4K7IA

Human peroxiredoxin 5 with a fragment
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
162
structure length
162
Chain Sequence
SAPIKVGDAIPAVEVFEGEPGNKVNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAEALKAKGVQVVACLSVNDAFVTGEWGRAHKAEGKVRLLADPTGAFGKETDLLLDDSLVSIFGNRRLKRFSMVVQDGIVKALNVEPDGTGLTCSLAPNIISQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Peroxiredoxin-5, mitochondrial
publication title Comparing Binding Modes of Analogous Fragments Using NMR in Fragment-Based Drug Design: Application to PRDX5
pubmed doi rcsb
source organism Homo sapiens
total genus 50
structure length 162
sequence length 162
chains with identical sequence B, C
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2013-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08534 Redoxin Redoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4k7iA00
4KAEA 6GSSA 3DKSA 3F4RA 3ZREA 5DCHA 5H5QA 3FZ9A 3MAKA 4JBBA 4XS4A 3EC3A 1ZL9A 2FNOA 2VLTA 5A4VA 2H1GA 2CA8A 1XW9A 1EP8A 2YNXA 3UOMA 2O85A 3TB2A 3KH7A 2V32A 3TOUA 4AJ6A 5EPFA 1XWCA 1SL2B 3VPQA 4O7HA 2YV9A 1OE7A 4PQHA 2JACA 1JZWA 1SL1B 1H75A 19GSA 1U88A 4G9HA 2C80A 4MJCA 5FWGA 3VFIA 3QMXA 1TI1A 3IC4A 2LQQA 4N0ZA 2IJYA 2PERA 3W8JA 2D2ZA 3N5OA 4TVEA 4GQFA 4ZILA 5GSTA 1MTCA 4IJIA 5HR3A 3L78A 1TTZA 4OWYA 1WE0A 4KW6A 2H6XA 3L4NA 1NM3A 4MP4A 2HSHA 3UJ1A 3DGQA 1KEBA 4IGJA 4MABA 4EUYA 4F0CA 1YKCA 1U6TA 4WKWA 3TKPA 3BCIA 1F6MC 2GQKA 3D6IA 3TKSA 1R5AA 3CMIA 4MDCA 4ECJA 3CYNA 3EINA 2YWOA 4RQRA 4DSQA 1N2AA 1QMVA 4D73A 4K7NA 4TRXA 2C1YA 3SWLA 3WD6A 3D21A 5IPGA 1YDKA 4DSSA 2J23A 4IBPA 3NIVA 1F37A 2H74A 5D93A 3L0HA 2H76A 3IAM2 3LXZA 2LRCA 2DSAA 1GULA 4IHUA 3KMNA 3F3QA 1AQXA 5DALB 2IFQB 2KHPA 2I1UA 1VGLA 4TR1B 3GMFA 5IMDA 3LSZA 2R37A 1XCCA 5G30A 3P90A 2MBTA 3VWXA 3ZMKA 3LYPA 4KCEA 2YWNA 1WMJA 3ZMLA 2PUKC 1GL8A 2O8VB 2HE3A 1JFUA 3HKRA 2V1MA 4LL1B 3ZL5A 2IMDA 5KN3A 4N10A 4MMMA 2EIRA 5KEJA 2KLXA 1O73A 2CT6A 3A2XA 3M1GA 2HNLA 1EOGA 1GSFA 3D5JA 1WOUA 1EEMA 1PRXA 5A5KA 4POBA 5ID2A 4RI6A 2LV3A 2EC4A 4PNGA 1K3LA 4PXOA 3IE3A 3D0ZA 1BQ7A 1XPVA 3D22A 2VD1A 2RIIA 5G31A 1GUHA 1GUMA 1EGOA 2WULA 4L0UA 4CHSA 4ZB8A 1QK8A 11GSA 2CX4A 3RAZA 1TRWA 3EURA 2VCXA 5INYA 1FHEA 2TRCP 4Q5FA 17GSA 4O92A 3IOSA 5LNKe 5LCZA 1G0TA 2PMTA 4EC0A 1TRVA 1Q98A 2DMLA 3F0IA 3TOTA 2F3MA 2O89A 4GSTA 5J41A 2AJQB 2HFDA 2OJLA 3S9FA 1IYHA 4MZCA 4KX4A 1T4YA 2M80A 3KIJA 3CSIA 2R6KA 3VLNA 5JCUA 1U3AA 2H1BA 3P8WA 1A8YA 3TJBA 3EMPA 1MDJA 4LMVA 1XOBA 3QD9A 4Q5QA 4NPBA 3UAPA 3PINA 3CTFA 4MZBA 3ZZXA 5ECNB 2YANA 3TJKA 1KTEA 4F03A 2DBCA 5G1LA 4EL1A 4OO5A 1THOA 3KGKA 4ZBBA 1YJ6A 5DAKA 2OACA 3TKQA 1KBNA 1GSEA 5IMAA 4I6XA 1X5EA 1W89A 4V1Ag 1ON4A 3TCOA 3KD0A 4K1FA 2LKUA 4PGTA 1PKZA 3G9BA 2IMEA 1M2DA 13GSA 4JR6A 6GSWA 1YY7A 1DBYA 3KXOA 2NVLA 3A2VA 5F8BA 3L9VA 3FHKA 3DRNA 1F3AA 5ABRA 2PU9C 4K0NA 1OE8A 3DVXA 1WJKA 4V2LA 3EVIA 2XPEA 2M46A 4MJAA 1SU9A 1GTBA 3I43A 5LD0A 1V57A 4NWYA 4J57E 2GVPA 3UBLA 5JCGA 3TRPA 1M2AA 3L9UA 5IO0A 4BWQA 3CBUA 2VOCA 3IK7A 1O8WA 1YKAA 4TR4A 4HUAA 5J4UA 2PN8A 4IS0A 2DJ0A 3HJPA 2MMAA 5IM9A 1XVQA 4WETA 2VLUA 2YN1A 1M9BA 3GTUB 5IOXA 5GSSA 3ZIVA 2OBKA 1FW1A 2F51A 3M9JA 5GZZB 1SJZA 1M7TA 4POKA 3C73A 5L71A 4EE0A 2EIOA 2AAWA 3G7IA 3O3TA 1EV4A 2JZTA 3U6VA 1ZOFA 2J9HA 4FYUA 4AF2A 4V2NA 2HRNA 2GT5A 1WP0A 18GSA 3P2AA 4NMUA 2YWMA 4MJEA 2K8SA 1MD4A 1PMTA 1ERVA 3MNGA 2GZPA 3EMXA 4ML1A 4YQMA 3W6GA 3IXRA 3LWAA 1GRXA 5ECQB 3DMLA 3BOAA 1URMA 1O85A 1KNGA 2AB6A 1OAZA 4RI7A 2H73A 3VK9A 1GSSA 1T1VA 5CP1A 2FWFA 2O87A 3WT2A 1A0RP 2IWTA 2VLVA 2IMFA 3FR9A 5IMVA 2NTOA 2I3YA 2H8LA 1T7PB 4GCIA 4POMA 1OC9A 4KGIA 2HZEB 4HZ4A 3TKRA 4LL4B 5E4WA 2E2MA 2B1KA 3IHQA 1PL1A 2TIRA 2IMIA 2O7KA 4BL7A 1SKWB 4KH7A 1G7EA 2H75A 1G6WA 4HI7A 4JU5A 4JE1A 2FCHA 1XW6A 3EE2A 1EZKA 1ERWA 2GQMA 3F4TA 4PQ1A 5KN2A 1DE2A 4MF6A 3SBCA 1F2EA 4ECBA 3VWVA 4TXOB 1PSQA 1QQ2A 2HT9A 3FR6A 4TXVA 3CRTA 3GL3A 3V1WA 4F82A 4POLA 4KUNA 5EY6A 3UARA 3HJOA 3FYGA 4GTUA 1TXXA 3GRXA 3E3EA 3GH6A 2HI7A 4IW9A 10GSA 3KH9A 4YAVA 2HSYA 2C0EA 5HQPA 1ABAA 3APQA 5CAXA 3PR8A 1TOFA 3WGEA 4DEJA 4QL9A 4IJ3A 4ECCA 4FIWA 5AIXA 4WEYA 1ERUA 2VAFA 1VF4A 2REMA 9GSSA 4K7IA 1AAZA 3GH9A 3IRAA 2WCIA 2VCTA 1DSBA 3GKXA 4K6XA 6GSVA 3HZ8A 2YJ7A 1X9WB 2LRTA 1CQHA 1XWGA 2DJ3A 2JU5A 1MD3A 1HNBA 1AXDA 1AQWA 1A0FA 1BX9A 2YPMA 3UBKA 4ZL7A 1F3BA 2LNTA 1FVJA 1J0FA 4IN0A 3ME7A 12GSA 2MBSA 5HR1A 2C8UA 4OMVA 2ALBA 1V2AA 2OA7A 1FOVA 2CAQA 2CZ3A 4LLRA 2RUEA 2LNSA 4EDZA 4XHMA 1CQGA 3QPMA 4EDYA 2YJHA 4V1Ap 4TR3A 5EL8A 2NDOA 1EV9A 2FWHA 3C71A 1ZYEA 2I9HA 1M0UA 4ZB6A 3BCKA 1LBKA 4ZL8A 4KDUA 1K3OA 5H5RA 1SD9A 2C3TA 4EXJA 4K0GA 2X8CA 3KM6A 1B4PA 2A2SA 2DC5A 1A23A 4Q5NA 4RUVA 4ML6A 1T4ZA 2ON7A 4TOPA 3J7Yk 1GNEA 2RUFA 3ZFLA 4XS4B 2GT6A 1GWCA 4L5OA 3GHAA 3LG6A 3WGDA 1FB6A 4JR4A 2L57A 3H4KA 3TRQA 20GSA 1TU8A 3VWWA 1NHYA 1UC7A 1XIYA 3W8SA 2H19A 1R26A 4L0WA 1Y25A 3GURA 4TW5A 3GL5A 3TJGA 1T00A 4X43A 5HR0A 3QCPA 4K7OA 2MMZA 4V2MA 2JSZA 4MH3A 3PGTA 4IQ1A 1O8XA 3ZITA 3D4MA 2IN3A 1A2LA 5CNWA 1AUCA 2YOIA 3TGZA 3RBTA 3FZAA 2JZSA 1I9DA 3DXBA 3F6DA 5KN1A 1ERTA 3WGXA 2GSRA 2B7JA 3KCMA 2B5YA 1XOAA 4KA0A 5GAND 3VPTA 5DVBA 1NHOA 3MDKA 4XIHA 5F0GA 2P31A 3APOA 4HQSA 2VL9A 2F8FA 3M9KA 4NHZA 1HYUA 3P7XA 2HZFA 4XTSA 1K0MA 6GSTA 1PA3A 2FWGA 1A2MA 1HNAA 3KZQA 3VURA 1RW1A 4DSSB 1XVWA 4YQUA 3ERFA 3IDVA 3LXTA 3A5WA 5ELAA 3OR5A 3HHVA 1AC1A 1NW2A 1TJDA 3ZVJD 3H8QA 4KNDA 3HVXA 2HXKA 1TU7A 1ST9A 5CREA 4OCEA 2VUPA 3J7Yb 2CV4A 2I4AA 3IPZA 1BYEA 2WS2A 1MDIA 4KDYA 4F9ZA 1SK2A 4QQ7A 3CSHA 3GV1A 4MK3A 1IYIA 1FVKA 3GKKA 4HU9A 2F9SA 3HA9A 2QKEA 2FA4A 1WPIA 3ISOA 1TK0B 5EVOA 2X99A 3DYRA 4WBRD 3LYKA 2RM5A 1K0NA 1GSUA 3NZNA 1PN9A 2DJJA 3C1SA 2KOKA 3DVWA 5ID2B 5ECSA 7GSSA 1WWJA 1EOHA 2IMKA 5A4UA 1GSYA 3A2WA 2NPBA 3IBHA 1XFLA 3ED3A 3F4SA 1ILOA 4J56E 2LUSA 1TK8B 4N30A 2ZNMA 4KCAA 3GFKA 2L4QA 1ZMAA 2GTUA 2V2GA 4JRRA 5D9VA 3LJRA 2ZUPA 3CSJA 5CRDA 5G5FA 5CRGA 2Z9SA 4FYCA 3GIXA 4LA1A 4J2FA 2GGTA 3US3A 1EWXA 1THXA 2XBQA 4E8HA 3NOFA 4ILFA 1QFNA 2CQ9A 3D4TA 4OCFA 2R4VA 2X64A 2E2GA 3QAGA 2A4VA 2G2QA 1JLVA 1B9YC 1ZZYA 2QSIA 2LRNA 5ELGA 2N5BA 4XRDA 4FH8A 1Z6MA 2GZYA 3WT1A 4G2EA 3WYWA 3GSTA 5D9TA 4HJMA 4GSNA 3FZ5A 4XS6A 1TI3A 3LEFA 1ZCPA 2I81A 4ZB9A 3IR4A 1XXUA 2DIZA 2KUCA 2FA8A 2GDRA 2JSYA 2N5FA 2WB9A 1OC3A 2RM6A 4OFNA 5KN0A 2MMNA 3M8NA 3C7MA 2B1LA 3FZ4A 2OADA 3GNJA 4FYBA 2PGTA 4I8BA 2MZCA 4ULXA 4WXTA 3UMAA 4YQVA 5DAKB 5ECLB 3QFBC 4MCUA 1PX6A 2IIYA 3GYKA 5B7CA 2JL4A 4MPFA 2L5LA 2XPDA 3DIEA 3RDWA 5J3RA 3H93A 3Q6OA 4ECIA 2B3SA 2M72A 1K0BA 1VF3A 3G7YA 3ERWA 4HJ2A 1PX7A 3Q74A 2V6KA 1ZGNA 3HVVA 4PURA 5HFIA 4YH2A 2JADA 3FK8A 2FUG2 1PD21 2H1AA 4H86A 4NXIA 2RLIA 1S3DA 5ECIB 3TRXA 1XWKA 3IV4A 3KMOA 4HQZA 1QXHA 5HR2A 1TDIA 4MZWA 1A2JA 2AV4A 2K18A 4AGSA 1V98A 4IKHA 1TP9A 5AIVA 5DJLA 2PVQA 2WJUA 3DWVA 1C72A 1H4OA 2H71A 2L6CA 1Z9HA 3HDCA 3QDNA 1B8XA 5D96A 2VCQA 3O6TA 1K0CA 2GS3A 3QAVA 1ACVA 3O76A 2VCWA 1S3CA 3ZYWA 3FY7A 4NV5A 3RPNA 1OKDA 2GLRA 3LQ7A 2GSTA 5ECKB 5DQYA 3GKMA 3F63A 2P5RA 1SD8A 2OBIA 1XW5A 2V6OA 2P5QA 1GTUA 2FY6A 2VL2C 4X0XA 2VCZA 2XBIA 4IVFA 5IMCA 4DVCA 1SK1A 4K2DA 2G0FA 1MDKA 1O81A 1A8LA 3H79A 5CO3A 2CAIA 4CDOA 3GUSA 3M0FA 1XZOA 2DIYA 4GXZA 1X9SB 2C0DA 1FB0A 1FO5A 1K0AA 4ISDA 3TKSE 1ZYQB 4BVYA 3HD5A 5CRHA 1LU4A 5J9BA 1SL0B 3UEMA 5IIZA 2FHEA 2YCDA 2GQLA 1Z6NA 3RHBA 4IQAA 3DEXA 3ZFBA 5DALA 4NAXA 2IFQA 2VM1A 1OC9B 1R5PA 3LORA 2PVOC 4TR1A 1USBA 4OFMA 2WFCA 3G7JA 1X9MB 5CRWA 2B5EA 5FT3A 1U3IA 3FEUA 1VRSD 5D9WA 2LS5A 2DJ2A 5FHIA 3RHCA 3UL3A 3IAS2 3TJJA 1R4WA 1G6YA 4Z7XA 2AUVA 1HNCA 2C3QA 2YZHA 5D9XA 4CW9A 4MH2A 1GSDA 1N8JA 1SJIA 4K8MA 1TK5B 5ECPB 1F9MA 1WIKA 2WZ9A 3GX0A 1BAYA 1YQ1A 4EF0A 3ZIJA 2R5GA 3BBYA 2OKAA 1J9BA 4L8EA 1GH2A 3KEBA 2H0GA 3FKFA 2VO4A 2YWIA 3Q18A 3U5RE 5CYYA 6GSYA 1I5GA 4L5LA 2IL3A 4WF4A 1UN2A 1K3YA 2NBSA 3JCML 4FO5A 1SJ6A 3ZTLA 2R2JA 5HFGA 4DSRA 1TRSA 4BVXA 4ZXGA 3IK9A 3F8UA 4MF7A 1Z7RA 5E59A 3KTBA 22GSA 3RPPA 4TKYA 1HD2A 2V41A 1X0RA 3QR6A 3UVHA 5IQYA 2BJXA 3F3RA 1SK0A 4OFTA 1WRYA 5AGYA 2B7KA 1Q4JA 1T3BA 2ES7A 3QOUA 3M3MA 4MJBA 4XCSA 6GSXA 2H72A 3TKSC 5B6MA 3EYTA 5H5SA 4HOJA 1YEPA 3VWUA 4GSSA 3KP8A 2CVDA 3CXGA 4HU7A 2H0HA 2BTOT 2BMXA 2QC7A 2H6ZA 3UVTA 8GSSA 2X8GA 5JWQB 1JZRA 3HVSA 2P0GA 5G5EA 1YEXA 3AY8A 3ME8A 2AHEA 3HJMA 3GX8A 3I6AA 4F2IA 2B6MA 1SYRA 2C0GA 1EGRA 5J9CA 3CTGA 3E9JB 3K8NA 3GSSA 3VI7A 1M9AA 1B9XC 1MEKA 2C4JA 2LEGA 1GNWA 3TJFA 4LMWA 3Q19A 1AIUA 5C04A 2F8AA 5IOWA 1GLPA 2YZUA 4IP1A 4D73B 2K6VA 3ZLPA 3TDGA 5JCWA 1XWAA 1S3AA 4IP6A 2HYXA 2N5AA 4WR4A 4HS1A 2MMOA 4WF5A 3APSA 4GLTA 4PQIA 4EKZA 4ZBDA 1Z3EA 1PQNA 1U87A 2L5OA 4RQXA 3KTLA 5ECHB 4NHWA 5B8AA 1SYXA 4TR0A 1G7OA 4WBJA 5DDLA 1K0OA 1TW9A 5D73A 2YV7A 6GSUA 4IELA 4O32A 3KJYA 3MSZA 2KP2A 1J08A 2E7PA 2LJRA 5ENUA 3PH9A 5AISA 1B4QA 2VM2A 3QAWA 1YF1A 2XHFA 4WR5A 4AJ8A 1BG5A 4Q5RA 2LTKA 2L4CA 2ON5A 4QL7A 2H0IA 2C0FA 3R2QA 1BJXA 4GWRA 3TUEA 4X1UA 4MLYA 3ZVJA 4HZ2A 1OYJA 1M99A 2H66A 3ERGA 4ZIJA 3QFAC 16GSA 4I2UA 3GTUA 4ID0A 3EU4A 4EO3A 3I9V2 1O6JA 2K9FA 5IMZA 5JWOB 4MA9A 2CX3A 3GA4A 1GTAA 2FLSA 4NV2A 1TKDB 3FRCA 2OE0A 3E0UA 4G19A 1PGTA 4YAPA 1GSQA 5F07A 3HYPA 4KB3A 1W4VA 4BWSA 3VI5A 4O5RA 3MWHA 3EU3A 4KDXA 1B48A 3I69A 4PUAA 2CVKA 1T8EB 4XRAA 5F05A 1RK4A 1GUKA 4KSMA 1HQOA 1EP7A 1YZXA 4GRFA 1UA5A 1E6BA 1V9WA 2H30A 1UVZA 4BA7A 4N11A 1JHBA 1DE1A 1Z5YE 1XBSA 1FG4A 2FD3A 4E8EA 2QGVA 2PPTA 2FWEA 2ZCTA 2L59A 4MF5A 2L6DA 4HDEA 2TRXA 2CZ2A 2HZEA 1JLWA 2IPAA 1R7HA 2GSQA 1SENA 2DLXA 2PWJA 1QUWA 1EEJA 3DD3A 1BEDA 5J5NA 3L9SA 4GQCA 1V58A 1PL2A 3FR3A 5JWRB 4ZL9A 5G2ZA 4XS1A 2C3NA 1FAAA 4ACSA 2EIQA 5ECMB 1Y6EA 2MYGA 2E0QA 2H01A 1JZOA 2HRFA 2AYTA 2H1DA 4EVMA 3LGCA 1X5DA 4PUFC 4I2TA 2X8HA 4TXOA 2KP1A 5C00A 1DUGA 5DQSA 3HXSA 1VF1A 3C1RA 1M2BA 3HZ4A 3UIWA 1ML6A 5ECOB 2H6YA 2PBJA 4K9ZA 4KE3A 2YP6A 5IPHA 1TRUA 3EWLA 3A3TA 2VIMA 2WGRA 5GAPD 1LJRA 2K8VA 2OE1A 3CRUA 1SKRB 1X5CA 5G1KA 5ECRB 2VCVA 4JZQA 2A2RA 2GZZA 2OE3A 1PKWA 3C8EA 5A4WA 2CVBA 4AJ7A 1GP1A 3BD2A 1NSWA 2DJ1A 3KP9A 4OD7A 1AW9A 3F9UA 3N9JA 4G10A 4P3YB 3ZRDA 2WRTA 5IO2A 2WDUA 4ZBAA 5DJMA 3LFLA 1V40A 2JZRA 4TN8A 1VF2A 2LQOA 1GTIA 3F6FA 1OKTA 2LJAA 3BJ5A 1OVNA 1XWBA 2VL2A 5F06A 2VL3A 1JZDA 14GSA 4MPGA 4OO4A 5B6NA 4PX1A 5D8IA 2XC2A 5IMFA 1E2YA 2GSSA 4KSOA 1O7UA 2HLSA 4JEDA 3GN3A 3HY2A 4I97A 5DCGA 1SKSB 3IA1A 4PNFA 1AQVA 4N0VA 3GKNA 2LJKA 1GLQA 3FW2A 4HEA2 3H1NA 2B5XA 2FGXA 1RQMA 4F0BA 1Z7PA 5B8BA 1A24A 2H70A 5HFKA 2R3XA 4BPYA 2DJKA 5AN1A 2LSTA 1YF0A 4GF0A 1OC8A 1K0DA 2VD0A 5COHA 2DMMA 3HCZA 4I5QA 1QGVA 5DBQA
