;  3ZIT A;  2O89 A;  4MF6 A;  4MJC A;  3TJG A;  1OKT A;  4GLT A;  4HEA 2;  1XWB A;  5GAN D;  5ECK B;  3HVS A;  4K0N A;  3KZQ A;  4PQI A;  4KUN A;  2FWE A;  5CRD A;  4XCS A;  1UC7 A;  2MYG A;  3FZ4 A;  4CDO A;  4TR3 A;  3LSZ A;  1SEN A;  4F0B A;  5C04 A;  1SL1 B;  1GSE A;  1EP7 A;  1S3A A;  4DSQ A;  4IHU A;  4KW6 A;  3H79 A;  2MZC A;  4HZ2 A;  2QKE A;  5KEJ A;  3GUR A;  4YH2 A;  1U3A A;  1R26 A;  1JZD A;  4KDY A;  1XW6 A;  3E3E A;  1K0C A;  4YAV A;  1EZK A;  2HLS A;  1PGT A;  4XTS A;  2GSR A;  1HNA A;  1F3A A;  3LG6 A;  4K7O A;  1GSS A;  5H5Q A;  1T8E B;  3F4T A;  1C72 A;  5FT3 A;  2TIR A;  2C8U A;  1ERV A;  3UIW A;  3TJK A;  1ZYQ B;  1YKC A;  2L6D A;  4NWY A;  2PUK C;  3L4N A;  3DEX A;  1X5E A;  5ECQ B;  1KNG A;  3BCK A;  2F8A A;  4XRA A;  2YOI A;  2K6V A;  2BTO T;  2F9S A;  2VAF A;  5ECR B;  5KN3 A;  1YF1 A;  4E8H A;  5ECP B;  4NPB A;  2JSZ A;  3QR6 A;  1T1V A;  2ZCT A;  1YKA A;  1UA5 A;  3VLN A;  1VF3 A;  3M9K A;  4ML1 A;  1N8J A;  1Y25 A;  1THX A;  3FZ9 A;  4WR4 A;  3GH9 A;  1E6B A;  5B6M A;  4HJM A;  1R5A A;  5B8B A;  3ZZX A;  5CRG A;  2YV7 A;  1XZO A;  1BED A;  2Z9S A;  4GCI A;  3TJJ A;  4EL1 A;  4ZL7 A;  1VRS D;  4AF2 A;  2X64 A;  4HI7 A;  2LQQ A;  3MDK A;  2GVP A;  2VD0 A;  2YNX A;  22GS A;  2G0F A;  2LJR A;  2FLS A;  1ERU A;  1WE0 A;  5IMZ A;  5IQY A;  1ZL9 A;  4N11 A;  5HQP A;  3F0I A;  4OCF A;  3QCP A;  4EUY A;  4HUA A;  4GQC A;  3UBK A;  1M2B A;  1WIK A;  1GWC A;  3W8J A;  1TDI A;  1TW9 A;  5G1K A;  4IQ1 A;  3ERW A;  4JED A;  1JZW A;  4HDE A;  5GSS A;  2C1Y A;  4N0V A;  2REM A;  5E59 A;  2PGT A;  4V1A g;  2CX3 A;  4I8B A;  4V2N A;  4Z7X A;  2FWF A;  4F2I A;  2F3M A;  3LQ7 A;  2PU9 C;  4GF0 A;  4ZB9 A;  1V98 A;  1A23 A;  2FNO A;  6GSU A;  5ECH B;  5EVO A;  4O7H A;  3TDG A;  5JCG A;  1XWK A;  1SK0 A;  3CSH A;  4GWR A;  3GRX A;  4IS0 A;  1AW9 A;  2CT6 A;  3E0U A;  5G1L A;  4Q5Q A;  1K3O A;  4KCA A;  1Z7P A;  2H0I A;  4Q5N A;  5G31 A;  1O8X A;  1ZGN A;  4O92 A;  1USB A;  1R5P A;  5D93 A;  2KLX A;  1B8X A;  4LLR A;  1EEM A;  6GST A;  2I1U A;  3P90 A;  1MDI A;  1OC9 A;  2JAC A;  1K3Y A;  4K2D A;  4X43 A;  5HR2 A;  3ZVJ D;  3MAK A;  3EE2 A;  3IBH A;  2FWG A;  1AUC A;  4TXO A;  2I3Y A;  3W8S A;  1GRX A;  5G5F A;  2LKU A;  3KIJ A;  4N10 A;  3MSZ A;  4BWQ A;  2N5F A;  2CVK A;  2YZU A;  1J0F A;  3Q19 A;  5LNK e;  5J9C A;  2R2J A;  1MTC A;  3HYP A;  5KN1 A;  4TR1 A;  2V32 A;  1PX6 A;  2M72 A;  3FEU A;  1GNW A;  3DD3 A;  1GLQ A;  1PKW A;  2DC5 A;  5IMA A;  1TRW A;  1XW9 A;  2H6X A;  1G0T A;  1ERW A;  3F4S A;  4L5L A;  3N5O A;  3TB2 A;  3GHA A;  1M0U A;  1HYU A;  2H75 A;  2AAW A;  5E4W A;  4EDZ A;  2FWH A;  2DIY A;  4DSS B;  5IIZ A;  3OR5 A;  2A2R A;  3TKS E;  4ECJ A;  2EC4 A;  2LV3 A;  4I2U A;  2C3T A;  2OE3 A;  1EEJ A;  1KTE A;  1QUW A;  3V1W A;  5B6N A;  4IJ3 A;  3KP9 A;  3GST A;  4ZB6 A;  3LYP A;  3LYK A;  2BMX A;  2H73 A;  2IJY A;  4XS4 B;  2I81 A;  3F3Q A;  5J3R A;  1FAA A;  3UJ1 A;  2GZY A;  1PN9 A;  1PQN A;  3C8E A;  5CRH A;  1O73 A;  3M8N A;  1JLW A;  3L9U A;  1U87 A;  3N9J A;  5ECN B;  1GSU A;  3UAR A;  2LEG A;  1UVZ A;  2AYT A;  2I4A A;  1IYH A;  1Z9H A;  5ECM B;  1ERT A;  1H75 A;  2VM2 A;  1T3B A;  3BJ5 A;  3IXR A;  4AJ6 A;  3D4T A;  5EY6 A;  4OFM A;  2V2G A;  9GSS A;  4OO4 A;  3KGK A;  3M0F A;  3HA9 A;  2YWM A;  2H1A A;  1HNC A;  4GXZ A;  1WMJ A;  2KP2 A;  4Q5F A;  2FA4 A;  3EIN A;  3WGE A;  2PBJ A;  4PQH A;  3IPZ A;  1WWJ A;  1J08 A;  3I9V 2;  1QGV A;  2LTK A;  4MH2 A;  3S9F A;  4N0Z A;  2B6M A;  3EWL A;  3F8U A;  1NW2 A;  1E2Y A;  1XVW A;  1SKR B;  2H30 A;  18GS A;  5DCH A;  3M3M A;  1Z5Y E;  12GS A;  1GUK A;  2VL2 A;  4ID0 A;  4EXJ A;  1A2M A;  3CRU A;  3ZRD A;  1O8W A;  1XCC A;  3KXO A;  2HT9 A;  4L0W A;  6GSX A;  2FCH A;  5AIX A;  1OC3 A;  5J5N A;  1GSF A;  4JR4 A;  2L4Q A;  1SJZ A;  4V2L A;  3J7Y b;  2GSS A;  2M80 A;  3TRX A;  2OE1 A;  1JFU A;  4PUF C;  4LMW A;  2AUV A;  3FZA A;  5EL8 A;  3UBL A;  3UMA A;  3RPN A;  1EOG A;  4ZBB A;  5DAL B;  4PNG A;  1EWX A;  1Z6M A;  3APS A;  4P3Y B;  4WBJ A;  1YF0 A;  3C73 A;  6GSW A;  1JZR A;  1YJ6 A;  3DYR A;  3GUS A;  4TOP A;  2J9H A;  3MWH A;  4GQF A;  5ECS A;  2NDO A;  2XPE A;  4ZBD A;  2H76 A;  5JWO B;  5HFG A;  1XFL A;  4YQM A;  3ZMK A;  5AN1 A;  5A4V A;  1OE8 A;  4POM A;  4JRR A;  1ST9 A;  1Q4J A;  1TRV A;  2GQL A;  1N2A A;  2P5R A;  1FOV A;  1M99 A;  4LL1 B;  4IEL A;  5DJM A;  5G2Z A;  4X0X A;  4TRX A;  5DCG A;  3VWX A;  3GL3 A;  4I2T A;  3HZ8 A;  3IHQ A;  4XS6 A;  1F37 A;  3G9B A;  2CV4 A;  1XOA A;  1B9X C;  2E2M A;  1Z6N A;  2H0G A;  2N5A A;  3D5J A;  4BL7 A;  2DIZ A;  1SL2 B;  2MMA A;  3H1N A;  2QC7 A;  4ZBA A;  3RDW A;  1S3D A;  3IA1 A;  2H1D A;  2LST A;  4IBP A;  