1X5DA

The solution structure of the second thioredoxin-like domain of human protein disulfide-isomerase a6
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
133
structure length
133
Chain Sequence
GSSGSSGDVIELTDDSFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAASEVKEQTKGKVKLAAVDATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIVSRALDLFSDNAPPPELLESGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein disulfide-isomerase A6
publication title The solution structure of the second thioredoxin-like domain of human Protein disulfide-isomerase A6
rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 26
structure length 133
sequence length 133
ec nomenclature ec 5.3.4.1: Protein disulfide-isomerase.
pdb deposition date 2005-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1x5dA01
2P0GA 1TP9A 3TKRA 1TJDA 3FKFA 2V1MA 1AQVA 2I81A 4WXTA 1GTUA 4V2MA 4EL1A 1GSQA 2HE3A 4MZCA 5CP1A 3KH7A 2H30A 1NM3A 3PGTA 2VIMA 3F9UA 3P8WA 4IBPA 3GV1A 2MMAA 2BTOT 3LORA 4IKHA 4K8MA 5HFGA 1DSBA 1AW9A 1M2DA 3FEUA 4MDCA 22GSA 5AIXA 1XXUA 3KTBA 5C00A 1XBSA 4HDEA 3M1GA 1GSEA 2Z9SA 3TJBA 2H73A 5IMVA 4IP1A 1K0MA 1K0OA 4IJ3A 1EZKA 1G6YA 1WE0A 2DJ3A 3TJFA 1QGVA 2XBIA 1XW9A 4FIWA 3VWXA 17GSA 4POMA 2V41A 4KSMA 3MNGA 3LXTA 2H72A 1GL8A 3O6TA 3HDCA 3HJOA 3QCPA 5COHA 2R5GA 2NBSA 5ECPB 4X1UA 5F8BA 1K3YA 2VL2A 2BJXA 1RK4A 4JR6A 4IN0A 2NPBA 3HA9A 2E2MA 1V9WA 1JZWA 3GTUA 1UVZA 2IFQB 3FR9A 2IMIA 1RQMA 3CYNA 3ZFLA 3CSHA 3N5OA 3KGKA 3IAM2 3F0IA 5ENUA 2WDUA 4RQRA 4D73B 3BD2A 1C72A 2PGTA 5B6NA 1TXXA 1M2BA 5CO3A 4PNFA 4K7OA 3LG6A 1T1VA 4GWRA 3GX8A 2GTUA 2GGTA 1W4VA 4I6XA 4YAVA 5JCGA 4QL7A 5CRHA 3C73A 1AIUA 4F0CA 1X9MB 3HCZA 3GFKA 4XRAA 5HFKA 2ZNMA 2EIQA 1ZYEA 3EWLA 3Q19A 3H79A 2GZZA 3LQ7A 5ELGA 2JU5A 3FZAA 4G10A 4ACSA 4HI7A 4IELA 6GSUA 5DDLA 4I8BA 4POLA 1WRYA 4WF4A 2IMKA 5B8BA 5ID2B 1HNAA 5B8AA 1OC9A 2HZEB 3J7Yb 2DIYA 1XOBA 6GSXA 4XS1A 1NW2A 4RI7A 5CNWA 5IOXA 2YZUA 2E0QA 4OO4A 1ML6A 2OBKA 3CTGA 5F05A 3HJPA 5JWOB 3WGDA 4JBBA 3HZ8A 4WR5A 1TOFA 1VGLA 2DMMA 2VCZA 3I43A 1V98A 3D21A 1XOAA 5FT3A 4K0NA 4PQ1A 3RHCA 5AGYA 1FVKA 3ED3A 3DGQA 5C04A 3GRXA 4HJMA 3ZTLA 4X0XA 4TOPA 1W89A 1TRUA 3D6IA 4EXJA 3GMFA 4KW6A 5KN1A 1OKTA 2WULA 5J9CA 2H76A 1PQNA 3HKRA 4K2DA 4FYCA 5J41A 1G0TA 8GSSA 3L9VA 4NHZA 5HFIA 2GVPA 3M9JA 1EGRA 1R5AA 3IDVA 2C3TA 4MPFA 2HT9A 2YP6A 5DVBA 2GDRA 2VL9A 1DE2A 3TB2A 2WGRA 2QSIA 1BYEA 1JLVA 5HQPA 1GSFA 2DJ1A 1HYUA 2CVDA 3L78A 3TJGA 2H19A 1SJZA 2CA8A 9GSSA 2MMZA 1GUHA 1ON4A 2XPDA 2DIZA 3GH6A 1O8XA 2YV9A 2GLRA 2FHEA 3K8NA 3G7YA 1AUCA 1EP8A 3GKKA 2RUFA 2CVBA 5G2ZA 4LL4B 4XS4A 3KM6A 2OE0A 1YKAA 1B9XC 4TR1B 3A2VA 3TKPA 2L4QA 1FB0A 1SD8A 3KMOA 2HSYA 7GSSA 2A4VA 3Q18A 3LFLA 3FZ5A 3TRXA 1G7EA 5IM9A 1FO5A 1X5CA 5FWGA 1K3LA 2K9FA 1QFNA 2ON5A 2LEGA 3W8JA 1A0FA 2R6KA 4ID0A 5D93A 5GSSA 2I9HA 2AB6A 1OVNA 2CQ9A 1PX6A 4EE0A 3GIXA 5FHIA 1SJIA 1EEJA 1B48A 2KP2A 4IW9A 1A2MA 4WF5A 4HZ4A 1A8LA 2H66A 3TOTA 3US3A 3FZ4A 3EVIA 4N11A 4YQUA 1LU4A 4MCUA 2HYXA 3KTLA 1G7OA 3D22A 2RLIA 2HRFA 5JCUA 1M0UA 2VAFA 5AIVA 3IBHA 4HEA2 3EMPA 4JE1A 1G6WA 2O89A 3H8QA 2GZYA 2TRXA 1F37A 2KUCA 2DLXA 3IAS2 3DMLA 1KEBA 4JR4A 2R4VA 5GZZB 2FY6A 3VFIA 5DCGA 5ECHB 1T00A 3GUSA 1ZYQB 3HY2A 5DAKA 2K8VA 4TR0A 3ZL5A 3HVSA 3ME7A 3WD6A 3U5RE 3SBCA 2TRCP 3QMXA 1T8EB 1X9WB 1WPIA 2A2RA 3GH9A 2H1AA 3UVTA 6GSTA 1NHYA 2C3NA 3ZMLA 4F03A 3F6DA 1QUWA 5IOWA 2DJJA 3RBTA 3N9JA 3H4KA 1YJ6A 4YQMA 2IMDA 1V2AA 2I1UA 2XPEA 2MYGA 3QAVA 3FR6A 19GSA 4BVYA 3M3MA 3F3QA 3ZVJA 4I5QA 1EV9A 1U6TA 2WFCA 3KH9A 3EU3A 2B5EA 4KDYA 4P3YB 1SKSB 1FHEA 3LGCA 3DD3A 2V6OA 5D9VA 3KMNA 2LNTA 5ECKB 3ERGA 4POKA 2C4JA 1MD4A 1U3AA 2LJAA 2NTOA 2REMA 1PA3A 2OKAA 1BAYA 1GNEA 3L9UA 2EIOA 5D8IA 1USBA 1VF1A 3G9BA 1X5DA 2L5OA 3R2QA 5A4VA 3UBKA 3A3TA 2HZFA 3L4NA 3DIEA 2E7PA 4N0ZA 3F6FA 5HR2A 2L57A 4BVXA 1A2LA 2K18A 2FWFA 3CMIA 1ERWA 2GS3A 3L9SA 4I2TA 1GRXA 1SD9A 4HJ2A 1XZOA 5KN2A 4L0UA 4K7NA 3C1SA 4CDOA 2M80A 1E6BA 4KH7A 4KDXA 1YZXA 1K0AA 2OJLA 3IRAA 1O73A 4LMVA 3HXSA 4V1Ap 2YOIA 1LJRA 2O7KA 4N30A 3GTUB 3ZIJA 1A24A 3EYTA 5HR3A 4TW5A 5ABRA 3LEFA 4F2IA 1T3BA 4FO5A 3C8EA 3CSIA 1OYJA 3FR3A 5INYA 5IQYA 4TR3A 5DALA 3D0ZA 3EURA 1F9MA 1M99A 1XVQA 2YN1A 3ZITA 3TJJA 2B6MA 4G19A 5IIZA 1GH2A 3NIVA 5IO2A 1O85A 2PBJA 5DQSA 1FG4A 1HNCA 4TKYA 2HNLA 5IMAA 3I69A 1ZL9A 3IPZA 3H93A 1J0FA 1O8WA 4OCEA 1QXHA 2YJHA 4KB3A 4RUVA 4NHWA 4EDZA 1XWCA 3M9KA 1IYHA 3GNJA 1GUKA 2D2ZA 4KCAA 5D9WA 3EC3A 4NAXA 2N5AA 1PL2A 2JACA 3ZVJD 3SWLA 2B1LA 2WRTA 1R4WA 2LUSA 2ZUPA 1OC9B 3MAKA 2P5RA 1Z7RA 1PX7A 1YKCA 3J7Yk 1OKDA 10GSA 1YEPA 3IK7A 5G30A 1E2YA 4BPYA 4ZXGA 1FOVA 2ES7A 1JFUA 5IO0A 1S3DA 2VCTA 5IPGA 4XIHA 5G1LA 1Y6EA 2FA4A 4TXOA 1NHOA 4DSSA 1HD2A 3TKSE 4PUFC 4J57E 5GSTA 4NV5A 4Q5RA 1A0RP 4ZB9A 1QQ2A 2FGXA 2N5BA 3KCMA 3RPNA 1TK0B 4XHMA 1Z7PA 3QD9A 1R26A 4PUAA 3GSTA 1PN9A 3D5JA 2CVKA 1PKWA 4F0BA 5ECRB 2H74A 14GSA 4ISDA 1S3CA 1ZGNA 2DSAA 5CREA 1TTZA 2X64A 4AJ6A 1AC1A 3CRUA 2CX3A 5DBQA 3F3RA 3EMXA 2OBIA 2WB9A 2MBTA 3KD0A 1RW1A 3TKSC 3EINA 1XVWA 4ZL8A 1TI3A 4ZL9A 2VLUA 2AV4A 1S3AA 4ILFA 1BEDA 2GSTA 4HQZA 4HQSA 2JZTA 1T4YA 3E9JB 1U88A 3BJ5A 5G31A 1ERUA 4J2FA 1GSYA 2KOKA 4ECCA 2MZCA 3W6GA 2R2JA 1CQHA 4KSOA 4O5RA 4XS4B 2XHFA 1U3IA 3CTFA 2HXKA 4WBJA 2FNOA 2YWIA 3KXOA 4YAPA 1JZDA 2F3MA 3GURA 2PVQA 5G5FA 5ECQB 1QK8A 2JZRA 5ECIB 1EGOA 1T4ZA 2QKEA 1X5EA 2KP1A 1YEXA 3I6AA 4K0GA 4PQIA 1TRVA 4CW9A 3VK9A 4NWYA 2C0EA 2H75A 2GQKA 2IPAA 3FZ9A 2PERA 3UL3A 2VL3A 4MA9A 1ERVA 4EUYA 5KN3A 3IR4A 2V2GA 3UMAA 3TOUA 3D4TA 3C7MA 5IMCA 2ZCTA 1FW1A 2AUVA 2R3XA 4HOJA 4O7HA 1JLWA 3WGEA 4IQ1A 4EC0A 4ZB6A 5B6MA 4JZQA 4H86A 1B8XA 2YNXA 3ZLPA 3QAWA 4MLYA 3GKXA 1UA5A 4ZBBA 3LSZA 3UAPA 5LCZA 1ZCPA 4XRDA 4LL1B 5D9TA 5G1KA 1FVJA 4FYBA 3F4RA 2H6ZA 2KLXA 1Q4JA 3D4MA 1BQ7A 4L8EA 3P90A 3CRTA 4KAEA 3AY8A 5DAKB 5J5NA 4KUNA 5G5EA 2OACA 2OE1A 2VCVA 5A4WA 3APOA 2F8FA 3PINA 2VOCA 4GF0A 2PVOC 2L6CA 3LYKA 4MF7A 1ZOFA 1MDJA 3RPPA 1HNBA 3HD5A 4MH2A 5DJLA 3APQA 4OFTA 4MZBA 1XWGA 2A2SA 2VCQA 2JL4A 2CAIA 2XBQA 4ZILA 5A5KA 2B5YA 3BBYA 2YWOA 1R5PA 3CSJA 1K0NA 1EV4A 2OA7A 1EWXA 1GLQA 2QC7A 1SK1A 2C1YA 2LTKA 2PUKC 3ZYWA 2CT6A 3RAZA 3QDNA 1GUMA 2V32A 4MABA 4XTSA 5EL8A 3QOUA 5JWRB 1OE7A 2OADA 2CX4A 2QGVA 5AN1A 1WP0A 3ZFBA 3IHQA 1Y25A 3PH9A 1T7PB 3ME8A 3L0HA 4QQ7A 2KHPA 1X0RA 3I9V2 2H6XA 2H8LA 1PKZA 1THOA 3DVXA 2B5XA 3WYWA 5DJMA 5J4UA 5ECLB 3F8UA 4IHUA 1WWJA 4HS1A 1M9AA 3KIJA 4NPBA 1B4QA 5ELAA 1THXA 1A8YA 3BOAA 2VCXA 4MF5A 5JWQB 1XWAA 2H1DA 2YV7A 3E3EA 2GZPA 4MP4A 2GQLA 3ZRDA 1F2EA 3HZ4A 2JSYA 3TGZA 3O76A 3UEMA 4DSRA 4N0VA 1GNWA 4PURA 1DBYA 2FCHA 3UARA 1GTAA 6GSSA 1F3AA 3VWUA 4MMMA 2H70A 1TRSA 4POBA 5KEJA 1QMVA 4ZIJA 1Z5YE 3KP9A 1VF3A 5ECNB 2DC5A 4I97A 2EC4A 2L59A 1SL0B 2X8GA 4LLRA 1SL1B 4TN8A 1AQXA 2C0GA 5CAXA 1F6MC 1PSQA 3IV4A 3TKQA 5EPFA 3M8NA 5DALB 1TK5B 2VCWA 5HR0A 1BJXA 4WKWA 1XWKA 2MBSA 4O32A 2K8SA 1ZMAA 4EO3A 1GSDA 1YF1A 2DJ0A 4MF6A 1WMJA 4AJ8A 3DVWA 2L4CA 4TRXA 4HZ2A 2RM6A 3EU4A 3C1RA 1U87A 4ULXA 3LJRA 1HQOA 1XW6A 3UBLA 2IMFA 4K6XA 4HU9A 3DWVA 2C8UA 4JRRA 3P7XA 2DBCA 6GSWA 3VI5A 1O6JA 4OFMA 2PN8A 1UC7A 3JCML 4YQVA 1LBKA 3S9FA 5LNKe 3MSZA 4GRFA 4JU5A 1N8JA 4WETA 2H0IA 3VPTA 3LXZA 4JEDA 4EF0A 3U6VA 2G0FA 4BWQA 3GYKA 5IMDA 2RIIA 2TIRA 2IL3A 4MJEA 1IYIA 2CAQA 3GSSA 1VF4A 4TXOB 5AISA 4DSSB 2N5FA 1GTBA 2HFDA 2F8AA 5H5SA 3IE3A 3QPMA 2X8HA 3TUEA 3FW2A 4MZWA 2VD0A 3A2XA 2AAWA 1F3BA 2GSSA 1KNGA 3LWAA 2LQQA 3M0FA 2ON7A 4IQAA 4GTUA 5H5RA 3VWVA 4RQXA 3DXBA 2LV3A 1MTCA 3GL5A 1AXDA 4EKZA 2FA8A 1K0DA 1CQGA 3UIWA 2WS2A 3W8SA 1KTEA 4IVFA 3FRCA 2LJKA 1MEKA 5CYYA 4K7IA 5J9BA 1TU7A 4IJIA 