chains in the Genus database with same CATH superfamily
4KAEA 6GSSA 3DKSA 3F4RA 3ZREA 5DCHA 5H5QA 1M3IA 3FZ9A 3MAKA 4JBBA 4XS4A 3EC3A 1ZL9A 4EIQA 2FNOA 2VLTA 5A4VA 2H1GA 2A4HA 2CA8A 1XW9A 1EP8A 4Z2TA 2YNXA 3UOMA 2O85A 3TB2A 2HRAA 3KH7A 2V32A 1S3RA 3TOUA 4AJ6A 5EPFA 1XWCA 1SL2B 3VPQA 4O7HA 2YV9A 1OE7A 4PQHA 2JACA 1JZWA 1M3JA 1SL1B 1H75A 19GSA 1U88A 4G9HA 2C80A 4MJCA 5FWGA 3VFIA 3QMXA 1TI1A 3IC4A 2LQQA 4N0ZA 2IJYA 2PERA 3W8JA 2D2ZA 3N5OA 4TVEA 4GQFA 4ZILA 5GSTA 1MTCA 4IJIA 5HR3A 3L78A 1TTZA 4OWYA 1WE0A 4KW6A 2H6XA 3L4NA 1NM3A 4MP4A 2HSHA 3UJ1A 3DGQA 1KEBA 4IGJA 3FMWA 4MABA 4EUYA 4F0CA 1YKCA 1U6TA 4WKWA 3TKPA 3BCIA 1F6MC 2GQKA 3D6IA 3TKSA 1R5AA 3CMIA 4MDCA 4ECJA 3CYNA 3EINA 2YWOA 4RQRA 4DSQA 1N2AA 1QMVA 4D73A 4K7NA 4TRXA 2C1YA 3SWLA 3WD6A 3D21A 5IPGA 1YDKA 4DSSA 2J23A 4BVYB 4IBPA 3NIVA 1F37A 2H74A 5D93A 3L0HA 2H76A 3IAM2 3LXZA 2LRCA 2DSAA 1FOHA 1GULA 4IHUA 3KMNA 3F3QA 1AQXA 5DALB 2IFQB 2KHPA 2I1UA 1VGLA 4TR1B 3GMFA 5IMDA 3LSZA 2R37A 1XCCA 5G30A 3P90A 2MBTA 3VWXA 3ZMKA 3LYPA 4KCEA 2QA1A 2YWNA 1WMJA 4X4JA 3ZMLA 2PUKC 1GL8A 2O8VB 2HE3A 1JFUA 3HKRA 2V1MA 4LL1B 3ZL5A 2IMDA 5KN3A 4N10A 4MMMA 2EIRA 5KEJA 2R0PA 2KLXA 1O73A 2CT6A 3A2XA 3M1GA 2HNLA 1EOGA 1GSFA 3D5JA 1WOUA 1EEMA 1PRXA 5A5KA 4POBA 5ID2A 4RI6A 2LV3A 2EC4A 4PNGA 1K3LA 4PXOA 3IE3A 4BVXB 3D0ZA 1BQ7A 1XPVA 3D22A 2VD1A 2RIIA 5G31A 1GUHA 1GUMA 1EGOA 2WULA 4L0UA 4CHSA 4ZB8A 1QK8A 11GSA 2CX4A 3RAZA 1TRWA 3EURA 2VCXA 2X49A 5INYA 1FHEA 2TRCP 4Q5FA 17GSA 5KOXA 4O92A 3IOSA 5LNKe 5LCZA 1G0TA 2PMTA 4EC0A 1TRVA 1Q98A 2DMLA 3F0IA 3TOTA 2F3MA 2O89A 4GSTA 5J41A 2AJQB 2HFDA 2OJLA 3S9FA 1IYHA 4MZCA 4KX4A 4BIKA 1T4YA 2M80A 3KIJA 3CSIA 2R6KA 3VLNA 5JCUA 1U3AA 2H1BA 3P8WA 1A8YA 3TJBA 3EMPA 1MDJA 4LMVA 1XOBA 3QD9A 4Q5QA 4NPBA 3UAPA 3PINA 3CTFA 4MZBA 3ZZXA 5ECNB 2YANA 3TJKA 1KTEA 4F03A 2DBCA 5G1LA 4EL1A 4OO5A 1THOA 3KGKA 4ZBBA 1YJ6A 5DAKA 2OACA 3TKQA 1KBNA 1GSEA 5IMAA 4I6XA 1X5EA 1W89A 4V1Ag 1ON4A 3TCOA 3KD0A 4K1FA 2LKUA 4PGTA 1PKZA 3G9BA 2IMEA 1M2DA 13GSA 4JR6A 6GSWA 1YY7A 1DBYA 2HRKA 3KXOA 2NVLA 3A2VA 5F8BA 3L9VA 3FHKA 3DRNA 1F3AA 5ABRA 2PU9C 4K0NA 1OE8A 3DVXA 1WJKA 4V2LA 3EVIA 2XPEA 2M46A 4MJAA 4MNNA 1SU9A 1GTBA 3I43A 5LD0A 1V57A 4NWYA 4J57E 2GVPA 3UBLA 5JCGA 3TRPA 1M2AA 3L9UA 5IO0A 4BWQA 3CBUA 2VOCA 4G0LA 3IK7A 1O8WA 1YKAA 4TR4A 4HUAA 5J4UA 2PN8A 4IS0A 2DJ0A 3HJPA 2MMAA 5IM9A 1XVQA 4WETA 2VLUA 4CY6A 2YN1A 1M9BA 3GTUB 5IOXA 5GSSA 3ZIVA 2OBKA 1FW1A 2F51A 3M9JA 5GZZB 1SJZA 1M7TA 4POKA 3C73A 5L71A 4EE0A 2EIOA 2AAWA 3G7IA 3O3TA 1EV4A 2JZTA 3U6VA 1ZOFA 2J9HA 4FYUA 4AF2A 4V2NA 2HRNA 2GT5A 1WP0A 18GSA 3P2AA 4NMUA 2YWMA 4MJEA 4CY8A 2K8SA 1MD4A 1PMTA 1ERVA 3MNGA 2GZPA 3EMXA 4ML1A 4YQMA 3W6GA 3IXRA 3LWAA 1GRXA 5ECQB 3DMLA 3BOAA 1URMA 1O85A 1KNGA 2AB6A 1OAZA 4RI7A 2H73A 3VK9A 1GSSA 2R0CA 1T1VA 5CP1A 2FWFA 3PPUA 2O87A 3WT2A 1A0RP 2IWTA 2VLVA 2IMFA 3FR9A 5IMVA 2NTOA 2I3YA 2H8LA 1T7PB 4GCIA 4POMA 1OC9A 4KGIA 2HZEB 4HZ4A 3TKRA 4LL4B 4YKFA 5E4WA 2E2MA 2B1KA 3IHQA 1PL1A 2TIRA 2IMIA 2O7KA 4BL7A 1SKWB 4KH7A 1G7EA 2H75A 1G6WA 4HI7A 4JU5A 4JE1A 2FCHA 1XW6A 3EE2A 1EZKA 1ERWA 2GQMA 3F4TA 4PQ1A 5KN2A 1DE2A 4MF6A 3SBCA 1PFOA 1F2EA 4FQUA 4ECBA 3VWVA 4TXOB 1PSQA 1QQ2A 2HT9A 3FR6A 4TXVA 3CRTA 3GL3A 3V1WA 4F82A 4POLA 4KUNA 5EY6A 3UARA 3HJOA 3FYGA 4GTUA 1TXXA 3GRXA 3E3EA 3GH6A 2HI7A 4IW9A 10GSA 3KH9A 4YAVA 2HSYA 2C0EA 5HQPA 1ABAA 3APQA 5CAXA 3PR8A 1TOFA 3A5IA 3WGEA 4DEJA 4QL9A 4IJ3A 4ECCA 4FIWA 5AIXA 4WEYA 1ERUA 2VAFA 1VF4A 2REMA 9GSSA 4K7IA 1AAZA 3GH9A 3IRAA 2WCIA 2VCTA 2DKHA 1DSBA 3GKXA 4K6XA 6GSVA 3HZ8A 2YJ7A 1X9WB 2LRTA 1CQHA 1XWGA 2DJ3A 2JU5A 1MD3A 1HNBA 1AXDA 1AQWA 1A0FA 1BX9A 2YPMA 3UBKA 4ZL7A 1F3BA 2LNTA 1FVJA 1J0FA 4IN0A 3ME7A 12GSA 2MBSA 5HR1A 2C8UA 4OMVA 2ALBA 1V2AA 2OA7A 1FOVA 2CAQA 2CZ3A 3HVNA 4LLRA 2RUEA 2LNSA 4EDZA 4XHMA 1CQGA 3QPMA 4EDYA 2YJHA 4V1Ap 4G0KA 4TR3A 5EL8A 2NDOA 1EV9A 2FWHA 3C71A 1ZYEA 2I9HA 1M0UA 4ZB6A 3BCKA 1LBKA 4ZL8A 4KDUA 1K3OA 5H5RA 1SD9A 2C3TA 4EXJA 4K0GA 2X8CA 3KM6A 1B4PA 2A2SA 2DC5A 1A23A 4Q5NA 4RUVA 4ML6A 1T4ZA 2ON7A 4TOPA 3J7Yk 1GNEA 2RUFA 3ZFLA 4XS4B 2GT6A 1GWCA 4L5OA 3GHAA 3LG6A 3WGDA 1FB6A 4JR4A 2L57A 3H4KA 3TRQA 20GSA 1TU8A 3VWWA 1NHYA 1UC7A 1XIYA 3IC8A 3W8SA 2H19A 4KF9A 1R26A 4L0WA 1Y25A 3GURA 4TW5A 3GL5A 3TJGA 1T00A 4EIPA 4X43A 3LW9A 5HR0A 3QCPA 4K7OA 2MMZA 4V2MA 2JSZA 4MH3A 3PGTA 4IQ1A 1O8XA 3ZITA 3D4MA 2IN3A 1A2LA 5CNWA 1AUCA 2YOIA 3TGZA 3RBTA 3FZAA 2JZSA 1I9DA 3DXBA 3F6DA 5KN1A 1ERTA 3WGXA 2GSRA 2B7JA 3KCMA 2B5YA 1XOAA 4KA0A 5GAND 3VPTA 5DVBA 1NHOA 3MDKA 4XIHA 5F0GA 2P31A 3APOA 4HQSA 2VL9A 2F8FA 3M9KA 4NHZA 1HYUA 3P7XA 2HZFA 4XTSA 1K0MA 6GSTA 1PA3A 2FWGA 1A2MA 1HNAA 3KZQA 3VURA 1RW1A 4DSSB 1XVWA 4YQUA 1ZYNA 3ERFA 3IDVA 3LXTA 3A5WA 5ELAA 3OR5A 3HHVA 1AC1A 1NW2A 1TJDA 3ZVJD 3H8QA 4KNDA 3HVXA 2HXKA 1TU7A 1ST9A 5CREA 4OCEA 2VUPA 3J7Yb 2CV4A 2I4AA 3IPZA 1BYEA 2WS2A 1MDIA 4KDYA 4F9ZA 1SK2A 4QQ7A 3CSHA 3GV1A 4MK3A 1IYIA 2X4AA 1FVKA 3GKKA 4HU9A 2F9SA 3HA9A 2QKEA 2FA4A 1WPIA 3ISOA 1TK0B 5EVOA 2X99A 3DYRA 4WBRD 3LYKA 2RM5A 1K0NA 1GSUA 4K2XA 3NZNA 1PN9A 1ZYPA 2DJJA 3C1SA 2KOKA 3DVWA 4O5UA 5ID2B 5ECSA 7GSSA 1WWJA 1EOHA 2IMKA 5A4UA 1GSYA 3A2WA 2NPBA 3IBHA 1XFLA 3ED3A 3F4SA 1ILOA 4J56E 2LUSA 1TK8B 4N30A 2ZNMA 4KCAA 3GFKA 2L4QA 1ZMAA 2GTUA 2V2GA 4JRRA 5D9VA 3LJRA 2ZUPA 3CSJA 5CRDA 5G5FA 5CRGA 2Z9SA 4FYCA 3GIXA 4LA1A 4J2FA 2GGTA 3US3A 1EWXA 1THXA 2XBQA 4E8HA 3NOFA 4ILFA 1QFNA 2CQ9A 3D4TA 4OCFA 2R4VA 2X64A 2E2GA 3QAGA 4A5PA 2A4VA 2G2QA 1JLVA 1B9YC 1ZZYA 2QSIA 2LRNA 5ELGA 2N5BA 4XRDA 4FH8A 1Z6MA 2GZYA 3WT1A 2R0GA 4G2EA 3WYWA 3GSTA 5D9TA 4HJMA 4GSNA 3FZ5A 4XS6A 1TI3A 3LEFA 1ZCPA 2I81A 4ZB9A 3IR4A 1XXUA 2DIZA 2KUCA 3MIXA 2FA8A 2GDRA 2JSYA 2N5FA 2WB9A 1OC3A 2RM6A 4OFNA 5KN0A 2MMNA 3M8NA 3C7MA 2B1LA 3FZ4A 2OADA 3GNJA 4FYBA 2PGTA 4I8BA 2MZCA 4ULXA 4WXTA 3UMAA 4YQVA 5DAKB 5ECLB 3QFBC 4MCUA 1PX6A 2IIYA 3GYKA 5BMUA 5B7CA 2JL4A 4MPFA 2L5LA 2XPDA 4USSA 3DIEA 3RDWA 5J3RA 2HSMA 3H93A 3Q6OA 4ECIA 2B3SA 2M72A 1K0BA 1VF3A 3G7YA 3ERWA 4HJ2A 1PX7A 3Q74A 2V6KA 1ZGNA 3HVVA 4PURA 5KOWA 5HFIA 4YH2A 2JADA 3FK8A 2FUG2 3R3EA 1PD21 2H1AA 4H86A 4NXIA 2RLIA 1S3DA 5ECIB 3TRXA 1XWKA 3IV4A 3KMOA 4HQZA 1QXHA 5HR2A 1TDIA 4MZWA 1A2JA 2AV4A 2K18A 4AGSA 1V98A 4IKHA 1TP9A 5AIVA 5DJLA 2PVQA 2WJUA 3DWVA 1C72A 1H4OA 2H71A 2L6CA 1Z9HA 3HDCA 3QDNA 1B8XA 5D96A 2VCQA 3O6TA 1K0CA 2GS3A 3QAVA 1ACVA 3O76A 2VCWA 1S3CA 3ZYWA 3FY7A 4NV5A 3RPNA 1OKDA 2GLRA 3LQ7A 2GSTA 5ECKB 5DQYA 3GKMA 3F63A 2P5RA 1SD8A 2OBIA 1XW5A 2V6OA 2P5QA 1GTUA 2FY6A 2VL2C 4X0XA 2VCZA 2XBIA 4IVFA 5IMCA 4O5QA 4DVCA 1SK1A 4K2DA 2G0FA 1MDKA 1O81A 1A8LA 3H79A 5CO3A 2CAIA 4CDOA 3GUSA 3M0FA 1XZOA 2DIYA 4GXZA 1X9SB 2C0DA 1FB0A 1FO5A 1K0AA 4ISDA 3TKSE 1ZYQB 4BVYA 3HD5A 5CRHA 1LU4A 5J9BA 1SL0B 2DKIA 3UEMA 5IIZA 2FHEA 2YCDA 2GQLA 1Z6NA 3RHBA 4IQAA 3DEXA 3ZFBA 5DALA 4NAXA 2IFQA 2VM1A 1OC9B 1R5PA 3LORA 2PVOC 4TR1A 1USBA 4OFMA 2WFCA 3G7JA 1X9MB 5CRWA 2B5EA 5FT3A 1U3IA 3FEUA 1VRSD 5D9WA 2LS5A 2DJ2A 5FHIA 3RHCA 4BL7B 3UL3A 3IAS2 3TJJA 1R4WA 1G6YA 4Z7XA 2AUVA 1HNCA 2C3QA 2YZHA 5D9XA 4CW9A 3EPTA 4MH2A 1GSDA 1N8JA 1SJIA 4K8MA 1TK5B 5ECPB 1F9MA 1WIKA 2WZ9A 3GX0A 1BAYA 1YQ1A 4EF0A 3ZIJA 2R5GA 3BBYA 2OKAA 1J9BA 4L8EA 1GH2A 3KEBA 2H0GA 3FKFA 2VO4A 2YWIA 3Q18A 3U5RE 5CYYA 6GSYA 1I5GA 4L5LA 2IL3A 4ICYA 4WF4A 1UN2A 1K3YA 2NBSA 3JCML 4FO5A 1SJ6A 3ZTLA 2R2JA 5HFGA 4DSRA 1TRSA 4BVXA 4ZXGA 3IK9A 3F8UA 4MF7A 1Z7RA 5E59A 3KTBA 22GSA 3RPPA 4TKYA 1HD2A 2V41A 1X0RA 3QR6A 3UVHA 5IQYA 2BJXA 3F3RA 1SK0A 4OFTA 1WRYA 5AGYA 2B7KA 1Q4JA 1T3BA 2ES7A 3QOUA 3M3MA 4YKGA 4MJBA 4XCSA 6GSXA 2H72A 3TKSC 5B6MA 3EYTA 5H5SA 4HOJA 1YEPA 3VWUA 4GSSA 3KP8A 2CVDA 3CXGA 4HU7A 2H0HA 2BTOT 2BMXA 2QC7A 2H6ZA 3UVTA 8GSSA 2X8GA 5JWQB 1JZRA 3HVSA 1PN0A 2P0GA 5G5EA 1YEXA 3AY8A 3ME8A 4K5SA 2AHEA 3HJMA 3GX8A 3I6AA 4F2IA 2B6MA 1SYRA 2C0GA 1EGRA 5J9CA 3CTGA 3MYDA 3E9JB 3K8NA 3GSSA 3VI7A 1M9AA 1B9XC 1MEKA 4G0IA 2C4JA 2LEGA 1GNWA 3TJFA 4LMWA 3Q19A 1AIUA 5C04A 2F8AA 5IOWA 1GLPA 2YZUA 4IP1A 4D73B 2K6VA 3ZLPA 3TDGA 5JCWA 1XWAA 1S3AA 4IP6A 2HYXA 2N5AA 4WR4A 4HS1A 2MMOA 4WF5A 3APSA 4GLTA 4PQIA 4EKZA 4ZBDA 1Z3EA 1PQNA 1U87A 2L5OA 4RQXA 3KTLA 5ECHB 4NHWA 5B8AA 1SYXA 4TR0A 1G7OA 4WBJA 5DDLA 1K0OA 1TW9A 5D73A 2YV7A 6GSUA 4IELA 2A2PA 4O32A 3KJYA 3IHGA 3MSZA 2KP2A 1J08A 2E7PA 2LJRA 5ENUA 3PH9A 5AISA 1B4QA 2VM2A 3QAWA 1YF1A 