4F82A

X-ray crystal structure of a putative thioredoxin reductase from burkholderia cenocepacia
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
171
structure length
171
Chain Sequence
b'HHHMIQVGDALPDAQLFEFIDDAREGCTLGPNACSVRDQVAGKRVVIFGLPGAFTPTCSAQHVPGYVEHAEQLRAAGIDEIWCVSVNDAFVMGAWGRDLHTAGKVRMMADGSAAFTHALGLTQDLSARGMGIRSLRYAMVIDGGVVKTLAVEAPGKFEVSDAASVLATLTS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thioredoxin Reductase
publication title X-ray crystal structure of a putative thioredoxin reductase from Burkholderia cenocepacia
rcsb
source organism Burkholderia cenocepacia
molecule tags Oxidoreductase
total genus 46
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08534 Redoxin Redoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4f82A00
4YQUA 2OE3A 3N5OA 2K6VA 2WGRA 4ECJA 3QFBC 4K9ZA 5KN3A 3ZLPA 2TIRA 1I9DA 3HCZA 2XPDA 4Z7XA 1M0UA 1T7PB 2O89A 4F2IA 3HZ4A 5ECQB 1OC9B 1DUGA 5J5NA 2F8AA 1Z6MA 1VRSD 2L5OA 5DVBA 3G7JA 3V1WA 3VWWA 3D22A 3KCMA 2VM2A 1UC7A 2E7PA 2K18A 4L5LA 2YV7A 2YWNA 1F6MC 4TR4A 4X43A 4WXTA 4IQ1A 2VOCA 1G7OA 2MMAA 3GMFA 1NW2A 1X9MB 4LL4B 4F0BA 1FW1A 1O8XA 4KDXA 4KW6A 1TRWA 3J7Yk 2M46A 2YWIA 3IR4A 4ZBBA 1LU4A 2H1DA 2C0DA 4DSSA 4I2UA 4JE1A 1CQHA 3H8QA 1ML6A 2P31A 4ECCA 1GLPA 1GUKA 2VO4A 4DVCA 4TKYA 2F51A 2I9HA 3UVHA 2DJ1A 2H76A 4KSMA 3R2QA 3GSSA 4PQIA 3D4TA 1YEXA 1AC1A 3DYRA 3I6AA 4KCEA 2GSRA 3C1RA 4PNFA 4GQCA 4NHWA 1PX6A 5IMVA 5LD0A 4NHZA 2E2MA 4NAXA 4TOPA 4BVYA 3ZREA 3DWVA 2G2QA 3RDWA 1N2AA 5ID2B 1NHYA 3QMXA 2CZ2A 1HD2A 1PRXA 3KJYA 4YH2A 2YANA 3E0UA 4KGIA 2I4AA 2FWGA 1PX7A 5CYYA 1RQMA 2HI7A 4EVMA 3IPZA 2YJ7A 3TDGA 4BA7A 1QUWA 2X8CA 1TJDA 2WCIA 3G7IA 1SL1B 1MD3A 1OYJA 3RPPA 3RPNA 3ZTLA 1SK0A 2CQ9A 3UBLA 5IMCA 3JCML 5G1KA 3KMOA 1GTAA 3KM6A 5ECKB 1V98A 5F8BA 2RM5A 3GN3A 1XIYA 2GTUA 2F8FA 3CYNA 3QAWA 1FO5A 3UMAA 4K7OA 4ID0A 2LTKA 4EDYA 5EPFA 5KN1A 1FVKA 5ECPB 3HJOA 1QGVA 4PQHA 1WE0A 1TK8B 2VCQA 3UBKA 3Q18A 3EMXA 4MA9A 1HNBA 3P8WA 4LA1A 3HJMA 4KNDA 4NV2A 3F8UA 1B8XA 2YJHA 2TRCP 4TXOB 3TRXA 2WULA 5DAKA 5HFKA 3W8SA 2MMOA 3EYTA 3VWVA 4DSSB 2HRNA 1GSFA 4IVFA 1XVQA 2L4CA 4MF7A 3GKNA 3KP8A 3N9JA 4G19A 2RM6A 5D93A 5F0GA 1ERUA 4JR4A 4MPFA 2QGVA 2PUKC 3LQ7A 3D6IA 5G30A 3L9VA 5EL8A 4GSSA 1SKRB 3G9BA 3FZ9A 4MDCA 2D2ZA 2MYGA 3FZAA 3H93A 2CVBA 1WJKA 1M9BA 1OC8A 4CHSA 3FW2A 1T1VA 2H30A 1SJIA 4J57E 1BEDA 4WR4A 5IMFA 2NBSA 2RUFA 3EINA 5ECNB 2B7JA 4XS4B 1PD21 2WDUA 3GYKA 2VCXA 2JZRA 2PMTA 3CBUA 2LV3A 3HA9A 3DRNA 1EEJA 1PN9A 3UOMA 1TRVA 3DMLA 3GRXA 1X0RA 2V6OA 1TRUA 3LGCA 4V2NA 2LJKA 1R7HA 4KB3A 4MP4A 2PU9C 2DIYA 1WRYA 4GF0A 2AJQB 5AGYA 3EU3A 2B7KA 2CT6A 3F3RA 3RHCA 3P7XA 2WRTA 3ZL5A 22GSA 3FEUA 1AUCA 4HUAA 1NM3A 3LWAA 1PMTA 4HDEA 4XCSA 2I1UA 5AIVA 1ERWA 2C4JA 1SYXA 2NDOA 5IO0A 2FY6A 3F4RA 5ECHB 3TCOA 3IC4A 11GSA 3SWLA 4KX4A 1EOHA 5G1LA 1DBYA 4PUFC 2GVPA 3A2XA 1K3YA 2VCTA 4MZWA 2H1AA 4PQ1A 1R4WA 1G6YA 5IMDA 3DXBA 2YZHA 3U6VA 2ON5A 1EOGA 4MMMA 4OMVA 4ZL9A 2AAWA 2ES7A 1PL2A 4MPGA 2HZFA 2FWEA 2LRNA 5A4WA 1YY7A 5KEJA 1TK5B 5ECRB 3GL3A 2H73A 2VUPA 5E4WA 3LYPA 1G6WA 1AQWA 4XRAA 3ZIJA 3F6FA 3CTFA 1KNGA 1I5GA 1YKAA 3KXOA 4JRRA 5DCHA 3ME8A 1V2AA 2VD0A 1ILOA 3ME7A 4HI7A 2QKEA 4I97A 3QAGA 1Z7PA 5EY6A 3IAS2 4G10A 2JU5A 5D9VA 4KE3A 3IK7A 4N30A 2IMKA 2I81A 3M1GA 1K0OA 4L5OA 4FO5A 4K7NA 5F06A 2YCDA 1GSDA 10GSA 5B8AA 5D9XA 3VURA 2KHPA 3GSTA 1PKWA 2HYXA 1CQGA 1O81A 4O32A 1EP8A 1S3CA 1PGTA 1XZOA 2GT6A 3QPMA 2LJRA 3IV4A 4XRDA 1SK2A 2HNLA 5IOXA 4OFTA 4K7IA 2RIIA 4AJ6A 1F9MA 1VF2A 2GSTA 3WGXA 3EVIA 4XTSA 4ML1A 4EUYA 2IN3A 2H1GA 1GRXA 3LJRA 3DIEA 1TRSA 4HS1A 1PL1A 2HLSA 2LNTA 5HFIA 2HRFA 2XC2A 3GURA 2A2SA 2PGTA 4K8MA 2KP1A 1TKDB 1MDJA 3M9KA 3J7Yb 2BTOT 2CVKA 2YOIA 5CRWA 3ZVJD 2OE0A 4BWQA 2J23A 4DSRA 4FYUA 3GA4A 1ZOFA 1EP7A 2C80A 1B4PA 3L0HA 2A2RA 1UN2A 4G9HA 2LQQA 1T00A 2P5RA 1YF1A 4ZB8A 4OD7A 1A2MA 1U3IA 2AUVA 4TN8A 5ECIB 4AJ7A 3I69A 4J2FA 4WR5A 5DBQA 1AIUA 5CO3A 5F05A 3ED3A 1FG4A 4EDZA 4BL7A 3TOTA 1V9WA 3MDKA 3IK9A 1X9WB 1VF3A 2CVDA 4Q5FA 2PN8A 4TR0A 3VWUA 1R5PA 1A24A 1THOA 2OJLA 3WGEA 5ECLB 1O73A 3UARA 2AB6A 2QC7A 1WWJA 2L6DA 3TRQA 1A0FA 1B9XC 4EXJA 3NZNA 2H70A 3RHBA 3VLNA 5FHIA 2LS5A 1KEBA 4ZXGA 1AAZA 5FT3A 1ERTA 1FB0A 1XWAA 4BPYA 4MH3A 3KZQA 1AQXA 3WYWA 1AXDA 5GAPD 1RW1A 19GSA 4IJIA 5ECOB 2CX3A 1GUMA 2WS2A 3PGTA 3S9FA 5DCGA 1XWKA 2MBTA 4NV5A 5IPHA 2O7KA 1JHBA 1FVJA 3M9JA 4MK3A 4BWSA 1Q4JA 1SJZA 4K2DA 4YQMA 1TK0B 2ZCTA 3TJFA 2FA4A 1BJXA 4POKA 1VF1A 3FR3A 2YV9A 4OWYA 3M8NA 2YWMA 3I43A 4ISDA 4EC0A 3ZIVA 3BOAA 1K0MA 3H79A 3UVTA 3EE2A 1ABAA 2R37A 4FH8A 2H1BA 1BG5A 2IMIA 2X99A 4XIHA 1ON4A 4TW5A 1U6TA 2N5FA 4RQXA 2CZ3A 2O8VB 1XXUA 1GULA 2CA8A 1JZRA 2YNXA 4H86A 4WKWA 1T4ZA 3IRAA 1DSBA 5LNKe 2PERA 3E3EA 4F03A 2LRTA 4IJ3A 1J0FA 3HY2A 3K8NA 1GSQA 16GSA 1TDIA 2HFDA 1BAYA 3IXRA 3GH6A 4GSNA 1F2EA 1E6BA 3KEBA 2C8UA 4KA0A 1NSWA 4HQSA 5FWGA 3Q74A 2PVOC 3H4KA 2REMA 3A5WA 4N0ZA 2VLVA 3HKRA 3LFLA 5A4VA 3CXGA 4NWYA 3KH7A 2GZYA 4DEJA 3ZYWA 1OVNA 5HR0A 4ZBDA 2PBJA 5CRDA 1SL2B 3FZ4A 3KTLA 2XHFA 5AN1A 4OCEA 5CREA 2BJXA 4LMVA 2GQLA 1U88A 1BQ7A 1O7UA 3ZITA 3W8JA 3FY7A 4LMWA 4OFNA 4IW9A 1IYIA 1XW5A 1WMJA 2GSQA 4CDOA 3KMNA 2IMFA 1WOUA 1O6JA 2R3XA 3ZMKA 5IIZA 2H6XA 2H6ZA 1DE2A 4Q5QA 1TP9A 1JZWA 2YWOA 4NXIA 1T4YA 4X0XA 3ZFLA 1FOVA 4E8EA 2OKAA 2PWJA 2X64A 1V40A 1O8WA 1MDIA 1PA3A 2L6CA 2IFQA 2HZEA 1K3OA 5G5FA 1PSQA 5H5QA 1GTBA 2FUG2 4IN0A 1F3AA 1TI3A 4Q5RA 3LORA 5G2ZA 3ZVJA 3IA1A 2LSTA 1HNAA 5A4UA 3M3MA 3IHQA 4QL9A 3F4SA 4I6XA 2HSHA 1UA5A 2PVQA 3W6GA 1U3AA 3EURA 1A8LA 4GQFA 2EIOA 3FRCA 4L0UA 1YF0A 2CAQA 3MWHA 1OKDA 4N0VA 2H0IA 5JWRB 3ZFBA 3L78A 4MH2A 5KN2A 2BMXA 4NPBA 2E2GA 4MCUA 5HQPA 2Z9SA 1Q98A 4ECBA 3TJBA 5ABRA 4IHUA 3ZZXA 1SD9A 1GSEA 1TI1A 2QSIA 1EV4A 1ZCPA 2ON7A 2B5EA 3DVXA 2PPTA 2MMNA 2XBQA 3CSHA 1M99A 4JBBA 2AHEA 1OE7A 1RK4A 2VD1A 1A8YA 3LYKA 4EKZA 2JZSA 1QMVA 4QL7A 1Z7RA 1ST9A 1SL0B 1K0BA 1VF4A 2H66A 3SBCA 5EVOA 3GV1A 3L4NA 3EC3A 3GKMA 4V1Ag 2F3MA 2NPBA 2NTOA 1MEKA 2V2GA 1GLQA 1GTIA 3HVSA 2VCWA 5IPGA 1EGOA 1FB6A 2C1YA 1M9AA 1GTUA 3VK9A 2OACA 5INYA 4ZB9A 5GSTA 3APOA 2GZPA 5B7CA 3U5RE 3DEXA 5H5SA 5J9CA 3G7YA 3TJGA 4N11A 5CRGA 1FHEA 5GSSA 2RLIA 2I3YA 4HZ2A 3ZMLA 3ISOA 4OCFA 2IFQB 4MJAA 3TKSC 4GSTA 1XOAA 3IAM2 2HZEB 2C3QA 5DAKB 2VLTA 1XW6A 4N10A 2B1KA 4MF6A 4HEA2 5D8IA 4GLTA 2GDRA 1A0RP 3GL5A 3D21A 3HDCA 2FD3A 3UJ1A 1OAZA 3AY8A 2E0QA 4HU7A 3VPQA 3D5JA 2K9FA 4KAEA 1IYHA 1SD8A 3QCPA 1K3LA 4ILFA 5J4UA 3D4MA 2L57A 3VPTA 1HQOA 4L8EA 4JR6A 3IE3A 5KN0A 2IMEA 1ZL9A 4Q5NA 2KP2A 1MTCA 1BX9A 3FK8A 3TKSE 2OBKA 2R2JA 4J56E 4ACSA 4HQZA 5GZZB 3RAZA 1DE1A 5ELAA 6GSXA 4XS6A 4BVXA 2ZUPA 2N5AA 2OA7A 5D96A 2AV4A 4MJEA 17GSA 1R5AA 5COHA 4IGJA 5L71A 4TR3A 4FYCA 2V1MA 3M0FA 4WETA 5ELGA 2LNSA 1ZYEA 1OC3A 1M2DA 2DBCA 1M7TA 1ZGNA 3GX8A 4K6XA 3F6DA 1J08A 2H75A 3C73A 1JZOA 2JSYA 5DJMA 4HU9A 2DJKA 1GH2A 4WBRD 3GUSA 2L4QA 3HYPA 4ZL7A 3CRTA 1Z6NA 1B9YC 2JL4A 4ZL8A 4FIWA 4XHMA 1MDKA 3Q19A 2H71A 3APSA 4ZBAA 1J9BA 1T3BA 2DC5A 5B6MA 4HJMA 2LEGA 3DVWA 1X5DA 1T8EB 3UAPA 4CW9A 3LXZA 4L0WA 1FAAA 2M80A 1AQVA 3DD3A 2GZZA 1B48A 1W4VA 4PGTA 1HYUA 3PR8A 1LBKA 4ZB6A 1K0NA 4IBPA 3CSJA 3BCIA 4EE0A 3O6TA 4MJCA 2JSZA 2H19A 3UIWA 3LG6A 2VM1A 2V32A 3BD2A 2CV4A 2CX4A 3DGQA 2DJ3A 5A5KA 1MD4A 1XWBA 5B8BA 5E59A 4LLRA 4KSOA 3DKSA 1QQ2A 3TJJA 6GSVA 20GSA 4AJ8A 1ZMAA 3TKQA 3US3A 2LRCA 3L9UA 4P3YB 2NVLA 3I9V2 3FYGA 1GP1A 2B6MA 5ENUA 2N5BA 5CRHA 3NOFA 2DMMA 4D73A 1M2BA 4E8HA 1XFLA 3FHKA 4GTUA 1K0AA 3UL3A 1XPVA 4MABA 2IIYA 5IM9A 5D9WA 2EC4A 1F3BA 1H75A 2C0FA 2VIMA 5DALA 1KBNA 1HNCA 5HR3A 3BJ5A 1UVZA 1VGLA 2V6KA 4ZIJA 3TKPA 3GKXA 2YN1A 1X5EA 2LKUA 3GIXA 2FWFA 3C71A 3NIVA 2C3NA 4YAVA 6GSWA 4K1FA 3QAVA 1U87A 4MLYA 5H5RA 2GT5A 4TXOA 2YP6A 2FCHA 1EZKA 3QOUA 2XBIA 5GAND 5DQSA 3ERGA 3TUEA 1S3AA 1EWXA 3A2VA 3MAKA 1R26A 3PINA 4FYBA 1E2YA 3ERWA 1GSYA 1LJRA 2P0GA 5C00A 3QDNA 2LJAA 4O5RA 4HJ2A 2FLSA 2LUSA 1A2JA 2K8SA 1O85A 2G0FA 4DSQA 4I8BA 1YKCA 1JZDA 2IMDA 3C1SA 5IO2A 1THXA 3CTGA 5J9BA 2A4VA 4TVEA 4F82A 2C0EA 5G5EA 1G0TA 3LEFA 4LL1B 1JLWA 5IOWA 3LSZA 1KTEA 1XBSA 2H01A 3IBHA 1YQ1A 4ULXA 2FNOA 4MJBA 2C3TA 18GSA 3F3QA 1TXXA 1GNWA 2ALBA 3GNJA 2L5LA 1GSUA 4JEDA 4KH7A 1XVWA 2VL2C 4XS4A 1W89A 3O76A 1Z9HA 1BYEA 4TRXA 2VL3A 1TTZA 2K8VA 5JCUA 2M72A 4XS1A 2H0HA 4RI7A 1X5CA 1EGRA 1YEPA 5CAXA 1WPIA 3CRUA 1EEMA 1A2LA 3FR9A 5F07A 6GSYA 3Q6OA 4GCIA 4D73B 3TKSA 3VFIA 1ERVA 3GH9A 4EL1A 5JWQB 5G31A 3KTBA 4K0NA 2WJUA 4OFMA 1TW9A 3PH9A 2F9SA 3KIJA 2KLXA 4WF4A 2JZTA 5DALB 3WD6A 1WIKA 5JWOB 4POLA 2WFCA 3GTUA 3WT1A 3A2WA 1GSSA 4ML6A 2IL3A 4PX1A 1QXHA 4WBJA 1QFNA 4IQAA 2DJJA 2P5QA 1V58A 2R5GA 5ECMB 3FKFA 2DJ0A 4OO4A 2HXKA 2WB9A 4JZQA 2MBSA 4GXZA 1AW9A 1V57A 2ZNMA 1SU9A 7GSSA 4AGSA 3VWXA 2FHEA 3LXTA 1A23A 3TGZA 3HVVA 3IDVA 3F63A 5IQYA 5JCGA 14GSA 1H4OA 1WP0A 1YJ6A 2VCVA 2OADA 2EIRA 3KH9A 2X8HA 4V2LA 5HFGA 1YZXA 5DJLA 2HSYA 3VI5A 3CSIA 3ERFA 2XPEA 4POMA 1SK1A 4RUVA 2VL9A 5AISA 4NMUA 2B1LA 2TRXA 2YPMA 3FR6A 3EWLA 1K0DA 2B5XA 3EMPA 2VLUA 2OBIA 1XW9A 3GFKA 8GSSA 1TU7A 6GSSA 2OE1A 3KGKA 1OE8A 1XWGA 2H74A 1Y6EA 2AYTA 2O85A 5LCZA 3QFAC 2O87A 5IMAA 2IJYA 13GSA 2DJ2A 4EO3A 2GQKA 3P90A 4YAPA 2HT9A 4KUNA 2EIQA 4MF5A 4IP1A 4TXVA 4TR1A 4HZ4A 4I5QA 1Z5YE 1SKWB 3TJKA 1GUHA 2MZCA 4PXOA 2FGXA 1ZYQB 1SENA 4RQRA 4X1UA 3HVXA 4KCAA 2JACA 2GLRA 3D0ZA 1ZZYA 9GSSA 4IKHA 2V41A 3HZ8A 3OR5A 2IWTA 4IS0A 4QQ7A 4PUAA 3TRPA 3GTUB 4WEYA 5DQYA 2WZ9A 4I2TA 2VCZA 1XOBA 1C72A 3L9SA 1OKTA 1F37A 1TU8A 1XCCA 1YDKA 1ACVA 3P2AA 2LQOA 6GSTA 2KUCA 3TB2A 3APQA 4PURA 4OO5A 4ECIA 4MZCA 2R6KA 1NHOA 1SJ6A 3F0IA 1XWCA 4MZBA 2J9HA 2H8LA 3EU4A 4G2EA 5B6NA 1SKSB 2B5YA 2H0GA 3QD9A 2GQMA 1GL8A 2FA8A 2KOKA 1Z3EA 3HHVA 1S3DA 2H6YA 1B4QA 1OC9A 4O7HA 1GWCA 3RBTA 2RUEA 4K0GA 3CMIA 2JADA 1X9SB 2X8GA 4IP6A 4YQVA 12GSA 2FWHA 4KDUA 3VI7A 3GKKA 3C7MA 1PQNA 1QK8A 4V1Ap 2VAFA 1JFUA 3TOUA 5AIXA 3BBYA 3HD5A 3GHAA 1EV9A 2GGTA 3MNGA 4F0CA 1GNEA 6GSUA 1SYRA 4JU5A 2DSAA 4IELA 2GSSA 1K0CA 5D73A 4ZILA 4V2MA 3WT2A 3FZ5A 3BCKA 2L59A 2YZUA 3A3TA 2IPAA 3KD0A 5ECSA 4POBA 1G7EA 3IOSA 3TKRA 5HR1A 5JCWA 1URMA 2DLXA 1PKZA 3MSZA 4WF5A 4EF0A 1M2AA 2DIZA 3F9UA 3H1NA 4HOJA 3QR6A 5J41A 4GWRA 5HR2A 1Y25A 2GS3A 5DDLA 4AF2A 5CNWA 2H72A 4TR1B 1N8JA 2C0GA 3WGDA 2VL2A 3ZRDA 4F9ZA 3KP9A 3F4TA 5ID2A 2R4VA 2MMZA 2CAIA 1TOFA 5IMZA 3GX0A 1USBA 4PNGA 5J3RA 5CP1A 5D9TA 3HJPA 4RI6A 3E9JB 4GRFA 3C8EA 5C04A 3HXSA 2B3SA 4KDYA 2DMLA 1JLVA 2HE3A 3UEMA 3O3TA 4O92A