2P0G A;  1R7H A;  2N5B A;  3P7X A;  4HU7 A;  4I97 A;  2DJ3 A;  2DLX A;  1TXX A;  4QL9 A;  1FB6 A;  1B48 A;  1NM3 A;  5D9X A;  5IOX A;  4TKY A;  2O8V B;  1PKZ A;  3F63 A;  3UVT A;  2L5L A;  2H1G A;  4MP4 A;  5IM9 A;  1T00 A;  3DVW A;  4E8E A;  5KN0 A;  7GSS A;  4ZL8 A;  4TVE A;  1S3C A;  14GS A;  1TRU A;  1G6Y A;  2JU5 A;  1G7E A;  4MDC A;  4XS1 A;  2DJ1 A;  4G10 A;  1TKD B;  2WRT A;  3L78 A;  2OJL A;  1XVQ A;  2JSY A;  3VWU A;  1H4O A;  4GSN A;  2B5X A;  1HNB A;  4MLY A;  4YAP A;  5ID2 B;  1TU8 A;  3QFB C;  1TK0 B;  3TKS C;  1GP1 A;  4GTU A;  3C71 A;  4WF4 A;  5AIS A;  2AV4 A;  2HFD A;  4TN8 A;  5CNW A;  1X9M B;  3ZRE A;  1MD3 A;  4I6X A;  4EE0 A;  2YP6 A;  1A24 A;  5HFI A;  4WKW A;  4K8M A;  1VF4 A;  4TR4 A;  3QDN A;  4KND A;  4MZB A;  2GLR A;  3VUR A;  3FR6 A;  4MH3 A;  1DUG A;  3DXB A;  4OCE A;  4GSS A;  2NBS A;  4LA1 A;  2C4J A;  4AGS A;  3EMP A;  4O32 A;  1G6W A;  1WP0 A;  5IMC A;  5J9B A;  4JR6 A;  2GT6 A;  2K8S A;  1ABA A;  2IIY A;  3D4M A;  1AQV A;  2GDR A;  1XXU A;  2LRT A;  2H8L A;  4N30 A;  4K9Z A;  5AGY A;  2C0E A;  2L5O A;  2C0G A;  1XWC A;  2ZUP A;  1YEX A;  4O5R A;  3KP8 A;  2IME A;  2V41 A;  1SJI A;  3H93 A;  1SD8 A;  3CXG A;  1GTB A;  2H71 A;  2YV9 A;  2A4V A;  3KM6 A;  1Y6E A;  2V1M A;  2PN8 A;  1DE1 A;  5HR3 A;  1RK4 A;  4JE1 A;  3TKQ A;  2MMZ A;  4QL7 A;  3APQ A;  3EU4 A;  5GZZ B;  4J56 E;  3Q6O A;  2F51 A;  5LD0 A;  1GNE A;  4NV2 A;  3UAP A;  2O87 A;  1AXD A;  3W6G A;  4IJI A;  5J4U A;  3TCO A;  1UN2 A;  3O3T A;  2CVD A;  16GS A;  1A2J A;  2WZ9 A;  5INY A;  2PWJ A;  3ZIJ A;  3WT2 A;  1EV9 A;  2FD3 A;  1RW1 A;  3UL3 A;  3PH9 A;  3G7I A;  3KTB A;  1PSQ A;  13GS A;  4BA7 A;  4YQU A;  1PL1 A;  3TRQ A;  2DMM A;  1TJD A;  3HJO A;  3U5R E;  2O7K A;  4PUR A;  1DSB A;  2P5Q A;  1SK2 A;  2C3Q A;  1WJK A;  1FVK A;  2WGR A;  5H5S A;  1PL2 A;  1F3B A;  2TRX A;  4K7N A;  4IVF A;  3KH7 A;  4EC0 A;  1AQW A;  1QMV A;  3FR3 A;  3JCM L;  1PD2 1;  5FWG A;  3D22 A;  2JZR A;  5D9T A;  2IMK A;  2XC2 A;  2B3S A;  1M9A A;  3C7M A;  5G30 A;  3A2W A;  1V40 A;  3NZN A;  3VWV A;  4V2M A;  3BD2 A;  3DVX A;  4DVC A;  4DSS A;  1TP9 A;  1OAZ A;  4FYB A;  4D73 B;  3LOR A;  4MMM A;  2VL3 A;  3KMO A;  1TTZ A;  2WFC A;  4FYC A;  3F4R A;  2R37 A;  3I69 A;  3GKK A;  4EO3 A;  4ZXG A;  3HXS A;  4IGJ A;  3FY7 A;  4RI6 A;  2C0F A;  3P8W A;  4XS4 A;  5CO3 A;  3ZLP A;  2F8F A;  3IK7 A;  4HQS A;  1SKW B;  1WPI A;  3QFA C;  5JCU A;  4OMV A;  5F8B A;  4L8E A;  3PGT A;  3KJY A;  4DSR A;  3J7Y k;  2RII A;  4OFN A;  2YJ7 A;  3GSS A;  3FHK A;  2L4C A;  4NV5 A;  3AY8 A;  3DKS A;  3HKR A;  3WGX A;  5DAK B;  5LCZ A;  2JZS A;  5C00 A;  4ZB8 A;  1DBY A;  4DEJ A;  2FY6 A;  1OVN A;  2JL4 A;  1OKD A;  1K0M A;  1TOF A;  1QXH A;  3PIN A;  2FUG 2;  4WR5 A;  4MJB A;  2K18 A;  1TK5 B;  3GNJ A;  5ECI B;  2RLI A;  1DE2 A;  2NPB A;  3D21 A;  1BX9 A;  1F2E A;  1OYJ A;  3VI5 A;  4IP6 A;  4WXT A;  2HYX A;  3VWW A;  2GZP A;  2H66 A;  1U88 A;  2VCQ A;  2DJ2 A;  3FR9 A;  1MD4 A;  4KB3 A;  2AHE A;  4RQX A;  5ECO B;  2B1L A;  1OE7 A;  2G2Q A;  4POK A;  2E0Q A;  2DJJ A;  4F9Z A;  3IR4 A;  4ULX A;  1MDK A;  1T4Z A;  2OA7 A;  4HZ4 A;  2RM5 A;  1J9B A;  2DJ0 A;  1SJ6 A;  2IFQ B;  2YN1 A; 
#chains in the Genus database with same CATH topology
 1LJR A;  1M7T A;  2GGT A;  3A2X A;  4FYU A;  4MZC A;  1TU7 A;  1YY7 A;  5IPG A;  1GLP A;  3GTU B;  1FOH A;  3NOF A;  2HZE B;  3HZ4 A;  3EC3 A;  5H5R A;  2YWI A;  5A5K A;  3QAW A;  4KDU A;  1RQM A;  3DIE A;  4HSC X;  2X99 A;  1ZYE A;  3QPM A;  3KCM A;  4JU5 A;  5DBQ A;  6GSS A;  2YAN A;  3TOU A;  2VUP A;  5HR1 A;  4JZQ A;  1M2A A;  3ZVJ A;  4MF5 A;  4QQ7 A;  3ERG A;  1M2D A;  2H6Z A;  2YZH A;  5DAL A;  1EGO A;  3EMX A;  4K1F A;  4FQU A;  4EVM A;  5IPH A;  2M46 A;  1K0B A;  5IMV A;  2C80 A;  1TI1 A;  4KSM A;  2GZZ A;  2VO4 A;  4PQ1 A;  2NTO A;  4YKF A;  2WUL A;  3A5W A;  1VF1 A;  5ABR A;  1A8Y A;  1HD2 A;  1YZX A;  5IO2 A;  2EIR A;  1PFO A;  3KEB A;  4IQA A;  4FH8 A;  2VL9 A;  1CQH A;  2PER A;  3HD5 A;  1X0R A;  2K9F A;  4HU9 A;  3GMF A;  1ZCP A;  2GST A;  2CX4 A;  1F6M C;  2RM6 A;  3A2V A;  2CZ3 A;  1KEB A;  3PR8 A;  4V1A p;  3LXT A;  4J2F A;  4AJ8 A;  4PX1 A;  4KA0 A;  3O76 A;  2R6K A;  3QMX A;  2WDU A;  1XW5 A;  1GTA A;  2GQM A;  1GTI A;  4BVY A;  1PX7 A;  1EOH A;  5CP1 A;  5JCW A;  2H70 A;  5F07 A;  4AJ7 A;  5CYY A;  2YJH A;  2A2S A;  2KUC A;  1SD9 A;  4MJE A;  3R3E A;  3MNG A;  1FB0 A;  3FK8 A;  3ZL5 A;  2JZT A;  2B7J A;  4PUA A;  4MJA A;  2X8G A;  4ILF A;  2VL2 C;  2HSH A;  6GSY A;  2IMD A;  4PXO A;  2VCZ A;  4I5Q A;  4HS1 A;  8GSS A;  4RQR A;  3L9S A;  2YPM A;  2LJK A;  5DQS A;  3IRA A;  2VCV A;  1BG5 A;  4LMV A;  3GIX A;  1ZOF A;  2C3N A;  