2XHFA 4WR5A 4AJ8A 1BG5A 4Q5RA 2LTKA 2L4CA 2ON5A 4QL7A 2H0IA 2C0FA 3R2QA 1BJXA 4GWRA 3TUEA 4X1UA 4MLYA 3ZVJA 4HZ2A 1OYJA 1M99A 2H66A 3ERGA 4ZIJA 3QFAC 16GSA 4I2UA 2UZ8A 3GTUA 4ID0A 3EU4A 4EO3A 3I9V2 1O6JA 2K9FA 5IMZA 5JWOB 4MA9A 2CX3A 3GA4A 1GTAA 3CQFA 2FLSA 4NV2A 1TKDB 3FRCA 2OE0A 3E0UA 4G19A 1PGTA 4YAPA 1GSQA 5F07A 3HYPA 4KB3A 1W4VA 5BRTA 4BWSA 3VI5A 4O5RA 3MWHA 3EU3A 4KDXA 1B48A 4PTSA 3I69A 4PUAA 2CVKA 1T8EB 4XRAA 5F05A 1RK4A 1GUKA 4KSMA 1HQOA 1EP7A 1YZXA 4GRFA 1UA5A 1E6BA 1V9WA 2H30A 1UVZA 4BA7A 4N11A 1JHBA 1DE1A 1Z5YE 4K5RA 1XBSA 1FG4A 2FD3A 4E8EA 2QGVA 2PPTA 2FWEA 2ZCTA 2L59A 4MF5A 2L6DA 4HDEA 2TRXA 2CZ2A 2HZEA 1JLWA 2IPAA 1R7HA 1XG8A 2GSQA 1SENA 2DLXA 2PWJA 1QUWA 1EEJA 3DD3A 1BEDA 5J5NA 3L9SA 4GQCA 1V58A 1PL2A 3FR3A 5JWRB 4ZL9A 5G2ZA 4XS1A 2C3NA 1FAAA 4ACSA 2EIQA 5ECMB 1Y6EA 2MYGA 2E0QA 2H01A 1JZOA 2HRFA 2AYTA 2H1DA 4EVMA 3LGCA 1X5DA 4PUFC 4I2TA 2X8HA 4TXOA 2KP1A 5C00A 1DUGA 5DQSA 3HXSA 1VF1A 3C1RA 1M2BA 3HZ4A 3UIWA 1ML6A 5ECOB 2H6YA 2PBJA 4K9ZA 4KE3A 2YP6A 5IPHA 2QA2A 1TRUA 3EWLA 3A3TA 2VIMA 2WGRA 5GAPD 1LJRA 2K8VA 2OE1A 3CRUA 1SKRB 1X5CA 5G1KA 5ECRB 2VCVA 4JZQA 2A2RA 2GZZA 2OE3A 1PKWA 3C8EA 5A4WA 2CVBA 4AJ7A 1GP1A 3BD2A 1NSWA 2DJ1A 3KP9A 4OD7A 1AW9A 3F9UA 3N9JA 4G10A 4P3YB 3ZRDA 2WRTA 5IO2A 2WDUA 4ZBAA 5DJMA 3LFLA 1V40A 2JZRA 4TN8A 1VF2A 2LQOA 1GTIA 3F6FA 1OKTA 2LJAA 3BJ5A 1OVNA 4Z2UA 1XWBA 2VL2A 5F06A 2VL3A 1JZDA 14GSA 4MPGA 4OO4A 5B6NA 4PX1A 5D8IA 2XC2A 5IMFA 1E2YA 2GSSA 4KSOA 1O7UA 2HLSA 4JEDA 3GN3A 3HY2A 4I97A 5DCGA 1SKSB 3IA1A 4PNFA 1AQVA 4N0VA 3GKNA 2LJKA 1GLQA 3FW2A 4HEA2 3H1NA 2B5XA 2FGXA 1RQMA 4F0BA 1Z7PA 5B8BA 1A24A 2H70A 5HFKA 2R3XA 4BPYA 2DJKA 5AN1A 2LSTA 1YF0A 4GF0A 4HSCX 1OC8A 4Z2RA 1K0DA 2VD0A 5COHA 2DMMA 3HCZA 4I5QA 1QGVA 5DBQA
chains in the Genus database with same CATH topology
4KAEA 6GSSA 3DKSA 3F4RA 3ZREA 5DCHA 5H5QA 3FZ9A 3MAKA 4JBBA 4XS4A 3EC3A 1ZL9A 4EIQA 2FNOA 2VLTA 5A4VA 2H1GA 2A4HA 2CA8A 1XW9A 1EP8A 4Z2TA 2YNXA 3UOMA 2O85A 3TB2A 2HRAA 3KH7A 2V32A 3TOUA 4AJ6A 5EPFA 1XWCA 1SL2B 3VPQA 4O7HA 2YV9A 1OE7A 4PQHA 2JACA 1JZWA 1SL1B 1H75A 19GSA 1U88A 4G9HA 2C80A 4MJCA 5FWGA 3VFIA 3QMXA 1TI1A 3IC4A 2LQQA 4N0ZA 2IJYA 2PERA 3W8JA 2D2ZA 3N5OA 4TVEA 4GQFA 4ZILA 5GSTA 1MTCA 4IJIA 5HR3A 3L78A 1TTZA 4OWYA 1WE0A 4KW6A 2H6XA 3L4NA 1NM3A 4MP4A 2HSHA 3UJ1A 3DGQA 1KEBA 4IGJA 3FMWA 4MABA 4EUYA 4F0CA 1YKCA 1U6TA 4WKWA 3TKPA 3BCIA 1F6MC 2GQKA 3D6IA 3TKSA 1R5AA 3CMIA 4MDCA 4ECJA 3CYNA 3EINA 2YWOA 4RQRA 4DSQA 1N2AA 1QMVA 4D73A 4K7NA 4TRXA 2C1YA 3SWLA 3WD6A 3D21A 5IPGA 1YDKA 4DSSA 2J23A 4BVYB 4IBPA 3NIVA 1F37A 2H74A 5D93A 3L0HA 2H76A 3IAM2 3LXZA 2LRCA 2DSAA 1FOHA 1GULA 4IHUA 3KMNA 3F3QA 1AQXA 5DALB 2IFQB 2KHPA 2I1UA 1VGLA 4TR1B 3GMFA 5IMDA 3LSZA 2R37A 1XCCA 5G30A 3P90A 2MBTA 3VWXA 3ZMKA 3LYPA 4KCEA 2QA1A 2YWNA 1WMJA 4X4JA 3ZMLA 2PUKC 1GL8A 2O8VB 2HE3A 1JFUA 3HKRA 2V1MA 4LL1B 3ZL5A 2IMDA 5KN3A 4N10A 4MMMA 2EIRA 5KEJA 2R0PA 2KLXA 1O73A 2CT6A 3A2XA 3M1GA 2HNLA 1EOGA 1GSFA 3D5JA 1WOUA 1EEMA 1PRXA 5A5KA 4POBA 5ID2A 4RI6A 2LV3A 2EC4A 4PNGA 1K3LA 4PXOA 3IE3A 4BVXB 3D0ZA 1BQ7A 1XPVA 3D22A 2VD1A 2RIIA 5G31A 1GUHA 1GUMA 1EGOA 2WULA 4L0UA 4CHSA 4ZB8A 1QK8A 11GSA 2CX4A 3RAZA 1TRWA 3EURA 2VCXA 2X49A 5INYA 1FHEA 2TRCP 4Q5FA 17GSA 5KOXA 4O92A 3IOSA 5LNKe 5LCZA 1G0TA 2PMTA 4EC0A 1TRVA 1Q98A 2DMLA 3F0IA 3TOTA 2F3MA 2O89A 4GSTA 5J41A 2AJQB 2HFDA 2OJLA 3S9FA 1IYHA 4MZCA 4KX4A 1T4YA 2M80A 3KIJA 3CSIA 2R6KA 3VLNA 5JCUA 1U3AA 2H1BA 3P8WA 1A8YA 3TJBA 3EMPA 1MDJA 4LMVA 1XOBA 3QD9A 4Q5QA 4NPBA 3UAPA 3PINA 3CTFA 4MZBA 3ZZXA 5ECNB 2YANA 3TJKA 1KTEA 4F03A 2DBCA 5G1LA 4EL1A 4OO5A 1THOA 3KGKA 4ZBBA 1YJ6A 5DAKA 2OACA 3TKQA 1KBNA 1GSEA 5IMAA 4I6XA 1X5EA 1W89A 4V1Ag 1ON4A 3TCOA 3KD0A 4K1FA 2LKUA 4PGTA 1PKZA 3G9BA 2IMEA 1M2DA 13GSA 4JR6A 6GSWA 1YY7A 1DBYA 2HRKA 3KXOA 2NVLA 3A2VA 5F8BA 3L9VA 3FHKA 3DRNA 1F3AA 5ABRA 2PU9C 4K0NA 1OE8A 3DVXA 1WJKA 4V2LA 3EVIA 2XPEA 2M46A 4MJAA 4MNNA 1SU9A 1GTBA 3I43A 5LD0A 1V57A 4NWYA 4J57E 2GVPA 3UBLA 5JCGA 3TRPA 1M2AA 3L9UA 5IO0A 4BWQA 3CBUA 2VOCA 4G0LA 3IK7A 1O8WA 1YKAA 4TR4A 4HUAA 5J4UA 2PN8A 4IS0A 2DJ0A 3HJPA 2MMAA 5IM9A 1XVQA 4WETA 2VLUA 4CY6A 2YN1A 1M9BA 3GTUB 5IOXA 5GSSA 3ZIVA 2OBKA 1FW1A 2F51A 3M9JA 5GZZB 1SJZA 1M7TA 4POKA 3C73A 5L71A 4EE0A 2EIOA 2AAWA 3G7IA 3O3TA 1EV4A 2JZTA 3U6VA 1ZOFA 2J9HA 4FYUA 4AF2A 4V2NA 2HRNA 2GT5A 1WP0A 18GSA 3P2AA 4NMUA 2YWMA 4MJEA 4CY8A 2K8SA 1MD4A 1PMTA 1ERVA 3MNGA 2GZPA 3EMXA 4ML1A 4YQMA 3W6GA 3IXRA 3LWAA 1GRXA 5ECQB 3DMLA 3BOAA 1URMA 1O85A 1KNGA 2AB6A 1OAZA 4RI7A 2H73A 3VK9A 1GSSA 2R0CA 1T1VA 5CP1A 2FWFA 3PPUA 2O87A 3WT2A 1A0RP 2IWTA 2VLVA 2IMFA 3FR9A 5IMVA 2NTOA 2I3YA 2H8LA 1T7PB 4GCIA 4POMA 1OC9A 4KGIA 2HZEB 4HZ4A 3TKRA 4LL4B 4YKFA 5E4WA 2E2MA 2B1KA 3IHQA 1PL1A 2TIRA 2IMIA 2O7KA 4BL7A 1SKWB 4KH7A 1G7EA 2H75A 1G6WA 4HI7A 4JU5A 4JE1A 2FCHA 1XW6A 3EE2A 1EZKA 1ERWA 2GQMA 3F4TA 4PQ1A 5KN2A 1DE2A 4MF6A 3SBCA 1F2EA 4FQUA 4ECBA 3VWVA 4TXOB 1PSQA 1QQ2A 2HT9A 3FR6A 4TXVA 3CRTA 3GL3A 3V1WA 4F82A 4POLA 4KUNA 5EY6A 3UARA 3HJOA 3FYGA 4GTUA 1TXXA 3GRXA 3E3EA 3GH6A 2HI7A 4IW9A 10GSA 3KH9A 4YAVA 2HSYA 2C0EA 5HQPA 1ABAA 3APQA 5CAXA 3PR8A 1TOFA 3A5IA 3WGEA 4DEJA 4QL9A 4IJ3A 4ECCA 4FIWA 5AIXA 4WEYA 1ERUA 2VAFA 1VF4A 2REMA 9GSSA 4K7IA 1AAZA 3GH9A 3IRAA 2WCIA 2VCTA 2DKHA 1DSBA 3GKXA 4K6XA 6GSVA 3HZ8A 2YJ7A 1X9WB 2LRTA 1CQHA 1XWGA 2DJ3A 2JU5A 1MD3A 1HNBA 1AXDA 1AQWA 1A0FA 1BX9A 2YPMA 3UBKA 4ZL7A 1F3BA 2LNTA 1FVJA 1J0FA 4IN0A 3ME7A 12GSA 2MBSA 5HR1A 2C8UA 4OMVA 2ALBA 1V2AA 2OA7A 1FOVA 2CAQA 2CZ3A 4LLRA 2RUEA 2LNSA 4EDZA 4XHMA 1CQGA 3QPMA 4EDYA 2YJHA 4V1Ap 4G0KA 4TR3A 5EL8A 2NDOA 1EV9A 2FWHA 3C71A 1ZYEA 2I9HA 1M0UA 4ZB6A 3BCKA 1LBKA 4ZL8A 4KDUA 1K3OA 5H5RA 1SD9A 2C3TA 4EXJA 4K0GA 2X8CA 3KM6A 1B4PA 2A2SA 2DC5A 1A23A 4Q5NA 4RUVA 4ML6A 1T4ZA 2ON7A 4TOPA 3J7Yk 1GNEA 2RUFA 3ZFLA 4XS4B 2GT6A 1GWCA 4L5OA 3GHAA 3LG6A 3WGDA 1FB6A 4JR4A 2L57A 3H4KA 3TRQA 20GSA 1TU8A 3VWWA 1NHYA 1UC7A 1XIYA 3IC8A 3W8SA 2H19A 4KF9A 1R26A 4L0WA 1Y25A 3GURA 4TW5A 3GL5A 3TJGA 1T00A 4EIPA 4X43A 3LW9A 5HR0A 3QCPA 4K7OA 2MMZA 4V2MA 2JSZA 4MH3A 3PGTA 4IQ1A 1O8XA 3ZITA 3D4MA 2IN3A 1A2LA 5CNWA 1AUCA 2YOIA 3TGZA 3RBTA 3FZAA 2JZSA 1I9DA 3DXBA 3F6DA 5KN1A 1ERTA 3WGXA 2GSRA 2B7JA 3KCMA 2B5YA 1XOAA 4KA0A 5GAND 3VPTA 5DVBA 1NHOA 3MDKA 4XIHA 5F0GA 2P31A 3APOA 4HQSA 2VL9A 2F8FA 3M9KA 4NHZA 1HYUA 3P7XA 2HZFA 4XTSA 1K0MA 6GSTA 1PA3A 2FWGA 1A2MA 1HNAA 3KZQA 3VURA 1RW1A 4DSSB 1XVWA 4YQUA 1ZYNA 3ERFA 3IDVA 3LXTA 3A5WA 5ELAA 3OR5A 3HHVA 1AC1A 1NW2A 1TJDA 3ZVJD 3H8QA 4KNDA 3HVXA 2HXKA 1TU7A 1ST9A 5CREA 4OCEA 2VUPA 3J7Yb 2CV4A 2I4AA 3IPZA 1BYEA 2WS2A 1MDIA 4KDYA 4F9ZA 1SK2A 4QQ7A 3CSHA 3GV1A 4MK3A 1IYIA 2X4AA 1FVKA 3GKKA 4HU9A 2F9SA 3HA9A 2QKEA 2FA4A 1WPIA 3ISOA 1TK0B 5EVOA 2X99A 3DYRA 4WBRD 3LYKA 2RM5A 1K0NA 1GSUA 4K2XA 3NZNA 1PN9A 1ZYPA 2DJJA 3C1SA 2KOKA 3DVWA 4O5UA 5ID2B 5ECSA 7GSSA 1WWJA 1EOHA 2IMKA 5A4UA 1GSYA 3A2WA 2NPBA 3IBHA 1XFLA 3ED3A 3F4SA 1ILOA 4J56E 2LUSA 1TK8B 4N30A 2ZNMA 4KCAA 3GFKA 2L4QA 1ZMAA 2GTUA 2V2GA 4JRRA 5D9VA 3LJRA 2ZUPA 3CSJA 5CRDA 5G5FA 5CRGA 2Z9SA 4FYCA 3GIXA 4LA1A 4J2FA 2GGTA 3US3A 1EWXA 1THXA 2XBQA 4E8HA 3NOFA 4ILFA 1QFNA 2CQ9A 3D4TA 4OCFA 2R4VA 2X64A 2E2GA 3QAGA 4A5PA 2A4VA 2G2QA 1JLVA 1B9YC 1ZZYA 2QSIA 2LRNA 5ELGA 2N5BA 4XRDA 4FH8A 1Z6MA 2GZYA 3WT1A 2R0GA 4G2EA 3WYWA 3GSTA 5D9TA 4HJMA 4GSNA 3FZ5A 4XS6A 1TI3A 3LEFA 1ZCPA 2I81A 4ZB9A 3IR4A 1XXUA 2DIZA 2KUCA 3MIXA 2FA8A 2GDRA 2JSYA 2N5FA 2WB9A 1OC3A 2RM6A 4OFNA 5KN0A 2MMNA 3M8NA 3C7MA 2B1LA 3FZ4A 2OADA 3GNJA 4FYBA 2PGTA 4I8BA 2MZCA 4ULXA 4WXTA 3UMAA 4YQVA 5DAKB 5ECLB 3QFBC 4MCUA 1PX6A 2IIYA 3GYKA 5BMUA 5B7CA 2JL4A 4MPFA 2L5LA 2XPDA 4USSA 3DIEA 3RDWA 5J3RA 2HSMA 3H93A 3Q6OA 4ECIA 2B3SA 2M72A 1K0BA 1VF3A 3G7YA 3ERWA 4HJ2A 1PX7A 3Q74A 2V6KA 1ZGNA 3HVVA 4PURA 5KOWA 5HFIA 4YH2A 2JADA 3FK8A 2FUG2 3R3EA 1PD21 2H1AA 4H86A 4NXIA 2RLIA 1S3DA 5ECIB 3TRXA 1XWKA 3IV4A 3KMOA 4HQZA 1QXHA 5HR2A 1TDIA 4MZWA 1A2JA 2AV4A 2K18A 4AGSA 1V98A 4IKHA 1TP9A 5AIVA 5DJLA 2PVQA 2WJUA 3DWVA 1C72A 1H4OA 2H71A 2L6CA 1Z9HA 3HDCA 3QDNA 1B8XA 5D96A 2VCQA 3O6TA 1K0CA 2GS3A 3QAVA 1ACVA 3O76A 2VCWA 1S3CA 3ZYWA 3FY7A 4NV5A 3RPNA 1OKDA 2GLRA 3LQ7A 2GSTA 5ECKB 5DQYA 3GKMA 3F63A 2P5RA 1SD8A 2OBIA 1XW5A 2V6OA 2P5QA 1GTUA 2FY6A 2VL2C 4X0XA 2VCZA 2XBIA 4IVFA 5IMCA 4O5QA 4DVCA 1SK1A 4K2DA 2G0FA 1MDKA 1O81A 1A8LA 3H79A 5CO3A 2CAIA 4CDOA 3GUSA 3M0FA 1XZOA 2DIYA 4GXZA 1X9SB 2C0DA 1FB0A 1FO5A 1K0AA 4ISDA 3TKSE 1ZYQB 4BVYA 3HD5A 5CRHA 1LU4A 5J9BA 1SL0B 2DKIA 3UEMA 5IIZA 2FHEA 2YCDA 2GQLA 1Z6NA 3RHBA 4IQAA 3DEXA 3ZFBA 5DALA 4NAXA 2IFQA 2VM1A 1OC9B 1R5PA 3LORA 2PVOC 4TR1A 1USBA 4OFMA 2WFCA 3G7JA 1X9MB 5CRWA 2B5EA 5FT3A 1U3IA 3FEUA 1VRSD 5D9WA 2LS5A 2DJ2A 5FHIA 3RHCA 4BL7B 3UL3A 3IAS2 3TJJA 1R4WA 1G6YA 4Z7XA 2AUVA 1HNCA 2C3QA 2YZHA 5D9XA 4CW9A 3EPTA 4MH2A 1GSDA 1N8JA 1SJIA 4K8MA 1TK5B 5ECPB 1F9MA 1WIKA 2WZ9A 3GX0A 1BAYA 1YQ1A 4EF0A 3ZIJA 2R5GA 3BBYA 2OKAA 1J9BA 4L8EA 1GH2A 3KEBA 2H0GA 3FKFA 2VO4A 2YWIA 3Q18A 3U5RE 5CYYA 6GSYA 1I5GA 4L5LA 2IL3A 4ICYA 4WF4A 1UN2A 1K3YA 2NBSA 3JCML 4FO5A 1SJ6A 3ZTLA 2R2JA 5HFGA 4DSRA 1TRSA 4BVXA 4ZXGA 3IK9A 3F8UA 4MF7A 1Z7RA 5E59A 3KTBA 22GSA 3RPPA 4TKYA 1HD2A 2V41A 1X0RA 3QR6A 3UVHA 5IQYA 2BJXA 3F3RA 1SK0A 4OFTA 1WRYA 5AGYA 2B7KA 1Q4JA 1T3BA 2ES7A 3QOUA 3M3MA 4YKGA 4MJBA 4XCSA 6GSXA 2H72A 3TKSC 5B6MA 3EYTA 5H5SA 4HOJA 1YEPA 3VWUA 4GSSA 3KP8A 2CVDA 3CXGA 4HU7A 2H0HA 2BTOT 2BMXA 2QC7A 2H6ZA 