4F82A

X-ray crystal structure of a putative thioredoxin reductase from burkholderia cenocepacia
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
171
structure length
171
Chain Sequence
HHHMIQVGDALPDAQLFEFIDDAREGCTLGPNACSVRDQVAGKRVVIFGLPGAFTPTCSAQHVPGYVEHAEQLRAAGIDEIWCVSVNDAFVMGAWGRDLHTAGKVRMMADGSAAFTHALGLTQDLSARGMGIRSLRYAMVIDGGVVKTLAVEAPGKFEVSDAASVLATLTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Thioredoxin Reductase
publication title X-ray crystal structure of a putative thioredoxin reductase from Burkholderia cenocepacia
rcsb
source organism Burkholderia cenocepacia
total genus 46
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08534 Redoxin Redoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4f82A00
5ECSA 4HQSA 2HRFA 4Q5FA 3LORA 5JWOB 1TTZA 2J23A 2R2JA 4N0ZA 4HU9A 2CVDA 4OO4A 4MDCA 1G7EA 4E8HA 3W8JA 4TXOA 4IN0A 2ZCTA 3QD9A 3V1WA 3ZMLA 2C0DA 2OBKA 3IAS2 2YJHA 1Y6EA 3HCZA 2VLUA 4MF5A 4V2MA 4GXZA 1DE2A 3P7XA 4K7OA 3SWLA 3P90A 5HR0A 4EUYA 1YEPA 2EC4A 1GTUA 4BPYA 2VL2A 1X5CA 4HZ2A 2AAWA 2EIOA 2YCDA 1F6MC 1PX6A 3D0ZA 2H0GA 2IIYA 1GSUA 1XWBA 4WXTA 4Q5NA 1YKCA 2C3QA 2O8VB 2FA4A 2BTOT 3L9UA 2HXKA 3M9KA 5H5RA 2C1YA 5IPGA 2TRXA 3P8WA 2I3YA 2CQ9A 2IWTA 5DALB 3ERWA 4IQAA 3WT1A 4LL4B 1S3DA 3IDVA 1Z6MA 3H8QA 4G2EA 3U6VA 3EC3A 4TKYA 3C1SA 5IIZA 3C1RA 1G6YA 4ECIA 1PSQA 3EYTA 1LU4A 4JBBA 1U3IA 1JLVA 3IR4A 5G1LA 2XPDA 4AJ7A 5IO0A 11GSA 3FZ5A 1PD21 1GTAA 1XOAA 2VLTA 5C04A 3LYKA 4GWRA 2C0EA 2C3TA 3FZ4A 3HVVA 3Q6OA 4HZ4A 5KN1A 1NM3A 3D6IA 5HQPA 4OFNA 4BVXA 2VCVA 3RHBA 1NHOA 1FO5A 1EGRA 1X9MB 2E7PA 2JADA 3UIWA 1URMA 1GSYA 12GSA 1PMTA 1K3YA 4F9ZA 1G0TA 4JZQA 2ALBA 5DVBA 5DAKB 3CTGA 2B5YA 4DVCA 5KN3A 5JCWA 1GTIA 3RPNA 3HJOA 5ECHB 4PNGA 1F9MA 3G7IA 2H73A 3LQ7A 2JZTA 5D9WA 2OKAA 5AIVA 2X8GA 2KP2A 3A3TA 4L8EA 4EO3A 5CRGA 2C8UA 2YOIA 4IJ3A 4TXVA 1YF1A 2PBJA 4K9ZA 3DXBA 2HI7A 9GSSA 3FY7A 4WR5A 4YQUA 1G6WA 2H76A 1Y25A 3NIVA 2PPTA 3D22A 4NV5A 5LNKe 4K8MA 1M2AA 2XBQA 2YWOA 2GVPA 2IJYA 3DRNA 3LXTA 2VM2A 2NDOA 2WRTA 2VCZA 1SU9A 2GQLA 4HJ2A 1HNBA 2QGVA 3GX0A 2HE3A 1H4OA 2NVLA 2WFCA 1T4ZA 1S3CA 5CO3A 2HZFA 3I6AA 2X8HA 4QL9A 3GA4A 3CBUA 5G2ZA 2V41A 1PKWA 4V1Ag 3D5JA 5AGYA 4ZBBA 4MH2A 1OKDA 3BCKA 1JZOA 1SD8A 4MABA 2A4VA 2ON5A 3E9JB 5ECQB 4KX4A 3WGDA 2LEGA 2H70A 2IMFA 1VF1A 3CTFA 1GLPA 2DJ3A 5DDLA 1A0FA 4KCEA 3VK9A 2VL2C 1BJXA 4EVMA 4O5RA 1ZYEA 2DJ2A 4HS1A 3F6DA 4KE3A 2LRCA 3E0UA 4GLTA 3P2AA 1FW1A 5DALA 1T3BA 1PQNA 3WYWA 1EV4A 1JLWA 3KM6A 4ZILA 2OADA 1ST9A 2DJKA 2RM6A 3ZFLA 2FWHA 4MLYA 5F06A 3D4MA 2H1AA 1WOUA 2V6OA 2IFQB 1BG5A 3VPQA 5EL8A 1U3AA 2I9HA 3KZQA 3CSIA 1TP9A 4LL1B 2CZ3A 3WT2A 3ED3A 1ERUA 5HFGA 1BAYA 2VOCA 4PQ1A 3BD2A 2VD1A 4OD7A 3G9BA 2PWJA 1TXXA 2IPAA 5H5SA 2LNSA 1A8YA 3Q74A 3HD5A 2TIRA 4ID0A 4WETA 4ECBA 2YV7A 3US3A 5B6MA 1FB0A 3H4KA 5CNWA 2C0GA 2GSSA 4ZL9A 3FEUA 4FYUA 3GH9A 2DSAA 5ENUA 4HQZA 4TW5A 1AW9A 3LFLA 2PUKC 1M2BA 3I9V2 5DAKA 2VAFA 2MBTA 1Q98A 2AB6A 3F3QA 4DEJA 2HLSA 1ERTA 4Q5QA 1A23A 2AV4A 3IPZA 4HOJA 4MCUA 3F8UA 3DIEA 1M9AA 1TI1A 2WB9A 2L6CA 3F4RA 1IYIA 4RI6A 5A4WA 4F0BA 2NBSA 3UEMA 3I43A 4LA1A 5CYYA 4MJCA 4EDYA 5ECOB 2K8VA 1SJIA 1SL2B 5D93A 2CT6A 1XOBA 4K7NA 3GMFA 4MH3A 2GZYA 7GSSA 4IGJA 1USBA 2F3MA 2IMIA 1A24A 4JR4A 2GZPA 4V2NA 1J9BA 2CV4A 3GTUB 4ZB6A 4OFMA 1SL0B 1ZZYA 2VCQA 2LS5A 1AQWA 1DUGA 3TUEA 3UVTA 1GUHA 4L0WA 1AQVA 2REMA 3KTBA 3UJ1A 6GSYA 3GUSA 3ISOA 2CVBA 3CRUA 3M1GA 4TR0A 1SYXA 1VF2A 1THOA 1TDIA 4O7HA 2L4QA 4OFTA 4LMVA 1XPVA 1PL1A 3FZ9A 4GQFA 4F82A 1VF3A 3VWUA 1ERVA 2EIRA 4PNFA 3ME7A 1PX7A 5ELAA 1SL1B 2CVKA 1GH2A 2CZ2A 4KCAA 5LCZA 4BA7A 3RDWA 2VUPA 1A2MA 6GSUA 5AISA 1DSBA 3W6GA 4MZWA 2B7JA 2H66A 1XW5A 4PGTA 2IFQA 2GLRA 1R4WA 4XS6A 3GHAA 1BQ7A 3D21A 2RUFA 3KMNA 2HYXA 3KEBA 1NHYA 1WRYA 1Z6NA 4MJAA 1MD4A 5FWGA 3TB2A 3F9UA 4WR4A 4KB3A 5J4UA 4HI7A 1QQ2A 1TKDB 2IL3A 2IMEA 3HHVA 2JSZA 4GQCA 1MDIA 3ZMKA 3FK8A 4PX1A 5D9TA 5E59A 5ABRA 2DIZA 4FH8A 2I1UA 5ECPB 5F0GA 4F03A 5G30A 1JZDA 4P3YB 2BMXA 4I97A 3UVHA 2KLXA 2H1BA 5IO2A 3DVXA 2H19A 1SD9A 5L71A 3M8NA 2V2GA 3HVXA 1YKAA 2WJUA 5D9VA 4WEYA 1SJZA 3IA1A 4HEA2 5JCUA 1FG4A 1V58A 4K7IA 3Q18A 4ULXA 1AUCA 2H8LA 3DVWA 3GURA 5CRDA 2FGXA 4MP4A 1C72A 3TKRA 1YDKA 1AIUA 5FT3A 2RUEA 4POBA 1HYUA 1O8XA 2GQKA 1V2AA 5IM9A 1TRSA 1JFUA 2MMNA 1F37A 4QQ7A 3J7Yk 2AUVA 5ECRB 4RUVA 4CW9A 5G1KA 4EE0A 3L0HA 1PL2A 1JZWA 3DWVA 2OACA 1TRUA 4G10A 3PH9A 1X9SB 1A8LA 1ZGNA 3GTUA 2GDRA 1OE7A 1ERWA 2M72A 4IP6A 1CQGA 3NZNA 3QFAC 3GSTA 1KBNA 5IMCA 2H75A 3GKXA 2LRNA 2WDUA 2VCXA 4GCIA 2FLSA 2DC5A 2H6YA 2MZCA 4E8EA 4JR6A 3KH7A 4D73B 6GSXA 3LYPA 3SBCA 3S9FA 1GSFA 2IMKA 2FY6A 5DCGA 1XIYA 1DBYA 2LTKA 4POKA 2LKUA 4CDOA 5J9CA 5CAXA 2G0FA 4AGSA 1TU8A 4RQXA 3GKKA 5G5FA 4MZBA 4ZL8A 1OC3A 3APSA 2I81A 5JWRB 1SK0A 2XPEA 3TGZA 3QAWA 3GL5A 4ILFA 5ECNB 2NPBA 3I69A 1M0UA 5EY6A 3QAVA 1U88A 1OAZA 1ZYQB 2H74A 2RIIA 2X99A 5D73A 4TR1B 3UBLA 1GP1A 1XVWA 3A5WA 13GSA 4WF4A 5KEJA 2KOKA 4ZBAA 1Z9HA 2GS3A 4IP1A 1SK2A 1GRXA 2ZNMA 4Q5RA 4I6XA 2R37A 1K3LA 1ON4A 4EXJA 2F8AA 1ML6A 1EOGA 4WBJA 1H75A 3E3EA 3HY2A 2H30A 4AJ6A 3VWWA 4ZB8A 1M7TA 3HZ4A 1NW2A 1AQXA 1TRWA 2EIQA 1FOVA 1EP7A 4DSSB 1T4YA 3MWHA 3CYNA 1QXHA 3HJMA 4X0XA 1HNAA 2WGRA 1I9DA 3GX8A 2L5OA 4KSMA 2P5QA 1GNEA 5C00A 3OR5A 3BOAA 3GFKA 4XS4B 3MNGA 3VFIA 2KUCA 5J5NA 3TJFA 3O6TA 3C73A 3GYKA 5G5EA 4ZB9A 1JHBA 3FR3A 1XBSA 3F6FA 5CREA 4MK3A 4J56E 2CX3A 1T1VA 1XVQA 4POLA 1B9XC 3W8SA 5DJMA 2DIYA 2YZUA 5IPHA 4KSOA 3VLNA 4O92A 2JSYA 2R4VA 2PU9C 2C3NA 3ZIJA 4F2IA 5GAPD 1U6TA 3LEFA 3TJJA 1S3AA 3IE3A 2C80A 4F0CA 3KP9A 1TI3A 1A0RP 1K0BA 4HU7A 1XFLA 3L9VA 1GSDA 4KDUA 3G7JA 4D73A 1ACVA 4N30A 4LLRA 3TKSC 3UOMA 1N8JA 2WCIA 3ZRDA 4MMMA 3APOA 4KDYA 3N9JA 5D9XA 4EKZA 4KW6A 2FNOA 4L0UA 1GL8A 2VM1A 4NPBA 17GSA 3ZIVA 3O3TA 2E0QA 4ECJA 1LBKA 3CSHA 4K6XA 4CHSA 3GRXA 4YH2A 4MF6A 1FVKA 4OCEA 1PRXA 1OKTA 3C71A 4YQMA 4JU5A 2JU5A 1OC9B 2G2QA 2LQOA 4TR1A 3DEXA 3C7MA 3A2VA 4LMWA 4EC0A 3F63A 4RQRA 2ES7A 3UBKA 2B5XA 1MEKA 3GN3A 1XWAA 2F8FA 2CAQA 3CMIA 1W89A 1YEXA 2CAIA 1ABAA 3HJPA 5ECIB 1B9YC 2OE1A 3IOSA 4KNDA 3DYRA 3D4TA 4BL7A 3ZL5A 3EU4A 1X9WB 1VRSD 1Q4JA 1M99A 3K8NA 3LGCA 3R2QA 4PXOA 4N10A 1VGLA 3FKFA 1MDKA 1R5PA 3IXRA 1RK4A 2VLVA 4DSSA 2K8SA 3ZTLA 4FYBA 1V40A 2H0HA 4WBRD 4PUFC 4O32A 1MTCA 2JL4A 2C4JA 1EZKA 3HYPA 1YY7A 2JZRA 3RPPA 4ML1A 2LUSA 3NOFA 2H6ZA 4XS4A 2OE0A 3VURA 4ZBDA 5CRHA 1SENA 1OYJA 2FD3A 1T00A 1BX9A 2XC2A 3EWLA 2VCTA 4GTUA 4NV2A 1SKRB 2J9HA 2NTOA 1KEBA 5F05A 3TKPA 5INYA 2E2GA 4KH7A 16GSA 2YJ7A 1O85A 1YJ6A 1K3OA 5A4UA 4I8BA 4NHZA 2V32A 2PERA 2M46A 3ZVJD 2DJ0A 2AYTA 2F9SA 3EE2A 2H72A 5D96A 2YZHA 5IOWA 1SKSB 4L5LA 3QPMA 1K0NA 3M9JA 3LG6A 3HKRA 4HJMA 4QL7A 3TJBA 5F07A 1PKZA 2QSIA 3HA9A 3UL3A 1EOHA 2B3SA 5EPFA 5ID2B 4KAEA 2AHEA 2FA8A 2DMMA 4KDXA 2A2SA 2B7KA 1PA3A 2DLXA 3KMOA 3H79A 5ECMB 6GSTA 1PGTA 4FIWA 1QK8A 2WS2A 3G7YA 4GF0A 4XTSA 2N5AA 3FR9A 1WIKA 5IOXA 2H01A 3VWXA 5GSTA 2MMOA 3IK9A 3LSZA 2JACA 1XWGA 4HDEA 1FAAA 2R5GA 4NHWA 2MMAA 3ZITA 1B4PA 5D8IA 4EL1A 2YPMA 4GSNA 2P0GA 4GSSA 1VF4A 2L5LA 2M80A 3LWAA 3AY8A 4XRDA 3FR6A 4G9HA 2O89A 4IVFA 1OC9A 5IMDA 2GZZA 1GSEA 1ZOFA 3KGKA 2GSQA 1B48A 1O7UA 3H1NA 2WZ9A 4K1FA 1GSQA 5B8AA 2GTUA 1QGVA 4JE1A 3FW2A 5F8BA 1HD2A 4K0GA 4PQHA 3BJ5A 3QMXA 1Z5YE 4I2TA 2L59A 3MDKA 3TRPA 4TVEA 2HT9A 4MJEA 1XZOA 2YWMA 3KP8A 1THXA 5IMZA 1TJDA 3IHQA 1YZXA 1SK1A 2MYGA 5B6NA 2Z9SA 1A2LA 1CQHA 2PN8A 2YWNA 3TKSA 5HFIA 2IN3A 4X1UA 3PGTA 3EVIA 4GRFA 2KP1A 2YNXA 22GSA 2CA8A 4X43A 1GULA 4MZCA 5ELGA 3TCOA 1XWKA 5GZZB 4KA0A 4MF7A 5A4VA 4ISDA 2DJJA 4WF5A 3F4SA 5J9BA 2O87A 4PUAA 3WD6A 4OCFA 1MD3A 5AN1A 3IV4A 3N5OA 3GL3A 3KTLA 2ZUPA 2N5FA 4AJ8A 2F51A 2LNTA 4TN8A 2VIMA 5FHIA 1EGOA 4JEDA 5DQSA 2H6XA 2QC7A 3TJGA 3L4NA 4ECCA 1RW1A 2YN1A 3KIJA 1OC8A 3GIXA 2HSHA 3KXOA 2H71A 1XXUA 5ECKB 4ACSA 2I4AA 5ID2A 1M2DA 4IELA 4J57E 2OE3A 1YF0A 4IS0A 2DJ1A 2AJQB 2GSRA 1PN9A 5B7CA 5HFKA 2LV3A 3FZAA 3HDCA 1WP0A 3TDGA 5IMFA 5DBQA 3ZLPA 5LD0A 3A2WA 2FHEA 2JZSA 2B6MA 1BEDA 4IHUA 1K0AA 1JZRA 1B4QA 5CRWA 1XW9A 3ZZXA 1X5DA 4TR3A 5GSSA 4PURA 3H93A 1ZMAA 2D2ZA 2HFDA 3ZVJA 1AXDA 3ME8A 2LJAA 2IMDA 2HZEB 4J2FA 5J3RA 2HSYA 4Z7XA 5B8BA 2K6VA 2MBSA 1TK0B 4XRAA 4DSQA 3IRAA 3GKMA 1XW6A 1E6BA 2C0FA 5IMAA 1BYEA 2TRCP 1OVNA 3GV1A 3DD3A 4V2LA 2VL3A 3GSSA 1K0CA 1W4VA 5KN0A 2GQMA 1TOFA 4V1Ap 1U87A 5ECLB 1R26A 5CP1A 2YWIA 5DQYA 2PGTA 1WWJA 1EV9A 1E2YA 3VI5A 3EMXA 2VD0A 3LXZA 4NWYA 3J7Yb 2LJKA 3QCPA 4BVYA 3A2XA 2B1LA 3ERFA 1X5EA 1V57A 3HXSA 4MPGA 5A5KA 3TKQA 1FVJA 3UARA 4I5QA 1Z7PA 2YP6A 1DE1A 4ZIJA 2B5EA 3KJYA 1KTEA 3CXGA 1J0FA 4XS1A 3CSJA 1GNWA 3FYGA 6GSWA 1WJKA 3U5RE 1A2JA 5HR2A 4POMA 1R7HA 4YQVA 3F3RA 1WE0A 1O6JA 3RHCA 1G7OA 4XCSA 3LJRA 2X8CA 1V98A 5KN2A 1TRVA 4BWSA 3TRXA 4RI7A 3DGQA 5AIXA 2DMLA 3RBTA 3VPTA 3ZREA 1F3AA 3ZYWA 1QMVA 4N0VA 2H1DA 3FRCA 3TOUA 1HQOA 4TRXA 3DMLA 4ZL7A 8GSSA 1UN2A 4IW9A 5DCHA 3EINA 1N2AA 5E4WA 1MDJA 1UA5A 4IBPA 4EDZA 4KUNA 2N5BA 4YAVA 2XBIA 4IKHA 1TK8B 3QFBC 1EWXA 2X64A 2P31A 1OE8A 2L4CA 3JCML 1QFNA 1GTBA 2HRNA 3F0IA 2FCHA 2PVOC 1O73A 20GSA 1FB6A 2CX4A 3DKSA 1GUMA 2A2RA 2E2MA 3ZFBA 2P5RA 2GSTA 2DBCA 4YAPA 1ZL9A 2V6KA 3ERGA 18GSA 3KH9A 3WGEA 1J08A 1GWCA 3M0FA 3KD0A 2OBIA 5JCGA 3TOTA 3PINA 3MSZA 2R3XA 2LQQA 3C8EA 1HNCA 1EEMA 1XWCA 1FHEA 3IAM2 4EF0A 2K9FA 2HZEA 5COHA 4ZXGA 19GSA 2VO4A 3IBHA 2MMZA 2WULA 2RLIA 3QOUA 4DSRA 1RQMA 4TXOB 3QAGA 1Z7RA 2FWFA 1K0MA 1EP8A 1TK5B 1F3BA 2YANA 1GLQA 5IQYA 3VI7A 1WMJA 4N11A 2PMTA 6GSSA 5HR3A 3F4TA 4ML6A 3TRQA 2L57A 1V9WA 3CRTA 3VWVA 2OA7A 1SJ6A 1IYHA 3BBYA 2QKEA 1B8XA 2LSTA 3QR6A 3RAZA 1EEJA 2PVQA 3BCIA 4OO5A 2K18A 4MPFA 1R5AA 2VCWA 3MAKA 1T7PB 4L5OA 5IMVA 2FWEA 3IC4A 1I5GA 4MA9A 5J41A 4IQ1A 3APQA 3EU3A 4WKWA 4I2UA 4AF2A 4IJIA 4KGIA 5DJLA 2GT6A 1QUWA 2LRTA 1AC1A 2VL9A 3PR8A 5EVOA 2H0IA 3UAPA 2OJLA 3O76A 3IK7A 4FYCA 2LJRA 1UC7A 1T8EB 3TKSE 3FHKA 2H1GA 4GSTA 2O7KA 4HUAA 1F2EA 10GSA 4NAXA 1ZCPA 3EMPA 1Z3EA 3EURA 1GSSA 4OMVA 2ON7A 1X0RA 2BJXA 1XCCA 2GGTA 4JRRA 1K0OA 4NMUA 1TW9A 5GAND 3KCMA 4H86A 4TOPA 4NXIA 2FWGA 1TU7A 2L6DA 1M9BA 2V1MA 5JWQB 3GH6A 1NSWA 1YQ1A 3L9SA 1K0DA 2O85A 3M3MA 2XHFA 1SYRA 5G31A 3HVSA 4FO5A 3GKNA 4XHMA 3GNJA 1LJRA 3HZ8A 1AAZA 3TJKA 2YV9A 3L78A 2R6KA 14GSA 4BWQA 4G19A 4K2DA 1SKWB 4PQIA 1GUKA 2HNLA 4K0NA 2GT5A 4XIHA 1UVZA 1O8WA 3Q19A 1ILOA 2B1KA 2KHPA 6GSVA 2FUG2 4TR4A 5H5QA 4OWYA 4MJBA 1WPIA 1KNGA 3WGXA 1O81A 3UMAA 5HR1A 2RM5A 3QDNA