3LXZ A;  3UOM A;  1AQX A;  2LNS A;  2R4V A;  1X9S B;  1PN0 A;  1S3R A;  4IP1 A;  2B7K A;  2CZ2 A;  4MAB A;  4MPG A;  3VI7 A;  3QAG A;  3QAV A;  2YCD A;  1V57 A;  5CRE A;  4HJ2 A;  5GAP D;  3IDV A;  4ISD A;  2FHE A;  3U6V A;  5J41 A;  2L57 A;  4NHW A;  3FRC A;  3M1G A;  2IN3 A;  4L0U A;  2YWN A;  3GX8 A;  1FG4 A;  2HZF A;  3RAZ A;  5D9W A;  2LRC A;  2NVL A;  2GTU A;  5ID2 A;  1ZZY A;  5ENU A;  3ZYW A;  2MMO A;  3DGQ A;  2GS3 A;  2LQO A;  2HXK A;  3O6T A;  1JZO A;  2B5E A;  4WF5 A;  4Z2T A;  3Q18 A;  3KD0 A;  5HR0 A;  4F82 A;  2R0G A;  2CQ9 A;  3EUR A;  2OBI A;  3APO A;  5L71 A;  4KSO A;  2XBI A;  4F03 A;  3FKF A;  1K0D A;  1GSD A;  2ON5 A;  4KGI A;  1X9W B;  2IPA A;  2ON7 A;  5IOW A;  1GSQ A;  1GTU A;  3CSI A;  4ZIL A;  3I43 A;  1F9M A;  4G0L A;  4KDX A;  4MZW A;  2DML A;  1ACV A;  2KP1 A;  4G0I A;  3GKX A;  3CTG A;  1X5C A;  3HVV A;  1M3J A;  2O85 A;  1VGL A;  2CAI A;  4ZL9 A;  1QFN A;  3WGD A;  2XPD A;  1MDJ A;  4ECI A;  2K8V A;  3FZ5 A;  3CTF A;  4GRF A;  2HI7 A;  3K8N A;  2H0H A;  1B4P A;  4KCE A;  3CYN A;  3GN3 A;  4G19 A;  3RHC A;  4X1U A;  2TRC P;  3GH6 A;  3ME7 A;  4MA9 A;  3C1R A;  2IMF A;  1B4Q A;  2WCI A;  4MCU A;  4J57 E;  3VK9 A;  1FO5 A;  2BJX A;  4NAX A;  4BVX A;  2IMI A;  2KHP A;  2LS5 A;  2VD1 A;  1W4V A;  2VLT A;  5AIV A;  1TK8 B;  2IWT A;  3G7J A;  1V9W A;  2P31 A;  2VCT A;  1TRS A;  4O5U A;  2H72 A;  4OO5 A;  3TJB A;  2PMT A;  5EPF A;  4XRD A;  3UEM A;  1XPV A;  5G5E A;  4CHS A;  5D9V A;  1PRX A;  1ILO A;  2XBQ A;  3GV1 A;  2J23 A;  3IOS A;  3IAS 2;  3BBY A;  1FVJ A;  3CRT A;  1THO A;  2H19 A;  1W89 A;  2VM1 A;  4TR0 A;  3IE3 A;  2VIM A;  4F0C A;  1EV4 A;  5D73 A;  4XHM A;  2DJK A;  1O85 A;  4EIQ A;  3ZFB A;  2HNL A;  2B1K A;  2OAD A;  5FHI A;  5B8A A;  2HRA A;  4HQZ A;  4G0K A;  5GST A;  2FGX A;  3A5I A;  1AIU A;  4KAE A;  4YKG A;  4EIP A;  2MBT A;  4XIH A;  3LJR A;  3VFI A;  2DBC A;  4BPY A;  1M9B A;  1K0O A;  4MNN A;  5ELA A;  3GL5 A;  3LW9 A;  4IN0 A;  1GUH A;  5A4U A;  1YDK A;  3HDC A;  2EIQ A;  4ZIJ A;  4BWS A;  4K7I A;  19GS A;  2MMN A;  17GS A;  4OD7 A;  3HJM A;  2CA8 A;  1OC8 A;  2MBS A;  5F05 A;  4ECC A;  1BYE A;  2H01 A;  2H74 A;  2VCX A;  3UVH A;  2QSI A;  4O5Q A;  20GS A;  1SU9 A;  3E9J B;  3R2Q A;  1A0R P;  3WT1 A;  1CQG A;  2OBK A;  3TOT A;  4D73 A;  1T7P B;  4KX4 A;  3L9V A;  1NHO A;  1QQ2 A;  1O6J A;  3F9U A;  4X4J A;  5IMF A;  1ZMA A;  4K6X A;  6GSV A;  3ISO A;  2LRN A;  2V6O A;  1VF2 A;  5IO0 A;  3KTL A;  2VLV A;  3TRP A;  2D2Z A;  1I5G A;  3CSJ A;  2LUS A;  3DML A;  3NIV A;  1KBN A;  5DQY A;  5F0G A;  3HJP A;  5CAX A;  1U6T A;  1G7O A;  2PVQ A;  1XBS A;  2R0P A;  2WJU A;  5JWR B;  2HSY A;  4L5O A;  3CBU A;  1JLV A;  1OC9 B;  3A3T A;  4PNF A;  5DJL A;  3HY2 A;  5CRW A;  3TKP A;  3VPQ A;  1FW1 A;  4TXO B;  3HVX A;  2LNT A;  1LBK A;  3GKM A;  5ECL B;  3RHB A;  4CW9 A;  2ZNM A;  5DAK A;  4POB A;  2X49 A;  1T4Y A;  4WBR D;  1XIY A;  2DSA A;  10GS A;  3IV4 A;  4TR1 B;  4LL4 B;  3BOA A;  3F3R A;  4K0G A;  1EP8 A;  1GL8 A;  4CY6 A;  4GST A;  2PVO C;  2EIO A;  4PTS A;  3Q74 A;  1GSY A;  1QK8 A;  2GT5 A;  4OWY A;  11GS A;  1XWG A;  1Q98 A;  1A8L A;  3RPP A;  1NSW A;  1A2L A;  3TKR A;  1HQO A;  3FW2 A;  5F06 A;  5KN2 A;  3D0Z A;  2VLU A;  1XOB A;  4FO5 A;  3WYW A;  3ZTL A;  1IYI A;  2HSM A;  2X8C A;  2PPT A;  3EU3 A;  3LEF A;  3ERF A;  3G7Y A;  5HFK A;  3ZML A;  1X5D A;  2OE0 A;  2OAC A;  2DKH A;  4KE3 A;  4EDY A;  5BRT A;  1O7U A;  1SYR A;  2VCW A;  4WEY A;  3HCZ A;  2VOC A;  3TJF A;  2IFQ A;  2IL3 A;  4RI7 A;  4Q5R A;  1NHY A;  2CAQ A;  1GH2 A;  4POL A;  4G2E A;  5COH A;  1SK1 A;  1WOU A;  2I9H A;  4MPF A;  3M9J A;  3GTU A;  3RBT A;  1BAY A;  2HZE A;  1XWA A;  3WD6 A;  1GUM A;  1I9D A;  2FA8 A;  4A5P A;  2V6K A;  4NHZ A;  3ZFL A;  4USS A;  1V2A A;  1O81 A;  4ACS A;  4FIW A;  3F6F A;  2H6Y A;  4RUV A;  5JWQ B;  1AC1 A;  3C1S A;  2X8H A;  2OKA A;  1R4W A;  5ELG A;  2AB6 A;  1PMT A;  2E7P A;  2R3X A;  4OFT A;  4G9H A;  1FHE A;  1BQ7 A;  2RUE A;  1B9Y C;  1V58 A;  2E2G A;  3H4K A;  3DWV A;  3TGZ A;  3TUE A;  4MK3 A;  3ME8 A;  2CVB A;  3SBC A;  5D8I A;  2R5G A;  4PGT A;  1GUL A;  3GA4 A;  2L59 A;  4EKZ A;  3IK9 A;  3LWA A;  1TI3 A;  2ES7 A;  3VPT A;  5IMD A;  3GX0 A;  3SWL A;  1ML6 A;  3L0H A;  2WB9 A;  3GKN A;  4NMU A;  2GQK A;  2QGV A;  3EYT A;  4HOJ A;  1AAZ A;  3KH9 A;  2JAD A;  5DVB A;  1A0F A;  1WRY A;  1XG8 A;  3QD9 A;  2B5Y A;  1YEP A;  1YQ1 A;  4ML6 A;  3US3 A;  2KOK A;  2GSQ A;  3CMI A;  3IC4 A;  4YQV A;  3ZIV A;  1SL0 B;  1K0N A;  3D6I A;  1EGR A;  3LGC A;  4KH7 A;  3HHV A;  3LFL A;  2LJA A;  1PA3 A;  1BJX A;  1Z7R A;  2X4A A;  2YWO A;  4MF7 A;  3FYG A;  5B7C A;  4TW5 A;  3IAM 2;  3EVI A;  