3UVTA 8GSSA 2X8GA 5JWQB 1JZRA 3HVSA 1PN0A 2P0GA 5G5EA 1YEXA 3AY8A 3ME8A 4K5SA 2AHEA 3HJMA 3GX8A 3I6AA 4F2IA 2B6MA 1SYRA 2C0GA 1EGRA 5J9CA 3CTGA 3MYDA 3E9JB 3K8NA 3GSSA 3VI7A 1M9AA 1B9XC 1MEKA 4G0IA 2C4JA 2LEGA 1GNWA 3TJFA 4LMWA 3Q19A 1AIUA 5C04A 2F8AA 5IOWA 1GLPA 2YZUA 4IP1A 4D73B 2K6VA 3ZLPA 3TDGA 5JCWA 1XWAA 1S3AA 4IP6A 2HYXA 2N5AA 4WR4A 4HS1A 2MMOA 4WF5A 3APSA 4GLTA 4PQIA 4EKZA 4ZBDA 1Z3EA 1PQNA 1U87A 2L5OA 4RQXA 3KTLA 5ECHB 4NHWA 5B8AA 1SYXA 4TR0A 1G7OA 4WBJA 5DDLA 1K0OA 1TW9A 5D73A 2YV7A 6GSUA 4IELA 2A2PA 4O32A 3KJYA 3IHGA 3MSZA 2KP2A 1J08A 2E7PA 2LJRA 5ENUA 3PH9A 5AISA 1B4QA 2VM2A 3QAWA 1YF1A 2XHFA 4WR5A 4AJ8A 1BG5A 4Q5RA 2LTKA 2L4CA 2ON5A 4QL7A 2H0IA 2C0FA 3R2QA 1BJXA 4GWRA 3TUEA 4X1UA 4MLYA 3ZVJA 4HZ2A 1OYJA 1M99A 2H66A 3ERGA 4ZIJA 3QFAC 16GSA 4I2UA 2UZ8A 3GTUA 4ID0A 3EU4A 4EO3A 3I9V2 1O6JA 2K9FA 5IMZA 5JWOB 4MA9A 2CX3A 3GA4A 1GTAA 2FLSA 4NV2A 1TKDB 3FRCA 2OE0A 3E0UA 4G19A 1PGTA 4YAPA 1GSQA 5F07A 3HYPA 4KB3A 1W4VA 5BRTA 4BWSA 3VI5A 4O5RA 3MWHA 3EU3A 4KDXA 1B48A 4PTSA 3I69A 4PUAA 2CVKA 1T8EB 4XRAA 5F05A 1RK4A 1GUKA 4KSMA 1HQOA 1EP7A 1YZXA 4GRFA 1UA5A 1E6BA 1V9WA 2H30A 1UVZA 4BA7A 4N11A 1JHBA 1DE1A 1Z5YE 4K5RA 1XBSA 1FG4A 2FD3A 4E8EA 2QGVA 2PPTA 2FWEA 2ZCTA 2L59A 4MF5A 2L6DA 4HDEA 2TRXA 2CZ2A 2HZEA 1JLWA 2IPAA 1R7HA 2GSQA 1SENA 2DLXA 2PWJA 1QUWA 1EEJA 3DD3A 1BEDA 5J5NA 3L9SA 4GQCA 1V58A 1PL2A 3FR3A 5JWRB 4ZL9A 5G2ZA 4XS1A 2C3NA 1FAAA 4ACSA 2EIQA 5ECMB 1Y6EA 2MYGA 2E0QA 2H01A 1JZOA 2HRFA 2AYTA 2H1DA 4EVMA 3LGCA 1X5DA 4PUFC 4I2TA 2X8HA 4TXOA 2KP1A 5C00A 1DUGA 5DQSA 3HXSA 1VF1A 3C1RA 1M2BA 3HZ4A 3UIWA 1ML6A 5ECOB 2H6YA 2PBJA 4K9ZA 4KE3A 2YP6A 5IPHA 2QA2A 1TRUA 3EWLA 3A3TA 2VIMA 2WGRA 5GAPD 1LJRA 2K8VA 2OE1A 3CRUA 1SKRB 1X5CA 5G1KA 5ECRB 2VCVA 4JZQA 2A2RA 2GZZA 2OE3A 1PKWA 3C8EA 5A4WA 2CVBA 4AJ7A 1GP1A 3BD2A 1NSWA 2DJ1A 3KP9A 4OD7A 1AW9A 3F9UA 3N9JA 4G10A 4P3YB 3ZRDA 2WRTA 5IO2A 2WDUA 4ZBAA 5DJMA 3LFLA 1V40A 2JZRA 4TN8A 1VF2A 2LQOA 1GTIA 3F6FA 1OKTA 2LJAA 3BJ5A 1OVNA 4Z2UA 1XWBA 2VL2A 5F06A 2VL3A 1JZDA 14GSA 4MPGA 4OO4A 5B6NA 4PX1A 5D8IA 2XC2A 5IMFA 1E2YA 2GSSA 4KSOA 1O7UA 2HLSA 4JEDA 3GN3A 3HY2A 4I97A 5DCGA 1SKSB 3IA1A 4PNFA 1AQVA 4N0VA 3GKNA 2LJKA 1GLQA 3FW2A 4HEA2 3H1NA 2B5XA 2FGXA 1RQMA 4F0BA 1Z7PA 5B8BA 1A24A 2H70A 5HFKA 2R3XA 4BPYA 2DJKA 5AN1A 2LSTA 1YF0A 4GF0A 1OC8A 4Z2RA 1K0DA 2VD0A 5COHA 2DMMA 3HCZA 4I5QA 1QGVA 5DBQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KAE A;  6GSS A;  3DKS A;  3F4R A;  3ZRE A;  5DCH A;  5H5Q A;  3FZ9 A;  3MAK A;  4JBB A;  4XS4 A;  3EC3 A;  1ZL9 A;  2FNO A;  2VLT A;  5A4V A;  2H1G A;  2CA8 A;  1XW9 A;  1EP8 A;  2YNX A;  3UOM A;  2O85 A;  3TB2 A;  3KH7 A;  2V32 A;  3TOU A;  4AJ6 A;  5EPF A;  1XWC A;  1SL2 B;  3VPQ A;  4O7H A;  2YV9 A;  1OE7 A;  4PQH A;  2JAC A;  1JZW A;  1SL1 B;  1H75 A;  19GS A;  1U88 A;  4G9H A;  2C80 A;  4MJC A;  5FWG A;  3VFI A;  3QMX A;  1TI1 A;  3IC4 A;  2LQQ A;  4N0Z A;  2IJY A;  2PER A;  3W8J A;  2D2Z A;  3N5O A;  4TVE A;  4GQF A;  4ZIL A;  5GST A;  1MTC A;  4IJI A;  5HR3 A;  3L78 A;  1TTZ A;  4OWY A;  1WE0 A;  4KW6 A;  2H6X A;  3L4N A;  1NM3 A;  4MP4 A;  2HSH A;  3UJ1 A;  3DGQ A;  1KEB A;  4IGJ A;  4MAB A;  4EUY A;  4F0C A;  1YKC A;  1U6T A;  4WKW A;  3TKP A;  3BCI A;  1F6M C;  2GQK A;  3D6I A;  3TKS A;  1R5A A;  3CMI A;  4MDC A;  4ECJ A;  3CYN A;  3EIN A;  2YWO A;  4RQR A;  4DSQ A;  1N2A A;  1QMV A;  4D73 A;  4K7N A;  4TRX A;  2C1Y A;  3SWL A;  3WD6 A;  3D21 A;  5IPG A;  1YDK A;  4DSS A;  2J23 A;  4IBP A;  3NIV A;  1F37 A;  2H74 A;  5D93 A;  3L0H A;  2H76 A;  3IAM 2;  3LXZ A;  2LRC A;  2DSA A;  1GUL A;  4IHU A;  3KMN A;  3F3Q A;  1AQX A;  5DAL B;  2IFQ B;  2KHP A;  2I1U A;  1VGL A;  4TR1 B;  3GMF A;  5IMD A;  3LSZ A;  2R37 A;  1XCC A;  5G30 A;  3P90 A;  2MBT A;  3VWX A;  3ZMK A;  3LYP A;  4KCE A;  2YWN A;  1WMJ A;  3ZML A;  2PUK C;  1GL8 A;  2O8V B;  2HE3 A;  1JFU A;  3HKR A;  2V1M A;  4LL1 B;  3ZL5 A;  2IMD A;  5KN3 A;  4N10 A;  4MMM A;  2EIR A;  5KEJ A;  2KLX A;  1O73 A;  2CT6 A;  3A2X A;  3M1G A;  2HNL A;  1EOG A;  1GSF A;  3D5J A;  1WOU A;  1EEM A;  1PRX A;  5A5K A;  4POB A;  5ID2 A;  4RI6 A;  2LV3 A;  2EC4 A;  4PNG A;  1K3L A;  4PXO A;  3IE3 A;  3D0Z A;  1BQ7 A;  1XPV A;  3D22 A;  2VD1 A;  2RII A;  5G31 A;  1GUH A;  1GUM A;  1EGO A;  2WUL A;  4L0U A;  4CHS A;  4ZB8 A;  1QK8 A;  11GS A;  2CX4 A;  3RAZ A;  1TRW A;  3EUR A;  2VCX A;  5INY A;  1FHE A;  2TRC P;  4Q5F A;  17GS A;  4O92 A;  3IOS A;  5LNK e;  5LCZ A;  1G0T A;  2PMT A;  4EC0 A;  1TRV A;  1Q98 A;  2DML A;  3F0I A;  3TOT A;  2F3M A;  2O89 A;  4GST A;  5J41 A;  2AJQ B;  2HFD A;  2OJL A;  3S9F A;  1IYH A;  4MZC A;  4KX4 A;  1T4Y A;  2M80 A;  3KIJ A;  3CSI A;  2R6K A;  3VLN A;  5JCU A;  1U3A A;  2H1B A;  3P8W A;  1A8Y A;  3TJB A;  3EMP A;  1MDJ A;  4LMV A;  1XOB A;  3QD9 A;  4Q5Q A;  4NPB A;  3UAP A;  3PIN A;  3CTF A;  4MZB A;  3ZZX A;  5ECN B;  2YAN A;  3TJK A;  1KTE A;  4F03 A;  2DBC A;  5G1L A;  4EL1 A;  4OO5 A;  1THO A;  3KGK A;  4ZBB A;  1YJ6 A;  5DAK A;  2OAC A;  3TKQ A;  1KBN A;  1GSE A;  5IMA A;  4I6X A;  1X5E A;  1W89 A;  4V1A g;  1ON4 A;  3TCO A;  3KD0 A;  4K1F A;  2LKU A;  4PGT A;  1PKZ A;  3G9B A;  2IME A;  1M2D A;  13GS A;  4JR6 A;  6GSW A;  1YY7 A;  1DBY A;  3KXO A;  2NVL A;  3A2V A;  5F8B A;  3L9V A;  3FHK A;  3DRN A;  1F3A A;  5ABR A;  2PU9 C;  4K0N A;  1OE8 A;  3DVX A;  1WJK A;  4V2L A;  3EVI A;  2XPE A;  2M46 A;  4MJA A;  1SU9 A;  1GTB A;  3I43 A;  5LD0 A;  1V57 A;  4NWY A;  4J57 E;  2GVP A;  3UBL A;  5JCG A;  3TRP A;  1M2A A;  3L9U A;  5IO0 A;  4BWQ A;  3CBU A;  2VOC A;  3IK7 A;  1O8W A;  1YKA A;  4TR4 A;  4HUA A;  5J4U A;  2PN8 A;  4IS0 A;  2DJ0 A;  3HJP A;  2MMA A;  5IM9 A;  1XVQ A;  4WET A;  2VLU A;  2YN1 A;  1M9B A;  3GTU B;  5IOX A;  5GSS A;  3ZIV A;  2OBK A;  1FW1 A;  2F51 A;  3M9J A;  5GZZ B;  1SJZ A;  1M7T A;  4POK A;  3C73 A;  5L71 A;  4EE0 A;  2EIO A;  2AAW A;  3G7I A;  3O3T A;  1EV4 A;  2JZT A;  3U6V A;  1ZOF A;  2J9H A;  4FYU A;  4AF2 A;  4V2N A;  2HRN A;  2GT5 A;  1WP0 A;  18GS A;  3P2A A;  4NMU A;  2YWM A;  4MJE A;  2K8S A;  1MD4 A;  1PMT A;  1ERV A;  3MNG A;  2GZP A;  3EMX A;  4ML1 A;  4YQM A;  3W6G A;  3IXR A;  3LWA A;  1GRX A;  5ECQ B;  3DML A;  3BOA A;  1URM A;  1O85 A;  1KNG A;  2AB6 A;  1OAZ A;  4RI7 A;  2H73 A;  3VK9 A;  1GSS A;  1T1V A;  5CP1 A;  2FWF A;  2O87 A;  3WT2 A;  1A0R P;  2IWT A;  2VLV A;  2IMF A;  3FR9 A;  5IMV A;  2NTO A;  2I3Y A;  2H8L A;  1T7P B;  4GCI A;  4POM A;  1OC9 A;  4KGI A;  2HZE B;  4HZ4 A;  3TKR A;  4LL4 B;  5E4W A;  2E2M A;  2B1K A;  3IHQ A;  1PL1 A;  2TIR A;  2IMI A;  2O7K A;  4BL7 A;  1SKW B;  4KH7 A;  1G7E A;  2H75 A;  1G6W A;  4HI7 A;  4JU5 A;  4JE1 A;  2FCH A;  1XW6 A;  3EE2 A;  1EZK A;  1ERW A;  2GQM A;  3F4T A;  4PQ1 A;  5KN2 A;  1DE2 A;  4MF6 A;  3SBC A;  1F2E A;  4ECB A;  3VWV A;  4TXO B;  1PSQ A;  1QQ2 A;  2HT9 A;  3FR6 A;  4TXV A;  3CRT A;  3GL3 A;  3V1W A;  4F82 A;  4POL A;  4KUN A;  5EY6 A;  3UAR A;  3HJO A;  3FYG A;  4GTU A;  1TXX A;  3GRX A;  3E3E A;  3GH6 A;  2HI7 A;  4IW9 A;  10GS A;  3KH9 A;  4YAV A;  2HSY A;  2C0E A;  5HQP A;  1ABA A;  3APQ A;  5CAX A;  3PR8 A;  1TOF A;  3WGE A;  4DEJ A;  4QL9 A;  4IJ3 A;  4ECC A;  4FIW A;  5AIX A;  4WEY A;  1ERU A;  2VAF A;  1VF4 A;  2REM A;  9GSS A;  4K7I A;  1AAZ A;  3GH9 A;  3IRA A;  2WCI A;  2VCT A;  1DSB A;  3GKX A;  4K6X A;  6GSV A;  3HZ8 A;  2YJ7 A;  1X9W B;  2LRT A;  1CQH A;  1XWG A;  2DJ3 A;  2JU5 A;  1MD3 A;  1HNB A;  1AXD A;  1AQW A;  1A0F A;  1BX9 A;  2YPM A;  3UBK A;  4ZL7 A;  1F3B A;  2LNT A;  1FVJ A;  1J0F A;  4IN0 A;  3ME7 A;  12GS A;  2MBS A;  5HR1 A;  2C8U A;  4OMV A;  2ALB A;  1V2A A;  2OA7 A;  1FOV A;  2CAQ A;  2CZ3 A;  4LLR A;  2RUE A;  2LNS A;  4EDZ A;  4XHM A;  1CQG A;  3QPM A;  4EDY A;  2YJH A;  4V1A p;  4TR3 A;  5EL8 A;  2NDO A;  1EV9 A;  2FWH A;  3C71 A;  1ZYE A;  2I9H A;  1M0U A;  4ZB6 A;  3BCK A;  1LBK A;  4ZL8 A;  4KDU A;  1K3O A;  5H5R A;  1SD9 A;  2C3T A;  4EXJ A;  4K0G A;  2X8C A;  3KM6 A;  1B4P A;  2A2S A;  2DC5 A;  1A23 A;  4Q5N A;  4RUV A;  4ML6 A;  1T4Z A;  2ON7 A;  4TOP A;  3J7Y k;  1GNE A;  2RUF A;  3ZFL A;  4XS4 B;  2GT6 A;  1GWC A;  4L5O A;  3GHA A;  3LG6 A;  3WGD A;  1FB6 A;  4JR4 A;  2L57 A;  3H4K A;  3TRQ A;  20GS A;  1TU8 A;  3VWW A;  1NHY A;  1UC7 A;  1XIY A;  3W8S A;  2H19 A;  1R26 A;  4L0W A;  1Y25 A;  3GUR A;  4TW5 A;  3GL5 A;  3TJG A;  1T00 A;  4X43 A;  5HR0 A;  3QCP A;  4K7O A;  2MMZ A;  4V2M A;  2JSZ A;  4MH3 A;  3PGT A;  4IQ1 A;  1O8X A;  3ZIT A;  3D4M A;  2IN3 A;  1A2L A;  5CNW A;  1AUC A;  2YOI A;  3TGZ A;  3RBT A;  3FZA A;  2JZS A;  1I9D A;  3DXB A;  3F6D A;  5KN1 A;  1ERT A;  3WGX A;  2GSR A;  2B7J A;  3KCM A;  2B5Y A;  1XOA A;  4KA0 A;  5GAN D;  3VPT A;  5DVB A;  1NHO A;  3MDK A;  4XIH A;  5F0G A;  2P31 A;  3APO A;  4HQS A;  2VL9 A;  2F8F A;  3M9K A;  4NHZ A;  1HYU A;  3P7X A;  2HZF A;  4XTS A;  1K0M A;  6GST A;  1PA3 A;  2FWG A;  1A2M A;  1HNA A;  3KZQ A;  3VUR A;  1RW1 A;  4DSS B;  1XVW A;  4YQU A;  3ERF A;  3IDV A;  3LXT A;  3A5W A;  5ELA A;  3OR5 A;  3HHV A;  1AC1 A;  1NW2 A;  1TJD A;  3ZVJ D;  3H8Q A;  4KND A;  3HVX A;  2HXK A;  1TU7 A;  1ST9 A;  5CRE A;  4OCE A;  2VUP A;  3J7Y b;  2CV4 A;  2I4A A;  3IPZ A;  1BYE A;  2WS2 A;  1MDI A;  4KDY A;  4F9Z A;  1SK2 A;  4QQ7 A;  3CSH A;  3GV1 A;  4MK3 A;  1IYI