chains in the Genus database with same CATH superfamily
4YQUA 2OE3A 3N5OA 2K6VA 2WGRA 4ECJA 3QFBC 4K9ZA 5KN3A 3ZLPA 2TIRA 1I9DA 3HCZA 2XPDA 4Z7XA 1M0UA 1T7PB 2O89A 4F2IA 3HZ4A 5ECQB 1OC9B 1DUGA 5J5NA 2F8AA 1Z6MA 1VRSD 2L5OA 5DVBA 3G7JA 3V1WA 3VWWA 3D22A 3KCMA 2VM2A 1UC7A 2E7PA 2K18A 4L5LA 2YV7A 2YWNA 1F6MC 4TR4A 4X43A 4WXTA 4IQ1A 2VOCA 1G7OA 2MMAA 3GMFA 1NW2A 1X9MB 4LL4B 4F0BA 1FW1A 1O8XA 4KDXA 4KW6A 1TRWA 3J7Yk 2M46A 2YWIA 3IR4A 4ZBBA 1LU4A 2H1DA 2C0DA 4DSSA 4I2UA 4JE1A 1CQHA 3H8QA 1ML6A 2P31A 4ECCA 1GLPA 1GUKA 4O5QA 2VO4A 4DVCA 4TKYA 2F51A 2I9HA 3UVHA 2DJ1A 2H76A 4KSMA 3R2QA 3GSSA 4PQIA 3D4TA 1YEXA 1AC1A 3DYRA 3I6AA 4KCEA 2GSRA 3C1RA 4PNFA 4GQCA 4NHWA 1PX6A 5IMVA 5LD0A 4NHZA 2E2MA 4NAXA 4TOPA 4BVYA 3ZREA 3DWVA 2G2QA 3RDWA 1N2AA 5ID2B 1NHYA 3QMXA 2CZ2A 1HD2A 1PRXA 3KJYA 4YH2A 2YANA 3E0UA 4KGIA 2I4AA 2FWGA 1PX7A 5CYYA 1RQMA 2HI7A 4EVMA 3IPZA 2YJ7A 3TDGA 4BA7A 1QUWA 2X8CA 1TJDA 2WCIA 3G7IA 1SL1B 1MD3A 1OYJA 3IHGA 3RPPA 3RPNA 3ZTLA 1SK0A 2CQ9A 3UBLA 5IMCA 3JCML 5G1KA 4EIPA 3KMOA 1GTAA 3KM6A 5ECKB 1V98A 5F8BA 2RM5A 3GN3A 1XIYA 2GTUA 2F8FA 3CYNA 3QAWA 1FO5A 3UMAA 4K7OA 4ID0A 2LTKA 4EDYA 5EPFA 5KN1A 1FVKA 5ECPB 3HJOA 1QGVA 4PQHA 1WE0A 1TK8B 2VCQA 3UBKA 3Q18A 3EMXA 4MA9A 1HNBA 3P8WA 4LA1A 3HJMA 4KNDA 4NV2A 3F8UA 1B8XA 2YJHA 4Z2TA 2TRCP 4TXOB 3TRXA 2WULA 5DAKA 5HFKA 3W8SA 2MMOA 3EYTA 3VWVA 4DSSB 2HRNA 1GSFA 4IVFA 1XVQA 2L4CA 4MF7A 3GKNA 3KP8A 3N9JA 4G19A 3A5IA 2RM6A 5D93A 5F0GA 1ERUA 3HVNA 4JR4A 4MPFA 2QGVA 2PUKC 3LQ7A 3D6IA 5G30A 3L9VA 5EL8A 4GSSA 1SKRB 3G9BA 3FZ9A 4MDCA 2D2ZA 2MYGA 3FZAA 4K5SA 3H93A 4BVYB 4X4JA 2CVBA 1WJKA 1M9BA 1OC8A 4CHSA 3FW2A 1T1VA 2H30A 1SJIA 3LW9A 4J57E 1BEDA 1PFOA 4WR4A 5IMFA 2NBSA 2RUFA 3EINA 5ECNB 2B7JA 4XS4B 1PD21 2WDUA 3GYKA 2VCXA 2JZRA 2PMTA 3CBUA 2LV3A 4Z2UA 3HA9A 3DRNA 1EEJA 1PN9A 3UOMA 1TRVA 3DMLA 3GRXA 1X0RA 4G0LA 2V6OA 1TRUA 3LGCA 4V2NA 2LJKA 1R7HA 4KB3A 4MP4A 2PU9C 4YKGA 2DIYA 1WRYA 4USSA 4GF0A 2AJQB 5AGYA 3EU3A 2B7KA 2CT6A 3F3RA 3RHCA 3P7XA 2WRTA 3ZL5A 22GSA 3FEUA 1AUCA 3FMWA 4HUAA 1NM3A 3LWAA 1S3RA 1PMTA 4HDEA 4XCSA 2I1UA 5AIVA 1ERWA 2C4JA 1SYXA 2NDOA 5IO0A 2FY6A 3F4RA 5ECHB 3TCOA 3IC4A 11GSA 3SWLA 4KX4A 1EOHA 5G1LA 1DBYA 4PUFC 2GVPA 3A2XA 1K3YA 2VCTA 4MZWA 2H1AA 4PQ1A 1R4WA 1G6YA 5IMDA 3DXBA 2YZHA 3U6VA 2ON5A 1EOGA 4MMMA 4OMVA 4ZL9A 2AAWA 2ES7A 1PL2A 4MPGA 2HZFA 2FWEA 2LRNA 5A4WA 1YY7A 5KEJA 1TK5B 5ECRB 3GL3A 2H73A 2VUPA 5E4WA 3LYPA 1G6WA 1AQWA 4XRAA 3ZIJA 3F6FA 3CTFA 1KNGA 1I5GA 1YKAA 3KXOA 4JRRA 5DCHA 3ME8A 1V2AA 2VD0A 1ILOA 3ME7A 4HI7A 2QKEA 4I97A 3QAGA 1Z7PA 1PN0A 5EY6A 3IAS2 4G10A 2JU5A 5D9VA 4A5PA 4KE3A 3IK7A 4N30A 2IMKA 2I81A 3M1GA 1K0OA 4L5OA 4FO5A 4K7NA 5F06A 2YCDA 1GSDA 10GSA 5B8AA 5D9XA 3VURA 2KHPA 3GSTA 1PKWA 2HYXA 1CQGA 1O81A 4O32A 1EP8A 1S3CA 1PGTA 1XZOA 2GT6A 3QPMA 2LJRA 3IV4A 4XRDA 1SK2A 2HNLA 5IOXA 4OFTA 4K7IA 2RIIA 4AJ6A 1F9MA 1VF2A 2GSTA 3WGXA 3EVIA 4XTSA 4ML1A 4EUYA 2IN3A 2H1GA 1GRXA 3LJRA 3DIEA 1TRSA 4HS1A 1PL1A 2HLSA 2LNTA 5HFIA 2HRFA 2XC2A 3GURA 2A2SA 2PGTA 4K8MA 2KP1A 1TKDB 1MDJA 3M9KA 3J7Yb 2BTOT 2CVKA 2YOIA 5CRWA 3ZVJD 2OE0A 4BWQA 2J23A 4DSRA 4FYUA 3GA4A 1ZOFA 1EP7A 2C80A 1B4PA 3L0HA 2A2RA 1UN2A 4G9HA 2LQQA 1T00A 2P5RA 1YF1A 4ZB8A 4OD7A 1A2MA 1U3IA 2AUVA 4TN8A 5ECIB 4AJ7A 3I69A 4J2FA 4WR5A 5DBQA 1AIUA 5CO3A 5F05A 3ED3A 1FG4A 4EDZA 4BL7A 3TOTA 1V9WA 3MDKA 3IK9A 1X9WB 1VF3A 2CVDA 4Q5FA 2PN8A 4TR0A 3VWUA 1R5PA 1A24A 1THOA 2OJLA 3WGEA 5ECLB 1O73A 3UARA 2AB6A 2QC7A 1WWJA 2L6DA 3TRQA 1A0FA 1B9XC 4EXJA 3NZNA 2H70A 3EPTA 3RHBA 3VLNA 5FHIA 2LS5A 1KEBA 4ZXGA 1AAZA 5FT3A 1ERTA 1FB0A 1XWAA 4BPYA 4MH3A 3KZQA 1AQXA 3WYWA 1AXDA 5GAPD 1RW1A 2UZ8A 19GSA 4IJIA 5ECOB 2CX3A 1GUMA 2WS2A 3PGTA 3S9FA 5DCGA 1XWKA 2MBTA 4NV5A 5IPHA 2O7KA 1JHBA 1FVJA 3M9JA 4MK3A 4BWSA 1Q4JA 1SJZA 4K2DA 4YQMA 1TK0B 2ZCTA 3TJFA 2FA4A 1BJXA 4POKA 3R3EA 1VF1A 3FR3A 2YV9A 4OWYA 3M8NA 2YWMA 3I43A 4ISDA 4EC0A 3ZIVA 3BOAA 1K0MA 3H79A 3UVTA 3EE2A 1ABAA 2R37A 4FH8A 2H1BA 1BG5A 2IMIA 2X99A 4XIHA 1ON4A 4TW5A 1U6TA 2N5FA 4RQXA 2CZ3A 2O8VB 1XXUA 1GULA 2CA8A 1JZRA 2YNXA 4H86A 4WKWA 1T4ZA 4PTSA 3IRAA 1DSBA 5LNKe 2PERA 3E3EA 4ICYA 4F03A 2LRTA 4CY6A 4IJ3A 1J0FA 3HY2A 3K8NA 1GSQA 16GSA 1TDIA 2HFDA 1BAYA 3IXRA 3GH6A 4GSNA 1F2EA 1E6BA 3MYDA 3KEBA 2C8UA 2HRAA 4KA0A 5BMUA 1NSWA 4HQSA 5FWGA 3Q74A 4BL7B 2PVOC 3H4KA 2REMA 3A5WA 4N0ZA 2VLVA 3HKRA 3LFLA 5A4VA 3CXGA 4NWYA 2R0GA 3KH7A 2GZYA 4DEJA 3ZYWA 2X4AA 1OVNA 5HR0A 4ZBDA 2PBJA 5CRDA 1SL2B 3FZ4A 3KTLA 2XHFA 5AN1A 4OCEA 5CREA 2BJXA 1M3IA 4LMVA 2GQLA 1U88A 1BQ7A 1O7UA 3ZITA 3W8JA 3FY7A 4LMWA 4G0KA 4OFNA 4IW9A 1IYIA 1XW5A 1WMJA 2GSQA 4CDOA 3KMNA 2QA2A 2IMFA 1WOUA 1O6JA 2R3XA 3ZMKA 5IIZA 2H6XA 2H6ZA 1DE2A 4Q5QA 1TP9A 1JZWA 2YWOA 4NXIA 1T4YA 4X0XA 3ZFLA 1FOVA 4E8EA 2OKAA 2PWJA 2X64A 1V40A 1O8WA 1MDIA 1PA3A 1XG8A 2L6CA 2IFQA 2HZEA 1K3OA 5G5FA 1PSQA 5H5QA 1GTBA 5BRTA 2FUG2 4IN0A 1F3AA 1TI3A 4Q5RA 3LORA 5G2ZA 3ZVJA 3IA1A 2LSTA 1HNAA 2A4HA 3M3MA 5A4UA 3IHQA 4QL9A 3F4SA 4I6XA 2HSHA 1UA5A 2PVQA 3W6GA 1U3AA 3EURA 1A8LA 4GQFA 2EIOA 3FRCA 4L0UA 1YF0A 2CAQA 3MWHA 1OKDA 4N0VA 2H0IA 2X49A 5JWRB 3ZFBA 3L78A 4MH2A 5KN2A 2BMXA 4NPBA 2E2GA 4MCUA 5HQPA 2Z9SA 1Q98A 4ECBA 3TJBA 5ABRA 4IHUA 3ZZXA 1SD9A 1GSEA 1TI1A 2QSIA 1EV4A 1ZCPA 2ON7A 2B5EA 3DVXA 2PPTA 2MMNA 2XBQA 3CSHA 1M99A 4JBBA 2AHEA 1OE7A 1RK4A 2VD1A 1A8YA 3LYKA 4EKZA 2JZSA 1QMVA 4QL7A 1Z7RA 1ST9A 1SL0B 1K0BA 1VF4A 2H66A 3SBCA 5EVOA 3GV1A 3L4NA 3EC3A 3GKMA 4V1Ag 2F3MA 2NPBA 3IC8A 2NTOA 1MEKA 2V2GA 1GLQA 1GTIA 3HVSA 2VCWA 5IPGA 1EGOA 1FB6A 2C1YA 1M9AA 1GTUA 3VK9A 2OACA 5INYA 4ZB9A 5GSTA 3APOA 2GZPA 5B7CA 3U5RE 3DEXA 5H5SA 5J9CA 3G7YA 3TJGA 4N11A 5CRGA 1FHEA 5GSSA 2RLIA 2I3YA 4HZ2A 3ZMLA 3ISOA 4OCFA 2IFQB 4MJAA 3TKSC 4GSTA 1XOAA 3IAM2 2HZEB 2C3QA 5DAKB 2VLTA 1XW6A 4N10A 2B1KA 4MF6A 4HEA2 5D8IA 4GLTA 2GDRA 1A0RP 3GL5A 2A2PA 3D21A 3HDCA 2FD3A 3UJ1A 1OAZA 3AY8A 2E0QA 4HU7A 3VPQA 3D5JA 2K9FA 4KAEA 1IYHA 1SD8A 3QCPA 1K3LA 4ILFA 5J4UA 3D4MA 2L57A 3VPTA 1HQOA 5KOXA 4L8EA 4JR6A 3IE3A 2QA1A 5KN0A 2IMEA 1ZL9A 4Q5NA 2KP2A 1MTCA 1BX9A 3FK8A 3TKSE 2OBKA 4O5UA 2R2JA 4J56E 4ACSA 4HQZA 5GZZB 3RAZA 1DE1A 5ELAA 6GSXA 4XS6A 4BVXA 2ZUPA 2N5AA 3PPUA 2OA7A 5D96A 2AV4A 4MJEA 17GSA 1R5AA 5COHA 4IGJA 5L71A 4TR3A 4FYCA 2V1MA 3M0FA 4WETA 5ELGA 2LNSA 1ZYEA 1OC3A 1M2DA 2DBCA 1M7TA 1ZGNA 3GX8A 4K6XA 3F6DA 1J08A 2H75A 3C73A 1JZOA 2JSYA 5DJMA 4HU9A 2DJKA 1GH2A 4WBRD 3GUSA 2L4QA 3HYPA 4ZL7A 3CRTA 1Z6NA 1B9YC 2JL4A 4ZL8A 4FIWA 4BIKA 4XHMA 1MDKA 3Q19A 2H71A 3APSA 4ZBAA 1J9BA 1T3BA 2DC5A 5B6MA 4HJMA 2LEGA 3DVWA 1X5DA 1M3JA 1T8EB 3UAPA 4CW9A 3LXZA 4L0WA 1FAAA 2M80A 1AQVA 3DD3A 2GZZA 1B48A 1W4VA 4PGTA 1HYUA 3PR8A 1LBKA 4ZB6A 1K0NA 4IBPA 3CSJA 3BCIA 4EE0A 3O6TA 4MJCA 2JSZA 2H19A 3UIWA 3LG6A 2VM1A 2V32A 3BD2A 2CV4A 2CX4A 3DGQA 2DJ3A 5A5KA 1MD4A 1XWBA 5B8BA 5E59A 4LLRA 4KSOA 3DKSA 1QQ2A 3TJJA 6GSVA 20GSA 4AJ8A 1ZMAA 3TKQA 3US3A 2LRCA 3L9UA 4P3YB 2NVLA 3I9V2 3FYGA 2R0PA 1GP1A 2B6MA 5ENUA 2N5BA 5CRHA 3NOFA 2DMMA 4D73A 1M2BA 4E8HA 1XFLA 3FHKA 4GTUA 1K0AA 3UL3A 1XPVA 4MABA 2IIYA 2HRKA 5IM9A 5D9WA 2EC4A 1F3BA 1H75A 2C0FA 2VIMA 5DALA 1KBNA 1HNCA 5HR3A 3BJ5A 1UVZA 1VGLA 2V6KA 4ZIJA 3TKPA 3GKXA 2YN1A 1X5EA 2LKUA 3GIXA 2FWFA 3C71A 4BVXB 3NIVA 2C3NA 4YAVA 6GSWA 4K1FA 3QAVA 1U87A 4MLYA 5H5RA 2GT5A 4TXOA 2YP6A 2FCHA 1EZKA 3QOUA 2XBIA 5GAND 5DQSA 3ERGA 3TUEA 1S3AA 1EWXA 4MNNA 3CQFA 4CY8A 3A2VA 3MAKA 1R26A 3PINA 4FYBA 2HSMA 1E2YA 3ERWA 2DKIA 1FOHA 1GSYA 1LJRA 2P0GA 5C00A 3QDNA 2LJAA 4O5RA 4HJ2A 2FLSA 2LUSA 1A2JA 2K8SA 1O85A 2G0FA 4DSQA 2R0CA 4I8BA 1YKCA 1JZDA 2IMDA 3C1SA 5IO2A 1THXA 3CTGA 5J9BA 2A4VA 4TVEA 4K2XA 4F82A 2C0EA 5G5EA 1G0TA 3LEFA 4LL1B 1JLWA 5IOWA 3LSZA 1KTEA 1XBSA 2H01A 3IBHA 1YQ1A 4ULXA 2FNOA 4MJBA 2C3TA 18GSA 3F3QA 1TXXA 1GNWA 2ALBA 3GNJA 3MIXA 2L5LA 1GSUA 4JEDA 4KH7A 1XVWA 2VL2C 4KF9A 4XS4A 1W89A 3O76A 1Z9HA 1BYEA 4TRXA 2VL3A 1TTZA 2K8VA 5JCUA 2M72A 4XS1A 2H0HA 4RI7A 1X5CA 1EGRA 1YEPA 5CAXA 1WPIA 3CRUA 1EEMA 1A2LA 3FR9A 5F07A 6GSYA 3Q6OA 4GCIA 4D73B 3TKSA 3VFIA 1ERVA 3GH9A 4EL1A 5JWQB 5G31A 3KTBA 4K0NA 2WJUA 4OFMA 1TW9A 3PH9A 2F9SA 3KIJA 2KLXA 4WF4A 2JZTA 5DALB 3WD6A 1WIKA 5JWOB 4YKFA 4POLA 2WFCA 3GTUA 3WT1A 3A2WA 1GSSA 4ML6A 2IL3A 4PX1A 1QXHA 4WBJA 1QFNA 4IQAA 2DJJA 2P5QA 1V58A 2R5GA 5ECMB 3FKFA 2DJ0A 4OO4A 2HXKA 2WB9A 4JZQA 2MBSA 4GXZA 1AW9A 1V57A 2ZNMA 1SU9A 7GSSA 4AGSA 3VWXA 2FHEA 3LXTA 1A23A 3TGZA 3HVVA 3IDVA 3F63A 5IQYA 