3F6D A;  2H1B A;  1MEK A;  3QOU A;  1SKS B;  4IKH A;  3BCI A;  5A4W A;  4ECB A;  2RUF A;  4H86 A;  2WS2 A;  3GYK A;  3TKS A;  4JBB A;  2HRF A;  3GFK A;  4WET A;  1Z3E A;  2AJQ B;  3KMN A;  3ED3 A;  1LU4 A;  3H8Q A;  3P2A A;  3I6A A;  1K3L A;  5DDL A;  1ON4 A;  3DRN A;  1K0A A;  2HE3 A;  1JHB A;  4EF0 A;  4IW9 A;  1SYX A;  2L6C A;  4TXV A;  2C0D A;  4NXI A;  1URM A;  2HRN A;  2XHF A;  5D96 A;  2ALB A;  1U3I A;  3ZIT A;  2O89 A;  4MF6 A;  4MJC A;  3TJG A;  1OKT A;  4GLT A;  4HEA 2;  1XWB A;  5GAN D;  5ECK B;  3HVS A;  4K0N A;  3KZQ A;  4PQI A;  4KUN A;  2FWE A;  5CRD A;  4XCS A;  1UC7 A;  2MYG A;  3FZ4 A;  4CDO A;  4TR3 A;  3LSZ A;  1SEN A;  4F0B A;  5C04 A;  1SL1 B;  1GSE A;  1EP7 A;  1S3A A;  4BL7 B;  4DSQ A;  4IHU A;  4KW6 A;  3H79 A;  2MZC A;  4HZ2 A;  2QKE A;  5KEJ A;  3GUR A;  4YH2 A;  1U3A A;  1R26 A;  1JZD A;  4KDY A;  1XW6 A;  3E3E A;  1K0C A;  4YAV A;  1EZK A;  2HLS A;  1PGT A;  4XTS A;  2GSR A;  1HNA A;  1F3A A;  3LG6 A;  4K7O A;  1GSS A;  5H5Q A;  1T8E B;  3F4T A;  1C72 A;  5FT3 A;  2TIR A;  2C8U A;  1ERV A;  3UIW A;  3TJK A;  1ZYQ B;  1YKC A;  2L6D A;  4NWY A;  2PUK C;  3L4N A;  1ZYP A;  3DEX A;  1X5E A;  5ECQ B;  1KNG A;  3BCK A;  2F8A A;  4XRA A;  2YOI A;  2K6V A;  2BTO T;  2F9S A;  2VAF A;  5ECR B;  5KN3 A;  1YF1 A;  4E8H A;  5ECP B;  4NPB A;  1ZYN A;  2JSZ A;  3QR6 A;  1T1V A;  2ZCT A;  1YKA A;  1UA5 A;  3VLN A;  1VF3 A;  3M9K A;  4ML1 A;  1N8J A;  1Y25 A;  1THX A;  3FZ9 A;  4WR4 A;  5KOW A;  3GH9 A;  1E6B A;  5B6M A;  4HJM A;  1R5A A;  5B8B A;  3ZZX A;  5CRG A;  2YV7 A;  1XZO A;  1BED A;  2Z9S A;  4GCI A;  3TJJ A;  4EL1 A;  4ZL7 A;  1VRS D;  4AF2 A;  2X64 A;  4HI7 A;  2LQQ A;  3MDK A;  2GVP A;  2VD0 A;  2YNX A;  2QA2 A;  22GS A;  2G0F A;  2LJR A;  2FLS A;  1ERU A;  1WE0 A;  5IMZ A;  5IQY A;  1ZL9 A;  4N11 A;  5HQP A;  3F0I A;  4OCF A;  3QCP A;  4EUY A;  4HUA A;  4GQC A;  3UBK A;  1M2B A;  1WIK A;  1GWC A;  3W8J A;  1TDI A;  1TW9 A;  5G1K A;  4IQ1 A;  3ERW A;  4JED A;  1JZW A;  4HDE A;  5GSS A;  2C1Y A;  4N0V A;  2REM A;  5E59 A;  2PGT A;  4V1A g;  2CX3 A;  4I8B A;  4V2N A;  4Z7X A;  2FWF A;  4F2I A;  2F3M A;  3LQ7 A;  2PU9 C;  4GF0 A;  4ZB9 A;  1V98 A;  1A23 A;  2FNO A;  6GSU A;  5ECH B;  5EVO A;  4O7H A;  3TDG A;  5JCG A;  1XWK A;  1SK0 A;  3CSH A;  4GWR A;  3GRX A;  4IS0 A;  1AW9 A;  2CT6 A;  3E0U A;  5G1L A;  4Q5Q A;  1K3O A;  4KCA A;  1Z7P A;  2H0I A;  4Q5N A;  5G31 A;  1O8X A;  1ZGN A;  4O92 A;  1USB A;  1R5P A;  5D93 A;  2KLX A;  1B8X A;  4LLR A;  1EEM A;  6GST A;  2I1U A;  3P90 A;  1MDI A;  1OC9 A;  2JAC A;  1K3Y A;  4K2D A;  4X43 A;  5HR2 A;  3ZVJ D;  3MAK A;  3EE2 A;  3IBH A;  2FWG A;  1AUC A;  4TXO A;  2I3Y A;  3W8S A;  1GRX A;  5G5F A;  2LKU A;  3KIJ A;  4N10 A;  3MSZ A;  4BWQ A;  3FMW A;  2N5F A;  2CVK A;  2YZU A;  1J0F A;  3IHG A;  3Q19 A;  5LNK e;  5J9C A;  2R2J A;  1MTC A;  3HYP A;  5KN1 A;  4TR1 A;  2V32 A;  1PX6 A;  2M72 A;  3FEU A;  1GNW A;  3DD3 A;  1GLQ A;  1PKW A;  2DC5 A;  5IMA A;  1TRW A;  1XW9 A;  2H6X A;  1G0T A;  1ERW A;  3F4S A;  4L5L A;  3N5O A;  3TB2 A;  3GHA A;  1M0U A;  1HYU A;  2H75 A;  2AAW A;  5E4W A;  4EDZ A;  2FWH A;  2DIY A;  4DSS B;  5IIZ A;  3OR5 A;  2A2R A;  3TKS E;  4ECJ A;  2EC4 A;  2LV3 A;  4I2U A;  2C3T A;  2OE3 A;  1EEJ A;  1KTE A;  1QUW A;  3V1W A;  5B6N A;  4IJ3 A;  3KP9 A;  3GST A;  4ZB6 A;  3LYP A;  3LYK A;  2BMX A;  2H73 A;  2IJY A;  4XS4 B;  2I81 A;  3F3Q A;  5J3R A;  1FAA A;  3UJ1 A;  2GZY A;  1PN9 A;  1PQN A;  3C8E A;  5CRH A;  1O73 A;  3M8N A;  1JLW A;  3L9U A;  1U87 A;  3N9J A;  5ECN B;  1GSU A;  3UAR A;  2LEG A;  1UVZ A;  2AYT A;  2I4A A;  1IYH A;  3IC8 A;  4CY8 A;  1Z9H A;  5ECM B;  2A4H A;  1ERT A;  1H75 A;  2VM2 A;  1T3B A;  3BJ5 A;  3IXR A;  4AJ6 A;  3D4T A;  5EY6 A;  4OFM A;  2V2G A;  9GSS A;  5KOX A;  4OO4 A;  3KGK A;  3M0F A;  3HA9 A;  2YWM A;  2H1A A;  1HNC A;  4GXZ A;  1WMJ A;  2KP2 A;  4Q5F A;  2FA4 A;  3EIN A;  3WGE A;  2PBJ A;  4PQH A;  3IPZ A;  1WWJ A;  1J08 A;  3I9V 2;  1QGV A;  2LTK A;  4MH2 A;  3S9F A;  4N0Z A;  2B6M A;  3EWL A;  3F8U A;  1NW2 A;  1E2Y A;  1XVW A;  1SKR B;  2H30 A;  18GS A;  5DCH A;  3M3M A;  1Z5Y E;  12GS A;  1GUK A;  2VL2 A;  4ID0 A;  4EXJ A;  1A2M A;  3CRU A;  3ZRD A;  1O8W A;  1XCC A;  3HVN A;  2DKI A;  3KXO A;  2HT9 A;  4L0W A;  6GSX A;  2FCH A;  5AIX A;  1OC3 A;  5J5N A;  1GSF A;  4JR4 A;  2L4Q A;  1SJZ A;  4V2L A;  3J7Y b;  2GSS A;  2M80 A;  3TRX A;  2OE1 A;  1JFU A;  4PUF C;  4LMW A;  2AUV A;  3FZA A;  5EL8 A;  3UBL A;  3UMA A;  3RPN A;  1EOG A;  4ZBB A;  5DAL B;  4PNG A;  1EWX A;  1Z6M A;  3APS A;  2R0C A;  4P3Y B;  4WBJ A;  1YF0 A;  3C73 A;  6GSW A;  1JZR A;  1YJ6 A;  3DYR A;  3GUS A;  4TOP A;  2J9H A;  3MWH A;  