1X5DA

The solution structure of the second thioredoxin-like domain of human protein disulfide-isomerase a6
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
133
structure length
133
Chain Sequence
GSSGSSGDVIELTDDSFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAASEVKEQTKGKVKLAAVDATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIVSRALDLFSDNAPPPELLESGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Protein disulfide-isomerase A6
publication title The solution structure of the second thioredoxin-like domain of human Protein disulfide-isomerase A6
rcsb
source organism Homo sapiens
total genus 26
structure length 133
sequence length 133
ec nomenclature ec 5.3.4.1: Protein disulfide-isomerase.
pdb deposition date 2005-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1x5dA01
2L6CA 2P5QA 4K9ZA 2V1MA 2TIRA 4F82A 1B9XC 4G9HA 1X0RA 2PMTA 3GV1A 1YY7A 1AXDA 5B8AA 3VI5A 7GSSA 5ECQB 3TKPA 5INYA 1GTAA 1Z7RA 2OE1A 4AJ6A 2HI7A 3C1SA 2H72A 4N11A 1K0AA 4K0NA 3ZMLA 1PKWA 2YANA 3KP8A 4MJCA 2YJHA 1TP9A 1K0CA 3IC4A 2H19A 4IHUA 3IBHA 4OCFA 4MLYA 4IP6A 3WGDA 3FKFA 5B6MA 14GSA 4IQ1A 4TOPA 2P0GA 3QAVA 1OVNA 1TU8A 1GLPA 2GZZA 1ERUA 1TDIA 3J7Yk 4MH3A 4FYCA 2H70A 3ZVJA 2IMKA 2PVOC 5D96A 3UIWA 3FYGA 5H5SA 4POLA 2VO4A 4V1Ag 1GP1A 2NDOA 4LL4B 3UARA 1ZZYA 4LLRA 1EOGA 4KCEA 2FY6A 4XTSA 1O73A 1V9WA 4YQVA 4IN0A 2MYGA 4NAXA 2O7KA 3UBLA 1JZWA 2H1DA 5GZZB 1HNAA 2LS5A 1N2AA 2FNOA 4QL7A 3M3MA 3ZMKA 3ZTLA 2OJLA 2YWOA 2ON7A 6GSTA 10GSA 1K3OA 1JZDA 1TXXA 2MMZA 3F3RA 3KD0A 2HE3A 2FWHA 5LNKe 3WGXA 5COHA 1X9SB 1NW2A 2C8UA 3QOUA 1K0BA 1JFUA 3DVXA 2PU9C 1BG5A 1WPIA 4TRXA 2P5RA 3H93A 4LA1A 1G6YA 1AQXA 4K7OA 2FUG2 5D9VA 5CNWA 2GTUA 3HVSA 5L71A 2B7KA 1LU4A 2WZ9A 5E4WA 3C73A 1PL2A 1DUGA 4JEDA 4Q5RA 2HNLA 4N30A 4HOJA 2C3QA 1WP0A 2BTOT 2VM2A 1GNWA 4L8EA 4XS6A 1SK1A 2GQLA 3TKSE 2CVDA 3P2AA 5HR0A 1AAZA 4GF0A 3VWXA 3QAWA 2L4CA 3RBTA 3MWHA 4PUAA 2WDUA 2OA7A 2FD3A 3TB2A 1T3BA 5B7CA 2GT5A 5LCZA 2GSSA 2AB6A 1SJIA 1YDKA 4I5QA 1FG4A 2LV3A 1O7UA 3F4RA 3ED3A 1XOAA 3ZIVA 4F2IA 2DC5A 4KDYA 5ECOB 5G1LA 5HR3A 2JACA 1GSSA 2RUFA 1TKDB 2BJXA 5DCHA 2R5GA 1VF3A 4WKWA 2QC7A 1ACVA 3VWWA 1BAYA 4JRRA 2WULA 1K0DA 4BA7A 2DMLA 1R4WA 2GSRA 3PGTA 2YJ7A 1Z7PA 3TKSA 1YQ1A 1A8YA 3E9JB 2C3TA 2PN8A 5J4UA 2EIQA 1VF2A 4ECIA 1Y6EA 4RI6A 1O85A 1K3LA 3V1WA 5IOWA 4CDOA 1TK0B 1WOUA 2J9HA 5CRWA 4MJEA 2DJ1A 3L9VA 5B6NA 2DIZA 5CP1A 1SL2B 5AIVA 1V2AA 1XW9A 4PQHA 6GSYA 1GRXA 4ZB6A 1F37A 3N9JA 5EVOA 2F8FA 1QMVA 4HJ2A 5IPGA 3I69A 2OADA 2FGXA 3PH9A 4DSSA 2LRNA 1QXHA 1Q98A 2HZEA 3JCML 4IBPA 3HZ8A 5F07A 4QQ7A 2M46A 2K8SA 1GSYA 2E7PA 1G7OA 1M9AA 5A5KA 3KTBA 1HNBA 3NZNA 1SKSB 4YAVA 1EEMA 3I9V2 1XCCA 2YN1A 4HS1A 3D5JA 1B4QA 3MNGA 1FB0A 3G7JA 1GNEA 3GKMA 5LD0A 2VLTA 1TK5B 1UC7A 1XXUA 3UL3A 2CZ2A 3OR5A 5B8BA 1G0TA 1MEKA 4POKA 3ZYWA 3GL3A 1AW9A 4Q5NA 1PA3A 3WD6A 4LMVA 4D73A 3TJKA 4HUAA 3CMIA 2IN3A 2JADA 3QDNA 4PQ1A 2LQOA 4GQCA 5HFIA 4BVXA 2LTKA 2IIYA 5DAKB 4KW6A 4F9ZA 3EC3A 1T00A 2CX4A 2GSQA 1V58A 1XIYA 4GCIA 2YWMA 4MF7A 3UVHA 2DJJA 2N5AA 2CT6A 4N10A 5C00A 2X99A 4KB3A 3E0UA 4P3YB 3E3EA 4V1Ap 4RQXA 3QD9A 2DJ0A 4HJMA 4ZB9A 4ECCA 1S3AA 1RK4A 2GVPA 4IP1A 2GT6A 4OO5A 5EL8A 1QK8A 1WIKA 3EMXA 2AUVA 3K8NA 1THXA 1EZKA 4NWYA 3VK9A 1VRSD 2C1YA 2ZCTA 3VI7A 1XWKA 3KMOA 1SKRB 3DGQA 4MMMA 2L57A 3TGZA 5IQYA 3DEXA 5F8BA 1VF1A 3LFLA 4XCSA 5HFKA 4ZBDA 3J7Yb 1KTEA 2H0IA 5DVBA 2QSIA 4ECBA 3KP9A 2IFQA 1K3YA 3HY2A 3KGKA 3ZFBA 2WGRA 4NMUA 1T4ZA 4TVEA 1QGVA 2B6MA 5A4UA 1BYEA 1RQMA 4L5OA 1WJKA 1OAZA 3IE3A 2WB9A 3HHVA 2XPEA 4X1UA 4LMWA 3UMAA 3IAS2 1NSWA 16GSA 4FIWA 2IPAA 1KBNA 4KA0A 4YH2A 4IKHA 3D22A 4YQMA 1WE0A 2B5XA 2J23A 2PERA 1XWBA 4FYBA 2E0QA 2H6ZA 4GTUA 2HT9A 3QMXA 11GSA 2YWNA 1DE1A 2XBIA 2FA4A 4OFNA 4O92A 3TRXA 2CQ9A 3FZ5A 3GTUB 2H6XA 2B7JA 2M80A 1GUHA 2VCQA 3A3TA 4CHSA 4GQFA 1F6MC 1K0MA 4GSTA 3ZL5A 2ES7A 3KXOA 2IJYA 5JCWA 3F4TA 1U3IA 4I97A 2L59A 3W8JA 2NVLA 1YKAA 2RM6A 2VCWA 1JZOA 5AN1A 3GURA 1B9YC 2VL2A 5ECIB 4KH7A 2L6DA 3APQA 1ZCPA 2C3NA 3DYRA 2K9FA 2YOIA 1O81A 3IA1A 4OCEA 3TKRA 2YV9A 2IMDA 4TXVA 4O32A 2VL3A 2NBSA 4TN8A 2JL4A 5ID2A 2XC2A 3CRUA 5ECKB 5G2ZA 2H30A 2L5LA 2NPBA 4EF0A 2YPMA 3VFIA 2FLSA 1TOFA 5A4VA 1WWJA 1X9MB 4RQRA 1XVWA 1Z5YE 4OD7A 6GSXA 4IQAA 2H1AA 4MABA 3UJ1A 3CBUA 1AC1A 5ECRB 3GMFA 3HKRA 2FWEA 4J56E 3EMPA 4TXOA 2GQMA 1F3BA 1F3AA 3F9UA 5C04A 2H74A 5A4WA 4J2FA 5CREA 4MPGA 3AY8A 3U6VA 3WT1A 1X5DA 4OMVA 3EURA 2B1LA 4ISDA 1QUWA 2DIYA 2TRXA 2LUSA 4OWYA 1LBKA 3TKSC 4YAPA 3HVXA 1R7HA 4K0GA 4FO5A 2R2JA 1U6TA 4K6XA 4BWSA 1OE8A 4MJAA 3Q6OA 4MK3A 4KNDA 1MD3A 3APSA 1XPVA 1K0OA 1Q4JA 3MAKA 3HA9A 1FW1A 2B5YA 1YF1A 1M9BA 1GLQA 3TCOA 5GAPD 3CTFA 2VCZA 4HZ4A 2C4JA 3TOUA 3ERFA 4ZXGA 1A0RP 4V2NA 3M0FA 3UAPA 3WGEA 4H86A 4F03A 4WR5A 3MDKA 3F6DA 2R3XA 4O5RA 2QKEA 4WBJA 2B5EA 1JZRA 3GA4A 1BJXA 1PKZA 1YJ6A 1BQ7A 2GSTA 4MF5A 3W6GA 1SJZA 2EIOA 1MDJA 2IMIA 3M8NA 17GSA 5FT3A 1XFLA 3D4TA 4I2UA 4GLTA 2VD1A 3DIEA 4NV2A 2R37A 2GQKA 3LG6A 2JSYA 1ERVA 1X5EA 1THOA 4JZQA 2VIMA 2V6OA 1OKTA 2H6YA 1EWXA 2C80A 3BBYA 3LYPA 2LNTA 1F2EA 1B8XA 1J9BA 3KMNA 1PGTA 4G19A 5D73A 2HSHA 3FW2A 1NM3A 1T4YA 1TK8B 1YF0A 4BL7A 1SK0A 2AV4A 3FY7A 4EKZA 3F4SA 3D0ZA 2HSYA 5GAND 5IM9A 1PL1A 5DALB 2AAWA 1XWGA 3BJ5A 4ID0A 3GNJA 3ZIJA 1PQNA 2F8AA 1B4PA 4IW9A 1ILOA 20GSA 5CYYA 4JR4A 3H4KA 3GIXA 3RPNA 4WXTA 2MBSA 4AJ7A 2HZFA 1SYXA 1PRXA 3EYTA 4OFMA 1LJRA 1HD2A 3QR6A 4EE0A 3EU3A 2XHFA 3D21A 5D8IA 3CSHA 5ELGA 4F0BA 4V2MA 4EUYA 2AJQB 3F8UA 3IK9A 2H75A 1Z9HA 5DCGA 1V98A 2MMAA 3DD3A 5E59A 1CQHA 4WF5A 3QFAC 3TJBA 4MJBA 1FHEA 2DJ2A 3VPTA 4K1FA 1TI1A 1ZMAA 2KOKA 4PXOA 2PUKC 3R2QA 3ZVJD 2X8CA 5G5FA 2K6VA 8GSSA 1GUKA 2YNXA 4WETA 1OC3A 4HQSA 1MDKA 2H66A 3LGCA 3HCZA 3M1GA 4DSSB 5ECMB 1MD4A 2CVKA 2XBQA 4RI7A 2LEGA 4EC0A 3ISOA 5G30A 2RIIA 4I8BA 3L9SA 3LORA 1Z6NA 2A2RA 2OBIA 2H73A 1TW9A 2WS2A 2GLRA 1F9MA 4OO4A 4EXJA 3C7MA 1SYRA 1T8EB 2VCVA 4AGSA 4MF6A 2JZSA 4PUFC 4TR1B 2TRCP 2VOCA 3UOMA 3UVTA 4N0VA 3GKKA 2H01A 2D2ZA 2G0FA 1SD9A 3NOFA 3FRCA 2LRCA 2CAIA 2DSAA 2CVBA 3KJYA 5G5EA 3HDCA 4GSNA 1QFNA 5JWRB 3CRTA 5HQPA 3O76A 3QPMA 4HQZA 18GSA 2VL2C 4MPFA 2HLSA 1EEJA 1O6JA 3O6TA 6GSUA 5H5QA 3KH7A 3APOA 3CYNA 3LYKA 3FK8A 2Z9SA 5HFGA 2QGVA 3GKXA 5F05A 5DAKA 3G7YA 3UBKA 3ZLPA 1AQWA 5D93A 3LEFA 4FH8A 1FAAA 1ZGNA 1NHOA 3IOSA 5H5RA 2H0GA 3P7XA 4AF2A 3F6FA 1SU9A 1ST9A 1SENA 1Z6MA 1XW5A 1R5PA 3GX0A 3KEBA 5J5NA 4MDCA 1EP8A 2F9SA 1MDIA 3W8SA 3Q19A 1EOHA 3QAGA 3GKNA 3CXGA 4GWRA 1O8XA 3KCMA 3GH9A 1OC9A 5ECLB 4TR4A 5D9XA 2V41A 4EO3A 3EWLA 2I1UA 3GFKA 1PD21 4BVYA 4Q5FA 4BWQA 4L5LA 3D4MA 3FR6A 3ZZXA 1SD8A 1XVQA 5J9CA 1JLWA 1TRSA 5IMCA 1GWCA 3GUSA 3HJMA 2RUEA 3L9UA 1YKCA 4K7NA 4XS4A 4XIHA 3KZQA 2PWJA 2N5FA 2GZYA 4K2DA 1TRWA 3GRXA 1PX6A 4ACSA 4V2LA 1OYJA 4HI7A 1XOBA 2WRTA 5ECHB 4ZB8A 4TW5A 1W89A 2I81A 3TJJA 1BEDA 4FYUA 4ULXA 4DSRA 1PX7A 4KCAA 2AYTA 1M7TA 4ZL8A 5IMAA 1XW6A 2LJAA 3DMLA 1PN9A 3M9KA 2V2GA 3IV4A 5ABRA 1VGLA 2V32A 3GTUA 2KP2A 3EVIA 2CX3A 3FZAA 3HJOA 2LQQA 5ECNB 4KDUA 4QL9A 1GSQA 1JLVA 1C72A 4HU7A 1GSEA 1ZYQB 3IRAA 3HZ4A 5IMVA 2C0DA 3IPZA 5KN3A 2A4VA 4IGJA 2FCHA 1KEBA 3C1RA 3ERWA 5ID2B 3TKQA 1ERTA 5JCUA 5EPFA 4XS1A 5IMDA 1DE2A 1GL8A 1HYUA 5KN2A 2JZRA 1PSQA 1KNGA 4POBA 1MTCA 5JWOB 2YV7A 3I43A 2I9HA 1XWAA 2K8VA 4TXOB 5IPHA 3F3QA 6GSVA 3I6AA 3EINA 5HR2A 1SK2A 3G9BA 3RHBA 4GXZA 4N0ZA 4GRFA 3DWVA 3VWVA 4EVMA 3H1NA 1GULA 3GSSA 2B3SA 2DBCA 4XRAA 4BPYA 3A2VA 3ERGA 4HU9A 4NXIA 5J3RA 1A23A 3GHAA 1GTUA 2F51A 5CO3A 2H0HA 2N5BA 3VURA 3U5RE 3N5OA 2PBJA 4LL1B 1OE7A 1USBA 5G31A 3D6IA 5AISA 3DRNA 1E6BA 2YCDA 4POMA 2EIRA 3BD2A 3IHQA 2OE3A 4RUVA 3WYWA 3M9JA 4MH2A 4JE1A 1Y25A 3RPPA 2ON5A 2VD0A 3KTLA 4G2EA 2MZCA 4ML1A 4NPBA 4I2TA 5KN0A 1A0FA 3TJFA 4ZBAA 3IAM2 4HEA2 3Q18A 3L0HA 1GH2A 3BCKA 1JHBA 2K18A 5CRGA 4L0WA 3TDGA 4WR4A 2VCXA 1YZXA 3TRPA 2R4VA 3F0IA 3ME8A 2O87A 2FA8A 2VCTA 4MZCA 4ZIJA 4KAEA 2DJKA 2MMOA 4MA9A 1A24A 5HR1A 1XBSA 1O8WA 4XRDA 1SJ6A 5ENUA 5DDLA 5KN1A 1YEPA 2YWIA 4EDYA 3GL5A 1SL1B 3IK7A 4AJ8A 4F0CA 1S3CA 3A2XA 2KLXA 2O89A 3LQ7A 3MSZA 2C0EA 1EV4A 4ILFA 2LJRA 4KX4A 1FVJA 2PGTA 1TJDA 4WEYA 4IJIA 1A2LA 2OE0A 1U87A 2X8GA 1M0UA 3HJPA 1Z3EA 2EC4A 1QQ2A 1HQOA 1V40A 5G1KA 5D9TA 1H75A 1H4OA 2V6KA 1NHYA 3UEMA 1TRVA 3VWUA 2GDRA 2C0FA 2GZPA 5CRDA 3QCPA 1EV9A 3H79A 3VPQA 2I3YA 3A2WA 3ZITA 4KDXA 3IXRA 2DJ3A 3S9FA 1PMTA 3PR8A 13GSA 4NV5A 3LJRA 2I4AA 4I6XA 4KUNA 2HRFA 1FB6A 1FOVA 1N8JA 2HFDA 1ABAA 2FWFA 5DALA 4KSMA 1X5CA 4IELA 2WCIA 2DLXA 3LWAA 4IS0A 4EL1A 4DSQA 22GSA 2LJKA 2L4QA 1I9DA 2WJUA 3L4NA 1M99A 2A2SA 3GX8A 2MBTA 2P31A 4E8HA 1EGOA 2FWGA 3RHCA 2GS3A 4ZL7A 2FHEA 1R26A 1ZOFA 2MMNA 2RM5A 1UA5A 3DKSA 3TOTA 2KHPA 1FO5A 5J9BA 2LNSA 2X64A 3TJGA 2NTOA 2VUPA 5DJLA 3FR3A 4OFTA 3TUEA 3SBCA 2IMEA 4Z7XA 1VF4A 4Q5QA 3QFBC 1EGRA 3KH9A 3VLNA 3ME7A 2R6KA 5CRHA 6GSSA 5DJMA 2IL3A 3BOAA 3KM6A 3ZREA 1M2AA 1YEXA 3FEUA 5IIZA 5F06A 2E2GA 3CSIA 1DBYA 3FHKA 1TRUA 1UVZA 3HYPA 4MCUA 2HZEB 3O3TA 3LXTA 4KGIA 5J41A 2IMFA 4TKYA 4WF4A 4L0UA 4IVFA 6GSWA 5FWGA 1CQGA 1X9WB 4K8MA 4PURA 2F3MA 1URMA 2YZHA 2VM1A 1HNCA 4JR6A 5IO2A 4ML6A 1GTIA 4TR3A 2PPTA 3NIVA 4ZBBA 4JU5A 4TR1A 3CTGA 1XZOA 4ECJA 4D73B 5EY6A 1B48A 4E8EA 3HVVA 2H76A 2VL9A 2YZUA 2GGTA 2VAFA 4WBRD 4MP4A 3BCIA 5DQSA 1E2YA 2HXKA 4PGTA 1ZYEA 3G7IA 2HRNA 2C0GA 2BMXA 4CW9A 1ML6A 4KE3A 2ALBA 1S3DA 2B1KA 3EU4A 12GSA 1WMJA 2REMA 1A2JA 3RDWA 2H8LA 1ZL9A 5DQYA 4EDZA 3F63A 3DXBA 1W4VA 1SKWB 1T1VA 1TTZA 3Q74A 3P90A 4ZL9A 4PX1A 3TRQA 4YQUA 2JU5A 5IMFA 1V57A 4DEJA 3SWLA 4NHZA 2OKAA 5FHIA 1I5GA 1TI3A 2YP6A 2CZ3A 2RLIA 2ZUPA 3CSJA 4NHWA 4X43A 2KP1A 2WFCA 1DSBA 4JBBA 1J0FA 3US3A 1OC9B 4X0XA 1SL0B 2H1BA 2PVQA 3GYKA 5D9WA 1WRYA 1EP7A 2IFQB 3GN3A 2O8VB 4O7HA 4K7IA 3KIJA 2CAQA 4PNFA 1BX9A 2LSTA 2HYXA 4MZWA 4XHMA 1A2MA 1FVKA 1OKDA 1GSUA 5IO0A 3DVWA 2KUCA 2M72A 1G6WA 3LXZA 2XPDA 1AUCA 2JZTA 4DVCA 4XS4B 4PNGA 5ECPB 1AQVA 1AIUA 2E2MA 3LSZA 1A8LA 5IMZA 1TU7A 3H8QA 9GSSA 2JSZA 1U3AA 2VLVA 2OACA 2O85A 3HXSA 2H1GA 4HDEA 2CV4A 2G2QA 1G7EA 5AGYA 3L78A 2DMMA 1M2DA 3IR4A 2L5OA 4J57E 4ZILA 4KSOA 5GSTA 2X8HA 1XWCA 3PINA 5DBQA 4GSSA 1GSDA 3WT2A 3P8WA 5CAXA 1M2BA 3ZRDA 5F0GA 2IWTA 1ON4A 1RW1A 4PQIA 2LRTA 19GSA 3EE2A 1GUMA 5ELAA 5AIXA 4G10A 4TR0A 2H71A 1K0NA 5KEJA 2OBKA 3IDVA 5JWQB 1IYHA 5JCGA 1T7PB 2VLUA 3FZ4A 3A5WA 1GSFA 1IYIA 2LKUA 1U88A 1J08A 3C71A 3RAZA 1GTBA 2AHEA 2CA8A 3C8EA 1OC8A 5GSSA 3ZFLA 1R5AA 3GSTA 4IJ3A 3HD5A 5IOXA 3GH6A 4MZBA 3FZ9A 3FR9A 1UN2A 5ECSA 2ZNMA 4HZ2A 1ERWA