A;  1FVK A;  3GKK A;  4HU9 A;  2F9S A;  3HA9 A;  2QKE A;  2FA4 A;  1WPI A;  3ISO A;  1TK0 B;  5EVO A;  2X99 A;  3DYR A;  4WBR D;  3LYK A;  2RM5 A;  1K0N A;  1GSU A;  3NZN A;  1PN9 A;  2DJJ A;  3C1S A;  2KOK A;  3DVW A;  5ID2 B;  5ECS A;  7GSS A;  1WWJ A;  1EOH A;  2IMK A;  5A4U A;  1GSY A;  3A2W A;  2NPB A;  3IBH A;  1XFL A;  3ED3 A;  3F4S A;  1ILO A;  4J56 E;  2LUS A;  1TK8 B;  4N30 A;  2ZNM A;  4KCA A;  3GFK A;  2L4Q A;  1ZMA A;  2GTU A;  2V2G A;  4JRR A;  5D9V A;  3LJR A;  2ZUP A;  3CSJ A;  5CRD A;  5G5F A;  5CRG A;  2Z9S A;  4FYC A;  3GIX A;  4LA1 A;  4J2F A;  2GGT A;  3US3 A;  1EWX A;  1THX A;  2XBQ A;  4E8H A;  3NOF A;  4ILF A;  1QFN A;  2CQ9 A;  3D4T A;  4OCF A;  2R4V A;  2X64 A;  2E2G A;  3QAG A;  2A4V A;  2G2Q A;  1JLV A;  1B9Y C;  1ZZY A;  2QSI A;  2LRN A;  5ELG A;  2N5B A;  4XRD A;  4FH8 A;  1Z6M A;  2GZY A;  3WT1 A;  4G2E A;  3WYW A;  3GST A;  5D9T A;  4HJM A;  4GSN A;  3FZ5 A;  4XS6 A;  1TI3 A;  3LEF A;  1ZCP A;  2I81 A;  4ZB9 A;  3IR4 A;  1XXU A;  2DIZ A;  2KUC A;  2FA8 A;  2GDR A;  2JSY A;  2N5F A;  2WB9 A;  1OC3 A;  2RM6 A;  4OFN A;  5KN0 A;  2MMN A;  3M8N A;  3C7M A;  2B1L A;  3FZ4 A;  2OAD A;  3GNJ A;  4FYB A;  2PGT A;  4I8B A;  2MZC A;  4ULX A;  4WXT A;  3UMA A;  4YQV A;  5DAK B;  5ECL B;  3QFB C;  4MCU A;  1PX6 A;  2IIY A;  3GYK A;  5B7C A;  2JL4 A;  4MPF A;  2L5L A;  2XPD A;  3DIE A;  3RDW A;  5J3R A;  3H93 A;  3Q6O A;  4ECI A;  2B3S A;  2M72 A;  1K0B A;  1VF3 A;  3G7Y A;  3ERW A;  4HJ2 A;  1PX7 A;  3Q74 A;  2V6K A;  1ZGN A;  3HVV A;  4PUR A;  5HFI A;  4YH2 A;  2JAD A;  3FK8 A;  2FUG 2;  1PD2 1;  2H1A A;  4H86 A;  4NXI A;  2RLI A;  1S3D A;  5ECI B;  3TRX A;  1XWK A;  3IV4 A;  3KMO A;  4HQZ A;  1QXH A;  5HR2 A;  1TDI A;  4MZW A;  1A2J A;  2AV4 A;  2K18 A;  4AGS A;  1V98 A;  4IKH A;  1TP9 A;  5AIV A;  5DJL A;  2PVQ A;  2WJU A;  3DWV A;  1C72 A;  1H4O A;  2H71 A;  2L6C A;  1Z9H A;  3HDC A;  3QDN A;  1B8X A;  5D96 A;  2VCQ A;  3O6T A;  1K0C A;  2GS3 A;  3QAV A;  1ACV A;  3O76 A;  2VCW A;  1S3C A;  3ZYW A;  3FY7 A;  4NV5 A;  3RPN A;  1OKD A;  2GLR A;  3LQ7 A;  2GST A;  5ECK B;  5DQY A;  3GKM A;  3F63 A;  2P5R A;  1SD8 A;  2OBI A;  1XW5 A;  2V6O A;  2P5Q A;  1GTU A;  2FY6 A;  2VL2 C;  4X0X A;  2VCZ A;  2XBI A;  4IVF A;  5IMC A;  4DVC A;  1SK1 A;  4K2D A;  2G0F A;  1MDK A;  1O81 A;  1A8L A;  3H79 A;  5CO3 A;  2CAI A;  4CDO A;  3GUS A;  3M0F A;  1XZO A;  2DIY A;  4GXZ A;  1X9S B;  2C0D A;  1FB0 A;  1FO5 A;  1K0A A;  4ISD A;  3TKS E;  1ZYQ B;  4BVY A;  3HD5 A;  5CRH A;  1LU4 A;  5J9B A;  1SL0 B;  3UEM A;  5IIZ A;  2FHE A;  2YCD A;  2GQL A;  1Z6N A;  3RHB A;  4IQA A;  3DEX A;  3ZFB A;  5DAL A;  4NAX A;  2IFQ A;  2VM1 A;  1OC9 B;  1R5P A;  3LOR A;  2PVO C;  4TR1 A;  1USB A;  4OFM A;  2WFC A;  3G7J A;  1X9M B;  5CRW A;  2B5E A;  5FT3 A;  1U3I A;  3FEU A;  1VRS D;  5D9W A;  2LS5 A;  2DJ2 A;  5FHI A;  3RHC A;  3UL3 A;  3IAS 2;  3TJJ A;  1R4W A;  1G6Y A;  4Z7X A;  2AUV A;  1HNC A;  2C3Q A;  2YZH A;  5D9X A;  4CW9 A;  4MH2 A;  1GSD A;  1N8J A;  1SJI A;  4K8M A;  1TK5 B;  5ECP B;  1F9M A;  1WIK A;  2WZ9 A;  3GX0 A;  1BAY A;  1YQ1 A;  4EF0 A;  3ZIJ A;  2R5G A;  3BBY A;  2OKA A;  1J9B A;  4L8E A;  1GH2 A;  3KEB A;  2H0G A;  3FKF A;  2VO4 A;  2YWI A;  3Q18 A;  3U5R E;  5CYY A;  6GSY A;  1I5G A;  4L5L A;  2IL3 A;  4WF4 A;  1UN2 A;  1K3Y A;  2NBS A;  3JCM L;  4FO5 A;  1SJ6 A;  3ZTL A;  2R2J A;  5HFG A;  4DSR A;  1TRS A;  4BVX A;  4ZXG A;  3IK9 A;  3F8U A;  4MF7 A;  1Z7R A;  5E59 A;  3KTB A;  22GS A;  3RPP A;  4TKY A;  1HD2 A;  2V41 A;  1X0R A;  3QR6 A;  3UVH A;  5IQY A;  2BJX A;  3F3R A;  1SK0 A;  4OFT A;  1WRY A;  5AGY A;  2B7K A;  1Q4J A;  1T3B A;  2ES7 A;  3QOU A;  3M3M A;  4MJB A;  4XCS A;  6GSX A;  2H72 A;  3TKS C;  5B6M A;  3EYT A;  5H5S A;  4HOJ A;  1YEP A;  3VWU A;  4GSS A;  3KP8 A;  2CVD A;  3CXG A;  4HU7 A;  2H0H A;  2BTO T;  2BMX A;  2QC7 A;  2H6Z A;  3UVT A;  8GSS A;  2X8G A;  5JWQ B;  1JZR A;  3HVS A;  2P0G A;  5G5E A;  1YEX A;  3AY8 A;  3ME8 A;  2AHE A;  3HJM A;  3GX8 A;  3I6A A;  4F2I A;  2B6M A;  1SYR A;  2C0G A;  1EGR A;  5J9C A;  3CTG A;  3E9J B;  3K8N A;  3GSS A;  3VI7 A;  1M9A A;  1B9X C;  1MEK A;  2C4J A;  2LEG A;  1GNW A;  3TJF A;  4LMW A;  3Q19 A;  1AIU A;  5C04 A;  2F8A A;  5IOW A;  1GLP A;  2YZU A;  4IP1 A;  4D73 B;  2K6V A;  3ZLP A;  3TDG A;  5JCW A;  1XWA A;  1S3A A;  4IP6 A;  2HYX A;  2N5A A;  4WR4 A;  4HS1 A;  2MMO A;  4WF5 A;  3APS A;  4GLT A;  4PQI A;  4EKZ A;  4ZBD A;  1Z3E A;  1PQN A;  1U87 A;  2L5O A;  4RQX A;  3KTL A;  5ECH B;  4NHW A;  5B8A A;  1SYX A;  4TR0 A;  1G7O A;  4WBJ A;  5DDL A;  1K0O A;  1TW9 A;  5D73 A;  2YV7 A;  6GSU A;  4IEL A;  4O32 A;  3KJY A;  3MSZ A;  2KP2 A;  1J08 A;  2E7P A;  2LJR A;  5ENU A;  3PH9 A;  5AIS A;  1B4Q A;  2VM2 A;  3QAW A;  1YF1 A;  2XHF A;  4WR5 A;  4AJ8 A;  1BG5 A;  4Q5R A;  2LTK A;  2L4C A;  2ON5 A;  4QL7 A;  2H0I A;  2C0F A;  3R2Q A;  1BJX A;  4GWR A;  3TUE A;  4X1U A;  4MLY A;  3ZVJ A;  4HZ2 A;  1OYJ A;  1M99 A;  2H66 A;  3ERG A;  4ZIJ A;  3QFA C;  16GS A;  4I2U A;  3GTU A;  4ID0 A;  3EU4 A;  4EO3 A;  3I9V 2;  1O6J A;  2K9F A;  5IMZ A;  5JWO B;  4MA9 A;  2CX3 A;  3GA4 A;  1GTA A;  2FLS A;  4NV2 A;  1TKD B;  3FRC A;  2OE0 A;  3E0U A;  4G19 A;  1PGT A;  4YAP A;  1GSQ A;  5F07 A;  3HYP A;  4KB3 A;  1W4V A;  4BWS A;  3VI5 A;  4O5R A;  3MWH A;  3EU3 A;  4KDX A;  1B48 A;  3I69 A;  4PUA A;  2CVK A;  1T8E B;  4XRA A;  5F05 A;  1RK4 A;  1GUK A;  4KSM A;  1HQO A;  1EP7 A;  1YZX A;  4GRF A;  1UA5 A;  1E6B A;  1V9W A;  2H30 A;  1UVZ A;  4BA7 A;  4N11 A;  1JHB A;  1DE1 A;  1Z5Y E;  1XBS A;  1FG4 A;  2FD3 A;  4E8E A;  2QGV A;  2PPT A;  2FWE A;  2ZCT A;  2L59 A;  4MF5 A;  2L6D A;  4HDE A;  2TRX A;  2CZ2 A;  2HZE A;  1JLW A;  2IPA A;  1R7H A;  2GSQ A;  1SEN A;  2DLX A;  2PWJ A;  1QUW A;  1EEJ A;  3DD3 A;  1BED A;  5J5N A;  3L9S A;  4GQC A;  1V58 A;  1PL2 A;  3FR3 A;  5JWR B;  4ZL9 A;  5G2Z A;  4XS1 A;  2C3N A;  1FAA A;  4ACS A;  2EIQ A;  5ECM B;  1Y6E A;  2MYG A;  2E0Q A;  2H01 A;  1JZO A;  2HRF A;  2AYT A;  2H1D A;  4EVM A;  3LGC A;  1X5D A;  4PUF C;  4I2T A;  2X8H A;  4TXO A;  2KP1 A;  5C00 A;  1DUG A;  5DQS A;  3HXS A;  1VF1 A;  3C1R A;  1M2B A;  3HZ4 A;  3UIW A;  1ML6 A;  5ECO B;  2H6Y A;  2PBJ A;  4K9Z A;  4KE3 A;  2YP6 A;  5IPH A;  1TRU A;  3EWL A;  3A3T A;  2VIM A;  2WGR A;  5GAP D;  1LJR A;  2K8V A;  2OE1 A;  3CRU A;  1SKR B;  1X5C A;  5G1K A;  5ECR B;  2VCV A;  4JZQ A;  2A2R A;  2GZZ A;  2OE3 A;  1PKW A;  3C8E A;  5A4W A;  2CVB A;  4AJ7 A;  1GP1 A;  3BD2 A;  1NSW A;  2DJ1 A;  3KP9 A;  4OD7 A;  1AW9 A;  3F9U A;  3N9J A;  4G10 A;  4P3Y B;  3ZRD A;  2WRT A;  5IO2 A;  2WDU A;  4ZBA A;  5DJM A;  3LFL A;  1V40 A;  2JZR A;  4TN8 A;  1VF2 A;  2LQO A;  1GTI A;  3F6F A;  1OKT A;  2LJA A;  3BJ5 A;  1OVN A;  1XWB A;  2VL2 A;  5F06 A;  2VL3 A;  1JZD A;  14GS A;  4MPG A;  4OO4 A;  5B6N A;  4PX1 A;  5D8I A;  2XC2 A;  5IMF A;  1E2Y A;  2GSS A;  4KSO A;  1O7U A;  2HLS A;  4JED A;  3GN3 A;  3HY2 A;  4I97 A;  5DCG A;  1SKS B;  3IA1 A;  4PNF A;  1AQV A;  4N0V A;  3GKN A;  2LJK A;  1GLQ A;  3FW2 A;  4HEA 2;  3H1N A;  2B5X A;  2FGX A;  1RQM A;  4F0B A;  1Z7P A;  5B8B A;  1A24 A;  2H70 A;  5HFK A;  2R3X A;  4BPY A;  2DJK A;  5AN1 A;  2LST A;  1YF0 A;  4GF0 A;  1OC8 A;  1K0D A;  2VD0 A;  5COH A;  2DMM A;  3HCZ A;  4I5Q A;  1QGV A;  5DBQ A; 
#chains in the Genus database with same CATH topology
 4KAE A;  6GSS A;  3DKS A;  3F4R A;  3ZRE A;  5DCH A;  5H5Q A;  1M3I A;  3FZ9 A;  3MAK A;  4JBB A;  4XS4 A;  3EC3 A;  1ZL9 A;  4EIQ A;  2FNO A;  2VLT A;  5A4V A;  2H1G A;  2A4H A;  2CA8 A;  1XW9 A;  1EP8 A;  4Z2T A;  2YNX A;  3UOM A;  2O85 A;  3TB2 A;  2HRA A;  3KH7 A;  2V32 A;  1S3R A;  3TOU A;  4AJ6 A;  5EPF A;  1XWC A;  1SL2 B;  3VPQ A;  4O7H A;  2YV9 A;  1OE7 A;  4PQH A;  2JAC A;  1JZW A;  1M3J A;  1SL1 B;  1H75 A;  19GS A;  1U88 A;  4G9H A;  2C80 A;  4MJC A;  5FWG A;  3VFI A;  3QMX A;  1TI1 A;  3IC4 A;  2LQQ A;  4N0Z A;  2IJY A;  2PER A;  3W8J A;  2D2Z A;  3N5O A;  4TVE A;  4GQF A;  4ZIL A;  5GST A;  1MTC A;  4IJI A;  5HR3 A;  3L78 A;  1TTZ A;  4OWY A;  1WE0 A;  4KW6 A;  2H6X A;  3L4N A;  1NM3 A;  4MP4 A;  2HSH A;  3UJ1 A;  3DGQ A;  1KEB A;  4IGJ A;  3FMW A;  4MAB A;  4EUY A;  4F0C A;  1YKC A;  1U6T A;  4WKW A;  3TKP A;  3BCI A;  1F6M C;  2GQK A;  3D6I A;  3TKS A;  1R5A A;  3CMI A;  4MDC A;  4ECJ A;  3CYN A;  3EIN A;  2YWO A;  4RQR A;  4DSQ A;  1N2A A;  1QMV A;  4D73 A;  4K7N A;  4TRX A;  2C1Y A;  3SWL A;  3WD6 A;  3D21 A;  5IPG A;  1YDK A;  4DSS A;  2J23 A;  4BVY B;  4IBP A;  3NIV A;  1F37 A;  2H74 A;  5D93 A;  3L0H A;  2H76 A;  3IAM 2;  3LXZ A;  2LRC A;  2DSA A;  1FOH A;  1GUL A;  4IHU A;  3KMN A;  3F3Q A;  1AQX A;  5DAL B;  2IFQ B;  2KHP A;  2I1U A;  1VGL A;  4TR1 B;  3GMF A;  5IMD A;  3LSZ A;  2R37 A;  1XCC A;  5G30 A;  3P90 A;  2MBT A;  3VWX A;  3ZMK A;  3LYP A;  4KCE A;  2QA1 A;  2YWN A;  1WMJ A;  4X4J A;  3ZML A;  2PUK C;  1GL8 A;  2O8V B;  2HE3 A;  1JFU A;  3HKR A;  2V1M A;  4LL1 B;  3ZL5 A;  2IMD A;  5KN3 A;  4N10 A;  4MMM A;  2EIR A;  5KEJ A;  2R0P A;  2KLX A;  1O73 A;  2CT6 A;  3A2X A;  3M1G A;  2HNL A;  1EOG A;  1GSF A;  3D5J A;  1WOU A;  1EEM A;  1PRX A;  5A5K A;  4POB A;  5ID2 A;  4RI6 A;  2LV3 A;  2EC4 A;  4PNG A;  1K3L A;  4PXO A;  3IE3 A;  4BVX B;  3D0Z