chains in the Genus database with same CATH superfamily
5ECSA 4HQSA 2HRFA 4Q5FA 3LORA 5JWOB 1TTZA 2J23A 2R2JA 4N0ZA 4HU9A 2CVDA 4OO4A 4MDCA 1G7EA 4E8HA 3W8JA 4TXOA 4IN0A 2ZCTA 3QD9A 3V1WA 3ZMLA 2C0DA 2OBKA 3IAS2 2YJHA 1Y6EA 3HCZA 2VLUA 4MF5A 4V2MA 4GXZA 1DE2A 3P7XA 4EIQA 4K7OA 3SWLA 3P90A 5HR0A 4EUYA 1YEPA 2EC4A 1GTUA 4BPYA 2VL2A 4Z2RA 1X5CA 4HZ2A 2AAWA 2EIOA 2YCDA 4K5RA 1F6MC 1PX6A 4G0LA 3D0ZA 2H0GA 2IIYA 1GSUA 1XWBA 4WXTA 4Q5NA 1YKCA 2C3QA 2O8VB 2FA4A 2BTOT 3L9UA 2HXKA 3M9KA 5H5RA 2C1YA 5IPGA 2TRXA 3P8WA 2I3YA 2CQ9A 2IWTA 5DALB 3ERWA 4IQAA 3WT1A 4LL4B 1S3DA 3IDVA 1Z6MA 3H8QA 2UZ8A 4G2EA 3U6VA 3EC3A 4TKYA 3C1SA 5IIZA 3C1RA 1G6YA 4ECIA 1PSQA 3EYTA 1LU4A 4JBBA 1U3IA 1JLVA 3IR4A 5G1LA 2XPDA 4A5PA 4AJ7A 5IO0A 11GSA 3FZ5A 1PD21 1GTAA 1XOAA 2VLTA 5C04A 3LYKA 4GWRA 2C0EA 2C3TA 3FZ4A 3HVVA 3Q6OA 4HZ4A 5KN1A 1NM3A 3D6IA 5HQPA 4OFNA 4BVXA 2VCVA 3RHBA 1NHOA 1FO5A 1EGRA 1X9MB 2E7PA 2JADA 3UIWA 1URMA 1GSYA 12GSA 1PMTA 1K3YA 4F9ZA 1G0TA 4JZQA 2ALBA 5DVBA 3CQFA 5DAKB 3CTGA 2B5YA 4DVCA 5KN3A 5JCWA 1GTIA 3RPNA 3HJOA 5ECHB 4PNGA 1F9MA 3G7IA 2H73A 3LQ7A 2JZTA 5D9WA 2OKAA 5AIVA 2X8GA 2KP2A 3A3TA 4L8EA 4EO3A 5CRGA 2C8UA 2YOIA 4IJ3A 4TXVA 1YF1A 2PBJA 4K9ZA 3DXBA 2HI7A 9GSSA 3FY7A 4WR5A 4YQUA 1G6WA 2H76A 1Y25A 3NIVA 2PPTA 3D22A 4NV5A 5LNKe 4K8MA 1M2AA 2XBQA 2YWOA 2GVPA 2IJYA 3DRNA 3LXTA 2VM2A 2NDOA 2WRTA 2VCZA 1SU9A 2GQLA 4HJ2A 1HNBA 2QGVA 3GX0A 2HE3A 1H4OA 2NVLA 2WFCA 1T4ZA 1S3CA 5CO3A 2HZFA 3I6AA 2X8HA 4QL9A 3GA4A 3IC8A 3CBUA 5G2ZA 2V41A 1PKWA 4V1Ag 3D5JA 5AGYA 4ZBBA 4MH2A 4MNNA 1OKDA 3BCKA 1JZOA 1SD8A 4MABA 2QA2A 2A4VA 2ON5A 3E9JB 5ECQB 4KX4A 3WGDA 2LEGA 2H70A 2IMFA 1VF1A 3CTFA 1GLPA 2DJ3A 5DDLA 1A0FA 4KCEA 3VK9A 2VL2C 1BJXA 4EVMA 4O5RA 1ZYEA 2DJ2A 4HS1A 3F6DA 4KE3A 2LRCA 3E0UA 4GLTA 3P2AA 1FW1A 5DALA 1T3BA 4BIKA 1PQNA 3WYWA 1EV4A 1JLWA 3KM6A 4ZILA 2OADA 1ST9A 2DJKA 2RM6A 3ZFLA 2FWHA 4MLYA 5F06A 3D4MA 2H1AA 1WOUA 2V6OA 2IFQB 1BG5A 3VPQA 5EL8A 1U3AA 2I9HA 3KZQA 3CSIA 1TP9A 4LL1B 2CZ3A 3WT2A 3ED3A 1ERUA 5HFGA 1BAYA 2VOCA 4PQ1A 3BD2A 2VD1A 4OD7A 3G9BA 2PWJA 1TXXA 2IPAA 5H5SA 2LNSA 1A8YA 3Q74A 3HD5A 2TIRA 4ID0A 4WETA 4ECBA 2YV7A 3US3A 5B6MA 1FB0A 3H4KA 5CNWA 2C0GA 2GSSA 1FOHA 4ZL9A 3FEUA 4FYUA 3GH9A 2DSAA 5ENUA 4HQZA 1ZYPA 4TW5A 1AW9A 3LFLA 2PUKC 1M2BA 3I9V2 5DAKA 2VAFA 2MBTA 1Q98A 2AB6A 3F3QA 4DEJA 2HLSA 1ERTA 4Q5QA 1A23A 2AV4A 3IPZA 4HOJA 4MCUA 3F8UA 3DIEA 1M9AA 1TI1A 2WB9A 2L6CA 3F4RA 1IYIA 4RI6A 5A4WA 4F0BA 2NBSA 3UEMA 3I43A 4LA1A 5CYYA 4MJCA 4EDYA 5ECOB 2K8VA 1SJIA 1SL2B 5D93A 4K5SA 2CT6A 1XOBA 4K7NA 3GMFA 4MH3A 2GZYA 7GSSA 4IGJA 1USBA 2F3MA 2IMIA 1A24A 4JR4A 2GZPA 4V2NA 1J9BA 2CV4A 3GTUB 4ZB6A 4OFMA 3EPTA 1SL0B 1ZZYA 2VCQA 2LS5A 1AQWA 1DUGA 4O5UA 3TUEA 3UVTA 1GUHA 4L0WA 1AQVA 2REMA 3KTBA 3UJ1A 6GSYA 3GUSA 3ISOA 2CVBA 3CRUA 3M1GA 4TR0A 1SYXA 1VF2A 1THOA 1TDIA 4O7HA 2HRAA 2L4QA 4OFTA 4LMVA 1XPVA 1PL1A 3FZ9A 4GQFA 4F82A 1VF3A 3VWUA 1ERVA 2EIRA 4PNFA 3ME7A 1PX7A 5ELAA 1SL1B 2CVKA 1GH2A 2CZ2A 4KCAA 5LCZA 4BA7A 3RDWA 2VUPA 1A2MA 1M3IA 6GSUA 5AISA 1DSBA 3W6GA 4MZWA 4YKGA 2B7JA 2H66A 1XW5A 4PGTA 2IFQA 2GLRA 1R4WA 4XS6A 3GHAA 1BQ7A 3D21A 2RUFA 3KMNA 2HYXA 3KEBA 1NHYA 1WRYA 1Z6NA 4MJAA 1MD4A 5FWGA 3TB2A 3F9UA 2X4AA 4WR4A 4KB3A 5J4UA 4HI7A 1QQ2A 1TKDB 2IL3A 2IMEA 3HHVA 2JSZA 4GQCA 1MDIA 3ZMKA 3FK8A 4PX1A 5D9TA 5E59A 5ABRA 2DIZA 4FH8A 2I1UA 5ECPB 2X49A 5F0GA 4F03A 5G30A 1JZDA 4P3YB 2BMXA 4I97A 3UVHA 2KLXA 2H1BA 5IO2A 3DVXA 2H19A 1SD9A 5L71A 3M8NA 2V2GA 3HVXA 1YKAA 2WJUA 5D9VA 4WEYA 1SJZA 3IA1A 4HEA2 5JCUA 1FG4A 1V58A 4K7IA 3Q18A 4ULXA 1AUCA 2H8LA 3DVWA 3GURA 5CRDA 2FGXA 4MP4A 1C72A 3TKRA 1YDKA 1AIUA 5FT3A 2RUEA 4POBA 1HYUA 1O8XA 2GQKA 1V2AA 5IM9A 1TRSA 1JFUA 2MMNA 1F37A 4QQ7A 3J7Yk 2AUVA 5ECRB 4RUVA 4CW9A 5G1KA 4EE0A 3L0HA 1PL2A 1JZWA 1M3JA 3DWVA 2OACA 1TRUA 4G10A 3LW9A 3PH9A 1X9SB 1A8LA 1ZGNA 3GTUA 2GDRA 1OE7A 1ERWA 2M72A 4IP6A 1CQGA 3NZNA 3QFAC 3GSTA 1KBNA 5IMCA 2H75A 3GKXA 2LRNA 2WDUA 2VCXA 4GCIA 2FLSA 2DC5A 2H6YA 2MZCA 4E8EA 4JR6A 3KH7A 4D73B 6GSXA 3LYPA 3SBCA 3S9FA 1GSFA 3A5IA 2IMKA 2FY6A 3PPUA 5DCGA 1XIYA 1DBYA 2LTKA 4POKA 2LKUA 4CDOA 5J9CA 5CAXA 2G0FA 4AGSA 1TU8A 4RQXA 3GKKA 5G5FA 4MZBA 4ZL8A 1OC3A 3APSA 2I81A 5JWRB 1SK0A 2XPEA 3TGZA 3QAWA 3GL5A 4ILFA 5ECNB 2NPBA 3I69A 1M0UA 5EY6A 3QAVA 1U88A 1OAZA 1ZYQB 2H74A 2RIIA 2X99A 5D73A 4TR1B 3UBLA 1GP1A 1XVWA 3A5WA 13GSA 4WF4A 5KEJA 2KOKA 4HSCX 4ZBAA 1Z9HA 2A2PA 2GS3A 4IP1A 1SK2A 1GRXA 2ZNMA 4Q5RA 4I6XA 2R37A 4BL7B 1K3LA 1ON4A 4EXJA 2F8AA 1ML6A 1EOGA 4WBJA 1H75A 3E3EA 3HY2A 2H30A 4AJ6A 3VWWA 4ZB8A 1M7TA 3HZ4A 1NW2A 1AQXA 1TRWA 2EIQA 1FOVA 1EP7A 4DSSB 1T4YA 3MWHA 3CYNA 1QXHA 3HJMA 4X0XA 1HNAA 2WGRA 1XG8A 1I9DA 3GX8A 2L5OA 4KSMA 2P5QA 1GNEA 5C00A 2A4HA 3OR5A 3BOAA 3GFKA 4XS4B 3MNGA 3VFIA 2KUCA 5J5NA 4G0KA 3TJFA 3O6TA 3C73A 3GYKA 5G5EA 4ZB9A 1JHBA 3FR3A 1XBSA 3F6FA 5CREA 4MK3A 4J56E 2CX3A 1T1VA 1XVQA 4POLA 1B9XC 3W8SA 5DJMA 2DIYA 2YZUA 5IPHA 4KSOA 3VLNA 4O92A 2JSYA 2R4VA 2PU9C 2C3NA 3ZIJA 4F2IA 5GAPD 1U6TA 3LEFA 3TJJA 1S3AA 3IE3A 2C80A 4F0CA 3KP9A 1TI3A 1A0RP 1K0BA 4HU7A 1XFLA 3L9VA 1GSDA 4KDUA 3G7JA 4D73A 1ACVA 4N30A 4LLRA 3TKSC 3UOMA 1N8JA 2WCIA 3ZRDA 4MMMA 3APOA 1PN0A 4KDYA 4O5QA 3N9JA 5D9XA 4EKZA 4KW6A 2FNOA 4L0UA 1GL8A 2VM1A 4NPBA 17GSA 3ZIVA 3O3TA 2E0QA 4ECJA 1LBKA 3CSHA 5KOWA 4K6XA 4CHSA 2R0CA 2HRKA 3GRXA 4YH2A 4MF6A 1FVKA 4OCEA 4CY8A 1PRXA 1OKTA 3C71A 4YQMA 5BMUA 4JU5A 2JU5A 1OC9B 2G2QA 2LQOA 4TR1A 3DEXA 3C7MA 3A2VA 4LMWA 4EC0A 3F63A 4RQRA 2ES7A 3UBKA 2B5XA 1MEKA 3GN3A 1XWAA 2F8FA 2CAQA 3CMIA 1W89A 1YEXA 2QA1A 1S3RA 2CAIA 1ABAA 3HJPA 5ECIB 1B9YC 2OE1A 3IOSA 4KNDA 3DYRA 3D4TA 4BL7A 3ZL5A 3EU4A 1X9WB 1VRSD 1Q4JA 1M99A 3K8NA 3LGCA 3R2QA 4PXOA 4N10A 1VGLA 3FKFA 1MDKA 1R5PA 3IXRA 1RK4A 2VLVA 4DSSA 2K8SA 3ZTLA 4FYBA 1V40A 2H0HA 4USSA 4WBRD 4PUFC 4O32A 1MTCA 2JL4A 2C4JA 1EZKA 3HYPA 1YY7A 2JZRA 3RPPA 4ML1A 2LUSA 3NOFA 2H6ZA 4XS4A 2OE0A 3VURA 4X4JA 4ZBDA 5CRHA 1SENA 1OYJA 2FD3A 1T00A 1BX9A 2XC2A 3EWLA 2VCTA 4GTUA 4NV2A 1SKRB 2J9HA 2NTOA 1KEBA 5F05A 3TKPA 5INYA 2E2GA 4KH7A 16GSA 2YJ7A 1O85A 1YJ6A 1K3OA 5A4UA 4I8BA 4NHZA 2V32A 2PERA 2M46A 3ZVJD 2DJ0A 2AYTA 2F9SA 3EE2A 2H72A 5D96A 2YZHA 5IOWA 1SKSB 4L5LA 3QPMA 1K0NA 3M9JA 3LG6A 3HKRA 4HJMA 4QL7A 3TJBA 5F07A 1PKZA 2QSIA 3HA9A 3UL3A 1EOHA 2B3SA 5EPFA 5ID2B 4KAEA 3HVNA 4Z2TA 2DKIA 2AHEA 2FA8A 2DMMA 4KDXA 2A2SA 2B7KA 1PA3A 2DLXA 3KMOA 3H79A 5ECMB 6GSTA 1PGTA 4FIWA 1QK8A 2WS2A 3G7YA 4GF0A 4XTSA 2N5AA 3FR9A 1WIKA 3FMWA 5IOXA 2H01A 3VWXA 5GSTA 2MMOA 3IK9A 3LSZA 2JACA 1XWGA 4HDEA 1FAAA 2R5GA 4NHWA 2MMAA 4Z2UA 3ZITA 1B4PA 5D8IA 4EL1A 2YPMA 4GSNA 2P0GA 4GSSA 1VF4A 2L5LA 2M80A 3LWAA 3AY8A 4XRDA 3FR6A 4G9HA 2O89A 4IVFA 1OC9A 5IMDA 2GZZA 1GSEA 1ZOFA 3KGKA 2GSQA 1B48A 1O7UA 3H1NA 4FQUA 2WZ9A 4K1FA 1GSQA 5B8AA 1ZYNA 2GTUA 3MIXA 1QGVA 4JE1A 3FW2A 5F8BA 1HD2A 4K0GA 4PQHA 3BJ5A 3QMXA 1Z5YE 4I2TA 2L59A 3MDKA 3TRPA 4TVEA 4BVYB 2HT9A 4MJEA 3MYDA 1XZOA 2YWMA 3KP8A 1THXA 5IMZA 1TJDA 3IHQA 1YZXA 1SK1A 2MYGA 5B6NA 2Z9SA 1A2LA 1CQHA 2PN8A 2YWNA 3TKSA 5HFIA 2IN3A 4X1UA 3PGTA 3EVIA 4GRFA 2KP1A 2YNXA 22GSA 2CA8A 4X43A 1GULA 4MZCA 5ELGA 3TCOA 2R0GA 1XWKA 5GZZB 4KA0A 4MF7A 5A4VA 4ISDA 2DJJA 4WF5A 3F4SA 5J9BA 2O87A 4PUAA 3WD6A 4OCFA 1MD3A 5AN1A 3IV4A 5BRTA 3N5OA 3GL3A 3KTLA 2ZUPA 2N5FA 4CY6A 4AJ8A 2F51A 2LNTA 4TN8A 2VIMA 5FHIA 1EGOA 4JEDA 5DQSA 2DKHA 2H6XA 2QC7A 3TJGA 3L4NA 4ECCA 1RW1A 2YN1A 3KIJA 1OC8A 3GIXA 2HSHA 3KXOA 2H71A 1XXUA 5ECKB 4ACSA 2I4AA 5ID2A 1M2DA 4IELA 4J57E 2OE3A 1YF0A 4IS0A 2DJ1A 2AJQB 2GSRA 1PN9A 5B7CA 5HFKA 2LV3A 3FZAA 3HDCA 1WP0A 3TDGA 5IMFA 5DBQA 3ZLPA 5LD0A 3A2WA 2FHEA 2JZSA 2B6MA 1BEDA 4IHUA 1K0AA 1JZRA 1B4QA 5CRWA 1XW9A 3ZZXA 1X5DA 4TR3A 5GSSA 4PURA 3H93A 1ZMAA 2D2ZA 2HFDA 3ZVJA 1AXDA 3ME8A 2LJAA 2IMDA 2HZEB 4J2FA 5J3RA 2HSYA 4Z7XA 5B8BA 2K6VA 2MBSA 1TK0B 4XRAA 4DSQA 4PTSA 3IRAA 3GKMA 1XW6A 1E6BA 2C0FA 5IMAA 1BYEA 2TRCP 1OVNA 3GV1A 3DD3A 4V2LA 2VL3A 3GSSA 1K0CA 1W4VA 5KN0A 2GQMA 1PFOA 1TOFA 4V1Ap 1U87A 5ECLB 1R26A 5CP1A 2YWIA 5DQYA 2PGTA 1WWJA 1EV9A 1E2YA 3VI5A 3EMXA 2VD0A 3LXZA 4NWYA 3J7Yb 2LJKA 3QCPA 4BVYA 3A2XA 2B1LA 3ERFA 4YKFA 1X5EA 1V57A 3HXSA 4MPGA 5A5KA 3TKQA 1FVJA 3UARA 4I5QA 1Z7PA 2YP6A 1DE1A 4ZIJA 5KOXA 2B5EA 3KJYA 1KTEA 3CXGA 1J0FA 3IHGA 4XS1A 3CSJA 1GNWA 3FYGA 6GSWA 1WJKA 3U5RE 1A2JA 5HR2A 4POMA 1R7HA 4YQVA 3F3RA 1WE0A 4ICYA 1O6JA 3RHCA 1G7OA 4XCSA 3LJRA 2X8CA 1V98A 5KN2A 1TRVA 4BWSA 3TRXA 4RI7A 3DGQA 5AIXA 2DMLA 