chains in the Genus database with same CATH superfamily
2L6CA 2P5QA 4K9ZA 2V1MA 2TIRA 2DKIA 4F82A 1B9XC 4G9HA 1X0RA 2PMTA 3GV1A 1YY7A 1AXDA 5B8AA 3VI5A 3A5IA 7GSSA 5ECQB 3TKPA 5INYA 1GTAA 1Z7RA 2OE1A 4AJ6A 2HI7A 3C1SA 2H72A 4N11A 1K0AA 4K0NA 3ZMLA 1PKWA 2YANA 3KP8A 4MJCA 2YJHA 1TP9A 1K0CA 4USSA 3IC4A 2H19A 4IHUA 3IBHA 4OCFA 4MLYA 4IP6A 3WGDA 3FKFA 5B6MA 14GSA 4IQ1A 4TOPA 2P0GA 3QAVA 1OVNA 1TU8A 1GLPA 2GZZA 1ERUA 1TDIA 3J7Yk 4MH3A 4FYCA 2H70A 3ZVJA 2IMKA 2PVOC 5D96A 3UIWA 3FYGA 5H5SA 4POLA 2VO4A 4V1Ag 1GP1A 2NDOA 4LL4B 3UARA 1ZZYA 4LLRA 1EOGA 4KCEA 2FY6A 4XTSA 1O73A 1V9WA 4YQVA 4IN0A 4BIKA 2MYGA 4NAXA 2O7KA 3UBLA 1JZWA 2H1DA 5GZZB 1HNAA 2LS5A 1N2AA 2FNOA 4QL7A 3M3MA 3ZMKA 3ZTLA 2OJLA 2YWOA 2ON7A 6GSTA 10GSA 1K3OA 1JZDA 1TXXA 2MMZA 3F3RA 3KD0A 2HE3A 2FWHA 5LNKe 3WGXA 5COHA 1X9SB 1NW2A 2C8UA 3QOUA 1K0BA 1JFUA 3DVXA 2PU9C 1BG5A 1WPIA 4TRXA 2P5RA 3H93A 4LA1A 1G6YA 1PFOA 1AQXA 4K7OA 2FUG2 5D9VA 4Z2RA 5CNWA 2GTUA 3HVSA 5L71A 2B7KA 1LU4A 2WZ9A 5E4WA 3C73A 1PL2A 1DUGA 4JEDA 4Q5RA 2HNLA 4N30A 4HOJA 2C3QA 1WP0A 2BTOT 2VM2A 1GNWA 4L8EA 4XS6A 1SK1A 2GQLA 3TKSE 2CVDA 3P2AA 5HR0A 1AAZA 4GF0A 3VWXA 3QAWA 2L4CA 3RBTA 3MWHA 4PUAA 2WDUA 2OA7A 4BL7B 2FD3A 3TB2A 1T3BA 5B7CA 1ZYPA 2GT5A 3MYDA 5LCZA 2GSSA 2AB6A 1SJIA 1YDKA 4I5QA 1FG4A 2LV3A 1O7UA 3F4RA 3ED3A 1XOAA 4KF9A 3ZIVA 4F2IA 4Z2UA 2DC5A 4KDYA 5ECOB 5G1LA 5HR3A 2JACA 1GSSA 2RUFA 1TKDB 2BJXA 5DCHA 3PPUA 2R5GA 1VF3A 4WKWA 2QC7A 1ACVA 3VWWA 1BAYA 4JRRA 5KOXA 2WULA 1K0DA 4BA7A 2DMLA 1R4WA 2GSRA 3PGTA 2YJ7A 1Z7PA 3TKSA 1YQ1A 1A8YA 2R0PA 3E9JB 2C3TA 2PN8A 5J4UA 2EIQA 1VF2A 4ECIA 1Y6EA 4RI6A 1O85A 1K3LA 3V1WA 5IOWA 3HVNA 4CDOA 1TK0B 1WOUA 2J9HA 5CRWA 4MJEA 2DJ1A 3L9VA 5B6NA 2DIZA 5CP1A 1SL2B 5AIVA 1V2AA 1XW9A 4PQHA 6GSYA 1GRXA 4ZB6A 1F37A 3N9JA 5EVOA 4K2XA 2F8FA 1QMVA 4HJ2A 5IPGA 3I69A 2OADA 2FGXA 3PH9A 4DSSA 2LRNA 1QXHA 1Q98A 2HZEA 3JCML 4IBPA 3HZ8A 5F07A 4QQ7A 2M46A 2K8SA 1GSYA 2E7PA 1G7OA 1M9AA 5A5KA 3KTBA 1HNBA 3NZNA 1SKSB 4YAVA 1EEMA 3I9V2 1XCCA 2YN1A 4HS1A 3D5JA 1B4QA 3MNGA 1FB0A 3G7JA 1GNEA 3GKMA 5LD0A 2VLTA 1TK5B 1UC7A 1XXUA 3UL3A 2CZ2A 3OR5A 5B8BA 1G0TA 1MEKA 4POKA 3ZYWA 3GL3A 1M3IA 1AW9A 4Q5NA 1PA3A 3WD6A 4LMVA 4D73A 3TJKA 4HUAA 3CMIA 2IN3A 2JADA 3QDNA 4PQ1A 2LQOA 4GQCA 5HFIA 4BVXA 2LTKA 2IIYA 5DAKB 4KW6A 4F9ZA 3EC3A 1T00A 2CX4A 2GSQA 1V58A 1XIYA 4GCIA 2YWMA 4MF7A 3UVHA 2DJJA 2N5AA 2CT6A 4N10A 5C00A 2X99A 4KB3A 3E0UA 2HSMA 4P3YB 3IHGA 3E3EA 4V1Ap 3R3EA 4RQXA 3QD9A 2DJ0A 4HJMA 4ZB9A 4ECCA 1S3AA 1RK4A 2GVPA 4IP1A 2GT6A 4OO5A 5EL8A 1QK8A 2HRKA 1WIKA 3EMXA 2AUVA 3K8NA 1ZYNA 1THXA 1EZKA 4NWYA 3VK9A 1VRSD 2C1YA 2ZCTA 3VI7A 1XWKA 3KMOA 5BRTA 1SKRB 3DGQA 4MMMA 2L57A 3TGZA 5IQYA 4BVYB 3DEXA 5F8BA 1VF1A 5BMUA 3LFLA 4XCSA 5HFKA 4K5SA 4ZBDA 3J7Yb 1KTEA 2H0IA 5DVBA 2QSIA 4ECBA 3KP9A 2IFQA 1K3YA 3HY2A 3KGKA 3ZFBA 2WGRA 4NMUA 1T4ZA 4TVEA 1QGVA 2B6MA 5A4UA 1BYEA 1RQMA 4L5OA 1WJKA 1OAZA 3IE3A 2WB9A 3HHVA 2XPEA 4G0KA 4LMWA 4X1UA 3UMAA 3IAS2 1NSWA 16GSA 4FIWA 2IPAA 1KBNA 4KA0A 4YH2A 4IKHA 3D22A 4YQMA 1WE0A 2B5XA 2J23A 2PERA 1XWBA 4FYBA 2E0QA 2H6ZA 4GTUA 2HT9A 3QMXA 11GSA 2YWNA 1DE1A 2XBIA 2FA4A 4OFNA 4O92A 3TRXA 2CQ9A 3FZ5A 3GTUB 2R0CA 2H6XA 2B7JA 2M80A 1GUHA 2VCQA 3A3TA 4CHSA 4GQFA 1F6MC 1K0MA 4GSTA 3ZL5A 2ES7A 3KXOA 2IJYA 5JCWA 3F4TA 1U3IA 4I97A 2L59A 3W8JA 2NVLA 1YKAA 2RM6A 2VCWA 1JZOA 5AN1A 3GURA 1B9YC 2VL2A 5ECIB 4CY8A 4KH7A 2L6DA 3APQA 1ZCPA 2C3NA 3DYRA 2K9FA 2YOIA 1O81A 3IA1A 4OCEA 3TKRA 2YV9A 2IMDA 4TXVA 4O32A 2VL3A 2NBSA 4TN8A 2JL4A 5ID2A 2XC2A 3CRUA 5ECKB 5G2ZA 2H30A 2L5LA 2NPBA 4EF0A 2YPMA 3VFIA 2FLSA 1TOFA 5A4VA 4O5QA 1WWJA 1X9MB 4RQRA 1XVWA 2X49A 1Z5YE 4OD7A 6GSXA 4IQAA 2H1AA 4MABA 3UJ1A 3CBUA 1AC1A 5ECRB 3GMFA 3HKRA 2FWEA 4J56E 3EMPA 4TXOA 4G0IA 2GQMA 1F3BA 1F3AA 3F9UA 5C04A 2H74A 5A4WA 4J2FA 5CREA 4K5RA 4MPGA 4YKGA 3AY8A 3U6VA 3WT1A 2A4HA 1X5DA 4OMVA 3EURA 2B1LA 4ISDA 1QUWA 2QA1A 2DIYA 2TRXA 2LUSA 4OWYA 1LBKA 3TKSC 4YAPA 3HVXA 1R7HA 4K0GA 4FO5A 2R2JA 1U6TA 4K6XA 4BWSA 1OE8A 4MJAA 3Q6OA 4MK3A 4KNDA 1MD3A 3APSA 1XPVA 1K0OA 1Q4JA 3MAKA 3HA9A 1FW1A 2B5YA 1YF1A 1M9BA 1GLQA 3TCOA 5GAPD 3CTFA 2VCZA 4HZ4A 2C4JA 3TOUA 3ERFA 4ZXGA 1A0RP 4V2NA 3M0FA 3UAPA 3WGEA 4H86A 4MNNA 4F03A 4WR5A 3MDKA 3F6DA 2R3XA 4O5RA 2QKEA 4WBJA 2B5EA 1JZRA 3GA4A 1BJXA 1PKZA 1YJ6A 1BQ7A 2GSTA 4MF5A 3W6GA 1SJZA 2EIOA 1MDJA 2IMIA 3M8NA 17GSA 5FT3A 1XFLA 3D4TA 4I2UA 4GLTA 2VD1A 3DIEA 4NV2A 2R37A 2GQKA 3LG6A 2JSYA 1ERVA 1X5EA 1S3RA 1THOA 4JZQA 2VIMA 2V6OA 1OKTA 2H6YA 1EWXA 2C80A 3BBYA 3LYPA 2LNTA 1F2EA 1B8XA 1J9BA 3KMNA 1PGTA 4G19A 5D73A 2HSHA 3FW2A 1NM3A 1T4YA 1FOHA 1TK8B 1YF0A 4BL7A 1SK0A 2AV4A 3FY7A 4EKZA 3F4SA 3D0ZA 2HSYA 5GAND 5IM9A 1PL1A 5DALB 2AAWA 1XWGA 3BJ5A 4ID0A 3GNJA 3ZIJA 1PQNA 2F8AA 1B4PA 4IW9A 1ILOA 20GSA 5CYYA 4JR4A 3H4KA 3GIXA 3RPNA 4WXTA 2MBSA 4AJ7A 2HZFA 1SYXA 1PRXA 3EYTA 4OFMA 1LJRA 1HD2A 3QR6A 4EE0A 3EU3A 2XHFA 3D21A 5D8IA 3CSHA 5ELGA 4F0BA 4V2MA 4EUYA 2AJQB 3F8UA 3IK9A 2H75A 1Z9HA 5DCGA 1V98A 2MMAA 3DD3A 5E59A 1CQHA 4WF5A 3QFAC 3TJBA 4MJBA 1FHEA 2DJ2A 3VPTA 4K1FA 1TI1A 1ZMAA 2KOKA 4PXOA 2PUKC 3R2QA 3ZVJD 2X8CA 5G5FA 2K6VA 8GSSA 2A2PA 1GUKA 2YNXA 4WETA 1OC3A 3LW9A 4HQSA 4Z2TA 1MDKA 2H66A 3LGCA 3HCZA 3M1GA 4DSSB 5ECMB 1MD4A 2CVKA 2XBQA 4RI7A 2LEGA 4EC0A 3ISOA 4ICYA 5G30A 2RIIA 4I8BA 3L9SA 3LORA 1Z6NA 2A2RA 2OBIA 2H73A 1TW9A 2WS2A 2GLRA 1F9MA 4OO4A 4EXJA 3C7MA 1SYRA 1T8EB 2VCVA 4AGSA 4MF6A 2JZSA 4PUFC 4TR1B 2TRCP 2VOCA 3UOMA 3UVTA 4N0VA 3GKKA 2H01A 2D2ZA 2G0FA 1SD9A 3NOFA 3FRCA 2LRCA 2CAIA 2DSAA 2CVBA 3KJYA 5G5EA 3HDCA 4GSNA 1QFNA 5JWRB 3CRTA 5HQPA 3O76A 3QPMA 4HQZA 18GSA 2VL2C 4MPFA 2HLSA 1EEJA 1O6JA 3O6TA 6GSUA 5H5QA 3KH7A 3APOA 3CYNA 3LYKA 3FK8A 2Z9SA 5HFGA 2QGVA 3GKXA 5F05A 5DAKA 3G7YA 3UBKA 3ZLPA 1AQWA 5D93A 3LEFA 4FH8A 1FAAA 1ZGNA 1NHOA 3IOSA 5H5RA 4A5PA 2H0GA 3P7XA 4AF2A 3F6FA 1SU9A 2DKHA 1ST9A 1SENA 1Z6MA 1XW5A 1R5PA 3GX0A 3KEBA 5J5NA 4MDCA 1EP8A 2F9SA 1MDIA 3W8SA 3Q19A 1EOHA 3QAGA 3GKNA 3CXGA 4GWRA 1O8XA 3KCMA 3GH9A 1OC9A 5ECLB 4TR4A 5D9XA 2V41A 4EO3A 3EWLA 2I1UA 3GFKA 1PD21 4BVYA 4Q5FA 4BWQA 4L5LA 3D4MA 1PN0A 3FR6A 3ZZXA 1SD8A 1XVQA 5J9CA 1JLWA 1TRSA 4O5UA 5IMCA 1GWCA 3GUSA 3HJMA 2RUEA 3L9UA 1YKCA 4K7NA 4XS4A 4XIHA 3KZQA 2PWJA 2N5FA 2GZYA 4K2DA 1TRWA 3GRXA 1PX6A 4ACSA 4V2LA 1OYJA 4HI7A 1XOBA 2WRTA 5ECHB 4ZB8A 4FQUA 4TW5A 1W89A 2I81A 3TJJA 2R0GA 1XG8A 1BEDA 4FYUA 4ULXA 4DSRA 1PX7A 4KCAA 2AYTA 1M7TA 4ZL8A 5IMAA 1XW6A 2LJAA 3DMLA 1PN9A 3M9KA 2V2GA 3IV4A 5ABRA 1VGLA 2V32A 3GTUA 2KP2A 3EVIA 2CX3A 3FZAA 3HJOA 2LQQA 5ECNB 4EIQA 4KDUA 4QL9A 1GSQA 1JLVA 1C72A 4HU7A 1GSEA 1ZYQB 1M3JA 3IRAA 3HZ4A 5IMVA 2C0DA 3IPZA 5KN3A 2A4VA 4IGJA 2FCHA 1KEBA 3C1RA 3ERWA 5ID2B 3TKQA 1ERTA 5JCUA 5KOWA 5EPFA 4XS1A 5IMDA 1DE2A 1GL8A 1HYUA 5KN2A 2JZRA 1PSQA 1KNGA 4POBA 1MTCA 5JWOB 2YV7A 3I43A 2I9HA 1XWAA 2K8VA 4TXOB 5IPHA 3F3QA 6GSVA 3I6AA 3EINA 5HR2A 1SK2A 3G9BA 3RHBA 4GXZA 4N0ZA 4GRFA 3DWVA 3VWVA 4EVMA 3H1NA 1GULA 3GSSA 2B3SA 2DBCA 4XRAA 4BPYA 3A2VA 3ERGA 4HU9A 4NXIA 5J3RA 1A23A 3GHAA 1GTUA 2F51A 5CO3A 2H0HA 2N5BA 3VURA 3U5RE 3N5OA 2PBJA 4LL1B 1OE7A 1USBA 5G31A 3D6IA 5AISA 3DRNA 1E6BA 2YCDA 4POMA 2EIRA 3BD2A 3IHQA 2OE3A 4RUVA 3WYWA 3M9JA 3EPTA 4MH2A 4JE1A 1Y25A 3RPPA 2ON5A 2VD0A 3KTLA 4G2EA 2MZCA 4ML1A 4NPBA 4I2TA 5KN0A 1A0FA 3TJFA 4ZBAA 3IAM2 4HEA2 3Q18A 3L0HA 1GH2A 3BCKA 1JHBA 2K18A 5CRGA 4L0WA 3TDGA 4WR4A 2VCXA 1YZXA 3TRPA 2R4VA 3F0IA 3ME8A 2O87A 2FA8A 2VCTA 4MZCA 4ZIJA 4KAEA 2DJKA 2MMOA 4MA9A 1A24A 5HR1A 1XBSA 1O8WA 4XRDA 1SJ6A 5ENUA 5DDLA 5KN1A 1YEPA 2YWIA 4EDYA 3GL5A 1SL1B 3IK7A 4AJ8A 4F0CA 1S3CA 3A2XA 2KLXA 2O89A 3LQ7A 3MSZA 2C0EA 1EV4A 4ILFA 2LJRA 4KX4A 1FVJA 2PGTA 1TJDA 4WEYA 4IJIA 1A2LA 2OE0A 1U87A 2X8GA 1M0UA 3HJPA 1Z3EA 2EC4A 1QQ2A 1HQOA 1V40A 5G1KA 5D9TA 1H75A 1H4OA 2V6KA 1NHYA 3UEMA 1TRVA 3VWUA 2GDRA 2C0FA 2GZPA 5CRDA 3QCPA 2X4AA 1EV9A 3H79A 4YKFA 3VPQA 4G0LA 2I3YA 3A2WA 3ZITA 4KDXA 3IXRA 2DJ3A 3S9FA 1PMTA 3PR8A 13GSA 4NV5A 3LJRA 2I4AA 4I6XA 4KUNA 2HRFA 1FB6A 1FOVA 1N8JA 2HFDA 1ABAA 2FWFA 5DALA 4KSMA 1X5CA 4IELA 2WCIA 2DLXA 3LWAA 4IS0A 4EL1A 4DSQA 22GSA 2LJKA 2L4QA 1I9DA 2WJUA 3L4NA 1M99A 2A2SA 3GX8A 2MBTA 2P31A 4E8HA 1EGOA 2FWGA 3RHCA 2GS3A 4ZL7A 2FHEA 1R26A 1ZOFA 2MMNA 2RM5A 1UA5A 3DKSA 3TOTA 2KHPA 1FO5A 5J9BA 2LNSA 2X64A 3TJGA 2NTOA 2VUPA 5DJLA 3FR3A 4OFTA 3TUEA 3SBCA 2IMEA 4Z7XA 1VF4A 4Q5QA 3QFBC 4CY6A 1EGRA 3KH9A 3VLNA 3ME7A 