5JCGA 14GSA 1H4OA 4K5RA 1WP0A 1YJ6A 2VCVA 2OADA 2EIRA 3KH9A 2X8HA 4V2LA 5HFGA 1YZXA 5DJLA 4FQUA 2HSYA 3VI5A 3CSIA 3ERFA 2XPEA 4POMA 1SK1A 4RUVA 2VL9A 5AISA 4NMUA 2B1LA 2TRXA 2YPMA 3FR6A 3EWLA 1K0DA 2B5XA 3EMPA 2VLUA 2OBIA 1XW9A 3GFKA 8GSSA 1TU7A 6GSSA 2OE1A 3KGKA 1OE8A 1XWGA 4EIQA 2H74A 1Y6EA 2AYTA 2O85A 5LCZA 3QFAC 2O87A 5IMAA 2IJYA 13GSA 2DJ2A 4EO3A 2GQKA 3P90A 4YAPA 2HT9A 4KUNA 2EIQA 4MF5A 4IP1A 4TXVA 4TR1A 4HZ4A 4I5QA 1Z5YE 1SKWB 3TJKA 1GUHA 2MZCA 4PXOA 2FGXA 1ZYQB 1SENA 4RQRA 4X1UA 3HVXA 4KCAA 2JACA 2GLRA 3D0ZA 1ZZYA 9GSSA 4IKHA 2V41A 3HZ8A 3OR5A 2IWTA 4IS0A 4QQ7A 4PUAA 3TRPA 3GTUB 4WEYA 5DQYA 2WZ9A 4I2TA 2VCZA 1XOBA 1C72A 3L9SA 1OKTA 1F37A 1TU8A 1XCCA 1YDKA 1ACVA 3P2AA 2LQOA 6GSTA 2KUCA 3TB2A 3APQA 4PURA 4OO5A 4ECIA 4G0IA 4MZCA 2R6KA 1NHOA 1SJ6A 3F0IA 1XWCA 4MZBA 2J9HA 2H8LA 4HSCX 3EU4A 4G2EA 5B6NA 1SKSB 2B5YA 2H0GA 3QD9A 2GQMA 1GL8A 2FA8A 2KOKA 1Z3EA 3HHVA 1S3DA 2H6YA 1B4QA 1OC9A 4O7HA 2DKHA 1GWCA 3RBTA 4Z2RA 2RUEA 4K0GA 3CMIA 2JADA 1X9SB 2X8GA 4IP6A 4YQVA 12GSA 2FWHA 4KDUA 3VI7A 3GKKA 3C7MA 1PQNA 1QK8A 4V1Ap 2VAFA 1JFUA 3TOUA 5AIXA 3BBYA 3HD5A 3GHAA 1EV9A 2GGTA 3MNGA 4F0CA 1GNEA 1ZYNA 1SYRA 6GSUA 4JU5A 2DSAA 4IELA 2GSSA 1K0CA 5D73A 4ZILA 4V2MA 3WT2A 1ZYPA 3FZ5A 3BCKA 2L59A 2YZUA 3A3TA 2IPAA 3KD0A 5ECSA 4POBA 1G7EA 3IOSA 3TKRA 5HR1A 5JCWA 1URMA 2DLXA 1PKZA 3MSZA 4WF5A 4EF0A 1M2AA 2DIZA 3F9UA 3H1NA 4HOJA 3QR6A 5J41A 4GWRA 5HR2A 1Y25A 2GS3A 5DDLA 4AF2A 5CNWA 2H72A 4TR1B 1N8JA 2C0GA 3WGDA 2VL2A 3ZRDA 4F9ZA 3KP9A 3F4TA 5ID2A 2R4VA 2MMZA 2CAIA 1TOFA 5IMZA 3GX0A 1USBA 4PNGA 5J3RA 5CP1A 5D9TA 3HJPA 4RI6A 3E9JB 4GRFA 3C8EA 5C04A 3HXSA 2B3SA 4KDYA 2DMLA 1JLVA 2HE3A 5KOWA 3UEMA 3O3TA 4O92A
chains in the Genus database with same CATH topology
4YQUA 2OE3A 3N5OA 2K6VA 2WGRA 4ECJA 3QFBC 4K9ZA 5KN3A 3ZLPA 2TIRA 1I9DA 3HCZA 2XPDA 4Z7XA 1M0UA 1T7PB 2O89A 4F2IA 3HZ4A 5ECQB 1OC9B 1DUGA 5J5NA 2F8AA 1Z6MA 1VRSD 2L5OA 5DVBA 3G7JA 3V1WA 3VWWA 3D22A 3KCMA 2VM2A 1UC7A 2E7PA 2K18A 4L5LA 2YV7A 2YWNA 1F6MC 4TR4A 4X43A 4WXTA 4IQ1A 2VOCA 1G7OA 2MMAA 3GMFA 1NW2A 1X9MB 4LL4B 4F0BA 1FW1A 1O8XA 4KDXA 4KW6A 1TRWA 3J7Yk 2M46A 2YWIA 3IR4A 4ZBBA 1LU4A 2H1DA 2C0DA 4DSSA 4I2UA 4JE1A 1CQHA 3H8QA 1ML6A 2P31A 4ECCA 1GLPA 1GUKA 4O5QA 2VO4A 4DVCA 4TKYA 2F51A 2I9HA 3UVHA 2DJ1A 2H76A 4KSMA 3R2QA 3GSSA 4PQIA 3D4TA 1YEXA 1AC1A 3DYRA 3I6AA 4KCEA 2GSRA 3C1RA 4PNFA 4GQCA 4NHWA 1PX6A 5IMVA 5LD0A 4NHZA 2E2MA 4NAXA 4TOPA 4BVYA 3ZREA 3DWVA 2G2QA 3RDWA 1N2AA 5ID2B 1NHYA 3QMXA 2CZ2A 1HD2A 1PRXA 3KJYA 4YH2A 2YANA 3E0UA 4KGIA 2I4AA 2FWGA 1PX7A 5CYYA 1RQMA 2HI7A 4EVMA 3IPZA 2YJ7A 3TDGA 4BA7A 1QUWA 2X8CA 1TJDA 2WCIA 3G7IA 1SL1B 1MD3A 1OYJA 3IHGA 3RPPA 3RPNA 3ZTLA 1SK0A 2CQ9A 3UBLA 5IMCA 3JCML 5G1KA 4EIPA 3KMOA 1GTAA 3KM6A 5ECKB 1V98A 5F8BA 2RM5A 3GN3A 1XIYA 2GTUA 2F8FA 3CYNA 3QAWA 1FO5A 3UMAA 4K7OA 4ID0A 2LTKA 4EDYA 5EPFA 5KN1A 1FVKA 5ECPB 3HJOA 1QGVA 4PQHA 1WE0A 1TK8B 2VCQA 3UBKA 3Q18A 3EMXA 4MA9A 1HNBA 3P8WA 4LA1A 3HJMA 4KNDA 4NV2A 3F8UA 1B8XA 2YJHA 4Z2TA 2TRCP 4TXOB 3TRXA 2WULA 5DAKA 5HFKA 3W8SA 2MMOA 3EYTA 3VWVA 4DSSB 2HRNA 1GSFA 4IVFA 1XVQA 2L4CA 4MF7A 3GKNA 3KP8A 3N9JA 4G19A 3A5IA 2RM6A 5D93A 5F0GA 1ERUA 4JR4A 4MPFA 2QGVA 2PUKC 3LQ7A 3D6IA 5G30A 3L9VA 5EL8A 4GSSA 1SKRB 3G9BA 3FZ9A 4MDCA 2D2ZA 2MYGA 3FZAA 4K5SA 3H93A 4BVYB 4X4JA 2CVBA 1WJKA 1M9BA 1OC8A 4CHSA 3FW2A 1T1VA 2H30A 1SJIA 3LW9A 4J57E 1BEDA 4WR4A 5IMFA 2NBSA 2RUFA 3EINA 5ECNB 2B7JA 4XS4B 1PD21 2WDUA 3GYKA 2VCXA 2JZRA 2PMTA 3CBUA 2LV3A 4Z2UA 3HA9A 3DRNA 1EEJA 1PN9A 3UOMA 1TRVA 3DMLA 3GRXA 1X0RA 4G0LA 2V6OA 1TRUA 3LGCA 4V2NA 2LJKA 1R7HA 4KB3A 4MP4A 2PU9C 4YKGA 2DIYA 1WRYA 4USSA 4GF0A 2AJQB 5AGYA 3EU3A 2B7KA 2CT6A 3F3RA 3RHCA 3P7XA 2WRTA 3ZL5A 22GSA 3FEUA 1AUCA 3FMWA 4HUAA 1NM3A 3LWAA 1PMTA 4HDEA 4XCSA 2I1UA 5AIVA 1ERWA 2C4JA 1SYXA 2NDOA 5IO0A 2FY6A 3F4RA 5ECHB 3TCOA 3IC4A 11GSA 3SWLA 4KX4A 1EOHA 5G1LA 1DBYA 4PUFC 2GVPA 3A2XA 1K3YA 2VCTA 4MZWA 2H1AA 4PQ1A 1R4WA 1G6YA 5IMDA 3DXBA 2YZHA 3U6VA 2ON5A 1EOGA 4MMMA 4OMVA 4ZL9A 2AAWA 2ES7A 1PL2A 4MPGA 2HZFA 2FWEA 2LRNA 5A4WA 1YY7A 5KEJA 1TK5B 5ECRB 3GL3A 2H73A 2VUPA 5E4WA 3LYPA 1G6WA 1AQWA 4XRAA 3ZIJA 3F6FA 3CTFA 1KNGA 1I5GA 1YKAA 3KXOA 4JRRA 5DCHA 3ME8A 1V2AA 2VD0A 1ILOA 3ME7A 4HI7A 2QKEA 4I97A 3QAGA 1Z7PA 1PN0A 5EY6A 3IAS2 4G10A 2JU5A 5D9VA 4A5PA 4KE3A 3IK7A 4N30A 2IMKA 2I81A 3M1GA 1K0OA 4L5OA 4FO5A 4K7NA 5F06A 2YCDA 1GSDA 10GSA 5B8AA 5D9XA 3VURA 2KHPA 3GSTA 1PKWA 2HYXA 1CQGA 1O81A 4O32A 1EP8A 1S3CA 1PGTA 1XZOA 2GT6A 3QPMA 2LJRA 3IV4A 4XRDA 1SK2A 2HNLA 5IOXA 4OFTA 4K7IA 2RIIA 4AJ6A 1F9MA 1VF2A 2GSTA 3WGXA 3EVIA 4XTSA 4ML1A 4EUYA 2IN3A 2H1GA 1GRXA 3LJRA 3DIEA 1TRSA 4HS1A 1PL1A 2HLSA 2LNTA 5HFIA 2HRFA 2XC2A 3GURA 2A2SA 2PGTA 4K8MA 2KP1A 1TKDB 1MDJA 3M9KA 3J7Yb 2BTOT 2CVKA 2YOIA 5CRWA 3ZVJD 2OE0A 4BWQA 2J23A 4DSRA 4FYUA 3GA4A 1ZOFA 1EP7A 2C80A 1B4PA 3L0HA 2A2RA 1UN2A 4G9HA 2LQQA 1T00A 2P5RA 1YF1A 4ZB8A 4OD7A 1A2MA 1U3IA 2AUVA 4TN8A 5ECIB 4AJ7A 3I69A 4J2FA 4WR5A 5DBQA 1AIUA 5CO3A 5F05A 3ED3A 1FG4A 4EDZA 4BL7A 3TOTA 1V9WA 3MDKA 3IK9A 1X9WB 1VF3A 2CVDA 4Q5FA 2PN8A 4TR0A 3VWUA 1R5PA 1A24A 1THOA 2OJLA 3WGEA 5ECLB 1O73A 3UARA 2AB6A 2QC7A 1WWJA 2L6DA 3TRQA 1A0FA 1B9XC 4EXJA 3NZNA 2H70A 3EPTA 3RHBA 3VLNA 5FHIA 2LS5A 1KEBA 4ZXGA 1AAZA 5FT3A 1ERTA 1FB0A 1XWAA 4BPYA 4MH3A 3KZQA 1AQXA 3WYWA 1AXDA 5GAPD 1RW1A 2UZ8A 19GSA 4IJIA 5ECOB 2CX3A 1GUMA 2WS2A 3PGTA 3S9FA 5DCGA 1XWKA 2MBTA 4NV5A 5IPHA 2O7KA 1JHBA 1FVJA 3M9JA 4MK3A 4BWSA 1Q4JA 1SJZA 4K2DA 4YQMA 1TK0B 2ZCTA 3TJFA 2FA4A 1BJXA 4POKA 3R3EA 1VF1A 3FR3A 2YV9A 4OWYA 3M8NA 2YWMA 3I43A 4ISDA 4EC0A 3ZIVA 3BOAA 1K0MA 3H79A 3UVTA 3EE2A 1ABAA 2R37A 4FH8A 2H1BA 1BG5A 2IMIA 2X99A 4XIHA 1ON4A 4TW5A 1U6TA 2N5FA 4RQXA 2CZ3A 2O8VB 1XXUA 1GULA 2CA8A 1JZRA 2YNXA 4H86A 4WKWA 1T4ZA 4PTSA 3IRAA 1DSBA 5LNKe 2PERA 3E3EA 4ICYA 4F03A 2LRTA 4CY6A 4IJ3A 1J0FA 3HY2A 3K8NA 1GSQA 16GSA 1TDIA 2HFDA 1BAYA 3IXRA 3GH6A 4GSNA 1F2EA 1E6BA 3MYDA 3KEBA 2C8UA 2HRAA 4KA0A 5BMUA 1NSWA 4HQSA 5FWGA 3Q74A 4BL7B 2PVOC 3H4KA 2REMA 3A5WA 4N0ZA 2VLVA 3HKRA 3LFLA 5A4VA 3CXGA 4NWYA 2R0GA 3KH7A 2GZYA 4DEJA 3ZYWA 2X4AA 1OVNA 5HR0A 4ZBDA 2PBJA 5CRDA 1SL2B 3FZ4A 3KTLA 2XHFA 5AN1A 4OCEA 5CREA 2BJXA 4LMVA 2GQLA 1U88A 1BQ7A 1O7UA 3ZITA 3W8JA 3FY7A 4LMWA 4G0KA 4OFNA 4IW9A 1IYIA 1XW5A 1WMJA 2GSQA 4CDOA 3KMNA 2QA2A 2IMFA 1WOUA 1O6JA 2R3XA 3ZMKA 5IIZA 2H6XA 2H6ZA 1DE2A 4Q5QA 1TP9A 1JZWA 2YWOA 4NXIA 1T4YA 4X0XA 3ZFLA 1FOVA 4E8EA 2OKAA 2PWJA 2X64A 1V40A 1O8WA 1MDIA 1PA3A 2L6CA 2IFQA 2HZEA 1K3OA 5G5FA 1PSQA 5H5QA 1GTBA 5BRTA 2FUG2 4IN0A 1F3AA 1TI3A 4Q5RA 3LORA 5G2ZA 3ZVJA 3IA1A 2LSTA 1HNAA 2A4HA 3M3MA 5A4UA 3IHQA 4QL9A 3F4SA 4I6XA 2HSHA 1UA5A 2PVQA 3W6GA 1U3AA 3EURA 1A8LA 4GQFA 2EIOA 3FRCA 4L0UA 1YF0A 2CAQA 3MWHA 1OKDA 4N0VA 2H0IA 2X49A 5JWRB 3ZFBA 3L78A 4MH2A 5KN2A 2BMXA 4NPBA 2E2GA 4MCUA 5HQPA 2Z9SA 1Q98A 4ECBA 3TJBA 5ABRA 4IHUA 3ZZXA 1SD9A 1GSEA 1TI1A 2QSIA 1EV4A 1ZCPA 2ON7A 2B5EA 3DVXA 2PPTA 2MMNA 2XBQA 3CSHA 1M99A 4JBBA 2AHEA 1OE7A 1RK4A 2VD1A 1A8YA 3LYKA 4EKZA 2JZSA 1QMVA 4QL7A 1Z7RA 1ST9A 1SL0B 1K0BA 1VF4A 2H66A 3SBCA 5EVOA 3GV1A 3L4NA 3EC3A 3GKMA 4V1Ag 2F3MA 2NPBA 3IC8A 2NTOA 1MEKA 2V2GA 1GLQA 1GTIA 3HVSA 2VCWA 5IPGA 1EGOA 1FB6A 2C1YA 1M9AA 1GTUA 3VK9A 2OACA 5INYA 4ZB9A 5GSTA 3APOA 2GZPA 5B7CA 3U5RE 3DEXA 5H5SA 5J9CA 3G7YA 3TJGA 4N11A 5CRGA 1FHEA 5GSSA 2RLIA 2I3YA 4HZ2A 3ZMLA 3ISOA 4OCFA 2IFQB 4MJAA 3TKSC 4GSTA 1XOAA 3IAM2 2HZEB 2C3QA 5DAKB 2VLTA 1XW6A 4N10A 2B1KA 4MF6A 4HEA2 5D8IA 4GLTA 2GDRA 1A0RP 3GL5A 2A2PA 3D21A 3HDCA 2FD3A 3UJ1A 1OAZA 3AY8A 2E0QA 4HU7A 3VPQA 3D5JA 2K9FA 4KAEA 1IYHA 1SD8A 3QCPA 1K3LA 4ILFA 5J4UA 3D4MA 2L57A 3VPTA 1HQOA 5KOXA 4L8EA 4JR6A 3IE3A 2QA1A 5KN0A 2IMEA 1ZL9A 4Q5NA 2KP2A 1MTCA 1BX9A 3FK8A 3TKSE 2OBKA 4O5UA 2R2JA 4J56E 4ACSA 4HQZA 5GZZB 3RAZA 1DE1A 5ELAA 6GSXA 4XS6A 4BVXA 2ZUPA 2N5AA 3PPUA 2OA7A 5D96A 2AV4A 4MJEA 17GSA 1R5AA 5COHA 4IGJA 5L71A 4TR3A 4FYCA 2V1MA 3M0FA 4WETA 5ELGA 2LNSA 1ZYEA 1OC3A 1M2DA 2DBCA 1M7TA 1ZGNA 3GX8A 4K6XA 3F6DA 1J08A 2H75A 3C73A 1JZOA 2JSYA 5DJMA 4HU9A 2DJKA 1GH2A 4WBRD 3GUSA 2L4QA 3HYPA 4ZL7A 3CRTA 1Z6NA 1B9YC 2JL4A 4ZL8A 4FIWA 4XHMA 1MDKA 3Q19A 2H71A 3APSA 4ZBAA 1J9BA 1T3BA 2DC5A 5B6MA 4HJMA 2LEGA 3DVWA 1X5DA 1T8EB 3UAPA 4CW9A 3LXZA 4L0WA 1FAAA 2M80A 1AQVA 3DD3A 2GZZA 1B48A 1W4VA 4PGTA 1HYUA 3PR8A 1LBKA 4ZB6A 1K0NA 4IBPA 3CSJA 3BCIA 4EE0A 3O6TA 4MJCA 2JSZA 2H19A 3UIWA 3LG6A 2VM1A 2V32A 3BD2A 2CV4A 2CX4A 3DGQA 2DJ3A 5A5KA 1MD4A 1XWBA 5B8BA 5E59A 4LLRA 4KSOA 3DKSA 1QQ2A 3TJJA 6GSVA 20GSA 4AJ8A 1ZMAA 3TKQA 3US3A 2LRCA 3L9UA 4P3YB 2NVLA 3I9V2 3FYGA 2R0PA 1GP1A 2B6MA 5ENUA 2N5BA 5CRHA 3NOFA 2DMMA 4D73A 1M2BA 4E8HA 1XFLA 3FHKA 4GTUA 1K0AA 3UL3A 1XPVA 4MABA 2IIYA 2HRKA 5IM9A 5D9WA 2EC4A 1F3BA 1H75A 2C0FA 2VIMA 5DALA 1KBNA 1HNCA 5HR3A 3BJ5A 1UVZA 1VGLA 2V6KA 4ZIJA 3TKPA 3GKXA 2YN1A 1X5EA 2LKUA 3GIXA 2FWFA 3C71A 4BVXB 3NIVA 2C3NA 4YAVA 6GSWA 4K1FA 3QAVA 1U87A 4MLYA 5H5RA 2GT5A 4TXOA 2YP6A 2FCHA 1EZKA 3QOUA 2XBIA 5GAND 5DQSA 3ERGA 3TUEA 1S3AA 1EWXA 4MNNA 4CY8A 3A2VA 3MAKA 1R26A 3PINA 4FYBA 2HSMA 1E2YA 3ERWA 2DKIA 1FOHA 1GSYA 1LJRA 2P0GA 5C00A 3QDNA 2LJAA 4O5RA 4HJ2A 2FLSA 2LUSA 1A2JA 2K8SA 1O85A 2G0FA 4DSQA 2R0CA 4I8BA 1YKCA 1JZDA 2IMDA 3C1SA 5IO2A 1THXA 3CTGA 5J9BA 2A4VA 4TVEA 4K2XA 4F82A 2C0EA 5G5EA 1G0TA 3LEFA 4LL1B 1JLWA 5IOWA 3LSZA 1KTEA 1XBSA 2H01A 3IBHA 1YQ1A 4ULXA 2FNOA 4MJBA 2C3TA 18GSA 3F3QA 1TXXA 1GNWA 2ALBA 