3RBTA 3VPTA 3ZREA 1F3AA 3ZYWA 1QMVA 4N0VA 2H1DA 3FRCA 3TOUA 1HQOA 4TRXA 3DMLA 4ZL7A 8GSSA 2R0PA 1UN2A 4IW9A 5DCHA 3EINA 1N2AA 5E4WA 1MDJA 1UA5A 4IBPA 4EDZA 4KUNA 2N5BA 4YAVA 2XBIA 4IKHA 1TK8B 3QFBC 1EWXA 2X64A 2P31A 1OE8A 2HSMA 2L4CA 3JCML 1QFNA 1GTBA 2HRNA 3F0IA 2FCHA 2PVOC 1O73A 20GSA 1FB6A 2CX4A 3DKSA 1GUMA 2A2RA 2E2MA 3ZFBA 2P5RA 2GSTA 2DBCA 4YAPA 1ZL9A 2V6KA 3ERGA 18GSA 3KH9A 3WGEA 1J08A 1GWCA 3M0FA 3KD0A 2OBIA 5JCGA 3TOTA 3PINA 3MSZA 2R3XA 2LQQA 3C8EA 1HNCA 1EEMA 1XWCA 1FHEA 3IAM2 4EF0A 2K9FA 2HZEA 5COHA 4ZXGA 19GSA 2VO4A 3IBHA 2MMZA 2WULA 2RLIA 3QOUA 4DSRA 1RQMA 4TXOB 3QAGA 1Z7RA 2FWFA 1K0MA 1EP8A 1TK5B 1F3BA 2YANA 1GLQA 5IQYA 3VI7A 1WMJA 4N11A 2PMTA 6GSSA 5HR3A 3F4TA 4ML6A 3TRQA 2L57A 1V9WA 3R3EA 3CRTA 3VWVA 2OA7A 1SJ6A 1IYHA 3BBYA 2QKEA 1B8XA 2LSTA 3QR6A 3RAZA 1EEJA 2PVQA 3BCIA 4OO5A 4KF9A 2K18A 4MPFA 1R5AA 2VCWA 3MAKA 1T7PB 4L5OA 5IMVA 2FWEA 3IC4A 1I5GA 4MA9A 5J41A 4IQ1A 3APQA 3EU3A 4WKWA 4I2UA 4AF2A 4K2XA 4IJIA 4KGIA 5DJLA 2GT6A 1QUWA 2LRTA 1AC1A 2VL9A 3PR8A 4G0IA 5EVOA 2H0IA 3UAPA 2OJLA 3O76A 3IK7A 4FYCA 2LJRA 1UC7A 1T8EB 3TKSE 3FHKA 2H1GA 4GSTA 2O7KA 4HUAA 1F2EA 10GSA 4NAXA 1ZCPA 3EMPA 1Z3EA 3EURA 1GSSA 4OMVA 2ON7A 1X0RA 2BJXA 1XCCA 2GGTA 4JRRA 1K0OA 4NMUA 1TW9A 5GAND 3KCMA 4H86A 4TOPA 4NXIA 2FWGA 1TU7A 2L6DA 1M9BA 2V1MA 5JWQB 3GH6A 1NSWA 1YQ1A 3L9SA 1K0DA 2O85A 3M3MA 2XHFA 4BVXB 1SYRA 5G31A 3HVSA 4FO5A 3GKNA 4XHMA 3GNJA 1LJRA 3HZ8A 1AAZA 3TJKA 2YV9A 3L78A 2R6KA 14GSA 4BWQA 4G19A 4K2DA 1SKWB 4PQIA 1GUKA 2HNLA 4K0NA 2GT5A 4XIHA 1UVZA 1O8WA 3Q19A 1ILOA 2B1KA 2KHPA 4EIPA 6GSVA 2FUG2 4TR4A 5H5QA 4OWYA 4MJBA 1WPIA 1KNGA 3WGXA 1O81A 3UMAA 5HR1A 2RM5A 3QDNA
chains in the Genus database with same CATH topology
5ECSA 4HQSA 2HRFA 4Q5FA 3LORA 5JWOB 1TTZA 2J23A 2R2JA 4N0ZA 4HU9A 2CVDA 4OO4A 4MDCA 1G7EA 4E8HA 3W8JA 4TXOA 4IN0A 2ZCTA 3QD9A 3V1WA 3ZMLA 2C0DA 2OBKA 3IAS2 2YJHA 1Y6EA 3HCZA 2VLUA 4MF5A 4V2MA 4GXZA 1DE2A 3P7XA 4EIQA 4K7OA 3SWLA 3P90A 5HR0A 4EUYA 1YEPA 2EC4A 1GTUA 4BPYA 2VL2A 4Z2RA 1X5CA 4HZ2A 2AAWA 2EIOA 2YCDA 4K5RA 1F6MC 1PX6A 4G0LA 3D0ZA 2H0GA 2IIYA 1GSUA 1XWBA 4WXTA 4Q5NA 1YKCA 2C3QA 2O8VB 2FA4A 2BTOT 3L9UA 2HXKA 3M9KA 5H5RA 2C1YA 5IPGA 2TRXA 3P8WA 2I3YA 2CQ9A 2IWTA 5DALB 3ERWA 4IQAA 3WT1A 4LL4B 1S3DA 3IDVA 1Z6MA 3H8QA 2UZ8A 4G2EA 3U6VA 3EC3A 4TKYA 3C1SA 5IIZA 3C1RA 1G6YA 4ECIA 1PSQA 3EYTA 1LU4A 4JBBA 1U3IA 1JLVA 3IR4A 5G1LA 2XPDA 4A5PA 4AJ7A 5IO0A 11GSA 3FZ5A 1PD21 1GTAA 1XOAA 2VLTA 5C04A 3LYKA 4GWRA 2C0EA 2C3TA 3FZ4A 3HVVA 3Q6OA 4HZ4A 5KN1A 1NM3A 3D6IA 5HQPA 4OFNA 4BVXA 2VCVA 3RHBA 1NHOA 1FO5A 1EGRA 1X9MB 2E7PA 2JADA 3UIWA 1URMA 1GSYA 12GSA 1PMTA 1K3YA 4F9ZA 1G0TA 4JZQA 2ALBA 5DVBA 5DAKB 3CTGA 2B5YA 4DVCA 5KN3A 5JCWA 1GTIA 3RPNA 3HJOA 5ECHB 4PNGA 1F9MA 3G7IA 2H73A 3LQ7A 2JZTA 5D9WA 2OKAA 5AIVA 2X8GA 2KP2A 3A3TA 4L8EA 4EO3A 5CRGA 2C8UA 2YOIA 4IJ3A 4TXVA 1YF1A 2PBJA 4K9ZA 3DXBA 2HI7A 9GSSA 3FY7A 4WR5A 4YQUA 1G6WA 2H76A 1Y25A 3NIVA 2PPTA 3D22A 4NV5A 5LNKe 4K8MA 1M2AA 2XBQA 2YWOA 2GVPA 2IJYA 3DRNA 3LXTA 2VM2A 2NDOA 2WRTA 2VCZA 1SU9A 2GQLA 4HJ2A 1HNBA 2QGVA 3GX0A 2HE3A 1H4OA 2NVLA 2WFCA 1T4ZA 1S3CA 5CO3A 2HZFA 3I6AA 2X8HA 4QL9A 3GA4A 3IC8A 3CBUA 5G2ZA 2V41A 1PKWA 4V1Ag 3D5JA 5AGYA 4ZBBA 4MH2A 4MNNA 1OKDA 3BCKA 1JZOA 1SD8A 4MABA 2QA2A 2A4VA 2ON5A 3E9JB 5ECQB 4KX4A 3WGDA 2LEGA 2H70A 2IMFA 1VF1A 3CTFA 1GLPA 2DJ3A 5DDLA 1A0FA 4KCEA 3VK9A 2VL2C 1BJXA 4EVMA 4O5RA 1ZYEA 2DJ2A 4HS1A 3F6DA 4KE3A 2LRCA 3E0UA 4GLTA 3P2AA 1FW1A 5DALA 1T3BA 1PQNA 3WYWA 1EV4A 1JLWA 3KM6A 4ZILA 2OADA 1ST9A 2DJKA 2RM6A 3ZFLA 2FWHA 4MLYA 5F06A 3D4MA 2H1AA 1WOUA 2V6OA 2IFQB 1BG5A 3VPQA 5EL8A 1U3AA 2I9HA 3KZQA 3CSIA 1TP9A 4LL1B 2CZ3A 3WT2A 3ED3A 1ERUA 5HFGA 1BAYA 2VOCA 4PQ1A 3BD2A 2VD1A 4OD7A 3G9BA 2PWJA 1TXXA 2IPAA 5H5SA 2LNSA 1A8YA 3Q74A 3HD5A 2TIRA 4ID0A 4WETA 4ECBA 2YV7A 3US3A 5B6MA 1FB0A 3H4KA 5CNWA 2C0GA 2GSSA 1FOHA 4ZL9A 3FEUA 4FYUA 3GH9A 2DSAA 5ENUA 4HQZA 1ZYPA 4TW5A 1AW9A 3LFLA 2PUKC 1M2BA 3I9V2 5DAKA 2VAFA 2MBTA 1Q98A 2AB6A 3F3QA 4DEJA 2HLSA 1ERTA 4Q5QA 1A23A 2AV4A 3IPZA 4HOJA 4MCUA 3F8UA 3DIEA 1M9AA 1TI1A 2WB9A 2L6CA 3F4RA 1IYIA 4RI6A 5A4WA 4F0BA 2NBSA 3UEMA 3I43A 4LA1A 5CYYA 4MJCA 4EDYA 5ECOB 2K8VA 1SJIA 1SL2B 5D93A 4K5SA 2CT6A 1XOBA 4K7NA 3GMFA 4MH3A 2GZYA 7GSSA 4IGJA 1USBA 2F3MA 2IMIA 1A24A 4JR4A 2GZPA 4V2NA 1J9BA 2CV4A 3GTUB 4ZB6A 4OFMA 3EPTA 1SL0B 1ZZYA 2VCQA 2LS5A 1AQWA 1DUGA 4O5UA 3TUEA 3UVTA 1GUHA 4L0WA 1AQVA 2REMA 3KTBA 3UJ1A 6GSYA 3GUSA 3ISOA 2CVBA 3CRUA 3M1GA 4TR0A 1SYXA 1VF2A 1THOA 1TDIA 4O7HA 2HRAA 2L4QA 4OFTA 4LMVA 1XPVA 1PL1A 3FZ9A 4GQFA 4F82A 1VF3A 3VWUA 1ERVA 2EIRA 4PNFA 3ME7A 1PX7A 5ELAA 1SL1B 2CVKA 1GH2A 2CZ2A 4KCAA 5LCZA 4BA7A 3RDWA 2VUPA 1A2MA 6GSUA 5AISA 1DSBA 3W6GA 4MZWA 4YKGA 2B7JA 2H66A 1XW5A 4PGTA 2IFQA 2GLRA 1R4WA 4XS6A 3GHAA 1BQ7A 3D21A 2RUFA 3KMNA 2HYXA 3KEBA 1NHYA 1WRYA 1Z6NA 4MJAA 1MD4A 5FWGA 3TB2A 3F9UA 2X4AA 4WR4A 4KB3A 5J4UA 4HI7A 1QQ2A 1TKDB 2IL3A 2IMEA 3HHVA 2JSZA 4GQCA 1MDIA 3ZMKA 3FK8A 4PX1A 5D9TA 5E59A 5ABRA 2DIZA 4FH8A 2I1UA 5ECPB 2X49A 5F0GA 4F03A 5G30A 1JZDA 4P3YB 2BMXA 4I97A 3UVHA 2KLXA 2H1BA 5IO2A 3DVXA 2H19A 1SD9A 5L71A 3M8NA 2V2GA 3HVXA 1YKAA 2WJUA 5D9VA 4WEYA 1SJZA 3IA1A 4HEA2 5JCUA 1FG4A 1V58A 4K7IA 3Q18A 4ULXA 1AUCA 2H8LA 3DVWA 3GURA 5CRDA 2FGXA 4MP4A 1C72A 3TKRA 1YDKA 1AIUA 5FT3A 2RUEA 4POBA 1HYUA 1O8XA 2GQKA 1V2AA 5IM9A 1TRSA 1JFUA 2MMNA 1F37A 4QQ7A 3J7Yk 2AUVA 5ECRB 4RUVA 4CW9A 5G1KA 4EE0A 3L0HA 1PL2A 1JZWA 3DWVA 2OACA 1TRUA 4G10A 3LW9A 3PH9A 1X9SB 1A8LA 1ZGNA 3GTUA 2GDRA 1OE7A 1ERWA 2M72A 4IP6A 1CQGA 3NZNA 3QFAC 3GSTA 1KBNA 5IMCA 2H75A 3GKXA 2LRNA 2WDUA 2VCXA 4GCIA 2FLSA 2DC5A 2H6YA 2MZCA 4E8EA 4JR6A 3KH7A 4D73B 6GSXA 3LYPA 3SBCA 3S9FA 1GSFA 3A5IA 2IMKA 2FY6A 3PPUA 5DCGA 1XIYA 1DBYA 2LTKA 4POKA 2LKUA 4CDOA 5J9CA 5CAXA 2G0FA 4AGSA 1TU8A 4RQXA 3GKKA 5G5FA 4MZBA 4ZL8A 1OC3A 3APSA 2I81A 5JWRB 1SK0A 2XPEA 3TGZA 3QAWA 3GL5A 4ILFA 5ECNB 2NPBA 3I69A 1M0UA 5EY6A 3QAVA 1U88A 1OAZA 1ZYQB 2H74A 2RIIA 5D73A 2X99A 4TR1B 3UBLA 1GP1A 1XVWA 3A5WA 13GSA 4WF4A 5KEJA 2KOKA 4ZBAA 1Z9HA 2A2PA 2GS3A 4IP1A 1SK2A 1GRXA 2ZNMA 4Q5RA 4I6XA 2R37A 4BL7B 1K3LA 1ON4A 4EXJA 2F8AA 1ML6A 1EOGA 4WBJA 1H75A 3E3EA 3HY2A 2H30A 4AJ6A 3VWWA 4ZB8A 1M7TA 3HZ4A 1NW2A 1AQXA 1TRWA 2EIQA 1FOVA 1EP7A 4DSSB 1T4YA 3MWHA 3CYNA 1QXHA 3HJMA 4X0XA 1HNAA 2WGRA 1I9DA 3GX8A 2L5OA 4KSMA 2P5QA 1GNEA 5C00A 2A4HA 3OR5A 3BOAA 3GFKA 4XS4B 3MNGA 3VFIA 2KUCA 5J5NA 4G0KA 3TJFA 3O6TA 3C73A 3GYKA 5G5EA 4ZB9A 1JHBA 3FR3A 1XBSA 3F6FA 5CREA 4MK3A 4J56E 2CX3A 1T1VA 1XVQA 4POLA 1B9XC 3W8SA 5DJMA 2DIYA 2YZUA 5IPHA 4KSOA 3VLNA 4O92A 2JSYA 2R4VA 2PU9C 2C3NA 3ZIJA 4F2IA 5GAPD 1U6TA 3LEFA 3TJJA 1S3AA 3IE3A 2C80A 4F0CA 3KP9A 1TI3A 1A0RP 1K0BA 4HU7A 1XFLA 3L9VA 1GSDA 4KDUA 3G7JA 4D73A 1ACVA 4N30A 4LLRA 3TKSC 3UOMA 1N8JA 2WCIA 3ZRDA 4MMMA 3APOA 1PN0A 4KDYA 4O5QA 3N9JA 5D9XA 4EKZA 4KW6A 2FNOA 4L0UA 1GL8A 2VM1A 4NPBA 17GSA 3ZIVA 3O3TA 2E0QA 4ECJA 1LBKA 3CSHA 5KOWA 4K6XA 4CHSA 2R0CA 2HRKA 3GRXA 4YH2A 4MF6A 1FVKA 4OCEA 4CY8A 1PRXA 1OKTA 3C71A 4YQMA 5BMUA 4JU5A 2JU5A 1OC9B 2G2QA 2LQOA 4TR1A 3DEXA 3C7MA 3A2VA 4LMWA 4EC0A 3F63A 4RQRA 2ES7A 3UBKA 2B5XA 1MEKA 3GN3A 1XWAA 2F8FA 2CAQA 3CMIA 1W89A 1YEXA 2QA1A 2CAIA 1ABAA 3HJPA 5ECIB 1B9YC 2OE1A 3IOSA 4KNDA 3DYRA 3D4TA 4BL7A 3ZL5A 3EU4A 1X9WB 1VRSD 1Q4JA 1M99A 3K8NA 3LGCA 3R2QA 4PXOA 4N10A 1VGLA 3FKFA 1MDKA 1R5PA 3IXRA 1RK4A 2VLVA 4DSSA 2K8SA 3ZTLA 4FYBA 1V40A 2H0HA 4USSA 4WBRD 4PUFC 4O32A 1MTCA 2JL4A 2C4JA 1EZKA 3HYPA 1YY7A 2JZRA 3RPPA 4ML1A 2LUSA 3NOFA 2H6ZA 4XS4A 2OE0A 3VURA 4X4JA 4ZBDA 5CRHA 1SENA 1OYJA 2FD3A 1T00A 1BX9A 2XC2A 3EWLA 2VCTA 4GTUA 4NV2A 1SKRB 2J9HA 2NTOA 1KEBA 5F05A 3TKPA 5INYA 2E2GA 4KH7A 16GSA 2YJ7A 1O85A 1YJ6A 1K3OA 5A4UA 4I8BA 4NHZA 2V32A 2PERA 2M46A 3ZVJD 2DJ0A 2AYTA 2F9SA 3EE2A 2H72A 5D96A 2YZHA 5IOWA 1SKSB 4L5LA 3QPMA 1K0NA 3M9JA 3LG6A 3HKRA 4HJMA 4QL7A 3TJBA 5F07A 1PKZA 2QSIA 3HA9A 3UL3A 1EOHA 2B3SA 5EPFA 5ID2B 4KAEA 4Z2TA 2DKIA 2AHEA 2FA8A 2DMMA 4KDXA 2A2SA 2B7KA 1PA3A 2DLXA 3KMOA 3H79A 5ECMB 6GSTA 1PGTA 4FIWA 1QK8A 2WS2A 3G7YA 4GF0A 4XTSA 2N5AA 3FR9A 1WIKA 3FMWA 5IOXA 2H01A 3VWXA 5GSTA 2MMOA 3IK9A 3LSZA 2JACA 1XWGA 4HDEA 1FAAA 2R5GA 4NHWA 2MMAA 4Z2UA 3ZITA 1B4PA 5D8IA 4EL1A 2YPMA 4GSNA 2P0GA 4GSSA 1VF4A 2L5LA 2M80A 3LWAA 3AY8A 4XRDA 3FR6A 4G9HA 2O89A 4IVFA 1OC9A 5IMDA 2GZZA 1GSEA 1ZOFA 3KGKA 2GSQA 1B48A 1O7UA 3H1NA 4FQUA 2WZ9A 4K1FA 1GSQA 5B8AA 1ZYNA 2GTUA 3MIXA 1QGVA 4JE1A 3FW2A 5F8BA 1HD2A 4K0GA 4PQHA 3BJ5A 3QMXA 1Z5YE 4I2TA 2L59A 3MDKA 3TRPA 4TVEA 4BVYB 2HT9A 4MJEA 3MYDA 1XZOA 2YWMA 3KP8A 1THXA 5IMZA 1TJDA 3IHQA 1YZXA 1SK1A 2MYGA 5B6NA 2Z9SA 1A2LA 1CQHA 2PN8A 2YWNA 3TKSA 5HFIA 2IN3A 4X1UA 3PGTA 3EVIA 4GRFA 2KP1A 2YNXA 22GSA 2CA8A 4X43A 1GULA 4MZCA 5ELGA 3TCOA 2R0GA 1XWKA 5GZZB 4KA0A 4MF7A 5A4VA 4ISDA 2DJJA 4WF5A 3F4SA 5J9BA 2O87A 4PUAA 3WD6A 4OCFA 1MD3A 5AN1A 3IV4A 5BRTA 3N5OA 3GL3A 3KTLA 2ZUPA 2N5FA 4CY6A 4AJ8A 2F51A 2LNTA 4TN8A 2VIMA 5FHIA 1EGOA 4JEDA 5DQSA 2DKHA 2H6XA 2QC7A 3TJGA 3L4NA 4ECCA 1RW1A 2YN1A 3KIJA 1OC8A 3GIXA 2HSHA 3KXOA 2H71A 1XXUA 5ECKB 4ACSA 2I4AA 5ID2A 1M2DA 4IELA 4J57E 2OE3A 1YF0A 4IS0A 2DJ1A 2AJQB 2GSRA 1PN9A 5B7CA 5HFKA 2LV3A 3FZAA 3HDCA 1WP0A 3TDGA 5IMFA 5DBQA 3ZLPA 5LD0A 3A2WA 2FHEA 2JZSA 2B6MA 1BEDA 4IHUA 1K0AA 1JZRA 1B4QA 5CRWA 1XW9A 3ZZXA 1X5DA 4TR3A 5GSSA 4PURA 3H93A 1ZMAA 2D2ZA 2HFDA 3ZVJA 1AXDA 3ME8A 2LJAA 2IMDA 2HZEB 4J2FA 5J3RA 2HSYA 