2EIRA 2X8CA 1ERTA 1EEMA 2G2QA 3HHVA 1H4OA 1SK0A 2VLTA 3HVXA 2VL2C 1YF0A 3KJYA 2WJUA 1BX9A 2IMEA 2HRNA 4YH2A 2DMLA 3APSA 2H1GA 3F4TA 1OAZA 4GQFA 4RI6A 5D96A 3RDWA 4OWYA 2X99A 2VM2A 4NXIA 2P31A 1AQWA 3GKMA 3ZMKA 1AAZA 5CRGA 2HI7A 4GQCA 3IK9A 4ZBAA 1V57A 12GSA 4KE3A 1Z6MA 4F9ZA 1O81A 20GSA 5JCWA 1Z3EA 1GLPA 2YWNA 2FLSA 3DRNA 1FAAA 1EOHA 1OC8A 2YPMA 2JZSA 1MD3A 2H0HA 2NDOA 3IOSA 3KZQA 4EVMA 4OFNA 5A4UA 1TDIA 1SK2A 5DQYA 2LRNA 1B4PA 3O3TA 2BMXA 4ZL7A 3PR8A 1VRSD 1GWCA 2YWMA 3TKSA 1NSWA 4LA1A 3MWHA 1GSSA 1ZZYA 4DVCA 3C71A 2FWHA 1XCCA 2O85A 4TXVA 3TCOA 1PD21 2O8VB 3QR6A 1UN2A 5EVOA 1K0CA 4KDUA 4G9HA 4LMWA 4KA0A 1SJ6A 3G7JA 2F9SA 2IFQA 3H1NA 2XC2A 2B3SA 2L6DA 4GXZA 4XCSA 4I2UA 1Z9HA 4ECBA 2GT5A 4D73A 3GN3A 3NZNA 2C80A 1V40A 2JSZA 2LKUA 2J23A 18GSA 2VUPA 4J56E 1YQ1A 1X9SB 3P2AA 2P5QA 4KCEA 4Z7XA 5J3RA 4N10A 1SKWB 4Q5QA 3HYPA 1SYRA 5EY6A 2O87A 3VWWA 1ABAA 5ECMB 2JADA 1A23A 1Z6NA 2H1BA 4MK3A 4GCIA 11GSA 2GSRA 1MDKA 1PMTA 3GKNA 2RUEA 1GTIA 1TI1A 5L71A 1Q98A 2DJKA 3KP8A 3QFAC 3HJMA 3HVVA 2MMNA 3IC4A 3CXGA 4OMVA 5ID2A 5E4WA 2AJQB 3VURA 4L0WA 1N2AA 1SKRB 3ZIVA 4AJ7A 4AF2A 2VD1A 2HZEA 3VI7A 2PU9C 5GAPD 2AHEA 3VLNA 2H6YA 2OE3A 3EE2A 1J9BA 4MH3A 1XW5A 1EOGA 4MJBA 3A2WA 1XIYA 4AGSA 1J08A 1O7UA 5ECSA 3E0UA 2H01A 2C3QA 4GSTA 4MJAA 1ACVA 5IMZA 3DYRA 3TRPA 3ZREA 1R7HA 1V58A 4O92A 4V2NA 2K6VA 3FY7A 2YZHA 2LS5A 1XFLA 1M2AA 2FWGA 3IA1A 2LQOA 1TRWA 5IPHA 3DKSA 2V6KA 5H5QA 5LD0A 3G7IA 1PL1A 4KX4A 3GA4A 1EP7A 3QFBC 5E59A 1JHBA 4OCFA 4ML1A 3WT2A 2CZ3A 3TRQA 1TW9A 1SU9A 4OD7A 5CRDA 2GSQA 16GSA 1KBNA 3VPQA 2H71A 5IMFA 2LJRA 3BCKA 2H0GA 4G2EA 3WT1A 3KEBA 4E8HA 4EDYA 2DJ2A 1SYXA 1K0BA 4E8EA 2VM1A 2IIYA 4QL9A 4K9ZA 4ECIA 2C0FA 4ML6A 1TU8A 5GAND 2IJYA 3UVHA 2IN3A 4ECJA 4XS6A 5KN0A 2VLVA 4IP6A 2MMOA 2CV4A 2PWJA 2IWTA 2LRTA 4TVEA 3V1WA 1MDIA 1TKDB 2HSHA 3MDKA 4BL7A 2FUG2 4Q5FA 2LSTA 4Q5NA 3UJ1A 3F63A 2M72A 2I4AA 6GSYA 4TR1A 3LYPA 3OR5A 4GSNA 6GSVA 2YCDA 3ISOA 1M9BA 4HUAA 3NOFA 4KGIA 1ST9A 1I5GA 3CBUA 5D9XA 2HLSA 4PNGA 1K3OA 1XWBA 2PPTA 4HU7A 3ERWA 1SENA 2FD3A 2B1KA 4MJCA 1GULA 3BCIA 3GX0A 2C0DA 2LRCA 2R37A 2NVLA 2M46A 2B7JA 4WEYA 3GL3A 1GSUA 3DEXA 3IXRA 4OO5A 3WGXA 2F51A 4DEJA 2ALBA 4K1FA 1PRXA 4V2LA 3QAGA 3UOMA 2E2GA 4PXOA 1I9DA 1PGTA 4WR4A 2WZ9A 1YDKA 2AYTA 4DSQA 3FHKA 4FYUA 2L5LA 3RHBA 5B7CA 2GQMA 4PQHA 2I3YA 1JZRA 4GLTA 2CZ2A 3TJKA 5DCHA 1BG5A 1YY7A 3ZZXA 4KNDA 1A2JA 4FH8A 4GSSA 4ZB8A 1WJKA 4TR4A 4PX1A 1OE8A 3Q74A 2WCIA 4L5OA 4NV2A 2J9HA 1B9YC 5ECOB 1VF2A 4BWSA 5HR1A 3GHAA 1GP1A 2RM5A 4L5LA 4NMUA 5D73A 4X43A 1SL2B 4MPGA 1URMA 3ERFA 5CRWA 4WBRD 1XPVA 4ZBDA 1FB6A 2LNSA 1M7TA 4CHSA 3F4SA 2YJ7A 4V1Ag 2GT6A 3Q6OA 1DUGA 1JZOA 1DE1A 3TDGA 5F0GA 4BA7A 3A5WA 1WOUA 1WIKA 1OC3A 2YANA 5F06A 1ILOA 3FK8A 2FWEA 5F07A 1TK8B 4IGJA 3FYGA 1H75A 2PMTA 13GSA 2VO4A 4PGTA 2B7KA 4IS0A 4F82A
chains in the Genus database with same CATH superfamily
2P0GA 1TP9A 3TKRA 1TJDA 3FKFA 2V1MA 1AQVA 2I81A 4WXTA 1GTUA 4V2MA 4EL1A 1GSQA 2HE3A 4MZCA 5CP1A 4O5UA 3KH7A 2H30A 1NM3A 3PGTA 2VIMA 3F9UA 3P8WA 4IBPA 3GV1A 2MMAA 2BTOT 3LORA 4IKHA 4K8MA 5HFGA 1DSBA 1AW9A 1M2DA 3FEUA 4MDCA 22GSA 5AIXA 1XXUA 3KTBA 5C00A 1XBSA 4HDEA 3M1GA 1GSEA 2Z9SA 3TJBA 2R0CA 2H73A 5IMVA 4IP1A 1K0MA 1K0OA 4IJ3A 1EZKA 1G6YA 1WE0A 2DJ3A 3TJFA 1QGVA 2XBIA 1XW9A 3IHGA 4FIWA 3VWXA 17GSA 4POMA 2V41A 4KSMA 3MNGA 3LXTA 2H72A 1GL8A 3O6TA 3HDCA 3HJOA 3QCPA 5COHA 2R5GA 2NBSA 5ECPB 4X1UA 5F8BA 1K3YA 2VL2A 2BJXA 1RK4A 4JR6A 4IN0A 2NPBA 3HA9A 2E2MA 1V9WA 1JZWA 3GTUA 1UVZA 2IFQB 3FR9A 2IMIA 1RQMA 3CYNA 3ZFLA 3CSHA 3N5OA 4K5RA 3KGKA 3IAM2 3F0IA 5ENUA 2WDUA 4RQRA 1FOHA 4D73B 3BD2A 1C72A 2PGTA 5B6NA 1TXXA 1M2BA 5CO3A 4PNFA 4K7OA 3LG6A 1T1VA 4GWRA 3GX8A 2GTUA 2GGTA 1W4VA 4I6XA 4YAVA 5JCGA 4QL7A 5CRHA 3C73A 1AIUA 4F0CA 1X9MB 3HCZA 2A4HA 3GFKA 4XRAA 5HFKA 2ZNMA 2EIQA 1ZYEA 3EWLA 4EIQA 3Q19A 3H79A 2GZZA 3LQ7A 5ELGA 2JU5A 3FZAA 5BMUA 4G10A 4ACSA 4HI7A 4IELA 6GSUA 5DDLA 4I8BA 4POLA 1WRYA 4WF4A 2IMKA 5B8BA 5ID2B 1HNAA 5B8AA 1OC9A 2HZEB 3J7Yb 2DIYA 1XOBA 6GSXA 4XS1A 1NW2A 4RI7A 5CNWA 5IOXA 2YZUA 2E0QA 4OO4A 1ML6A 2OBKA 3CTGA 5F05A 3HJPA 5JWOB 3WGDA 4JBBA 3HZ8A 4WR5A 1TOFA 1VGLA 2DMMA 2VCZA 3I43A 1V98A 3D21A 1XOAA 2X49A 5FT3A 4K0NA 4PQ1A 3RHCA 5AGYA 1FVKA 3ED3A 1ZYNA 3DGQA 5C04A 3GRXA 4HJMA 3MYDA 3ZTLA 4X0XA 4TOPA 1W89A 1TRUA 3D6IA 4EXJA 2HRKA 3GMFA 4KW6A 5KN1A 1OKTA 2WULA 5J9CA 2H76A 1PQNA 3HKRA 4K2DA 4FYCA 5J41A 1G0TA 8GSSA 3L9VA 4NHZA 5HFIA 2GVPA 3M9JA 1EGRA 4G0LA 1R5AA 3IDVA 2C3TA 4MPFA 2HT9A 2YP6A 5DVBA 2GDRA 2VL9A 1DE2A 3TB2A 2WGRA 2QSIA 1BYEA 1JLVA 5HQPA 1GSFA 2DJ1A 1HYUA 2CVDA 3L78A 3TJGA 2H19A 1SJZA 2CA8A 9GSSA 2MMZA 1GUHA 1ON4A 2XPDA 2DIZA 3GH6A 1O8XA 2YV9A 2GLRA 2FHEA 4BL7B 3K8NA 3G7YA 1AUCA 1EP8A 3GKKA 2RUFA 2CVBA 5G2ZA 4LL4B 4XS4A 3KM6A 2OE0A 1YKAA 1B9XC 4TR1B 3A2VA 3TKPA 2L4QA 1FB0A 1SD8A 3KMOA 2HSYA 7GSSA 2A4VA 3Q18A 3LFLA 3FZ5A 3TRXA 1G7EA 5IM9A 1FO5A 1X5CA 3PPUA 5FWGA 1K3LA 2K9FA 1QFNA 2ON5A 2LEGA 3W8JA 1A0FA 2R6KA 4ID0A 5D93A 5GSSA 2I9HA 2AB6A 1OVNA 2CQ9A 1PX6A 4EE0A 3GIXA 5FHIA 1SJIA 1EEJA 1B48A 2QA1A 2KP2A 4IW9A 1A2MA 4PTSA 4WF5A 4HZ4A 1A8LA 2H66A 3TOTA 3US3A 2UZ8A 3FZ4A 3EVIA 4N11A 4YQUA 1LU4A 4MCUA 2HYXA 3KTLA 1G7OA 3D22A 2RLIA 2HRFA 5JCUA 1M0UA 4K2XA 2VAFA 3IBHA 4HEA2 5AIVA 3EMPA 4JE1A 1G6WA 2O89A 3H8QA 2GZYA 2R0GA 2TRXA 1F37A 2KUCA 2DLXA 3IAS2 3DMLA 4X4JA 1KEBA 4JR4A 2R4VA 5GZZB 2FY6A 3VFIA 5DCGA 5ECHB 1T00A 3GUSA 1ZYQB 3HY2A 5DAKA 2K8VA 4TR0A 3ZL5A 3HVSA 3ME7A 3WD6A 3U5RE 3SBCA 2TRCP 3QMXA 1T8EB 1X9WB 1WPIA 2A2RA 3GH9A 2H1AA 3UVTA 6GSTA 1NHYA 2C3NA 3ZMLA 4F03A 2A2PA 3F6DA 1QUWA 5IOWA 2DJJA 3RBTA 3N9JA 3H4KA 1YJ6A 4YQMA 2IMDA 1V2AA 2I1UA 2XPEA 2MYGA 3QAVA 3FR6A 19GSA 4BVYA 3M3MA 3F3QA 3ZVJA 4I5QA 1EV9A 2HRAA 1U6TA 2WFCA 3KH9A 4Z2TA 3EU3A 2B5EA 4KDYA 4P3YB 1SKSB 1FHEA 3LGCA 3DD3A 2V6OA 5D9VA 3KMNA 2LNTA 5ECKB 3ERGA 4POKA 2C4JA 1MD4A 1U3AA 2LJAA 2NTOA 2REMA 4G0IA 1PA3A 2OKAA 1BAYA 1GNEA 3L9UA 2EIOA 5D8IA 1USBA 1VF1A 3G9BA 1X5DA 2L5OA 3R2QA 5A4VA 3UBKA 3A3TA 2HZFA 3L4NA 3DIEA 2E7PA 4N0ZA 3F6FA 5HR2A 2L57A 4BVXA 1A2LA 4YKGA 2K18A 2FWFA 3CMIA 1ERWA 2GS3A 3L9SA 4I2TA 1GRXA 1S3RA 1SD9A 4HJ2A 1XZOA 5KN2A 4L0UA 4K7NA 3C1SA 4CDOA 2M80A 1E6BA 4KH7A 4KDXA 1YZXA 1K0AA 2OJLA 3IRAA 1O73A 3IC8A 4LMVA 3HXSA 4V1Ap 4N30A 2YOIA 1LJRA 2O7KA 3GTUB 3ZIJA 1A24A 3EYTA 5HR3A 4TW5A 5ABRA 3LEFA 4F2IA 1T3BA 4FO5A 3C8EA 3CSIA 1OYJA 3FR3A 5INYA 5IQYA 4TR3A 5DALA 3D0ZA 3EURA 1F9MA 1M99A 1XVQA 2YN1A 3ZITA 3TJJA 2B6MA 4G19A 5IIZA 1GH2A 3NIVA 5IO2A 1O85A 2PBJA 5DQSA 1XG8A 1FG4A 1HNCA 4TKYA 2HNLA 5IMAA 3I69A 1ZL9A 3IPZA 3H93A 1J0FA 1O8WA 4OCEA 3R3EA 1QXHA 2YJHA 4KB3A 4RUVA 4NHWA 4EDZA 1XWCA 3FMWA 3M9KA 1IYHA 3GNJA 1GUKA 2D2ZA 4KCAA 5D9WA 3EC3A 4NAXA 2N5AA 1PL2A 2JACA 3ZVJD 3SWLA 2B1LA 2WRTA 1R4WA 2LUSA 2ZUPA 1OC9B 3MAKA 2P5RA 1Z7RA 1PX7A 1YKCA 3J7Yk 1OKDA 4KF9A 1YEPA 10GSA 3IK7A 5G30A 1E2YA 4BPYA 4ZXGA 1FOVA 2ES7A 1JFUA 5IO0A 1S3DA 2VCTA 5IPGA 4XIHA 5G1LA 1Y6EA 2FA4A 4TXOA 1NHOA 4DSSA 3LW9A 1HD2A 4EIPA 3TKSE 4PUFC 4J57E 5GSTA 4NV5A 4Q5RA 1A0RP 4ZB9A 5BRTA 1QQ2A 2FGXA 2N5BA 3KCMA 3RPNA 1TK0B 4XHMA 1Z7PA 3QD9A 1R26A 4PUAA 3GSTA 1PN9A 3D5JA 2CVKA 1PKWA 4F0BA 5ECRB 2H74A 14GSA 4ISDA 1S3CA 1ZGNA 2DSAA 5CREA 1TTZA 2X64A 4AJ6A 1AC1A 1M3IA 3CRUA 2CX3A 5DBQA 3F3RA 3EMXA 2OBIA 2WB9A 2MBTA 3KD0A 1RW1A 3TKSC 3EINA 1XVWA 4ZL8A 1TI3A 4ZL9A 2VLUA 2AV4A 1S3AA 4ILFA 1BEDA 2GSTA 4HQZA 4HQSA 2JZTA 1T4YA 3E9JB 1U88A 3BJ5A 5G31A 1ERUA 4J2FA 1GSYA 2KOKA 4ECCA 2MZCA 3W6GA 2R2JA 1CQHA 4KSOA 4O5RA 4XS4B 2XHFA 1U3IA 3CTFA 2HXKA 4WBJA 2FNOA 2YWIA 3KXOA 4YAPA 1JZDA 2F3MA 3GURA 2PVQA 5G5FA 5ECQB 1QK8A 