4GQF A;  5ECS A;  2NDO A;  2XPE A;  2A2P A;  4ZBD A;  2H76 A;  5JWO B;  5HFG A;  4KF9 A;  2QA1 A;  1XFL A;  4YQM A;  3ZMK A;  5AN1 A;  5A4V A;  1OE8 A;  4POM A;  4JRR A;  1ST9 A;  1Q4J A;  1TRV A;  2GQL A;  1N2A A;  2P5R A;  1FOV A;  1M99 A;  4LL1 B;  4IEL A;  5DJM A;  5G2Z A;  4X0X A;  4BVY B;  4TRX A;  5DCG A;  3VWX A;  3GL3 A;  4I2T A;  3HZ8 A;  3IHQ A;  4XS6 A;  1F37 A;  3G9B A;  2CV4 A;  3EPT A;  1XOA A;  1B9X C;  2E2M A;  1Z6N A;  2H0G A;  2N5A A;  3D5J A;  4BL7 A;  2DIZ A;  1SL2 B;  2MMA A;  3H1N A;  2QC7 A;  4ZBA A;  3RDW A;  1S3D A;  3IA1 A;  2H1D A;  2LST A;  4IBP A;  2P0G A;  1R7H A;  2N5B A;  3P7X A;  4HU7 A;  4I97 A;  2DJ3 A;  2DLX A;  1TXX A;  4QL9 A;  1FB6 A;  1B48 A;  1NM3 A;  5D9X A;  5IOX A;  4TKY A;  2O8V B;  1PKZ A;  3F63 A;  3UVT A;  2L5L A;  2H1G A;  2HRK A;  4MP4 A;  5IM9 A;  1T00 A;  3DVW A;  4E8E A;  5KN0 A;  7GSS A;  4ZL8 A;  4TVE A;  3PPU A;  1S3C A;  14GS A;  1TRU A;  1G6Y A;  2JU5 A;  1G7E A;  4MDC A;  4XS1 A;  2DJ1 A;  4G10 A;  1TKD B;  2WRT A;  3L78 A;  2OJL A;  1XVQ A;  2JSY A;  3VWU A;  1H4O A;  4GSN A;  2B5X A;  1HNB A;  4MLY A;  4YAP A;  5ID2 B;  1TU8 A;  3QFB C;  1TK0 B;  3TKS C;  1GP1 A;  4GTU A;  3C71 A;  5BMU A;  4WF4 A;  5AIS A;  2AV4 A;  2HFD A;  4TN8 A;  5CNW A;  1X9M B;  3ZRE A;  1MD3 A;  4I6X A;  4EE0 A;  2YP6 A;  1A24 A;  5HFI A;  4WKW A;  4K8M A;  1VF4 A;  4TR4 A;  3QDN A;  4KND A;  4MZB A;  2GLR A;  3VUR A;  3FR6 A;  4MH3 A;  1DUG A;  3DXB A;  4OCE A;  4GSS A;  2NBS A;  4LA1 A;  2C4J A;  4AGS A;  3EMP A;  4O32 A;  1G6W A;  1WP0 A;  5IMC A;  5J9B A;  4JR6 A;  2GT6 A;  2K8S A;  1ABA A;  2IIY A;  3D4M A;  1AQV A;  2GDR A;  1XXU A;  2LRT A;  2H8L A;  4N30 A;  4K9Z A;  5AGY A;  2C0E A;  2L5O A;  2C0G A;  1XWC A;  2ZUP A;  1YEX A;  4O5R A;  3KP8 A;  2IME A;  2V41 A;  2UZ8 A;  1SJI A;  3H93 A;  1SD8 A;  3CXG A;  1GTB A;  2H71 A;  2YV9 A;  2A4V A;  3KM6 A;  1Y6E A;  2V1M A;  4BVX B;  2PN8 A;  1DE1 A;  5HR3 A;  4Z2R A;  1RK4 A;  4JE1 A;  3TKQ A;  2MMZ A;  4QL7 A;  3APQ A;  3EU4 A;  5GZZ B;  4J56 E;  3Q6O A;  2F51 A;  5LD0 A;  1GNE A;  4NV2 A;  3UAP A;  2O87 A;  1AXD A;  3W6G A;  4IJI A;  5J4U A;  3TCO A;  1UN2 A;  3O3T A;  2CVD A;  16GS A;  1A2J A;  2WZ9 A;  5INY A;  2PWJ A;  3ZIJ A;  4K2X A;  3WT2 A;  1EV9 A;  2FD3 A;  1RW1 A;  3UL3 A;  3PH9 A;  3G7I A;  3KTB A;  1PSQ A;  13GS A;  4BA7 A;  4YQU A;  1PL1 A;  3TRQ A;  2DMM A;  1TJD A;  3HJO A;  3U5R E;  2O7K A;  4Z2U A;  4PUR A;  1DSB A;  2P5Q A;  1SK2 A;  2C3Q A;  1WJK A;  1FVK A;  2WGR A;  5H5S A;  1PL2 A;  1F3B A;  2TRX A;  4K7N A;  4IVF A;  3KH7 A;  4EC0 A;  1AQW A;  1QMV A;  3FR3 A;  3JCM L;  1PD2 1;  5FWG A;  3D22 A;  2JZR A;  2IMK A;  5D9T A;  2XC2 A;  2B3S A;  1M9A A;  3C7M A;  5G30 A;  3A2W A;  1V40 A;  3NZN A;  3VWV A;  4V2M A;  3BD2 A;  3DVX A;  4DVC A;  4BIK A;  4DSS A;  1TP9 A;  1OAZ A;  4FYB A;  4K5S A;  4D73 B;  3LOR A;  4MMM A;  2VL3 A;  3KMO A;  1TTZ A;  3CQF A;  2WFC A;  4FYC A;  3F4R A;  2R37 A;  3I69 A;  3GKK A;  4EO3 A;  4ZXG A;  3HXS A;  4IGJ A;  3FY7 A;  3MYD A;  4RI6 A;  2C0F A;  4ICY A;  3P8W A;  4XS4 A;  5CO3 A;  3ZLP A;  2F8F A;  3IK7 A;  4HQS A;  1SKW B;  1WPI A;  1M3I A;  3QFA C;  5JCU A;  4OMV A;  5F8B A;  4L8E A;  3PGT A;  3KJY A;  4DSR A;  3J7Y k;  2RII A;  4OFN A;  2YJ7 A;  3GSS A;  3FHK A;  2L4C A;  4K5R A;  4NV5 A;  3AY8 A;  3DKS A;  3HKR A;  3WGX A;  5DAK B;  5LCZ A;  2JZS A;  5C00 A;  4ZB8 A;  1DBY A;  4DEJ A;  2FY6 A;  1OVN A;  2JL4 A;  1OKD A;  1K0M A;  1TOF A;  1QXH A;  3PIN A;  2FUG 2;  4WR5 A;  4MJB A;  2K18 A;  1TK5 B;  3GNJ A;  5ECI B;  2RLI A;  1DE2 A;  2NPB A;  3D21 A;  1BX9 A;  1F2E A;  1OYJ A;  3VI5 A;  4IP6 A;  4WXT A;  2HYX A;  3VWW A;  2GZP A;  2H66 A;  1U88 A;  2VCQ A;  2DJ2 A;  3FR9 A;  1MD4 A;  4KB3 A;  2AHE A;  4RQX A;  5ECO B;  2B1L A;  1OE7 A;  2G2Q A;  4POK A;  2E0Q A;  2DJJ A;  4F9Z A;  3IR4 A;  4ULX A;  1MDK A;  1T4Z A;  2OA7 A;  4HZ4 A;  2RM5 A;  3MIX A;  1J9B A;  2DJ0 A;  1SJ6 A;  2IFQ B;  2YN1 A; 
#chains in the Genus database with same CATH homology