2R6KA 5CRHA 6GSSA 5DJMA 2IL3A 3BOAA 3KM6A 3ZREA 1M2AA 1YEXA 3FEUA 5IIZA 5F06A 2E2GA 3CSIA 1DBYA 3FHKA 1TRUA 1UVZA 3HYPA 4MCUA 2HZEB 3O3TA 3LXTA 4KGIA 5J41A 2IMFA 4TKYA 4WF4A 4L0UA 4IVFA 6GSWA 5FWGA 1CQGA 1X9WB 4K8MA 4PURA 2F3MA 1URMA 2YZHA 2VM1A 1HNCA 4JR6A 5IO2A 4ML6A 1GTIA 4TR3A 2PPTA 3NIVA 4PTSA 4ZBBA 4JU5A 4TR1A 3CTGA 1XZOA 4ECJA 4D73B 5EY6A 1B48A 4E8EA 3HVVA 2H76A 2VL9A 2YZUA 2GGTA 2VAFA 4WBRD 4BVXB 4MP4A 3BCIA 5DQSA 1E2YA 2HXKA 4PGTA 1ZYEA 2HRAA 3G7IA 2HRNA 2C0GA 2BMXA 4CW9A 1ML6A 4KE3A 2ALBA 1S3DA 2B1KA 3EU4A 12GSA 1WMJA 2REMA 1A2JA 2QA2A 3RDWA 2H8LA 1ZL9A 5DQYA 4EDZA 3F63A 3DXBA 1W4VA 1SKWB 1T1VA 1TTZA 3Q74A 3P90A 4ZL9A 4PX1A 3TRQA 4HSCX 4YQUA 2JU5A 5IMFA 1V57A 4DEJA 3SWLA 4NHZA 2OKAA 5FHIA 1I5GA 1TI3A 2YP6A 2CZ3A 2RLIA 2ZUPA 3CSJA 4NHWA 4X43A 2KP1A 2WFCA 1DSBA 4JBBA 1J0FA 3US3A 1OC9B 4X0XA 1SL0B 2H1BA 2PVQA 3GYKA 5D9WA 1WRYA 1EP7A 2IFQB 3GN3A 2O8VB 4O7HA 4K7IA 3KIJA 2UZ8A 2CAQA 4PNFA 1BX9A 2LSTA 2HYXA 4MZWA 4XHMA 3FMWA 1A2MA 1FVKA 1OKDA 1GSUA 5IO0A 3IC8A 3DVWA 2KUCA 2M72A 1G6WA 3LXZA 2XPDA 1AUCA 2JZTA 4DVCA 4XS4B 4PNGA 5ECPB 1AQVA 1AIUA 2E2MA 3LSZA 1A8LA 5IMZA 1TU7A 3H8QA 9GSSA 2JSZA 1U3AA 2VLVA 2OACA 2O85A 3HXSA 2H1GA 4HDEA 2CV4A 2G2QA 1G7EA 5AGYA 3L78A 2DMMA 1M2DA 3IR4A 4EIPA 2L5OA 4J57E 4ZILA 4KSOA 5GSTA 2X8HA 1XWCA 4X4JA 3PINA 5DBQA 4GSSA 1GSDA 3WT2A 3P8WA 5CAXA 1M2BA 3CQFA 3ZRDA 5F0GA 2IWTA 1ON4A 1RW1A 4PQIA 2LRTA 19GSA 3EE2A 1GUMA 5ELAA 5AIXA 4G10A 4TR0A 2H71A 1K0NA 5KEJA 2OBKA 3IDVA 5JWQB 1IYHA 5JCGA 1T7PB 2VLUA 3FZ4A 3A5WA 1GSFA 1IYIA 2LKUA 1U88A 1J08A 3C71A 3RAZA 1GTBA 2AHEA 2CA8A 3C8EA 1OC8A 5GSSA 3MIXA 3ZFLA 1R5AA 3GSTA 4IJ3A 3HD5A 5IOXA 3GH6A 4MZBA 3FZ9A 3FR9A 1UN2A 5ECSA 2ZNMA 4HZ2A 1ERWA
chains in the Genus database with same CATH topology
2L6CA 2P5QA 4K9ZA 2V1MA 2TIRA 2DKIA 4F82A 1B9XC 4G9HA 1X0RA 2PMTA 3GV1A 1YY7A 1AXDA 5B8AA 3VI5A 3A5IA 7GSSA 5ECQB 3TKPA 5INYA 1GTAA 1Z7RA 2OE1A 4AJ6A 2HI7A 3C1SA 2H72A 4N11A 1K0AA 4K0NA 3ZMLA 1PKWA 2YANA 3KP8A 4MJCA 2YJHA 1TP9A 1K0CA 4USSA 3IC4A 2H19A 4IHUA 3IBHA 4OCFA 4MLYA 4IP6A 3WGDA 3FKFA 5B6MA 14GSA 4IQ1A 4TOPA 2P0GA 3QAVA 1OVNA 1TU8A 1GLPA 2GZZA 1ERUA 1TDIA 3J7Yk 4MH3A 4FYCA 2H70A 3ZVJA 2IMKA 2PVOC 5D96A 3UIWA 3FYGA 5H5SA 4POLA 2VO4A 4V1Ag 1GP1A 2NDOA 4LL4B 3UARA 1ZZYA 4LLRA 1EOGA 4KCEA 2FY6A 4XTSA 1O73A 1V9WA 4YQVA 4IN0A 2MYGA 4NAXA 2O7KA 3UBLA 1JZWA 2H1DA 5GZZB 1HNAA 2LS5A 1N2AA 2FNOA 4QL7A 3M3MA 3ZMKA 3ZTLA 2OJLA 2YWOA 2ON7A 6GSTA 10GSA 1K3OA 1JZDA 1TXXA 2MMZA 3F3RA 3KD0A 2HE3A 2FWHA 5LNKe 3WGXA 5COHA 1X9SB 1NW2A 2C8UA 3QOUA 1K0BA 1JFUA 3DVXA 2PU9C 1BG5A 1WPIA 4TRXA 2P5RA 3H93A 4LA1A 1G6YA 1AQXA 4K7OA 2FUG2 5D9VA 4Z2RA 5CNWA 2GTUA 3HVSA 5L71A 2B7KA 1LU4A 2WZ9A 5E4WA 3C73A 1PL2A 1DUGA 4JEDA 4Q5RA 2HNLA 4N30A 4HOJA 2C3QA 1WP0A 2BTOT 2VM2A 1GNWA 4L8EA 4XS6A 1SK1A 2GQLA 3TKSE 2CVDA 3P2AA 5HR0A 1AAZA 4GF0A 3VWXA 3QAWA 2L4CA 3RBTA 3MWHA 4PUAA 2WDUA 2OA7A 4BL7B 2FD3A 3TB2A 1T3BA 5B7CA 1ZYPA 2GT5A 3MYDA 5LCZA 2GSSA 2AB6A 1SJIA 1YDKA 4I5QA 1FG4A 2LV3A 1O7UA 3F4RA 3ED3A 1XOAA 4KF9A 3ZIVA 4F2IA 4Z2UA 2DC5A 4KDYA 5ECOB 5G1LA 5HR3A 2JACA 1GSSA 2RUFA 1TKDB 2BJXA 5DCHA 3PPUA 2R5GA 1VF3A 4WKWA 2QC7A 1ACVA 3VWWA 1BAYA 4JRRA 5KOXA 2WULA 1K0DA 4BA7A 2DMLA 1R4WA 2GSRA 3PGTA 2YJ7A 1Z7PA 3TKSA 1YQ1A 1A8YA 2R0PA 3E9JB 2C3TA 2PN8A 5J4UA 2EIQA 1VF2A 4ECIA 1Y6EA 4RI6A 1O85A 1K3LA 3V1WA 5IOWA 4CDOA 1TK0B 1WOUA 2J9HA 5CRWA 4MJEA 2DJ1A 3L9VA 5B6NA 2DIZA 5CP1A 1SL2B 5AIVA 1V2AA 1XW9A 4PQHA 6GSYA 1GRXA 4ZB6A 1F37A 3N9JA 5EVOA 4K2XA 2F8FA 1QMVA 4HJ2A 5IPGA 3I69A 2OADA 2FGXA 3PH9A 4DSSA 2LRNA 1QXHA 1Q98A 2HZEA 3JCML 4IBPA 3HZ8A 5F07A 4QQ7A 2M46A 2K8SA 1GSYA 2E7PA 1G7OA 1M9AA 5A5KA 3KTBA 1HNBA 3NZNA 1SKSB 4YAVA 1EEMA 3I9V2 1XCCA 2YN1A 4HS1A 3D5JA 1B4QA 3MNGA 1FB0A 3G7JA 1GNEA 3GKMA 5LD0A 2VLTA 1TK5B 1UC7A 1XXUA 3UL3A 2CZ2A 3OR5A 5B8BA 1G0TA 1MEKA 4POKA 3ZYWA 3GL3A 1AW9A 4Q5NA 1PA3A 3WD6A 4LMVA 4D73A 3TJKA 4HUAA 3CMIA 2IN3A 2JADA 3QDNA 4PQ1A 2LQOA 4GQCA 5HFIA 4BVXA 2LTKA 2IIYA 5DAKB 4KW6A 4F9ZA 3EC3A 1T00A 2CX4A 2GSQA 1V58A 1XIYA 4GCIA 2YWMA 4MF7A 3UVHA 2DJJA 2N5AA 2CT6A 4N10A 5C00A 2X99A 4KB3A 3E0UA 2HSMA 4P3YB 3IHGA 3E3EA 4V1Ap 3R3EA 4RQXA 3QD9A 2DJ0A 4HJMA 4ZB9A 4ECCA 1S3AA 1RK4A 2GVPA 4IP1A 2GT6A 4OO5A 5EL8A 1QK8A 2HRKA 1WIKA 3EMXA 2AUVA 3K8NA 1ZYNA 1THXA 1EZKA 4NWYA 3VK9A 1VRSD 2C1YA 2ZCTA 3VI7A 1XWKA 3KMOA 5BRTA 1SKRB 3DGQA 4MMMA 2L57A 3TGZA 5IQYA 4BVYB 3DEXA 5F8BA 1VF1A 5BMUA 3LFLA 4XCSA 5HFKA 4K5SA 4ZBDA 3J7Yb 1KTEA 2H0IA 5DVBA 2QSIA 4ECBA 3KP9A 2IFQA 1K3YA 3HY2A 3KGKA 3ZFBA 2WGRA 4NMUA 1T4ZA 4TVEA 1QGVA 2B6MA 5A4UA 1BYEA 1RQMA 4L5OA 1WJKA 1OAZA 3IE3A 2WB9A 3HHVA 2XPEA 4G0KA 4LMWA 4X1UA 3UMAA 3IAS2 1NSWA 16GSA 4FIWA 2IPAA 1KBNA 4KA0A 4YH2A 4IKHA 3D22A 4YQMA 1WE0A 2B5XA 2J23A 2PERA 1XWBA 4FYBA 2E0QA 2H6ZA 4GTUA 2HT9A 3QMXA 11GSA 2YWNA 1DE1A 2XBIA 2FA4A 4OFNA 4O92A 3TRXA 2CQ9A 3FZ5A 3GTUB 2R0CA 2H6XA 2B7JA 2M80A 1GUHA 2VCQA 3A3TA 4CHSA 4GQFA 1F6MC 1K0MA 4GSTA 3ZL5A 2ES7A 3KXOA 2IJYA 5JCWA 3F4TA 1U3IA 4I97A 2L59A 3W8JA 2NVLA 1YKAA 2RM6A 2VCWA 1JZOA 5AN1A 3GURA 1B9YC 2VL2A 5ECIB 4CY8A 4KH7A 2L6DA 3APQA 1ZCPA 2C3NA 3DYRA 2K9FA 2YOIA 1O81A 3IA1A 4OCEA 3TKRA 2YV9A 2IMDA 4TXVA 4O32A 2VL3A 2NBSA 4TN8A 2JL4A 5ID2A 2XC2A 3CRUA 5ECKB 5G2ZA 2H30A 2L5LA 2NPBA 4EF0A 2YPMA 3VFIA 2FLSA 1TOFA 5A4VA 4O5QA 1WWJA 1X9MB 4RQRA 1XVWA 2X49A 1Z5YE 4OD7A 6GSXA 4IQAA 2H1AA 4MABA 3UJ1A 3CBUA 1AC1A 5ECRB 3GMFA 3HKRA 2FWEA 4J56E 3EMPA 4TXOA 4G0IA 2GQMA 1F3BA 1F3AA 3F9UA 5C04A 2H74A 5A4WA 4J2FA 5CREA 4K5RA 4MPGA 4YKGA 3AY8A 3U6VA 3WT1A 2A4HA 1X5DA 4OMVA 3EURA 2B1LA 4ISDA 1QUWA 2QA1A 2DIYA 2TRXA 2LUSA 4OWYA 1LBKA 3TKSC 4YAPA 3HVXA 1R7HA 4K0GA 4FO5A 2R2JA 1U6TA 4K6XA 4BWSA 1OE8A 4MJAA 3Q6OA 4MK3A 4KNDA 1MD3A 3APSA 1XPVA 1K0OA 1Q4JA 3MAKA 3HA9A 1FW1A 2B5YA 1YF1A 1M9BA 1GLQA 3TCOA 5GAPD 3CTFA 2VCZA 4HZ4A 2C4JA 3TOUA 3ERFA 4ZXGA 1A0RP 4V2NA 3M0FA 3UAPA 3WGEA 4H86A 4MNNA 4F03A 4WR5A 3MDKA 3F6DA 2R3XA 4O5RA 2QKEA 4WBJA 2B5EA 1JZRA 3GA4A 1BJXA 1PKZA 1YJ6A 1BQ7A 2GSTA 4MF5A 3W6GA 1SJZA 2EIOA 1MDJA 2IMIA 3M8NA 17GSA 5FT3A 1XFLA 3D4TA 4I2UA 4GLTA 2VD1A 3DIEA 4NV2A 2R37A 2GQKA 3LG6A 2JSYA 1ERVA 1X5EA 1THOA 4JZQA 2VIMA 2V6OA 1OKTA 2H6YA 1EWXA 2C80A 3BBYA 3LYPA 2LNTA 1F2EA 1B8XA 1J9BA 3KMNA 1PGTA 4G19A 5D73A 2HSHA 3FW2A 1NM3A 1T4YA 1FOHA 1TK8B 1YF0A 4BL7A 1SK0A 2AV4A 3FY7A 4EKZA 3F4SA 3D0ZA 2HSYA 5GAND 5IM9A 1PL1A 5DALB 2AAWA 1XWGA 3BJ5A 4ID0A 3GNJA 3ZIJA 1PQNA 2F8AA 1B4PA 4IW9A 1ILOA 20GSA 5CYYA 4JR4A 3H4KA 3GIXA 3RPNA 4WXTA 2MBSA 4AJ7A 2HZFA 1SYXA 1PRXA 3EYTA 4OFMA 1LJRA 1HD2A 3QR6A 4EE0A 3EU3A 2XHFA 3D21A 5D8IA 3CSHA 5ELGA 4F0BA 4V2MA 4EUYA 2AJQB 3F8UA 3IK9A 2H75A 1Z9HA 5DCGA 1V98A 2MMAA 3DD3A 5E59A 1CQHA 4WF5A 3QFAC 3TJBA 4MJBA 1FHEA 2DJ2A 3VPTA 4K1FA 1TI1A 1ZMAA 2KOKA 4PXOA 2PUKC 3R2QA 3ZVJD 2X8CA 5G5FA 2K6VA 8GSSA 2A2PA 1GUKA 2YNXA 4WETA 1OC3A 3LW9A 4HQSA 4Z2TA 1MDKA 2H66A 3LGCA 3HCZA 3M1GA 4DSSB 5ECMB 1MD4A 2CVKA 2XBQA 4RI7A 2LEGA 4EC0A 3ISOA 4ICYA 5G30A 2RIIA 4I8BA 3L9SA 3LORA 1Z6NA 2A2RA 2OBIA 2H73A 1TW9A 2WS2A 2GLRA 1F9MA 4OO4A 4EXJA 3C7MA 1SYRA 1T8EB 2VCVA 4AGSA 4MF6A 2JZSA 4PUFC 4TR1B 2TRCP 2VOCA 3UOMA 3UVTA 4N0VA 3GKKA 2H01A 2D2ZA 2G0FA 1SD9A 3NOFA 3FRCA 2LRCA 2CAIA 2DSAA 2CVBA 3KJYA 5G5EA 3HDCA 4GSNA 1QFNA 5JWRB 3CRTA 5HQPA 3O76A 3QPMA 4HQZA 18GSA 2VL2C 4MPFA 2HLSA 1EEJA 1O6JA 3O6TA 6GSUA 5H5QA 3KH7A 3APOA 3CYNA 3LYKA 3FK8A 2Z9SA 5HFGA 2QGVA 3GKXA 5F05A 5DAKA 3G7YA 3UBKA 3ZLPA 1AQWA 5D93A 3LEFA 4FH8A 1FAAA 1ZGNA 1NHOA 3IOSA 5H5RA 4A5PA 2H0GA 3P7XA 4AF2A 3F6FA 1SU9A 2DKHA 1ST9A 1SENA 1Z6MA 1XW5A 1R5PA 3GX0A 3KEBA 5J5NA 4MDCA 1EP8A 2F9SA 1MDIA 3W8SA 3Q19A 1EOHA 3QAGA 3GKNA 3CXGA 4GWRA 1O8XA 3KCMA 3GH9A 1OC9A 5ECLB 4TR4A 5D9XA 2V41A 4EO3A 3EWLA 2I1UA 3GFKA 1PD21 4BVYA 4Q5FA 4BWQA 4L5LA 3D4MA 1PN0A 3FR6A 3ZZXA 1SD8A 1XVQA 5J9CA 1JLWA 1TRSA 4O5UA 5IMCA 1GWCA 3GUSA 3HJMA 2RUEA 3L9UA 1YKCA 4K7NA 4XS4A 4XIHA 3KZQA 2PWJA 2N5FA 2GZYA 4K2DA 1TRWA 3GRXA 1PX6A 4ACSA 4V2LA 1OYJA 4HI7A 1XOBA 2WRTA 5ECHB 4ZB8A 4FQUA 4TW5A 1W89A 2I81A 3TJJA 2R0GA 1BEDA 4FYUA 4ULXA 4DSRA 1PX7A 4KCAA 2AYTA 1M7TA 4ZL8A 5IMAA 1XW6A 2LJAA 3DMLA 1PN9A 3M9KA 2V2GA 3IV4A 5ABRA 1VGLA 2V32A 3GTUA 2KP2A 3EVIA 2CX3A 3FZAA 3HJOA 2LQQA 5ECNB 4EIQA 4KDUA 4QL9A 1GSQA 1JLVA 1C72A 4HU7A 1GSEA 1ZYQB 3IRAA 3HZ4A 5IMVA 2C0DA 3IPZA 5KN3A 2A4VA 4IGJA 2FCHA 1KEBA 3C1RA 3ERWA 5ID2B 3TKQA 1ERTA 5JCUA 5KOWA 5EPFA 4XS1A 5IMDA 1DE2A 1GL8A 1HYUA 5KN2A 2JZRA 1PSQA 1KNGA 4POBA 1MTCA 5JWOB 2YV7A 3I43A 2I9HA 1XWAA 2K8VA 4TXOB 5IPHA 3F3QA 6GSVA 3I6AA 3EINA 5HR2A 1SK2A 3G9BA 3RHBA 4GXZA 4N0ZA 4GRFA 3DWVA 3VWVA 4EVMA 3H1NA 1GULA 3GSSA 2B3SA 2DBCA 4XRAA 4BPYA 3A2VA 3ERGA 4HU9A 4NXIA 5J3RA 1A23A 3GHAA 1GTUA 2F51A 5CO3A 2H0HA 2N5BA 3VURA 3U5RE 3N5OA 2PBJA 4LL1B 1OE7A 1USBA 5G31A 3D6IA 5AISA 3DRNA 1E6BA 2YCDA 4POMA 2EIRA 3BD2A 3IHQA 2OE3A 4RUVA 3WYWA 3M9JA 3EPTA 4MH2A 4JE1A 1Y25A 3RPPA 2ON5A 2VD0A 3KTLA 4G2EA 2MZCA 4ML1A 4NPBA 4I2TA 5KN0A 1A0FA 3TJFA 4ZBAA 3IAM2 4HEA2 3Q18A 3L0HA 1GH2A 3BCKA 1JHBA 2K18A 5CRGA 4L0WA 3TDGA 4WR4A 2VCXA 1YZXA 3TRPA 2R4VA 3F0IA 3ME8A 2O87A 2FA8A 2VCTA 4MZCA 4ZIJA 4KAEA 2DJKA 2MMOA 4MA9A 1A24A 5HR1A 1XBSA 1O8WA 4XRDA 1SJ6A 5ENUA 5DDLA 5KN1A 1YEPA 2YWIA 4EDYA 3GL5A 1SL1B 3IK7A 4AJ8A 4F0CA 1S3CA 3A2XA 2KLXA 2O89A 3LQ7A 3MSZA 2C0EA 1EV4A 4ILFA 2LJRA 4KX4A 1FVJA 2PGTA 1TJDA 4WEYA 4IJIA 1A2LA 2OE0A 1U87A 2X8GA 1M0UA 3HJPA 1Z3EA 2EC4A 1QQ2A 