2JZRA 5ECIB 4A5PA 1EGOA 1T4ZA 2QKEA 1X5EA 2KP1A 1YEXA 3I6AA 4K0GA 4PQIA 1TRVA 4CW9A 3VK9A 4NWYA 2C0EA 2H75A 2DKHA 2GQKA 2IPAA 3FZ9A 2PERA 3UL3A 2VL3A 4MA9A 1ERVA 4EUYA 5KN3A 3IR4A 2V2GA 3UMAA 3TOUA 3D4TA 3C7MA 5IMCA 2ZCTA 1FW1A 3A5IA 2AUVA 2R3XA 4HOJA 4O7HA 1JLWA 3WGEA 4IQ1A 4EC0A 4ZB6A 5B6MA 4JZQA 4H86A 1B8XA 2YNXA 3ZLPA 1PN0A 3QAWA 4MLYA 3GKXA 1UA5A 4ZBBA 3LSZA 3UAPA 5LCZA 1ZCPA 4XRDA 4LL1B 5D9TA 5G1KA 1FVJA 4FYBA 3F4RA 4CY6A 2H6ZA 2KLXA 1Q4JA 3D4MA 1BQ7A 4L8EA 3P90A 3CRTA 4KAEA 3AY8A 5DAKB 5J5NA 4KUNA 5G5EA 4Z2UA 4MNNA 2OACA 2OE1A 2VCVA 5A4WA 3APOA 2F8FA 3PINA 2VOCA 4GF0A 2PVOC 2L6CA 3LYKA 4MF7A 1ZOFA 1MDJA 3RPPA 1HNBA 4MH2A 3HD5A 5DJLA 3APQA 4OFTA 4MZBA 2DKIA 1XWGA 2A2SA 2VCQA 2JL4A 2CAIA 2XBQA 4ZILA 5A5KA 2B5YA 3BBYA 2YWOA 1R5PA 3CSJA 1K0NA 1EV4A 4BVYB 2OA7A 1EWXA 1GLQA 2QC7A 1SK1A 2C1YA 2LTKA 2PUKC 3ZYWA 2CT6A 3RAZA 3QDNA 1GUMA 2V32A 4MABA 4XTSA 5EL8A 3QOUA 5JWRB 1OE7A 2OADA 2CX4A 2QGVA 5AN1A 1WP0A 3ZFBA 3IHQA 1Y25A 3PH9A 1T7PB 3ME8A 3L0HA 4QQ7A 2KHPA 1X0RA 3I9V2 2H6XA 2H8LA 1PKZA 1THOA 3DVXA 5KOXA 2B5XA 3WYWA 5DJMA 5J4UA 5ECLB 3F8UA 4IHUA 1WWJA 4HS1A 1M9AA 3KIJA 4NPBA 1B4QA 5ELAA 1THXA 1A8YA 3BOAA 2VCXA 4MF5A 5JWQB 1XWAA 4BVXB 2H1DA 2YV7A 3E3EA 2GZPA 4MP4A 2GQLA 3ZRDA 1F2EA 3HZ4A 2JSYA 3TGZA 3O76A 3UEMA 4DSRA 4N0VA 1GNWA 4PURA 1DBYA 2FCHA 3UARA 1GTAA 6GSSA 1F3AA 3VWUA 4MMMA 2H70A 1TRSA 4POBA 5KEJA 1QMVA 4ZIJA 4O5QA 1Z5YE 3KP9A 1VF3A 5ECNB 2DC5A 4I97A 2EC4A 2L59A 1SL0B 2X8GA 4LLRA 1SL1B 4TN8A 1AQXA 2C0GA 5CAXA 1F6MC 1PSQA 3IV4A 3TKQA 5EPFA 3M8NA 5DALB 1TK5B 2VCWA 5HR0A 1BJXA 4WKWA 1XWKA 2MBSA 4O32A 2K8SA 1ZMAA 4EO3A 1GSDA 1YF1A 2DJ0A 4MF6A 1WMJA 4AJ8A 3DVWA 2L4CA 4TRXA 4HZ2A 2RM6A 3EU4A 3C1RA 1U87A 4ULXA 3LJRA 1HQOA 1XW6A 4FQUA 3UBLA 2IMFA 4K6XA 4HU9A 3DWVA 2C8UA 4JRRA 3P7XA 2DBCA 6GSWA 3VI5A 1O6JA 4OFMA 2PN8A 1UC7A 3JCML 4YQVA 1LBKA 3S9FA 5LNKe 3MSZA 4GRFA 4JU5A 1N8JA 4WETA 3EPTA 2H0IA 3VPTA 3LXZA 4JEDA 4EF0A 3U6VA 2G0FA 4BWQA 3GYKA 5IMDA 2RIIA 2TIRA 2IL3A 4MJEA 1IYIA 2CAQA 3GSSA 1VF4A 4TXOB 5AISA 4G0KA 4DSSB 2N5FA 1GTBA 2HFDA 2F8AA 5H5SA 3IE3A 3QPMA 2X8HA 3TUEA 3FW2A 4MZWA 2VD0A 3A2XA 2AAWA 1F3BA 2GSSA 1KNGA 3LWAA 2LQQA 3M0FA 4HSCX 2ON7A 4IQAA 4GTUA 5H5RA 3VWVA 4RQXA 3DXBA 2LV3A 1MTCA 3GL5A 1AXDA 4EKZA 2FA8A 1K0DA 1CQGA 3UIWA 2WS2A 3W8SA 1KTEA 4IVFA 3FRCA 2LJKA 1MEKA 5CYYA 4K7IA 5J9BA 1TU7A 4IJIA 2EIRA 2X8CA 1ERTA 1EEMA 2G2QA 3HHVA 1H4OA 3HVNA 1SK0A 2VLTA 3HVXA 2VL2C 1YF0A 3KJYA 2WJUA 1BX9A 2IMEA 2HRNA 4YH2A 2DMLA 3APSA 2H1GA 3F4TA 1OAZA 4GQFA 4RI6A 5D96A 3RDWA 4OWYA 2X99A 2VM2A 2X4AA 2P31A 4NXIA 1AQWA 3GKMA 3ZMKA 1AAZA 5CRGA 2HI7A 4GQCA 3IK9A 4ZBAA 1V57A 12GSA 4KE3A 1Z6MA 4F9ZA 1O81A 20GSA 5JCWA 1Z3EA 1GLPA 2YWNA 2FLSA 3DRNA 1FAAA 1EOHA 1OC8A 2YPMA 2JZSA 1MD3A 2H0HA 2NDOA 3IOSA 3KZQA 4EVMA 4OFNA 5A4UA 2R0PA 1TDIA 1SK2A 5DQYA 2LRNA 1B4PA 3O3TA 2BMXA 4ZL7A 3PR8A 1VRSD 1GWCA 2YWMA 3MIXA 3TKSA 1NSWA 4LA1A 3MWHA 1GSSA 1ZZYA 4DVCA 3C71A 2FWHA 1XCCA 2O85A 4TXVA 3TCOA 1PD21 2O8VB 3QR6A 1UN2A 5EVOA 1K0CA 4KDUA 4G9HA 4LMWA 4KA0A 1SJ6A 3G7JA 2F9SA 2IFQA 3H1NA 2XC2A 2B3SA 4CY8A 2L6DA 4GXZA 4XCSA 4I2UA 1Z9HA 4ECBA 2GT5A 4D73A 3GN3A 3NZNA 2C80A 1V40A 2JSZA 2LKUA 2J23A 18GSA 2VUPA 4J56E 1YQ1A 1X9SB 3P2AA 2P5QA 4KCEA 4Z7XA 5J3RA 4N10A 1SKWB 4Q5QA 1ZYPA 3HYPA 1SYRA 5EY6A 2O87A 3VWWA 1ABAA 5ECMB 2JADA 1A23A 1Z6NA 2H1BA 4MK3A 4GCIA 11GSA 2GSRA 1MDKA 1PMTA 3GKNA 2RUEA 1GTIA 1TI1A 5L71A 1Q98A 2DJKA 3KP8A 3QFAC 2QA2A 3HJMA 3HVVA 2MMNA 3IC4A 1M3JA 3CXGA 4OMVA 5ID2A 5E4WA 2AJQB 3VURA 4L0WA 1N2AA 1SKRB 3ZIVA 4AJ7A 4AF2A 2VD1A 2HZEA 3VI7A 2PU9C 5GAPD 2AHEA 3VLNA 2H6YA 2OE3A 3EE2A 1J9BA 4MH3A 1XW5A 4ICYA 1EOGA 4MJBA 3A2WA 1XIYA 4AGSA 1J08A 1O7UA 5ECSA 3E0UA 2H01A 2C3QA 4GSTA 4K5SA 4MJAA 1ACVA 5IMZA 3DYRA 3TRPA 3ZREA 1R7HA 1V58A 4O92A 4V2NA 2K6VA 3FY7A 2YZHA 2LS5A 1XFLA 1M2AA 2FWGA 3IA1A 2LQOA 1TRWA 5IPHA 3CQFA 3DKSA 2V6KA 5H5QA 5LD0A 3G7IA 1PL1A 4KX4A 3GA4A 1EP7A 3QFBC 5E59A 1JHBA 4OCFA 4ML1A 3WT2A 2CZ3A 3TRQA 1TW9A 1SU9A 4OD7A 5CRDA 2GSQA 16GSA 2HSMA 1KBNA 3VPQA 2H71A 5IMFA 2LJRA 3BCKA 5KOWA 2H0GA 4G2EA 3WT1A 3KEBA 4E8HA 4EDYA 2DJ2A 1SYXA 1K0BA 4E8EA 2VM1A 2IIYA 4QL9A 4K9ZA 4ECIA 2C0FA 4ML6A 1TU8A 5GAND 2IJYA 3UVHA 2IN3A 4ECJA 4XS6A 5KN0A 2VLVA 4IP6A 2MMOA 2CV4A 2PWJA 2IWTA 2LRTA 4TVEA 3V1WA 1MDIA 1TKDB 2HSHA 3MDKA 4Z2RA 4BL7A 2FUG2 4Q5FA 2LSTA 4YKFA 4Q5NA 3UJ1A 3F63A 2M72A 2I4AA 6GSYA 4TR1A 3LYPA 3OR5A 4GSNA 6GSVA 2YCDA 4USSA 3ISOA 1M9BA 4HUAA 3NOFA 4KGIA 1ST9A 1I5GA 3CBUA 5D9XA 2HLSA 4PNGA 1K3OA 1XWBA 2PPTA 4HU7A 4BIKA 3ERWA 1SENA 2FD3A 2B1KA 4MJCA 1GULA 3BCIA 3GX0A 2C0DA 2LRCA 2R37A 2NVLA 2M46A 2B7JA 4WEYA 3GL3A 1GSUA 3DEXA 3IXRA 4OO5A 3WGXA 2F51A 4DEJA 2ALBA 4K1FA 1PRXA 4V2LA 3QAGA 3UOMA 2E2GA 4PXOA 1I9DA 1PGTA 4WR4A 2WZ9A 1YDKA 2AYTA 4DSQA 3FHKA 4FYUA 2L5LA 3RHBA 5B7CA 2GQMA 4PQHA 2I3YA 1JZRA 4GLTA 2CZ2A 3TJKA 5DCHA 1BG5A 1YY7A 3ZZXA 4KNDA 1A2JA 4FH8A 4GSSA 4ZB8A 1WJKA 4TR4A 4PX1A 1OE8A 3Q74A 2WCIA 4L5OA 4NV2A 2J9HA 1B9YC 5ECOB 1VF2A 4BWSA 5HR1A 3GHAA 1GP1A 2RM5A 4L5LA 4NMUA 5D73A 4X43A 1SL2B 4MPGA 1URMA 3ERFA 5CRWA 4WBRD 1XPVA 4ZBDA 1FB6A 2LNSA 1M7TA 4CHSA 3F4SA 2YJ7A 4V1Ag 2GT6A 3Q6OA 1DUGA 1JZOA 1DE1A 3TDGA 5F0GA 4BA7A 3A5WA 1WOUA 1WIKA 1OC3A 2YANA 5F06A 1ILOA 3FK8A 2FWEA 5F07A 1TK8B 4IGJA 3FYGA 1H75A 2PMTA 13GSA 2VO4A 4PGTA 2B7KA 1PFOA 4IS0A 4F82A
chains in the Genus database with same CATH topology
2P0GA 1TP9A 3TKRA 1TJDA 3FKFA 2V1MA 1AQVA 2I81A 4WXTA 1GTUA 4V2MA 4EL1A 1GSQA 2HE3A 4MZCA 5CP1A 4O5UA 3KH7A 2H30A 1NM3A 3PGTA 2VIMA 3F9UA 3P8WA 4IBPA 3GV1A 2MMAA 2BTOT 3LORA 4IKHA 4K8MA 5HFGA 1DSBA 1AW9A 1M2DA 3FEUA 4MDCA 22GSA 5AIXA 1XXUA 3KTBA 5C00A 1XBSA 4HDEA 3M1GA 1GSEA 2Z9SA 3TJBA 2R0CA 2H73A 5IMVA 4IP1A 1K0MA 1K0OA 4IJ3A 1EZKA 1G6YA 1WE0A 2DJ3A 3TJFA 1QGVA 2XBIA 1XW9A 3IHGA 4FIWA 3VWXA 17GSA 4POMA 2V41A 4KSMA 3MNGA 3LXTA 2H72A 1GL8A 3O6TA 3HDCA 3HJOA 3QCPA 5COHA 2R5GA 2NBSA 5ECPB 4X1UA 5F8BA 1K3YA 2VL2A 2BJXA 1RK4A 4JR6A 4IN0A 2NPBA 3HA9A 2E2MA 1V9WA 1JZWA 3GTUA 1UVZA 2IFQB 3FR9A 2IMIA 1RQMA 3CYNA 3ZFLA 3CSHA 3N5OA 4K5RA 3KGKA 3IAM2 3F0IA 5ENUA 2WDUA 4RQRA 1FOHA 4D73B 3BD2A 1C72A 2PGTA 5B6NA 1TXXA 1M2BA 5CO3A 4PNFA 4K7OA 3LG6A 1T1VA 4GWRA 3GX8A 2GTUA 2GGTA 1W4VA 4I6XA 4YAVA 5JCGA 4QL7A 5CRHA 3C73A 1AIUA 4F0CA 1X9MB 3HCZA 2A4HA 3GFKA 4XRAA 5HFKA 2ZNMA 2EIQA 1ZYEA 3EWLA 4EIQA 3Q19A 3H79A 2GZZA 3LQ7A 5ELGA 2JU5A 3FZAA 5BMUA 4G10A 4ACSA 4HI7A 4IELA 6GSUA 5DDLA 4I8BA 4POLA 1WRYA 4WF4A 2IMKA 5B8BA 5ID2B 1HNAA 5B8AA 1OC9A 2HZEB 3J7Yb 2DIYA 1XOBA 6GSXA 4XS1A 1NW2A 4RI7A 5CNWA 5IOXA 2YZUA 2E0QA 4OO4A 1ML6A 2OBKA 3CTGA 5F05A 3HJPA 5JWOB 3WGDA 4JBBA 3HZ8A 4WR5A 1TOFA 1VGLA 2DMMA 2VCZA 3I43A 1V98A 3D21A 1XOAA 2X49A 5FT3A 4K0NA 4PQ1A 3RHCA 5AGYA 1FVKA 3ED3A 1ZYNA 3DGQA 5C04A 3GRXA 4HJMA 3MYDA 3ZTLA 4X0XA 4TOPA 1W89A 1TRUA 3D6IA 4EXJA 2HRKA 3GMFA 4KW6A 5KN1A 1OKTA 2WULA 5J9CA 2H76A 1PQNA 3HKRA 4K2DA 4FYCA 5J41A 1G0TA 8GSSA 3L9VA 4NHZA 5HFIA 2GVPA 3M9JA 1EGRA 4G0LA 1R5AA 3IDVA 2C3TA 4MPFA 2HT9A 2YP6A 5DVBA 2GDRA 2VL9A 1DE2A 3TB2A 2WGRA 2QSIA 1BYEA 1JLVA 5HQPA 1GSFA 2DJ1A 1HYUA 2CVDA 3L78A 3TJGA 2H19A 1SJZA 2CA8A 9GSSA 2MMZA 1GUHA 1ON4A 2XPDA 2DIZA 3GH6A 1O8XA 2YV9A 2GLRA 2FHEA 4BL7B 3K8NA 3G7YA 1AUCA 1EP8A 3GKKA 2RUFA 2CVBA 5G2ZA 4LL4B 4XS4A 3KM6A 2OE0A 1YKAA 1B9XC 4TR1B 3A2VA 3TKPA 2L4QA 1FB0A 1SD8A 3KMOA 2HSYA 7GSSA 2A4VA 3Q18A 3LFLA 3FZ5A 3TRXA 1G7EA 5IM9A 1FO5A 1X5CA 3PPUA 5FWGA 1K3LA 2K9FA 1QFNA 2ON5A 2LEGA 3W8JA 1A0FA 2R6KA 4ID0A 5D93A 5GSSA 2I9HA 2AB6A 1OVNA 2CQ9A 1PX6A 4EE0A 3GIXA 5FHIA 1SJIA 1EEJA 1B48A 2QA1A 2KP2A 4IW9A 1A2MA 4PTSA 4WF5A 4HZ4A 