A;  1BQ7 A;  1XPV A;  3D22 A;  2VD1 A;  2RII A;  5G31 A;  1GUH A;  1GUM A;  1EGO A;  2WUL A;  4L0U A;  4CHS A;  4ZB8 A;  1QK8 A;  11GS A;  2CX4 A;  3RAZ A;  1TRW A;  3EUR A;  2VCX A;  2X49 A;  5INY A;  1FHE A;  2TRC P;  4Q5F A;  17GS A;  5KOX A;  4O92 A;  3IOS A;  5LNK e;  5LCZ A;  1G0T A;  2PMT A;  4EC0 A;  1TRV A;  1Q98 A;  2DML A;  3F0I A;  3TOT A;  2F3M A;  2O89 A;  4GST A;  5J41 A;  2AJQ B;  2HFD A;  2OJL A;  3S9F A;  1IYH A;  4MZC A;  4KX4 A;  4BIK A;  1T4Y A;  2M80 A;  3KIJ A;  3CSI A;  2R6K A;  3VLN A;  5JCU A;  1U3A A;  2H1B A;  3P8W A;  1A8Y A;  3TJB A;  3EMP A;  1MDJ A;  4LMV A;  1XOB A;  3QD9 A;  4Q5Q A;  4NPB A;  3UAP A;  3PIN A;  3CTF A;  4MZB A;  3ZZX A;  5ECN B;  2YAN A;  3TJK A;  1KTE A;  4F03 A;  2DBC A;  5G1L A;  4EL1 A;  4OO5 A;  1THO A;  3KGK A;  4ZBB A;  1YJ6 A;  5DAK A;  2OAC A;  3TKQ A;  1KBN A;  1GSE A;  5IMA A;  4I6X A;  1X5E A;  1W89 A;  4V1A g;  1ON4 A;  3TCO A;  3KD0 A;  4K1F A;  2LKU A;  4PGT A;  1PKZ A;  3G9B A;  2IME A;  1M2D A;  13GS A;  4JR6 A;  6GSW A;  1YY7 A;  1DBY A;  2HRK A;  3KXO A;  2NVL A;  3A2V A;  5F8B A;  3L9V A;  3FHK A;  3DRN A;  1F3A A;  5ABR A;  2PU9 C;  4K0N A;  1OE8 A;  3DVX A;  1WJK A;  4V2L A;  3EVI A;  2XPE A;  2M46 A;  4MJA A;  4MNN A;  1SU9 A;  1GTB A;  3I43 A;  5LD0 A;  1V57 A;  4NWY A;  4J57 E;  2GVP A;  3UBL A;  5JCG A;  3TRP A;  1M2A A;  3L9U A;  5IO0 A;  4BWQ A;  3CBU A;  2VOC A;  4G0L A;  3IK7 A;  1O8W A;  1YKA A;  4TR4 A;  4HUA A;  5J4U A;  2PN8 A;  4IS0 A;  2DJ0 A;  3HJP A;  2MMA A;  5IM9 A;  1XVQ A;  4WET A;  2VLU A;  4CY6 A;  2YN1 A;  1M9B A;  3GTU B;  5IOX A;  5GSS A;  3ZIV A;  2OBK A;  1FW1 A;  2F51 A;  3M9J A;  5GZZ B;  1SJZ A;  1M7T A;  4POK A;  3C73 A;  5L71 A;  4EE0 A;  2EIO A;  2AAW A;  3G7I A;  3O3T A;  1EV4 A;  2JZT A;  3U6V A;  1ZOF A;  2J9H A;  4FYU A;  4AF2 A;  4V2N A;  2HRN A;  2GT5 A;  1WP0 A;  18GS A;  3P2A A;  4NMU A;  2YWM A;  4MJE A;  4CY8 A;  2K8S A;  1MD4 A;  1PMT A;  1ERV A;  3MNG A;  2GZP A;  3EMX A;  4ML1 A;  4YQM A;  3W6G A;  3IXR A;  3LWA A;  1GRX A;  5ECQ B;  3DML A;  3BOA A;  1URM A;  1O85 A;  1KNG A;  2AB6 A;  1OAZ A;  4RI7 A;  2H73 A;  3VK9 A;  1GSS A;  2R0C A;  1T1V A;  5CP1 A;  2FWF A;  3PPU A;  2O87 A;  3WT2 A;  1A0R P;  2IWT A;  2VLV A;  2IMF A;  3FR9 A;  5IMV A;  2NTO A;  2I3Y A;  2H8L A;  1T7P B;  4GCI A;  4POM A;  1OC9 A;  4KGI A;  2HZE B;  4HZ4 A;  3TKR A;  4LL4 B;  4YKF A;  5E4W A;  2E2M A;  2B1K A;  3IHQ A;  1PL1 A;  2TIR A;  2IMI A;  2O7K A;  4BL7 A;  1SKW B;  4KH7 A;  1G7E A;  2H75 A;  1G6W A;  4HI7 A;  4JU5 A;  4JE1 A;  2FCH A;  1XW6 A;  3EE2 A;  1EZK A;  1ERW A;  2GQM A;  3F4T A;  4PQ1 A;  5KN2 A;  1DE2 A;  4MF6 A;  3SBC A;  1PFO A;  1F2E A;  4FQU A;  4ECB A;  3VWV A;  4TXO B;  1PSQ A;  1QQ2 A;  2HT9 A;  3FR6 A;  4TXV A;  3CRT A;  3GL3 A;  3V1W A;  4F82 A;  4POL A;  4KUN A;  5EY6 A;  3UAR A;  3HJO A;  3FYG A;  4GTU A;  1TXX A;  3GRX A;  3E3E A;  3GH6 A;  2HI7 A;  4IW9 A;  10GS A;  3KH9 A;  4YAV A;  2HSY A;  2C0E A;  5HQP A;  1ABA A;  3APQ A;  5CAX A;  3PR8 A;  1TOF A;  3A5I A;  3WGE A;  4DEJ A;  4QL9 A;  4IJ3 A;  4ECC A;  4FIW A;  5AIX A;  4WEY A;  1ERU A;  2VAF A;  1VF4 A;  2REM A;  9GSS A;  4K7I A;  1AAZ A;  3GH9 A;  3IRA A;  2WCI A;  2VCT A;  2DKH A;  1DSB A;  3GKX A;  4K6X A;  6GSV A;  3HZ8 A;  2YJ7 A;  1X9W B;  2LRT A;  1CQH A;  1XWG A;  2DJ3 A;  2JU5 A;  1MD3 A;  1HNB A;  1AXD A;  1AQW A;  1A0F A;  1BX9 A;  2YPM A;  3UBK A;  4ZL7 A;  1F3B A;  2LNT A;  1FVJ A;  1J0F A;  4IN0 A;  3ME7 A;  12GS A;  2MBS A;  5HR1 A;  2C8U A;  4OMV A;  2ALB A;  1V2A A;  2OA7 A;  1FOV A;  2CAQ A;  2CZ3 A;  3HVN A;  4LLR A;  2RUE A;  2LNS A;  4EDZ A;  4XHM A;  1CQG A;  3QPM A;  4EDY A;  2YJH A;  4V1A p;  4G0K A;  4TR3 A;  5EL8 A;  2NDO A;  1EV9 A;  2FWH A;  3C71 A;  1ZYE A;  2I9H A;  1M0U A;  4ZB6 A;  3BCK A;  1LBK A;  4ZL8 A;  4KDU A;  1K3O A;  5H5R A;  1SD9 A;  2C3T A;  4EXJ A;  4K0G A;  2X8C A;  3KM6 A;  1B4P A;  2A2S A;  2DC5 A;  1A23 A;  4Q5N A;  4RUV A;  4ML6 A;  1T4Z A;  2ON7 A;  4TOP A;  3J7Y k;  1GNE A;  2RUF A;  3ZFL A;  4XS4 B;  2GT6 A;  1GWC A;  4L5O A;  3GHA A;  3LG6 A;  3WGD A;  1FB6 A;  4JR4 A;  2L57 A;  3H4K A;  3TRQ A;  20GS A;  1TU8 A;  3VWW A;  1NHY A;  1UC7 A;  1XIY A;  3IC8 A;  3W8S A;  2H19 A;  4KF9 A;  1R26 A;  4L0W A;  1Y25 A;  3GUR A;  4TW5 A;  3GL5 A;  3TJG A;  1T00 A;  4EIP A;  4X43 A;  3LW9 A;  5HR0 A;  3QCP A;  4K7O A;  2MMZ A;  4V2M A;  2JSZ A;  4MH3 A;  3PGT A;  4IQ1 A;  1O8X A;  3ZIT A;  3D4M A;  2IN3 A;  1A2L A;  5CNW A;  1AUC A;  2YOI A;  3TGZ A;  3RBT A;  3FZA A;  2JZS A;  1I9D A;  3DXB A;  3F6D A;  5KN1 A;  1ERT A;  3WGX A;  2GSR A;  2B7J A;  3KCM A;  2B5Y A;  1XOA A;  4KA0 A;  5GAN D;  3VPT A;  5DVB A;  1NHO A;  3MDK A;  4XIH A;  5F0G A;  2P31 A;  3APO A;  4HQS A;  2VL9 A;  2F8F A;  3M9K A;  4NHZ A;  1HYU A;  3P7X A;  2HZF A;  4XTS A;  1K0M A;  6GST A;  1PA3 A;  2FWG A;  1A2M A;  1HNA A;  3KZQ A;  3VUR A;  1RW1 A;  4DSS B;  1XVW A;  4YQU A;  1ZYN A;  3ERF A;  3IDV A;  3LXT A;  3A5W A;  5ELA A;  3OR5 A;  3HHV A;  1AC1 A;  1NW2 A;  1TJD A;  3ZVJ D;  3H8Q A;  4KND A;  3HVX A;  2HXK A;  1TU7 A;  1ST9 A;  5CRE A;  4OCE A;  2VUP A;  3J7Y b;  2CV4 A;  2I4A A;  3IPZ A;  1BYE A;  2WS2 A;  1MDI A;  4KDY A;  4F9Z A;  1SK2 A;  4QQ7 A;  3CSH A;  3GV1 A;  4MK3 A;  1IYI A;  2X4A A;  1FVK A;  3GKK A;  4HU9 A;  2F9S A;  3HA9 A;  2QKE A;  2FA4 A;  1WPI A;  3ISO A;  1TK0 B;  5EVO A;  2X99 A;  3DYR A;  4WBR D;  3LYK A;  2RM5 A;  1K0N A;  1GSU A;  4K2X A;  3NZN A;  1PN9 A;  1ZYP A;  2DJJ A;  3C1S A;  2KOK A;  3DVW A;  4O5U A;  5ID2 B;  5ECS A;  7GSS A;  1WWJ A;  1EOH A;  2IMK A;  5A4U A;  1GSY A;  3A2W A;  2NPB A;  3IBH A;  1XFL A;  3ED3 A;  3F4S A;  1ILO A;  4J56 E;  2LUS A;  1TK8 B;  4N30 A;  2ZNM A;  4KCA A;  3GFK A;  2L4Q A;  1ZMA A;  2GTU A;  2V2G A;  4JRR A;  5D9V A;  3LJR A;  2ZUP A;  3CSJ A;  5CRD A;  5G5F A;  5CRG A;  2Z9S A;  4FYC A;  3GIX A;  4LA1 A;  4J2F A;  2GGT A;  3US3 A;  1EWX A;  1THX A;  2XBQ A;  4E8H A;  3NOF A;  4ILF A;  1QFN A;  2CQ9 A;  3D4T A;  4OCF A;  2R4V A;  2X64 A;  2E2G A;  3QAG A;  4A5P A;  2A4V A;  2G2Q A;  1JLV A;  1B9Y C;  1ZZY A;  2QSI A;  2LRN A;  5ELG A;  2N5B A;  4XRD A;  4FH8 A;  1Z6M A;  2GZY A;  3WT1 A;  2R0G A;  4G2E A;  3WYW A;  3GST A;  5D9T A;  4HJM A;  4GSN A;  3FZ5 A;  4XS6 A;  1TI3 A;  3LEF A;  1ZCP A;  2I81 A;  4ZB9 A;  3IR4 A;  1XXU A;  2DIZ A;  2KUC A;  3MIX A;  2FA8 A;  2GDR A;  2JSY A;  2N5F A;  2WB9 A;  1OC3 A;  2RM6 A;  4OFN A;  5KN0 A;  2MMN A;  3M8N A;  3C7M A;  2B1L A;  3FZ4 A;  2OAD A;  3GNJ A;  4FYB A;  2PGT A;  4I8B A;  2MZC A;  4ULX A;  4WXT A;  3UMA A;  4YQV A;  5DAK B;  5ECL B;  3QFB C;  4MCU A;  1PX6 A;  2IIY A;  3GYK A;  5BMU A;  5B7C A;  2JL4 A;  4MPF A;  2L5L A;  2XPD A;  4USS A;  3DIE A;  3RDW A;  5J3R A;  2HSM A;  3H93 A;  3Q6O A;  4ECI A;  2B3S A;  2M72 A;  1K0B A;  1VF3 A;  3G7Y A;  3ERW A;  4HJ2 A;  1PX7 A;  3Q74 A;  2V6K A;  1ZGN A;  3HVV A;  4PUR A;  5KOW A;  5HFI A;  4YH2 A;  2JAD A;  3FK8 A;  2FUG 2;  3R3E A;  1PD2 1;  2H1A A;  4H86 A;  4NXI A;  2RLI A;  1S3D A;  5ECI B;  3TRX A;  1XWK A;  3IV4 A;  3KMO A;  4HQZ A;  1QXH A;  5HR2 A;  1TDI A;  4MZW A;  1A2J A;  2AV4 A;  2K18 A;  4AGS A;  1V98 A;  4IKH A;  1TP9 A;  5AIV A;  5DJL A;  2PVQ A;  2WJU A;  3DWV A;  1C72 A;  1H4O A;  2H71 A;  2L6C A;  1Z9H A;  3HDC A;  3QDN A;  1B8X A;  5D96 A;  2VCQ A;  3O6T A;  1K0C A;  2GS3 A;  3QAV A;  1ACV A;  3O76 A;  2VCW A;  1S3C A;  3ZYW A;  3FY7 A;  4NV5 A;  3RPN A;  1OKD A;  2GLR A;  3LQ7 A;  2GST A;  5ECK B;  5DQY A;  3GKM A;  3F63 A;  2P5R A;  1SD8 A;  2OBI A;  1XW5 A;  2V6O A;  2P5Q A;  1GTU A;  2FY6 A;  2VL2 C;  4X0X A;  2VCZ A;  2XBI A;  4IVF A;  5IMC A;  4O5Q A;  4DVC A;  1SK1 A;  4K2D A;  2G0F A;  1MDK A;  1O81 A;  1A8L A;  3H79 A;  5CO3 A;  2CAI A;  4CDO A;  3GUS A;  3M0F A;  1XZO A;  2DIY A;  4GXZ A;  1X9S B;  2C0D A;  1FB0 A;  1FO5 A;  1K0A A;  4ISD A;  3TKS E;  1ZYQ B;  4BVY A;  3HD5 A;  5CRH A;  1LU4 A;  5J9B A;  1SL0 B;  2DKI A;  3UEM A;  5IIZ A;  2FHE A;  2YCD A;  2GQL A;  1Z6N A;  3RHB A;  4IQA A;  3DEX A;  3ZFB A;  5DAL A;  4NAX A;  2IFQ A;  2VM1 A;  1OC9 B;  1R5P A;  3LOR A;  2PVO C;  4TR1 A;  1USB A;  4OFM A;  2WFC A;  3G7J A;  1X9M B;  5CRW A;  2B5E A;  5FT3 A;  1U3I A;  3FEU A;  1VRS D;  5D9W A;  2LS5 A;  2DJ2 A;  5FHI A;  3RHC A;  4BL7 B;  3UL3 A;  3IAS 2;  3TJJ A;  1R4W A;  1G6Y A;  4Z7X A;  2AUV A;  1HNC A;  2C3Q A;  2YZH A;  5D9X A;  4CW9 A;  3EPT A;  4MH2 A;  1GSD A;  1N8J A;  1SJI A;  4K8M A;  1TK5 B;  5ECP B;  1F9M A;  1WIK A;  2WZ9 A;  3GX0 A;  1BAY A;  1YQ1 A;  4EF0 A;  3ZIJ A;  2R5G A;  3BBY A;  2OKA A;  1J9B A;  4L8E A;  1GH2 A;  3KEB A;  2H0G A;  3FKF A;  2VO4 A;  2YWI A;  3Q18 A;  3U5R E;  5CYY A;  6GSY A;  1I5G A;  4L5L A;  2IL3 A;  4ICY A;  4WF4 A;  1UN2 A;  1K3Y A;  2NBS A;  3JCM L;  4FO5 A;  1SJ6 A;  3ZTL A;  2R2J A;  5HFG A;  4DSR A;  1TRS A;  4BVX A;  4ZXG A;  3IK9 A;  3F8U A;  4MF7 A;  1Z7R A;  5E59 A;  3KTB A;  22GS A;  3RPP A;  4TKY A;  1HD2 A;  2V41 A;  1X0R A;  3QR6 A;  3UVH A;  5IQY A;  2BJX A;  3F3R A;  1SK0 A;  4OFT A;  1WRY A;  5AGY A;  2B7K A;  1Q4J A;  1T3B A;  2ES7 A;  3QOU A;  3M3M A;  4YKG A;  4MJB A;  4XCS A;  6GSX A;  2H72 A;  3TKS C;  5B6M A;  3EYT A;  5H5S A;  4HOJ A;  1YEP A;  3VWU