1HQOA 1V40A 5G1KA 5D9TA 1H75A 1H4OA 2V6KA 1NHYA 3UEMA 1TRVA 3VWUA 2GDRA 2C0FA 2GZPA 5CRDA 3QCPA 2X4AA 1EV9A 3H79A 4YKFA 3VPQA 4G0LA 2I3YA 3A2WA 3ZITA 4KDXA 3IXRA 2DJ3A 3S9FA 1PMTA 3PR8A 13GSA 4NV5A 3LJRA 2I4AA 4I6XA 4KUNA 2HRFA 1FB6A 1FOVA 1N8JA 2HFDA 1ABAA 2FWFA 5DALA 4KSMA 1X5CA 4IELA 2WCIA 2DLXA 3LWAA 4IS0A 4EL1A 4DSQA 22GSA 2LJKA 2L4QA 1I9DA 2WJUA 3L4NA 1M99A 2A2SA 3GX8A 2MBTA 2P31A 4E8HA 1EGOA 2FWGA 3RHCA 2GS3A 4ZL7A 2FHEA 1R26A 1ZOFA 2MMNA 2RM5A 1UA5A 3DKSA 3TOTA 2KHPA 1FO5A 5J9BA 2LNSA 2X64A 3TJGA 2NTOA 2VUPA 5DJLA 3FR3A 4OFTA 3TUEA 3SBCA 2IMEA 4Z7XA 1VF4A 4Q5QA 3QFBC 4CY6A 1EGRA 3KH9A 3VLNA 3ME7A 2R6KA 5CRHA 6GSSA 5DJMA 2IL3A 3BOAA 3KM6A 3ZREA 1M2AA 1YEXA 3FEUA 5IIZA 5F06A 2E2GA 3CSIA 1DBYA 3FHKA 1TRUA 1UVZA 3HYPA 4MCUA 2HZEB 3O3TA 3LXTA 4KGIA 5J41A 2IMFA 4TKYA 4WF4A 4L0UA 4IVFA 6GSWA 5FWGA 1CQGA 1X9WB 4K8MA 4PURA 2F3MA 1URMA 2YZHA 2VM1A 1HNCA 4JR6A 5IO2A 4ML6A 1GTIA 4TR3A 2PPTA 3NIVA 4PTSA 4ZBBA 4JU5A 4TR1A 3CTGA 1XZOA 4ECJA 4D73B 5EY6A 1B48A 4E8EA 3HVVA 2H76A 2VL9A 2YZUA 2GGTA 2VAFA 4WBRD 4BVXB 4MP4A 3BCIA 5DQSA 1E2YA 2HXKA 4PGTA 1ZYEA 2HRAA 3G7IA 2HRNA 2C0GA 2BMXA 4CW9A 1ML6A 4KE3A 2ALBA 1S3DA 2B1KA 3EU4A 12GSA 1WMJA 2REMA 1A2JA 2QA2A 3RDWA 2H8LA 1ZL9A 5DQYA 4EDZA 3F63A 3DXBA 1W4VA 1SKWB 1T1VA 1TTZA 3Q74A 3P90A 4ZL9A 4PX1A 3TRQA 4YQUA 2JU5A 5IMFA 1V57A 4DEJA 3SWLA 4NHZA 2OKAA 5FHIA 1I5GA 1TI3A 2YP6A 2CZ3A 2RLIA 2ZUPA 3CSJA 4NHWA 4X43A 2KP1A 2WFCA 1DSBA 4JBBA 1J0FA 3US3A 1OC9B 4X0XA 1SL0B 2H1BA 2PVQA 3GYKA 5D9WA 1WRYA 1EP7A 2IFQB 3GN3A 2O8VB 4O7HA 4K7IA 3KIJA 2UZ8A 2CAQA 4PNFA 1BX9A 2LSTA 2HYXA 4MZWA 4XHMA 3FMWA 1A2MA 1FVKA 1OKDA 1GSUA 5IO0A 3IC8A 3DVWA 2KUCA 2M72A 1G6WA 3LXZA 2XPDA 1AUCA 2JZTA 4DVCA 4XS4B 4PNGA 5ECPB 1AQVA 1AIUA 2E2MA 3LSZA 1A8LA 5IMZA 1TU7A 3H8QA 9GSSA 2JSZA 1U3AA 2VLVA 2OACA 2O85A 3HXSA 2H1GA 4HDEA 2CV4A 2G2QA 1G7EA 5AGYA 3L78A 2DMMA 1M2DA 3IR4A 4EIPA 2L5OA 4J57E 4ZILA 4KSOA 5GSTA 2X8HA 1XWCA 4X4JA 3PINA 5DBQA 4GSSA 1GSDA 3WT2A 3P8WA 5CAXA 1M2BA 3ZRDA 5F0GA 2IWTA 1ON4A 1RW1A 4PQIA 2LRTA 19GSA 3EE2A 1GUMA 5ELAA 5AIXA 4G10A 4TR0A 2H71A 1K0NA 5KEJA 2OBKA 3IDVA 5JWQB 1IYHA 5JCGA 1T7PB 2VLUA 3FZ4A 3A5WA 1GSFA 1IYIA 2LKUA 1U88A 1J08A 3C71A 3RAZA 1GTBA 2AHEA 2CA8A 3C8EA 1OC8A 5GSSA 3MIXA 3ZFLA 1R5AA 3GSTA 4IJ3A 3HD5A 5IOXA 3GH6A 4MZBA 3FZ9A 3FR9A 1UN2A 5ECSA 2ZNMA 4HZ2A 1ERWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L6C A;  2P5Q A;  4K9Z A;  2V1M A;  2TIR A;  4F82 A;  1B9X C;  4G9H A;  1X0R A;  2PMT A;  3GV1 A;  1YY7 A;  1AXD A;  5B8A A;  3VI5 A;  7GSS A;  5ECQ B;  3TKP A;  5INY A;  1GTA A;  1Z7R A;  2OE1 A;  4AJ6 A;  2HI7 A;  3C1S A;  2H72 A;  4N11 A;  1K0A A;  4K0N A;  3ZML A;  1PKW A;  2YAN A;  3KP8 A;  4MJC A;  2YJH A;  1TP9 A;  1K0C A;  3IC4 A;  2H19 A;  4IHU A;  3IBH A;  4OCF A;  4MLY A;  4IP6 A;  3WGD A;  3FKF A;  5B6M A;  14GS A;  4IQ1 A;  4TOP A;  2P0G A;  3QAV A;  1OVN A;  1TU8 A;  1GLP A;  2GZZ A;  1ERU A;  1TDI A;  3J7Y k;  4MH3 A;  4FYC A;  2H70 A;  3ZVJ A;  2IMK A;  2PVO C;  5D96 A;  3UIW A;  3FYG A;  5H5S A;  4POL A;  2VO4 A;  4V1A g;  1GP1 A;  2NDO A;  4LL4 B;  3UAR A;  1ZZY A;  4LLR A;  1EOG A;  4KCE A;  2FY6 A;  4XTS A;  1O73 A;  1V9W A;  4YQV A;  4IN0 A;  2MYG A;  4NAX A;  2O7K A;  3UBL A;  1JZW A;  2H1D A;  5GZZ B;  1HNA A;  2LS5 A;  1N2A A;  2FNO A;  4QL7 A;  3M3M A;  3ZMK A;  3ZTL A;  2OJL A;  2YWO A;  2ON7 A;  6GST A;  10GS A;  1K3O A;  1JZD A;  1TXX A;  2MMZ A;  3F3R A;  3KD0 A;  2HE3 A;  2FWH A;  5LNK e;  3WGX A;  5COH A;  1X9S B;  1NW2 A;  2C8U A;  3QOU A;  1K0B A;  1JFU A;  3DVX A;  2PU9 C;  1BG5 A;  1WPI A;  4TRX A;  2P5R A;  3H93 A;  4LA1 A;  1G6Y A;  1AQX A;  4K7O A;  2FUG 2;  5D9V A;  5CNW A;  2GTU A;  3HVS A;  5L71 A;  2B7K A;  1LU4 A;  2WZ9 A;  5E4W A;  3C73 A;  1PL2 A;  1DUG A;  4JED A;  4Q5R A;  2HNL A;  4N30 A;  4HOJ A;  2C3Q A;  1WP0 A;  2BTO T;  2VM2 A;  1GNW A;  4L8E A;  4XS6 A;  1SK1 A;  2GQL A;  3TKS E;  2CVD A;  3P2A A;  5HR0 A;  1AAZ A;  4GF0 A;  3VWX A;  3QAW A;  2L4C A;  3RBT A;  3MWH A;  4PUA A;  2WDU A;  2OA7 A;  2FD3 A;  3TB2 A;  1T3B A;  5B7C A;  2GT5 A;  5LCZ A;  2GSS A;  2AB6 A;  1SJI A;  1YDK A;  4I5Q A;  1FG4 A;  2LV3 A;  1O7U A;  3F4R A;  3ED3 A;  1XOA A;  3ZIV A;  4F2I A;  2DC5 A;  4KDY A;  5ECO B;  5G1L A;  5HR3 A;  2JAC A;  1GSS A;  2RUF A;  1TKD B;  2BJX A;  5DCH A;  2R5G A;  1VF3 A;  4WKW A;  2QC7 A;  1ACV A;  3VWW A;  1BAY A;  4JRR A;  2WUL A;  1K0D A;  4BA7 A;  2DML A;  1R4W A;  2GSR A;  3PGT A;  2YJ7 A;  1Z7P A;  3TKS A;  1YQ1 A;  1A8Y A;  3E9J B;  2C3T A;  2PN8 A;  5J4U A;  2EIQ A;  1VF2 A;  4ECI A;  1Y6E A;  4RI6 A;  1O85 A;  1K3L A;  3V1W A;  5IOW A;  4CDO A;  1TK0 B;  1WOU A;  2J9H A;  5CRW A;  4MJE A;  2DJ1 A;  3L9V A;  5B6N A;  2DIZ A;  5CP1 A;  1SL2 B;  5AIV A;  1V2A A;  1XW9 A;  4PQH A;  6GSY A;  1GRX A;  4ZB6 A;  1F37 A;  3N9J A;  5EVO A;  2F8F A;  1QMV A;  4HJ2 A;  5IPG A;  3I69 A;  2OAD A;  2FGX A;  3PH9 A;  4DSS A;  2LRN A;  1QXH A;  1Q98 A;  2HZE A;  3JCM L;  4IBP A;  3HZ8 A;  5F07 A;  4QQ7 A;  2M46 A;  2K8S A;  1GSY A;  2E7P A;  1G7O A;  1M9A A;  5A5K A;  3KTB A;  1HNB A;  3NZN A;  1SKS B;  4YAV A;  1EEM A;  3I9V 2;  1XCC A;  2YN1 A;  4HS1 A;  3D5J A;  1B4Q A;  3MNG A;  1FB0 A;  3G7J A;  1GNE A;  3GKM A;  5LD0 A;  2VLT A;  1TK5 B;  1UC7 A;  1XXU A;  3UL3 A;  2CZ2 A;  3OR5 A;  5B8B A;  1G0T A;  1MEK A;  4POK A;  3ZYW A;  3GL3 A;  1AW9 A;  4Q5N A;  1PA3 A;  3WD6 A;  4LMV A;  4D73 A;  3TJK A;  4HUA A;  3CMI A;  2IN3 A;  2JAD A;  3QDN A;  4PQ1 A;  2LQO A;  4GQC A;  5HFI A;  4BVX A;  2LTK A;  2IIY A;  5DAK B;  4KW6 A;  4F9Z A;  3EC3 A;  1T00 A;  2CX4 A;  2GSQ A;  1V58 A;  1XIY A;  4GCI A;  2YWM A;  4MF7 A;  3UVH A;  2DJJ A;  2N5A A;  2CT6 A;  4N10 A;  5C00 A;  2X99 A;  4KB3 A;  3E0U A;  4P3Y B;  3E3E A;  4V1A p;  4RQX A;  3QD9 A;  2DJ0 A;  4HJM A;  4ZB9 A;  4ECC A;  1S3A A;  1RK4 A;  2GVP A;  4IP1 A;  2GT6 A;  4OO5 A;  5EL8 A;  1QK8 A;  1WIK A;  3EMX A;  2AUV A;  3K8N A;  1THX A;  1EZK A;  4NWY A;  3VK9 A;  1VRS D;  2C1Y A;  2ZCT A;  3VI7 A;  1XWK A;  3KMO A;  1SKR B;  3DGQ A;  4MMM A;  2L57 A;  3TGZ A;  5IQY A;  3DEX A;  5F8B A;  1VF1 A;  3LFL A;  4XCS A;  5HFK A;  4ZBD A;  3J7Y b;  1KTE A;  2H0I A;  5DVB A;  2QSI A;  4ECB A;  3KP9 A;  2IFQ A;  1K3Y A;  3HY2 A;  3KGK A;  3ZFB A;  2WGR A;  4NMU A;  1T4Z A;  4TVE A;  1QGV A;  2B6M A;  5A4U A;  1BYE A;  1RQM A;  4L5O A;  1WJK A;  1OAZ A;  3IE3 A;  2WB9 A;  3HHV A;  2XPE A;  4X1U A;  4LMW A;  3UMA A;  3IAS 2;  1NSW A;  16GS A;  4FIW A;  2IPA A;  1KBN A;  4KA0 A;  4YH2 A;  4IKH A;  3D22 A;  4YQM A;  1WE0 A;  2B5X A;  2J23 A;  2PER A;  1XWB A;  4FYB A;  2E0Q A;  2H6Z A;  4GTU A;  2HT9 A;  3QMX A;  11GS A;  2YWN A;  1DE1 A;  2XBI A;  2FA4 A;  4OFN A;  4O92 A;  3TRX A;  2CQ9 A;  3FZ5 A;  3GTU B;  2H6X A;  2B7J A;  2M80 A;  1GUH A;  2VCQ A;  3A3T A;  4CHS A;  4GQF A;  1F6M C;  1K0M A;  4GST A;  3ZL5 A;  2ES7 A;  3KXO A;  2IJY A;  5JCW A;  3F4T A;  1U3I A;  4I97 A;  2L59 A;  3W8J A;  2NVL A;  1YKA A;  2RM6 A;  2VCW A;  1JZO A;  5AN1 A;  3GUR A;  1B9Y C;  2VL2 A;  5ECI B;  4KH7 A;  2L6D A;  3APQ A;  1ZCP A;  2C3N A;  3DYR A;  2K9F A;  2YOI A;  1O81 A;  3IA1 A;  4OCE A;  3TKR A;  2YV9 A;  2IMD A;  4TXV A;  4O32 A;  2VL3 A;  2NBS A;  4TN8 A;  2JL4 A;  5ID2 A;  2XC2 A;  3CRU A;  5ECK B;  5G2Z A;  2H30 A;  2L5L A;  2NPB A;  4EF0 A;  2YPM A;  3VFI A;  2FLS A;  1TOF A;  5A4V A;  1WWJ A;  1X9M B;  4RQR A;  1XVW A;  1Z5Y E;  4OD7 A;  6GSX A;  4IQA A;  2H1A A;  4MAB A;  3UJ1 A;  3CBU A;  1AC1 A;  5ECR B;  3GMF A;  3HKR A;  2FWE A;  4J56 E;  3EMP A;  4TXO A;  2GQM A;  1F3B A;  1F3A A;  3F9U A;  5C04 A;  2H74 A;  5A4W A;  4J2F A;  5CRE A;  4MPG A;  3AY8 A;  3U6V A;  3WT1 A;  1X5D A;  4OMV A;  3EUR A;  2B1L A;  4ISD A;  1QUW A;  2DIY A;  2TRX A;  2LUS A;  4OWY A;  1LBK A;  3TKS C;  4YAP A;  3HVX A;  1R7H A;  4K0G A;  4FO5 A;  2R2J A;  1U6T A;  4K6X A;  4BWS A;  1OE8 A;  4MJA A;  3Q6O A;  4MK3 A;  4KND A;  1MD3 A;  3APS A;  1XPV A;  1K0O A;  1Q4J A;  3MAK A;  3HA9 A;  1FW1 A;  2B5Y A;  1YF1 A;  1M9B A;  1GLQ A;  3TCO A;  5GAP D;  3CTF A;  2VCZ A;  4HZ4 A;  2C4J A;  3TOU A;  3ERF A;  4ZXG A;  1A0R P;  4V2N A;  3M0F A;  3UAP A;  3WGE A;  4H86 A;  4F03 A;  4WR5 A;  3MDK A;  3F6D A;  2R3X A;  4O5R A;  2QKE A;  4WBJ A;  2B5E A;  1JZR A;  3GA4 A;  1BJX A;  1PKZ A;  1YJ6 A;  1BQ7 A;  2GST A;  4MF5 A;  3W6G A;  1SJZ A;  2EIO A;  1MDJ A;  2IMI A;  3M8N A;  17GS A;  5FT3 A;  1XFL A;  3D4T A;  4I2U A;  4GLT A;  2VD1 A;  3DIE A;  4NV2 A;  2R37 A;  2GQK A;  3LG6 A;  2JSY A;  1ERV A;  1X5E A;  1THO A;  4JZQ A;  2VIM A;  2V6O A;  1OKT A;  2H6Y A;  1EWX A;  2C80 A;  3BBY A;  3LYP A;  2LNT A;  1F2E A;  1B8X A;  1J9B A;  3KMN A;  1PGT A;  4G19 A;  5D73 A;  2HSH A;  3FW2 A;  1NM3 A;  1T4Y A;  1TK8 B;  1YF0 A;  4BL7 A;  1SK0 A;  2AV4 A;  3FY7 A;  4EKZ A;  3F4S A;  3D0Z A;  2HSY A;  5GAN D;  5IM9 A;  1PL1 A;  5DAL B;  2AAW A;  1XWG A;  3BJ5 A;  4ID0 A;  3GNJ A;  3ZIJ A;  1PQN A;  2F8A A;  1B4P A;  4IW9 A;  1ILO A;  20GS A;  5CYY A;  4JR4 A;  3H4K A;  3GIX A;  3RPN A;  4WXT A;  2MBS A;  4AJ7 A;  2HZF A;  1SYX A;  1PRX A;  3EYT A;  4OFM A;  1LJR A;  1HD2 A;  3QR6 A;  4EE0 A;  3EU3 A;  2XHF A;  3D21 A;  5D8I A;  3CSH A;  5ELG A;  4F0B A;  4V2M A;  4EUY A;  2AJQ B;  3F8U A;  3IK9 A;  2H75 A;  