1A8LA 2H66A 3TOTA 3US3A 2UZ8A 3FZ4A 3EVIA 4N11A 4YQUA 1LU4A 4MCUA 2HYXA 3KTLA 1G7OA 3D22A 2RLIA 2HRFA 5JCUA 1M0UA 4K2XA 2VAFA 5AIVA 3IBHA 4HEA2 3EMPA 4JE1A 1G6WA 2O89A 3H8QA 2GZYA 2R0GA 2TRXA 1F37A 2KUCA 2DLXA 3IAS2 3DMLA 4X4JA 1KEBA 4JR4A 2R4VA 5GZZB 2FY6A 3VFIA 5DCGA 5ECHB 1T00A 3GUSA 1ZYQB 3HY2A 5DAKA 2K8VA 4TR0A 3ZL5A 3HVSA 3ME7A 3WD6A 3U5RE 3SBCA 2TRCP 3QMXA 1T8EB 1X9WB 1WPIA 2A2RA 3GH9A 2H1AA 3UVTA 6GSTA 1NHYA 2C3NA 3ZMLA 4F03A 2A2PA 3F6DA 1QUWA 5IOWA 2DJJA 3RBTA 3N9JA 3H4KA 1YJ6A 4YQMA 2IMDA 1V2AA 2I1UA 2XPEA 2MYGA 3QAVA 3FR6A 19GSA 4BVYA 3M3MA 3F3QA 3ZVJA 4I5QA 1EV9A 2HRAA 1U6TA 2WFCA 3KH9A 4Z2TA 3EU3A 2B5EA 4KDYA 4P3YB 1SKSB 1FHEA 3LGCA 3DD3A 2V6OA 5D9VA 3KMNA 2LNTA 5ECKB 3ERGA 4POKA 2C4JA 1MD4A 1U3AA 2LJAA 2NTOA 2REMA 4G0IA 1PA3A 2OKAA 1BAYA 1GNEA 3L9UA 2EIOA 5D8IA 1USBA 1VF1A 3G9BA 1X5DA 2L5OA 3R2QA 5A4VA 3UBKA 3A3TA 2HZFA 3L4NA 3DIEA 2E7PA 4N0ZA 3F6FA 5HR2A 2L57A 4BVXA 1A2LA 4YKGA 2K18A 2FWFA 3CMIA 1ERWA 2GS3A 3L9SA 4I2TA 1GRXA 1SD9A 4HJ2A 1XZOA 5KN2A 4L0UA 4K7NA 3C1SA 4CDOA 2M80A 1E6BA 4KH7A 4KDXA 1YZXA 1K0AA 2OJLA 3IRAA 1O73A 3IC8A 4LMVA 3HXSA 4V1Ap 4N30A 2YOIA 1LJRA 2O7KA 3GTUB 3ZIJA 1A24A 3EYTA 5HR3A 4TW5A 5ABRA 3LEFA 4F2IA 1T3BA 4FO5A 3C8EA 3CSIA 1OYJA 3FR3A 5INYA 5IQYA 4TR3A 5DALA 3D0ZA 3EURA 1F9MA 1M99A 1XVQA 2YN1A 3ZITA 3TJJA 2B6MA 4G19A 5IIZA 1GH2A 3NIVA 5IO2A 1O85A 2PBJA 5DQSA 1FG4A 1HNCA 4TKYA 2HNLA 5IMAA 3I69A 1ZL9A 3IPZA 3H93A 1J0FA 1O8WA 4OCEA 3R3EA 1QXHA 2YJHA 4KB3A 4RUVA 4NHWA 4EDZA 1XWCA 3FMWA 3M9KA 1IYHA 3GNJA 1GUKA 2D2ZA 4KCAA 5D9WA 3EC3A 4NAXA 2N5AA 1PL2A 2JACA 3ZVJD 3SWLA 2B1LA 2WRTA 1R4WA 2LUSA 2ZUPA 1OC9B 3MAKA 2P5RA 1Z7RA 1PX7A 1YKCA 3J7Yk 1OKDA 4KF9A 1YEPA 10GSA 3IK7A 5G30A 1E2YA 4BPYA 4ZXGA 1FOVA 2ES7A 1JFUA 5IO0A 1S3DA 2VCTA 5IPGA 4XIHA 5G1LA 1Y6EA 2FA4A 4TXOA 1NHOA 4DSSA 3LW9A 1HD2A 4EIPA 3TKSE 4PUFC 4J57E 5GSTA 4NV5A 4Q5RA 1A0RP 4ZB9A 5BRTA 1QQ2A 2FGXA 2N5BA 3KCMA 3RPNA 1TK0B 4XHMA 1Z7PA 3QD9A 1R26A 4PUAA 3GSTA 1PN9A 3D5JA 2CVKA 1PKWA 4F0BA 5ECRB 2H74A 14GSA 4ISDA 1S3CA 1ZGNA 2DSAA 5CREA 1TTZA 2X64A 4AJ6A 1AC1A 3CRUA 2CX3A 5DBQA 3F3RA 3EMXA 2OBIA 2WB9A 2MBTA 3KD0A 1RW1A 3TKSC 3EINA 1XVWA 4ZL8A 1TI3A 4ZL9A 2VLUA 2AV4A 1S3AA 4ILFA 1BEDA 2GSTA 4HQZA 4HQSA 2JZTA 1T4YA 3E9JB 1U88A 3BJ5A 5G31A 1ERUA 4J2FA 1GSYA 2KOKA 4ECCA 2MZCA 3W6GA 2R2JA 1CQHA 4KSOA 4O5RA 4XS4B 2XHFA 1U3IA 3CTFA 2HXKA 4WBJA 2FNOA 2YWIA 3KXOA 4YAPA 1JZDA 2F3MA 3GURA 2PVQA 5G5FA 5ECQB 1QK8A 2JZRA 5ECIB 4A5PA 1EGOA 1T4ZA 2QKEA 1X5EA 2KP1A 1YEXA 3I6AA 4K0GA 4PQIA 1TRVA 4CW9A 3VK9A 4NWYA 2C0EA 2H75A 2DKHA 2GQKA 2IPAA 3FZ9A 2PERA 3UL3A 2VL3A 4MA9A 1ERVA 4EUYA 5KN3A 3IR4A 2V2GA 3UMAA 3TOUA 3D4TA 3C7MA 5IMCA 2ZCTA 1FW1A 3A5IA 2AUVA 2R3XA 4HOJA 4O7HA 1JLWA 3WGEA 4IQ1A 4EC0A 4ZB6A 5B6MA 4JZQA 4H86A 1B8XA 2YNXA 3ZLPA 1PN0A 3QAWA 4MLYA 3GKXA 1UA5A 4ZBBA 3LSZA 3UAPA 5LCZA 1ZCPA 4XRDA 4LL1B 5D9TA 5G1KA 1FVJA 4FYBA 3F4RA 4CY6A 2H6ZA 2KLXA 1Q4JA 3D4MA 1BQ7A 4L8EA 3P90A 3CRTA 4KAEA 3AY8A 5DAKB 5J5NA 4KUNA 5G5EA 4Z2UA 4MNNA 2OACA 2OE1A 2VCVA 5A4WA 3APOA 2F8FA 3PINA 2VOCA 4GF0A 2PVOC 2L6CA 3LYKA 4MF7A 1ZOFA 1MDJA 3RPPA 1HNBA 3HD5A 4MH2A 5DJLA 3APQA 4OFTA 4MZBA 2DKIA 1XWGA 2A2SA 2VCQA 2JL4A 2CAIA 2XBQA 4ZILA 5A5KA 2B5YA 3BBYA 2YWOA 1R5PA 3CSJA 1K0NA 1EV4A 4BVYB 2OA7A 1EWXA 1GLQA 2QC7A 1SK1A 2C1YA 2LTKA 2PUKC 3ZYWA 2CT6A 3RAZA 3QDNA 1GUMA 2V32A 4MABA 4XTSA 5EL8A 3QOUA 5JWRB 1OE7A 2OADA 2CX4A 2QGVA 5AN1A 1WP0A 3ZFBA 3IHQA 1Y25A 3PH9A 1T7PB 3ME8A 3L0HA 4QQ7A 2KHPA 1X0RA 3I9V2 2H6XA 2H8LA 1PKZA 1THOA 3DVXA 5KOXA 2B5XA 3WYWA 5DJMA 5J4UA 5ECLB 3F8UA 4IHUA 1WWJA 4HS1A 1M9AA 3KIJA 4NPBA 1B4QA 5ELAA 1THXA 1A8YA 3BOAA 2VCXA 4MF5A 5JWQB 1XWAA 4BVXB 2H1DA 2YV7A 3E3EA 2GZPA 4MP4A 2GQLA 3ZRDA 1F2EA 3HZ4A 2JSYA 3TGZA 3O76A 3UEMA 4DSRA 4N0VA 1GNWA 4PURA 1DBYA 2FCHA 3UARA 1GTAA 6GSSA 1F3AA 3VWUA 4MMMA 2H70A 1TRSA 4POBA 5KEJA 1QMVA 4ZIJA 4O5QA 1Z5YE 3KP9A 1VF3A 5ECNB 2DC5A 4I97A 2EC4A 2L59A 1SL0B 2X8GA 4LLRA 1SL1B 4TN8A 1AQXA 2C0GA 5CAXA 1F6MC 1PSQA 3IV4A 3TKQA 5EPFA 3M8NA 5DALB 1TK5B 2VCWA 5HR0A 1BJXA 4WKWA 1XWKA 2MBSA 4O32A 2K8SA 1ZMAA 4EO3A 1GSDA 1YF1A 2DJ0A 4MF6A 1WMJA 4AJ8A 3DVWA 2L4CA 4TRXA 4HZ2A 2RM6A 3EU4A 3C1RA 1U87A 4ULXA 3LJRA 1HQOA 1XW6A 4FQUA 3UBLA 2IMFA 4K6XA 4HU9A 3DWVA 2C8UA 4JRRA 3P7XA 2DBCA 6GSWA 3VI5A 1O6JA 4OFMA 2PN8A 1UC7A 3JCML 4YQVA 1LBKA 3S9FA 5LNKe 3MSZA 4GRFA 4JU5A 1N8JA 4WETA 3EPTA 2H0IA 3VPTA 3LXZA 4JEDA 4EF0A 3U6VA 2G0FA 4BWQA 3GYKA 5IMDA 2RIIA 2TIRA 2IL3A 4MJEA 1IYIA 2CAQA 3GSSA 1VF4A 4TXOB 5AISA 4G0KA 4DSSB 2N5FA 1GTBA 2HFDA 2F8AA 5H5SA 3IE3A 3QPMA 2X8HA 3TUEA 3FW2A 4MZWA 2VD0A 3A2XA 2AAWA 1F3BA 2GSSA 1KNGA 3LWAA 2LQQA 3M0FA 2ON7A 4IQAA 4GTUA 5H5RA 3VWVA 4RQXA 3DXBA 2LV3A 1MTCA 3GL5A 1AXDA 4EKZA 2FA8A 1K0DA 1CQGA 3UIWA 2WS2A 3W8SA 1KTEA 4IVFA 3FRCA 2LJKA 1MEKA 5CYYA 4K7IA 5J9BA 1TU7A 4IJIA 2EIRA 2X8CA 1ERTA 1EEMA 2G2QA 3HHVA 1H4OA 1SK0A 2VLTA 3HVXA 2VL2C 1YF0A 3KJYA 2WJUA 1BX9A 2IMEA 2HRNA 4YH2A 2DMLA 3APSA 2H1GA 3F4TA 1OAZA 4GQFA 4RI6A 5D96A 3RDWA 4OWYA 2X99A 2VM2A 2X4AA 2P31A 4NXIA 1AQWA 3GKMA 3ZMKA 1AAZA 5CRGA 2HI7A 4GQCA 3IK9A 4ZBAA 1V57A 12GSA 4KE3A 1Z6MA 4F9ZA 1O81A 20GSA 5JCWA 1Z3EA 1GLPA 2YWNA 2FLSA 3DRNA 1FAAA 1EOHA 1OC8A 2YPMA 2JZSA 1MD3A 2H0HA 2NDOA 3IOSA 3KZQA 4EVMA 4OFNA 5A4UA 2R0PA 1TDIA 1SK2A 5DQYA 2LRNA 1B4PA 3O3TA 2BMXA 4ZL7A 3PR8A 1VRSD 1GWCA 2YWMA 3MIXA 3TKSA 1NSWA 4LA1A 3MWHA 1GSSA 1ZZYA 4DVCA 3C71A 2FWHA 1XCCA 2O85A 4TXVA 3TCOA 1PD21 2O8VB 3QR6A 1UN2A 5EVOA 1K0CA 4KDUA 4G9HA 4LMWA 4KA0A 1SJ6A 3G7JA 2F9SA 2IFQA 3H1NA 2XC2A 2B3SA 4CY8A 2L6DA 4GXZA 4XCSA 4I2UA 1Z9HA 4ECBA 2GT5A 4D73A 3GN3A 3NZNA 2C80A 1V40A 2JSZA 2LKUA 2J23A 18GSA 2VUPA 4J56E 1YQ1A 1X9SB 3P2AA 2P5QA 4KCEA 4Z7XA 5J3RA 4N10A 1SKWB 4Q5QA 1ZYPA 3HYPA 1SYRA 5EY6A 2O87A 3VWWA 1ABAA 5ECMB 2JADA 1A23A 1Z6NA 2H1BA 4MK3A 4GCIA 11GSA 2GSRA 1MDKA 1PMTA 3GKNA 2RUEA 1GTIA 1TI1A 5L71A 1Q98A 2DJKA 3KP8A 3QFAC 2QA2A 3HJMA 3HVVA 2MMNA 3IC4A 3CXGA 4OMVA 5ID2A 5E4WA 2AJQB 3VURA 4L0WA 1N2AA 1SKRB 3ZIVA 4AJ7A 4AF2A 2VD1A 2HZEA 3VI7A 2PU9C 5GAPD 2AHEA 3VLNA 2H6YA 2OE3A 3EE2A 1J9BA 4MH3A 1XW5A 4ICYA 1EOGA 4MJBA 3A2WA 1XIYA 4AGSA 1J08A 1O7UA 5ECSA 3E0UA 2H01A 2C3QA 4GSTA 4K5SA 4MJAA 1ACVA 5IMZA 3DYRA 3TRPA 3ZREA 1R7HA 1V58A 4O92A 4V2NA 2K6VA 3FY7A 2YZHA 2LS5A 1XFLA 1M2AA 2FWGA 3IA1A 2LQOA 1TRWA 5IPHA 3DKSA 2V6KA 5H5QA 5LD0A 3G7IA 1PL1A 4KX4A 3GA4A 1EP7A 3QFBC 5E59A 1JHBA 4OCFA 4ML1A 3WT2A 2CZ3A 3TRQA 1TW9A 1SU9A 4OD7A 5CRDA 2GSQA 16GSA 2HSMA 1KBNA 3VPQA 2H71A 5IMFA 2LJRA 3BCKA 5KOWA 2H0GA 4G2EA 3WT1A 3KEBA 4E8HA 4EDYA 2DJ2A 1SYXA 1K0BA 4E8EA 2VM1A 2IIYA 4QL9A 4K9ZA 4ECIA 2C0FA 4ML6A 1TU8A 5GAND 2IJYA 3UVHA 2IN3A 4ECJA 4XS6A 5KN0A 2VLVA 4IP6A 2MMOA 2CV4A 2PWJA 2IWTA 2LRTA 4TVEA 3V1WA 1MDIA 1TKDB 2HSHA 3MDKA 4Z2RA 4BL7A 2FUG2 4Q5FA 2LSTA 4YKFA 4Q5NA 3UJ1A 3F63A 2M72A 2I4AA 6GSYA 4TR1A 3LYPA 3OR5A 4GSNA 6GSVA 2YCDA 4USSA 3ISOA 1M9BA 4HUAA 3NOFA 4KGIA 1ST9A 1I5GA 3CBUA 5D9XA 2HLSA 4PNGA 1K3OA 1XWBA 2PPTA 4HU7A 3ERWA 1SENA 2FD3A 2B1KA 4MJCA 1GULA 3BCIA 3GX0A 2C0DA 2LRCA 2R37A 2NVLA 2M46A 2B7JA 4WEYA 3GL3A 1GSUA 3DEXA 3IXRA 4OO5A 3WGXA 2F51A 4DEJA 2ALBA 4K1FA 1PRXA 4V2LA 3QAGA 3UOMA 2E2GA 4PXOA 1I9DA 1PGTA 4WR4A 2WZ9A 1YDKA 2AYTA 4DSQA 3FHKA 4FYUA 2L5LA 3RHBA 5B7CA 2GQMA 4PQHA 2I3YA 1JZRA 4GLTA 2CZ2A 3TJKA 5DCHA 1BG5A 1YY7A 3ZZXA 4KNDA 1A2JA 4FH8A 4GSSA 4ZB8A 1WJKA 4TR4A 4PX1A 1OE8A 3Q74A 2WCIA 4L5OA 4NV2A 2J9HA 1B9YC 5ECOB 1VF2A 4BWSA 5HR1A 3GHAA 1GP1A 2RM5A 4L5LA 4NMUA 5D73A 4X43A 1SL2B 4MPGA 1URMA 3ERFA 5CRWA 4WBRD 1XPVA 4ZBDA 1FB6A 2LNSA 1M7TA 4CHSA 3F4SA 2YJ7A 4V1Ag 2GT6A 3Q6OA 1DUGA 