3GNJA 3MIXA 2L5LA 1GSUA 4JEDA 4KH7A 1XVWA 2VL2C 4KF9A 4XS4A 1W89A 3O76A 1Z9HA 1BYEA 4TRXA 2VL3A 1TTZA 2K8VA 5JCUA 2M72A 4XS1A 2H0HA 4RI7A 1X5CA 1EGRA 1YEPA 5CAXA 1WPIA 3CRUA 1EEMA 1A2LA 3FR9A 5F07A 6GSYA 3Q6OA 4GCIA 4D73B 3TKSA 3VFIA 1ERVA 3GH9A 4EL1A 5JWQB 5G31A 3KTBA 4K0NA 2WJUA 4OFMA 1TW9A 3PH9A 2F9SA 3KIJA 2KLXA 4WF4A 2JZTA 5DALB 3WD6A 1WIKA 5JWOB 4YKFA 4POLA 2WFCA 3GTUA 3WT1A 3A2WA 1GSSA 4ML6A 2IL3A 4PX1A 1QXHA 4WBJA 1QFNA 4IQAA 2DJJA 2P5QA 1V58A 2R5GA 5ECMB 3FKFA 2DJ0A 4OO4A 2HXKA 2WB9A 4JZQA 2MBSA 4GXZA 1AW9A 1V57A 2ZNMA 1SU9A 7GSSA 4AGSA 3VWXA 2FHEA 3LXTA 1A23A 3TGZA 3HVVA 3IDVA 3F63A 5IQYA 5JCGA 14GSA 1H4OA 4K5RA 1WP0A 1YJ6A 2VCVA 2OADA 2EIRA 3KH9A 2X8HA 4V2LA 5HFGA 1YZXA 5DJLA 4FQUA 2HSYA 3VI5A 3CSIA 3ERFA 2XPEA 4POMA 1SK1A 4RUVA 2VL9A 5AISA 4NMUA 2B1LA 2TRXA 2YPMA 3FR6A 3EWLA 1K0DA 2B5XA 3EMPA 2VLUA 2OBIA 1XW9A 3GFKA 8GSSA 1TU7A 6GSSA 2OE1A 3KGKA 1OE8A 1XWGA 4EIQA 2H74A 1Y6EA 2AYTA 2O85A 5LCZA 3QFAC 2O87A 5IMAA 2IJYA 13GSA 2DJ2A 4EO3A 2GQKA 3P90A 4YAPA 2HT9A 4KUNA 2EIQA 4MF5A 4IP1A 4TXVA 4TR1A 4HZ4A 4I5QA 1Z5YE 1SKWB 3TJKA 1GUHA 2MZCA 4PXOA 2FGXA 1ZYQB 1SENA 4RQRA 4X1UA 3HVXA 4KCAA 2JACA 2GLRA 3D0ZA 1ZZYA 9GSSA 4IKHA 2V41A 3HZ8A 3OR5A 2IWTA 4IS0A 4QQ7A 4PUAA 3TRPA 3GTUB 4WEYA 5DQYA 2WZ9A 4I2TA 2VCZA 1XOBA 1C72A 3L9SA 1OKTA 1F37A 1TU8A 1XCCA 1YDKA 1ACVA 3P2AA 2LQOA 6GSTA 2KUCA 3TB2A 3APQA 4PURA 4OO5A 4ECIA 4G0IA 4MZCA 2R6KA 1NHOA 1SJ6A 3F0IA 1XWCA 4MZBA 2J9HA 2H8LA 3EU4A 4G2EA 5B6NA 1SKSB 2B5YA 2H0GA 3QD9A 2GQMA 1GL8A 2FA8A 2KOKA 1Z3EA 3HHVA 1S3DA 2H6YA 1B4QA 1OC9A 4O7HA 2DKHA 1GWCA 3RBTA 4Z2RA 2RUEA 4K0GA 3CMIA 2JADA 1X9SB 2X8GA 4IP6A 4YQVA 12GSA 2FWHA 4KDUA 3VI7A 3GKKA 3C7MA 1PQNA 1QK8A 4V1Ap 2VAFA 1JFUA 3TOUA 5AIXA 3BBYA 3HD5A 3GHAA 1EV9A 2GGTA 3MNGA 4F0CA 1GNEA 1ZYNA 1SYRA 6GSUA 4JU5A 2DSAA 4IELA 2GSSA 1K0CA 5D73A 4ZILA 4V2MA 3WT2A 1ZYPA 3FZ5A 3BCKA 2L59A 2YZUA 3A3TA 2IPAA 3KD0A 5ECSA 4POBA 1G7EA 3IOSA 3TKRA 5HR1A 5JCWA 1URMA 2DLXA 1PKZA 3MSZA 4WF5A 4EF0A 1M2AA 2DIZA 3F9UA 3H1NA 4HOJA 3QR6A 5J41A 4GWRA 5HR2A 1Y25A 2GS3A 5DDLA 4AF2A 5CNWA 2H72A 4TR1B 1N8JA 2C0GA 3WGDA 2VL2A 3ZRDA 4F9ZA 3KP9A 3F4TA 5ID2A 2R4VA 2MMZA 2CAIA 1TOFA 5IMZA 3GX0A 1USBA 4PNGA 5J3RA 5CP1A 5D9TA 3HJPA 4RI6A 3E9JB 4GRFA 3C8EA 5C04A 3HXSA 2B3SA 4KDYA 2DMLA 1JLVA 2HE3A 5KOWA 3UEMA 3O3TA 4O92A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YQU A;  2OE3 A;  3N5O A;  2K6V A;  2WGR A;  4ECJ A;  3QFB C;  4K9Z A;  5KN3 A;  3ZLP A;  2TIR A;  1I9D A;  3HCZ A;  2XPD A;  4Z7X A;  1M0U A;  1T7P B;  2O89 A;  4F2I A;  3HZ4 A;  5ECQ B;  1OC9 B;  1DUG A;  5J5N A;  2F8A A;  1Z6M A;  1VRS D;  2L5O A;  5DVB A;  3G7J A;  3V1W A;  3VWW A;  3D22 A;  3KCM A;  2VM2 A;  1UC7 A;  2E7P A;  2K18 A;  4L5L A;  2YV7 A;  2YWN A;  1F6M C;  4TR4 A;  4X43 A;  4WXT A;  4IQ1 A;  2VOC A;  1G7O A;  2MMA A;  3GMF A;  1NW2 A;  1X9M B;  4LL4 B;  4F0B A;  1FW1 A;  1O8X A;  4KDX A;  4KW6 A;  1TRW A;  3J7Y k;  2M46 A;  2YWI A;  3IR4 A;  4ZBB A;  1LU4 A;  2H1D A;  2C0D A;  4DSS A;  4I2U A;  4JE1 A;  1CQH A;  3H8Q A;  1ML6 A;  2P31 A;  4ECC A;  1GLP A;  1GUK A;  2VO4 A;  4DVC A;  4TKY A;  2F51 A;  2I9H A;  3UVH A;  2DJ1 A;  2H76 A;  4KSM A;  3R2Q A;  3GSS A;  4PQI A;  3D4T A;  1YEX A;  1AC1 A;  3DYR A;  3I6A A;  4KCE A;  2GSR A;  3C1R A;  4PNF A;  4GQC A;  4NHW A;  1PX6 A;  5IMV A;  5LD0 A;  4NHZ A;  2E2M A;  4NAX A;  4TOP A;  4BVY A;  3ZRE A;  3DWV A;  2G2Q A;  3RDW A;  1N2A A;  5ID2 B;  1NHY A;  3QMX A;  2CZ2 A;  1HD2 A;  1PRX A;  3KJY A;  4YH2 A;  2YAN A;  3E0U A;  4KGI A;  2I4A A;  2FWG A;  1PX7 A;  5CYY A;  1RQM A;  2HI7 A;  4EVM A;  3IPZ A;  2YJ7 A;  3TDG A;  4BA7 A;  1QUW A;  2X8C A;  1TJD A;  2WCI A;  3G7I A;  1SL1 B;  1MD3 A;  1OYJ A;  3RPP A;  3RPN A;  3ZTL A;  1SK0 A;  2CQ9 A;  3UBL A;  5IMC A;  3JCM L;  5G1K A;  3KMO A;  1GTA A;  3KM6 A;  5ECK B;  1V98 A;  5F8B A;  2RM5 A;  3GN3 A;  1XIY A;  2GTU A;  2F8F A;  3CYN A;  3QAW A;  1FO5 A;  3UMA A;  4K7O A;  4ID0 A;  2LTK A;  4EDY A;  5EPF A;  5KN1 A;  1FVK A;  5ECP B;  3HJO A;  1QGV A;  4PQH A;  1WE0 A;  1TK8 B;  2VCQ A;  3UBK A;  3Q18 A;  3EMX A;  4MA9 A;  1HNB A;  3P8W A;  4LA1 A;  3HJM A;  4KND A;  4NV2 A;  3F8U A;  1B8X A;  2YJH A;  2TRC P;  4TXO B;  3TRX A;  2WUL A;  5DAK A;  5HFK A;  3W8S A;  2MMO A;  3EYT A;  3VWV A;  4DSS B;  2HRN A;  1GSF A;  4IVF A;  1XVQ A;  2L4C A;  4MF7 A;  3GKN A;  3KP8 A;  3N9J A;  4G19 A;  2RM6 A;  5D93 A;  5F0G A;  1ERU A;  4JR4 A;  4MPF A;  2QGV A;  2PUK C;  3LQ7 A;  3D6I A;  5G30 A;  3L9V A;  5EL8 A;  4GSS A;  1SKR B;  3G9B A;  3FZ9 A;  4MDC A;  2D2Z A;  2MYG A;  3FZA A;  3H93 A;  2CVB A;  1WJK A;  1M9B A;  1OC8 A;  4CHS A;  3FW2 A;  1T1V A;  2H30 A;  1SJI A;  4J57 E;  1BED A;  4WR4 A;  5IMF A;  2NBS A;  2RUF A;  3EIN A;  5ECN B;  2B7J A;  4XS4 B;  1PD2 1;  2WDU A;  3GYK A;  2VCX A;  2JZR A;  2PMT A;  3CBU A;  2LV3 A;  3HA9 A;  3DRN A;  1EEJ A;  1PN9 A;  3UOM A;  1TRV A;  3DML A;  3GRX A;  1X0R A;  2V6O A;  1TRU A;  3LGC A;  4V2N A;  2LJK A;  1R7H A;  4KB3 A;  4MP4 A;  2PU9 C;  2DIY A;  1WRY A;  4GF0 A;  2AJQ B;  5AGY A;  3EU3 A;  2B7K A;  2CT6 A;  3F3R A;  3RHC A;  3P7X A;  2WRT A;  3ZL5 A;  22GS A;  3FEU A;  1AUC A;  4HUA A;  1NM3 A;  3LWA A;  1PMT A;  4HDE A;  4XCS A;  2I1U A;  5AIV A;  1ERW A;  2C4J A;  1SYX A;  2NDO A;  5IO0 A;  2FY6 A;  3F4R A;  5ECH B;  3TCO A;  3IC4 A;  11GS A;  3SWL A;  4KX4 A;  1EOH A;  5G1L A;  1DBY A;  4PUF C;  2GVP A;  3A2X A;  1K3Y A;  2VCT A;  4MZW A;  2H1A A;  4PQ1 A;  1R4W A;  1G6Y A;  5IMD A;  3DXB A;  2YZH A;  3U6V A;  2ON5 A;  1EOG A;  4MMM A;  4OMV A;  4ZL9 A;  2AAW A;  2ES7 A;  1PL2 A;  4MPG A;  2HZF A;  2FWE A;  2LRN A;  5A4W A;  1YY7 A;  5KEJ A;  1TK5 B;  5ECR B;  3GL3 A;  2H73 A;  2VUP A;  5E4W A;  3LYP A;  1G6W A;  1AQW A;  4XRA A;  3ZIJ A;  3F6F A;  3CTF A;  1KNG A;  1I5G A;  1YKA A;  3KXO A;  4JRR A;  5DCH A;  3ME8 A;  1V2A A;  2VD0 A;  1ILO A;  3ME7 A;  4HI7 A;  2QKE A;  4I97 A;  3QAG A;  1Z7P A;  5EY6 A;  3IAS 2;  4G10 A;  2JU5 A;  5D9V A;  4KE3 A;  3IK7 A;  4N30 A;  2IMK A;  2I81 A;  3M1G A;  1K0O A;  4L5O A;  4FO5 A;  4K7N A;  5F06 A;  2YCD A;  1GSD A;  10GS A;  5B8A A;  5D9X A;  3VUR A;  2KHP A;  3GST A;  1PKW A;  2HYX A;  1CQG A;  1O81 A;  4O32 A;  1EP8 A;  1S3C A;  1PGT A;  1XZO A;  2GT6 A;  3QPM A;  2LJR A;  3IV4 A;  4XRD A;  1SK2 A;  2HNL A;  5IOX A;  4OFT A;  4K7I A;  2RII A;  4AJ6 A;  1F9M A;  1VF2 A;  2GST A;  3WGX A;  3EVI A;  4XTS A;  4ML1 A;  4EUY A;  2IN3 A;  2H1G A;  1GRX A;  3LJR A;  3DIE A;  1TRS A;  4HS1 A;  1PL1 A;  2HLS A;  2LNT A;  5HFI A;  2HRF A;  2XC2 A;  3GUR A;  2A2S A;  2PGT A;  4K8M A;  2KP1 A;  1TKD B;  1MDJ A;  3M9K A;  3J7Y b;  2BTO T;  2CVK A;  2YOI A;  5CRW A;  3ZVJ D;  2OE0 A;  4BWQ A;  2J23 A;  4DSR A;  4FYU A;  3GA4 A;  1ZOF A;  1EP7 A;  2C80 A;  1B4P A;  3L0H A;  2A2R A;  1UN2 A;  4G9H A;  2LQQ A;  1T00 A;  2P5R A;  1YF1 A;  4ZB8 A;  4OD7 A;  1A2M A;  1U3I A;  2AUV A;  4TN8 A;  5ECI B;  4AJ7 A;  3I69 A;  4J2F A;  4WR5 A;  5DBQ A;  1AIU A;  5CO3 A;  5F05 A;  3ED3 A;  1FG4 A;  4EDZ A;  4BL7 A;  3TOT A;  1V9W A;  3MDK A;  3IK9 A;  1X9W B;  1VF3 A;  2CVD A;  4Q5F A;  2PN8 A;  4TR0 A;  3VWU A;  1R5P A;  1A24 A;  1THO A;  2OJL A;  3WGE A;  5ECL B;  1O73 A;  3UAR A;  2AB6 A;  2QC7 A;  1WWJ A;  2L6D A;  3TRQ A;  1A0F A;  1B9X C;  4EXJ A;  3NZN A;  2H70 A;  3RHB A;  3VLN A;  5FHI A;  2LS5 A;  1KEB A;  4ZXG A;  1AAZ A;  5FT3 A;  1ERT A;  1FB0 A;  1XWA A;  4BPY A;  4MH3 A;  3KZQ A;  1AQX A;  3WYW A;  1AXD A;  5GAP D;  1RW1 A;  19GS A;  4IJI A;  5ECO B;  2CX3 A;  1GUM A;  2WS2 A;  3PGT A;  3S9F A;  5DCG A;  1XWK A;  2MBT A;  4NV5 A;  5IPH A;  2O7K A;  1JHB A;  1FVJ A;  3M9J A;  4MK3 A;  4BWS A;  1Q4J A;  1SJZ A;  4K2D A;  4YQM A;  1TK0 B;  2ZCT A;  3TJF A;  2FA4 A;  1BJX A;  4POK A;  1VF1 A;  3FR3 A;  2YV9 A;  4OWY A;  3M8N A;  2YWM A;  3I43 A;  4ISD A;  4EC0 A;  3ZIV A;  3BOA A;  1K0M A;  3H79 A;  3UVT A;  3EE2 A;  1ABA A;  2R37 A;  4FH8 A;  2H1B A;  1BG5 A;  2IMI A;  2X99 A;  4XIH A;  1ON4 A;  4TW5 A;  1U6T A;  2N5F A;  4RQX A;  2CZ3 A;  2O8V B;  1XXU A;  1GUL A;  2CA8 A;  1JZR A;  2YNX A;  4H86 A;  4WKW A;  1T4Z A;  3IRA A;  1DSB A;  5LNK e;  2PER A;  3E3E A;  4F03 A;  2LRT A;  4IJ3 A;  1J0F A;  3HY2 A;  3K8N A;  1GSQ A;  16GS A;  1TDI A;  2HFD A;  1BAY A;  3IXR A;  3GH6 A;  4GSN A;  1F2E A;  1E6B A;  3KEB A;  2C8U A;  4KA0 A;  1NSW A;  4HQS A;  5FWG A;  3Q74 A;  2PVO C;  3H4K A;  2REM A;  3A5W A;  4N0Z A;  2VLV A;  3HKR A;  3LFL A;  5A4V A;  3CXG A;  4NWY A;  3KH7 A;  2GZY A;  4DEJ A;  3ZYW A;  1OVN A;  5HR0 A;  4ZBD A;  2PBJ A;  5CRD A;  1SL2 B;  3FZ4 A;  3KTL A;  2XHF A;  5AN1 A;  4OCE A;  5CRE A;  2BJX A;  4LMV A;  2GQL A;  1U88 A;  1BQ7 A;  1O7U A;  3ZIT A;  3W8J A;  3FY7 A;  4LMW A;  4OFN A;  4IW9 A;  1IYI A;  1XW5 A;  1WMJ A;  2GSQ A;  4CDO A;  3KMN A;  2IMF A;  1WOU A;  1O6J A;  2R3X A;  3ZMK A;  5IIZ A;  2H6X A;  2H6Z A;  1DE2 A;  4Q5Q A;  1TP9 A;  1JZW A;  2YWO A;  4NXI A;  1T4Y A;  4X0X A;  3ZFL A;  1FOV A;  4E8E A;  2OKA A;  2PWJ A;  2X64 A;  1V40 A;  1O8W A;  1MDI A;  1PA3 A;  2L6C A;  2IFQ A;  2HZE A;  1K3O A;  5G5F A;  1PSQ A;  5H5Q A;  1GTB A;  2FUG 2;  4IN0 A;  1F3A A;  1TI3 A;  4Q5R A;  3LOR A;  5G2Z A;  3ZVJ A;  3IA1 A;  2LST A;  1HNA A;  5A4U A;  3M3M A;  3IHQ A;  