1Z9H A;  5DCG A;  1V98 A;  2MMA A;  3DD3 A;  5E59 A;  1CQH A;  4WF5 A;  3QFA C;  3TJB A;  4MJB A;  1FHE A;  2DJ2 A;  3VPT A;  4K1F A;  1TI1 A;  1ZMA A;  2KOK A;  4PXO A;  2PUK C;  3R2Q A;  3ZVJ D;  2X8C A;  5G5F A;  2K6V A;  8GSS A;  1GUK A;  2YNX A;  4WET A;  1OC3 A;  4HQS A;  1MDK A;  2H66 A;  3LGC A;  3HCZ A;  3M1G A;  4DSS B;  5ECM B;  1MD4 A;  2CVK A;  2XBQ A;  4RI7 A;  2LEG A;  4EC0 A;  3ISO A;  5G30 A;  2RII A;  4I8B A;  3L9S A;  3LOR A;  1Z6N A;  2A2R A;  2OBI A;  2H73 A;  1TW9 A;  2WS2 A;  2GLR A;  1F9M A;  4OO4 A;  4EXJ A;  3C7M A;  1SYR A;  1T8E B;  2VCV A;  4AGS A;  4MF6 A;  2JZS A;  4PUF C;  4TR1 B;  2TRC P;  2VOC A;  3UOM A;  3UVT A;  4N0V A;  3GKK A;  2H01 A;  2D2Z A;  2G0F A;  1SD9 A;  3NOF A;  3FRC A;  2LRC A;  2CAI A;  2DSA A;  2CVB A;  3KJY A;  5G5E A;  3HDC A;  4GSN A;  1QFN A;  5JWR B;  3CRT A;  5HQP A;  3O76 A;  3QPM A;  4HQZ A;  18GS A;  2VL2 C;  4MPF A;  2HLS A;  1EEJ A;  1O6J A;  3O6T A;  6GSU A;  5H5Q A;  3KH7 A;  3APO A;  3CYN A;  3LYK A;  3FK8 A;  2Z9S A;  5HFG A;  2QGV A;  3GKX A;  5F05 A;  5DAK A;  3G7Y A;  3UBK A;  3ZLP A;  1AQW A;  5D93 A;  3LEF A;  4FH8 A;  1FAA A;  1ZGN A;  1NHO A;  3IOS A;  5H5R A;  2H0G A;  3P7X A;  4AF2 A;  3F6F A;  1SU9 A;  1ST9 A;  1SEN A;  1Z6M A;  1XW5 A;  1R5P A;  3GX0 A;  3KEB A;  5J5N A;  4MDC A;  1EP8 A;  2F9S A;  1MDI A;  3W8S A;  3Q19 A;  1EOH A;  3QAG A;  3GKN A;  3CXG A;  4GWR A;  1O8X A;  3KCM A;  3GH9 A;  1OC9 A;  5ECL B;  4TR4 A;  5D9X A;  2V41 A;  4EO3 A;  3EWL A;  2I1U A;  3GFK A;  1PD2 1;  4BVY A;  4Q5F A;  4BWQ A;  4L5L A;  3D4M A;  3FR6 A;  3ZZX A;  1SD8 A;  1XVQ A;  5J9C A;  1JLW A;  1TRS A;  5IMC A;  1GWC A;  3GUS A;  3HJM A;  2RUE A;  3L9U A;  1YKC A;  4K7N A;  4XS4 A;  4XIH A;  3KZQ A;  2PWJ A;  2N5F A;  2GZY A;  4K2D A;  1TRW A;  3GRX A;  1PX6 A;  4ACS A;  4V2L A;  1OYJ A;  4HI7 A;  1XOB A;  2WRT A;  5ECH B;  4ZB8 A;  4TW5 A;  1W89 A;  2I81 A;  3TJJ A;  1BED A;  4FYU A;  4ULX A;  4DSR A;  1PX7 A;  4KCA A;  2AYT A;  1M7T A;  4ZL8 A;  5IMA A;  1XW6 A;  2LJA A;  3DML A;  1PN9 A;  3M9K A;  2V2G A;  3IV4 A;  5ABR A;  1VGL A;  2V32 A;  3GTU A;  2KP2 A;  3EVI A;  2CX3 A;  3FZA A;  3HJO A;  2LQQ A;  5ECN B;  4KDU A;  4QL9 A;  1GSQ A;  1JLV A;  1C72 A;  4HU7 A;  1GSE A;  1ZYQ B;  3IRA A;  3HZ4 A;  5IMV A;  2C0D A;  3IPZ A;  5KN3 A;  2A4V A;  4IGJ A;  2FCH A;  1KEB A;  3C1R A;  3ERW A;  5ID2 B;  3TKQ A;  1ERT A;  5JCU A;  5EPF A;  4XS1 A;  5IMD A;  1DE2 A;  1GL8 A;  1HYU A;  5KN2 A;  2JZR A;  1PSQ A;  1KNG A;  4POB A;  1MTC A;  5JWO B;  2YV7 A;  3I43 A;  2I9H A;  1XWA A;  2K8V A;  4TXO B;  5IPH A;  3F3Q A;  6GSV A;  3I6A A;  3EIN A;  5HR2 A;  1SK2 A;  3G9B A;  3RHB A;  4GXZ A;  4N0Z A;  4GRF A;  3DWV A;  3VWV A;  4EVM A;  3H1N A;  1GUL A;  3GSS A;  2B3S A;  2DBC A;  4XRA A;  4BPY A;  3A2V A;  3ERG A;  4HU9 A;  4NXI A;  5J3R A;  1A23 A;  3GHA A;  1GTU A;  2F51 A;  5CO3 A;  2H0H A;  2N5B A;  3VUR A;  3U5R E;  3N5O A;  2PBJ A;  4LL1 B;  1OE7 A;  1USB A;  5G31 A;  3D6I A;  5AIS A;  3DRN A;  1E6B A;  2YCD A;  4POM A;  2EIR A;  3BD2 A;  3IHQ A;  2OE3 A;  4RUV A;  3WYW A;  3M9J A;  4MH2 A;  4JE1 A;  1Y25 A;  3RPP A;  2ON5 A;  2VD0 A;  3KTL A;  4G2E A;  2MZC A;  4ML1 A;  4NPB A;  4I2T A;  5KN0 A;  1A0F A;  3TJF A;  4ZBA A;  3IAM 2;  4HEA 2;  3Q18 A;  3L0H A;  1GH2 A;  3BCK A;  1JHB A;  2K18 A;  5CRG A;  4L0W A;  3TDG A;  4WR4 A;  2VCX A;  1YZX A;  3TRP A;  2R4V A;  3F0I A;  3ME8 A;  2O87 A;  2FA8 A;  2VCT A;  4MZC A;  4ZIJ A;  4KAE A;  2DJK A;  2MMO A;  4MA9 A;  1A24 A;  5HR1 A;  1XBS A;  1O8W A;  4XRD A;  1SJ6 A;  5ENU A;  5DDL A;  5KN1 A;  1YEP A;  2YWI A;  4EDY A;  3GL5 A;  1SL1 B;  3IK7 A;  4AJ8 A;  4F0C A;  1S3C A;  3A2X A;  2KLX A;  2O89 A;  3LQ7 A;  3MSZ A;  2C0E A;  1EV4 A;  4ILF A;  2LJR A;  4KX4 A;  1FVJ A;  2PGT A;  1TJD A;  4WEY A;  4IJI A;  1A2L A;  2OE0 A;  1U87 A;  2X8G A;  1M0U A;  3HJP A;  1Z3E A;  2EC4 A;  1QQ2 A;  1HQO A;  1V40 A;  5G1K A;  5D9T A;  1H75 A;  1H4O A;  2V6K A;  1NHY A;  3UEM A;  1TRV A;  3VWU A;  2GDR A;  2C0F A;  2GZP A;  5CRD A;  3QCP A;  1EV9 A;  3H79 A;  3VPQ A;  2I3Y A;  3A2W A;  3ZIT A;  4KDX A;  3IXR A;  2DJ3 A;  3S9F A;  1PMT A;  3PR8 A;  13GS A;  4NV5 A;  3LJR A;  2I4A A;  4I6X A;  4KUN A;  2HRF A;  1FB6 A;  1FOV A;  1N8J A;  2HFD A;  1ABA A;  2FWF A;  5DAL A;  4KSM A;  1X5C A;  4IEL A;  2WCI A;  2DLX A;  3LWA A;  4IS0 A;  4EL1 A;  4DSQ A;  22GS A;  2LJK A;  2L4Q A;  1I9D A;  2WJU A;  3L4N A;  1M99 A;  2A2S A;  3GX8 A;  2MBT A;  2P31 A;  4E8H A;  1EGO A;  2FWG A;  3RHC A;  2GS3 A;  4ZL7 A;  2FHE A;  1R26 A;  1ZOF A;  2MMN A;  2RM5 A;  1UA5 A;  3DKS A;  3TOT A;  2KHP A;  1FO5 A;  5J9B A;  2LNS A;  2X64 A;  3TJG A;  2NTO A;  2VUP A;  5DJL A;  3FR3 A;  4OFT A;  3TUE A;  3SBC A;  2IME A;  4Z7X A;  1VF4 A;  4Q5Q A;  3QFB C;  1EGR A;  3KH9 A;  3VLN A;  3ME7 A;  2R6K A;  5CRH A;  6GSS A;  5DJM A;  2IL3 A;  3BOA A;  3KM6 A;  3ZRE A;  1M2A A;  1YEX A;  3FEU A;  5IIZ A;  5F06 A;  2E2G A;  3CSI A;  1DBY A;  3FHK A;  1TRU A;  1UVZ A;  3HYP A;  4MCU A;  2HZE B;  3O3T A;  3LXT A;  4KGI A;  5J41 A;  2IMF A;  4TKY A;  4WF4 A;  4L0U A;  4IVF A;  6GSW A;  5FWG A;  1CQG A;  1X9W B;  4K8M A;  4PUR A;  2F3M A;  1URM A;  2YZH A;  2VM1 A;  1HNC A;  4JR6 A;  5IO2 A;  4ML6 A;  1GTI A;  4TR3 A;  2PPT A;  3NIV A;  4ZBB A;  4JU5 A;  4TR1 A;  3CTG A;  1XZO A;  4ECJ A;  4D73 B;  5EY6 A;  1B48 A;  4E8E A;  3HVV A;  2H76 A;  2VL9 A;  2YZU A;  2GGT A;  2VAF A;  4WBR D;  4MP4 A;  3BCI A;  5DQS A;  1E2Y A;  2HXK A;  4PGT A;  1ZYE A;  3G7I A;  2HRN A;  2C0G A;  2BMX A;  4CW9 A;  1ML6 A;  4KE3 A;  2ALB A;  1S3D A;  2B1K A;  3EU4 A;  12GS A;  1WMJ A;  2REM A;  1A2J A;  3RDW A;  2H8L A;  1ZL9 A;  5DQY A;  4EDZ A;  3F63 A;  3DXB A;  1W4V A;  1SKW B;  1T1V A;  1TTZ A;  3Q74 A;  3P90 A;  4ZL9 A;  4PX1 A;  3TRQ A;  4YQU A;  2JU5 A;  5IMF A;  1V57 A;  4DEJ A;  3SWL A;  4NHZ A;  2OKA A;  5FHI A;  1I5G A;  1TI3 A;  2YP6 A;  2CZ3 A;  2RLI A;  2ZUP A;  3CSJ A;  4NHW A;  4X43 A;  2KP1 A;  2WFC A;  1DSB A;  4JBB A;  1J0F A;  3US3 A;  1OC9 B;  4X0X A;  1SL0 B;  2H1B A;  2PVQ A;  3GYK A;  5D9W A;  1WRY A;  1EP7 A;  2IFQ B;  3GN3 A;  2O8V B;  4O7H A;  4K7I A;  3KIJ A;  2CAQ A;  4PNF A;  1BX9 A;  2LST A;  2HYX A;  4MZW A;  4XHM A;  1A2M A;  1FVK A;  1OKD A;  1GSU A;  5IO0 A;  3DVW A;  2KUC A;  2M72 A;  1G6W A;  3LXZ A;  2XPD A;  1AUC A;  2JZT A;  4DVC A;  4XS4 B;  4PNG A;  5ECP B;  1AQV A;  1AIU A;  2E2M A;  3LSZ A;  1A8L A;  5IMZ A;  1TU7 A;  3H8Q A;  9GSS A;  2JSZ A;  1U3A A;  2VLV A;  2OAC A;  2O85 A;  3HXS A;  2H1G A;  4HDE A;  2CV4 A;  2G2Q A;  1G7E A;  5AGY A;  3L78 A;  2DMM A;  1M2D A;  3IR4 A;  2L5O A;  4J57 E;  4ZIL A;  4KSO A;  5GST A;  2X8H A;  1XWC A;  3PIN A;  5DBQ A;  4GSS A;  1GSD A;  3WT2 A;  3P8W A;  5CAX A;  1M2B A;  3ZRD A;  5F0G A;  2IWT A;  1ON4 A;  1RW1 A;  4PQI A;  2LRT A;  19GS A;  3EE2 A;  1GUM A;  5ELA A;  5AIX A;  4G10 A;  4TR0 A;  2H71 A;  1K0N A;  5KEJ A;  2OBK A;  3IDV A;  5JWQ B;  1IYH A;  5JCG A;  1T7P B;  2VLU A;  3FZ4 A;  3A5W A;  1GSF A;  1IYI A;  2LKU A;  1U88 A;  1J08 A;  3C71 A;  3RAZ A;  1GTB A;  2AHE A;  2CA8 A;  3C8E A;  1OC8 A;  5GSS A;  3ZFL A;  1R5A A;  3GST A;  4IJ3 A;  3HD5 A;  5IOX A;  3GH6 A;  4MZB A;  3FZ9 A;  3FR9 A;  1UN2 A;  5ECS A;  2ZNM A;  4HZ2 A;  1ERW A; 
#chains in the Genus database with same CATH topology
 2L6C A;  2P5Q A;  4K9Z A;  2V1M A;  2TIR A;  2DKI A;  4F82 A;  1B9X C;  4G9H A;  1X0R A;  2PMT A;  3GV1 A;  1YY7 A;  1AXD A;  5B8A A;  3VI5 A;  3A5I A;  7GSS A;  5ECQ B;  3TKP A;  5INY A;  1GTA A;  1Z7R A;  2OE1 A;  4AJ6 A;  2HI7 A;  3C1S A;  2H72 A;  4N11 A;  1K0A A;  4K0N A;  3ZML A;  1PKW A;  2YAN A;  3KP8 A;  4MJC A;  2YJH A;  1TP9 A;  1K0C A;  4USS A;  3IC4 A;  2H19 A;  4IHU A;  3IBH A;  4OCF A;  4MLY A;  4IP6 A;  3WGD A;  3FKF A;  5B6M A;  14GS A;  4IQ1 A;  4TOP A;  2P0G A;  3QAV A;  1OVN A;  1TU8 A;  1GLP A;  2GZZ A;  1ERU A;  1TDI A;  3J7Y k;  4MH3 A;  4FYC A;  2H70 A;  3ZVJ A;  2IMK A;  2PVO C;  5D96 A;  3UIW A;  3FYG A;  5H5S A;  4POL A;  2VO4 A;  4V1A g;  1GP1 A;  2NDO A;  4LL4 B;  3UAR A;  1ZZY A;  4LLR A;  1EOG A;  4KCE A;  2FY6 A;  4XTS A;  1O73 A;  1V9W A;  4YQV A;  4IN0 A;  4BIK A;  2MYG A;  4NAX A;  2O7K A;  3UBL A;  1JZW A;  2H1D A;  5GZZ B;  1HNA A;  2LS5 A;  1N2A A;  2FNO A;  4QL7 A;  3M3M A;  3ZMK A;  3ZTL A;  2OJL A;  2YWO A;  2ON7 A;  6GST A;  10GS A;  1K3O A;  1JZD A;  1TXX A;  2MMZ A;  3F3R A;  3KD0 A;  2HE3 A;  2FWH A;  5LNK e;  3WGX A;  5COH A;  1X9S B;  1NW2 A;  2C8U A;  3QOU A;  1K0B A;  1JFU A;  3DVX A;  2PU9 C;  1BG5 A;  1WPI A;  4TRX A;  2P5R A;  3H93 A;  4LA1 A;  1G6Y A;  1PFO A;  1AQX A;  4K7O A;  2FUG 2;  5D9V A;  4Z2R A;  5CNW A;  2GTU A;  3HVS A;  5L71 A;  2B7K A;  1LU4 A;  2WZ9 A;  5E4W A;  3C73 A;  1PL2 A;  1DUG A;  4JED A;  4Q5R A;  2HNL A;  4N30 A;  4HOJ A;  2C3Q A;  1WP0 A;  2BTO T;  2VM2 A;  1GNW A;  4L8E A;  4XS6 A;  1SK1 A;  2GQL A;  3TKS E;  2CVD A;  3P2A A;  5HR0 A;  1AAZ A;  4GF0 A;  3VWX A;  3QAW A;  2L4C A;  3RBT A;  3MWH A;  4PUA A;  2WDU A;  2OA7 A;  4BL7 B;  2FD3 A;  3TB2 A;  1T3B A;  5B7C A;  1ZYP A;  2GT5 A;  3MYD A;  5LCZ A;  2GSS A;  2AB6 A;  1SJI A;  1YDK A;  4I5Q A;  1FG4 A;  2LV3 A;  1O7U A;  3F4R A;  3ED3 A;  1XOA A;  4KF9 A;  3ZIV