1JZOA 1DE1A 3TDGA 5F0GA 4BA7A 3A5WA 1WOUA 1WIKA 1OC3A 2YANA 5F06A 1ILOA 3FK8A 2FWEA 5F07A 1TK8B 4IGJA 3FYGA 1H75A 2PMTA 13GSA 2VO4A 4PGTA 2B7KA 4IS0A 4F82A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P0G A;  1TP9 A;  3TKR A;  1TJD A;  3FKF A;  2V1M A;  1AQV A;  2I81 A;  4WXT A;  1GTU A;  4V2M A;  4EL1 A;  1GSQ A;  2HE3 A;  4MZC A;  5CP1 A;  3KH7 A;  2H30 A;  1NM3 A;  3PGT A;  2VIM A;  3F9U A;  3P8W A;  4IBP A;  3GV1 A;  2MMA A;  2BTO T;  3LOR A;  4IKH A;  4K8M A;  5HFG A;  1DSB A;  1AW9 A;  1M2D A;  3FEU A;  4MDC A;  22GS A;  5AIX A;  1XXU A;  3KTB A;  5C00 A;  1XBS A;  4HDE A;  3M1G A;  1GSE A;  2Z9S A;  3TJB A;  2H73 A;  5IMV A;  4IP1 A;  1K0M A;  1K0O A;  4IJ3 A;  1EZK A;  1G6Y A;  1WE0 A;  2DJ3 A;  3TJF A;  1QGV A;  2XBI A;  1XW9 A;  4FIW A;  3VWX A;  17GS A;  4POM A;  2V41 A;  4KSM A;  3MNG A;  3LXT A;  2H72 A;  1GL8 A;  3O6T A;  3HDC A;  3HJO A;  3QCP A;  5COH A;  2R5G A;  2NBS A;  5ECP B;  4X1U A;  5F8B A;  1K3Y A;  2VL2 A;  2BJX A;  1RK4 A;  4JR6 A;  4IN0 A;  2NPB A;  3HA9 A;  2E2M A;  1V9W A;  1JZW A;  3GTU A;  1UVZ A;  2IFQ B;  3FR9 A;  2IMI A;  1RQM A;  3CYN A;  3ZFL A;  3CSH A;  3N5O A;  3KGK A;  3IAM 2;  3F0I A;  5ENU A;  2WDU A;  4RQR A;  4D73 B;  3BD2 A;  1C72 A;  2PGT A;  5B6N A;  1TXX A;  1M2B A;  5CO3 A;  4PNF A;  4K7O A;  3LG6 A;  1T1V A;  4GWR A;  3GX8 A;  2GTU A;  2GGT A;  1W4V A;  4I6X A;  4YAV A;  5JCG A;  4QL7 A;  5CRH A;  3C73 A;  1AIU A;  4F0C A;  1X9M B;  3HCZ A;  3GFK A;  4XRA A;  5HFK A;  2ZNM A;  2EIQ A;  1ZYE A;  3EWL A;  3Q19 A;  3H79 A;  2GZZ A;  3LQ7 A;  5ELG A;  2JU5 A;  3FZA A;  4G10 A;  4ACS A;  4HI7 A;  4IEL A;  6GSU A;  5DDL A;  4I8B A;  4POL A;  1WRY A;  4WF4 A;  2IMK A;  5B8B A;  5ID2 B;  1HNA A;  5B8A A;  1OC9 A;  2HZE B;  3J7Y b;  2DIY A;  1XOB A;  6GSX A;  4XS1 A;  1NW2 A;  4RI7 A;  5CNW A;  5IOX A;  2YZU A;  2E0Q A;  4OO4 A;  1ML6 A;  2OBK A;  3CTG A;  5F05 A;  3HJP A;  5JWO B;  3WGD A;  4JBB A;  3HZ8 A;  4WR5 A;  1TOF A;  1VGL A;  2DMM A;  2VCZ A;  3I43 A;  1V98 A;  3D21 A;  1XOA A;  5FT3 A;  4K0N A;  4PQ1 A;  3RHC A;  5AGY A;  1FVK A;  3ED3 A;  3DGQ A;  5C04 A;  3GRX A;  4HJM A;  3ZTL A;  4X0X A;  4TOP A;  1W89 A;  1TRU A;  3D6I A;  4EXJ A;  3GMF A;  4KW6 A;  5KN1 A;  1OKT A;  2WUL A;  5J9C A;  2H76 A;  1PQN A;  3HKR A;  4K2D A;  4FYC A;  5J41 A;  1G0T A;  8GSS A;  3L9V A;  4NHZ A;  5HFI A;  2GVP A;  3M9J A;  1EGR A;  1R5A A;  3IDV A;  2C3T A;  4MPF A;  2HT9 A;  2YP6 A;  5DVB A;  2GDR A;  2VL9 A;  1DE2 A;  3TB2 A;  2WGR A;  2QSI A;  1BYE A;  1JLV A;  5HQP A;  1GSF A;  2DJ1 A;  1HYU A;  2CVD A;  3L78 A;  3TJG A;  2H19 A;  1SJZ A;  2CA8 A;  9GSS A;  2MMZ A;  1GUH A;  1ON4 A;  2XPD A;  2DIZ A;  3GH6 A;  1O8X A;  2YV9 A;  2GLR A;  2FHE A;  3K8N A;  3G7Y A;  1AUC A;  1EP8 A;  3GKK A;  2RUF A;  2CVB A;  5G2Z A;  4LL4 B;  4XS4 A;  3KM6 A;  2OE0 A;  1YKA A;  1B9X C;  4TR1 B;  3A2V A;  3TKP A;  2L4Q A;  1FB0 A;  1SD8 A;  3KMO A;  2HSY A;  7GSS A;  2A4V A;  3Q18 A;  3LFL A;  3FZ5 A;  3TRX A;  1G7E A;  5IM9 A;  1FO5 A;  1X5C A;  5FWG A;  1K3L A;  2K9F A;  1QFN A;  2ON5 A;  2LEG A;  3W8J A;  1A0F A;  2R6K A;  4ID0 A;  5D93 A;  5GSS A;  2I9H A;  2AB6 A;  1OVN A;  2CQ9 A;  1PX6 A;  4EE0 A;  3GIX A;  5FHI A;  1SJI A;  1EEJ A;  1B48 A;  2KP2 A;  4IW9 A;  1A2M A;  4WF5 A;  4HZ4 A;  1A8L A;  2H66 A;  3TOT A;  3US3 A;  3FZ4 A;  3EVI A;  4N11 A;  4YQU A;  1LU4 A;  4MCU A;  2HYX A;  3KTL A;  1G7O A;  3D22 A;  2RLI A;  2HRF A;  5JCU A;  1M0U A;  2VAF A;  5AIV A;  3IBH A;  4HEA 2;  3EMP A;  4JE1 A;  1G6W A;  2O89 A;  3H8Q A;  2GZY A;  2TRX A;  1F37 A;  2KUC A;  2DLX A;  3IAS 2;  3DML A;  1KEB A;  4JR4 A;  2R4V A;  5GZZ B;  2FY6 A;  3VFI A;  5DCG A;  5ECH B;  1T00 A;  3GUS A;  1ZYQ B;  3HY2 A;  5DAK A;  2K8V A;  4TR0 A;  3ZL5 A;  3HVS A;  3ME7 A;  3WD6 A;  3U5R E;  3SBC A;  2TRC P;  3QMX A;  1T8E B;  1X9W B;  1WPI A;  2A2R A;  3GH9 A;  2H1A A;  3UVT A;  6GST A;  1NHY A;  2C3N A;  3ZML A;  4F03 A;  3F6D A;  1QUW A;  5IOW A;  2DJJ A;  3RBT A;  3N9J A;  3H4K A;  1YJ6 A;  4YQM A;  2IMD A;  1V2A A;  2I1U A;  2XPE A;  2MYG A;  3QAV A;  3FR6 A;  19GS A;  4BVY A;  3M3M A;  3F3Q A;  3ZVJ A;  4I5Q A;  1EV9 A;  1U6T A;  2WFC A;  3KH9 A;  3EU3 A;  2B5E A;  4KDY A;  4P3Y B;  1SKS B;  1FHE A;  3LGC A;  3DD3 A;  2V6O A;  5D9V A;  3KMN A;  2LNT A;  5ECK B;  3ERG A;  4POK A;  2C4J A;  1MD4 A;  1U3A A;  2LJA A;  2NTO A;  2REM A;  1PA3 A;  2OKA A;  1BAY A;  1GNE A;  3L9U A;  2EIO A;  5D8I A;  1USB A;  1VF1 A;  3G9B A;  1X5D A;  2L5O A;  3R2Q A;  5A4V A;  3UBK A;  3A3T A;  2HZF A;  3L4N A;  3DIE A;  2E7P A;  4N0Z A;  3F6F A;  5HR2 A;  2L57 A;  4BVX A;  1A2L A;  2K18 A;  2FWF A;  3CMI A;  1ERW A;  2GS3 A;  3L9S A;  4I2T A;  1GRX A;  1SD9 A;  4HJ2 A;  1XZO A;  5KN2 A;  4L0U A;  4K7N A;  3C1S A;  4CDO A;  2M80 A;  1E6B A;  4KH7 A;  4KDX A;  1YZX A;  1K0A A;  2OJL A;  3IRA A;  1O73 A;  4LMV A;  3HXS A;  4V1A p;  2YOI A;  1LJR A;  2O7K A;  4N30 A;  3GTU B;  3ZIJ A;  1A24 A;  3EYT A;  5HR3 A;  4TW5 A;  5ABR A;  3LEF A;  4F2I A;  1T3B A;  4FO5 A;  3C8E A;  3CSI A;  1OYJ A;  3FR3 A;  5INY A;  5IQY A;  4TR3 A;  5DAL A;  3D0Z A;  3EUR A;  1F9M A;  1M99 A;  1XVQ A;  2YN1 A;  3ZIT A;  3TJJ A;  2B6M A;  4G19 A;  5IIZ A;  1GH2 A;  3NIV A;  5IO2 A;  1O85 A;  2PBJ A;  5DQS A;  1FG4 A;  1HNC A;  4TKY A;  2HNL A;  5IMA A;  3I69 A;  1ZL9 A;  3IPZ A;  3H93 A;  1J0F A;  1O8W A;  4OCE A;  1QXH A;  2YJH A;  4KB3 A;  4RUV A;  4NHW A;  4EDZ A;  1XWC A;  3M9K A;  1IYH A;  3GNJ A;  1GUK A;  2D2Z A;  4KCA A;  5D9W A;  3EC3 A;  4NAX A;  2N5A A;  1PL2 A;  2JAC A;  3ZVJ D;  3SWL A;  2B1L A;  2WRT A;  1R4W A;  2LUS A;  2ZUP A;  1OC9 B;  3MAK A;  2P5R A;  1Z7R A;  1PX7 A;  1YKC A;  3J7Y k;  1OKD A;  10GS A;  1YEP A;  3IK7 A;  5G30 A;  1E2Y A;  4BPY A;  4ZXG A;  1FOV A;  2ES7 A;  1JFU A;  5IO0 A;  1S3D A;  2VCT A;  5IPG A;  4XIH A;  5G1L A;  1Y6E A;  2FA4 A;  4TXO A;  1NHO A;  4DSS A;  1HD2 A;  3TKS E;  4PUF C;  4J57 E;  5GST A;  4NV5 A;  4Q5R A;  1A0R P;  4ZB9 A;  1QQ2 A;  2FGX A;  2N5B A;  3KCM A;  3RPN A;  1TK0 B;  4XHM A;  1Z7P A;  3QD9 A;  1R26 A;  4PUA A;  3GST A;  1PN9 A;  3D5J A;  2CVK A;  1PKW A;  4F0B A;  5ECR B;  2H74 A;  14GS A;  4ISD A;  1S3C A;  1ZGN A;  2DSA A;  5CRE A;  1TTZ A;  2X64 A;  4AJ6 A;  1AC1 A;  3CRU A;  2CX3 A;  5DBQ A;  3F3R A;  3EMX A;  2OBI A;  2WB9 A;  2MBT A;  3KD0 A;  1RW1 A;  3TKS C;  3EIN A;  1XVW A;  4ZL8 A;  1TI3 A;  4ZL9 A;  2VLU A;  2AV4 A;  1S3A A;  4ILF A;  1BED A;  2GST A;  4HQZ A;  4HQS A;  2JZT A;  1T4Y A;  3E9J B;  1U88 A;  3BJ5 A;  5G31 A;  1ERU A;  4J2F A;  1GSY A;  2KOK A;  4ECC A;  2MZC A;  3W6G A;  2R2J A;  1CQH A;  4KSO A;  4O5R A;  4XS4 B;  2XHF A;  1U3I A;  3CTF A;  2HXK A;  4WBJ A;  2FNO A;  2YWI A;  3KXO A;  4YAP A;  1JZD A;  2F3M A;  3GUR A;  2PVQ A;  5G5F A;  5ECQ B;  1QK8 A;  2JZR A;  5ECI B;  1EGO A;  1T4Z A;  2QKE A;  1X5E A;  2KP1 A;  1YEX A;  3I6A A;  4K0G A;  4PQI A;  1TRV A;  4CW9 A;  3VK9 A;  4NWY A;  2C0E A;  2H75 A;  2GQK A;  2IPA A;  3FZ9 A;  2PER A;  3UL3 A;  2VL3 A;  4MA9 A;  1ERV A;  4EUY A;  5KN3 A;  3IR4 A;  2V2G A;  3UMA A;  3TOU A;  3D4T A;  3C7M A;  5IMC A;  2ZCT A;  1FW1 A;  2AUV A;  2R3X A;  4HOJ A;  4O7H A;  1JLW A;  3WGE A;  4IQ1 A;  4EC0 A;  4ZB6 A;  5B6M A;  4JZQ A;  4H86 A;  1B8X A;  2YNX A;  3ZLP A;  3QAW A;  4MLY A;  3GKX A;  1UA5 A;  4ZBB A;  3LSZ A;  3UAP A;  5LCZ A;  1ZCP A;  4XRD A;  4LL1 B;  5D9T A;  5G1K A;  1FVJ A;  4FYB A;  3F4R A;  2H6Z A;  2KLX A;  1Q4J A;  3D4M A;  