4Z7XA 5B8BA 2K6VA 2MBSA 1TK0B 4XRAA 4DSQA 4PTSA 3IRAA 3GKMA 1XW6A 1E6BA 2C0FA 5IMAA 1BYEA 2TRCP 1OVNA 3GV1A 3DD3A 4V2LA 2VL3A 3GSSA 1K0CA 1W4VA 5KN0A 2GQMA 1TOFA 4V1Ap 1U87A 5ECLB 1R26A 5CP1A 2YWIA 5DQYA 2PGTA 1WWJA 1EV9A 1E2YA 3VI5A 3EMXA 2VD0A 3LXZA 4NWYA 3J7Yb 2LJKA 3QCPA 4BVYA 3A2XA 2B1LA 3ERFA 4YKFA 1X5EA 1V57A 3HXSA 4MPGA 5A5KA 3TKQA 1FVJA 3UARA 4I5QA 1Z7PA 2YP6A 1DE1A 4ZIJA 5KOXA 2B5EA 3KJYA 1KTEA 3CXGA 1J0FA 3IHGA 4XS1A 3CSJA 1GNWA 3FYGA 6GSWA 1WJKA 3U5RE 1A2JA 5HR2A 4POMA 1R7HA 4YQVA 3F3RA 1WE0A 4ICYA 1O6JA 3RHCA 1G7OA 4XCSA 3LJRA 2X8CA 1V98A 5KN2A 1TRVA 4BWSA 3TRXA 4RI7A 3DGQA 5AIXA 2DMLA 3RBTA 3VPTA 3ZREA 1F3AA 3ZYWA 1QMVA 4N0VA 2H1DA 3FRCA 3TOUA 1HQOA 4TRXA 3DMLA 4ZL7A 8GSSA 2R0PA 1UN2A 4IW9A 5DCHA 3EINA 1N2AA 5E4WA 1MDJA 1UA5A 4IBPA 4EDZA 4KUNA 2N5BA 4YAVA 2XBIA 4IKHA 1TK8B 3QFBC 1EWXA 2X64A 2P31A 1OE8A 2HSMA 2L4CA 3JCML 1QFNA 1GTBA 2HRNA 3F0IA 2FCHA 2PVOC 1O73A 20GSA 1FB6A 2CX4A 3DKSA 1GUMA 2A2RA 2E2MA 3ZFBA 2P5RA 2GSTA 2DBCA 4YAPA 1ZL9A 2V6KA 3ERGA 18GSA 3KH9A 3WGEA 1J08A 1GWCA 3M0FA 3KD0A 2OBIA 5JCGA 3TOTA 3PINA 3MSZA 2R3XA 2LQQA 3C8EA 1HNCA 1EEMA 1XWCA 1FHEA 3IAM2 4EF0A 2K9FA 2HZEA 5COHA 4ZXGA 19GSA 2VO4A 3IBHA 2MMZA 2WULA 2RLIA 3QOUA 4DSRA 1RQMA 4TXOB 3QAGA 1Z7RA 2FWFA 1K0MA 1EP8A 1TK5B 1F3BA 2YANA 1GLQA 5IQYA 3VI7A 1WMJA 4N11A 2PMTA 6GSSA 5HR3A 3F4TA 4ML6A 3TRQA 2L57A 1V9WA 3R3EA 3CRTA 3VWVA 2OA7A 1SJ6A 1IYHA 3BBYA 2QKEA 1B8XA 2LSTA 3QR6A 3RAZA 1EEJA 2PVQA 3BCIA 4OO5A 4KF9A 2K18A 4MPFA 1R5AA 2VCWA 3MAKA 1T7PB 4L5OA 5IMVA 2FWEA 3IC4A 1I5GA 4MA9A 5J41A 4IQ1A 3APQA 3EU3A 4WKWA 4I2UA 4AF2A 4K2XA 4IJIA 4KGIA 5DJLA 2GT6A 1QUWA 2LRTA 1AC1A 2VL9A 3PR8A 4G0IA 5EVOA 2H0IA 3UAPA 2OJLA 3O76A 3IK7A 4FYCA 2LJRA 1UC7A 1T8EB 3TKSE 3FHKA 2H1GA 4GSTA 2O7KA 4HUAA 1F2EA 10GSA 4NAXA 1ZCPA 3EMPA 1Z3EA 3EURA 1GSSA 4OMVA 2ON7A 1X0RA 2BJXA 1XCCA 2GGTA 4JRRA 1K0OA 4NMUA 1TW9A 5GAND 3KCMA 4H86A 4TOPA 4NXIA 2FWGA 1TU7A 2L6DA 1M9BA 2V1MA 5JWQB 3GH6A 1NSWA 1YQ1A 3L9SA 1K0DA 2O85A 3M3MA 2XHFA 4BVXB 1SYRA 5G31A 3HVSA 4FO5A 3GKNA 4XHMA 3GNJA 1LJRA 3HZ8A 1AAZA 3TJKA 2YV9A 3L78A 2R6KA 14GSA 4BWQA 4G19A 4K2DA 1SKWB 4PQIA 1GUKA 2HNLA 4K0NA 2GT5A 4XIHA 1UVZA 1O8WA 3Q19A 1ILOA 2B1KA 2KHPA 4EIPA 6GSVA 2FUG2 4TR4A 5H5QA 4OWYA 4MJBA 1WPIA 1KNGA 3WGXA 1O81A 3UMAA 5HR1A 2RM5A 3QDNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ECS A;  4HQS A;  2HRF A;  4Q5F A;  3LOR A;  5JWO B;  1TTZ A;  2J23 A;  2R2J A;  4N0Z A;  4HU9 A;  2CVD A;  4OO4 A;  4MDC A;  1G7E A;  4E8H A;  3W8J A;  4TXO A;  4IN0 A;  2ZCT A;  3QD9 A;  3V1W A;  3ZML A;  2C0D A;  2OBK A;  3IAS 2;  2YJH A;  1Y6E A;  3HCZ A;  2VLU A;  4MF5 A;  4V2M A;  4GXZ A;  1DE2 A;  3P7X A;  4K7O A;  3SWL A;  3P90 A;  5HR0 A;  4EUY A;  1YEP A;  2EC4 A;  1GTU A;  4BPY A;  2VL2 A;  1X5C A;  4HZ2 A;  2AAW A;  2EIO A;  2YCD A;  1F6M C;  1PX6 A;  3D0Z A;  2H0G A;  2IIY A;  1GSU A;  1XWB A;  4WXT A;  4Q5N A;  1YKC A;  2C3Q A;  2O8V B;  2FA4 A;  2BTO T;  3L9U A;  2HXK A;  3M9K A;  5H5R A;  2C1Y A;  5IPG A;  2TRX A;  3P8W A;  2I3Y A;  2CQ9 A;  2IWT A;  5DAL B;  3ERW A;  4IQA A;  3WT1 A;  4LL4 B;  1S3D A;  3IDV A;  1Z6M A;  3H8Q A;  4G2E A;  3U6V A;  3EC3 A;  4TKY A;  3C1S A;  5IIZ A;  3C1R A;  1G6Y A;  4ECI A;  1PSQ A;  3EYT A;  1LU4 A;  4JBB A;  1U3I A;  1JLV A;  3IR4 A;  5G1L A;  2XPD A;  4AJ7 A;  5IO0 A;  11GS A;  3FZ5 A;  1PD2 1;  1GTA A;  1XOA A;  2VLT A;  5C04 A;  3LYK A;  4GWR A;  2C0E A;  2C3T A;  3FZ4 A;  3HVV A;  3Q6O A;  4HZ4 A;  5KN1 A;  1NM3 A;  3D6I A;  5HQP A;  4OFN A;  4BVX A;  2VCV A;  3RHB A;  1NHO A;  1FO5 A;  1EGR A;  1X9M B;  2E7P A;  2JAD A;  3UIW A;  1URM A;  1GSY A;  12GS A;  1PMT A;  1K3Y A;  4F9Z A;  1G0T A;  4JZQ A;  2ALB A;  5DVB A;  5DAK B;  3CTG A;  2B5Y A;  4DVC A;  5KN3 A;  5JCW A;  1GTI A;  3RPN A;  3HJO A;  5ECH B;  4PNG A;  1F9M A;  3G7I A;  2H73 A;  3LQ7 A;  2JZT A;  5D9W A;  2OKA A;  5AIV A;  2X8G A;  2KP2 A;  3A3T A;  4L8E A;  4EO3 A;  5CRG A;  2C8U A;  2YOI A;  4IJ3 A;  4TXV A;  1YF1 A;  2PBJ A;  4K9Z A;  3DXB A;  2HI7 A;  9GSS A;  3FY7 A;  4WR5 A;  4YQU A;  1G6W A;  2H76 A;  1Y25 A;  3NIV A;  2PPT A;  3D22 A;  4NV5 A;  5LNK e;  4K8M A;  1M2A A;  2XBQ A;  2YWO A;  2GVP A;  2IJY A;  3DRN A;  3LXT A;  2VM2 A;  2NDO A;  2WRT A;  2VCZ A;  1SU9 A;  2GQL A;  4HJ2 A;  1HNB A;  2QGV A;  3GX0 A;  2HE3 A;  1H4O A;  2NVL A;  2WFC A;  1T4Z A;  1S3C A;  5CO3 A;  2HZF A;  3I6A A;  2X8H A;  4QL9 A;  3GA4 A;  3CBU A;  5G2Z A;  2V41 A;  1PKW A;  4V1A g;  3D5J A;  5AGY A;  4ZBB A;  4MH2 A;  1OKD A;  3BCK A;  1JZO A;  1SD8 A;  4MAB A;  2A4V A;  2ON5 A;  3E9J B;  5ECQ B;  4KX4 A;  3WGD A;  2LEG A;  2H70 A;  2IMF A;  1VF1 A;  3CTF A;  1GLP A;  2DJ3 A;  5DDL A;  1A0F A;  4KCE A;  3VK9 A;  2VL2 C;  1BJX A;  4EVM A;  4O5R A;  1ZYE A;  2DJ2 A;  4HS1 A;  3F6D A;  4KE3 A;  2LRC A;  3E0U A;  4GLT A;  3P2A A;  1FW1 A;  5DAL A;  1T3B A;  1PQN A;  3WYW A;  1EV4 A;  1JLW A;  3KM6 A;  4ZIL A;  2OAD A;  1ST9 A;  2DJK A;  2RM6 A;  3ZFL A;  2FWH A;  4MLY A;  5F06 A;  3D4M A;  2H1A A;  1WOU A;  2V6O A;  2IFQ B;  1BG5 A;  3VPQ A;  5EL8 A;  1U3A A;  2I9H A;  3KZQ A;  3CSI A;  1TP9 A;  4LL1 B;  2CZ3 A;  3WT2 A;  3ED3 A;  1ERU A;  5HFG A;  1BAY A;  2VOC A;  4PQ1 A;  3BD2 A;  2VD1 A;  4OD7 A;  3G9B A;  2PWJ A;  1TXX A;  2IPA A;  5H5S A;  2LNS A;  1A8Y A;  3Q74 A;  3HD5 A;  2TIR A;  4ID0 A;  4WET A;  4ECB A;  2YV7 A;  3US3 A;  5B6M A;  1FB0 A;  3H4K A;  5CNW A;  2C0G A;  2GSS A;  4ZL9 A;  3FEU A;  4FYU A;  3GH9 A;  2DSA A;  5ENU A;  4HQZ A;  4TW5 A;  1AW9 A;  3LFL A;  2PUK C;  1M2B A;  3I9V 2;  5DAK A;  2VAF A;  2MBT A;  1Q98 A;  2AB6 A;  3F3Q A;  4DEJ A;  2HLS A;  1ERT A;  4Q5Q A;  1A23 A;  2AV4 A;  3IPZ A;  4HOJ A;  4MCU A;  3F8U A;  3DIE A;  1M9A A;  1TI1 A;  2WB9 A;  2L6C A;  3F4R A;  1IYI A;  4RI6 A;  5A4W A;  4F0B A;  2NBS A;  3UEM A;  3I43 A;  4LA1 A;  5CYY A;  4MJC A;  4EDY A;  5ECO B;  2K8V A;  1SJI A;  1SL2 B;  5D93 A;  2CT6 A;  1XOB A;  4K7N A;  3GMF A;  4MH3 A;  2GZY A;  7GSS A;  4IGJ A;  1USB A;  2F3M A;  2IMI A;  1A24 A;  4JR4 A;  2GZP A;  4V2N A;  1J9B A;  2CV4 A;  3GTU B;  4ZB6 A;  4OFM A;  1SL0 B;  1ZZY A;  2VCQ A;  2LS5 A;  1AQW A;  1DUG A;  3TUE A;  3UVT A;  1GUH A;  4L0W A;  1AQV A;  2REM A;  3KTB A;  3UJ1 A;  6GSY A;  3GUS A;  3ISO A;  2CVB A;  3CRU A;  3M1G A;  4TR0 A;  1SYX A;  1VF2 A;  1THO A;  1TDI A;  4O7H A;  2L4Q A;  4OFT A;  4LMV A;  1XPV A;  1PL1 A;  3FZ9 A;  4GQF A;  4F82 A;  1VF3 A;  3VWU A;  1ERV A;  2EIR A;  4PNF A;  3ME7 A;  1PX7 A;  5ELA A;  1SL1 B;  2CVK A;  1GH2 A;  2CZ2 A;  4KCA A;  5LCZ A;  4BA7 A;  3RDW A;  2VUP A;  1A2M A;  6GSU A;  5AIS A;  1DSB A;  3W6G A;  4MZW A;  2B7J A;  2H66 A;  1XW5 A;  4PGT A;  2IFQ A;  2GLR A;  1R4W A;  4XS6 A;  3GHA A;  1BQ7 A;  3D21 A;  2RUF A;  3KMN A;  2HYX A;  3KEB A;  1NHY A;  1WRY A;  1Z6N A;  4MJA A;  1MD4 A;  5FWG A;  3TB2 A;  3F9U A;  4WR4 A;  4KB3 A;  5J4U A;  4HI7 A;  1QQ2 A;  1TKD B;  2IL3 A;  2IME A;  3HHV A;  2JSZ A;  4GQC A;  1MDI A;  3ZMK A;  3FK8 A;  4PX1 A;  5D9T A;  5E59 A;  5ABR A;  2DIZ A;  4FH8 A;  2I1U A;  5ECP B;  5F0G A;  4F03 A;  5G30 A;  1JZD A;  4P3Y B;  2BMX A;  4I97 A;  3UVH A;  2KLX A;  2H1B A;  5IO2 A;  3DVX A;  2H19 A;  1SD9 A;  5L71 A;  3M8N A;  2V2G A;  3HVX A;  1YKA A;  2WJU A;  5D9V A;  4WEY A;  1SJZ A;  3IA1 A;  4HEA 2;  5JCU A;  1FG4 A;  1V58 A;  4K7I A;  3Q18 A;  4ULX A;  1AUC A;  2H8L A;  3DVW A;  3GUR A;  5CRD A;  2FGX A;  4MP4 A;  1C72 A;  3TKR A;  1YDK A;  1AIU A;  5FT3 A;  2RUE A;  4POB A;  1HYU A;  1O8X A;  2GQK A;  1V2A A;  5IM9 A;  1TRS A;  1JFU A;  2MMN A;  1F37 A;  4QQ7 A;  3J7Y k;  2AUV A;  5ECR B;  4RUV A;  4CW9 A;  5G1K A;  4EE0 A;  3L0H A;  1PL2 A;  1JZW A;  3DWV A;  2OAC A;  1TRU A;  4G10 A;  3PH9 A;  1X9S B;  1A8L A;  1ZGN A;  3GTU A;  2GDR A;  1OE7 A;  1ERW A;  2M72 A;  4IP6 A;  1CQG A;  3NZN A;  3QFA C;  3GST A;  1KBN A;  5IMC A;  2H75 A;  3GKX A;  2LRN A;  2WDU A;  2VCX A;  4GCI A;  2FLS A;  2DC5 A;  2H6Y A;  2MZC A;  4E8E A;  4JR6 A;  3KH7 A;  4D73 B;  6GSX A;  3LYP A;  3SBC A;  3S9F A;  1GSF A;  2IMK A;  2FY6 A;  5DCG A;  1XIY A;  1DBY A;  2LTK A;  4POK A;  2LKU A;  4CDO A;  5J9C A;  5CAX A;  2G0F A;  4AGS A;  1TU8 A;  4RQX A;  3GKK A;  5G5F A;  4MZB A;  4ZL8 A;  1OC3 A;  3APS A;  2I81 A;  5JWR B;  1SK0 A;  2XPE A;  3TGZ A;  3QAW A;  3GL5 A;  4ILF A;  5ECN B;  2NPB A;  3I69 A;  1M0U A;  5EY6 A;  3QAV A;  1U88 A;  1OAZ A;  1ZYQ B;  2H74 A;  2RII A;  2X99 A;  5D73 A;  4TR1 B;  3UBL A;  1GP1 A;  1XVW A;  3A5W A;  13GS A;  4WF4 A;  5KEJ A;  2KOK A;  4ZBA A;  1Z9H A;  2GS3 A;  4IP1 A;  1SK2 A;  1GRX A;  2ZNM A;  4Q5R A;  4I6X A;  2R37 A;  1K3L A;  1ON4 A;  4EXJ A;  2F8A A;  1ML6 A;  1EOG A;  4WBJ A;  1H75 A;  3E3E A;  3HY2 A;  2H30 A;  4AJ6 A;  3VWW A;  4ZB8 A;  1M7T A;  3HZ4 A;  1NW2 A;  1AQX A;  1TRW A;  2EIQ A;  1FOV A;  1EP7 A;  4DSS B;  1T4Y A;  3MWH A;  3CYN A;  1QXH A;  3HJM A;  4X0X A;  1HNA A;  2WGR A;  1I9D A;  3GX8 A;  2L5O A;  4KSM A;  2P5Q A;  1GNE A;  5C00 A;  3OR5 A;  3BOA A;  3GFK A;  4XS4 B;  3MNG A;  3VFI A;  2KUC A;  5J5N A;  3TJF A;  3O6T A;  3C73 A;  3GYK A;  5G5E A;  4ZB9 A;  1JHB A;  3FR3 A;  1XBS A;  3F6F A;  5CRE A;  4MK3 A;  4J56 E;  2CX3 A;  1T1V A;  1XVQ A;  4POL A;  1B9X C;  3W8S A;  5DJM A;  2DIY A;  2YZU A;  5IPH A;  4KSO A;  