A;  4F2I A;  4Z2U A;  2DC5 A;  4KDY A;  5ECO B;  5G1L A;  5HR3 A;  2JAC A;  1GSS A;  2RUF A;  1TKD B;  2BJX A;  5DCH A;  3PPU A;  2R5G A;  1VF3 A;  4WKW A;  2QC7 A;  1ACV A;  3VWW A;  1BAY A;  4JRR A;  5KOX A;  2WUL A;  1K0D A;  4BA7 A;  2DML A;  1R4W A;  2GSR A;  3PGT A;  2YJ7 A;  1Z7P A;  3TKS A;  1YQ1 A;  1A8Y A;  2R0P A;  3E9J B;  2C3T A;  2PN8 A;  5J4U A;  2EIQ A;  1VF2 A;  4ECI A;  1Y6E A;  4RI6 A;  1O85 A;  1K3L A;  3V1W A;  5IOW A;  3HVN A;  4CDO A;  1TK0 B;  1WOU A;  2J9H A;  5CRW A;  4MJE A;  2DJ1 A;  3L9V A;  5B6N A;  2DIZ A;  5CP1 A;  1SL2 B;  5AIV A;  1V2A A;  1XW9 A;  4PQH A;  6GSY A;  1GRX A;  4ZB6 A;  1F37 A;  3N9J A;  5EVO A;  4K2X A;  2F8F A;  1QMV A;  4HJ2 A;  5IPG A;  3I69 A;  2OAD A;  2FGX A;  3PH9 A;  4DSS A;  2LRN A;  1QXH A;  1Q98 A;  2HZE A;  3JCM L;  4IBP A;  3HZ8 A;  5F07 A;  4QQ7 A;  2M46 A;  2K8S A;  1GSY A;  2E7P A;  1G7O A;  1M9A A;  5A5K A;  3KTB A;  1HNB A;  3NZN A;  1SKS B;  4YAV A;  1EEM A;  3I9V 2;  1XCC A;  2YN1 A;  4HS1 A;  3D5J A;  1B4Q A;  3MNG A;  1FB0 A;  3G7J A;  1GNE A;  3GKM A;  5LD0 A;  2VLT A;  1TK5 B;  1UC7 A;  1XXU A;  3UL3 A;  2CZ2 A;  3OR5 A;  5B8B A;  1G0T A;  1MEK A;  4POK A;  3ZYW A;  3GL3 A;  1M3I A;  1AW9 A;  4Q5N A;  1PA3 A;  3WD6 A;  4LMV A;  4D73 A;  3TJK A;  4HUA A;  3CMI A;  2IN3 A;  2JAD A;  3QDN A;  4PQ1 A;  2LQO A;  4GQC A;  5HFI A;  4BVX A;  2LTK A;  2IIY A;  5DAK B;  4KW6 A;  4F9Z A;  3EC3 A;  1T00 A;  2CX4 A;  2GSQ A;  1V58 A;  1XIY A;  4GCI A;  2YWM A;  4MF7 A;  3UVH A;  2DJJ A;  2N5A A;  2CT6 A;  4N10 A;  5C00 A;  2X99 A;  4KB3 A;  3E0U A;  2HSM A;  4P3Y B;  3IHG A;  3E3E A;  4V1A p;  3R3E A;  4RQX A;  3QD9 A;  2DJ0 A;  4HJM A;  4ZB9 A;  4ECC A;  1S3A A;  1RK4 A;  2GVP A;  4IP1 A;  2GT6 A;  4OO5 A;  5EL8 A;  1QK8 A;  2HRK A;  1WIK A;  3EMX A;  2AUV A;  3K8N A;  1ZYN A;  1THX A;  1EZK A;  4NWY A;  3VK9 A;  1VRS D;  2C1Y A;  2ZCT A;  3VI7 A;  1XWK A;  3KMO A;  5BRT A;  1SKR B;  3DGQ A;  4MMM A;  2L57 A;  3TGZ A;  5IQY A;  4BVY B;  3DEX A;  5F8B A;  1VF1 A;  5BMU A;  3LFL A;  4XCS A;  5HFK A;  4K5S A;  4ZBD A;  3J7Y b;  1KTE A;  2H0I A;  5DVB A;  2QSI A;  4ECB A;  3KP9 A;  2IFQ A;  1K3Y A;  3HY2 A;  3KGK A;  3ZFB A;  2WGR A;  4NMU A;  1T4Z A;  4TVE A;  1QGV A;  2B6M A;  5A4U A;  1BYE A;  1RQM A;  4L5O A;  1WJK A;  1OAZ A;  3IE3 A;  2WB9 A;  3HHV A;  2XPE A;  4G0K A;  4LMW A;  4X1U A;  3UMA A;  3IAS 2;  1NSW A;  16GS A;  4FIW A;  2IPA A;  1KBN A;  4KA0 A;  4YH2 A;  4IKH A;  3D22 A;  4YQM A;  1WE0 A;  2B5X A;  2J23 A;  2PER A;  1XWB A;  4FYB A;  2E0Q A;  2H6Z A;  4GTU A;  2HT9 A;  3QMX A;  11GS A;  2YWN A;  1DE1 A;  2XBI A;  2FA4 A;  4OFN A;  4O92 A;  3TRX A;  2CQ9 A;  3FZ5 A;  3GTU B;  2R0C A;  2H6X A;  2B7J A;  2M80 A;  1GUH A;  2VCQ A;  3A3T A;  4CHS A;  4GQF A;  1F6M C;  1K0M A;  4GST A;  3ZL5 A;  2ES7 A;  3KXO A;  2IJY A;  5JCW A;  3F4T A;  1U3I A;  4I97 A;  2L59 A;  3W8J A;  2NVL A;  1YKA A;  2RM6 A;  2VCW A;  1JZO A;  5AN1 A;  3GUR A;  1B9Y C;  2VL2 A;  5ECI B;  4CY8 A;  4KH7 A;  2L6D A;  3APQ A;  1ZCP A;  2C3N A;  3DYR A;  2K9F A;  2YOI A;  1O81 A;  3IA1 A;  4OCE A;  3TKR A;  2YV9 A;  2IMD A;  4TXV A;  4O32 A;  2VL3 A;  2NBS A;  4TN8 A;  2JL4 A;  5ID2 A;  2XC2 A;  3CRU A;  5ECK B;  5G2Z A;  2H30 A;  2L5L A;  2NPB A;  4EF0 A;  2YPM A;  3VFI A;  2FLS A;  1TOF A;  5A4V A;  4O5Q A;  1WWJ A;  1X9M B;  4RQR A;  1XVW A;  2X49 A;  1Z5Y E;  4OD7 A;  6GSX A;  4IQA A;  2H1A A;  4MAB A;  3UJ1 A;  3CBU A;  1AC1 A;  5ECR B;  3GMF A;  3HKR A;  2FWE A;  4J56 E;  3EMP A;  4TXO A;  4G0I A;  2GQM A;  1F3B A;  1F3A A;  3F9U A;  5C04 A;  2H74 A;  5A4W A;  4J2F A;  5CRE A;  4K5R A;  4MPG A;  4YKG A;  3AY8 A;  3U6V A;  3WT1 A;  2A4H A;  1X5D A;  4OMV A;  3EUR A;  2B1L A;  4ISD A;  1QUW A;  2QA1 A;  2DIY A;  2TRX A;  2LUS A;  4OWY A;  1LBK A;  3TKS C;  4YAP A;  3HVX A;  1R7H A;  4K0G A;  4FO5 A;  2R2J A;  1U6T A;  4K6X A;  4BWS A;  1OE8 A;  4MJA A;  3Q6O A;  4MK3 A;  4KND A;  1MD3 A;  3APS A;  1XPV A;  1K0O A;  1Q4J A;  3MAK A;  3HA9 A;  1FW1 A;  2B5Y A;  1YF1 A;  1M9B A;  1GLQ A;  3TCO A;  5GAP D;  3CTF A;  2VCZ A;  4HZ4 A;  2C4J A;  3TOU A;  3ERF A;  4ZXG A;  1A0R P;  4V2N A;  3M0F A;  3UAP A;  3WGE A;  4H86 A;  4MNN A;  4F03 A;  4WR5 A;  3MDK A;  3F6D A;  2R3X A;  4O5R A;  2QKE A;  4WBJ A;  2B5E A;  1JZR A;  3GA4 A;  1BJX A;  1PKZ A;  1YJ6 A;  1BQ7 A;  2GST A;  4MF5 A;  3W6G A;  1SJZ A;  2EIO A;  1MDJ A;  2IMI A;  3M8N A;  17GS A;  5FT3 A;  1XFL A;  3D4T A;  4I2U A;  4GLT A;  2VD1 A;  3DIE A;  4NV2 A;  2R37 A;  2GQK A;  3LG6 A;  2JSY A;  1ERV A;  1X5E A;  1S3R A;  1THO A;  4JZQ A;  2VIM A;  2V6O A;  1OKT A;  2H6Y A;  1EWX A;  2C80 A;  3BBY A;  3LYP A;  2LNT A;  1F2E A;  1B8X A;  1J9B A;  3KMN A;  1PGT A;  4G19 A;  5D73 A;  2HSH A;  3FW2 A;  1NM3 A;  1T4Y A;  1FOH A;  1TK8 B;  1YF0 A;  4BL7 A;  1SK0 A;  2AV4 A;  3FY7 A;  4EKZ A;  3F4S A;  3D0Z A;  2HSY A;  5GAN D;  5IM9 A;  1PL1 A;  5DAL B;  2AAW A;  1XWG A;  3BJ5 A;  4ID0 A;  3GNJ A;  3ZIJ A;  1PQN A;  2F8A A;  1B4P A;  4IW9 A;  1ILO A;  20GS A;  5CYY A;  4JR4 A;  3H4K A;  3GIX A;  3RPN A;  4WXT A;  2MBS A;  4AJ7 A;  2HZF A;  1SYX A;  1PRX A;  3EYT A;  4OFM A;  1LJR A;  1HD2 A;  3QR6 A;  4EE0 A;  3EU3 A;  2XHF A;  3D21 A;  5D8I A;  3CSH A;  5ELG A;  4F0B A;  4V2M A;  4EUY A;  2AJQ B;  3F8U A;  3IK9 A;  2H75 A;  1Z9H A;  5DCG A;  1V98 A;  2MMA A;  3DD3 A;  5E59 A;  1CQH A;  4WF5 A;  3QFA C;  3TJB A;  4MJB A;  1FHE A;  2DJ2 A;  3VPT A;  4K1F A;  1TI1 A;  1ZMA A;  2KOK A;  4PXO A;  2PUK C;  3R2Q A;  3ZVJ D;  2X8C A;  5G5F A;  2K6V A;  8GSS A;  2A2P A;  1GUK A;  2YNX A;  4WET A;  1OC3 A;  3LW9 A;  4HQS A;  4Z2T A;  1MDK A;  2H66 A;  3LGC A;  3HCZ A;  3M1G A;  4DSS B;  5ECM B;  1MD4 A;  2CVK A;  2XBQ A;  4RI7 A;  2LEG A;  4EC0 A;  3ISO A;  4ICY A;  5G30 A;  2RII A;  4I8B A;  3L9S A;  3LOR A;  1Z6N A;  2A2R A;  2OBI A;  2H73 A;  1TW9 A;  2WS2 A;  2GLR A;  1F9M A;  4OO4 A;  4EXJ A;  3C7M A;  1SYR A;  1T8E B;  2VCV A;  4AGS A;  4MF6 A;  2JZS A;  4PUF C;  4TR1 B;  2TRC P;  2VOC A;  3UOM A;  3UVT A;  4N0V A;  3GKK A;  2H01 A;  2D2Z A;  2G0F A;  1SD9 A;  3NOF A;  3FRC A;  2LRC A;  2CAI A;  2DSA A;  2CVB A;  3KJY A;  5G5E A;  3HDC A;  4GSN A;  1QFN A;  5JWR B;  3CRT A;  5HQP A;  3O76 A;  3QPM A;  4HQZ A;  18GS A;  2VL2 C;  4MPF A;  2HLS A;  1EEJ A;  1O6J A;  3O6T A;  6GSU A;  5H5Q A;  3KH7 A;  3APO A;  3CYN A;  3LYK A;  3FK8 A;  2Z9S A;  5HFG A;  2QGV A;  3GKX A;  5F05 A;  5DAK A;  3G7Y A;  3UBK A;  3ZLP A;  1AQW A;  5D93 A;  3LEF A;  4FH8 A;  1FAA A;  1ZGN A;  1NHO A;  3IOS A;  5H5R A;  4A5P A;  2H0G A;  3P7X A;  4AF2 A;  3F6F A;  1SU9 A;  2DKH A;  1ST9 A;  1SEN A;  1Z6M A;  1XW5 A;  1R5P A;  3GX0 A;  3KEB A;  5J5N A;  4MDC A;  1EP8 A;  2F9S A;  1MDI A;  3W8S A;  3Q19 A;  1EOH A;  3QAG A;  3GKN A;  3CXG A;  4GWR A;  1O8X A;  3KCM A;  3GH9 A;  1OC9 A;  5ECL B;  4TR4 A;  5D9X A;  2V41 A;  4EO3 A;  3EWL A;  2I1U A;  3GFK A;  1PD2 1;  4BVY A;  4Q5F A;  4BWQ A;  4L5L A;  3D4M A;  1PN0 A;  3FR6 A;  3ZZX A;  1SD8 A;  1XVQ A;  5J9C A;  1JLW A;  1TRS A;  4O5U A;  5IMC A;  1GWC A;  3GUS A;  3HJM A;  2RUE A;  3L9U A;  1YKC A;  4K7N A;  4XS4 A;  4XIH A;  3KZQ A;  2PWJ A;  2N5F A;  2GZY A;  4K2D A;  1TRW A;  3GRX A;  1PX6 A;  4ACS A;  4V2L A;  1OYJ A;  4HI7 A;  1XOB A;  2WRT A;  5ECH B;  4ZB8 A;  4FQU A;  4TW5 A;  1W89 A;  2I81 A;  3TJJ A;  2R0G A;  1XG8 A;  1BED A;  4FYU A;  4ULX A;  4DSR A;  1PX7 A;  4KCA A;  2AYT A;  1M7T A;  4ZL8 A;  5IMA A;  1XW6 A;  2LJA A;  3DML A;  1PN9 A;  3M9K A;  2V2G A;  3IV4 A;  5ABR A;  1VGL A;  2V32 A;  3GTU A;  2KP2 A;  3EVI A;  2CX3 A;  3FZA A;  3HJO A;  2LQQ A;  5ECN B;  4EIQ A;  4KDU A;  4QL9 A;  1GSQ A;  1JLV A;  1C72 A;  4HU7 A;  1GSE A;  1ZYQ B;  1M3J A;  3IRA A;  3HZ4 A;  5IMV A;  2C0D A;  3IPZ A;  5KN3 A;  2A4V A;  4IGJ A;  2FCH A;  1KEB A;  3C1R A;  3ERW A;  5ID2 B;  3TKQ A;  1ERT A;  5JCU A;  5KOW A;  5EPF A;  4XS1 A;  5IMD A;  1DE2 A;  1GL8 A;  1HYU A;  5KN2 A;  2JZR A;  1PSQ A;  1KNG A;  4POB A;  1MTC A;  5JWO B;  2YV7 A;  3I43 A;  2I9H A;  1XWA A;  2K8V A;  4TXO B;  5IPH A;  3F3Q A;  6GSV A;  3I6A A;  3EIN A;  5HR2 A;  1SK2 A;  3G9B A;  3RHB A;  4GXZ A;  4N0Z A;  4GRF A;  3DWV A;  3VWV A;  4EVM A;  3H1N A;  1GUL A;  3GSS A;  2B3S A;  2DBC A;  4XRA A;  4BPY A;  3A2V A;  3ERG A;  4HU9 A;  4NXI A;  5J3R A;  1A23 A;  3GHA A;  1GTU A;  2F51 A;  5CO3 A;  2H0H A;  2N5B A;  3VUR A;  3U5R E;  3N5O A;  2PBJ A;  4LL1 B;  1OE7 A;  1USB A;  5G31 A;  3D6I A;  5AIS A;  3DRN A;  1E6B A;  2YCD A;  4POM A;  2EIR A;  3BD2 A;  3IHQ A;  2OE3 A;  4RUV A;  3WYW A;  3M9J A;  3EPT A;  4MH2 A;  4JE1 A;  1Y25 A;  3RPP A;  2ON5 A;  2VD0 A;  3KTL A;  4G2E A;  2MZC A;  4ML1 A;  4NPB A;  4I2T A;  5KN0 A;  1A0F A;  3TJF A;  4ZBA A;  3IAM 2;  4HEA 2;  3Q18 A;  3L0H A;  1GH2 A;  3BCK A;  1JHB A;  2K18 A;  5CRG A;  4L0W A;  3TDG A;  4WR4 A;  2VCX A;  1YZX A;  3TRP A;  2R4V A;  3F0I A;  3ME8 A;  2O87 A;  2FA8 A;  2VCT A;  4MZC A;  4ZIJ A;  4KAE A;  2DJK A;  2MMO A;  4MA9 A;  1A24 A;  5HR1 A;  1XBS A;  1O8W A;  4XRD A;  1SJ6 A;  5ENU A;  5DDL A;  5KN1 A;  1YEP A;  2YWI A;  4EDY A;  3GL5 A;  1SL1 B;  3IK7 A;  4AJ8 A;  4F0C A;  1S3C A;  3A2X A;  2KLX A;  2O89 A;  3LQ7 A;  3MSZ A;  2C0E A;  1EV4 A;  4ILF A;  2LJR A;  