4QL9 A;  3F4S A;  4I6X A;  2HSH A;  1UA5 A;  2PVQ A;  3W6G A;  1U3A A;  3EUR A;  1A8L A;  4GQF A;  2EIO A;  3FRC A;  4L0U A;  1YF0 A;  2CAQ A;  3MWH A;  1OKD A;  4N0V A;  2H0I A;  5JWR B;  3ZFB A;  3L78 A;  4MH2 A;  5KN2 A;  2BMX A;  4NPB A;  2E2G A;  4MCU A;  5HQP A;  2Z9S A;  1Q98 A;  4ECB A;  3TJB A;  5ABR A;  4IHU A;  3ZZX A;  1SD9 A;  1GSE A;  1TI1 A;  2QSI A;  1EV4 A;  1ZCP A;  2ON7 A;  2B5E A;  3DVX A;  2PPT A;  2MMN A;  2XBQ A;  3CSH A;  1M99 A;  4JBB A;  2AHE A;  1OE7 A;  1RK4 A;  2VD1 A;  1A8Y A;  3LYK A;  4EKZ A;  2JZS A;  1QMV A;  4QL7 A;  1Z7R A;  1ST9 A;  1SL0 B;  1K0B A;  1VF4 A;  2H66 A;  3SBC A;  5EVO A;  3GV1 A;  3L4N A;  3EC3 A;  3GKM A;  4V1A g;  2F3M A;  2NPB A;  2NTO A;  1MEK A;  2V2G A;  1GLQ A;  1GTI A;  3HVS A;  2VCW A;  5IPG A;  1EGO A;  1FB6 A;  2C1Y A;  1M9A A;  1GTU A;  3VK9 A;  2OAC A;  5INY A;  4ZB9 A;  5GST A;  3APO A;  2GZP A;  5B7C A;  3U5R E;  3DEX A;  5H5S A;  5J9C A;  3G7Y A;  3TJG A;  4N11 A;  5CRG A;  1FHE A;  5GSS A;  2RLI A;  2I3Y A;  4HZ2 A;  3ZML A;  3ISO A;  4OCF A;  2IFQ B;  4MJA A;  3TKS C;  4GST A;  1XOA A;  3IAM 2;  2HZE B;  2C3Q A;  5DAK B;  2VLT A;  1XW6 A;  4N10 A;  2B1K A;  4MF6 A;  4HEA 2;  5D8I A;  4GLT A;  2GDR A;  1A0R P;  3GL5 A;  3D21 A;  3HDC A;  2FD3 A;  3UJ1 A;  1OAZ A;  3AY8 A;  2E0Q A;  4HU7 A;  3VPQ A;  3D5J A;  2K9F A;  4KAE A;  1IYH A;  1SD8 A;  3QCP A;  1K3L A;  4ILF A;  5J4U A;  3D4M A;  2L57 A;  3VPT A;  1HQO A;  4L8E A;  4JR6 A;  3IE3 A;  5KN0 A;  2IME A;  1ZL9 A;  4Q5N A;  2KP2 A;  1MTC A;  1BX9 A;  3FK8 A;  3TKS E;  2OBK A;  2R2J A;  4J56 E;  4ACS A;  4HQZ A;  5GZZ B;  3RAZ A;  1DE1 A;  5ELA A;  6GSX A;  4XS6 A;  4BVX A;  2ZUP A;  2N5A A;  2OA7 A;  5D96 A;  2AV4 A;  4MJE A;  17GS A;  1R5A A;  5COH A;  4IGJ A;  5L71 A;  4TR3 A;  4FYC A;  2V1M A;  3M0F A;  4WET A;  5ELG A;  2LNS A;  1ZYE A;  1OC3 A;  1M2D A;  2DBC A;  1M7T A;  1ZGN A;  3GX8 A;  4K6X A;  3F6D A;  1J08 A;  2H75 A;  3C73 A;  1JZO A;  2JSY A;  5DJM A;  4HU9 A;  2DJK A;  1GH2 A;  4WBR D;  3GUS A;  2L4Q A;  3HYP A;  4ZL7 A;  3CRT A;  1Z6N A;  1B9Y C;  2JL4 A;  4ZL8 A;  4FIW A;  4XHM A;  1MDK A;  3Q19 A;  2H71 A;  3APS A;  4ZBA A;  1J9B A;  1T3B A;  2DC5 A;  5B6M A;  4HJM A;  2LEG A;  3DVW A;  1X5D A;  1T8E B;  3UAP A;  4CW9 A;  3LXZ A;  4L0W A;  1FAA A;  2M80 A;  1AQV A;  3DD3 A;  2GZZ A;  1B48 A;  1W4V A;  4PGT A;  1HYU A;  3PR8 A;  1LBK A;  4ZB6 A;  1K0N A;  4IBP A;  3CSJ A;  3BCI A;  4EE0 A;  3O6T A;  4MJC A;  2JSZ A;  2H19 A;  3UIW A;  3LG6 A;  2VM1 A;  2V32 A;  3BD2 A;  2CV4 A;  2CX4 A;  3DGQ A;  2DJ3 A;  5A5K A;  1MD4 A;  1XWB A;  5B8B A;  5E59 A;  4LLR A;  4KSO A;  3DKS A;  1QQ2 A;  3TJJ A;  6GSV A;  20GS A;  4AJ8 A;  1ZMA A;  3TKQ A;  3US3 A;  2LRC A;  3L9U A;  4P3Y B;  2NVL A;  3I9V 2;  3FYG A;  1GP1 A;  2B6M A;  5ENU A;  2N5B A;  5CRH A;  3NOF A;  2DMM A;  4D73 A;  1M2B A;  4E8H A;  1XFL A;  3FHK A;  4GTU A;  1K0A A;  3UL3 A;  1XPV A;  4MAB A;  2IIY A;  5IM9 A;  5D9W A;  2EC4 A;  1F3B A;  1H75 A;  2C0F A;  2VIM A;  5DAL A;  1KBN A;  1HNC A;  5HR3 A;  3BJ5 A;  1UVZ A;  1VGL A;  2V6K A;  4ZIJ A;  3TKP A;  3GKX A;  2YN1 A;  1X5E A;  2LKU A;  3GIX A;  2FWF A;  3C71 A;  3NIV A;  2C3N A;  4YAV A;  6GSW A;  4K1F A;  3QAV A;  1U87 A;  4MLY A;  5H5R A;  2GT5 A;  4TXO A;  2YP6 A;  2FCH A;  1EZK A;  3QOU A;  2XBI A;  5GAN D;  5DQS A;  3ERG A;  3TUE A;  1S3A A;  1EWX A;  3A2V A;  3MAK A;  1R26 A;  3PIN A;  4FYB A;  1E2Y A;  3ERW A;  1GSY A;  1LJR A;  2P0G A;  5C00 A;  3QDN A;  2LJA A;  4O5R A;  4HJ2 A;  2FLS A;  2LUS A;  1A2J A;  2K8S A;  1O85 A;  2G0F A;  4DSQ A;  4I8B A;  1YKC A;  1JZD A;  2IMD A;  3C1S A;  5IO2 A;  1THX A;  3CTG A;  5J9B A;  2A4V A;  4TVE A;  4F82 A;  2C0E A;  5G5E A;  1G0T A;  3LEF A;  4LL1 B;  1JLW A;  5IOW A;  3LSZ A;  1KTE A;  1XBS A;  2H01 A;  3IBH A;  1YQ1 A;  4ULX A;  2FNO A;  4MJB A;  2C3T A;  18GS A;  3F3Q A;  1TXX A;  1GNW A;  2ALB A;  3GNJ A;  2L5L A;  1GSU A;  4JED A;  4KH7 A;  1XVW A;  2VL2 C;  4XS4 A;  1W89 A;  3O76 A;  1Z9H A;  1BYE A;  4TRX A;  2VL3 A;  1TTZ A;  2K8V A;  5JCU A;  2M72 A;  4XS1 A;  2H0H A;  4RI7 A;  1X5C A;  1EGR A;  1YEP A;  5CAX A;  1WPI A;  3CRU A;  1EEM A;  1A2L A;  3FR9 A;  5F07 A;  6GSY A;  3Q6O A;  4GCI A;  4D73 B;  3TKS A;  3VFI A;  1ERV A;  3GH9 A;  4EL1 A;  5JWQ B;  5G31 A;  3KTB A;  4K0N A;  2WJU A;  4OFM A;  1TW9 A;  3PH9 A;  2F9S A;  3KIJ A;  2KLX A;  4WF4 A;  2JZT A;  5DAL B;  3WD6 A;  1WIK A;  5JWO B;  4POL A;  2WFC A;  3GTU A;  3WT1 A;  3A2W A;  1GSS A;  4ML6 A;  2IL3 A;  4PX1 A;  1QXH A;  4WBJ A;  1QFN A;  4IQA A;  2DJJ A;  2P5Q A;  1V58 A;  2R5G A;  5ECM B;  3FKF A;  2DJ0 A;  4OO4 A;  2HXK A;  2WB9 A;  4JZQ A;  2MBS A;  4GXZ A;  1AW9 A;  1V57 A;  2ZNM A;  1SU9 A;  7GSS A;  4AGS A;  3VWX A;  2FHE A;  3LXT A;  1A23 A;  3TGZ A;  3HVV A;  3IDV A;  3F63 A;  5IQY A;  5JCG A;  14GS A;  1H4O A;  1WP0 A;  1YJ6 A;  2VCV A;  2OAD A;  2EIR A;  3KH9 A;  2X8H A;  4V2L A;  5HFG A;  1YZX A;  5DJL A;  2HSY A;  3VI5 A;  3CSI A;  3ERF A;  2XPE A;  4POM A;  1SK1 A;  4RUV A;  2VL9 A;  5AIS A;  4NMU A;  2B1L A;  2TRX A;  2YPM A;  3FR6 A;  3EWL A;  1K0D A;  2B5X A;  3EMP A;  2VLU A;  2OBI A;  1XW9 A;  3GFK A;  8GSS A;  1TU7 A;  6GSS A;  2OE1 A;  3KGK A;  1OE8 A;  1XWG A;  2H74 A;  1Y6E A;  2AYT A;  2O85 A;  5LCZ A;  3QFA C;  2O87 A;  5IMA A;  2IJY A;  13GS A;  2DJ2 A;  4EO3 A;  2GQK A;  3P90 A;  4YAP A;  2HT9 A;  4KUN A;  2EIQ A;  4MF5 A;  4IP1 A;  4TXV A;  4TR1 A;  4HZ4 A;  4I5Q A;  1Z5Y E;  1SKW B;  3TJK A;  1GUH A;  2MZC A;  4PXO A;  2FGX A;  1ZYQ B;  1SEN A;  4RQR A;  4X1U A;  3HVX A;  4KCA A;  2JAC A;  2GLR A;  3D0Z A;  1ZZY A;  9GSS A;  4IKH A;  2V41 A;  3HZ8 A;  3OR5 A;  2IWT A;  4IS0 A;  4QQ7 A;  4PUA A;  3TRP A;  3GTU B;  4WEY A;  5DQY A;  2WZ9 A;  4I2T A;  2VCZ A;  1XOB A;  1C72 A;  3L9S A;  1OKT A;  1F37 A;  1TU8 A;  1XCC A;  1YDK A;  1ACV A;  3P2A A;  2LQO A;  6GST A;  2KUC A;  3TB2 A;  3APQ A;  4PUR A;  4OO5 A;  4ECI A;  4MZC A;  2R6K A;  1NHO A;  1SJ6 A;  3F0I A;  1XWC A;  4MZB A;  2J9H A;  2H8L A;  3EU4 A;  4G2E A;  5B6N A;  1SKS B;  2B5Y A;  2H0G A;  3QD9 A;  2GQM A;  1GL8 A;  2FA8 A;  2KOK A;  1Z3E A;  3HHV A;  1S3D A;  2H6Y A;  1B4Q A;  1OC9 A;  4O7H A;  1GWC A;  3RBT A;  2RUE A;  4K0G A;  3CMI A;  2JAD A;  1X9S B;  2X8G A;  4IP6 A;  4YQV A;  12GS A;  2FWH A;  4KDU A;  3VI7 A;  3GKK A;  3C7M A;  1PQN A;  1QK8 A;  4V1A p;  2VAF A;  1JFU A;  3TOU A;  5AIX A;  3BBY A;  3HD5 A;  3GHA A;  1EV9 A;  2GGT A;  3MNG A;  4F0C A;  1GNE A;  6GSU A;  1SYR A;  4JU5 A;  2DSA A;  4IEL A;  2GSS A;  1K0C A;  5D73 A;  4ZIL A;  4V2M A;  3WT2 A;  3FZ5 A;  3BCK A;  2L59 A;  2YZU A;  3A3T A;  2IPA A;  3KD0 A;  5ECS A;  4POB A;  1G7E A;  3IOS A;  3TKR A;  5HR1 A;  5JCW A;  1URM A;  2DLX A;  1PKZ A;  3MSZ A;  4WF5 A;  4EF0 A;  1M2A A;  2DIZ A;  3F9U A;  3H1N A;  4HOJ A;  3QR6 A;  5J41 A;  4GWR A;  5HR2 A;  1Y25 A;  2GS3 A;  5DDL A;  4AF2 A;  5CNW A;  2H72 A;  4TR1 B;  1N8J A;  2C0G A;  3WGD A;  2VL2 A;  3ZRD A;  4F9Z A;  3KP9 A;  3F4T A;  5ID2 A;  2R4V A;  2MMZ A;  2CAI A;  1TOF A;  5IMZ A;  3GX0 A;  1USB A;  4PNG A;  5J3R A;  5CP1 A;  5D9T A;  3HJP A;  4RI6 A;  3E9J B;  4GRF A;  3C8E A;  5C04 A;  3HXS A;  2B3S A;  4KDY A;  2DML A;  1JLV A;  2HE3 A;  3UEM A;  3O3T A;  4O92 A; 
#chains in the Genus database with same CATH topology
 4YQU A;  2OE3 A;  3N5O A;  2K6V A;  2WGR A;  4ECJ A;  3QFB C;  4K9Z A;  5KN3 A;  3ZLP A;  2TIR A;  1I9D A;  3HCZ A;  2XPD A;  4Z7X A;  1M0U A;  1T7P B;  2O89 A;  4F2I A;  3HZ4 A;  5ECQ B;  1OC9 B;  1DUG A;  5J5N A;  2F8A A;  1Z6M A;  1VRS D;  2L5O A;  5DVB A;  3G7J A;  3V1W A;  3VWW A;  3D22 A;  3KCM A;  2VM2 A;  1UC7 A;  2E7P A;  2K18 A;  4L5L A;  2YV7 A;  2YWN A;  1F6M C;  4TR4 A;  4X43 A;  4WXT A;  4IQ1 A;  2VOC A;  1G7O A;  2MMA A;  3GMF A;  1NW2 A;  1X9M B;  4LL4 B;  4F0B A;  1FW1 A;  1O8X A;  4KDX A;  4KW6 A;  1TRW A;  3J7Y k;  2M46 A;  2YWI A;  3IR4 A;  4ZBB A;  1LU4 A;  2H1D A;  2C0D A;  4DSS A;  4I2U A;  4JE1 A;  1CQH A;  3H8Q A;  1ML6 A;  2P31 A;  4ECC A;  1GLP A;  1GUK A;  4O5Q A;  2VO4 A;  4DVC A;  4TKY A;  2F51 A;  2I9H A;  3UVH A;  2DJ1 A;  2H76 A;  4KSM A;  3R2Q A;  3GSS A;  4PQI A;  3D4T A;  1YEX A;  1AC1 A;  3DYR A;  3I6A A;  4KCE A;  2GSR A;  3C1R A;  4PNF A;  4GQC A;  4NHW A;  1PX6 A;  5IMV A;  5LD0 A;  4NHZ A;  2E2M A;  4NAX A;  4TOP A;  4BVY A;  3ZRE A;  3DWV A;  2G2Q A;  3RDW A;  1N2A A;  5ID2 B;  1NHY A;  3QMX A;  2CZ2 A;  1HD2 A;  1PRX A;  3KJY A;  4YH2 A;  2YAN A;  3E0U A;  4KGI A;  2I4A A;  2FWG A;  1PX7 A;  5CYY A;  1RQM A;  2HI7 A;  4EVM A;  3IPZ A;  2YJ7 A;  3TDG A;  4BA7 A;  1QUW A;  2X8C A;  1TJD A;  2WCI A;  3G7I A;  1SL1 B;  1MD3 A;  1OYJ A;  3IHG A;  3RPP A;  3RPN A;  3ZTL A;  1SK0 A;  2CQ9 A;  3UBL A;  5IMC A;  3JCM L;  5G1K A;  4EIP A;  3KMO A;  1GTA A;  3KM6 A;  5ECK B;  1V98 A;  5F8B A;  2RM5 A;  3GN3 A;  1XIY A;  2GTU A;  2F8F A;  3CYN A;  3QAW A;  1FO5 A;  3UMA A;  4K7O A;  4ID0 A;  2LTK A;  4EDY A;  5EPF A;  5KN1 A;  1FVK A;  5ECP B;  3HJO A;  1QGV A;  4PQH A;  1WE0 A;  1TK8 B;  2VCQ A;  3UBK A;  3Q18 A;  3EMX A;  4MA9 A;  1HNB A;  3P8W A;  4LA1 A;  3HJM A;  4KND A;  4NV2 A;  3F8U A;  1B8X A;  2YJH A;  4Z2T A;  2TRC P;  4TXO B;  3TRX A;  2WUL A;  5DAK A;  5HFK A;  