3VLN A;  4O92 A;  2JSY A;  2R4V A;  2PU9 C;  2C3N A;  3ZIJ A;  4F2I A;  5GAP D;  1U6T A;  3LEF A;  3TJJ A;  1S3A A;  3IE3 A;  2C80 A;  4F0C A;  3KP9 A;  1TI3 A;  1A0R P;  1K0B A;  4HU7 A;  1XFL A;  3L9V A;  1GSD A;  4KDU A;  3G7J A;  4D73 A;  1ACV A;  4N30 A;  4LLR A;  3TKS C;  3UOM A;  1N8J A;  2WCI A;  3ZRD A;  4MMM A;  3APO A;  4KDY A;  3N9J A;  5D9X A;  4EKZ A;  4KW6 A;  2FNO A;  4L0U A;  1GL8 A;  2VM1 A;  4NPB A;  17GS A;  3ZIV A;  3O3T A;  2E0Q A;  4ECJ A;  1LBK A;  3CSH A;  4K6X A;  4CHS A;  3GRX A;  4YH2 A;  4MF6 A;  1FVK A;  4OCE A;  1PRX A;  1OKT A;  3C71 A;  4YQM A;  4JU5 A;  2JU5 A;  1OC9 B;  2G2Q A;  2LQO A;  4TR1 A;  3DEX A;  3C7M A;  3A2V A;  4LMW A;  4EC0 A;  3F63 A;  4RQR A;  2ES7 A;  3UBK A;  2B5X A;  1MEK A;  3GN3 A;  1XWA A;  2F8F A;  2CAQ A;  3CMI A;  1W89 A;  1YEX A;  2CAI A;  1ABA A;  3HJP A;  5ECI B;  1B9Y C;  2OE1 A;  3IOS A;  4KND A;  3DYR A;  3D4T A;  4BL7 A;  3ZL5 A;  3EU4 A;  1X9W B;  1VRS D;  1Q4J A;  1M99 A;  3K8N A;  3LGC A;  3R2Q A;  4PXO A;  4N10 A;  1VGL A;  3FKF A;  1MDK A;  1R5P A;  3IXR A;  1RK4 A;  2VLV A;  4DSS A;  2K8S A;  3ZTL A;  4FYB A;  1V40 A;  2H0H A;  4WBR D;  4PUF C;  4O32 A;  1MTC A;  2JL4 A;  2C4J A;  1EZK A;  3HYP A;  1YY7 A;  2JZR A;  3RPP A;  4ML1 A;  2LUS A;  3NOF A;  2H6Z A;  4XS4 A;  2OE0 A;  3VUR A;  4ZBD A;  5CRH A;  1SEN A;  1OYJ A;  2FD3 A;  1T00 A;  1BX9 A;  2XC2 A;  3EWL A;  2VCT A;  4GTU A;  4NV2 A;  1SKR B;  2J9H A;  2NTO A;  1KEB A;  5F05 A;  3TKP A;  5INY A;  2E2G A;  4KH7 A;  16GS A;  2YJ7 A;  1O85 A;  1YJ6 A;  1K3O A;  5A4U A;  4I8B A;  4NHZ A;  2V32 A;  2PER A;  2M46 A;  3ZVJ D;  2DJ0 A;  2AYT A;  2F9S A;  3EE2 A;  2H72 A;  5D96 A;  2YZH A;  5IOW A;  1SKS B;  4L5L A;  3QPM A;  1K0N A;  3M9J A;  3LG6 A;  3HKR A;  4HJM A;  4QL7 A;  3TJB A;  5F07 A;  1PKZ A;  2QSI A;  3HA9 A;  3UL3 A;  1EOH A;  2B3S A;  5EPF A;  5ID2 B;  4KAE A;  2AHE A;  2FA8 A;  2DMM A;  4KDX A;  2A2S A;  2B7K A;  1PA3 A;  2DLX A;  3KMO A;  3H79 A;  5ECM B;  6GST A;  1PGT A;  4FIW A;  1QK8 A;  2WS2 A;  3G7Y A;  4GF0 A;  4XTS A;  2N5A A;  3FR9 A;  1WIK A;  5IOX A;  2H01 A;  3VWX A;  5GST A;  2MMO A;  3IK9 A;  3LSZ A;  2JAC A;  1XWG A;  4HDE A;  1FAA A;  2R5G A;  4NHW A;  2MMA A;  3ZIT A;  1B4P A;  5D8I A;  4EL1 A;  2YPM A;  4GSN A;  2P0G A;  4GSS A;  1VF4 A;  2L5L A;  2M80 A;  3LWA A;  3AY8 A;  4XRD A;  3FR6 A;  4G9H A;  2O89 A;  4IVF A;  1OC9 A;  5IMD A;  2GZZ A;  1GSE A;  1ZOF A;  3KGK A;  2GSQ A;  1B48 A;  1O7U A;  3H1N A;  2WZ9 A;  4K1F A;  1GSQ A;  5B8A A;  2GTU A;  1QGV A;  4JE1 A;  3FW2 A;  5F8B A;  1HD2 A;  4K0G A;  4PQH A;  3BJ5 A;  3QMX A;  1Z5Y E;  4I2T A;  2L59 A;  3MDK A;  3TRP A;  4TVE A;  2HT9 A;  4MJE A;  1XZO A;  2YWM A;  3KP8 A;  1THX A;  5IMZ A;  1TJD A;  3IHQ A;  1YZX A;  1SK1 A;  2MYG A;  5B6N A;  2Z9S A;  1A2L A;  1CQH A;  2PN8 A;  2YWN A;  3TKS A;  5HFI A;  2IN3 A;  4X1U A;  3PGT A;  3EVI A;  4GRF A;  2KP1 A;  2YNX A;  22GS A;  2CA8 A;  4X43 A;  1GUL A;  4MZC A;  5ELG A;  3TCO A;  1XWK A;  5GZZ B;  4KA0 A;  4MF7 A;  5A4V A;  4ISD A;  2DJJ A;  4WF5 A;  3F4S A;  5J9B A;  2O87 A;  4PUA A;  3WD6 A;  4OCF A;  1MD3 A;  5AN1 A;  3IV4 A;  3N5O A;  3GL3 A;  3KTL A;  2ZUP A;  2N5F A;  4AJ8 A;  2F51 A;  2LNT A;  4TN8 A;  2VIM A;  5FHI A;  1EGO A;  4JED A;  5DQS A;  2H6X A;  2QC7 A;  3TJG A;  3L4N A;  4ECC A;  1RW1 A;  2YN1 A;  3KIJ A;  1OC8 A;  3GIX A;  2HSH A;  3KXO A;  2H71 A;  1XXU A;  5ECK B;  4ACS A;  2I4A A;  5ID2 A;  1M2D A;  4IEL A;  4J57 E;  2OE3 A;  1YF0 A;  4IS0 A;  2DJ1 A;  2AJQ B;  2GSR A;  1PN9 A;  5B7C A;  5HFK A;  2LV3 A;  3FZA A;  3HDC A;  1WP0 A;  3TDG A;  5IMF A;  5DBQ A;  3ZLP A;  5LD0 A;  3A2W A;  2FHE A;  2JZS A;  2B6M A;  1BED A;  4IHU A;  1K0A A;  1JZR A;  1B4Q A;  5CRW A;  1XW9 A;  3ZZX A;  1X5D A;  4TR3 A;  5GSS A;  4PUR A;  3H93 A;  1ZMA A;  2D2Z A;  2HFD A;  3ZVJ A;  1AXD A;  3ME8 A;  2LJA A;  2IMD A;  2HZE B;  4J2F A;  5J3R A;  2HSY A;  4Z7X A;  5B8B A;  2K6V A;  2MBS A;  1TK0 B;  4XRA A;  4DSQ A;  3IRA A;  3GKM A;  1XW6 A;  1E6B A;  2C0F A;  5IMA A;  1BYE A;  2TRC P;  1OVN A;  3GV1 A;  3DD3 A;  4V2L A;  2VL3 A;  3GSS A;  1K0C A;  1W4V A;  5KN0 A;  2GQM A;  1TOF A;  4V1A p;  1U87 A;  5ECL B;  1R26 A;  5CP1 A;  2YWI A;  5DQY A;  2PGT A;  1WWJ A;  1EV9 A;  1E2Y A;  3VI5 A;  3EMX A;  2VD0 A;  3LXZ A;  4NWY A;  3J7Y b;  2LJK A;  3QCP A;  4BVY A;  3A2X A;  2B1L A;  3ERF A;  1X5E A;  1V57 A;  3HXS A;  4MPG A;  5A5K A;  3TKQ A;  1FVJ A;  3UAR A;  4I5Q A;  1Z7P A;  2YP6 A;  1DE1 A;  4ZIJ A;  2B5E A;  3KJY A;  1KTE A;  3CXG A;  1J0F A;  4XS1 A;  3CSJ A;  1GNW A;  3FYG A;  6GSW A;  1WJK A;  3U5R E;  1A2J A;  5HR2 A;  4POM A;  1R7H A;  4YQV A;  3F3R A;  1WE0 A;  1O6J A;  3RHC A;  1G7O A;  4XCS A;  3LJR A;  2X8C A;  1V98 A;  5KN2 A;  1TRV A;  4BWS A;  3TRX A;  4RI7 A;  3DGQ A;  5AIX A;  2DML A;  3RBT A;  3VPT A;  3ZRE A;  1F3A A;  3ZYW A;  1QMV A;  4N0V A;  2H1D A;  3FRC A;  3TOU A;  1HQO A;  4TRX A;  3DML A;  4ZL7 A;  8GSS A;  1UN2 A;  4IW9 A;  5DCH A;  3EIN A;  1N2A A;  5E4W A;  1MDJ A;  1UA5 A;  4IBP A;  4EDZ A;  4KUN A;  2N5B A;  4YAV A;  2XBI A;  4IKH A;  1TK8 B;  3QFB C;  1EWX A;  2X64 A;  2P31 A;  1OE8 A;  2L4C A;  3JCM L;  1QFN A;  1GTB A;  2HRN A;  3F0I A;  2FCH A;  2PVO C;  1O73 A;  20GS A;  1FB6 A;  2CX4 A;  3DKS A;  1GUM A;  2A2R A;  2E2M A;  3ZFB A;  2P5R A;  2GST A;  2DBC A;  4YAP A;  1ZL9 A;  2V6K A;  3ERG A;  18GS A;  3KH9 A;  3WGE A;  1J08 A;  1GWC A;  3M0F A;  3KD0 A;  2OBI A;  5JCG A;  3TOT A;  3PIN A;  3MSZ A;  2R3X A;  2LQQ A;  3C8E A;  1HNC A;  1EEM A;  1XWC A;  1FHE A;  3IAM 2;  4EF0 A;  2K9F A;  2HZE A;  5COH A;  4ZXG A;  19GS A;  2VO4 A;  3IBH A;  2MMZ A;  2WUL A;  2RLI A;  3QOU A;  4DSR A;  1RQM A;  4TXO B;  3QAG A;  1Z7R A;  2FWF A;  1K0M A;  1EP8 A;  1TK5 B;  1F3B A;  2YAN A;  1GLQ A;  5IQY A;  3VI7 A;  1WMJ A;  4N11 A;  2PMT A;  6GSS A;  5HR3 A;  3F4T A;  4ML6 A;  3TRQ A;  2L57 A;  1V9W A;  3CRT A;  3VWV A;  2OA7 A;  1SJ6 A;  1IYH A;  3BBY A;  2QKE A;  1B8X A;  2LST A;  3QR6 A;  3RAZ A;  1EEJ A;  2PVQ A;  3BCI A;  4OO5 A;  2K18 A;  4MPF A;  1R5A A;  2VCW A;  3MAK A;  1T7P B;  4L5O A;  5IMV A;  2FWE A;  3IC4 A;  1I5G A;  4MA9 A;  5J41 A;  4IQ1 A;  3APQ A;  3EU3 A;  4WKW A;  4I2U A;  4AF2 A;  4IJI A;  4KGI A;  5DJL A;  2GT6 A;  1QUW A;  2LRT A;  1AC1 A;  2VL9 A;  3PR8 A;  5EVO A;  2H0I A;  3UAP A;  2OJL A;  3O76 A;  3IK7 A;  4FYC A;  2LJR A;  1UC7 A;  1T8E B;  3TKS E;  3FHK A;  2H1G A;  4GST A;  2O7K A;  4HUA A;  1F2E A;  10GS A;  4NAX A;  1ZCP A;  3EMP A;  1Z3E A;  3EUR A;  1GSS A;  4OMV A;  2ON7 A;  1X0R A;  2BJX A;  1XCC A;  2GGT A;  4JRR A;  1K0O A;  4NMU A;  1TW9 A;  5GAN D;  3KCM A;  4H86 A;  4TOP A;  4NXI A;  2FWG A;  1TU7 A;  2L6D A;  1M9B A;  2V1M A;  5JWQ B;  3GH6 A;  1NSW A;  1YQ1 A;  3L9S A;  1K0D A;  2O85 A;  3M3M A;  2XHF A;  1SYR A;  5G31 A;  3HVS A;  4FO5 A;  3GKN A;  4XHM A;  3GNJ A;  1LJR A;  3HZ8 A;  1AAZ A;  3TJK A;  2YV9 A;  3L78 A;  2R6K A;  14GS A;  4BWQ A;  4G19 A;  4K2D A;  1SKW B;  4PQI A;  1GUK A;  2HNL A;  4K0N A;  2GT5 A;  4XIH A;  1UVZ A;  1O8W A;  3Q19 A;  1ILO A;  2B1K A;  2KHP A;  6GSV A;  2FUG 2;  4TR4 A;  5H5Q A;  4OWY A;  4MJB A;  1WPI A;  1KNG A;  3WGX A;  1O81 A;  3UMA A;  5HR1 A;  2RM5 A;  3QDN A; 
#chains in the Genus database with same CATH topology
 5ECS A;  4HQS A;  2HRF A;  4Q5F A;  3LOR A;  5JWO B;  1TTZ A;  2J23 A;  2R2J A;  4N0Z A;  4HU9 A;  2CVD A;  4OO4 A;  4MDC A;  1G7E A;  4E8H A;  3W8J A;  4TXO A;  4IN0 A;  2ZCT A;  3QD9 A;  3V1W A;  3ZML A;  2C0D A;  2OBK A;  3IAS 2;  2YJH A;  1Y6E A;  3HCZ A;  2VLU A;  4MF5 A;  4V2M A;  4GXZ A;  1DE2 A;  3P7X A;  4EIQ A;  4K7O A;  3SWL A;  3P90 A;  5HR0 A;  4EUY A;  1YEP A;  2EC4 A;  1GTU A;  4BPY A;  2VL2 A;  4Z2R A;  1X5C A;  4HZ2 A;  2AAW A;  2EIO A;  2YCD A;  4K5R A;  1F6M C;  1PX6 A;  4G0L A;  3D0Z A;  2H0G A;  2IIY A;  1GSU A;  1XWB A;  4WXT A;  4Q5N A;  1YKC A;  2C3Q A;  2O8V B;  2FA4 A;  2BTO T;  3L9U A;  2HXK A;  3M9K A;  5H5R A;  2C1Y A;  5IPG A;  2TRX A;  3P8W A;  2I3Y A;  2CQ9 A;  2IWT A;  5DAL B;  3ERW A;  4IQA A;  3WT1 A;  4LL4 B;  1S3D A;  3IDV A;  1Z6M A;  3H8Q A;  2UZ8 A;  4G2E A;  3U6V A;  3EC3 A;  4TKY A;  3C1S A;  5IIZ A;  3C1R A;  1G6Y A;  4ECI A;  1PSQ A;  3EYT A;  1LU4 A;  4JBB A;  1U3I A;  1JLV A;  3IR4 A;  5G1L A;  2XPD A;  4A5P A;  4AJ7 A;  5IO0 A;  11GS A;  3FZ5 A;  1PD2 1;  1GTA A;  1XOA A;  2VLT A;  5C04 A;  3LYK A;  4GWR A;  2C0E A;  2C3T A;  3FZ4 A;  3HVV A;  3Q6O A;  4HZ4 A;  5KN1 A;  1NM3 A;  3D6I A;  5HQP A;  4OFN A;  4BVX A;  2VCV A;  3RHB A;  1NHO A;  1FO5 A;  1EGR A;  1X9M B;  2E7P A;  2JAD A;  3UIW A;  1URM A;  1GSY A;  12GS A;  1PMT A;  1K3Y A;  4F9Z A;  1G0T A;  4JZQ A;  2ALB A;  5DVB A;  3CQF A;  5DAK B;  3CTG A;  2B5Y A;  4DVC A;  5KN3 A;  5JCW A;  1GTI A;  3RPN A;  3HJO A;  5ECH B;  4PNG A;  1F9M A;  3G7I A;  2H73 A;  3LQ7 A;  2JZT A;  5D9W A;  2OKA A;  5AIV A;  2X8G A;  2KP2 A;  3A3T A;  4L8E A;  4EO3 A;  5CRG A;  2C8U A;  2YOI A;  4IJ3 A;  4TXV A;  1YF1 A;  2PBJ A;  4K9Z A;  3DXB A;  2HI7 A;  9GSS A;  3FY7 A;  4WR5 A;  4YQU A;  1G6W A;  2H76 A;  1Y25 A;  3NIV A;  2PPT A;  3D22 A;  4NV5 A;  5LNK e;  4K8M A;  1M2A A;  2XBQ A;  2YWO A;  2GVP A;  2IJY A;  3DRN A;  3LXT A;  2VM2 