A;  4GSS A;  3KP8 A;  2CVD A;  3CXG A;  4HU7 A;  2H0H A;  2BTO T;  2BMX A;  2QC7 A;  2H6Z A;  3UVT A;  8GSS A;  2X8G A;  5JWQ B;  1JZR A;  3HVS A;  1PN0 A;  2P0G A;  5G5E A;  1YEX A;  3AY8 A;  3ME8 A;  4K5S A;  2AHE A;  3HJM A;  3GX8 A;  3I6A A;  4F2I A;  2B6M A;  1SYR A;  2C0G A;  1EGR A;  5J9C A;  3CTG A;  3MYD A;  3E9J B;  3K8N A;  3GSS A;  3VI7 A;  1M9A A;  1B9X C;  1MEK A;  4G0I A;  2C4J A;  2LEG A;  1GNW A;  3TJF A;  4LMW A;  3Q19 A;  1AIU A;  5C04 A;  2F8A A;  5IOW A;  1GLP A;  2YZU A;  4IP1 A;  4D73 B;  2K6V A;  3ZLP A;  3TDG A;  5JCW A;  1XWA A;  1S3A A;  4IP6 A;  2HYX A;  2N5A A;  4WR4 A;  4HS1 A;  2MMO A;  4WF5 A;  3APS A;  4GLT A;  4PQI A;  4EKZ A;  4ZBD A;  1Z3E A;  1PQN A;  1U87 A;  2L5O A;  4RQX A;  3KTL A;  5ECH B;  4NHW A;  5B8A A;  1SYX A;  4TR0 A;  1G7O A;  4WBJ A;  5DDL A;  1K0O A;  1TW9 A;  5D73 A;  2YV7 A;  6GSU A;  4IEL A;  2A2P A;  4O32 A;  3KJY A;  3IHG A;  3MSZ A;  2KP2 A;  1J08 A;  2E7P A;  2LJR A;  5ENU A;  3PH9 A;  5AIS A;  1B4Q A;  2VM2 A;  3QAW A;  1YF1 A;  2XHF A;  4WR5 A;  4AJ8 A;  1BG5 A;  4Q5R A;  2LTK A;  2L4C A;  2ON5 A;  4QL7 A;  2H0I A;  2C0F A;  3R2Q A;  1BJX A;  4GWR A;  3TUE A;  4X1U A;  4MLY A;  3ZVJ A;  4HZ2 A;  1OYJ A;  1M99 A;  2H66 A;  3ERG A;  4ZIJ A;  3QFA C;  16GS A;  4I2U A;  2UZ8 A;  3GTU A;  4ID0 A;  3EU4 A;  4EO3 A;  3I9V 2;  1O6J A;  2K9F A;  5IMZ A;  5JWO B;  4MA9 A;  2CX3 A;  3GA4 A;  1GTA A;  3CQF A;  2FLS A;  4NV2 A;  1TKD B;  3FRC A;  2OE0 A;  3E0U A;  4G19 A;  1PGT A;  4YAP A;  1GSQ A;  5F07 A;  3HYP A;  4KB3 A;  1W4V A;  5BRT A;  4BWS A;  3VI5 A;  4O5R A;  3MWH A;  3EU3 A;  4KDX A;  1B48 A;  4PTS A;  3I69 A;  4PUA A;  2CVK A;  1T8E B;  4XRA A;  5F05 A;  1RK4 A;  1GUK A;  4KSM A;  1HQO A;  1EP7 A;  1YZX A;  4GRF A;  1UA5 A;  1E6B A;  1V9W A;  2H30 A;  1UVZ A;  4BA7 A;  4N11 A;  1JHB A;  1DE1 A;  1Z5Y E;  4K5R A;  1XBS A;  1FG4 A;  2FD3 A;  4E8E A;  2QGV A;  2PPT A;  2FWE A;  2ZCT A;  2L59 A;  4MF5 A;  2L6D A;  4HDE A;  2TRX A;  2CZ2 A;  2HZE A;  1JLW A;  2IPA A;  1R7H A;  1XG8 A;  2GSQ A;  1SEN A;  2DLX A;  2PWJ A;  1QUW A;  1EEJ A;  3DD3 A;  1BED A;  5J5N A;  3L9S A;  4GQC A;  1V58 A;  1PL2 A;  3FR3 A;  5JWR B;  4ZL9 A;  5G2Z A;  4XS1 A;  2C3N A;  1FAA A;  4ACS A;  2EIQ A;  5ECM B;  1Y6E A;  2MYG A;  2E0Q A;  2H01 A;  1JZO A;  2HRF A;  2AYT A;  2H1D A;  4EVM A;  3LGC A;  1X5D A;  4PUF C;  4I2T A;  2X8H A;  4TXO A;  2KP1 A;  5C00 A;  1DUG A;  5DQS A;  3HXS A;  1VF1 A;  3C1R A;  1M2B A;  3HZ4 A;  3UIW A;  1ML6 A;  5ECO B;  2H6Y A;  2PBJ A;  4K9Z A;  4KE3 A;  2YP6 A;  5IPH A;  2QA2 A;  1TRU A;  3EWL A;  3A3T A;  2VIM A;  2WGR A;  5GAP D;  1LJR A;  2K8V A;  2OE1 A;  3CRU A;  1SKR B;  1X5C A;  5G1K A;  5ECR B;  2VCV A;  4JZQ A;  2A2R A;  2GZZ A;  2OE3 A;  1PKW A;  3C8E A;  5A4W A;  2CVB A;  4AJ7 A;  1GP1 A;  3BD2 A;  1NSW A;  2DJ1 A;  3KP9 A;  4OD7 A;  1AW9 A;  3F9U A;  3N9J A;  4G10 A;  4P3Y B;  3ZRD A;  2WRT A;  5IO2 A;  2WDU A;  4ZBA A;  5DJM A;  3LFL A;  1V40 A;  2JZR A;  4TN8 A;  1VF2 A;  2LQO A;  1GTI A;  3F6F A;  1OKT A;  2LJA A;  3BJ5 A;  1OVN A;  4Z2U A;  1XWB A;  2VL2 A;  5F06 A;  2VL3 A;  1JZD A;  14GS A;  4MPG A;  4OO4 A;  5B6N A;  4PX1 A;  5D8I A;  2XC2 A;  5IMF A;  1E2Y A;  2GSS A;  4KSO A;  1O7U A;  2HLS A;  4JED A;  3GN3 A;  3HY2 A;  4I97 A;  5DCG A;  1SKS B;  3IA1 A;  4PNF A;  1AQV A;  4N0V A;  3GKN A;  2LJK A;  1GLQ A;  3FW2 A;  4HEA 2;  3H1N A;  2B5X A;  2FGX A;  1RQM A;  4F0B A;  1Z7P A;  5B8B A;  1A24 A;  2H70 A;  5HFK A;  2R3X A;  4BPY A;  2DJK A;  5AN1 A;  2LST A;  1YF0 A;  4GF0 A;  4HSC X;  1OC8 A;  4Z2R A;  1K0D A;  2VD0 A;  5COH A;  2DMM A;  3HCZ A;  4I5Q A;  1QGV A;  5DBQ A; 
#chains in the Genus database with same CATH homology
 4KAE A;  6GSS A;  3DKS A;  3F4R A;  3ZRE A;  5DCH A;  5H5Q A;  3FZ9 A;  3MAK A;  4JBB A;  4XS4 A;  3EC3 A;  1ZL9 A;  4EIQ A;  2FNO A;  2VLT A;  5A4V A;  2H1G A;  2A4H A;  2CA8 A;  1XW9 A;  1EP8 A;  4Z2T A;  2YNX A;  3UOM A;  2O85 A;  3TB2 A;  2HRA A;  3KH7 A;  2V32 A;  3TOU A;  4AJ6 A;  5EPF A;  1XWC A;  1SL2 B;  3VPQ A;  4O7H A;  2YV9 A;  1OE7 A;  4PQH A;  2JAC A;  1JZW A;  1SL1 B;  1H75 A;  19GS A;  1U88 A;  4G9H A;  2C80 A;  4MJC A;  5FWG A;  3VFI A;  3QMX A;  1TI1 A;  3IC4 A;  2LQQ A;  4N0Z A;  2IJY A;  2PER A;  3W8J A;  2D2Z A;  3N5O A;  4TVE A;  4GQF A;  4ZIL A;  5GST A;  1MTC A;  4IJI A;  5HR3 A;  3L78 A;  1TTZ A;  4OWY A;  1WE0 A;  4KW6 A;  2H6X A;  3L4N A;  1NM3 A;  4MP4 A;  2HSH A;  3UJ1 A;  3DGQ A;  1KEB A;  4IGJ A;  3FMW A;  4MAB A;  4EUY A;  4F0C A;  1YKC A;  1U6T A;  4WKW A;  3TKP A;  3BCI A;  1F6M C;  2GQK A;  3D6I A;  3TKS A;  1R5A A;  3CMI A;  4MDC A;  4ECJ A;  3CYN A;  3EIN A;  2YWO A;  4RQR A;  4DSQ A;  1N2A A;  1QMV A;  4D73 A;  4K7N A;  4TRX A;  2C1Y A;  3SWL A;  3WD6 A;  3D21 A;  5IPG A;  1YDK A;  4DSS A;  2J23 A;  4BVY B;  4IBP A;  3NIV A;  1F37 A;  2H74 A;  5D93 A;  3L0H A;  2H76 A;  3IAM 2;  3LXZ A;  2LRC A;  2DSA A;  1FOH A;  1GUL A;  4IHU A;  3KMN A;  3F3Q A;  1AQX A;  5DAL B;  2IFQ B;  2KHP A;  2I1U A;  1VGL A;  4TR1 B;  3GMF A;  5IMD A;  3LSZ A;  2R37 A;  1XCC A;  5G30 A;  3P90 A;  2MBT A;  3VWX A;  3ZMK A;  3LYP A;  4KCE A;  2QA1 A;  2YWN A;  1WMJ A;  4X4J A;  3ZML A;  2PUK C;  1GL8 A;  2O8V B;  2HE3 A;  1JFU A;  3HKR A;  2V1M A;  4LL1 B;  3ZL5 A;  2IMD A;  5KN3 A;  4N10 A;  4MMM A;  2EIR A;  5KEJ A;  2R0P A;  2KLX A;  1O73 A;  2CT6 A;  3A2X A;  3M1G A;  2HNL A;  1EOG A;  1GSF A;  3D5J A;  1WOU A;  1EEM A;  1PRX A;  5A5K A;  4POB A;  5ID2 A;  4RI6 A;  2LV3 A;  2EC4 A;  4PNG A;  1K3L A;  4PXO A;  3IE3 A;  4BVX B;  3D0Z A;  1BQ7 A;  1XPV A;  3D22 A;  2VD1 A;  2RII A;  5G31 A;  1GUH A;  1GUM A;  1EGO A;  2WUL A;  4L0U A;  4CHS A;  4ZB8 A;  1QK8 A;  11GS A;  2CX4 A;  3RAZ A;  1TRW A;  3EUR A;  2VCX A;  2X49 A;  5INY A;  1FHE A;  2TRC P;  4Q5F A;  17GS A;  5KOX A;  4O92 A;  3IOS A;  5LNK e;  5LCZ A;  1G0T A;  2PMT A;  4EC0 A;  1TRV A;  1Q98 A;  2DML A;  3F0I A;  3TOT A;  2F3M A;  2O89 A;  4GST A;  5J41 A;  2AJQ B;  2HFD A;  2OJL A;  3S9F A;  1IYH A;  4MZC A;  4KX4 A;  1T4Y A;  2M80 A;  3KIJ A;  3CSI A;  2R6K A;  3VLN A;  5JCU A;  1U3A A;  2H1B A;  3P8W A;  1A8Y A;  3TJB A;  3EMP A;  1MDJ A;  4LMV A;  1XOB A;  3QD9 A;  4Q5Q A;  4NPB A;  3UAP A;  3PIN A;  3CTF A;  4MZB A;  3ZZX A;  5ECN B;  2YAN A;  3TJK A;  1KTE A;  4F03 A;  2DBC A;  5G1L A;  4EL1 A;  4OO5 A;  1THO A;  3KGK A;  4ZBB A;  1YJ6 A;  5DAK A;  2OAC A;  3TKQ A;  1KBN A;  1GSE A;  5IMA A;  4I6X A;  1X5E A;  1W89 A;  4V1A g;  1ON4 A;  3TCO A;  3KD0 A;  4K1F A;  2LKU A;  4PGT A;  1PKZ A;  3G9B A;  2IME A;  1M2D A;  13GS A;  4JR6 A;  6GSW A;  1YY7 A;  1DBY A;  2HRK A;  3KXO A;  2NVL A;  3A2V A;  5F8B A;  3L9V A;  3FHK A;  3DRN A;  1F3A A;  5ABR A;  2PU9 C;  4K0N A;  1OE8 A;  3DVX A;  1WJK A;  4V2L A;  3EVI A;  2XPE A;  2M46 A;  4MJA A;  4MNN A;  1SU9 A;  1GTB A;  3I43 A;  5LD0 A;  1V57 A;  4NWY A;  4J57 E;  2GVP A;  3UBL A;  5JCG A;  3TRP A;  1M2A A;  3L9U A;  5IO0 A;  4BWQ A;  3CBU A;  2VOC A;  4G0L A;  3IK7 A;  1O8W A;  1YKA A;  4TR4 A;  4HUA A;  5J4U A;  2PN8 A;  4IS0 A;  2DJ0 A;  3HJP A;  2MMA A;  5IM9 A;  1XVQ A;  4WET A;  2VLU A;  4CY6 A;  2YN1 A;  1M9B A;  3GTU B;  5IOX A;  5GSS A;  3ZIV A;  2OBK A;  1FW1 A;  2F51 A;  3M9J A;  5GZZ B;  1SJZ A;  1M7T A;  4POK A;  3C73 A;  5L71 A;  4EE0 A;  2EIO A;  2AAW A;  3G7I A;  3O3T A;  1EV4 A;  2JZT A;  3U6V A;  1ZOF A;  2J9H A;  4FYU A;  4AF2 A;  4V2N A;  2HRN A;  2GT5 A;  1WP0 A;  18GS A;  3P2A A;  4NMU A;  2YWM A;  4MJE A;  4CY8 A;  2K8S A;  1MD4 A;  1PMT A;  1ERV A;  3MNG A;  2GZP A;  3EMX A;  4ML1 A;  4YQM A;  3W6G A;  3IXR A;  3LWA A;  1GRX A;  5ECQ B;  3DML A;  3BOA A;  1URM A;  1O85 A;  1KNG A;  2AB6 A;  1OAZ A;  4RI7 A;  2H73 A;  3VK9 A;  1GSS A;  2R0C A;  1T1V A;  5CP1 A;  2FWF A;  3PPU A;  2O87 A;  3WT2 A;  1A0R P;  2IWT A;  2VLV A;  2IMF A;  3FR9 A;  5IMV A;  2NTO A;  2I3Y A;  2H8L A;  1T7P B;  4GCI A;  4POM A;  1OC9 A;  4KGI A;  2HZE B;  4HZ4 A;  3TKR A;  4LL4 B;  4YKF A;  5E4W A;  2E2M A;  2B1K A;  3IHQ A;  1PL1 A;  2TIR A;  2IMI A;  2O7K A;  4BL7 A;  1SKW B;  4KH7 A;  1G7E A;  2H75 A;  1G6W A;  4HI7 A;  4JU5 A;  4JE1 A;  2FCH A;  1XW6 A;  3EE2 A;  1EZK A;  1ERW A;  2GQM A;  3F4T A;  4PQ1 A;  5KN2 A;  1DE2 A;  4MF6 A;  3SBC A;  1F2E A;  4FQU A;  4ECB A;  3VWV A;  4TXO B;  1PSQ A;  1QQ2 A;  2HT9 A;  3FR6 A;  4TXV A;  3CRT A;  3GL3 A;  3V1W A;  4F82 A;  4POL A;  4KUN A;  5EY6 A;  3UAR A;  3HJO A;  3FYG A;  4GTU A;  1TXX A;  3GRX A;  3E3E A;  3GH6 A;  2HI7 A;  4IW9 A;  10GS A;  3KH9 A;  4YAV A;  2HSY A;  2C0E A;  5HQP A;  1ABA A;  3APQ A;  5CAX A;  3PR8 A;  1TOF A;  3A5I A;  3WGE A;  4DEJ A;  4QL9 A;  4IJ3 A;  4ECC A;  4FIW A;  5AIX A;  4WEY A;  1ERU A;  2VAF A;  1VF4 A;  2REM A;  9GSS A;  4K7I A;  1AAZ A;  3GH9 A;  3IRA A;  2WCI A;  2VCT A;  2DKH A;  1DSB A;  3GKX A;  4K6X A;  6GSV A;  3HZ8 A;  2YJ7 A;  1X9W B;  2LRT A;  1CQH A;  1XWG A;  2DJ3 A;  2JU5 A;  1MD3 A;  1HNB A;  1AXD A;  1AQW A;  1A0F A;  1BX9 A;  2YPM A;  3UBK A;  4ZL7 A;  1F3B A;  2LNT A;  1FVJ A;  1J0F A;  4IN0 A;  3ME7 A;  12GS A;  2MBS A;  5HR1 A;  2C8U A;  4OMV A;  2ALB A;  1V2A A;  2OA7 A;  1FOV A;  2CAQ A;  2CZ3 A;  4LLR A;  2RUE A;  2LNS A;  4EDZ A;  4XHM A;  1CQG A;  3QPM A;  4EDY A;  2YJH