1BQ7 A;  4L8E A;  3P90 A;  3CRT A;  4KAE A;  3AY8 A;  5DAK B;  5J5N A;  4KUN A;  5G5E A;  2OAC A;  2OE1 A;  2VCV A;  5A4W A;  3APO A;  2F8F A;  3PIN A;  2VOC A;  4GF0 A;  2PVO C;  2L6C A;  3LYK A;  4MF7 A;  1ZOF A;  1MDJ A;  3RPP A;  1HNB A;  3HD5 A;  4MH2 A;  5DJL A;  3APQ A;  4OFT A;  4MZB A;  1XWG A;  2A2S A;  2VCQ A;  2JL4 A;  2CAI A;  2XBQ A;  4ZIL A;  5A5K A;  2B5Y A;  3BBY A;  2YWO A;  1R5P A;  3CSJ A;  1K0N A;  1EV4 A;  2OA7 A;  1EWX A;  1GLQ A;  2QC7 A;  1SK1 A;  2C1Y A;  2LTK A;  2PUK C;  3ZYW A;  2CT6 A;  3RAZ A;  3QDN A;  1GUM A;  2V32 A;  4MAB A;  4XTS A;  5EL8 A;  3QOU A;  5JWR B;  1OE7 A;  2OAD A;  2CX4 A;  2QGV A;  5AN1 A;  1WP0 A;  3ZFB A;  3IHQ A;  1Y25 A;  3PH9 A;  1T7P B;  3ME8 A;  3L0H A;  4QQ7 A;  2KHP A;  1X0R A;  3I9V 2;  2H6X A;  2H8L A;  1PKZ A;  1THO A;  3DVX A;  2B5X A;  3WYW A;  5DJM A;  5J4U A;  5ECL B;  3F8U A;  4IHU A;  1WWJ A;  4HS1 A;  1M9A A;  3KIJ A;  4NPB A;  1B4Q A;  5ELA A;  1THX A;  1A8Y A;  3BOA A;  2VCX A;  4MF5 A;  5JWQ B;  1XWA A;  2H1D A;  2YV7 A;  3E3E A;  2GZP A;  4MP4 A;  2GQL A;  3ZRD A;  1F2E A;  3HZ4 A;  2JSY A;  3TGZ A;  3O76 A;  3UEM A;  4DSR A;  4N0V A;  1GNW A;  4PUR A;  1DBY A;  2FCH A;  3UAR A;  1GTA A;  6GSS A;  1F3A A;  3VWU A;  4MMM A;  2H70 A;  1TRS A;  4POB A;  5KEJ A;  1QMV A;  4ZIJ A;  1Z5Y E;  3KP9 A;  1VF3 A;  5ECN B;  2DC5 A;  4I97 A;  2EC4 A;  2L59 A;  1SL0 B;  2X8G A;  4LLR A;  1SL1 B;  4TN8 A;  1AQX A;  2C0G A;  5CAX A;  1F6M C;  1PSQ A;  3IV4 A;  3TKQ A;  5EPF A;  3M8N A;  5DAL B;  1TK5 B;  2VCW A;  5HR0 A;  1BJX A;  4WKW A;  1XWK A;  2MBS A;  4O32 A;  2K8S A;  1ZMA A;  4EO3 A;  1GSD A;  1YF1 A;  2DJ0 A;  4MF6 A;  1WMJ A;  4AJ8 A;  3DVW A;  2L4C A;  4TRX A;  4HZ2 A;  2RM6 A;  3EU4 A;  3C1R A;  1U87 A;  4ULX A;  3LJR A;  1HQO A;  1XW6 A;  3UBL A;  2IMF A;  4K6X A;  4HU9 A;  3DWV A;  2C8U A;  4JRR A;  3P7X A;  2DBC A;  6GSW A;  3VI5 A;  1O6J A;  4OFM A;  2PN8 A;  1UC7 A;  3JCM L;  4YQV A;  1LBK A;  3S9F A;  5LNK e;  3MSZ A;  4GRF A;  4JU5 A;  1N8J A;  4WET A;  2H0I A;  3VPT A;  3LXZ A;  4JED A;  4EF0 A;  3U6V A;  2G0F A;  4BWQ A;  3GYK A;  5IMD A;  2RII A;  2TIR A;  2IL3 A;  4MJE A;  1IYI A;  2CAQ A;  3GSS A;  1VF4 A;  4TXO B;  5AIS A;  4DSS B;  2N5F A;  1GTB A;  2HFD A;  2F8A A;  5H5S A;  3IE3 A;  3QPM A;  2X8H A;  3TUE A;  3FW2 A;  4MZW A;  2VD0 A;  3A2X A;  2AAW A;  1F3B A;  2GSS A;  1KNG A;  3LWA A;  2LQQ A;  3M0F A;  2ON7 A;  4IQA A;  4GTU A;  5H5R A;  3VWV A;  4RQX A;  3DXB A;  2LV3 A;  1MTC A;  3GL5 A;  1AXD A;  4EKZ A;  2FA8 A;  1K0D A;  1CQG A;  3UIW A;  2WS2 A;  3W8S A;  1KTE A;  4IVF A;  3FRC A;  2LJK A;  1MEK A;  5CYY A;  4K7I A;  5J9B A;  1TU7 A;  4IJI A;  2EIR A;  2X8C A;  1ERT A;  1EEM A;  2G2Q A;  3HHV A;  1H4O A;  1SK0 A;  2VLT A;  3HVX A;  2VL2 C;  1YF0 A;  3KJY A;  2WJU A;  1BX9 A;  2IME A;  2HRN A;  4YH2 A;  2DML A;  3APS A;  2H1G A;  3F4T A;  1OAZ A;  4GQF A;  4RI6 A;  5D96 A;  3RDW A;  4OWY A;  2X99 A;  2VM2 A;  4NXI A;  2P31 A;  1AQW A;  3GKM A;  3ZMK A;  1AAZ A;  5CRG A;  2HI7 A;  4GQC A;  3IK9 A;  4ZBA A;  1V57 A;  12GS A;  4KE3 A;  1Z6M A;  4F9Z A;  1O81 A;  20GS A;  5JCW A;  1Z3E A;  1GLP A;  2YWN A;  2FLS A;  3DRN A;  1FAA A;  1EOH A;  1OC8 A;  2YPM A;  2JZS A;  1MD3 A;  2H0H A;  2NDO A;  3IOS A;  3KZQ A;  4EVM A;  4OFN A;  5A4U A;  1TDI A;  1SK2 A;  5DQY A;  2LRN A;  1B4P A;  3O3T A;  2BMX A;  4ZL7 A;  3PR8 A;  1VRS D;  1GWC A;  2YWM A;  3TKS A;  1NSW A;  4LA1 A;  3MWH A;  1GSS A;  1ZZY A;  4DVC A;  3C71 A;  2FWH A;  1XCC A;  2O85 A;  4TXV A;  3TCO A;  1PD2 1;  2O8V B;  3QR6 A;  1UN2 A;  5EVO A;  1K0C A;  4KDU A;  4G9H A;  4LMW A;  4KA0 A;  1SJ6 A;  3G7J A;  2F9S A;  2IFQ A;  3H1N A;  2XC2 A;  2B3S A;  2L6D A;  4GXZ A;  4XCS A;  4I2U A;  1Z9H A;  4ECB A;  2GT5 A;  4D73 A;  3GN3 A;  3NZN A;  2C80 A;  1V40 A;  2JSZ A;  2LKU A;  2J23 A;  18GS A;  2VUP A;  4J56 E;  1YQ1 A;  1X9S B;  3P2A A;  2P5Q A;  4KCE A;  4Z7X A;  5J3R A;  4N10 A;  1SKW B;  4Q5Q A;  3HYP A;  1SYR A;  5EY6 A;  2O87 A;  3VWW A;  1ABA A;  5ECM B;  2JAD A;  1A23 A;  1Z6N A;  2H1B A;  4MK3 A;  4GCI A;  11GS A;  2GSR A;  1MDK A;  1PMT A;  3GKN A;  2RUE A;  1GTI A;  1TI1 A;  5L71 A;  1Q98 A;  2DJK A;  3KP8 A;  3QFA C;  3HJM A;  3HVV A;  2MMN A;  3IC4 A;  3CXG A;  4OMV A;  5ID2 A;  5E4W A;  2AJQ B;  3VUR A;  4L0W A;  1N2A A;  1SKR B;  3ZIV A;  4AJ7 A;  4AF2 A;  2VD1 A;  2HZE A;  3VI7 A;  2PU9 C;  5GAP D;  2AHE A;  3VLN A;  2H6Y A;  2OE3 A;  3EE2 A;  1J9B A;  4MH3 A;  1XW5 A;  1EOG A;  4MJB A;  3A2W A;  1XIY A;  4AGS A;  1J08 A;  1O7U A;  5ECS A;  3E0U A;  2H01 A;  2C3Q A;  4GST A;  4MJA A;  1ACV A;  5IMZ A;  3DYR A;  3TRP A;  3ZRE A;  1R7H A;  1V58 A;  4O92 A;  4V2N A;  2K6V A;  3FY7 A;  2YZH A;  2LS5 A;  1XFL A;  1M2A A;  2FWG A;  3IA1 A;  2LQO A;  1TRW A;  5IPH A;  3DKS A;  2V6K A;  5H5Q A;  5LD0 A;  3G7I A;  1PL1 A;  4KX4 A;  3GA4 A;  1EP7 A;  3QFB C;  5E59 A;  1JHB A;  4OCF A;  4ML1 A;  3WT2 A;  2CZ3 A;  3TRQ A;  1TW9 A;  1SU9 A;  4OD7 A;  5CRD A;  2GSQ A;  16GS A;  1KBN A;  3VPQ A;  2H71 A;  5IMF A;  2LJR A;  3BCK A;  2H0G A;  4G2E A;  3WT1 A;  3KEB A;  4E8H A;  4EDY A;  2DJ2 A;  1SYX A;  1K0B A;  4E8E A;  2VM1 A;  2IIY A;  4QL9 A;  4K9Z A;  4ECI A;  2C0F A;  4ML6 A;  1TU8 A;  5GAN D;  2IJY A;  3UVH A;  2IN3 A;  4ECJ A;  4XS6 A;  5KN0 A;  2VLV A;  4IP6 A;  2MMO A;  2CV4 A;  2PWJ A;  2IWT A;  2LRT A;  4TVE A;  3V1W A;  1MDI A;  1TKD B;  2HSH A;  3MDK A;  4BL7 A;  2FUG 2;  4Q5F A;  2LST A;  4Q5N A;  3UJ1 A;  3F63 A;  2M72 A;  2I4A A;  6GSY A;  4TR1 A;  3LYP A;  3OR5 A;  4GSN A;  6GSV A;  2YCD A;  3ISO A;  1M9B A;  4HUA A;  3NOF A;  4KGI A;  1ST9 A;  1I5G A;  3CBU A;  5D9X A;  2HLS A;  4PNG A;  1K3O A;  1XWB A;  2PPT A;  4HU7 A;  3ERW A;  1SEN A;  2FD3 A;  2B1K A;  4MJC A;  1GUL A;  3BCI A;  3GX0 A;  2C0D A;  2LRC A;  2R37 A;  2NVL A;  2M46 A;  2B7J A;  4WEY A;  3GL3 A;  1GSU A;  3DEX A;  3IXR A;  4OO5 A;  3WGX A;  2F51 A;  4DEJ A;  2ALB A;  4K1F A;  1PRX A;  4V2L A;  3QAG A;  3UOM A;  2E2G A;  4PXO A;  1I9D A;  1PGT A;  4WR4 A;  2WZ9 A;  1YDK A;  2AYT A;  4DSQ A;  3FHK A;  4FYU A;  2L5L A;  3RHB A;  5B7C A;  2GQM A;  4PQH A;  2I3Y A;  1JZR A;  4GLT A;  2CZ2 A;  3TJK A;  5DCH A;  1BG5 A;  1YY7 A;  3ZZX A;  4KND A;  1A2J A;  4FH8 A;  4GSS A;  4ZB8 A;  1WJK A;  4TR4 A;  4PX1 A;  1OE8 A;  3Q74 A;  2WCI A;  4L5O A;  4NV2 A;  2J9H A;  1B9Y C;  5ECO B;  1VF2 A;  4BWS A;  5HR1 A;  3GHA A;  1GP1 A;  2RM5 A;  4L5L A;  4NMU A;  5D73 A;  4X43 A;  1SL2 B;  4MPG A;  1URM A;  3ERF A;  5CRW A;  4WBR D;  1XPV A;  4ZBD A;  1FB6 A;  2LNS A;  1M7T A;  4CHS A;  3F4S A;  2YJ7 A;  4V1A g;  2GT6 A;  3Q6O A;  1DUG A;  1JZO A;  1DE1 A;  3TDG A;  5F0G A;  4BA7 A;  3A5W A;  1WOU A;  1WIK A;  1OC3 A;  2YAN A;  5F06 A;  1ILO A;  3FK8 A;  2FWE A;  5F07 A;  1TK8 B;  4IGJ A;  3FYG A;  1H75 A;  2PMT A;  13GS A;  2VO4 A;  4PGT A;  2B7K A;  4IS0 A;  4F82 A; 
#chains in the Genus database with same CATH topology