A;  2NDO A;  2WRT A;  2VCZ A;  1SU9 A;  2GQL A;  4HJ2 A;  1HNB A;  2QGV A;  3GX0 A;  2HE3 A;  1H4O A;  2NVL A;  2WFC A;  1T4Z A;  1S3C A;  5CO3 A;  2HZF A;  3I6A A;  2X8H A;  4QL9 A;  3GA4 A;  3IC8 A;  3CBU A;  5G2Z A;  2V41 A;  1PKW A;  4V1A g;  3D5J A;  5AGY A;  4ZBB A;  4MH2 A;  4MNN A;  1OKD A;  3BCK A;  1JZO A;  1SD8 A;  4MAB A;  2QA2 A;  2A4V A;  2ON5 A;  3E9J B;  5ECQ B;  4KX4 A;  3WGD A;  2LEG A;  2H70 A;  2IMF A;  1VF1 A;  3CTF A;  1GLP A;  2DJ3 A;  5DDL A;  1A0F A;  4KCE A;  3VK9 A;  2VL2 C;  1BJX A;  4EVM A;  4O5R A;  1ZYE A;  2DJ2 A;  4HS1 A;  3F6D A;  4KE3 A;  2LRC A;  3E0U A;  4GLT A;  3P2A A;  1FW1 A;  5DAL A;  1T3B A;  4BIK A;  1PQN A;  3WYW A;  1EV4 A;  1JLW A;  3KM6 A;  4ZIL A;  2OAD A;  1ST9 A;  2DJK A;  2RM6 A;  3ZFL A;  2FWH A;  4MLY A;  5F06 A;  3D4M A;  2H1A A;  1WOU A;  2V6O A;  2IFQ B;  1BG5 A;  3VPQ A;  5EL8 A;  1U3A A;  2I9H A;  3KZQ A;  3CSI A;  1TP9 A;  4LL1 B;  2CZ3 A;  3WT2 A;  3ED3 A;  1ERU A;  5HFG A;  1BAY A;  2VOC A;  4PQ1 A;  3BD2 A;  2VD1 A;  4OD7 A;  3G9B A;  2PWJ A;  1TXX A;  2IPA A;  5H5S A;  2LNS A;  1A8Y A;  3Q74 A;  3HD5 A;  2TIR A;  4ID0 A;  4WET A;  4ECB A;  2YV7 A;  3US3 A;  5B6M A;  1FB0 A;  3H4K A;  5CNW A;  2C0G A;  2GSS A;  1FOH A;  4ZL9 A;  3FEU A;  4FYU A;  3GH9 A;  2DSA A;  5ENU A;  4HQZ A;  1ZYP A;  4TW5 A;  1AW9 A;  3LFL A;  2PUK C;  1M2B A;  3I9V 2;  5DAK A;  2VAF A;  2MBT A;  1Q98 A;  2AB6 A;  3F3Q A;  4DEJ A;  2HLS A;  1ERT A;  4Q5Q A;  1A23 A;  2AV4 A;  3IPZ A;  4HOJ A;  4MCU A;  3F8U A;  3DIE A;  1M9A A;  1TI1 A;  2WB9 A;  2L6C A;  3F4R A;  1IYI A;  4RI6 A;  5A4W A;  4F0B A;  2NBS A;  3UEM A;  3I43 A;  4LA1 A;  5CYY A;  4MJC A;  4EDY A;  5ECO B;  2K8V A;  1SJI A;  1SL2 B;  5D93 A;  4K5S A;  2CT6 A;  1XOB A;  4K7N A;  3GMF A;  4MH3 A;  2GZY A;  7GSS A;  4IGJ A;  1USB A;  2F3M A;  2IMI A;  1A24 A;  4JR4 A;  2GZP A;  4V2N A;  1J9B A;  2CV4 A;  3GTU B;  4ZB6 A;  4OFM A;  3EPT A;  1SL0 B;  1ZZY A;  2VCQ A;  2LS5 A;  1AQW A;  1DUG A;  4O5U A;  3TUE A;  3UVT A;  1GUH A;  4L0W A;  1AQV A;  2REM A;  3KTB A;  3UJ1 A;  6GSY A;  3GUS A;  3ISO A;  2CVB A;  3CRU A;  3M1G A;  4TR0 A;  1SYX A;  1VF2 A;  1THO A;  1TDI A;  4O7H A;  2HRA A;  2L4Q A;  4OFT A;  4LMV A;  1XPV A;  1PL1 A;  3FZ9 A;  4GQF A;  4F82 A;  1VF3 A;  3VWU A;  1ERV A;  2EIR A;  4PNF A;  3ME7 A;  1PX7 A;  5ELA A;  1SL1 B;  2CVK A;  1GH2 A;  2CZ2 A;  4KCA A;  5LCZ A;  4BA7 A;  3RDW A;  2VUP A;  1A2M A;  1M3I A;  6GSU A;  5AIS A;  1DSB A;  3W6G A;  4MZW A;  4YKG A;  2B7J A;  2H66 A;  1XW5 A;  4PGT A;  2IFQ A;  2GLR A;  1R4W A;  4XS6 A;  3GHA A;  1BQ7 A;  3D21 A;  2RUF A;  3KMN A;  2HYX A;  3KEB A;  1NHY A;  1WRY A;  1Z6N A;  4MJA A;  1MD4 A;  5FWG A;  3TB2 A;  3F9U A;  2X4A A;  4WR4 A;  4KB3 A;  5J4U A;  4HI7 A;  1QQ2 A;  1TKD B;  2IL3 A;  2IME A;  3HHV A;  2JSZ A;  4GQC A;  1MDI A;  3ZMK A;  3FK8 A;  4PX1 A;  5D9T A;  5E59 A;  5ABR A;  2DIZ A;  4FH8 A;  2I1U A;  5ECP B;  2X49 A;  5F0G A;  4F03 A;  5G30 A;  1JZD A;  4P3Y B;  2BMX A;  4I97 A;  3UVH A;  2KLX A;  2H1B A;  5IO2 A;  3DVX A;  2H19 A;  1SD9 A;  5L71 A;  3M8N A;  2V2G A;  3HVX A;  1YKA A;  2WJU A;  5D9V A;  4WEY A;  1SJZ A;  3IA1 A;  4HEA 2;  5JCU A;  1FG4 A;  1V58 A;  4K7I A;  3Q18 A;  4ULX A;  1AUC A;  2H8L A;  3DVW A;  3GUR A;  5CRD A;  2FGX A;  4MP4 A;  1C72 A;  3TKR A;  1YDK A;  1AIU A;  5FT3 A;  2RUE A;  4POB A;  1HYU A;  1O8X A;  2GQK A;  1V2A A;  5IM9 A;  1TRS A;  1JFU A;  2MMN A;  1F37 A;  4QQ7 A;  3J7Y k;  2AUV A;  5ECR B;  4RUV A;  4CW9 A;  5G1K A;  4EE0 A;  3L0H A;  1PL2 A;  1JZW A;  1M3J A;  3DWV A;  2OAC A;  1TRU A;  4G10 A;  3LW9 A;  3PH9 A;  1X9S B;  1A8L A;  1ZGN A;  3GTU A;  2GDR A;  1OE7 A;  1ERW A;  2M72 A;  4IP6 A;  1CQG A;  3NZN A;  3QFA C;  3GST A;  1KBN A;  5IMC A;  2H75 A;  3GKX A;  2LRN A;  2WDU A;  2VCX A;  4GCI A;  2FLS A;  2DC5 A;  2H6Y A;  2MZC A;  4E8E A;  4JR6 A;  3KH7 A;  4D73 B;  6GSX A;  3LYP A;  3SBC A;  3S9F A;  1GSF A;  3A5I A;  2IMK A;  2FY6 A;  3PPU A;  5DCG A;  1XIY A;  1DBY A;  2LTK A;  4POK A;  2LKU A;  4CDO A;  5J9C A;  5CAX A;  2G0F A;  4AGS A;  1TU8 A;  4RQX A;  3GKK A;  5G5F A;  4MZB A;  4ZL8 A;  1OC3 A;  3APS A;  2I81 A;  5JWR B;  1SK0 A;  2XPE A;  3TGZ A;  3QAW A;  3GL5 A;  4ILF A;  5ECN B;  2NPB A;  3I69 A;  1M0U A;  5EY6 A;  3QAV A;  1U88 A;  1OAZ A;  1ZYQ B;  2H74 A;  2RII A;  2X99 A;  5D73 A;  4TR1 B;  3UBL A;  1GP1 A;  1XVW A;  3A5W A;  13GS A;  4WF4 A;  5KEJ A;  2KOK A;  4HSC X;  4ZBA A;  1Z9H A;  2A2P A;  2GS3 A;  4IP1 A;  1SK2 A;  1GRX A;  2ZNM A;  4Q5R A;  4I6X A;  2R37 A;  4BL7 B;  1K3L A;  1ON4 A;  4EXJ A;  2F8A A;  1ML6 A;  1EOG A;  4WBJ A;  1H75 A;  3E3E A;  3HY2 A;  2H30 A;  4AJ6 A;  3VWW A;  4ZB8 A;  1M7T A;  3HZ4 A;  1NW2 A;  1AQX A;  1TRW A;  2EIQ A;  1FOV A;  1EP7 A;  4DSS B;  1T4Y A;  3MWH A;  3CYN A;  1QXH A;  3HJM A;  4X0X A;  1HNA A;  2WGR A;  1XG8 A;  1I9D A;  3GX8 A;  2L5O A;  4KSM A;  2P5Q A;  1GNE A;  5C00 A;  2A4H A;  3OR5 A;  3BOA A;  3GFK A;  4XS4 B;  3MNG A;  3VFI A;  2KUC A;  5J5N A;  4G0K A;  3TJF A;  3O6T A;  3C73 A;  3GYK A;  5G5E A;  4ZB9 A;  1JHB A;  3FR3 A;  1XBS A;  3F6F A;  5CRE A;  4MK3 A;  4J56 E;  2CX3 A;  1T1V A;  1XVQ A;  4POL A;  1B9X C;  3W8S A;  5DJM A;  2DIY A;  2YZU A;  5IPH A;  4KSO A;  3VLN A;  4O92 A;  2JSY A;  2R4V A;  2PU9 C;  2C3N A;  3ZIJ A;  4F2I A;  5GAP D;  1U6T A;  3LEF A;  3TJJ A;  1S3A A;  3IE3 A;  2C80 A;  4F0C A;  3KP9 A;  1TI3 A;  1A0R P;  1K0B A;  4HU7 A;  1XFL A;  3L9V A;  1GSD A;  4KDU A;  3G7J A;  4D73 A;  1ACV A;  4N30 A;  4LLR A;  3TKS C;  3UOM A;  1N8J A;  2WCI A;  3ZRD A;  4MMM A;  3APO A;  1PN0 A;  4KDY A;  4O5Q A;  3N9J A;  5D9X A;  4EKZ A;  4KW6 A;  2FNO A;  4L0U A;  1GL8 A;  2VM1 A;  4NPB A;  17GS A;  3ZIV A;  3O3T A;  2E0Q A;  4ECJ A;  1LBK A;  3CSH A;  5KOW A;  4K6X A;  4CHS A;  2R0C A;  2HRK A;  3GRX A;  4YH2 A;  4MF6 A;  1FVK A;  4OCE A;  4CY8 A;  1PRX A;  1OKT A;  3C71 A;  4YQM A;  5BMU A;  4JU5 A;  2JU5 A;  1OC9 B;  2G2Q A;  2LQO A;  4TR1 A;  3DEX A;  3C7M A;  3A2V A;  4LMW A;  4EC0 A;  3F63 A;  4RQR A;  2ES7 A;  3UBK A;  2B5X A;  1MEK A;  3GN3 A;  1XWA A;  2F8F A;  2CAQ A;  3CMI A;  1W89 A;  1YEX A;  2QA1 A;  1S3R A;  2CAI A;  1ABA A;  3HJP A;  5ECI B;  1B9Y C;  2OE1 A;  3IOS A;  4KND A;  3DYR A;  3D4T A;  4BL7 A;  3ZL5 A;  3EU4 A;  1X9W B;  1VRS D;  1Q4J A;  1M99 A;  3K8N A;  3LGC A;  3R2Q A;  4PXO A;  4N10 A;  1VGL A;  3FKF A;  1MDK A;  1R5P A;  3IXR A;  1RK4 A;  2VLV A;  4DSS A;  2K8S A;  3ZTL A;  4FYB A;  1V40 A;  2H0H A;  4USS A;  4WBR D;  4PUF C;  4O32 A;  1MTC A;  2JL4 A;  2C4J A;  1EZK A;  3HYP A;  1YY7 A;  2JZR A;  3RPP A;  4ML1 A;  2LUS A;  3NOF A;  2H6Z A;  4XS4 A;  2OE0 A;  3VUR A;  4X4J A;  4ZBD A;  5CRH A;  1SEN A;  1OYJ A;  2FD3 A;  1T00 A;  1BX9 A;  2XC2 A;  3EWL A;  2VCT A;  4GTU A;  4NV2 A;  1SKR B;  2J9H A;  2NTO A;  1KEB A;  5F05 A;  3TKP A;  5INY A;  2E2G A;  4KH7 A;  16GS A;  2YJ7 A;  1O85 A;  1YJ6 A;  1K3O A;  5A4U A;  4I8B A;  4NHZ A;  2V32 A;  2PER A;  2M46 A;  3ZVJ D;  2DJ0 A;  2AYT A;  2F9S A;  3EE2 A;  2H72 A;  5D96 A;  2YZH A;  5IOW A;  1SKS B;  4L5L A;  3QPM A;  1K0N A;  3M9J A;  3LG6 A;  3HKR A;  4HJM A;  4QL7 A;  3TJB A;  5F07 A;  1PKZ A;  2QSI A;  3HA9 A;  3UL3 A;  1EOH A;  2B3S A;  5EPF A;  5ID2 B;  4KAE A;  3HVN A;  4Z2T A;  2DKI A;  2AHE A;  2FA8 A;  2DMM A;  4KDX A;  2A2S A;  2B7K A;  1PA3 A;  2DLX A;  3KMO A;  3H79 A;  5ECM B;  6GST A;  1PGT A;  4FIW A;  1QK8 A;  2WS2 A;  3G7Y A;  4GF0 A;  4XTS A;  2N5A A;  3FR9 A;  1WIK A;  3FMW A;  5IOX A;  2H01 A;  3VWX A;  5GST A;  2MMO A;  3IK9 A;  3LSZ A;  2JAC A;  1XWG A;  4HDE A;  1FAA A;  2R5G A;  4NHW A;  2MMA A;  4Z2U A;  3ZIT A;  1B4P A;  5D8I A;  4EL1 A;  2YPM A;  4GSN A;  2P0G A;  4GSS A;  1VF4 A;  2L5L A;  2M80 A;  3LWA A;  3AY8 A;  4XRD A;  3FR6 A;  4G9H A;  2O89 A;  4IVF A;  1OC9 A;  5IMD A;  2GZZ A;  1GSE A;  1ZOF A;  3KGK A;  2GSQ A;  1B48 A;  1O7U A;  3H1N A;  4FQU A;  2WZ9 A;  4K1F A;  1GSQ A;  5B8A A;  1ZYN A;  2GTU A;  3MIX A;  1QGV A;  4JE1 A;  3FW2 A;  5F8B A;  1HD2 A;  4K0G A;  4PQH A;  3BJ5 A;  3QMX A;  1Z5Y E;  4I2T A;  2L59 A;  3MDK A;  3TRP A;  4TVE A;  4BVY B;  2HT9 A;  4MJE A;  3MYD A;  1XZO A;  2YWM A;  3KP8 A;  1THX A;  5IMZ A;  1TJD A;  3IHQ A;  1YZX A;  1SK1 A;  2MYG A;  5B6N A;  2Z9S A;  1A2L A;  1CQH A;  2PN8 A;  2YWN A;  3TKS A;  5HFI A;  2IN3 A;  4X1U A;  3PGT A;  3EVI A;  4GRF A;  2KP1 A;  2YNX A;  22GS A;  2CA8 A;  4X43 A;  1GUL A;  4MZC A;  5ELG A;  3TCO A;  2R0G A;  1XWK A;  5GZZ B;  4KA0 A;  4MF7 A;  5A4V A;  4ISD A;  2DJJ A;  4WF5 A;  3F4S A;  5J9B A;  2O87 A;  4PUA A;  3WD6 A;  4OCF A;  1MD3 A;  5AN1 A;  3IV4 A;  5BRT A;  3N5O A;  3GL3 A;  3KTL A;  2ZUP A;  2N5F A;  4CY6 A;  4AJ8 A;  2F51 A;  2LNT A;  4TN8 A;  2VIM A;  5FHI A;  1EGO A;  4JED A;  5DQS A;  2DKH A;  2H6X A;  2QC7 A;  3TJG A;  3L4N A;  4ECC A;  1RW1 A;  2YN1 A;  3KIJ A;  1OC8 A;  3GIX A;  2HSH A;  3KXO A;  2H71 A;  1XXU A;  5ECK B;  4ACS A;  2I4A A;  5ID2 A;  1M2D A;  4IEL A;  4J57 E;  2OE3 A;  1YF0 A;  4IS0 A;  2DJ1 A;  2AJQ B;  2GSR A;  1PN9 A;  5B7C A;  5HFK A;  2LV3 A;  3FZA A;  3HDC A;  1WP0 A;  3TDG A;  5IMF A;  5DBQ A;  3ZLP A;  5LD0 A;  3A2W A;  2FHE A;  2JZS A;  2B6M A;  1BED A;  4IHU A;  1K0A A;  1JZR A;  