3W8S A;  2MMO A;  3EYT A;  3VWV A;  4DSS B;  2HRN A;  1GSF A;  4IVF A;  1XVQ A;  2L4C A;  4MF7 A;  3GKN A;  3KP8 A;  3N9J A;  4G19 A;  3A5I A;  2RM6 A;  5D93 A;  5F0G A;  1ERU A;  3HVN A;  4JR4 A;  4MPF A;  2QGV A;  2PUK C;  3LQ7 A;  3D6I A;  5G30 A;  3L9V A;  5EL8 A;  4GSS A;  1SKR B;  3G9B A;  3FZ9 A;  4MDC A;  2D2Z A;  2MYG A;  3FZA A;  4K5S A;  3H93 A;  4BVY B;  4X4J A;  2CVB A;  1WJK A;  1M9B A;  1OC8 A;  4CHS A;  3FW2 A;  1T1V A;  2H30 A;  1SJI A;  3LW9 A;  4J57 E;  1BED A;  1PFO A;  4WR4 A;  5IMF A;  2NBS A;  2RUF A;  3EIN A;  5ECN B;  2B7J A;  4XS4 B;  1PD2 1;  2WDU A;  3GYK A;  2VCX A;  2JZR A;  2PMT A;  3CBU A;  2LV3 A;  4Z2U A;  3HA9 A;  3DRN A;  1EEJ A;  1PN9 A;  3UOM A;  1TRV A;  3DML A;  3GRX A;  1X0R A;  4G0L A;  2V6O A;  1TRU A;  3LGC A;  4V2N A;  2LJK A;  1R7H A;  4KB3 A;  4MP4 A;  2PU9 C;  4YKG A;  2DIY A;  1WRY A;  4USS A;  4GF0 A;  2AJQ B;  5AGY A;  3EU3 A;  2B7K A;  2CT6 A;  3F3R A;  3RHC A;  3P7X A;  2WRT A;  3ZL5 A;  22GS A;  3FEU A;  1AUC A;  3FMW A;  4HUA A;  1NM3 A;  3LWA A;  1S3R A;  1PMT A;  4HDE A;  4XCS A;  2I1U A;  5AIV A;  1ERW A;  2C4J A;  1SYX A;  2NDO A;  5IO0 A;  2FY6 A;  3F4R A;  5ECH B;  3TCO A;  3IC4 A;  11GS A;  3SWL A;  4KX4 A;  1EOH A;  5G1L A;  1DBY A;  4PUF C;  2GVP A;  3A2X A;  1K3Y A;  2VCT A;  4MZW A;  2H1A A;  4PQ1 A;  1R4W A;  1G6Y A;  5IMD A;  3DXB A;  2YZH A;  3U6V A;  2ON5 A;  1EOG A;  4MMM A;  4OMV A;  4ZL9 A;  2AAW A;  2ES7 A;  1PL2 A;  4MPG A;  2HZF A;  2FWE A;  2LRN A;  5A4W A;  1YY7 A;  5KEJ A;  1TK5 B;  5ECR B;  3GL3 A;  2H73 A;  2VUP A;  5E4W A;  3LYP A;  1G6W A;  1AQW A;  4XRA A;  3ZIJ A;  3F6F A;  3CTF A;  1KNG A;  1I5G A;  1YKA A;  3KXO A;  4JRR A;  5DCH A;  3ME8 A;  1V2A A;  2VD0 A;  1ILO A;  3ME7 A;  4HI7 A;  2QKE A;  4I97 A;  3QAG A;  1Z7P A;  1PN0 A;  5EY6 A;  3IAS 2;  4G10 A;  2JU5 A;  5D9V A;  4A5P A;  4KE3 A;  3IK7 A;  4N30 A;  2IMK A;  2I81 A;  3M1G A;  1K0O A;  4L5O A;  4FO5 A;  4K7N A;  5F06 A;  2YCD A;  1GSD A;  10GS A;  5B8A A;  5D9X A;  3VUR A;  2KHP A;  3GST A;  1PKW A;  2HYX A;  1CQG A;  1O81 A;  4O32 A;  1EP8 A;  1S3C A;  1PGT A;  1XZO A;  2GT6 A;  3QPM A;  2LJR A;  3IV4 A;  4XRD A;  1SK2 A;  2HNL A;  5IOX A;  4OFT A;  4K7I A;  2RII A;  4AJ6 A;  1F9M A;  1VF2 A;  2GST A;  3WGX A;  3EVI A;  4XTS A;  4ML1 A;  4EUY A;  2IN3 A;  2H1G A;  1GRX A;  3LJR A;  3DIE A;  1TRS A;  4HS1 A;  1PL1 A;  2HLS A;  2LNT A;  5HFI A;  2HRF A;  2XC2 A;  3GUR A;  2A2S A;  2PGT A;  4K8M A;  2KP1 A;  1TKD B;  1MDJ A;  3M9K A;  3J7Y b;  2BTO T;  2CVK A;  2YOI A;  5CRW A;  3ZVJ D;  2OE0 A;  4BWQ A;  2J23 A;  4DSR A;  4FYU A;  3GA4 A;  1ZOF A;  1EP7 A;  2C80 A;  1B4P A;  3L0H A;  2A2R A;  1UN2 A;  4G9H A;  2LQQ A;  1T00 A;  2P5R A;  1YF1 A;  4ZB8 A;  4OD7 A;  1A2M A;  1U3I A;  2AUV A;  4TN8 A;  5ECI B;  4AJ7 A;  3I69 A;  4J2F A;  4WR5 A;  5DBQ A;  1AIU A;  5CO3 A;  5F05 A;  3ED3 A;  1FG4 A;  4EDZ A;  4BL7 A;  3TOT A;  1V9W A;  3MDK A;  3IK9 A;  1X9W B;  1VF3 A;  2CVD A;  4Q5F A;  2PN8 A;  4TR0 A;  3VWU A;  1R5P A;  1A24 A;  1THO A;  2OJL A;  3WGE A;  5ECL B;  1O73 A;  3UAR A;  2AB6 A;  2QC7 A;  1WWJ A;  2L6D A;  3TRQ A;  1A0F A;  1B9X C;  4EXJ A;  3NZN A;  2H70 A;  3EPT A;  3RHB A;  3VLN A;  5FHI A;  2LS5 A;  1KEB A;  4ZXG A;  1AAZ A;  5FT3 A;  1ERT A;  1FB0 A;  1XWA A;  4BPY A;  4MH3 A;  3KZQ A;  1AQX A;  3WYW A;  1AXD A;  5GAP D;  1RW1 A;  2UZ8 A;  19GS A;  4IJI A;  5ECO B;  2CX3 A;  1GUM A;  2WS2 A;  3PGT A;  3S9F A;  5DCG A;  1XWK A;  2MBT A;  4NV5 A;  5IPH A;  2O7K A;  1JHB A;  1FVJ A;  3M9J A;  4MK3 A;  4BWS A;  1Q4J A;  1SJZ A;  4K2D A;  4YQM A;  1TK0 B;  2ZCT A;  3TJF A;  2FA4 A;  1BJX A;  4POK A;  3R3E A;  1VF1 A;  3FR3 A;  2YV9 A;  4OWY A;  3M8N A;  2YWM A;  3I43 A;  4ISD A;  4EC0 A;  3ZIV A;  3BOA A;  1K0M A;  3H79 A;  3UVT A;  3EE2 A;  1ABA A;  2R37 A;  4FH8 A;  2H1B A;  1BG5 A;  2IMI A;  2X99 A;  4XIH A;  1ON4 A;  4TW5 A;  1U6T A;  2N5F A;  4RQX A;  2CZ3 A;  2O8V B;  1XXU A;  1GUL A;  2CA8 A;  1JZR A;  2YNX A;  4H86 A;  4WKW A;  1T4Z A;  4PTS A;  3IRA A;  1DSB A;  5LNK e;  2PER A;  3E3E A;  4ICY A;  4F03 A;  2LRT A;  4CY6 A;  4IJ3 A;  1J0F A;  3HY2 A;  3K8N A;  1GSQ A;  16GS A;  1TDI A;  2HFD A;  1BAY A;  3IXR A;  3GH6 A;  4GSN A;  1F2E A;  1E6B A;  3MYD A;  3KEB A;  2C8U A;  2HRA A;  4KA0 A;  5BMU A;  1NSW A;  4HQS A;  5FWG A;  3Q74 A;  4BL7 B;  2PVO C;  3H4K A;  2REM A;  3A5W A;  4N0Z A;  2VLV A;  3HKR A;  3LFL A;  5A4V A;  3CXG A;  4NWY A;  2R0G A;  3KH7 A;  2GZY A;  4DEJ A;  3ZYW A;  2X4A A;  1OVN A;  5HR0 A;  4ZBD A;  2PBJ A;  5CRD A;  1SL2 B;  3FZ4 A;  3KTL A;  2XHF A;  5AN1 A;  4OCE A;  5CRE A;  2BJX A;  1M3I A;  4LMV A;  2GQL A;  1U88 A;  1BQ7 A;  1O7U A;  3ZIT A;  3W8J A;  3FY7 A;  4LMW A;  4G0K A;  4OFN A;  4IW9 A;  1IYI A;  1XW5 A;  1WMJ A;  2GSQ A;  4CDO A;  3KMN A;  2QA2 A;  2IMF A;  1WOU A;  1O6J A;  2R3X A;  3ZMK A;  5IIZ A;  2H6X A;  2H6Z A;  1DE2 A;  4Q5Q A;  1TP9 A;  1JZW A;  2YWO A;  4NXI A;  1T4Y A;  4X0X A;  3ZFL A;  1FOV A;  4E8E A;  2OKA A;  2PWJ A;  2X64 A;  1V40 A;  1O8W A;  1MDI A;  1PA3 A;  1XG8 A;  2L6C A;  2IFQ A;  2HZE A;  1K3O A;  5G5F A;  1PSQ A;  5H5Q A;  1GTB A;  5BRT A;  2FUG 2;  4IN0 A;  1F3A A;  1TI3 A;  4Q5R A;  3LOR A;  5G2Z A;  3ZVJ A;  3IA1 A;  2LST A;  1HNA A;  2A4H A;  3M3M A;  5A4U A;  3IHQ A;  4QL9 A;  3F4S A;  4I6X A;  2HSH A;  1UA5 A;  2PVQ A;  3W6G A;  1U3A A;  3EUR A;  1A8L A;  4GQF A;  2EIO A;  3FRC A;  4L0U A;  1YF0 A;  2CAQ A;  3MWH A;  1OKD A;  4N0V A;  2H0I A;  2X49 A;  5JWR B;  3ZFB A;  3L78 A;  4MH2 A;  5KN2 A;  2BMX A;  4NPB A;  2E2G A;  4MCU A;  5HQP A;  2Z9S A;  1Q98 A;  4ECB A;  3TJB A;  5ABR A;  4IHU A;  3ZZX A;  1SD9 A;  1GSE A;  1TI1 A;  2QSI A;  1EV4 A;  1ZCP A;  2ON7 A;  2B5E A;  3DVX A;  2PPT A;  2MMN A;  2XBQ A;  3CSH A;  1M99 A;  4JBB A;  2AHE A;  1OE7 A;  1RK4 A;  2VD1 A;  1A8Y A;  3LYK A;  4EKZ A;  2JZS A;  1QMV A;  4QL7 A;  1Z7R A;  1ST9 A;  1SL0 B;  1K0B A;  1VF4 A;  2H66 A;  3SBC A;  5EVO A;  3GV1 A;  3L4N A;  3EC3 A;  3GKM A;  4V1A g;  2F3M A;  2NPB A;  3IC8 A;  2NTO A;  1MEK A;  2V2G A;  1GLQ A;  1GTI A;  3HVS A;  2VCW A;  5IPG A;  1EGO A;  1FB6 A;  2C1Y A;  1M9A A;  1GTU A;  3VK9 A;  2OAC A;  5INY A;  4ZB9 A;  5GST A;  3APO A;  2GZP A;  5B7C A;  3U5R E;  3DEX A;  5H5S A;  5J9C A;  3G7Y A;  3TJG A;  4N11 A;  5CRG A;  1FHE A;  5GSS A;  2RLI A;  2I3Y A;  4HZ2 A;  3ZML A;  3ISO A;  4OCF A;  2IFQ B;  4MJA A;  3TKS C;  4GST A;  1XOA A;  3IAM 2;  2HZE B;  2C3Q A;  5DAK B;  2VLT A;  1XW6 A;  4N10 A;  2B1K A;  4MF6 A;  4HEA 2;  5D8I A;  4GLT A;  2GDR A;  1A0R P;  3GL5 A;  2A2P A;  3D21 A;  3HDC A;  2FD3 A;  3UJ1 A;  1OAZ A;  3AY8 A;  2E0Q A;  4HU7 A;  3VPQ A;  3D5J A;  2K9F A;  4KAE A;  1IYH A;  1SD8 A;  3QCP A;  1K3L A;  4ILF A;  5J4U A;  3D4M A;  2L57 A;  3VPT A;  1HQO A;  5KOX A;  4L8E A;  4JR6 A;  3IE3 A;  2QA1 A;  5KN0 A;  2IME A;  1ZL9 A;  4Q5N A;  2KP2 A;  1MTC A;  1BX9 A;  3FK8 A;  3TKS E;  2OBK A;  4O5U A;  2R2J A;  4J56 E;  4ACS A;  4HQZ A;  5GZZ B;  3RAZ A;  1DE1 A;  5ELA A;  6GSX A;  4XS6 A;  4BVX A;  2ZUP A;  2N5A A;  3PPU A;  2OA7 A;  5D96 A;  2AV4 A;  4MJE A;  17GS A;  1R5A A;  5COH A;  4IGJ A;  5L71 A;  4TR3 A;  4FYC A;  2V1M A;  3M0F A;  4WET A;  5ELG A;  2LNS A;  1ZYE A;  1OC3 A;  1M2D A;  2DBC A;  1M7T A;  1ZGN A;  3GX8 A;  4K6X A;  3F6D A;  1J08 A;  2H75 A;  3C73 A;  1JZO A;  2JSY A;  5DJM A;  4HU9 A;  2DJK A;  1GH2 A;  4WBR D;  3GUS A;  2L4Q A;  3HYP A;  4ZL7 A;  3CRT A;  1Z6N A;  1B9Y C;  2JL4 A;  4ZL8 A;  4FIW A;  4BIK A;  4XHM A;  1MDK A;  3Q19 A;  2H71 A;  3APS A;  4ZBA A;  1J9B A;  1T3B A;  2DC5 A;  5B6M A;  4HJM A;  2LEG A;  3DVW A;  1X5D A;  1M3J A;  1T8E B;  3UAP A;  4CW9 A;  3LXZ A;  4L0W A;  1FAA A;  2M80 A;  1AQV A;  3DD3 A;  2GZZ A;  1B48 A;  1W4V A;  4PGT A;  1HYU A;  3PR8 A;  1LBK A;  4ZB6 A;  1K0N A;  4IBP A;  3CSJ A;  3BCI A;  4EE0 A;  3O6T A;  4MJC A;  2JSZ A;  2H19 A;  3UIW A;  3LG6 A;  2VM1 A;  2V32 A;  3BD2 A;  2CV4 A;  2CX4 A;  3DGQ A;  2DJ3 A;  5A5K A;  1MD4 A;  1XWB A;  5B8B A;  5E59 A;  4LLR A;  4KSO A;  3DKS A;  1QQ2 A;  3TJJ A;  6GSV A;  20GS A;  4AJ8 A;  1ZMA A;  3TKQ A;  3US3 A;  2LRC A;  3L9U A;  4P3Y B;  2NVL A;  3I9V 2;  3FYG A;  2R0P A;  1GP1 A;  2B6M A;  5ENU A;  2N5B A;  5CRH A;  3NOF A;  2DMM A;  4D73 A;  1M2B A;  4E8H A;  1XFL A;  3FHK A;  4GTU A;  1K0A A;  3UL3 A;  1XPV A;  4MAB A;  2IIY A;  2HRK A;  5IM9 A;  5D9W A;  2EC4 A;  1F3B A;  1H75 A;  2C0F A;  2VIM A;  5DAL A;  1KBN A;  1HNC A;  5HR3 A;  3BJ5 A;  1UVZ A;  1VGL A;  2V6K A;  4ZIJ A;  3TKP A;  3GKX A;  2YN1 A;  1X5E A;  2LKU A;  3GIX A;  2FWF A;  3C71 A;  4BVX B;  3NIV A;  2C3N A;  4YAV A;  6GSW A;  4K1F A;  3QAV A;  1U87 A;  4MLY A;  5H5R A;  2GT5 A;  4TXO A;  2YP6 A;  2FCH A;  1EZK A;  3QOU A;  2XBI A;  5GAN D;  5DQS A;  3ERG A;  3TUE A;  1S3A A;  1EWX A;  4MNN A;  3CQF A;  4CY8 A;  3A2V A;  3MAK A;  1R26 A;  3PIN A;  4FYB A;  2HSM A;  1E2Y A;  3ERW A;  2DKI A;  1FOH A;  1GSY A;  1LJR A;  2P0G A;  5C00 A;  3QDN A;  2LJA A;  4O5R A;  4HJ2 A;  2FLS A;  2LUS A;  1A2J A;  2K8S A;  1O85 A;  2G0F A;  4DSQ A;  2R0C A;  4I8B A;  1YKC A;  1JZD A;  2IMD A;  3C1S A;  5IO2 A;  1THX A;  3CTG A;  5J9B A;  2A4V A;  4TVE A;  4K2X A;  4F82 A;  2C0E A;  5G5E A;  1G0T A;  