 1LJR A;  1M7T A;  2GGT A;  3A2X A;  4FYU A;  4MZC A;  1TU7 A;  1YY7 A;  5IPG A;  1GLP A;  3GTU B;  1FOH A;  3NOF A;  2HZE B;  3HZ4 A;  3EC3 A;  5H5R A;  2YWI A;  5A5K A;  3QAW A;  4KDU A;  1RQM A;  3DIE A;  2X99 A;  1ZYE A;  3QPM A;  3KCM A;  4JU5 A;  5DBQ A;  6GSS A;  2YAN A;  3TOU A;  2VUP A;  5HR1 A;  4JZQ A;  1M2A A;  3ZVJ A;  4MF5 A;  4QQ7 A;  3ERG A;  1M2D A;  2H6Z A;  2YZH A;  5DAL A;  1EGO A;  3EMX A;  4K1F A;  4FQU A;  4EVM A;  5IPH A;  2M46 A;  1K0B A;  5IMV A;  2C80 A;  1TI1 A;  4KSM A;  2GZZ A;  2VO4 A;  4PQ1 A;  2NTO A;  4YKF A;  2WUL A;  3A5W A;  1VF1 A;  5ABR A;  1A8Y A;  1HD2 A;  1YZX A;  5IO2 A;  2EIR A;  3KEB A;  4IQA A;  4FH8 A;  2VL9 A;  1CQH A;  2PER A;  3HD5 A;  1X0R A;  2K9F A;  4HU9 A;  3GMF A;  1ZCP A;  2GST A;  2CX4 A;  1F6M C;  2RM6 A;  3A2V A;  2CZ3 A;  1KEB A;  3PR8 A;  4V1A p;  3LXT A;  4J2F A;  4AJ8 A;  4PX1 A;  4KA0 A;  3O76 A;  2R6K A;  3QMX A;  2WDU A;  1XW5 A;  1GTA A;  2GQM A;  1GTI A;  4BVY A;  1PX7 A;  1EOH A;  5CP1 A;  5JCW A;  2H70 A;  5F07 A;  4AJ7 A;  5CYY A;  2YJH A;  2A2S A;  2KUC A;  1SD9 A;  4MJE A;  3R3E A;  3MNG A;  1FB0 A;  3FK8 A;  3ZL5 A;  2JZT A;  2B7J A;  4PUA A;  4MJA A;  2X8G A;  4ILF A;  2VL2 C;  2HSH A;  6GSY A;  2IMD A;  4PXO A;  2VCZ A;  4I5Q A;  4HS1 A;  8GSS A;  4RQR A;  3L9S A;  2YPM A;  2LJK A;  5DQS A;  3IRA A;  2VCV A;  1BG5 A;  4LMV A;  3GIX A;  1ZOF A;  2C3N A;  3LXZ A;  3UOM A;  1AQX A;  2LNS A;  2R4V A;  1X9S B;  1PN0 A;  4IP1 A;  2B7K A;  2CZ2 A;  4MAB A;  4MPG A;  3VI7 A;  3QAG A;  3QAV A;  2YCD A;  1V57 A;  5CRE A;  4HJ2 A;  5GAP D;  3IDV A;  4ISD A;  2FHE A;  3U6V A;  5J41 A;  2L57 A;  4NHW A;  3FRC A;  3M1G A;  2IN3 A;  4L0U A;  2YWN A;  3GX8 A;  1FG4 A;  2HZF A;  3RAZ A;  5D9W A;  2LRC A;  2NVL A;  2GTU A;  5ID2 A;  1ZZY A;  5ENU A;  3ZYW A;  2MMO A;  3DGQ A;  2GS3 A;  2LQO A;  2HXK A;  3O6T A;  1JZO A;  2B5E A;  4WF5 A;  4Z2T A;  3Q18 A;  3KD0 A;  5HR0 A;  4F82 A;  2R0G A;  2CQ9 A;  3EUR A;  2OBI A;  3APO A;  5L71 A;  4KSO A;  2XBI A;  4F03 A;  3FKF A;  1K0D A;  1GSD A;  2ON5 A;  4KGI A;  1X9W B;  2IPA A;  2ON7 A;  5IOW A;  1GSQ A;  1GTU A;  3CSI A;  4ZIL A;  3I43 A;  1F9M A;  4G0L A;  4KDX A;  4MZW A;  2DML A;  1ACV A;  2KP1 A;  4G0I A;  3GKX A;  3CTG A;  1X5C A;  3HVV A;  2O85 A;  1VGL A;  2CAI A;  4ZL9 A;  1QFN A;  3WGD A;  2XPD A;  1MDJ A;  4ECI A;  2K8V A;  3FZ5 A;  3CTF A;  4GRF A;  2HI7 A;  3K8N A;  2H0H A;  1B4P A;  4KCE A;  3CYN A;  3GN3 A;  4G19 A;  3RHC A;  4X1U A;  2TRC P;  3GH6 A;  3ME7 A;  4MA9 A;  3C1R A;  2IMF A;  1B4Q A;  2WCI A;  4MCU A;  4J57 E;  3VK9 A;  1FO5 A;  2BJX A;  4NAX A;  4BVX A;  2IMI A;  2KHP A;  2LS5 A;  2VD1 A;  1W4V A;  2VLT A;  5AIV A;  1TK8 B;  2IWT A;  3G7J A;  1V9W A;  2P31 A;  2VCT A;  1TRS A;  4O5U A;  2H72 A;  4OO5 A;  3TJB A;  2PMT A;  5EPF A;  4XRD A;  3UEM A;  1XPV A;  5G5E A;  4CHS A;  5D9V A;  1PRX A;  1ILO A;  2XBQ A;  3GV1 A;  2J23 A;  3IOS A;  3IAS 2;  3BBY A;  1FVJ A;  3CRT A;  1THO A;  2H19 A;  1W89 A;  2VM1 A;  4TR0 A;  3IE3 A;  2VIM A;  4F0C A;  1EV4 A;  5D73 A;  4XHM A;  2DJK A;  1O85 A;  4EIQ A;  3ZFB A;  2HNL A;  2B1K A;  2OAD A;  5FHI A;  5B8A A;  2HRA A;  4HQZ A;  4G0K A;  5GST A;  2FGX A;  3A5I A;  1AIU A;  4KAE A;  4YKG A;  4EIP A;  2MBT A;  4XIH A;  3LJR A;  3VFI A;  2DBC A;  4BPY A;  1M9B A;  1K0O A;  4MNN A;  5ELA A;  3GL5 A;  3LW9 A;  4IN0 A;  1GUH A;  5A4U A;  1YDK A;  3HDC A;  2EIQ A;  4ZIJ A;  4BWS A;  4K7I A;  19GS A;  2MMN A;  17GS A;  4OD7 A;  3HJM A;  2CA8 A;  1OC8 A;  2MBS A;  5F05 A;  4ECC A;  1BYE A;  2H01 A;  2H74 A;  2VCX A;  3UVH A;  2QSI A;  4O5Q A;  20GS A;  1SU9 A;  3E9J B;  3R2Q A;  1A0R P;  3WT1 A;  1CQG A;  2OBK A;  3TOT A;  4D73 A;  1T7P B;  4KX4 A;  3L9V A;  1NHO A;  1QQ2 A;  1O6J A;  3F9U A;  4X4J A;  5IMF A;  1ZMA A;  4K6X A;  6GSV A;  3ISO A;  2LRN A;  2V6O A;  1VF2 A;  5IO0 A;  3KTL A;  2VLV A;  3TRP A;  2D2Z A;  1I5G A;  3CSJ A;  2LUS A;  3DML A;  3NIV A;  1KBN A;  5DQY A;  5F0G A;  3HJP A;  5CAX A;  1U6T A;  1G7O A;  2PVQ A;  1XBS A;  2R0P A;  2WJU A;  5JWR B;  2HSY A;  4L5O A;  3CBU A;  1JLV A;  1OC9 B;  3A3T A;  4PNF A;  5DJL A;  3HY2 A;  5CRW A;  3TKP A;  3VPQ A;  1FW1 A;  4TXO B;  3HVX A;  2LNT A;  1LBK A;  3GKM A;  5ECL B;  3RHB A;  4CW9 A;  2ZNM A;  5DAK A;  4POB A;  2X49 A;  1T4Y A;  4WBR D;  1XIY A;  2DSA A;  10GS A;  3IV4 A;  4TR1 B;  4LL4 B;  3BOA A;  3F3R A;  4K0G A;  1EP8 A;  1GL8 A;  4CY6 A;  4GST A;  2PVO C;  2EIO A;  4PTS A;  3Q74 A;  1GSY A;  1QK8 A;  2GT5 A;  4OWY A;  11GS A;  1XWG A;  1Q98 A;  1A8L A;  3RPP A;  1NSW A;  1A2L A;  3TKR A;  1HQO A;  3FW2 A;  5F06 A;  5KN2 A;  3D0Z A;  2VLU A;  1XOB A;  4FO5 A;  3WYW A;  3ZTL A;  1IYI A;  2HSM A;  2X8C A;  2PPT A;  3EU3 A;  3LEF A;  3ERF A;  3G7Y A;  5HFK A;  3ZML A;  1X5D A;  2OE0 A;  2OAC A;  2DKH A;  4KE3 A;  4EDY A;  5BRT A;  1O7U A;  1SYR A;  2VCW A;  4WEY A;  3HCZ A;  2VOC A;  3TJF A;  2IFQ A;  2IL3 A;  4RI7 A;  4Q5R A;  1NHY A;  2CAQ A;  1GH2 A;  4POL A;  4G2E A;  5COH A;  1SK1 A;  1WOU A;  2I9H A;  4MPF A;  3M9J A;  3GTU A;  3RBT A;  1BAY A;  2HZE A;  1XWA A;  3WD6 A;  1GUM A;  1I9D A;  2FA8 A;  4A5P A;  2V6K A;  4NHZ A;  3ZFL A;  4USS A;  1V2A A;  1O81 A;  4ACS A;  4FIW A;  3F6F A;  2H6Y A;  4RUV A;  5JWQ B;  1AC1 A;  3C1S A;  2X8H A;  2OKA A;  1R4W A;  5ELG A;  2AB6 A;  1PMT A;  2E7P A;  2R3X A;  4OFT A;  4G9H A;  1FHE