1B4Q A;  5CRW A;  1XW9 A;  3ZZX A;  1X5D A;  4TR3 A;  5GSS A;  4PUR A;  3H93 A;  1ZMA A;  2D2Z A;  2HFD A;  3ZVJ A;  1AXD A;  3ME8 A;  2LJA A;  2IMD A;  2HZE B;  4J2F A;  5J3R A;  2HSY A;  4Z7X A;  5B8B A;  2K6V A;  2MBS A;  1TK0 B;  4XRA A;  4DSQ A;  4PTS A;  3IRA A;  3GKM A;  1XW6 A;  1E6B A;  2C0F A;  5IMA A;  1BYE A;  2TRC P;  1OVN A;  3GV1 A;  3DD3 A;  4V2L A;  2VL3 A;  3GSS A;  1K0C A;  1W4V A;  5KN0 A;  2GQM A;  1PFO A;  1TOF A;  4V1A p;  1U87 A;  5ECL B;  1R26 A;  5CP1 A;  2YWI A;  5DQY A;  2PGT A;  1WWJ A;  1EV9 A;  1E2Y A;  3VI5 A;  3EMX A;  2VD0 A;  3LXZ A;  4NWY A;  3J7Y b;  2LJK A;  3QCP A;  4BVY A;  3A2X A;  2B1L A;  3ERF A;  4YKF A;  1X5E A;  1V57 A;  3HXS A;  4MPG A;  5A5K A;  3TKQ A;  1FVJ A;  3UAR A;  4I5Q A;  1Z7P A;  2YP6 A;  1DE1 A;  4ZIJ A;  5KOX A;  2B5E A;  3KJY A;  1KTE A;  3CXG A;  1J0F A;  3IHG A;  4XS1 A;  3CSJ A;  1GNW A;  3FYG A;  6GSW A;  1WJK A;  3U5R E;  1A2J A;  5HR2 A;  4POM A;  1R7H A;  4YQV A;  3F3R A;  1WE0 A;  4ICY A;  1O6J A;  3RHC A;  1G7O A;  4XCS A;  3LJR A;  2X8C A;  1V98 A;  5KN2 A;  1TRV A;  4BWS A;  3TRX A;  4RI7 A;  3DGQ A;  5AIX A;  2DML A;  3RBT A;  3VPT A;  3ZRE A;  1F3A A;  3ZYW A;  1QMV A;  4N0V A;  2H1D A;  3FRC A;  3TOU A;  1HQO A;  4TRX A;  3DML A;  4ZL7 A;  8GSS A;  2R0P A;  1UN2 A;  4IW9 A;  5DCH A;  3EIN A;  1N2A A;  5E4W A;  1MDJ A;  1UA5 A;  4IBP A;  4EDZ A;  4KUN A;  2N5B A;  4YAV A;  2XBI A;  4IKH A;  1TK8 B;  3QFB C;  1EWX A;  2X64 A;  2P31 A;  1OE8 A;  2HSM A;  2L4C A;  3JCM L;  1QFN A;  1GTB A;  2HRN A;  3F0I A;  2FCH A;  2PVO C;  1O73 A;  20GS A;  1FB6 A;  2CX4 A;  3DKS A;  1GUM A;  2A2R A;  2E2M A;  3ZFB A;  2P5R A;  2GST A;  2DBC A;  4YAP A;  1ZL9 A;  2V6K A;  3ERG A;  18GS A;  3KH9 A;  3WGE A;  1J08 A;  1GWC A;  3M0F A;  3KD0 A;  2OBI A;  5JCG A;  3TOT A;  3PIN A;  3MSZ A;  2R3X A;  2LQQ A;  3C8E A;  1HNC A;  1EEM A;  1XWC A;  1FHE A;  3IAM 2;  4EF0 A;  2K9F A;  2HZE A;  5COH A;  4ZXG A;  19GS A;  2VO4 A;  3IBH A;  2MMZ A;  2WUL A;  2RLI A;  3QOU A;  4DSR A;  1RQM A;  4TXO B;  3QAG A;  1Z7R A;  2FWF A;  1K0M A;  1EP8 A;  1TK5 B;  1F3B A;  2YAN A;  1GLQ A;  5IQY A;  3VI7 A;  1WMJ A;  4N11 A;  2PMT A;  6GSS A;  5HR3 A;  3F4T A;  4ML6 A;  3TRQ A;  2L57 A;  1V9W A;  3R3E A;  3CRT A;  3VWV A;  2OA7 A;  1SJ6 A;  1IYH A;  3BBY A;  2QKE A;  1B8X A;  2LST A;  3QR6 A;  3RAZ A;  1EEJ A;  2PVQ A;  3BCI A;  4OO5 A;  4KF9 A;  2K18 A;  4MPF A;  1R5A A;  2VCW A;  3MAK A;  1T7P B;  4L5O A;  5IMV A;  2FWE A;  3IC4 A;  1I5G A;  4MA9 A;  5J41 A;  4IQ1 A;  3APQ A;  3EU3 A;  4WKW A;  4I2U A;  4AF2 A;  4K2X A;  4IJI A;  4KGI A;  5DJL A;  2GT6 A;  1QUW A;  2LRT A;  1AC1 A;  2VL9 A;  3PR8 A;  4G0I A;  5EVO A;  2H0I A;  3UAP A;  2OJL A;  3O76 A;  3IK7 A;  4FYC A;  2LJR A;  1UC7 A;  1T8E B;  3TKS E;  3FHK A;  2H1G A;  4GST A;  2O7K A;  4HUA A;  1F2E A;  10GS A;  4NAX A;  1ZCP A;  3EMP A;  1Z3E A;  3EUR A;  1GSS A;  4OMV A;  2ON7 A;  1X0R A;  2BJX A;  1XCC A;  2GGT A;  4JRR A;  1K0O A;  4NMU A;  1TW9 A;  5GAN D;  3KCM A;  4H86 A;  4TOP A;  4NXI A;  2FWG A;  1TU7 A;  2L6D A;  1M9B A;  2V1M A;  5JWQ B;  3GH6 A;  1NSW A;  1YQ1 A;  3L9S A;  1K0D A;  2O85 A;  3M3M A;  2XHF A;  4BVX B;  1SYR A;  5G31 A;  3HVS A;  4FO5 A;  3GKN A;  4XHM A;  3GNJ A;  1LJR A;  3HZ8 A;  1AAZ A;  3TJK A;  2YV9 A;  3L78 A;  2R6K A;  14GS A;  4BWQ A;  4G19 A;  4K2D A;  1SKW B;  4PQI A;  1GUK A;  2HNL A;  4K0N A;  2GT5 A;  4XIH A;  1UVZ A;  1O8W A;  3Q19 A;  1ILO A;  2B1K A;  2KHP A;  4EIP A;  6GSV A;  2FUG 2;  4TR4 A;  5H5Q A;  4OWY A;  4MJB A;  1WPI A;  1KNG A;  3WGX A;  1O81 A;  3UMA A;  5HR1 A;  2RM5 A;  3QDN A; 
#chains in the Genus database with same CATH homology
 5ECS A;  4HQS A;  2HRF A;  4Q5F A;  3LOR A;  5JWO B;  1TTZ A;  2J23 A;  2R2J A;  4N0Z A;  4HU9 A;  2CVD A;  4OO4 A;  4MDC A;  1G7E A;  4E8H A;  3W8J A;  4TXO A;  4IN0 A;  2ZCT A;  3QD9 A;  3V1W A;  3ZML A;  2C0D A;  2OBK A;  3IAS 2;  2YJH A;  1Y6E A;  3HCZ A;  2VLU A;  4MF5 A;  4V2M A;  4GXZ A;  1DE2 A;  3P7X A;  4EIQ A;  4K7O A;  3SWL A;  3P90 A;  5HR0 A;  4EUY A;  1YEP A;  2EC4 A;  1GTU A;  4BPY A;  2VL2 A;  4Z2R A;  1X5C A;  4HZ2 A;  2AAW A;  2EIO A;  2YCD A;  4K5R A;  1F6M C;  1PX6 A;  4G0L A;  3D0Z A;  2H0G A;  2IIY A;  1GSU A;  1XWB A;  4WXT A;  4Q5N A;  1YKC A;  2C3Q A;  2O8V B;  2FA4 A;  2BTO T;  3L9U A;  2HXK A;  3M9K A;  5H5R A;  2C1Y A;  5IPG A;  2TRX A;  3P8W A;  2I3Y A;  2CQ9 A;  2IWT A;  5DAL B;  3ERW A;  4IQA A;  3WT1 A;  4LL4 B;  1S3D A;  3IDV A;  1Z6M A;  3H8Q A;  2UZ8 A;  4G2E A;  3U6V A;  3EC3 A;  4TKY A;  3C1S A;  5IIZ A;  3C1R A;  1G6Y A;  4ECI A;  1PSQ A;  3EYT A;  1LU4 A;  4JBB A;  1U3I A;  1JLV A;  3IR4 A;  5G1L A;  2XPD A;  4A5P A;  4AJ7 A;  5IO0 A;  11GS A;  3FZ5 A;  1PD2 1;  1GTA A;  1XOA A;  2VLT A;  5C04 A;  3LYK A;  4GWR A;  2C0E A;  2C3T A;  3FZ4 A;  3HVV A;  3Q6O A;  4HZ4 A;  5KN1 A;  1NM3 A;  3D6I A;  5HQP A;  4OFN A;  4BVX A;  2VCV A;  3RHB A;  1NHO A;  1FO5 A;  1EGR A;  1X9M B;  2E7P A;  2JAD A;  3UIW A;  1URM A;  1GSY A;  12GS A;  1PMT A;  1K3Y A;  4F9Z A;  1G0T A;  4JZQ A;  2ALB A;  5DVB A;  5DAK B;  3CTG A;  2B5Y A;  4DVC A;  5KN3 A;  5JCW A;  1GTI A;  3RPN A;  3HJO A;  5ECH B;  4PNG A;  1F9M A;  3G7I A;  2H73 A;  3LQ7 A;  2JZT A;  5D9W A;  2OKA A;  5AIV A;  2X8G A;  2KP2 A;  3A3T A;  4L8E A;  4EO3 A;  5CRG A;  2C8U A;  2YOI A;  4IJ3 A;  4TXV A;  1YF1 A;  2PBJ A;  4K9Z A;  3DXB A;  2HI7 A;  9GSS A;  3FY7 A;  4WR5 A;  4YQU A;  1G6W A;  2H76 A;  1Y25 A;  3NIV A;  2PPT A;  3D22 A;  4NV5 A;  5LNK e;  4K8M A;  1M2A A;  2XBQ A;  2YWO A;  2GVP A;  2IJY A;  3DRN A;  3LXT A;  2VM2 A;  2NDO A;  2WRT A;  2VCZ A;  1SU9 A;  2GQL A;  4HJ2 A;  1HNB A;  2QGV A;  3GX0 A;  2HE3 A;  1H4O A;  2NVL A;  2WFC A;  1T4Z A;  1S3C A;  5CO3 A;  2HZF A;  3I6A A;  2X8H A;  4QL9 A;  3GA4 A;  3IC8 A;  3CBU A;  5G2Z A;  2V41 A;  1PKW A;  4V1A g;  3D5J A;  5AGY A;  4ZBB A;  4MH2 A;  4MNN A;  1OKD A;  3BCK A;  1JZO A;  1SD8 A;  4MAB A;  2QA2 A;  2A4V A;  2ON5 A;  3E9J B;  5ECQ B;  4KX4 A;  3WGD A;  2LEG A;  2H70 A;  2IMF A;  1VF1 A;  3CTF A;  1GLP A;  2DJ3 A;  5DDL A;  1A0F A;  4KCE A;  3VK9 A;  2VL2 C;  1BJX A;  4EVM A;  4O5R A;  1ZYE A;  2DJ2 A;  4HS1 A;  3F6D A;  4KE3 A;  2LRC A;  3E0U A;  4GLT A;  3P2A A;  1FW1 A;  5DAL A;  1T3B A;  1PQN A;  3WYW A;  1EV4 A;  1JLW A;  3KM6 A;  4ZIL A;  2OAD A;  1ST9 A;  2DJK A;  2RM6 A;  3ZFL A;  2FWH A;  4MLY A;  5F06 A;  3D4M A;  2H1A A;  1WOU A;  2V6O A;  2IFQ B;  1BG5 A;  3VPQ A;  5EL8 A;  1U3A A;  2I9H A;  3KZQ A;  3CSI A;  1TP9 A;  4LL1 B;  2CZ3 A;  3WT2 A;  3ED3 A;  1ERU A;  5HFG A;  1BAY A;  2VOC A;  4PQ1 A;  3BD2 A;  2VD1 A;  4OD7 A;  3G9B A;  2PWJ A;  1TXX A;  2IPA A;  5H5S A;  2LNS A;  1A8Y A;  3Q74 A;  3HD5 A;  2TIR A;  4ID0 A;  4WET A;  4ECB A;  2YV7 A;  3US3 A;  5B6M A;  1FB0 A;  3H4K A;  5CNW A;  2C0G A;  2GSS A;  1FOH A;  4ZL9 A;  3FEU A;  4FYU A;  3GH9 A;  2DSA A;  5ENU A;  4HQZ A;  1ZYP A;  4TW5 A;  1AW9 A;  3LFL A;  2PUK C;  1M2B A;  3I9V 2;  5DAK A;  2VAF A;  2MBT A;  1Q98 A;  2AB6 A;  3F3Q A;  4DEJ A;  2HLS A;  1ERT A;  4Q5Q A;  1A23 A;  2AV4 A;  3IPZ A;  4HOJ A;  4MCU A;  3F8U A;  3DIE A;  1M9A A;  1TI1 A;  2WB9 A;  2L6C A;  3F4R A;  1IYI A;  4RI6 A;  5A4W A;  4F0B A;  2NBS A;  3UEM A;  3I43 A;  4LA1 A;  5CYY A;  4MJC A;  4EDY A;  5ECO B;  2K8V A;  1SJI A;  1SL2 B;  5D93 A;  4K5S A;  2CT6 A;  1XOB A;  4K7N A;  3GMF A;  4MH3 A;  2GZY A;  7GSS A;  4IGJ A;  1USB A;  2F3M A;  2IMI A;  1A24 A;  4JR4 A;  2GZP A;  4V2N A;  1J9B A;  2CV4 A;  3GTU B;  4ZB6 A;  4OFM A;  3EPT A;  1SL0 B;  1ZZY A;  2VCQ A;  2LS5 A;  1AQW A;  1DUG A;  4O5U A;  3TUE A;  3UVT A;  1GUH A;  4L0W A;  1AQV A;  2REM A;  3KTB A;  3UJ1 A;  6GSY A;  3GUS A;  3ISO A;  2CVB A;  3CRU A;  3M1G A;  4TR0 A;  1SYX A;  1VF2 A;  1THO A;  1TDI A;  4O7H A;  2HRA A;  2L4Q A;  4OFT A;  4LMV A;  1XPV A;  1PL1 A;  3FZ9 A;  4GQF A;  4F82 A;  1VF3 A;  3VWU A;  1ERV A;  2EIR A;  4PNF A;  3ME7 A;  1PX7 A;  5ELA A;  1SL1 B;  2CVK A;  1GH2 A;  2CZ2 A;  4KCA A;  5LCZ A;  4BA7 A;  3RDW A;  2VUP A;  1A2M A;  6GSU A;  5AIS A;  1DSB A;  3W6G A;  4MZW A;  4YKG A;  2B7J A;  2H66 A;  1XW5 A;  4PGT A;  2IFQ A;  2GLR A;  1R4W A;  4XS6 A;  3GHA A;  1BQ7 A;  3D21 A;  2RUF A;  3KMN A;  2HYX A;  3KEB A;  1NHY A;  1WRY A;  1Z6N A;  4MJA A;  1MD4 A;  5FWG A;  3TB2 A;  3F9U A;  2X4A A;  4WR4 A;  4KB3 A;  5J4U A;  4HI7 A;  1QQ2 A;  1TKD B;  2IL3 A;  2IME A;  3HHV A;  2JSZ A;  4GQC A;  1MDI A;  3ZMK A;  3FK8 A;  4PX1 A;  5D9T A;  5E59 A;  5ABR A;  2DIZ A;  4FH8 A;  2I1U A;  5ECP B;  2X49 A;  5F0G A;  4F03 A;  5G30 A;  1JZD A;  4P3Y B;  2BMX A;  4I97 A;  3UVH A;  2KLX A;  2H1B A;  5IO2 A;  3DVX A;  2H19 A;  1SD9 A;  5L71 A;  3M8N A;  2V2G A;  3HVX A;  1YKA A;  2WJU A;  5D9V A;  4WEY A;  1SJZ A;  3IA1 A;  4HEA 2;  5JCU A;  1FG4 A;  1V58 A;  4K7I A;  3Q18 A;  4ULX A;  1AUC A;  2H8L A;  3DVW A;  3GUR A;  5CRD A;  2FGX A;  4MP4 A;  1C72 A;  3TKR A;  1YDK A;  1AIU A;  5FT3 A;  2RUE A;  4POB A;  1HYU A;  1O8X A;  2GQK A;  1V2A A;  5IM9 A;  1TRS A;  1JFU A;  2MMN A;  1F37 A;  4QQ7 A;  3J7Y k;  2AUV A;  5ECR B;  4RUV A;  4CW9 A;  5G1K A;  4EE0 A;  3L0H A;  1PL2 A;  1JZW A;  3DWV A;  2OAC A;  1TRU A;  4G10 A;  3LW9 A;  3PH9 A;  1X9S B;  