 2P0G A;  1TP9 A;  3TKR A;  1TJD A;  3FKF A;  2V1M A;  1AQV A;  2I81 A;  4WXT A;  1GTU A;  4V2M A;  4EL1 A;  1GSQ A;  2HE3 A;  4MZC A;  5CP1 A;  4O5U A;  3KH7 A;  2H30 A;  1NM3 A;  3PGT A;  2VIM A;  3F9U A;  3P8W A;  4IBP A;  3GV1 A;  2MMA A;  2BTO T;  3LOR A;  4IKH A;  4K8M A;  5HFG A;  1DSB A;  1AW9 A;  1M2D A;  3FEU A;  4MDC A;  22GS A;  5AIX A;  1XXU A;  3KTB A;  5C00 A;  1XBS A;  4HDE A;  3M1G A;  1GSE A;  2Z9S A;  3TJB A;  2R0C A;  2H73 A;  5IMV A;  4IP1 A;  1K0M A;  1K0O A;  4IJ3 A;  1EZK A;  1G6Y A;  1WE0 A;  2DJ3 A;  3TJF A;  1QGV A;  2XBI A;  1XW9 A;  3IHG A;  4FIW A;  3VWX A;  17GS A;  4POM A;  2V41 A;  4KSM A;  3MNG A;  3LXT A;  2H72 A;  1GL8 A;  3O6T A;  3HDC A;  3HJO A;  3QCP A;  5COH A;  2R5G A;  2NBS A;  5ECP B;  4X1U A;  5F8B A;  1K3Y A;  2VL2 A;  2BJX A;  1RK4 A;  4JR6 A;  4IN0 A;  2NPB A;  3HA9 A;  2E2M A;  1V9W A;  1JZW A;  3GTU A;  1UVZ A;  2IFQ B;  3FR9 A;  2IMI A;  1RQM A;  3CYN A;  3ZFL A;  3CSH A;  3N5O A;  4K5R A;  3KGK A;  3IAM 2;  3F0I A;  5ENU A;  2WDU A;  4RQR A;  1FOH A;  4D73 B;  3BD2 A;  1C72 A;  2PGT A;  5B6N A;  1TXX A;  1M2B A;  5CO3 A;  4PNF A;  4K7O A;  3LG6 A;  1T1V A;  4GWR A;  3GX8 A;  2GTU A;  2GGT A;  1W4V A;  4I6X A;  4YAV A;  5JCG A;  4QL7 A;  5CRH A;  3C73 A;  1AIU A;  4F0C A;  1X9M B;  3HCZ A;  2A4H A;  3GFK A;  4XRA A;  5HFK A;  2ZNM A;  2EIQ A;  1ZYE A;  3EWL A;  4EIQ A;  3Q19 A;  3H79 A;  2GZZ A;  3LQ7 A;  5ELG A;  2JU5 A;  3FZA A;  5BMU A;  4G10 A;  4ACS A;  4HI7 A;  4IEL A;  6GSU A;  5DDL A;  4I8B A;  4POL A;  1WRY A;  4WF4 A;  2IMK A;  5B8B A;  5ID2 B;  1HNA A;  5B8A A;  1OC9 A;  2HZE B;  3J7Y b;  2DIY A;  1XOB A;  6GSX A;  4XS1 A;  1NW2 A;  4RI7 A;  5CNW A;  5IOX A;  2YZU A;  2E0Q A;  4OO4 A;  1ML6 A;  2OBK A;  3CTG A;  5F05 A;  3HJP A;  5JWO B;  3WGD A;  4JBB A;  3HZ8 A;  4WR5 A;  1TOF A;  1VGL A;  2DMM A;  2VCZ A;  3I43 A;  1V98 A;  3D21 A;  1XOA A;  2X49 A;  5FT3 A;  4K0N A;  4PQ1 A;  3RHC A;  5AGY A;  1FVK A;  3ED3 A;  1ZYN A;  3DGQ A;  5C04 A;  3GRX A;  4HJM A;  3MYD A;  3ZTL A;  4X0X A;  4TOP A;  1W89 A;  1TRU A;  3D6I A;  4EXJ A;  2HRK A;  3GMF A;  4KW6 A;  5KN1 A;  1OKT A;  2WUL A;  5J9C A;  2H76 A;  1PQN A;  3HKR A;  4K2D A;  4FYC A;  5J41 A;  1G0T A;  8GSS A;  3L9V A;  4NHZ A;  5HFI A;  2GVP A;  3M9J A;  1EGR A;  4G0L A;  1R5A A;  3IDV A;  2C3T A;  4MPF A;  2HT9 A;  2YP6 A;  5DVB A;  2GDR A;  2VL9 A;  1DE2 A;  3TB2 A;  2WGR A;  2QSI A;  1BYE A;  1JLV A;  5HQP A;  1GSF A;  2DJ1 A;  1HYU A;  2CVD A;  3L78 A;  3TJG A;  2H19 A;  1SJZ A;  2CA8 A;  9GSS A;  2MMZ A;  1GUH A;  1ON4 A;  2XPD A;  2DIZ A;  3GH6 A;  1O8X A;  2YV9 A;  2GLR A;  2FHE A;  4BL7 B;  3K8N A;  3G7Y A;  1AUC A;  1EP8 A;  3GKK A;  2RUF A;  2CVB A;  5G2Z A;  4LL4 B;  4XS4 A;  3KM6 A;  2OE0 A;  1YKA A;  1B9X C;  4TR1 B;  3A2V A;  3TKP A;  2L4Q A;  1FB0 A;  1SD8 A;  3KMO A;  2HSY A;  7GSS A;  2A4V A;  3Q18 A;  3LFL A;  3FZ5 A;  3TRX A;  1G7E A;  5IM9 A;  1FO5 A;  1X5C A;  3PPU A;  5FWG A;  1K3L A;  2K9F A;  1QFN A;  2ON5 A;  2LEG A;  3W8J A;  1A0F A;  2R6K A;  4ID0 A;  5D93 A;  5GSS A;  2I9H A;  2AB6 A;  1OVN A;  2CQ9 A;  1PX6 A;  4EE0 A;  3GIX A;  5FHI A;  1SJI A;  1EEJ A;  1B48 A;  2QA1 A;  2KP2 A;  4IW9 A;  1A2M A;  4PTS A;  4WF5 A;  4HZ4 A;  1A8L A;  2H66 A;  3TOT A;  3US3 A;  2UZ8 A;  3FZ4 A;  3EVI A;  4N11 A;  4YQU A;  1LU4 A;  4MCU A;  2HYX A;  3KTL A;  1G7O A;  3D22 A;  2RLI A;  2HRF A;  5JCU A;  1M0U A;  4K2X A;  2VAF A;  3IBH A;  4HEA 2;  5AIV A;  3EMP A;  4JE1 A;  1G6W A;  2O89 A;  3H8Q A;  2GZY A;  2R0G A;  2TRX A;  1F37 A;  2KUC A;  2DLX A;  3IAS 2;  3DML A;  4X4J A;  1KEB A;  4JR4 A;  2R4V A;  5GZZ B;  2FY6 A;  3VFI A;  5DCG A;  5ECH B;  1T00 A;  3GUS A;  1ZYQ B;  3HY2 A;  5DAK A;  2K8V A;  4TR0 A;  3ZL5 A;  3HVS A;  3ME7 A;  3WD6 A;  3U5R E;  3SBC A;  2TRC P;  3QMX A;  1T8E B;  1X9W B;  1WPI A;  2A2R A;  3GH9 A;  2H1A A;  3UVT A;  6GST A;  1NHY A;  2C3N A;  3ZML A;  4F03 A;  2A2P A;  3F6D A;  1QUW A;  5IOW A;  2DJJ A;  3RBT A;  3N9J A;  3H4K A;  1YJ6 A;  4YQM A;  2IMD A;  1V2A A;  2I1U A;  2XPE A;  2MYG A;  3QAV A;  3FR6 A;  19GS A;  4BVY A;  3M3M A;  3F3Q A;  3ZVJ A;  4I5Q A;  1EV9 A;  2HRA A;  1U6T A;  2WFC A;  3KH9 A;  4Z2T A;  3EU3 A;  2B5E A;  4KDY A;  4P3Y B;  1SKS B;  1FHE A;  3LGC A;  3DD3 A;  2V6O A;  5D9V A;  3KMN A;  2LNT A;  5ECK B;  3ERG A;  4POK A;  2C4J A;  1MD4 A;  1U3A A;  2LJA A;  2NTO A;  2REM A;  4G0I A;  1PA3 A;  2OKA A;  1BAY A;  1GNE A;  3L9U A;  2EIO A;  5D8I A;  1USB A;  1VF1 A;  3G9B A;  1X5D A;  2L5O A;  3R2Q A;  5A4V A;  3UBK A;  3A3T A;  2HZF A;  3L4N A;  3DIE A;  2E7P A;  4N0Z A;  3F6F A;  5HR2 A;  2L57 A;  4BVX A;  1A2L A;  4YKG A;  2K18 A;  2FWF A;  3CMI A;  1ERW A;  2GS3 A;  3L9S A;  4I2T A;  1GRX A;  1S3R A;  1SD9 A;  4HJ2 A;  1XZO A;  5KN2 A;  4L0U A;  4K7N A;  3C1S A;  4CDO A;  2M80 A;  1E6B A;  4KH7 A;  4KDX A;  1YZX A;  1K0A A;  2OJL A;  3IRA A;  1O73 A;  3IC8 A;  4LMV A;  3HXS A;  4V1A p;  4N30 A;  2YOI A;  1LJR A;  2O7K A;  3GTU B;  3ZIJ A;  1A24 A;  3EYT A;  5HR3 A;  4TW5 A;  5ABR A;  3LEF A;  4F2I A;  1T3B A;  4FO5 A;  3C8E A;  3CSI A;  1OYJ A;  3FR3 A;  5INY A;  5IQY A;  4TR3 A;  5DAL A;  3D0Z A;  3EUR A;  1F9M A;  1M99 A;  1XVQ A;  2YN1 A;  3ZIT A;  3TJJ A;  2B6M A;  4G19 A;  5IIZ A;  1GH2 A;  3NIV A;  5IO2 A;  1O85 A;  2PBJ A;  5DQS A;  1XG8 A;  1FG4 A;  1HNC A;  4TKY A;  2HNL A;  5IMA A;  3I69 A;  1ZL9 A;  3IPZ A;  3H93 A;  1J0F A;  1O8W A;  4OCE A;  3R3E A;  1QXH A;  2YJH A;  4KB3 A;  4RUV A;  4NHW A;  4EDZ A;  1XWC A;  3FMW A;  3M9K A;  1IYH A;  3GNJ A;  1GUK A;  2D2Z A;  4KCA A;  5D9W A;  3EC3 A;  4NAX A;  2N5A A;  1PL2 A;  2JAC A;  3ZVJ D;  3SWL A;  2B1L A;  2WRT A;  1R4W A;  2LUS A;  2ZUP A;  1OC9 B;  3MAK A;  2P5R A;  1Z7R A;  1PX7 A;  1YKC A;  3J7Y k;  1OKD A;  4KF9 A;  1YEP A;  10GS A;  3IK7 A;  5G30 A;  1E2Y A;  4BPY A;  4ZXG A;  1FOV A;  2ES7 A;  1JFU A;  5IO0 A;  1S3D A;  2VCT A;  5IPG A;  4XIH A;  5G1L A;  1Y6E A;  2FA4 A;  4TXO A;  1NHO A;  4DSS A;  3LW9 A;  1HD2 A;  4EIP A;  3TKS E;  4PUF C;  4J57 E;  5GST A;  4NV5 A;  4Q5R A;  1A0R P;  4ZB9 A;  5BRT A;  1QQ2 A;  2FGX A;  2N5B A;  3KCM A;  3RPN A;  1TK0 B;  4XHM A;  1Z7P A;  3QD9 A;  1R26 A;  4PUA A;  3GST A;  1PN9 A;  3D5J A;  2CVK A;  1PKW A;  4F0B A;  5ECR B;  2H74 A;  14GS A;  4ISD A;  1S3C A;  1ZGN A;  2DSA A;  5CRE A;  1TTZ A;  2X64 A;  4AJ6 A;  1AC1 A;  1M3I A;  3CRU A;  2CX3 A;  5DBQ A;  3F3R A;  3EMX A;  2OBI A;  2WB9 A;  2MBT A;  3KD0 A;  1RW1 A;  3TKS C;  3EIN A;  1XVW A;  4ZL8 A;  1TI3 A;  4ZL9 A;  2VLU A;  2AV4 A;  1S3A A;  4ILF A;  1BED A;  2GST A;  4HQZ A;  4HQS A;  2JZT A;  1T4Y A;  3E9J B;  1U88 A;  3BJ5 A;  5G31 A;  1ERU A;  4J2F A;  1GSY A;  2KOK A;  4ECC A;  2MZC A;  3W6G A;  2R2J A;  1CQH A;  4KSO A;  4O5R A;  4XS4 B;  2XHF A;  1U3I A;  3CTF A;  2HXK A;  4WBJ A;  2FNO A;  2YWI A;  3KXO A;  4YAP A;  1JZD A;  2F3M A;  3GUR A;  2PVQ A;  5G5F A;  5ECQ B;  1QK8 A;  2JZR A;  5ECI B;  4A5P A;  1EGO A;  1T4Z A;  2QKE A;  1X5E A;  2KP1 A;  1YEX A;  3I6A A;  4K0G A;  4PQI A;  1TRV A;  4CW9 A;  3VK9 A;  4NWY A;  2C0E A;  2H75 A;  2DKH A;  2GQK A;  2IPA A;  3FZ9 A;  2PER A;  3UL3 A;  2VL3 A;  4MA9 A;  1ERV A;  4EUY A;  5KN3 A;  3IR4 A;  2V2G A;  3UMA A;  3TOU A;  3D4T A;  3C7M A;  5IMC A;  2ZCT A;  1FW1 A;  3A5I A;  2AUV A;  2R3X A;  4HOJ A;  4O7H A;  1JLW A;  3WGE A;  4IQ1 A;  4EC0 A;  4ZB6 A;  5B6M A;  4JZQ A;  4H86 A;  1B8X A;  2YNX A;  3ZLP A;  1PN0 A;  3QAW A;  4MLY A;  3GKX A;  1UA5 A;  4ZBB A;  3LSZ A;  3UAP A;  5LCZ A;  1ZCP A;  4XRD A;  4LL1 B;  5D9T A;  5G1K A;  1FVJ A;  4FYB A;  3F4R A;  4CY6 A;  2H6Z A;  2KLX A;  1Q4J A;  3D4M A;  1BQ7 A;  4L8E A;  3P90 A;  3CRT A;  4KAE A;  3AY8 A;  5DAK B;  5J5N A;  4KUN A;  5G5E A;  4Z2U A;  4MNN A;  2OAC A;  2OE1 A;  2VCV A;  5A4W A;  3APO A;  2F8F A;  3PIN A;  2VOC A;  4GF0 A;  2PVO C;  2L6C A;  3LYK A;  4MF7 A;  1ZOF A;  1MDJ A;  3RPP A;  1HNB A;  4MH2 A;  3HD5 A;  5DJL A;  3APQ A;  4OFT A;  4MZB A;  2DKI A;  1XWG A;  2A2S A;  2VCQ A;  