A;  1BQ7 A;  2RUE A;  1B9Y C;  1V58 A;  2E2G A;  3H4K A;  3DWV A;  3TGZ A;  3TUE A;  4MK3 A;  3ME8 A;  2CVB A;  3SBC A;  5D8I A;  2R5G A;  4PGT A;  1GUL A;  3GA4 A;  2L59 A;  4EKZ A;  3IK9 A;  3LWA A;  1TI3 A;  2ES7 A;  3VPT A;  5IMD A;  3GX0 A;  3SWL A;  1ML6 A;  3L0H A;  2WB9 A;  3GKN A;  4NMU A;  2GQK A;  2QGV A;  3EYT A;  4HOJ A;  1AAZ A;  3KH9 A;  2JAD A;  5DVB A;  1A0F A;  1WRY A;  3QD9 A;  2B5Y A;  1YEP A;  1YQ1 A;  4ML6 A;  3US3 A;  2KOK A;  2GSQ A;  3CMI A;  3IC4 A;  4YQV A;  3ZIV A;  1SL0 B;  1K0N A;  3D6I A;  1EGR A;  3LGC A;  4KH7 A;  3HHV A;  3LFL A;  2LJA A;  1PA3 A;  1BJX A;  1Z7R A;  2X4A A;  2YWO A;  4MF7 A;  3FYG A;  5B7C A;  4TW5 A;  3IAM 2;  3EVI A;  3F6D A;  2H1B A;  1MEK A;  3QOU A;  1SKS B;  4IKH A;  3BCI A;  5A4W A;  4ECB A;  2RUF A;  4H86 A;  2WS2 A;  3GYK A;  3TKS A;  4JBB A;  2HRF A;  3GFK A;  4WET A;  1Z3E A;  2AJQ B;  3KMN A;  3ED3 A;  1LU4 A;  3H8Q A;  3P2A A;  3I6A A;  1K3L A;  5DDL A;  1ON4 A;  3DRN A;  1K0A A;  2HE3 A;  1JHB A;  4EF0 A;  4IW9 A;  1SYX A;  2L6C A;  4TXV A;  2C0D A;  4NXI A;  1URM A;  2HRN A;  2XHF A;  5D96 A;  2ALB A;  1U3I A;  3ZIT A;  2O89 A;  4MF6 A;  4MJC A;  3TJG A;  1OKT A;  4GLT A;  4HEA 2;  1XWB A;  5GAN D;  5ECK B;  3HVS A;  4K0N A;  3KZQ A;  4PQI A;  4KUN A;  2FWE A;  5CRD A;  4XCS A;  1UC7 A;  2MYG A;  3FZ4 A;  4CDO A;  4TR3 A;  3LSZ A;  1SEN A;  4F0B A;  5C04 A;  1SL1 B;  1GSE A;  1EP7 A;  1S3A A;  4BL7 B;  4DSQ A;  4IHU A;  4KW6 A;  3H79 A;  2MZC A;  4HZ2 A;  2QKE A;  5KEJ A;  3GUR A;  4YH2 A;  1U3A A;  1R26 A;  1JZD A;  4KDY A;  1XW6 A;  3E3E A;  1K0C A;  4YAV A;  1EZK A;  2HLS A;  1PGT A;  4XTS A;  2GSR A;  1HNA A;  1F3A A;  3LG6 A;  4K7O A;  1GSS A;  5H5Q A;  1T8E B;  3F4T A;  1C72 A;  5FT3 A;  2TIR A;  2C8U A;  1ERV A;  3UIW A;  3TJK A;  1ZYQ B;  1YKC A;  2L6D A;  4NWY A;  2PUK C;  3L4N A;  1ZYP A;  3DEX A;  1X5E A;  5ECQ B;  1KNG A;  3BCK A;  2F8A A;  4XRA A;  2YOI A;  2K6V A;  2BTO T;  2F9S A;  2VAF A;  5ECR B;  5KN3 A;  1YF1 A;  4E8H A;  5ECP B;  4NPB A;  1ZYN A;  2JSZ A;  3QR6 A;  1T1V A;  2ZCT A;  1YKA A;  1UA5 A;  3VLN A;  1VF3 A;  3M9K A;  4ML1 A;  1N8J A;  1Y25 A;  1THX A;  3FZ9 A;  4WR4 A;  5KOW A;  3GH9 A;  1E6B A;  5B6M A;  4HJM A;  1R5A A;  5B8B A;  3ZZX A;  5CRG A;  2YV7 A;  1XZO A;  1BED A;  2Z9S A;  4GCI A;  3TJJ A;  4EL1 A;  4ZL7 A;  1VRS D;  4AF2 A;  2X64 A;  4HI7 A;  2LQQ A;  3MDK A;  2GVP A;  2VD0 A;  2YNX A;  2QA2 A;  22GS A;  2G0F A;  2LJR A;  2FLS A;  1ERU A;  1WE0 A;  5IMZ A;  5IQY A;  1ZL9 A;  4N11 A;  5HQP A;  3F0I A;  4OCF A;  3QCP A;  4EUY A;  4HUA A;  4GQC A;  3UBK A;  1M2B A;  1WIK A;  1GWC A;  3W8J A;  1TDI A;  1TW9 A;  5G1K A;  4IQ1 A;  3ERW A;  4JED A;  1JZW A;  4HDE A;  5GSS A;  2C1Y A;  4N0V A;  2REM A;  5E59 A;  2PGT A;  4V1A g;  2CX3 A;  4I8B A;  4V2N A;  4Z7X A;  2FWF A;  4F2I A;  2F3M A;  3LQ7 A;  2PU9 C;  4GF0 A;  4ZB9 A;  1V98 A;  1A23 A;  2FNO A;  6GSU A;  5ECH B;  5EVO A;  4O7H A;  3TDG A;  5JCG A;  1XWK A;  1SK0 A;  3CSH A;  4GWR A;  3GRX A;  4IS0 A;  1AW9 A;  2CT6 A;  3E0U A;  5G1L A;  4Q5Q A;  1K3O A;  4KCA A;  1Z7P A;  2H0I A;  4Q5N A;  5G31 A;  1O8X A;  1ZGN A;  4O92 A;  1USB A;  1R5P A;  5D93 A;  2KLX A;  1B8X A;  4LLR A;  1EEM A;  6GST A;  2I1U A;  3P90 A;  1MDI A;  1OC9 A;  2JAC A;  1K3Y A;  4K2D A;  4X43 A;  5HR2 A;  3ZVJ D;  3MAK A;  3EE2 A;  3IBH A;  2FWG A;  1AUC A;  4TXO A;  2I3Y A;  3W8S A;  1GRX A;  5G5F A;  2LKU A;  3KIJ A;  4N10 A;  3MSZ A;  4BWQ A;  3FMW A;  2N5F A;  2CVK A;  2YZU A;  1J0F A;  3IHG A;  3Q19 A;  5LNK e;  5J9C A;  2R2J A;  1MTC A;  3HYP A;  5KN1 A;  4TR1 A;  2V32 A;  1PX6 A;  2M72 A;  3FEU A;  1GNW A;  3DD3 A;  1GLQ A;  1PKW A;  2DC5 A;  5IMA A;  1TRW A;  1XW9 A;  2H6X A;  1G0T A;  1ERW A;  3F4S A;  4L5L A;  3N5O A;  3TB2 A;  3GHA A;  1M0U A;  1HYU A;  2H75 A;  2AAW A;  5E4W A;  4EDZ A;  2FWH A;  2DIY A;  4DSS B;  5IIZ A;  3OR5 A;  2A2R A;  3TKS E;  4ECJ A;  2EC4 A;  2LV3 A;  4I2U A;  2C3T A;  2OE3 A;  1EEJ A;  1KTE A;  1QUW A;  3V1W A;  5B6N A;  4IJ3 A;  3KP9 A;  3GST A;  4ZB6 A;  3LYP A;  3LYK A;  2BMX A;  2H73 A;  2IJY A;  4XS4 B;  2I81 A;  3F3Q A;  5J3R A;  1FAA A;  3UJ1 A;  2GZY A;  1PN9 A;  1PQN A;  3C8E A;  5CRH A;  1O73 A;  3M8N A;  1JLW A;  3L9U A;  1U87 A;  3N9J A;  5ECN B;  1GSU A;  3UAR A;  2LEG A;  1UVZ A;  2AYT A;  2I4A A;  1IYH A;  3IC8 A;  4CY8 A;  1Z9H A;  5ECM B;  2A4H A;  1ERT A;  1H75 A;  2VM2 A;  1T3B A;  3BJ5 A;  3IXR A;  4AJ6 A;  3D4T A;  5EY6 A;  4OFM A;  2V2G A;  9GSS A;  5KOX A;  4OO4 A;  3KGK A;  3M0F A;  3HA9 A;  2YWM A;  2H1A A;  1HNC A;  4GXZ A;  1WMJ A;  2KP2 A;  4Q5F A;  2FA4 A;  3EIN A;  3WGE A;  2PBJ A;  4PQH A;  3IPZ A;  1WWJ A;  1J08 A;  3I9V 2;  1QGV