1A8L A;  1ZGN A;  3GTU A;  2GDR A;  1OE7 A;  1ERW A;  2M72 A;  4IP6 A;  1CQG A;  3NZN A;  3QFA C;  3GST A;  1KBN A;  5IMC A;  2H75 A;  3GKX A;  2LRN A;  2WDU A;  2VCX A;  4GCI A;  2FLS A;  2DC5 A;  2H6Y A;  2MZC A;  4E8E A;  4JR6 A;  3KH7 A;  4D73 B;  6GSX A;  3LYP A;  3SBC A;  3S9F A;  1GSF A;  3A5I A;  2IMK A;  2FY6 A;  3PPU A;  5DCG A;  1XIY A;  1DBY A;  2LTK A;  4POK A;  2LKU A;  4CDO A;  5J9C A;  5CAX A;  2G0F A;  4AGS A;  1TU8 A;  4RQX A;  3GKK A;  5G5F A;  4MZB A;  4ZL8 A;  1OC3 A;  3APS A;  2I81 A;  5JWR B;  1SK0 A;  2XPE A;  3TGZ A;  3QAW A;  3GL5 A;  4ILF A;  5ECN B;  2NPB A;  3I69 A;  1M0U A;  5EY6 A;  3QAV A;  1U88 A;  1OAZ A;  1ZYQ B;  2H74 A;  2RII A;  5D73 A;  2X99 A;  4TR1 B;  3UBL A;  1GP1 A;  1XVW A;  3A5W A;  13GS A;  4WF4 A;  5KEJ A;  2KOK A;  4ZBA A;  1Z9H A;  2A2P A;  2GS3 A;  4IP1 A;  1SK2 A;  1GRX A;  2ZNM A;  4Q5R A;  4I6X A;  2R37 A;  4BL7 B;  1K3L A;  1ON4 A;  4EXJ A;  2F8A A;  1ML6 A;  1EOG A;  4WBJ A;  1H75 A;  3E3E A;  3HY2 A;  2H30 A;  4AJ6 A;  3VWW A;  4ZB8 A;  1M7T A;  3HZ4 A;  1NW2 A;  1AQX A;  1TRW A;  2EIQ A;  1FOV A;  1EP7 A;  4DSS B;  1T4Y A;  3MWH A;  3CYN A;  1QXH A;  3HJM A;  4X0X A;  1HNA A;  2WGR A;  1I9D A;  3GX8 A;  2L5O A;  4KSM A;  2P5Q A;  1GNE A;  5C00 A;  2A4H A;  3OR5 A;  3BOA A;  3GFK A;  4XS4 B;  3MNG A;  3VFI A;  2KUC A;  5J5N A;  4G0K A;  3TJF A;  3O6T A;  3C73 A;  3GYK A;  5G5E A;  4ZB9 A;  1JHB A;  3FR3 A;  1XBS A;  3F6F A;  5CRE A;  4MK3 A;  4J56 E;  2CX3 A;  1T1V A;  1XVQ A;  4POL A;  1B9X C;  3W8S A;  5DJM A;  2DIY A;  2YZU A;  5IPH A;  4KSO A;  3VLN A;  4O92 A;  2JSY A;  2R4V A;  2PU9 C;  2C3N A;  3ZIJ A;  4F2I A;  5GAP D;  1U6T A;  3LEF A;  3TJJ A;  1S3A A;  3IE3 A;  2C80 A;  4F0C A;  3KP9 A;  1TI3 A;  1A0R P;  1K0B A;  4HU7 A;  1XFL A;  3L9V A;  1GSD A;  4KDU A;  3G7J A;  4D73 A;  1ACV A;  4N30 A;  4LLR A;  3TKS C;  3UOM A;  1N8J A;  2WCI A;  3ZRD A;  4MMM A;  3APO A;  1PN0 A;  4KDY A;  4O5Q A;  3N9J A;  5D9X A;  4EKZ A;  4KW6 A;  2FNO A;  4L0U A;  1GL8 A;  2VM1 A;  4NPB A;  17GS A;  3ZIV A;  3O3T A;  2E0Q A;  4ECJ A;  1LBK A;  3CSH A;  5KOW A;  4K6X A;  4CHS A;  2R0C A;  2HRK A;  3GRX A;  4YH2 A;  4MF6 A;  1FVK A;  4OCE A;  4CY8 A;  1PRX A;  1OKT A;  3C71 A;  4YQM A;  5BMU A;  4JU5 A;  2JU5 A;  1OC9 B;  2G2Q A;  2LQO A;  4TR1 A;  3DEX A;  3C7M A;  3A2V A;  4LMW A;  4EC0 A;  3F63 A;  4RQR A;  2ES7 A;  3UBK A;  2B5X A;  1MEK A;  3GN3 A;  1XWA A;  2F8F A;  2CAQ A;  3CMI A;  1W89 A;  1YEX A;  2QA1 A;  2CAI A;  1ABA A;  3HJP A;  5ECI B;  1B9Y C;  2OE1 A;  3IOS A;  4KND A;  3DYR A;  3D4T A;  4BL7 A;  3ZL5 A;  3EU4 A;  1X9W B;  1VRS D;  1Q4J A;  1M99 A;  3K8N A;  3LGC A;  3R2Q A;  4PXO A;  4N10 A;  1VGL A;  3FKF A;  1MDK A;  1R5P A;  3IXR A;  1RK4 A;  2VLV A;  4DSS A;  2K8S A;  3ZTL A;  4FYB A;  1V40 A;  2H0H A;  4USS A;  4WBR D;  4PUF C;  4O32 A;  1MTC A;  2JL4 A;  2C4J A;  1EZK A;  3HYP A;  1YY7 A;  2JZR A;  3RPP A;  4ML1 A;  2LUS A;  3NOF A;  2H6Z A;  4XS4 A;  2OE0 A;  3VUR A;  4X4J A;  4ZBD A;  5CRH A;  1SEN A;  1OYJ A;  2FD3 A;  1T00 A;  1BX9 A;  2XC2 A;  3EWL A;  2VCT A;  4GTU A;  4NV2 A;  1SKR B;  2J9H A;  2NTO A;  1KEB A;  5F05 A;  3TKP A;  5INY A;  2E2G A;  4KH7 A;  16GS A;  2YJ7 A;  1O85 A;  1YJ6 A;  1K3O A;  5A4U A;  4I8B A;  4NHZ A;  2V32 A;  2PER A;  2M46 A;  3ZVJ D;  2DJ0 A;  2AYT A;  2F9S A;  3EE2 A;  2H72 A;  5D96 A;  2YZH A;  5IOW A;  1SKS B;  4L5L A;  3QPM A;  1K0N A;  3M9J A;  3LG6 A;  3HKR A;  4HJM A;  4QL7 A;  3TJB A;  5F07 A;  1PKZ A;  2QSI A;  3HA9 A;  3UL3 A;  1EOH A;  2B3S A;  5EPF A;  5ID2 B;  4KAE A;  4Z2T A;  2DKI A;  2AHE A;  2FA8 A;  2DMM A;  4KDX A;  2A2S A;  2B7K A;  1PA3 A;  2DLX A;  3KMO A;  3H79 A;  5ECM B;  6GST A;  1PGT A;  4FIW A;  1QK8 A;  2WS2 A;  3G7Y A;  4GF0 A;  4XTS A;  2N5A A;  3FR9 A;  1WIK A;  3FMW A;  5IOX A;  2H01 A;  3VWX A;  5GST A;  2MMO A;  3IK9 A;  3LSZ A;  2JAC A;  1XWG A;  4HDE A;  1FAA A;  2R5G A;  4NHW A;  2MMA A;  4Z2U A;  3ZIT A;  1B4P A;  5D8I A;  4EL1 A;  2YPM A;  4GSN A;  2P0G A;  4GSS A;  1VF4 A;  2L5L A;  2M80 A;  3LWA A;  3AY8 A;  4XRD A;  3FR6 A;  4G9H A;  2O89 A;  4IVF A;  1OC9 A;  5IMD A;  2GZZ A;  1GSE A;  1ZOF A;  3KGK A;  2GSQ A;  1B48 A;  1O7U A;  3H1N A;  4FQU A;  2WZ9 A;  4K1F A;  1GSQ A;  5B8A A;  1ZYN A;  2GTU A;  3MIX A;  1QGV A;  4JE1 A;  3FW2 A;  5F8B A;  1HD2 A;  4K0G A;  4PQH A;  3BJ5 A;  3QMX A;  1Z5Y E;  4I2T A;  2L59 A;  3MDK A;  3TRP A;  4TVE A;  4BVY B;  2HT9 A;  4MJE A;  3MYD A;  1XZO A;  2YWM A;  3KP8 A;  1THX A;  5IMZ A;  1TJD A;  3IHQ A;  1YZX A;  1SK1 A;  2MYG A;  5B6N A;  2Z9S A;  1A2L A;  1CQH A;  2PN8 A;  2YWN A;  3TKS A;  5HFI A;  2IN3 A;  4X1U A;  3PGT A;  3EVI A;  4GRF A;  2KP1 A;  2YNX A;  22GS A;  2CA8 A;  4X43 A;  1GUL A;  4MZC A;  5ELG A;  3TCO A;  2R0G A;  1XWK A;  5GZZ B;  4KA0 A;  4MF7 A;  5A4V A;  4ISD A;  2DJJ A;  4WF5 A;  3F4S A;  5J9B A;  2O87 A;  4PUA A;  3WD6 A;  4OCF A;  1MD3 A;  5AN1 A;  3IV4 A;  5BRT A;  3N5O A;  3GL3 A;  3KTL A;  2ZUP A;  2N5F A;  4CY6 A;  4AJ8 A;  2F51 A;  2LNT A;  4TN8 A;  2VIM A;  5FHI A;  1EGO A;  4JED A;  5DQS A;  2DKH A;  2H6X A;  2QC7 A;  3TJG A;  3L4N A;  4ECC A;  1RW1 A;  2YN1 A;  3KIJ A;  1OC8 A;  3GIX A;  2HSH A;  3KXO A;  2H71 A;  1XXU A;  5ECK B;  4ACS A;  2I4A A;  5ID2 A;  1M2D A;  4IEL A;  4J57 E;  2OE3 A;  1YF0 A;  4IS0 A;  2DJ1 A;  2AJQ B;  2GSR A;  1PN9 A;  5B7C A;  5HFK A;  2LV3 A;  3FZA A;  3HDC A;  1WP0 A;  3TDG A;  5IMF A;  5DBQ A;  3ZLP A;  5LD0 A;  3A2W A;  2FHE A;  2JZS A;  2B6M A;  1BED A;  4IHU A;  1K0A A;  1JZR A;  1B4Q A;  5CRW A;  1XW9 A;  3ZZX A;  1X5D A;  4TR3 A;  5GSS A;  4PUR A;  3H93 A;  1ZMA A;  2D2Z A;  2HFD A;  3ZVJ A;  1AXD A;  3ME8 A;  2LJA A;  2IMD A;  2HZE B;  4J2F A;  5J3R A;  2HSY A;  4Z7X A;  5B8B A;  2K6V A;  2MBS A;  1TK0 B;  4XRA A;  4DSQ A;  4PTS A;  3IRA A;  3GKM A;  1XW6 A;  1E6B A;  2C0F A;  5IMA A;  1BYE A;  2TRC P;  1OVN A;  3GV1 A;  3DD3 A;  4V2L A;  2VL3 A;  3GSS A;  1K0C A;  1W4V A;  5KN0 A;  2GQM A;  1TOF A;  4V1A p;  1U87 A;  5ECL B;  1R26 A;  5CP1 A;  2YWI A;  5DQY A;  2PGT A;  1WWJ A;  1EV9 A;  1E2Y A;  3VI5 A;  3EMX A;  2VD0 A;  3LXZ A;  4NWY A;  3J7Y b;  2LJK A;  3QCP A;  4BVY A;  3A2X A;  2B1L A;  3ERF A;  4YKF A;  1X5E A;  1V57 A;  3HXS A;  4MPG A;  5A5K A;  3TKQ A;  1FVJ A;  3UAR A;  4I5Q A;  1Z7P A;  2YP6 A;  1DE1 A;  4ZIJ A;  5KOX A;  2B5E A;  3KJY A;  1KTE A;  3CXG A;  1J0F A;  3IHG A;  4XS1 A;  3CSJ A;  1GNW A;  3FYG A;  6GSW A;  1WJK A;  3U5R E;  1A2J A;  5HR2 A;  4POM A;  1R7H A;  4YQV A;  3F3R A;  1WE0 A;  4ICY A;  1O6J A;  3RHC A;  1G7O A;  4XCS A;  3LJR A;  2X8C A;  1V98 A;  5KN2 A;  1TRV A;  4BWS A;  3TRX A;  4RI7 A;  3DGQ A;  5AIX A;  2DML A;  3RBT A;  3VPT A;  3ZRE A;  1F3A A;  3ZYW A;  1QMV A;  4N0V A;  2H1D A;  3FRC A;  3TOU A;  1HQO A;  4TRX A;  3DML A;  4ZL7 A;  8GSS A;  2R0P A;  1UN2 A;  4IW9 A;  5DCH A;  3EIN A;  1N2A A;  5E4W A;  1MDJ A;  1UA5 A;  4IBP A;  4EDZ A;  4KUN A;  2N5B A;  4YAV A;  2XBI A;  4IKH A;  1TK8 B;  3QFB C;  1EWX A;  2X64 A;  2P31 A;  1OE8 A;  2HSM A;  2L4C A;  3JCM L;  1QFN A;  1GTB A;  2HRN A;  3F0I A;  2FCH A;  2PVO C;  1O73 A;  20GS A;  1FB6 A;  2CX4 A;  3DKS A;  1GUM A;  2A2R A;  2E2M A;  3ZFB A;  2P5R A;  2GST A;  2DBC A;  4YAP A;  1ZL9 A;  2V6K A;  3ERG A;  18GS A;  3KH9 A;  3WGE A;  1J08 A;  1GWC A;  3M0F A;  3KD0 A;  2OBI A;  5JCG A;  3TOT A;  3PIN A;  3MSZ A;  2R3X A;  2LQQ A;  3C8E A;  1HNC A;  1EEM A;  1XWC A;  1FHE A;  3IAM 2;  4EF0 A;  2K9F A;  2HZE A;  5COH A;  4ZXG A;  19GS A;  2VO4 A;  3IBH A;  2MMZ A;  2WUL A;  2RLI A;  3QOU A;  4DSR A;  1RQM A;  4TXO B;  3QAG A;  1Z7R A;  2FWF A;  1K0M A;  1EP8 A;  1TK5 B;  1F3B A;  2YAN A;  1GLQ A;  5IQY A;  3VI7 A;  1WMJ A;  4N11 A;  2PMT A;  6GSS A;  5HR3 A;  3F4T A;  4ML6 A;  3TRQ A;  2L57 A;  1V9W A;  3R3E A;  3CRT A;  3VWV A;  2OA7 A;  1SJ6 A;  1IYH A;  3BBY A;  2QKE A;  1B8X A;  2LST A;  3QR6 A;  3RAZ A;  1EEJ A;  2PVQ A;  3BCI A;  4OO5 A;  4KF9 A;  2K18 A;  4MPF A;  1R5A A;  2VCW A;  3MAK A;  1T7P B;  4L5O A;  5IMV A;  2FWE A;  3IC4 A;  1I5G A;  4MA9 A;  5J41 A;  4IQ1 A;  3APQ A;  3EU3 A;  4WKW A;  4I2U A;  4AF2 A;  4K2X A;  4IJI A;  4KGI A;  5DJL A;  2GT6 A;  1QUW A;  2LRT A;  1AC1 A;  2VL9 A;  3PR8 A;  4G0I A;  5EVO A;  2H0I A;  3UAP A;  2OJL A;  3O76 A;  3IK7 A;  4FYC A;  2LJR A;  1UC7 A;  1T8E B;  3TKS E;  3FHK A;  2H1G A;  4GST A;  2O7K A;  4HUA A;  1F2E A;  10GS A;  4NAX A;  1ZCP A;  3EMP A;  1Z3E A;  3EUR A;  1GSS A;  4OMV A;  2ON7 A;  1X0R A;  2BJX A;  1XCC A;  2GGT A;  4JRR A;  1K0O A;  4NMU A;  1TW9 A;  5GAN D;  3KCM A;  4H86 A;  4TOP A;  4NXI A;  2FWG A;  1TU7 A;  2L6D A;  1M9B A;  2V1M A;  5JWQ B;  3GH6 A;  1NSW A;  1YQ1 A;  3L9S A;  1K0D A;  2O85 A;  3M3M A;  2XHF A;  4BVX B;  1SYR A;  5G31 A;  3HVS A;  4FO5 A;  3GKN A;  4XHM A;  3GNJ A;  1LJR A;  3HZ8 A;  1AAZ A;  3TJK A;  2YV9 A;  3L78 A;  2R6K A;  14GS A;  4BWQ A;  4G19 A;  4K2D A;  1SKW B;  4PQI A;  1GUK A;  2HNL A;  4K0N A;  2GT5 A;  4XIH A;  1UVZ A;  1O8W A;  3Q19 A;  1ILO A;  2B1K A;  2KHP A;  4EIP A;  6GSV A;  2FUG 2;  4TR4 A;  5H5Q A;  4OWY A;  4MJB A;  1WPI A;  1KNG A;  3WGX A;  1O81 A;  3UMA A;  5HR1 A;  2RM5 A;  3QDN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...