3LEF A;  4LL1 B;  1JLW A;  5IOW A;  3LSZ A;  1KTE A;  1XBS A;  2H01 A;  3IBH A;  1YQ1 A;  4ULX A;  2FNO A;  4MJB A;  2C3T A;  18GS A;  3F3Q A;  1TXX A;  1GNW A;  2ALB A;  3GNJ A;  3MIX A;  2L5L A;  1GSU A;  4JED A;  4KH7 A;  1XVW A;  2VL2 C;  4KF9 A;  4XS4 A;  1W89 A;  3O76 A;  1Z9H A;  1BYE A;  4TRX A;  2VL3 A;  1TTZ A;  2K8V A;  5JCU A;  2M72 A;  4XS1 A;  2H0H A;  4RI7 A;  1X5C A;  1EGR A;  1YEP A;  5CAX A;  1WPI A;  3CRU A;  1EEM A;  1A2L A;  3FR9 A;  5F07 A;  6GSY A;  3Q6O A;  4GCI A;  4D73 B;  3TKS A;  3VFI A;  1ERV A;  3GH9 A;  4EL1 A;  5JWQ B;  5G31 A;  3KTB A;  4K0N A;  2WJU A;  4OFM A;  1TW9 A;  3PH9 A;  2F9S A;  3KIJ A;  2KLX A;  4WF4 A;  2JZT A;  5DAL B;  3WD6 A;  1WIK A;  5JWO B;  4YKF A;  4POL A;  2WFC A;  3GTU A;  3WT1 A;  3A2W A;  1GSS A;  4ML6 A;  2IL3 A;  4PX1 A;  1QXH A;  4WBJ A;  1QFN A;  4IQA A;  2DJJ A;  2P5Q A;  1V58 A;  2R5G A;  5ECM B;  3FKF A;  2DJ0 A;  4OO4 A;  2HXK A;  2WB9 A;  4JZQ A;  2MBS A;  4GXZ A;  1AW9 A;  1V57 A;  2ZNM A;  1SU9 A;  7GSS A;  4AGS A;  3VWX A;  2FHE A;  3LXT A;  1A23 A;  3TGZ A;  3HVV A;  3IDV A;  3F63 A;  5IQY A;  5JCG A;  14GS A;  1H4O A;  4K5R A;  1WP0 A;  1YJ6 A;  2VCV A;  2OAD A;  2EIR A;  3KH9 A;  2X8H A;  4V2L A;  5HFG A;  1YZX A;  5DJL A;  4FQU A;  2HSY A;  3VI5 A;  3CSI A;  3ERF A;  2XPE A;  4POM A;  1SK1 A;  4RUV A;  2VL9 A;  5AIS A;  4NMU A;  2B1L A;  2TRX A;  2YPM A;  3FR6 A;  3EWL A;  1K0D A;  2B5X A;  3EMP A;  2VLU A;  2OBI A;  1XW9 A;  3GFK A;  8GSS A;  1TU7 A;  6GSS A;  2OE1 A;  3KGK A;  1OE8 A;  1XWG A;  4EIQ A;  2H74 A;  1Y6E A;  2AYT A;  2O85 A;  5LCZ A;  3QFA C;  2O87 A;  5IMA A;  2IJY A;  13GS A;  2DJ2 A;  4EO3 A;  2GQK A;  3P90 A;  4YAP A;  2HT9 A;  4KUN A;  2EIQ A;  4MF5 A;  4IP1 A;  4TXV A;  4TR1 A;  4HZ4 A;  4I5Q A;  1Z5Y E;  1SKW B;  3TJK A;  1GUH A;  2MZC A;  4PXO A;  2FGX A;  1ZYQ B;  1SEN A;  4RQR A;  4X1U A;  3HVX A;  4KCA A;  2JAC A;  2GLR A;  3D0Z A;  1ZZY A;  9GSS A;  4IKH A;  2V41 A;  3HZ8 A;  3OR5 A;  2IWT A;  4IS0 A;  4QQ7 A;  4PUA A;  3TRP A;  3GTU B;  4WEY A;  5DQY A;  2WZ9 A;  4I2T A;  2VCZ A;  1XOB A;  1C72 A;  3L9S A;  1OKT A;  1F37 A;  1TU8 A;  1XCC A;  1YDK A;  1ACV A;  3P2A A;  2LQO A;  6GST A;  2KUC A;  3TB2 A;  3APQ A;  4PUR A;  4OO5 A;  4ECI A;  4G0I A;  4MZC A;  2R6K A;  1NHO A;  1SJ6 A;  3F0I A;  1XWC A;  4MZB A;  2J9H A;  2H8L A;  4HSC X;  3EU4 A;  4G2E A;  5B6N A;  1SKS B;  2B5Y A;  2H0G A;  3QD9 A;  2GQM A;  1GL8 A;  2FA8 A;  2KOK A;  1Z3E A;  3HHV A;  1S3D A;  2H6Y A;  1B4Q A;  1OC9 A;  4O7H A;  2DKH A;  1GWC A;  3RBT A;  4Z2R A;  2RUE A;  4K0G A;  3CMI A;  2JAD A;  1X9S B;  2X8G A;  4IP6 A;  4YQV A;  12GS A;  2FWH A;  4KDU A;  3VI7 A;  3GKK A;  3C7M A;  1PQN A;  1QK8 A;  4V1A p;  2VAF A;  1JFU A;  3TOU A;  5AIX A;  3BBY A;  3HD5 A;  3GHA A;  1EV9 A;  2GGT A;  3MNG A;  4F0C A;  1GNE A;  1ZYN A;  1SYR A;  6GSU A;  4JU5 A;  2DSA A;  4IEL A;  2GSS A;  1K0C A;  5D73 A;  4ZIL A;  4V2M A;  3WT2 A;  1ZYP A;  3FZ5 A;  3BCK A;  2L59 A;  2YZU A;  3A3T A;  2IPA A;  3KD0 A;  5ECS A;  4POB A;  1G7E A;  3IOS A;  3TKR A;  5HR1 A;  5JCW A;  1URM A;  2DLX A;  1PKZ A;  3MSZ A;  4WF5 A;  4EF0 A;  1M2A A;  2DIZ A;  3F9U A;  3H1N A;  4HOJ A;  3QR6 A;  5J41 A;  4GWR A;  5HR2 A;  1Y25 A;  2GS3 A;  5DDL A;  4AF2 A;  5CNW A;  2H72 A;  4TR1 B;  1N8J A;  2C0G A;  3WGD A;  2VL2 A;  3ZRD A;  4F9Z A;  3KP9 A;  3F4T A;  5ID2 A;  2R4V A;  2MMZ A;  2CAI A;  1TOF A;  5IMZ A;  3GX0 A;  1USB A;  4PNG A;  5J3R A;  5CP1 A;  5D9T A;  3HJP A;  4RI6 A;  3E9J B;  4GRF A;  3C8E A;  5C04 A;  3HXS A;  2B3S A;  4KDY A;  2DML A;  1JLV A;  2HE3 A;  5KOW A;  3UEM A;  3O3T A;  4O92 A; 
#chains in the Genus database with same CATH homology
 4YQU A;  2OE3 A;  3N5O A;  2K6V A;  2WGR A;  4ECJ A;  3QFB C;  4K9Z A;  5KN3 A;  3ZLP A;  2TIR A;  1I9D A;  3HCZ A;  2XPD A;  4Z7X A;  1M0U A;  1T7P B;  2O89 A;  4F2I A;  3HZ4 A;  5ECQ B;  1OC9 B;  1DUG A;  5J5N A;  2F8A A;  1Z6M A;  1VRS D;  2L5O A;  5DVB A;  3G7J A;  3V1W A;  3VWW A;  3D22 A;  3KCM A;  2VM2 A;  1UC7 A;  2E7P A;  2K18 A;  4L5L A;  2YV7 A;  2YWN A;  1F6M C;  4TR4 A;  4X43 A;  4WXT A;  4IQ1 A;  2VOC A;  1G7O A;  2MMA A;  3GMF A;  1NW2 A;  1X9M B;  4LL4 B;  4F0B A;  1FW1 A;  1O8X A;  4KDX A;  4KW6 A;  1TRW A;  3J7Y k;  2M46 A;  2YWI A;  3IR4 A;  4ZBB A;  1LU4 A;  2H1D A;  2C0D A;  4DSS A;  4I2U A;  4JE1 A;  1CQH A;  3H8Q A;  1ML6 A;  2P31 A;  4ECC A;  1GLP A;  1GUK A;  4O5Q A;  2VO4 A;  4DVC A;  4TKY A;  2F51 A;  2I9H A;  3UVH A;  2DJ1 A;  2H76 A;  4KSM A;  3R2Q A;  3GSS A;  4PQI A;  3D4T A;  1YEX A;  1AC1 A;  3DYR A;  3I6A A;  4KCE A;  2GSR A;  3C1R A;  4PNF A;  4GQC A;  4NHW A;  1PX6 A;  5IMV A;  5LD0 A;  4NHZ A;  2E2M A;  4NAX A;  4TOP A;  4BVY A;  3ZRE A;  3DWV A;  2G2Q A;  3RDW A;  1N2A A;  5ID2 B;  1NHY A;  3QMX A;  2CZ2 A;  1HD2 A;  1PRX A;  3KJY A;  4YH2 A;  2YAN A;  3E0U A;  4KGI A;  2I4A A;  2FWG A;  1PX7 A;  5CYY A;  1RQM A;  2HI7 A;  4EVM A;  3IPZ A;  2YJ7 A;  3TDG A;  4BA7 A;  1QUW A;  2X8C A;  1TJD A;  2WCI A;  3G7I A;  1SL1 B;  1MD3 A;  1OYJ A;  3IHG A;  3RPP A;  3RPN A;  3ZTL A;  1SK0 A;  2CQ9 A;  3UBL A;  5IMC A;  3JCM L;  5G1K A;  4EIP A;  3KMO A;  1GTA A;  3KM6 A;  5ECK B;  1V98 A;  5F8B A;  2RM5 A;  3GN3 A;  1XIY A;  2GTU A;  2F8F A;  3CYN A;  3QAW A;  1FO5 A;  3UMA A;  4K7O A;  4ID0 A;  2LTK A;  4EDY A;  5EPF A;  5KN1 A;  1FVK A;  5ECP B;  3HJO A;  1QGV A;  4PQH A;  1WE0 A;  1TK8 B;  2VCQ A;  3UBK A;  3Q18 A;  3EMX A;  4MA9 A;  1HNB A;  3P8W A;  4LA1 A;  3HJM A;  4KND A;  4NV2 A;  3F8U A;  1B8X A;  2YJH A;  4Z2T A;  2TRC P;  4TXO B;  3TRX A;  2WUL A;  5DAK A;  5HFK A;  3W8S A;  2MMO A;  3EYT A;  3VWV A;  4DSS B;  2HRN A;  1GSF A;  4IVF A;  1XVQ A;  2L4C A;  4MF7 A;  3GKN A;  3KP8 A;  3N9J A;  4G19 A;  3A5I A;  2RM6 A;  5D93 A;  5F0G A;  1ERU A;  4JR4 A;  4MPF A;  2QGV A;  2PUK C;  3LQ7 A;  3D6I A;  5G30 A;  3L9V A;  5EL8 A;  4GSS A;  1SKR B;  3G9B A;  3FZ9 A;  4MDC A;  2D2Z A;  2MYG A;  3FZA A;  4K5S A;  3H93 A;  4BVY B;  4X4J A;  2CVB A;  1WJK A;  1M9B A;  1OC8 A;  4CHS A;  3FW2 A;  1T1V A;  2H30 A;  1SJI A;  3LW9 A;  4J57 E;  1BED A;  4WR4 A;  5IMF A;  2NBS A;  2RUF A;  3EIN A;  5ECN B;  2B7J A;  4XS4 B;  1PD2 1;  2WDU A;  3GYK A;  2VCX A;  2JZR A;  2PMT A;  3CBU A;  2LV3 A;  4Z2U A;  3HA9 A;  3DRN A;  1EEJ A;  1PN9 A;  3UOM A;  1TRV A;  3DML A;  3GRX A;  1X0R A;  4G0L A;  2V6O A;  1TRU A;  3LGC A;  4V2N A;  2LJK A;  1R7H A;  4KB3 A;  4MP4 A;  2PU9 C;  4YKG A;  2DIY A;  1WRY A;  4USS A;  4GF0 A;  2AJQ B;  5AGY A;  3EU3 A;  2B7K A;  2CT6 A;  3F3R A;  3RHC A;  3P7X A;  2WRT A;  3ZL5 A;  22GS A;  3FEU A;  1AUC A;  3FMW A;  4HUA A;  1NM3 A;  3LWA A;  1PMT A;  4HDE A;  4XCS A;  2I1U A;  5AIV A;  1ERW A;  2C4J A;  1SYX A;  2NDO A;  5IO0 A;  2FY6 A;  3F4R A;  5ECH B;  3TCO A;  3IC4 A;  11GS A;  3SWL A;  4KX4 A;  1EOH A;  5G1L A;  1DBY A;  4PUF C;  2GVP A;  3A2X A;  1K3Y A;  2VCT A;  4MZW A;  2H1A A;  4PQ1 A;  1R4W A;  1G6Y A;  5IMD A;  3DXB A;  2YZH A;  3U6V A;  2ON5 A;  1EOG A;  4MMM A;  4OMV A;  4ZL9 A;  2AAW A;  2ES7 A;  1PL2 A;  4MPG A;  2HZF A;  2FWE A;  2LRN A;  5A4W A;  1YY7 A;  5KEJ A;  1TK5 B;  5ECR B;  3GL3 A;  2H73 A;  2VUP A;  5E4W A;  3LYP A;  1G6W A;  1AQW A;  4XRA A;  3ZIJ A;  3F6F A;  3CTF A;  1KNG A;  1I5G A;  1YKA A;  3KXO A;  4JRR A;  5DCH A;  3ME8 A;  1V2A A;  2VD0 A;  1ILO A;  3ME7 A;  4HI7 A;  2QKE A;  4I97 A;  3QAG A;  1Z7P A;  1PN0 A;  5EY6 A;  3IAS 2;  4G10 A;  2JU5 A;  5D9V A;  4A5P A;  4KE3 A;  3IK7 A;  4N30 A;  2IMK A;  2I81 A;  3M1G A;  1K0O A;  4L5O A;  4FO5 A;  4K7N A;  5F06 A;  2YCD A;  1GSD A;  10GS A;  5B8A A;  5D9X A;  3VUR A;  2KHP A;  3GST A;  1PKW A;  2HYX A;  1CQG A;  1O81 A;  4O32 A;  1EP8 A;  1S3C A;  1PGT A;  1XZO A;  2GT6 A;  3QPM A;  2LJR A;  3IV4 A;  4XRD A;  1SK2 A;  2HNL A;  5IOX A;  4OFT A;  4K7I A;  2RII A;  4AJ6 A;  1F9M A;  1VF2 A;  2GST A;  3WGX A;  3EVI A;  4XTS A;  4ML1 A;  4EUY A;  2IN3 A;  2H1G A;  1GRX A;  3LJR A;  3DIE A;  1TRS A;  4HS1 A;  1PL1 A;  2HLS A;  2LNT A;  5HFI A;  2HRF A;  2XC2 A;  3GUR A;  2A2S A;  2PGT A;  4K8M A;  2KP1 A;  1TKD B;  1MDJ A;  3M9K A;  3J7Y b;  2BTO T;  2CVK A;  2YOI A;  5CRW A;  3ZVJ D;  2OE0 A;  4BWQ A;  2J23 A;  4DSR A;  4FYU A;  3GA4 A;  1ZOF A;  1EP7 A;  2C80 A;  1B4P A;  3L0H A;  2A2R A;  1UN2 A;  4G9H A;  2LQQ A;  1T00 A;  2P5R A;  1YF1 A;  4ZB8 A;  4OD7 A;  1A2M A;  1U3I A;  2AUV A;  4TN8 A;  5ECI B;  4AJ7 A;  3I69 A;  4J2F A;  4WR5 A;  5DBQ A;  1AIU A;  5CO3 A;  5F05 A;  3ED3 A;  1FG4 A;  4EDZ A;  4BL7 A;  3TOT A;  1V9W A;  3MDK A;  3IK9 A;  1X9W B;  1VF3 A;  2CVD A;  4Q5F A;  2PN8 A;  4TR0 A;  3VWU A;  1R5P A;  1A24 A;  1THO A;  2OJL A;  3WGE A;  5ECL B;  1O73 A;  3UAR A;  2AB6 A;  2QC7 A;  1WWJ A;  2L6D A;  3TRQ A;  1A0F A;  1B9X C;  4EXJ A;  3NZN A;  2H70 A;  3EPT A;  3RHB A;  3VLN A;  5FHI A;  2LS5 A;  1KEB A;  4ZXG A;  1AAZ A;  5FT3 A;  1ERT A;  1FB0 A;  1XWA A;  4BPY A;  4MH3 A;  3KZQ A;  1AQX A;  3WYW A;  1AXD A;  5GAP D;  1RW1 A;  2UZ8 A;  19GS A;  4IJI A;  5ECO B;  2CX3 A;  1GUM A;  2WS2 A;  3PGT A;  3S9F A;  5DCG A;  1XWK A;  2MBT A;  4NV5 A;  5IPH A;  2O7K A;  1JHB A;  1FVJ A;  3M9J A;  4MK3 A;  4BWS A;  1Q4J A;  1SJZ A;  4K2D A;  4YQM A;  1TK0 B;  2ZCT A;  3TJF A;  2FA4 A;  