A;  2LTK A;  4MH2 A;  3S9F A;  4N0Z A;  2B6M A;  3EWL A;  3F8U A;  1NW2 A;  1E2Y A;  1XVW A;  1SKR B;  2H30 A;  18GS A;  5DCH A;  3M3M A;  1Z5Y E;  12GS A;  1GUK A;  2VL2 A;  4ID0 A;  4EXJ A;  1A2M A;  3CRU A;  3ZRD A;  1O8W A;  1XCC A;  2DKI A;  3KXO A;  2HT9 A;  4L0W A;  6GSX A;  2FCH A;  5AIX A;  1OC3 A;  5J5N A;  1GSF A;  4JR4 A;  2L4Q A;  1SJZ A;  4V2L A;  3J7Y b;  2GSS A;  2M80 A;  3TRX A;  2OE1 A;  1JFU A;  4PUF C;  4LMW A;  2AUV A;  3FZA A;  5EL8 A;  3UBL A;  3UMA A;  3RPN A;  1EOG A;  4ZBB A;  5DAL B;  4PNG A;  1EWX A;  1Z6M A;  3APS A;  2R0C A;  4P3Y B;  4WBJ A;  1YF0 A;  3C73 A;  6GSW A;  1JZR A;  1YJ6 A;  3DYR A;  3GUS A;  4TOP A;  2J9H A;  3MWH A;  4GQF A;  5ECS A;  2NDO A;  2XPE A;  2A2P A;  4ZBD A;  2H76 A;  5JWO B;  5HFG A;  4KF9 A;  2QA1 A;  1XFL A;  4YQM A;  3ZMK A;  5AN1 A;  5A4V A;  1OE8 A;  4POM A;  4JRR A;  1ST9 A;  1Q4J A;  1TRV A;  2GQL A;  1N2A A;  2P5R A;  1FOV A;  1M99 A;  4LL1 B;  4IEL A;  5DJM A;  5G2Z A;  4X0X A;  4BVY B;  4TRX A;  5DCG A;  3VWX A;  3GL3 A;  4I2T A;  3HZ8 A;  3IHQ A;  4XS6 A;  1F37 A;  3G9B A;  2CV4 A;  3EPT A;  1XOA A;  1B9X C;  2E2M A;  1Z6N A;  2H0G A;  2N5A A;  3D5J A;  4BL7 A;  2DIZ A;  1SL2 B;  2MMA A;  3H1N A;  2QC7 A;  4ZBA A;  3RDW A;  1S3D A;  3IA1 A;  2H1D A;  2LST A;  4IBP A;  2P0G A;  1R7H A;  2N5B A;  3P7X A;  4HU7 A;  4I97 A;  2DJ3 A;  2DLX A;  1TXX A;  4QL9 A;  1FB6 A;  1B48 A;  1NM3 A;  5D9X A;  5IOX A;  4TKY A;  2O8V B;  1PKZ A;  3F63 A;  3UVT A;  2L5L A;  2H1G A;  2HRK A;  4MP4 A;  5IM9 A;  1T00 A;  3DVW A;  4E8E A;  5KN0 A;  7GSS A;  4ZL8 A;  4TVE A;  3PPU A;  1S3C A;  14GS A;  1TRU A;  1G6Y A;  2JU5 A;  1G7E A;  4MDC A;  4XS1 A;  2DJ1 A;  4G10 A;  1TKD B;  2WRT A;  3L78 A;  2OJL A;  1XVQ A;  2JSY A;  3VWU A;  1H4O A;  4GSN A;  2B5X A;  1HNB A;  4MLY A;  4YAP A;  5ID2 B;  1TU8 A;  3QFB C;  1TK0 B;  3TKS C;  1GP1 A;  4GTU A;  3C71 A;  5BMU A;  4WF4 A;  5AIS A;  2AV4 A;  2HFD A;  4TN8 A;  5CNW A;  1X9M B;  3ZRE A;  1MD3 A;  4I6X A;  4EE0 A;  2YP6 A;  1A24 A;  5HFI A;  4WKW A;  4K8M A;  1VF4 A;  4TR4 A;  3QDN A;  4KND A;  4MZB A;  2GLR A;  3VUR A;  3FR6 A;  4MH3 A;  1DUG A;  3DXB A;  4OCE A;  4GSS A;  2NBS A;  4LA1 A;  2C4J A;  4AGS A;  3EMP A;  4O32 A;  1G6W A;  1WP0 A;  5IMC A;  5J9B A;  4JR6 A;  2GT6 A;  2K8S A;  1ABA A;  2IIY A;  3D4M A;  1AQV A;  2GDR A;  1XXU A;  2LRT A;  2H8L A;  4N30 A;  4K9Z A;  5AGY A;  2C0E A;  2L5O A;  2C0G A;  1XWC A;  2ZUP A;  1YEX A;  4O5R A;  3KP8 A;  2IME A;  2V41 A;  2UZ8 A;  1SJI A;  3H93 A;  1SD8 A;  3CXG A;  1GTB A;  2H71 A;  2YV9 A;  2A4V A;  3KM6 A;  1Y6E A;  2V1M A;  4BVX B;  2PN8 A;  1DE1 A;  5HR3 A;  4Z2R A;  1RK4 A;  4JE1 A;  3TKQ A;  2MMZ A;  4QL7 A;  3APQ A;  3EU4 A;  5GZZ B;  4J56 E;  3Q6O A;  2F51 A;  5LD0 A;  1GNE A;  4NV2 A;  3UAP A;  2O87 A;  1AXD A;  3W6G A;  4IJI A;  5J4U A;  3TCO A;  1UN2 A;  3O3T A;  2CVD A;  16GS A;  1A2J A;  2WZ9 A;  5INY A;  2PWJ A;  3ZIJ A;  4K2X A;  3WT2 A;  1EV9 A;  2FD3 A;  1RW1 A;  3UL3 A;  3PH9 A;  3G7I A;  3KTB A;  1PSQ A;  13GS A;  4BA7 A;  4YQU A;  1PL1 A;  3TRQ A;  2DMM A;  1TJD A;  3HJO A;  3U5R E;  2O7K A;  4Z2U A;  4PUR A;  1DSB A;  2P5Q A;  1SK2 A;  2C3Q A;  1WJK A;  1FVK A;  2WGR A;  5H5S A;  1PL2 A;  1F3B A;  2TRX A;  4K7N A;  4IVF A;  3KH7 A;  4EC0 A;  1AQW A;  1QMV A;  3FR3 A;  3JCM L;  1PD2 1;  5FWG A;  3D22 A;  2JZR A;  2IMK A;  5D9T A;  2XC2 A;  2B3S A;  1M9A A;  3C7M A;  5G30 A;  3A2W A;  1V40 A;  3NZN A;  3VWV A;  4V2M A;  3BD2 A;  3DVX A;  4DVC A;  4DSS A;  1TP9 A;  1OAZ A;  4FYB A;  4K5S A;  4D73 B;  3LOR A;  4MMM A;  2VL3 A;  3KMO A;  1TTZ A;  2WFC A;  4FYC A;  3F4R A;  2R37 A;  3I69 A;  3GKK A;  4EO3 A;  4ZXG A;  3HXS A;  4IGJ A;  3FY7 A;  3MYD A;  4RI6 A;  2C0F A;  4ICY A;  3P8W A;  4XS4 A;  5CO3 A;  3ZLP A;  2F8F A;  3IK7 A;  4HQS A;  1SKW B;  1WPI A;  3QFA C;  5JCU A;  4OMV A;  5F8B A;  4L8E A;  3PGT A;  3KJY A;  4DSR A;  3J7Y k;  2RII A;  4OFN A;  2YJ7 A;  3GSS A;  3FHK A;  2L4C A;  4K5R A;  4NV5 A;  3AY8 A;  3DKS A;  3HKR A;  3WGX A;  5DAK B;  5LCZ A;  2JZS A;  5C00 A;  4ZB8 A;  1DBY A;  4DEJ A;  2FY6 A;  1OVN A;  2JL4 A;  1OKD A;  1K0M A;  1TOF A;  1QXH A;  3PIN A;  2FUG 2;  4WR5 A;  4MJB A;  2K18 A;  1TK5 B;  3GNJ A;  5ECI B;  2RLI A;  1DE2 A;  2NPB A;  3D21 A;  1BX9 A;  1F2E A;  1OYJ A;  3VI5 A;  4IP6 A;  4WXT A;  2HYX A;  3VWW A;  2GZP A;  2H66 A;  1U88 A;  2VCQ A;  2DJ2 A;  3FR9 A;  1MD4 A;  4KB3 A;  2AHE A;  4RQX A;  5ECO B;  2B1L A;  1OE7 A;  2G2Q A;  4POK A;  2E0Q A;  2DJJ A;  4F9Z A;  3IR4 A;  4ULX A;  1MDK A;  1T4Z A;  2OA7 A;  4HZ4 A;  2RM5 A;  3MIX A;  1J9B A;  2DJ0 A;  1SJ6 A;  2IFQ B;  2YN1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...