4KX4 A;  1FVJ A;  2PGT A;  1TJD A;  4WEY A;  4IJI A;  1A2L A;  2OE0 A;  1U87 A;  2X8G A;  1M0U A;  3HJP A;  1Z3E A;  2EC4 A;  1QQ2 A;  1HQO A;  1V40 A;  5G1K A;  5D9T A;  1H75 A;  1H4O A;  2V6K A;  1NHY A;  3UEM A;  1TRV A;  3VWU A;  2GDR A;  2C0F A;  2GZP A;  5CRD A;  3QCP A;  2X4A A;  1EV9 A;  3H79 A;  4YKF A;  3VPQ A;  4G0L A;  2I3Y A;  3A2W A;  3ZIT A;  4KDX A;  3IXR A;  2DJ3 A;  3S9F A;  1PMT A;  3PR8 A;  13GS A;  4NV5 A;  3LJR A;  2I4A A;  4I6X A;  4KUN A;  2HRF A;  1FB6 A;  1FOV A;  1N8J A;  2HFD A;  1ABA A;  2FWF A;  5DAL A;  4KSM A;  1X5C A;  4IEL A;  2WCI A;  2DLX A;  3LWA A;  4IS0 A;  4EL1 A;  4DSQ A;  22GS A;  2LJK A;  2L4Q A;  1I9D A;  2WJU A;  3L4N A;  1M99 A;  2A2S A;  3GX8 A;  2MBT A;  2P31 A;  4E8H A;  1EGO A;  2FWG A;  3RHC A;  2GS3 A;  4ZL7 A;  2FHE A;  1R26 A;  1ZOF A;  2MMN A;  2RM5 A;  1UA5 A;  3DKS A;  3TOT A;  2KHP A;  1FO5 A;  5J9B A;  2LNS A;  2X64 A;  3TJG A;  2NTO A;  2VUP A;  5DJL A;  3FR3 A;  4OFT A;  3TUE A;  3SBC A;  2IME A;  4Z7X A;  1VF4 A;  4Q5Q A;  3QFB C;  4CY6 A;  1EGR A;  3KH9 A;  3VLN A;  3ME7 A;  2R6K A;  5CRH A;  6GSS A;  5DJM A;  2IL3 A;  3BOA A;  3KM6 A;  3ZRE A;  1M2A A;  1YEX A;  3FEU A;  5IIZ A;  5F06 A;  2E2G A;  3CSI A;  1DBY A;  3FHK A;  1TRU A;  1UVZ A;  3HYP A;  4MCU A;  2HZE B;  3O3T A;  3LXT A;  4KGI A;  5J41 A;  2IMF A;  4TKY A;  4WF4 A;  4L0U A;  4IVF A;  6GSW A;  5FWG A;  1CQG A;  1X9W B;  4K8M A;  4PUR A;  2F3M A;  1URM A;  2YZH A;  2VM1 A;  1HNC A;  4JR6 A;  5IO2 A;  4ML6 A;  1GTI A;  4TR3 A;  2PPT A;  3NIV A;  4PTS A;  4ZBB A;  4JU5 A;  4TR1 A;  3CTG A;  1XZO A;  4ECJ A;  4D73 B;  5EY6 A;  1B48 A;  4E8E A;  3HVV A;  2H76 A;  2VL9 A;  2YZU A;  2GGT A;  2VAF A;  4WBR D;  4BVX B;  4MP4 A;  3BCI A;  5DQS A;  1E2Y A;  2HXK A;  4PGT A;  1ZYE A;  2HRA A;  3G7I A;  2HRN A;  2C0G A;  2BMX A;  4CW9 A;  1ML6 A;  4KE3 A;  2ALB A;  1S3D A;  2B1K A;  3EU4 A;  12GS A;  1WMJ A;  2REM A;  1A2J A;  2QA2 A;  3RDW A;  2H8L A;  1ZL9 A;  5DQY A;  4EDZ A;  3F63 A;  3DXB A;  1W4V A;  1SKW B;  1T1V A;  1TTZ A;  3Q74 A;  3P90 A;  4ZL9 A;  4PX1 A;  3TRQ A;  4HSC X;  4YQU A;  2JU5 A;  5IMF A;  1V57 A;  4DEJ A;  3SWL A;  4NHZ A;  2OKA A;  5FHI A;  1I5G A;  1TI3 A;  2YP6 A;  2CZ3 A;  2RLI A;  2ZUP A;  3CSJ A;  4NHW A;  4X43 A;  2KP1 A;  2WFC A;  1DSB A;  4JBB A;  1J0F A;  3US3 A;  1OC9 B;  4X0X A;  1SL0 B;  2H1B A;  2PVQ A;  3GYK A;  5D9W A;  1WRY A;  1EP7 A;  2IFQ B;  3GN3 A;  2O8V B;  4O7H A;  4K7I A;  3KIJ A;  2UZ8 A;  2CAQ A;  4PNF A;  1BX9 A;  2LST A;  2HYX A;  4MZW A;  4XHM A;  3FMW A;  1A2M A;  1FVK A;  1OKD A;  1GSU A;  5IO0 A;  3IC8 A;  3DVW A;  2KUC A;  2M72 A;  1G6W A;  3LXZ A;  2XPD A;  1AUC A;  2JZT A;  4DVC A;  4XS4 B;  4PNG A;  5ECP B;  1AQV A;  1AIU A;  2E2M A;  3LSZ A;  1A8L A;  5IMZ A;  1TU7 A;  3H8Q A;  9GSS A;  2JSZ A;  1U3A A;  2VLV A;  2OAC A;  2O85 A;  3HXS A;  2H1G A;  4HDE A;  2CV4 A;  2G2Q A;  1G7E A;  5AGY A;  3L78 A;  2DMM A;  1M2D A;  3IR4 A;  4EIP A;  2L5O A;  4J57 E;  4ZIL A;  4KSO A;  5GST A;  2X8H A;  1XWC A;  4X4J A;  3PIN A;  5DBQ A;  4GSS A;  1GSD A;  3WT2 A;  3P8W A;  5CAX A;  1M2B A;  3CQF A;  3ZRD A;  5F0G A;  2IWT A;  1ON4 A;  1RW1 A;  4PQI A;  2LRT A;  19GS A;  3EE2 A;  1GUM A;  5ELA A;  5AIX A;  4G10 A;  4TR0 A;  2H71 A;  1K0N A;  5KEJ A;  2OBK A;  3IDV A;  5JWQ B;  1IYH A;  5JCG A;  1T7P B;  2VLU A;  3FZ4 A;  3A5W A;  1GSF A;  1IYI A;  2LKU A;  1U88 A;  1J08 A;  3C71 A;  3RAZ A;  1GTB A;  2AHE A;  2CA8 A;  3C8E A;  1OC8 A;  5GSS A;  3MIX A;  3ZFL A;  1R5A A;  3GST A;  4IJ3 A;  3HD5 A;  5IOX A;  3GH6 A;  4MZB A;  3FZ9 A;  3FR9 A;  1UN2 A;  5ECS A;  2ZNM A;  4HZ2 A;  1ERW A; 
#chains in the Genus database with same CATH homology
 2L6C A;  2P5Q A;  4K9Z A;  2V1M A;  2TIR A;  2DKI A;  4F82 A;  1B9X C;  4G9H A;  1X0R A;  2PMT A;  3GV1 A;  1YY7 A;  1AXD A;  5B8A A;  3VI5 A;  3A5I A;  7GSS A;  5ECQ B;  3TKP A;  5INY A;  1GTA A;  1Z7R A;  2OE1 A;  4AJ6 A;  2HI7 A;  3C1S A;  2H72 A;  4N11 A;  1K0A A;  4K0N A;  3ZML A;  1PKW A;  2YAN A;  3KP8 A;  4MJC A;  2YJH A;  1TP9 A;  1K0C A;  4USS A;  3IC4 A;  2H19 A;  4IHU A;  3IBH A;  4OCF A;  4MLY A;  4IP6 A;  3WGD A;  3FKF A;  5B6M A;  14GS A;  4IQ1 A;  4TOP A;  2P0G A;  3QAV A;  1OVN A;  1TU8 A;  1GLP A;  2GZZ A;  1ERU A;  1TDI A;  3J7Y k;  4MH3 A;  4FYC A;  2H70 A;  3ZVJ A;  2IMK A;  2PVO C;  5D96 A;  3UIW A;  3FYG A;  5H5S A;  4POL A;  2VO4 A;  4V1A g;  1GP1 A;  2NDO A;  4LL4 B;  3UAR A;  1ZZY A;  4LLR A;  1EOG A;  4KCE A;  2FY6 A;  4XTS A;  1O73 A;  1V9W A;  4YQV A;  4IN0 A;  2MYG A;  4NAX A;  2O7K A;  3UBL A;  1JZW A;  2H1D A;  5GZZ B;  1HNA A;  2LS5 A;  1N2A A;  2FNO A;  4QL7 A;  3M3M A;  3ZMK A;  3ZTL A;  2OJL A;  2YWO A;  2ON7 A;  6GST A;  10GS A;  1K3O A;  1JZD A;  1TXX A;  2MMZ A;  3F3R A;  3KD0 A;  2HE3 A;  2FWH A;  5LNK e;  3WGX A;  5COH A;  1X9S B;  1NW2 A;  2C8U A;  3QOU A;  1K0B A;  1JFU A;  3DVX A;  2PU9 C;  1BG5 A;  1WPI A;  4TRX A;  2P5R A;  3H93 A;  4LA1 A;  1G6Y A;  1AQX A;  4K7O A;  2FUG 2;  5D9V A;  4Z2R A;  5CNW A;  2GTU A;  3HVS A;  5L71 A;  2B7K A;  1LU4 A;  2WZ9 A;  5E4W A;  3C73 A;  1PL2 A;  1DUG A;  4JED A;  4Q5R A;  2HNL A;  4N30 A;  4HOJ A;  2C3Q A;  1WP0 A;  2BTO T;  2VM2 A;  1GNW A;  4L8E A;  4XS6 A;  1SK1 A;  2GQL A;  3TKS E;  2CVD A;  3P2A A;  5HR0 A;  1AAZ A;  4GF0 A;  3VWX A;  3QAW A;  2L4C A;  3RBT A;  3MWH A;  4PUA A;  2WDU A;  2OA7 A;  4BL7 B;  2FD3 A;  3TB2 A;  1T3B A;  5B7C A;  1ZYP A;  2GT5 A;  3MYD A;  5LCZ A;  2GSS A;  2AB6 A;  1SJI A;  1YDK A;  4I5Q A;  1FG4 A;  2LV3 A;  1O7U A;  3F4R A;  3ED3 A;  1XOA A;  4KF9 A;  3ZIV A;  4F2I A;  4Z2U A;  2DC5 A;  4KDY A;  5ECO B;  5G1L A;  5HR3 A;  2JAC A;  1GSS A;  2RUF A;  1TKD B;  2BJX A;  5DCH A;  3PPU A;  2R5G A;  1VF3 A;  4WKW A;  2QC7 A;  1ACV A;  3VWW A;  1BAY A;  4JRR A;  5KOX A;  2WUL A;  1K0D A;  4BA7 A;  2DML A;  1R4W A;  2GSR A;  3PGT A;  2YJ7 A;  1Z7P A;  3TKS A;  1YQ1 A;  1A8Y A;  2R0P A;  3E9J B;  2C3T A;  2PN8 A;  5J4U A;  2EIQ A;  1VF2 A;  4ECI A;  1Y6E A;  4RI6 A;  1O85 A;  1K3L A;  3V1W A;  5IOW A;  4CDO A;  1TK0 B;  1WOU A;  2J9H A;  5CRW A;  4MJE A;  2DJ1 A;  3L9V A;  5B6N A;  2DIZ A;  5CP1 A;  1SL2 B;  5AIV A;  1V2A A;  1XW9 A;  4PQH A;  6GSY A;  1GRX A;  4ZB6 A;  1F37 A;  3N9J A;  5EVO A;  4K2X A;  2F8F A;  1QMV A;  4HJ2 A;  5IPG A;  3I69 A;  2OAD A;  2FGX A;  3PH9 A;  4DSS A;  2LRN A;  1QXH A;  1Q98 A;  2HZE A;  3JCM L;  4IBP A;  3HZ8 A;  5F07 A;  4QQ7 A;  2M46 A;  2K8S A;  1GSY A;  2E7P A;  1G7O A;  1M9A A;  5A5K A;  3KTB A;  1HNB A;  3NZN A;  1SKS B;  4YAV A;  1EEM A;  3I9V 2;  1XCC A;  2YN1 A;  4HS1 A;  3D5J A;  1B4Q A;  3MNG A;  1FB0 A;  3G7J A;  1GNE A;  3GKM A;  5LD0 A;  2VLT A;  1TK5 B;  1UC7 A;  1XXU A;  3UL3 A;  2CZ2 A;  3OR5 A;  5B8B A;  1G0T A;  1MEK A;  4POK A;  3ZYW A;  3GL3 A;  1AW9 A;  4Q5N A;  1PA3 A;  3WD6 A;  4LMV A;  4D73 A;  3TJK A;  4HUA A;  3CMI A;  2IN3 A;  2JAD A;  3QDN A;  4PQ1 A;  2LQO A;  4GQC A;  5HFI A;  4BVX A;  2LTK A;  2IIY A;  5DAK B;  4KW6 A;  4F9Z A;  3EC3 A;  1T00 A;  2CX4 A;  2GSQ A;  1V58 A;  1XIY A;  4GCI A;  2YWM A;  4MF7 A;  3UVH A;  2DJJ A;  2N5A A;  2CT6 A;  4N10 A;  5C00 A;  2X99 A;  4KB3 A;  3E0U A;  2HSM A;  4P3Y B;  3IHG A;  3E3E A;  4V1A p;  3R3E A;  4RQX A;  3QD9 A;  2DJ0 A;  4HJM A;  4ZB9 A;  4ECC A;  1S3A A;  1RK4 A;  2GVP A;  4IP1 A;  2GT6 A;  4OO5 A;  5EL8 A;  1QK8 A;  2HRK A;  1WIK A;  3EMX A;  2AUV A;  3K8N A;  1ZYN A;  1THX A;  1EZK A;  4NWY A;  3VK9 A;  1VRS D;  2C1Y A;  2ZCT A;  3VI7 A;  1XWK A;  3KMO A;  5BRT A;  1SKR B;  3DGQ A;  4MMM A;  2L57 A;  3TGZ A;  5IQY A;  4BVY B;  3DEX A;  5F8B A;  1VF1 A;  5BMU A;  3LFL A;  4XCS A;  5HFK A;  4K5S A;  4ZBD A;  3J7Y b;  1KTE A;  2H0I A;  5DVB A;  2QSI A;  4ECB A;  3KP9 A;  2IFQ A;  1K3Y A;  3HY2 A;  3KGK A;  3ZFB A;  2WGR A;  4NMU A;  1T4Z A;  4TVE A;  1QGV A;  2B6M A;  5A4U A;  1BYE A;  1RQM A;  4L5O A;  1WJK A;  1OAZ A;  3IE3 A;  2WB9 A;  3HHV A;  2XPE A;  4G0K A;  4LMW A;  4X1U A;  3UMA A;  3IAS 2;  1NSW A;  16GS A;  4FIW A;  2IPA A;  1KBN A;  4KA0 A;  4YH2 A;  4IKH A;  3D22 A;  4YQM A;  1WE0 A;  2B5X A;  2J23 A;  2PER A;  1XWB A;  4FYB A;  2E0Q A;  2H6Z A;  4GTU A;  2HT9 A;  3QMX A;  11GS A;  2YWN A;  1DE1 A;  2XBI A;  2FA4 A;  4OFN A;  4O92 A;  3TRX A;  2CQ9 A;  3FZ5 A;  3GTU B;  2R0C A;  2H6X A;  2B7J A;  2M80 A;  1GUH A;  2VCQ A;  3A3T A;  4CHS A;  4GQF A;  1F6M C;  1K0M A;  4GST A;  3ZL5 A;  2ES7 A;  3KXO A;  2IJY A;  5JCW A;  3F4T A;  1U3I A;  4I97 A;  2L59 A;  3W8J A;  2NVL A;  1YKA A;  2RM6 A;  2VCW A;  1JZO A;  5AN1 A;  3GUR A;  1B9Y C;  2VL2 A;  5ECI B;  4CY8 A;  4KH7 A;  2L6D A;  3APQ A;  1ZCP A;  2C3N A;  3DYR A;  2K9F A;  2YOI A;  1O81 A;  3IA1 A;  4OCE A;  3TKR A;  2YV9 A;  2IMD A;  4TXV A;  4O32 A;  2VL3 A;  2NBS A;  4TN8 A;  2JL4 A;  5ID2 A;  2XC2 A;  3CRU A;  5ECK B;  5G2Z A;  2H30 A;  2L5L A;  2NPB A;  4EF0 A;  2YPM A;  3VFI A;  2FLS A;  1TOF A;  5A4V A;  4O5Q A;  1WWJ A;  1X9M B;  4RQR A;  1XVW A;  2X49 A;  1Z5Y E;  4OD7 A;  6GSX A;  4IQA A;  2H1A A;  4MAB A;  3UJ1 A;  3CBU A;  1AC1 A;  5ECR B;  3GMF A;  3HKR A;  2FWE A;  4J56 E;  3EMP A;  4TXO A;  4G0I A;  2GQM A;  1F3B A;  1F3A A;  3F9U A;  5C04 A;  2H74 A;  5A4W A;  4J2F A;  5CRE A;  4K5R A;  4MPG A;  4YKG A;  