1BJX A;  4POK A;  3R3E A;  1VF1 A;  3FR3 A;  2YV9 A;  4OWY A;  3M8N A;  2YWM A;  3I43 A;  4ISD A;  4EC0 A;  3ZIV A;  3BOA A;  1K0M A;  3H79 A;  3UVT A;  3EE2 A;  1ABA A;  2R37 A;  4FH8 A;  2H1B A;  1BG5 A;  2IMI A;  2X99 A;  4XIH A;  1ON4 A;  4TW5 A;  1U6T A;  2N5F A;  4RQX A;  2CZ3 A;  2O8V B;  1XXU A;  1GUL A;  2CA8 A;  1JZR A;  2YNX A;  4H86 A;  4WKW A;  1T4Z A;  4PTS A;  3IRA A;  1DSB A;  5LNK e;  2PER A;  3E3E A;  4ICY A;  4F03 A;  2LRT A;  4CY6 A;  4IJ3 A;  1J0F A;  3HY2 A;  3K8N A;  1GSQ A;  16GS A;  1TDI A;  2HFD A;  1BAY A;  3IXR A;  3GH6 A;  4GSN A;  1F2E A;  1E6B A;  3MYD A;  3KEB A;  2C8U A;  2HRA A;  4KA0 A;  5BMU A;  1NSW A;  4HQS A;  5FWG A;  3Q74 A;  4BL7 B;  2PVO C;  3H4K A;  2REM A;  3A5W A;  4N0Z A;  2VLV A;  3HKR A;  3LFL A;  5A4V A;  3CXG A;  4NWY A;  2R0G A;  3KH7 A;  2GZY A;  4DEJ A;  3ZYW A;  2X4A A;  1OVN A;  5HR0 A;  4ZBD A;  2PBJ A;  5CRD A;  1SL2 B;  3FZ4 A;  3KTL A;  2XHF A;  5AN1 A;  4OCE A;  5CRE A;  2BJX A;  4LMV A;  2GQL A;  1U88 A;  1BQ7 A;  1O7U A;  3ZIT A;  3W8J A;  3FY7 A;  4LMW A;  4G0K A;  4OFN A;  4IW9 A;  1IYI A;  1XW5 A;  1WMJ A;  2GSQ A;  4CDO A;  3KMN A;  2QA2 A;  2IMF A;  1WOU A;  1O6J A;  2R3X A;  3ZMK A;  5IIZ A;  2H6X A;  2H6Z A;  1DE2 A;  4Q5Q A;  1TP9 A;  1JZW A;  2YWO A;  4NXI A;  1T4Y A;  4X0X A;  3ZFL A;  1FOV A;  4E8E A;  2OKA A;  2PWJ A;  2X64 A;  1V40 A;  1O8W A;  1MDI A;  1PA3 A;  2L6C A;  2IFQ A;  2HZE A;  1K3O A;  5G5F A;  1PSQ A;  5H5Q A;  1GTB A;  5BRT A;  2FUG 2;  4IN0 A;  1F3A A;  1TI3 A;  4Q5R A;  3LOR A;  5G2Z A;  3ZVJ A;  3IA1 A;  2LST A;  1HNA A;  2A4H A;  3M3M A;  5A4U A;  3IHQ A;  4QL9 A;  3F4S A;  4I6X A;  2HSH A;  1UA5 A;  2PVQ A;  3W6G A;  1U3A A;  3EUR A;  1A8L A;  4GQF A;  2EIO A;  3FRC A;  4L0U A;  1YF0 A;  2CAQ A;  3MWH A;  1OKD A;  4N0V A;  2H0I A;  2X49 A;  5JWR B;  3ZFB A;  3L78 A;  4MH2 A;  5KN2 A;  2BMX A;  4NPB A;  2E2G A;  4MCU A;  5HQP A;  2Z9S A;  1Q98 A;  4ECB A;  3TJB A;  5ABR A;  4IHU A;  3ZZX A;  1SD9 A;  1GSE A;  1TI1 A;  2QSI A;  1EV4 A;  1ZCP A;  2ON7 A;  2B5E A;  3DVX A;  2PPT A;  2MMN A;  2XBQ A;  3CSH A;  1M99 A;  4JBB A;  2AHE A;  1OE7 A;  1RK4 A;  2VD1 A;  1A8Y A;  3LYK A;  4EKZ A;  2JZS A;  1QMV A;  4QL7 A;  1Z7R A;  1ST9 A;  1SL0 B;  1K0B A;  1VF4 A;  2H66 A;  3SBC A;  5EVO A;  3GV1 A;  3L4N A;  3EC3 A;  3GKM A;  4V1A g;  2F3M A;  2NPB A;  3IC8 A;  2NTO A;  1MEK A;  2V2G A;  1GLQ A;  1GTI A;  3HVS A;  2VCW A;  5IPG A;  1EGO A;  1FB6 A;  2C1Y A;  1M9A A;  1GTU A;  3VK9 A;  2OAC A;  5INY A;  4ZB9 A;  5GST A;  3APO A;  2GZP A;  5B7C A;  3U5R E;  3DEX A;  5H5S A;  5J9C A;  3G7Y A;  3TJG A;  4N11 A;  5CRG A;  1FHE A;  5GSS A;  2RLI A;  2I3Y A;  4HZ2 A;  3ZML A;  3ISO A;  4OCF A;  2IFQ B;  4MJA A;  3TKS C;  4GST A;  1XOA A;  3IAM 2;  2HZE B;  2C3Q A;  5DAK B;  2VLT A;  1XW6 A;  4N10 A;  2B1K A;  4MF6 A;  4HEA 2;  5D8I A;  4GLT A;  2GDR A;  1A0R P;  3GL5 A;  2A2P A;  3D21 A;  3HDC A;  2FD3 A;  3UJ1 A;  1OAZ A;  3AY8 A;  2E0Q A;  4HU7 A;  3VPQ A;  3D5J A;  2K9F A;  4KAE A;  1IYH A;  1SD8 A;  3QCP A;  1K3L A;  4ILF A;  5J4U A;  3D4M A;  2L57 A;  3VPT A;  1HQO A;  5KOX A;  4L8E A;  4JR6 A;  3IE3 A;  2QA1 A;  5KN0 A;  2IME A;  1ZL9 A;  4Q5N A;  2KP2 A;  1MTC A;  1BX9 A;  3FK8 A;  3TKS E;  2OBK A;  4O5U A;  2R2J A;  4J56 E;  4ACS A;  4HQZ A;  5GZZ B;  3RAZ A;  1DE1 A;  5ELA A;  6GSX A;  4XS6 A;  4BVX A;  2ZUP A;  2N5A A;  3PPU A;  2OA7 A;  5D96 A;  2AV4 A;  4MJE A;  17GS A;  1R5A A;  5COH A;  4IGJ A;  5L71 A;  4TR3 A;  4FYC A;  2V1M A;  3M0F A;  4WET A;  5ELG A;  2LNS A;  1ZYE A;  1OC3 A;  1M2D A;  2DBC A;  1M7T A;  1ZGN A;  3GX8 A;  4K6X A;  3F6D A;  1J08 A;  2H75 A;  3C73 A;  1JZO A;  2JSY A;  5DJM A;  4HU9 A;  2DJK A;  1GH2 A;  4WBR D;  3GUS A;  2L4Q A;  3HYP A;  4ZL7 A;  3CRT A;  1Z6N A;  1B9Y C;  2JL4 A;  4ZL8 A;  4FIW A;  4XHM A;  1MDK A;  3Q19 A;  2H71 A;  3APS A;  4ZBA A;  1J9B A;  1T3B A;  2DC5 A;  5B6M A;  4HJM A;  2LEG A;  3DVW A;  1X5D A;  1T8E B;  3UAP A;  4CW9 A;  3LXZ A;  4L0W A;  1FAA A;  2M80 A;  1AQV A;  3DD3 A;  2GZZ A;  1B48 A;  1W4V A;  4PGT A;  1HYU A;  3PR8 A;  1LBK A;  4ZB6 A;  1K0N A;  4IBP A;  3CSJ A;  3BCI A;  4EE0 A;  3O6T A;  4MJC A;  2JSZ A;  2H19 A;  3UIW A;  3LG6 A;  2VM1 A;  2V32 A;  3BD2 A;  2CV4 A;  2CX4 A;  3DGQ A;  2DJ3 A;  5A5K A;  1MD4 A;  1XWB A;  5B8B A;  5E59 A;  4LLR A;  4KSO A;  3DKS A;  1QQ2 A;  3TJJ A;  6GSV A;  20GS A;  4AJ8 A;  1ZMA A;  3TKQ A;  3US3 A;  2LRC A;  3L9U A;  4P3Y B;  2NVL A;  3I9V 2;  3FYG A;  2R0P A;  1GP1 A;  2B6M A;  5ENU A;  2N5B A;  5CRH A;  3NOF A;  2DMM A;  4D73 A;  1M2B A;  4E8H A;  1XFL A;  3FHK A;  4GTU A;  1K0A A;  3UL3 A;  1XPV A;  4MAB A;  2IIY A;  2HRK A;  5IM9 A;  5D9W A;  2EC4 A;  1F3B A;  1H75 A;  2C0F A;  2VIM A;  5DAL A;  1KBN A;  1HNC A;  5HR3 A;  3BJ5 A;  1UVZ A;  1VGL A;  2V6K A;  4ZIJ A;  3TKP A;  3GKX A;  2YN1 A;  1X5E A;  2LKU A;  3GIX A;  2FWF A;  3C71 A;  4BVX B;  3NIV A;  2C3N A;  4YAV A;  6GSW A;  4K1F A;  3QAV A;  1U87 A;  4MLY A;  5H5R A;  2GT5 A;  4TXO A;  2YP6 A;  2FCH A;  1EZK A;  3QOU A;  2XBI A;  5GAN D;  5DQS A;  3ERG A;  3TUE A;  1S3A A;  1EWX A;  4MNN A;  4CY8 A;  3A2V A;  3MAK A;  1R26 A;  3PIN A;  4FYB A;  2HSM A;  1E2Y A;  3ERW A;  2DKI A;  1FOH A;  1GSY A;  1LJR A;  2P0G A;  5C00 A;  3QDN A;  2LJA A;  4O5R A;  4HJ2 A;  2FLS A;  2LUS A;  1A2J A;  2K8S A;  1O85 A;  2G0F A;  4DSQ A;  2R0C A;  4I8B A;  1YKC A;  1JZD A;  2IMD A;  3C1S A;  5IO2 A;  1THX A;  3CTG A;  5J9B A;  2A4V A;  4TVE A;  4K2X A;  4F82 A;  2C0E A;  5G5E A;  1G0T A;  3LEF A;  4LL1 B;  1JLW A;  5IOW A;  3LSZ A;  1KTE A;  1XBS A;  2H01 A;  3IBH A;  1YQ1 A;  4ULX A;  2FNO A;  4MJB A;  2C3T A;  18GS A;  3F3Q A;  1TXX A;  1GNW A;  2ALB A;  3GNJ A;  3MIX A;  2L5L A;  1GSU A;  4JED A;  4KH7 A;  1XVW A;  2VL2 C;  4KF9 A;  4XS4 A;  1W89 A;  3O76 A;  1Z9H A;  1BYE A;  4TRX A;  2VL3 A;  1TTZ A;  2K8V A;  5JCU A;  2M72 A;  4XS1 A;  2H0H A;  4RI7 A;  1X5C A;  1EGR A;  1YEP A;  5CAX A;  1WPI A;  3CRU A;  1EEM A;  1A2L A;  3FR9 A;  5F07 A;  6GSY A;  3Q6O A;  4GCI A;  4D73 B;  3TKS A;  3VFI A;  1ERV A;  3GH9 A;  4EL1 A;  5JWQ B;  5G31 A;  3KTB A;  4K0N A;  2WJU A;  4OFM A;  1TW9 A;  3PH9 A;  2F9S A;  3KIJ A;  2KLX A;  4WF4 A;  2JZT A;  5DAL B;  3WD6 A;  1WIK A;  5JWO B;  4YKF A;  4POL A;  2WFC A;  3GTU A;  3WT1 A;  3A2W A;  1GSS A;  4ML6 A;  2IL3 A;  4PX1 A;  1QXH A;  4WBJ A;  1QFN A;  4IQA A;  2DJJ A;  2P5Q A;  1V58 A;  2R5G A;  5ECM B;  3FKF A;  2DJ0 A;  4OO4 A;  2HXK A;  2WB9 A;  4JZQ A;  2MBS A;  4GXZ A;  1AW9 A;  1V57 A;  2ZNM A;  1SU9 A;  7GSS A;  4AGS A;  3VWX A;  2FHE A;  3LXT A;  1A23 A;  3TGZ A;  3HVV A;  3IDV A;  3F63 A;  5IQY A;  5JCG A;  14GS A;  1H4O A;  4K5R A;  1WP0 A;  1YJ6 A;  2VCV A;  2OAD A;  2EIR A;  3KH9 A;  2X8H A;  4V2L A;  5HFG A;  1YZX A;  5DJL A;  4FQU A;  2HSY A;  3VI5 A;  3CSI A;  3ERF A;  2XPE A;  4POM A;  1SK1 A;  4RUV A;  2VL9 A;  5AIS A;  4NMU A;  2B1L A;  2TRX A;  2YPM A;  3FR6 A;  3EWL A;  1K0D A;  2B5X A;  3EMP A;  2VLU A;  2OBI A;  1XW9 A;  3GFK A;  8GSS A;  1TU7 A;  6GSS A;  2OE1 A;  3KGK A;  1OE8 A;  1XWG A;  4EIQ A;  2H74 A;  1Y6E A;  2AYT A;  2O85 A;  5LCZ A;  3QFA C;  2O87 A;  5IMA A;  2IJY A;  13GS A;  2DJ2 A;  4EO3 A;  2GQK A;  3P90 A;  4YAP A;  2HT9 A;  4KUN A;  2EIQ A;  4MF5 A;  4IP1 A;  4TXV A;  4TR1 A;  4HZ4 A;  4I5Q A;  1Z5Y E;  1SKW B;  3TJK A;  1GUH A;  2MZC A;  4PXO A;  2FGX A;  1ZYQ B;  1SEN A;  4RQR A;  4X1U A;  3HVX A;  4KCA A;  2JAC A;  2GLR A;  3D0Z A;  1ZZY A;  9GSS A;  4IKH A;  2V41 A;  3HZ8 A;  3OR5 A;  2IWT A;  4IS0 A;  4QQ7 A;  4PUA A;  3TRP A;  3GTU B;  4WEY A;  5DQY A;  2WZ9 A;  4I2T A;  2VCZ A;  1XOB A;  1C72 A;  3L9S A;  1OKT A;  1F37 A;  1TU8 A;  1XCC A;  1YDK A;  1ACV A;  3P2A A;  2LQO A;  6GST A;  2KUC A;  3TB2 A;  3APQ A;  4PUR A;  4OO5 A;  4ECI A;  4G0I A;  4MZC A;  2R6K A;  1NHO A;  1SJ6 A;  3F0I A;  1XWC A;  4MZB A;  2J9H A;  2H8L A;  3EU4 A;  4G2E A;  5B6N A;  1SKS B;  2B5Y A;  2H0G A;  3QD9 A;  2GQM A;  1GL8 A;  2FA8 A;  2KOK A;  1Z3E A;  3HHV A;  1S3D A;  2H6Y A;  1B4Q A;  1OC9 A;  4O7H A;  2DKH A;  1GWC A;  3RBT A;  4Z2R A;  2RUE A;  4K0G A;  3CMI A;  2JAD A;  1X9S B;  2X8G A;  4IP6 A;  4YQV A;  12GS A;  2FWH A;  4KDU A;  3VI7 A;  3GKK A;  3C7M A;  1PQN A;  1QK8 A;  4V1A p;  2VAF A;  1JFU A;  3TOU A;  5AIX A;  3BBY A;  3HD5 A;  3GHA A;  1EV9 A;  2GGT A;  3MNG A;  4F0C A;  1GNE A;  1ZYN A;  1SYR A;  6GSU A;  4JU5 A;  2DSA A;  4IEL A;  2GSS A;  1K0C A;  5D73 A;  4ZIL A;  4V2M A;  3WT2 A;  1ZYP A;  3FZ5 A;  3BCK A;  2L59 A;  2YZU A;  3A3T A;  2IPA A;  3KD0 A;  5ECS A;  4POB A;  1G7E A;  3IOS A;  3TKR A;  5HR1 A;  5JCW A;  1URM A;  2DLX A;  1PKZ A;  3MSZ A;  4WF5 A;  4EF0 A;  1M2A A;  2DIZ A;  3F9U A;  3H1N A;  4HOJ A;  3QR6 A;  5J41 A;  4GWR A;  5HR2 A;  1Y25 A;  2GS3 A;  5DDL A;  4AF2 A;  5CNW A;  2H72 A;  4TR1 B;  1N8J A;  2C0G A;  3WGD A;  2VL2 A;  3ZRD A;  4F9Z A;  3KP9 A;  3F4T A;  5ID2 A;  2R4V A;  2MMZ A;  2CAI A;  1TOF A;  5IMZ A;  3GX0 A;  1USB A;  4PNG A;  5J3R A;  5CP1 A;  5D9T A;  3HJP A;  4RI6 A;  3E9J B;  4GRF A;  3C8E A;  5C04 A;  3HXS A;  2B3S A;  4KDY A;  2DML A;  1JLV A;  2HE3 A;  5KOW A;  3UEM A;  3O3T A;  4O92 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...