A;  4V1A p;  4G0K A;  4TR3 A;  5EL8 A;  2NDO A;  1EV9 A;  2FWH A;  3C71 A;  1ZYE A;  2I9H A;  1M0U A;  4ZB6 A;  3BCK A;  1LBK A;  4ZL8 A;  4KDU A;  1K3O A;  5H5R A;  1SD9 A;  2C3T A;  4EXJ A;  4K0G A;  2X8C A;  3KM6 A;  1B4P A;  2A2S A;  2DC5 A;  1A23 A;  4Q5N A;  4RUV A;  4ML6 A;  1T4Z A;  2ON7 A;  4TOP A;  3J7Y k;  1GNE A;  2RUF A;  3ZFL A;  4XS4 B;  2GT6 A;  1GWC A;  4L5O A;  3GHA A;  3LG6 A;  3WGD A;  1FB6 A;  4JR4 A;  2L57 A;  3H4K A;  3TRQ A;  20GS A;  1TU8 A;  3VWW A;  1NHY A;  1UC7 A;  1XIY A;  3IC8 A;  3W8S A;  2H19 A;  4KF9 A;  1R26 A;  4L0W A;  1Y25 A;  3GUR A;  4TW5 A;  3GL5 A;  3TJG A;  1T00 A;  4EIP A;  4X43 A;  3LW9 A;  5HR0 A;  3QCP A;  4K7O A;  2MMZ A;  4V2M A;  2JSZ A;  4MH3 A;  3PGT A;  4IQ1 A;  1O8X A;  3ZIT A;  3D4M A;  2IN3 A;  1A2L A;  5CNW A;  1AUC A;  2YOI A;  3TGZ A;  3RBT A;  3FZA A;  2JZS A;  1I9D A;  3DXB A;  3F6D A;  5KN1 A;  1ERT A;  3WGX A;  2GSR A;  2B7J A;  3KCM A;  2B5Y A;  1XOA A;  4KA0 A;  5GAN D;  3VPT A;  5DVB A;  1NHO A;  3MDK A;  4XIH A;  5F0G A;  2P31 A;  3APO A;  4HQS A;  2VL9 A;  2F8F A;  3M9K A;  4NHZ A;  1HYU A;  3P7X A;  2HZF A;  4XTS A;  1K0M A;  6GST A;  1PA3 A;  2FWG A;  1A2M A;  1HNA A;  3KZQ A;  3VUR A;  1RW1 A;  4DSS B;  1XVW A;  4YQU A;  1ZYN A;  3ERF A;  3IDV A;  3LXT A;  3A5W A;  5ELA A;  3OR5 A;  3HHV A;  1AC1 A;  1NW2 A;  1TJD A;  3ZVJ D;  3H8Q A;  4KND A;  3HVX A;  2HXK A;  1TU7 A;  1ST9 A;  5CRE A;  4OCE A;  2VUP A;  3J7Y b;  2CV4 A;  2I4A A;  3IPZ A;  1BYE A;  2WS2 A;  1MDI A;  4KDY A;  4F9Z A;  1SK2 A;  4QQ7 A;  3CSH A;  3GV1 A;  4MK3 A;  1IYI A;  2X4A A;  1FVK A;  3GKK A;  4HU9 A;  2F9S A;  3HA9 A;  2QKE A;  2FA4 A;  1WPI A;  3ISO A;  1TK0 B;  5EVO A;  2X99 A;  3DYR A;  4WBR D;  3LYK A;  2RM5 A;  1K0N A;  1GSU A;  4K2X A;  3NZN A;  1PN9 A;  1ZYP A;  2DJJ A;  3C1S A;  2KOK A;  3DVW A;  4O5U A;  5ID2 B;  5ECS A;  7GSS A;  1WWJ A;  1EOH A;  2IMK A;  5A4U A;  1GSY A;  3A2W A;  2NPB A;  3IBH A;  1XFL A;  3ED3 A;  3F4S A;  1ILO A;  4J56 E;  2LUS A;  1TK8 B;  4N30 A;  2ZNM A;  4KCA A;  3GFK A;  2L4Q A;  1ZMA A;  2GTU A;  2V2G A;  4JRR A;  5D9V A;  3LJR A;  2ZUP A;  3CSJ A;  5CRD A;  5G5F A;  5CRG A;  2Z9S A;  4FYC A;  3GIX A;  4LA1 A;  4J2F A;  2GGT A;  3US3 A;  1EWX A;  1THX A;  2XBQ A;  4E8H A;  3NOF A;  4ILF A;  1QFN A;  2CQ9 A;  3D4T A;  4OCF A;  2R4V A;  2X64 A;  2E2G A;  3QAG A;  4A5P A;  2A4V A;  2G2Q A;  1JLV A;  1B9Y C;  1ZZY A;  2QSI A;  2LRN A;  5ELG A;  2N5B A;  4XRD A;  4FH8 A;  1Z6M A;  2GZY A;  3WT1 A;  2R0G A;  4G2E A;  3WYW A;  3GST A;  5D9T A;  4HJM A;  4GSN A;  3FZ5 A;  4XS6 A;  1TI3 A;  3LEF A;  1ZCP A;  2I81 A;  4ZB9 A;  3IR4 A;  1XXU A;  2DIZ A;  2KUC A;  3MIX A;  2FA8 A;  2GDR A;  2JSY A;  2N5F A;  2WB9 A;  1OC3 A;  2RM6 A;  4OFN A;  5KN0 A;  2MMN A;  3M8N A;  3C7M A;  2B1L A;  3FZ4 A;  2OAD A;  3GNJ A;  4FYB A;  2PGT A;  4I8B A;  2MZC A;  4ULX A;  4WXT A;  3UMA A;  4YQV A;  5DAK B;  5ECL B;  3QFB C;  4MCU A;  1PX6 A;  2IIY A;  3GYK A;  5BMU A;  5B7C A;  2JL4 A;  4MPF A;  2L5L A;  2XPD A;  4USS A;  3DIE A;  3RDW A;  5J3R A;  2HSM A;  3H93 A;  3Q6O A;  4ECI A;  2B3S A;  2M72 A;  1K0B A;  1VF3 A;  3G7Y A;  3ERW A;  4HJ2 A;  1PX7 A;  3Q74 A;  2V6K A;  1ZGN A;  3HVV A;  4PUR A;  5KOW A;  5HFI A;  4YH2 A;  2JAD A;  3FK8 A;  2FUG 2;  3R3E A;  1PD2 1;  2H1A A;  4H86 A;  4NXI A;  2RLI A;  1S3D A;  5ECI B;  3TRX A;  1XWK A;  3IV4 A;  3KMO A;  4HQZ A;  1QXH A;  5HR2 A;  1TDI A;  4MZW A;  1A2J A;  2AV4 A;  2K18 A;  4AGS A;  1V98 A;  4IKH A;  1TP9 A;  5AIV A;  5DJL A;  2PVQ A;  2WJU A;  3DWV A;  1C72 A;  1H4O A;  2H71 A;  2L6C A;  1Z9H A;  3HDC A;  3QDN A;  1B8X A;  5D96 A;  2VCQ A;  3O6T A;  1K0C A;  2GS3 A;  3QAV A;  1ACV A;  3O76 A;  2VCW A;  1S3C A;  3ZYW A;  3FY7 A;  4NV5 A;  3RPN A;  1OKD A;  2GLR A;  3LQ7 A;  2GST A;  5ECK B;  5DQY A;  3GKM A;  3F63 A;  2P5R A;  1SD8 A;  2OBI A;  1XW5 A;  2V6O A;  2P5Q A;  1GTU A;  2FY6 A;  2VL2 C;  4X0X A;  2VCZ A;  2XBI A;  4IVF A;  5IMC A;  4O5Q A;  4DVC A;  1SK1 A;  4K2D A;  2G0F A;  1MDK A;  1O81 A;  1A8L A;  3H79 A;  5CO3 A;  2CAI A;  4CDO A;  3GUS A;  3M0F A;  1XZO A;  2DIY A;  4GXZ A;  1X9S B;  2C0D A;  1FB0 A;  1FO5 A;  1K0A A;  4ISD A;  3TKS E;  1ZYQ B;  4BVY A;  3HD5 A;  5CRH A;  1LU4 A;  5J9B A;  1SL0 B;  2DKI A;  3UEM A;  5IIZ A;  2FHE A;  2YCD A;  2GQL A;  1Z6N A;  3RHB A;  4IQA A;  3DEX A;  3ZFB A;  5DAL A;  4NAX A;  2IFQ A;  2VM1 A;  1OC9 B;  1R5P A;  3LOR A;  2PVO C;  4TR1 A;  1USB A;  4OFM A;  2WFC A;  3G7J A;  1X9M B;  5CRW A;  2B5E A;  5FT3 A;  1U3I A;  3FEU A;  1VRS D;  5D9W A;  2LS5 A;  2DJ2 A;  5FHI A;  3RHC A;  4BL7 B;  3UL3 A;  3IAS 2;  3TJJ A;  1R4W A;  1G6Y A;  4Z7X A;  2AUV A;  1HNC A;  2C3Q A;  2YZH A;  5D9X A;  4CW9 A;  3EPT A;  4MH2 A;  1GSD A;  1N8J A;  1SJI A;  4K8M A;  1TK5 B;  5ECP B;  1F9M A;  1WIK A;  2WZ9 A;  3GX0 A;  1BAY A;  1YQ1 A;  4EF0 A;  3ZIJ A;  2R5G A;  3BBY A;  2OKA A;  1J9B A;  4L8E A;  1GH2 A;  3KEB A;  2H0G A;  3FKF A;  2VO4 A;  2YWI A;  3Q18 A;  3U5R E;  5CYY A;  6GSY A;  1I5G A;  4L5L A;  2IL3 A;  4ICY A;  4WF4 A;  1UN2 A;  1K3Y A;  2NBS A;  3JCM L;  4FO5 A;  1SJ6 A;  3ZTL A;  2R2J A;  5HFG A;  4DSR A;  1TRS A;  4BVX A;  4ZXG A;  3IK9 A;  3F8U A;  4MF7 A;  1Z7R A;  5E59 A;  3KTB A;  22GS A;  3RPP A;  4TKY A;  1HD2 A;  2V41 A;  1X0R A;  3QR6 A;  3UVH A;  5IQY A;  2BJX A;  3F3R A;  1SK0 A;  4OFT A;  1WRY A;  5AGY A;  2B7K A;  1Q4J A;  1T3B A;  2ES7 A;  3QOU A;  3M3M A;  4YKG A;  4MJB A;  4XCS A;  6GSX A;  2H72 A;  3TKS C;  5B6M A;  3EYT A;  5H5S A;  4HOJ A;  1YEP A;  3VWU A;  4GSS A;  3KP8 A;  2CVD A;  3CXG A;  4HU7 A;  2H0H A;  2BTO T;  2BMX A;  2QC7 A;  2H6Z A;  3UVT A;  8GSS A;  2X8G A;  5JWQ B;  1JZR A;  3HVS A;  1PN0 A;  2P0G A;  5G5E A;  1YEX A;  3AY8 A;  3ME8 A;  4K5S A;  2AHE A;  3HJM A;  3GX8 A;  3I6A A;  4F2I A;  2B6M A;  1SYR A;  2C0G A;  1EGR A;  5J9C A;  3CTG A;  3MYD A;  3E9J B;  3K8N A;  3GSS A;  3VI7 A;  1M9A A;  1B9X C;  1MEK A;  4G0I A;  2C4J A;  2LEG A;  1GNW A;  3TJF A;  4LMW A;  3Q19 A;  1AIU A;  5C04 A;  2F8A A;  5IOW A;  1GLP A;  2YZU A;  4IP1 A;  4D73 B;  2K6V A;  3ZLP A;  3TDG A;  5JCW A;  1XWA A;  1S3A A;  4IP6 A;  2HYX A;  2N5A A;  4WR4 A;  4HS1 A;  2MMO A;  4WF5 A;  3APS A;  4GLT A;  4PQI A;  4EKZ A;  4ZBD A;  1Z3E A;  1PQN A;  1U87 A;  2L5O A;  4RQX A;  3KTL A;  5ECH B;  4NHW A;  5B8A A;  1SYX A;  4TR0 A;  1G7O A;  4WBJ A;  5DDL A;  1K0O A;  1TW9 A;  5D73 A;  2YV7 A;  6GSU A;  4IEL A;  2A2P A;  4O32 A;  3KJY A;  3IHG A;  3MSZ A;  2KP2 A;  1J08 A;  2E7P A;  2LJR A;  5ENU A;  3PH9 A;  5AIS A;  1B4Q A;  2VM2 A;  3QAW A;  1YF1 A;  2XHF A;  4WR5 A;  4AJ8 A;  1BG5 A;  4Q5R A;  2LTK A;  2L4C A;  2ON5 A;  4QL7 A;  2H0I A;  2C0F A;  3R2Q A;  1BJX A;  4GWR A;  3TUE A;  4X1U A;  4MLY A;  3ZVJ A;  4HZ2 A;  1OYJ A;  1M99 A;  2H66 A;  3ERG A;  4ZIJ A;  3QFA C;  16GS A;  4I2U A;  2UZ8 A;  3GTU A;  4ID0 A;  3EU4 A;  4EO3 A;  3I9V 2;  1O6J A;  2K9F A;  5IMZ A;  5JWO B;  4MA9 A;  2CX3 A;  3GA4 A;  1GTA A;  2FLS A;  4NV2 A;  1TKD B;  3FRC A;  2OE0 A;  3E0U A;  4G19 A;  1PGT A;  4YAP A;  1GSQ A;  5F07 A;  3HYP A;  4KB3 A;  1W4V A;  5BRT A;  4BWS A;  3VI5 A;  4O5R A;  3MWH A;  3EU3 A;  4KDX A;  1B48 A;  4PTS A;  3I69 A;  4PUA A;  2CVK A;  1T8E B;  4XRA A;  5F05 A;  1RK4 A;  1GUK A;  4KSM A;  1HQO A;  1EP7 A;  1YZX A;  4GRF A;  1UA5 A;  1E6B A;  1V9W A;  2H30 A;  1UVZ A;  4BA7 A;  4N11 A;  1JHB A;  1DE1 A;  1Z5Y E;  4K5R A;  1XBS A;  1FG4 A;  2FD3 A;  4E8E A;  2QGV A;  2PPT A;  2FWE A;  2ZCT A;  2L59 A;  4MF5 A;  2L6D A;  4HDE A;  2TRX A;  2CZ2 A;  2HZE A;  1JLW A;  2IPA A;  1R7H A;  2GSQ A;  1SEN A;  2DLX A;  2PWJ A;  1QUW A;  1EEJ A;  3DD3 A;  1BED A;  5J5N A;  3L9S A;  4GQC A;  1V58 A;  1PL2 A;  3FR3 A;  5JWR B;  4ZL9 A;  5G2Z A;  4XS1 A;  2C3N A;  1FAA A;  4ACS A;  2EIQ A;  5ECM B;  1Y6E A;  2MYG A;  2E0Q A;  2H01 A;  1JZO A;  2HRF A;  2AYT A;  2H1D A;  4EVM A;  3LGC A;  1X5D A;  4PUF C;  4I2T A;  2X8H A;  4TXO A;  2KP1 A;  5C00 A;  1DUG A;  5DQS A;  3HXS A;  1VF1 A;  3C1R A;  1M2B A;  3HZ4 A;  3UIW A;  1ML6 A;  5ECO B;  2H6Y A;  2PBJ A;  4K9Z A;  4KE3 A;  2YP6 A;  5IPH A;  2QA2 A;  1TRU A;  3EWL A;  3A3T A;  2VIM A;  2WGR A;  5GAP D;  1LJR A;  2K8V A;  2OE1 A;  3CRU A;  1SKR B;  1X5C A;  5G1K A;  5ECR B;  2VCV A;  4JZQ A;  2A2R A;  2GZZ A;  2OE3 A;  1PKW A;  3C8E A;  5A4W A;  2CVB A;  4AJ7 A;  1GP1 A;  3BD2 A;  1NSW A;  2DJ1 A;  3KP9 A;  4OD7 A;  1AW9 A;  3F9U A;  3N9J A;  4G10 A;  4P3Y B;  3ZRD A;  2WRT A;  5IO2 A;  2WDU A;  4ZBA A;  5DJM A;  3LFL A;  1V40 A;  2JZR A;  4TN8 A;  1VF2 A;  2LQO A;  1GTI A;  3F6F A;  1OKT A;  2LJA A;  3BJ5 A;  1OVN A;  4Z2U A;  1XWB A;  2VL2 A;  5F06 A;  2VL3 A;  1JZD A;  14GS A;  4MPG A;  4OO4 A;  5B6N A;  4PX1 A;  5D8I A;  2XC2 A;  5IMF A;  1E2Y A;  2GSS A;  4KSO A;  1O7U A;  2HLS A;  4JED A;  3GN3 A;  3HY2 A;  4I97 A;  5DCG A;  1SKS B;  3IA1 A;  4PNF A;  1AQV A;  4N0V A;  3GKN A;  2LJK A;  1GLQ A;  3FW2 A;  4HEA 2;  3H1N A;  2B5X A;  2FGX A;  1RQM A;  4F0B A;  1Z7P A;  5B8B A;  1A24 A;  2H70 A;  5HFK A;  2R3X A;  4BPY A;  2DJK A;  5AN1 A;  2LST A;  1YF0 A;  4GF0 A;  1OC8 A;  4Z2R A;  1K0D A;  2VD0 A;  5COH A;  2DMM A;  3HCZ A;  4I5Q A;  1QGV A;  5DBQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...