3AY8 A;  3U6V A;  3WT1 A;  2A4H A;  1X5D A;  4OMV A;  3EUR A;  2B1L A;  4ISD A;  1QUW A;  2QA1 A;  2DIY A;  2TRX A;  2LUS A;  4OWY A;  1LBK A;  3TKS C;  4YAP A;  3HVX A;  1R7H A;  4K0G A;  4FO5 A;  2R2J A;  1U6T A;  4K6X A;  4BWS A;  1OE8 A;  4MJA A;  3Q6O A;  4MK3 A;  4KND A;  1MD3 A;  3APS A;  1XPV A;  1K0O A;  1Q4J A;  3MAK A;  3HA9 A;  1FW1 A;  2B5Y A;  1YF1 A;  1M9B A;  1GLQ A;  3TCO A;  5GAP D;  3CTF A;  2VCZ A;  4HZ4 A;  2C4J A;  3TOU A;  3ERF A;  4ZXG A;  1A0R P;  4V2N A;  3M0F A;  3UAP A;  3WGE A;  4H86 A;  4MNN A;  4F03 A;  4WR5 A;  3MDK A;  3F6D A;  2R3X A;  4O5R A;  2QKE A;  4WBJ A;  2B5E A;  1JZR A;  3GA4 A;  1BJX A;  1PKZ A;  1YJ6 A;  1BQ7 A;  2GST A;  4MF5 A;  3W6G A;  1SJZ A;  2EIO A;  1MDJ A;  2IMI A;  3M8N A;  17GS A;  5FT3 A;  1XFL A;  3D4T A;  4I2U A;  4GLT A;  2VD1 A;  3DIE A;  4NV2 A;  2R37 A;  2GQK A;  3LG6 A;  2JSY A;  1ERV A;  1X5E A;  1THO A;  4JZQ A;  2VIM A;  2V6O A;  1OKT A;  2H6Y A;  1EWX A;  2C80 A;  3BBY A;  3LYP A;  2LNT A;  1F2E A;  1B8X A;  1J9B A;  3KMN A;  1PGT A;  4G19 A;  5D73 A;  2HSH A;  3FW2 A;  1NM3 A;  1T4Y A;  1FOH A;  1TK8 B;  1YF0 A;  4BL7 A;  1SK0 A;  2AV4 A;  3FY7 A;  4EKZ A;  3F4S A;  3D0Z A;  2HSY A;  5GAN D;  5IM9 A;  1PL1 A;  5DAL B;  2AAW A;  1XWG A;  3BJ5 A;  4ID0 A;  3GNJ A;  3ZIJ A;  1PQN A;  2F8A A;  1B4P A;  4IW9 A;  1ILO A;  20GS A;  5CYY A;  4JR4 A;  3H4K A;  3GIX A;  3RPN A;  4WXT A;  2MBS A;  4AJ7 A;  2HZF A;  1SYX A;  1PRX A;  3EYT A;  4OFM A;  1LJR A;  1HD2 A;  3QR6 A;  4EE0 A;  3EU3 A;  2XHF A;  3D21 A;  5D8I A;  3CSH A;  5ELG A;  4F0B A;  4V2M A;  4EUY A;  2AJQ B;  3F8U A;  3IK9 A;  2H75 A;  1Z9H A;  5DCG A;  1V98 A;  2MMA A;  3DD3 A;  5E59 A;  1CQH A;  4WF5 A;  3QFA C;  3TJB A;  4MJB A;  1FHE A;  2DJ2 A;  3VPT A;  4K1F A;  1TI1 A;  1ZMA A;  2KOK A;  4PXO A;  2PUK C;  3R2Q A;  3ZVJ D;  2X8C A;  5G5F A;  2K6V A;  8GSS A;  2A2P A;  1GUK A;  2YNX A;  4WET A;  1OC3 A;  3LW9 A;  4HQS A;  4Z2T A;  1MDK A;  2H66 A;  3LGC A;  3HCZ A;  3M1G A;  4DSS B;  5ECM B;  1MD4 A;  2CVK A;  2XBQ A;  4RI7 A;  2LEG A;  4EC0 A;  3ISO A;  4ICY A;  5G30 A;  2RII A;  4I8B A;  3L9S A;  3LOR A;  1Z6N A;  2A2R A;  2OBI A;  2H73 A;  1TW9 A;  2WS2 A;  2GLR A;  1F9M A;  4OO4 A;  4EXJ A;  3C7M A;  1SYR A;  1T8E B;  2VCV A;  4AGS A;  4MF6 A;  2JZS A;  4PUF C;  4TR1 B;  2TRC P;  2VOC A;  3UOM A;  3UVT A;  4N0V A;  3GKK A;  2H01 A;  2D2Z A;  2G0F A;  1SD9 A;  3NOF A;  3FRC A;  2LRC A;  2CAI A;  2DSA A;  2CVB A;  3KJY A;  5G5E A;  3HDC A;  4GSN A;  1QFN A;  5JWR B;  3CRT A;  5HQP A;  3O76 A;  3QPM A;  4HQZ A;  18GS A;  2VL2 C;  4MPF A;  2HLS A;  1EEJ A;  1O6J A;  3O6T A;  6GSU A;  5H5Q A;  3KH7 A;  3APO A;  3CYN A;  3LYK A;  3FK8 A;  2Z9S A;  5HFG A;  2QGV A;  3GKX A;  5F05 A;  5DAK A;  3G7Y A;  3UBK A;  3ZLP A;  1AQW A;  5D93 A;  3LEF A;  4FH8 A;  1FAA A;  1ZGN A;  1NHO A;  3IOS A;  5H5R A;  4A5P A;  2H0G A;  3P7X A;  4AF2 A;  3F6F A;  1SU9 A;  2DKH A;  1ST9 A;  1SEN A;  1Z6M A;  1XW5 A;  1R5P A;  3GX0 A;  3KEB A;  5J5N A;  4MDC A;  1EP8 A;  2F9S A;  1MDI A;  3W8S A;  3Q19 A;  1EOH A;  3QAG A;  3GKN A;  3CXG A;  4GWR A;  1O8X A;  3KCM A;  3GH9 A;  1OC9 A;  5ECL B;  4TR4 A;  5D9X A;  2V41 A;  4EO3 A;  3EWL A;  2I1U A;  3GFK A;  1PD2 1;  4BVY A;  4Q5F A;  4BWQ A;  4L5L A;  3D4M A;  1PN0 A;  3FR6 A;  3ZZX A;  1SD8 A;  1XVQ A;  5J9C A;  1JLW A;  1TRS A;  4O5U A;  5IMC A;  1GWC A;  3GUS A;  3HJM A;  2RUE A;  3L9U A;  1YKC A;  4K7N A;  4XS4 A;  4XIH A;  3KZQ A;  2PWJ A;  2N5F A;  2GZY A;  4K2D A;  1TRW A;  3GRX A;  1PX6 A;  4ACS A;  4V2L A;  1OYJ A;  4HI7 A;  1XOB A;  2WRT A;  5ECH B;  4ZB8 A;  4FQU A;  4TW5 A;  1W89 A;  2I81 A;  3TJJ A;  2R0G A;  1BED A;  4FYU A;  4ULX A;  4DSR A;  1PX7 A;  4KCA A;  2AYT A;  1M7T A;  4ZL8 A;  5IMA A;  1XW6 A;  2LJA A;  3DML A;  1PN9 A;  3M9K A;  2V2G A;  3IV4 A;  5ABR A;  1VGL A;  2V32 A;  3GTU A;  2KP2 A;  3EVI A;  2CX3 A;  3FZA A;  3HJO A;  2LQQ A;  5ECN B;  4EIQ A;  4KDU A;  4QL9 A;  1GSQ A;  1JLV A;  1C72 A;  4HU7 A;  1GSE A;  1ZYQ B;  3IRA A;  3HZ4 A;  5IMV A;  2C0D A;  3IPZ A;  5KN3 A;  2A4V A;  4IGJ A;  2FCH A;  1KEB A;  3C1R A;  3ERW A;  5ID2 B;  3TKQ A;  1ERT A;  5JCU A;  5KOW A;  5EPF A;  4XS1 A;  5IMD A;  1DE2 A;  1GL8 A;  1HYU A;  5KN2 A;  2JZR A;  1PSQ A;  1KNG A;  4POB A;  1MTC A;  5JWO B;  2YV7 A;  3I43 A;  2I9H A;  1XWA A;  2K8V A;  4TXO B;  5IPH A;  3F3Q A;  6GSV A;  3I6A A;  3EIN A;  5HR2 A;  1SK2 A;  3G9B A;  3RHB A;  4GXZ A;  4N0Z A;  4GRF A;  3DWV A;  3VWV A;  4EVM A;  3H1N A;  1GUL A;  3GSS A;  2B3S A;  2DBC A;  4XRA A;  4BPY A;  3A2V A;  3ERG A;  4HU9 A;  4NXI A;  5J3R A;  1A23 A;  3GHA A;  1GTU A;  2F51 A;  5CO3 A;  2H0H A;  2N5B A;  3VUR A;  3U5R E;  3N5O A;  2PBJ A;  4LL1 B;  1OE7 A;  1USB A;  5G31 A;  3D6I A;  5AIS A;  3DRN A;  1E6B A;  2YCD A;  4POM A;  2EIR A;  3BD2 A;  3IHQ A;  2OE3 A;  4RUV A;  3WYW A;  3M9J A;  3EPT A;  4MH2 A;  4JE1 A;  1Y25 A;  3RPP A;  2ON5 A;  2VD0 A;  3KTL A;  4G2E A;  2MZC A;  4ML1 A;  4NPB A;  4I2T A;  5KN0 A;  1A0F A;  3TJF A;  4ZBA A;  3IAM 2;  4HEA 2;  3Q18 A;  3L0H A;  1GH2 A;  3BCK A;  1JHB A;  2K18 A;  5CRG A;  4L0W A;  3TDG A;  4WR4 A;  2VCX A;  1YZX A;  3TRP A;  2R4V A;  3F0I A;  3ME8 A;  2O87 A;  2FA8 A;  2VCT A;  4MZC A;  4ZIJ A;  4KAE A;  2DJK A;  2MMO A;  4MA9 A;  1A24 A;  5HR1 A;  1XBS A;  1O8W A;  4XRD A;  1SJ6 A;  5ENU A;  5DDL A;  5KN1 A;  1YEP A;  2YWI A;  4EDY A;  3GL5 A;  1SL1 B;  3IK7 A;  4AJ8 A;  4F0C A;  1S3C A;  3A2X A;  2KLX A;  2O89 A;  3LQ7 A;  3MSZ A;  2C0E A;  1EV4 A;  4ILF A;  2LJR A;  4KX4 A;  1FVJ A;  2PGT A;  1TJD A;  4WEY A;  4IJI A;  1A2L A;  2OE0 A;  1U87 A;  2X8G A;  1M0U A;  3HJP A;  1Z3E A;  2EC4 A;  1QQ2 A;  1HQO A;  1V40 A;  5G1K A;  5D9T A;  1H75 A;  1H4O A;  2V6K A;  1NHY A;  3UEM A;  1TRV A;  3VWU A;  2GDR A;  2C0F A;  2GZP A;  5CRD A;  3QCP A;  2X4A A;  1EV9 A;  3H79 A;  4YKF A;  3VPQ A;  4G0L A;  2I3Y A;  3A2W A;  3ZIT A;  4KDX A;  3IXR A;  2DJ3 A;  3S9F A;  1PMT A;  3PR8 A;  13GS A;  4NV5 A;  3LJR A;  2I4A A;  4I6X A;  4KUN A;  2HRF A;  1FB6 A;  1FOV A;  1N8J A;  2HFD A;  1ABA A;  2FWF A;  5DAL A;  4KSM A;  1X5C A;  4IEL A;  2WCI A;  2DLX A;  3LWA A;  4IS0 A;  4EL1 A;  4DSQ A;  22GS A;  2LJK A;  2L4Q A;  1I9D A;  2WJU A;  3L4N A;  1M99 A;  2A2S A;  3GX8 A;  2MBT A;  2P31 A;  4E8H A;  1EGO A;  2FWG A;  3RHC A;  2GS3 A;  4ZL7 A;  2FHE A;  1R26 A;  1ZOF A;  2MMN A;  2RM5 A;  1UA5 A;  3DKS A;  3TOT A;  2KHP A;  1FO5 A;  5J9B A;  2LNS A;  2X64 A;  3TJG A;  2NTO A;  2VUP A;  5DJL A;  3FR3 A;  4OFT A;  3TUE A;  3SBC A;  2IME A;  4Z7X A;  1VF4 A;  4Q5Q A;  3QFB C;  4CY6 A;  1EGR A;  3KH9 A;  3VLN A;  3ME7 A;  2R6K A;  5CRH A;  6GSS A;  5DJM A;  2IL3 A;  3BOA A;  3KM6 A;  3ZRE A;  1M2A A;  1YEX A;  3FEU A;  5IIZ A;  5F06 A;  2E2G A;  3CSI A;  1DBY A;  3FHK A;  1TRU A;  1UVZ A;  3HYP A;  4MCU A;  2HZE B;  3O3T A;  3LXT A;  4KGI A;  5J41 A;  2IMF A;  4TKY A;  4WF4 A;  4L0U A;  4IVF A;  6GSW A;  5FWG A;  1CQG A;  1X9W B;  4K8M A;  4PUR A;  2F3M A;  1URM A;  2YZH A;  2VM1 A;  1HNC A;  4JR6 A;  5IO2 A;  4ML6 A;  1GTI A;  4TR3 A;  2PPT A;  3NIV A;  4PTS A;  4ZBB A;  4JU5 A;  4TR1 A;  3CTG A;  1XZO A;  4ECJ A;  4D73 B;  5EY6 A;  1B48 A;  4E8E A;  3HVV A;  2H76 A;  2VL9 A;  2YZU A;  2GGT A;  2VAF A;  4WBR D;  4BVX B;  4MP4 A;  3BCI A;  5DQS A;  1E2Y A;  2HXK A;  4PGT A;  1ZYE A;  2HRA A;  3G7I A;  2HRN A;  2C0G A;  2BMX A;  4CW9 A;  1ML6 A;  4KE3 A;  2ALB A;  1S3D A;  2B1K A;  3EU4 A;  12GS A;  1WMJ A;  2REM A;  1A2J A;  2QA2 A;  3RDW A;  2H8L A;  1ZL9 A;  5DQY A;  4EDZ A;  3F63 A;  3DXB A;  1W4V A;  1SKW B;  1T1V A;  1TTZ A;  3Q74 A;  3P90 A;  4ZL9 A;  4PX1 A;  3TRQ A;  4YQU A;  2JU5 A;  5IMF A;  1V57 A;  4DEJ A;  3SWL A;  4NHZ A;  2OKA A;  5FHI A;  1I5G A;  1TI3 A;  2YP6 A;  2CZ3 A;  2RLI A;  2ZUP A;  3CSJ A;  4NHW A;  4X43 A;  2KP1 A;  2WFC A;  1DSB A;  4JBB A;  1J0F A;  3US3 A;  1OC9 B;  4X0X A;  1SL0 B;  2H1B A;  2PVQ A;  3GYK A;  5D9W A;  1WRY A;  1EP7 A;  2IFQ B;  3GN3 A;  2O8V B;  4O7H A;  4K7I A;  3KIJ A;  2UZ8 A;  2CAQ A;  4PNF A;  1BX9 A;  2LST A;  2HYX A;  4MZW A;  4XHM A;  3FMW A;  1A2M A;  1FVK A;  1OKD A;  1GSU A;  5IO0 A;  3IC8 A;  3DVW A;  2KUC A;  2M72 A;  1G6W A;  3LXZ A;  2XPD A;  1AUC A;  2JZT A;  4DVC A;  4XS4 B;  4PNG A;  5ECP B;  1AQV A;  1AIU A;  2E2M A;  3LSZ A;  1A8L A;  5IMZ A;  1TU7 A;  3H8Q A;  9GSS A;  2JSZ A;  1U3A A;  2VLV A;  2OAC A;  2O85 A;  3HXS A;  2H1G A;  4HDE A;  2CV4 A;  2G2Q A;  1G7E A;  5AGY A;  3L78 A;  2DMM A;  1M2D A;  3IR4 A;  4EIP A;  2L5O A;  4J57 E;  4ZIL A;  4KSO A;  5GST A;  2X8H A;  1XWC A;  4X4J A;  3PIN A;  5DBQ A;  4GSS A;  1GSD A;  3WT2 A;  3P8W A;  5CAX A;  1M2B A;  3ZRD A;  5F0G A;  2IWT A;  1ON4 A;  1RW1 A;  4PQI A;  2LRT A;  19GS A;  3EE2 A;  1GUM A;  5ELA A;  5AIX A;  4G10 A;  4TR0 A;  2H71 A;  1K0N A;  5KEJ A;  2OBK A;  3IDV A;  5JWQ B;  1IYH A;  5JCG A;  1T7P B;  2VLU A;  3FZ4 A;  3A5W A;  1GSF A;  1IYI A;  2LKU A;  1U88 A;  1J08 A;  3C71 A;  3RAZ A;  1GTB A;  2AHE A;  2CA8 A;  3C8E A;  1OC8 A;  5GSS A;  3MIX A;  3ZFL A;  1R5A A;  3GST A;  4IJ3 A;  3HD5 A;  5IOX A;  3GH6 A;  4MZB A;  3FZ9 A;  3FR9 A;  1UN2 A;  5ECS A;  2ZNM A;  4HZ2 A;  1ERW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...