2JL4 A;  2CAI A;  2XBQ A;  4ZIL A;  5A5K A;  2B5Y A;  3BBY A;  2YWO A;  1R5P A;  3CSJ A;  1K0N A;  1EV4 A;  4BVY B;  2OA7 A;  1EWX A;  1GLQ A;  2QC7 A;  1SK1 A;  2C1Y A;  2LTK A;  2PUK C;  3ZYW A;  2CT6 A;  3RAZ A;  3QDN A;  1GUM A;  2V32 A;  4MAB A;  4XTS A;  5EL8 A;  3QOU A;  5JWR B;  1OE7 A;  2OAD A;  2CX4 A;  2QGV A;  5AN1 A;  1WP0 A;  3ZFB A;  3IHQ A;  1Y25 A;  3PH9 A;  1T7P B;  3ME8 A;  3L0H A;  4QQ7 A;  2KHP A;  1X0R A;  3I9V 2;  2H6X A;  2H8L A;  1PKZ A;  1THO A;  3DVX A;  5KOX A;  2B5X A;  3WYW A;  5DJM A;  5J4U A;  5ECL B;  3F8U A;  4IHU A;  1WWJ A;  4HS1 A;  1M9A A;  3KIJ A;  4NPB A;  1B4Q A;  5ELA A;  1THX A;  1A8Y A;  3BOA A;  2VCX A;  4MF5 A;  5JWQ B;  1XWA A;  4BVX B;  2H1D A;  2YV7 A;  3E3E A;  2GZP A;  4MP4 A;  2GQL A;  3ZRD A;  1F2E A;  3HZ4 A;  2JSY A;  3TGZ A;  3O76 A;  3UEM A;  4DSR A;  4N0V A;  1GNW A;  4PUR A;  1DBY A;  2FCH A;  3UAR A;  1GTA A;  6GSS A;  1F3A A;  3VWU A;  4MMM A;  2H70 A;  1TRS A;  4POB A;  5KEJ A;  1QMV A;  4ZIJ A;  4O5Q A;  1Z5Y E;  3KP9 A;  1VF3 A;  5ECN B;  2DC5 A;  4I97 A;  2EC4 A;  2L59 A;  1SL0 B;  2X8G A;  4LLR A;  1SL1 B;  4TN8 A;  1AQX A;  2C0G A;  5CAX A;  1F6M C;  1PSQ A;  3IV4 A;  3TKQ A;  5EPF A;  3M8N A;  5DAL B;  1TK5 B;  2VCW A;  5HR0 A;  1BJX A;  4WKW A;  1XWK A;  2MBS A;  4O32 A;  2K8S A;  1ZMA A;  4EO3 A;  1GSD A;  1YF1 A;  2DJ0 A;  4MF6 A;  1WMJ A;  4AJ8 A;  3DVW A;  2L4C A;  4TRX A;  4HZ2 A;  2RM6 A;  3EU4 A;  3C1R A;  1U87 A;  4ULX A;  3LJR A;  1HQO A;  1XW6 A;  4FQU A;  3UBL A;  2IMF A;  4K6X A;  4HU9 A;  3DWV A;  2C8U A;  4JRR A;  3P7X A;  2DBC A;  6GSW A;  3VI5 A;  1O6J A;  4OFM A;  2PN8 A;  1UC7 A;  3JCM L;  4YQV A;  1LBK A;  3S9F A;  5LNK e;  3MSZ A;  4GRF A;  4JU5 A;  1N8J A;  4WET A;  3EPT A;  2H0I A;  3VPT A;  3LXZ A;  4JED A;  4EF0 A;  3U6V A;  2G0F A;  4BWQ A;  3GYK A;  5IMD A;  2RII A;  2TIR A;  2IL3 A;  4MJE A;  1IYI A;  2CAQ A;  3GSS A;  1VF4 A;  4TXO B;  5AIS A;  4G0K A;  4DSS B;  2N5F A;  1GTB A;  2HFD A;  2F8A A;  5H5S A;  3IE3 A;  3QPM A;  2X8H A;  3TUE A;  3FW2 A;  4MZW A;  2VD0 A;  3A2X A;  2AAW A;  1F3B A;  2GSS A;  1KNG A;  3LWA A;  2LQQ A;  3M0F A;  4HSC X;  2ON7 A;  4IQA A;  4GTU A;  5H5R A;  3VWV A;  4RQX A;  3DXB A;  2LV3 A;  1MTC A;  3GL5 A;  1AXD A;  4EKZ A;  2FA8 A;  1K0D A;  1CQG A;  3UIW A;  2WS2 A;  3W8S A;  1KTE A;  4IVF A;  3FRC A;  2LJK A;  1MEK A;  5CYY A;  4K7I A;  5J9B A;  1TU7 A;  4IJI A;  2EIR A;  2X8C A;  1ERT A;  1EEM A;  2G2Q A;  3HHV A;  1H4O A;  3HVN A;  1SK0 A;  2VLT A;  3HVX A;  2VL2 C;  1YF0 A;  3KJY A;  2WJU A;  1BX9 A;  2IME A;  2HRN A;  4YH2 A;  2DML A;  3APS A;  2H1G A;  3F4T A;  1OAZ A;  4GQF A;  4RI6 A;  5D96 A;  3RDW A;  4OWY A;  2X99 A;  2VM2 A;  2X4A A;  2P31 A;  4NXI A;  1AQW A;  3GKM A;  3ZMK A;  1AAZ A;  5CRG A;  2HI7 A;  4GQC A;  3IK9 A;  4ZBA A;  1V57 A;  12GS A;  4KE3 A;  1Z6M A;  4F9Z A;  1O81 A;  20GS A;  5JCW A;  1Z3E A;  1GLP A;  2YWN A;  2FLS A;  3DRN A;  1FAA A;  1EOH A;  1OC8 A;  2YPM A;  2JZS A;  1MD3 A;  2H0H A;  2NDO A;  3IOS A;  3KZQ A;  4EVM A;  4OFN A;  5A4U A;  2R0P A;  1TDI A;  1SK2 A;  5DQY A;  2LRN A;  1B4P A;  3O3T A;  2BMX A;  4ZL7 A;  3PR8 A;  1VRS D;  1GWC A;  2YWM A;  3MIX A;  3TKS A;  1NSW A;  4LA1 A;  3MWH A;  1GSS A;  1ZZY A;  4DVC A;  3C71 A;  2FWH A;  1XCC A;  2O85 A;  4TXV A;  3TCO A;  1PD2 1;  2O8V B;  3QR6 A;  1UN2 A;  5EVO A;  1K0C A;  4KDU A;  4G9H A;  4LMW A;  4KA0 A;  1SJ6 A;  3G7J A;  2F9S A;  2IFQ A;  3H1N A;  2XC2 A;  2B3S A;  4CY8 A;  2L6D A;  4GXZ A;  4XCS A;  4I2U A;  1Z9H A;  4ECB A;  2GT5 A;  4D73 A;  3GN3 A;  3NZN A;  2C80 A;  1V40 A;  2JSZ A;  2LKU A;  2J23 A;  18GS A;  2VUP A;  4J56 E;  1YQ1 A;  1X9S B;  3P2A A;  2P5Q A;  4KCE A;  4Z7X A;  5J3R A;  4N10 A;  1SKW B;  4Q5Q A;  1ZYP A;  3HYP A;  1SYR A;  5EY6 A;  2O87 A;  3VWW A;  1ABA A;  5ECM B;  2JAD A;  1A23 A;  1Z6N A;  2H1B A;  4MK3 A;  4GCI A;  11GS A;  2GSR A;  1MDK A;  1PMT A;  3GKN A;  2RUE A;  1GTI A;  1TI1 A;  5L71 A;  1Q98 A;  2DJK A;  3KP8 A;  3QFA C;  2QA2 A;  3HJM A;  3HVV A;  2MMN A;  3IC4 A;  1M3J A;  3CXG A;  4OMV A;  5ID2 A;  5E4W A;  2AJQ B;  3VUR A;  4L0W A;  1N2A A;  1SKR B;  3ZIV A;  4AJ7 A;  4AF2 A;  2VD1 A;  2HZE A;  3VI7 A;  2PU9 C;  5GAP D;  2AHE A;  3VLN A;  2H6Y A;  2OE3 A;  3EE2 A;  1J9B A;  4MH3 A;  1XW5 A;  4ICY A;  1EOG A;  4MJB A;  3A2W A;  1XIY A;  4AGS A;  1J08 A;  1O7U A;  5ECS A;  3E0U A;  2H01 A;  2C3Q A;  4GST A;  4K5S A;  4MJA A;  1ACV A;  5IMZ A;  3DYR A;  3TRP A;  3ZRE A;  1R7H A;  1V58 A;  4O92 A;  4V2N A;  2K6V A;  3FY7 A;  2YZH A;  2LS5 A;  1XFL A;  1M2A A;  2FWG A;  3IA1 A;  2LQO A;  1TRW A;  5IPH A;  3CQF A;  3DKS A;  2V6K A;  5H5Q A;  5LD0 A;  3G7I A;  1PL1 A;  4KX4 A;  3GA4 A;  1EP7 A;  3QFB C;  5E59 A;  1JHB A;  4OCF A;  4ML1 A;  3WT2 A;  2CZ3 A;  3TRQ A;  1TW9 A;  1SU9 A;  4OD7 A;  5CRD A;  2GSQ A;  16GS A;  2HSM A;  1KBN A;  3VPQ A;  2H71 A;  5IMF A;  2LJR A;  3BCK A;  5KOW A;  2H0G A;  4G2E A;  3WT1 A;  3KEB A;  4E8H A;  4EDY A;  2DJ2 A;  1SYX A;  1K0B A;  4E8E A;  2VM1 A;  2IIY A;  4QL9 A;  4K9Z A;  4ECI A;  2C0F A;  4ML6 A;  1TU8 A;  5GAN D;  2IJY A;  3UVH A;  2IN3 A;  4ECJ A;  4XS6 A;  5KN0 A;  2VLV A;  4IP6 A;  2MMO A;  2CV4 A;  2PWJ A;  2IWT A;  2LRT A;  4TVE A;  3V1W A;  1MDI A;  1TKD B;  2HSH A;  3MDK A;  4Z2R A;  4BL7 A;  2FUG 2;  4Q5F A;  2LST A;  4YKF A;  4Q5N A;  3UJ1 A;  3F63 A;  2M72 A;  2I4A A;  6GSY A;  4TR1 A;  3LYP A;  3OR5 A;  4GSN A;  6GSV A;  2YCD A;  4USS A;  3ISO A;  1M9B A;  4HUA A;  3NOF A;  4KGI A;  1ST9 A;  1I5G A;  3CBU A;  5D9X A;  2HLS A;  4PNG A;  1K3O A;  1XWB A;  2PPT A;  4HU7 A;  4BIK A;  3ERW A;  1SEN A;  2FD3 A;  2B1K A;  4MJC A;  1GUL A;  3BCI A;  3GX0 A;  2C0D A;  2LRC A;  2R37 A;  2NVL A;  2M46 A;  2B7J A;  4WEY A;  3GL3 A;  1GSU A;  3DEX A;  3IXR A;  4OO5 A;  3WGX A;  2F51 A;  4DEJ A;  2ALB A;  4K1F A;  1PRX A;  4V2L A;  3QAG A;  3UOM A;  2E2G A;  4PXO A;  1I9D A;  1PGT A;  4WR4 A;  2WZ9 A;  1YDK A;  2AYT A;  4DSQ A;  3FHK A;  4FYU A;  2L5L A;  3RHB A;  5B7C A;  2GQM A;  4PQH A;  2I3Y A;  1JZR A;  4GLT A;  2CZ2 A;  3TJK A;  5DCH A;  1BG5 A;  1YY7 A;  3ZZX A;  4KND A;  1A2J A;  4FH8 A;  4GSS A;  4ZB8 A;  1WJK A;  4TR4 A;  4PX1 A;  1OE8 A;  3Q74 A;  2WCI A;  4L5O A;  4NV2 A;  2J9H A;  1B9Y C;  5ECO B;  1VF2 A;  4BWS A;  5HR1 A;  3GHA A;  1GP1 A;  2RM5 A;  4L5L A;  4NMU A;  5D73 A;  4X43 A;  1SL2 B;  4MPG A;  1URM A;  3ERF A;  5CRW A;  4WBR D;  1XPV A;  4ZBD A;  1FB6 A;  2LNS A;  1M7T A;  4CHS A;  3F4S A;  2YJ7 A;  4V1A g;  2GT6 A;  3Q6O A;  1DUG A;  1JZO A;  1DE1 A;  3TDG A;  5F0G A;  4BA7 A;  3A5W A;  1WOU A;  1WIK A;  1OC3 A;  2YAN A;  5F06 A;  1ILO A;  3FK8 A;  2FWE A;  5F07 A;  1TK8 B;  4IGJ A;  3FYG A;  1H75 A;  2PMT A;  13GS A;  2VO4 A;  4PGT A;  2B7K A;  1PFO A;  4IS0 A;  4F82 A; 
#chains in the Genus database with same CATH homology
 2P0G A;  1TP9 A;  3TKR A;  1TJD A;  3FKF A;  2V1M A;  1AQV A;  2I81 A;  4WXT A;  1GTU A;  4V2M A;  4EL1 A;  1GSQ A;  2HE3 A;  4MZC A;  5CP1 A;  4O5U A;  3KH7 A;  2H30 A;  1NM3 A;  3PGT A;  2VIM A;  3F9U A;  3P8W A;  4IBP A;  3GV1 A;  2MMA A;  2BTO T;  3LOR A;  4IKH A;  4K8M A;  5HFG A;  1DSB A;  1AW9 A;  1M2D A;  3FEU A;  4MDC A;  22GS A;  5AIX A;  1XXU A;  3KTB A;  5C00 A;  1XBS A;  4HDE A;  3M1G A;  1GSE A;  2Z9S A;  3TJB A;  2R0C A;  2H73 A;  5IMV A;  4IP1 A;  1K0M A;  1K0O A;  4IJ3 A;  1EZK A;  1G6Y A;  1WE0 A;  2DJ3 A;  3TJF A;  1QGV A;  2XBI A;  1XW9 A;  3IHG A;  4FIW A;  3VWX A;  17GS A;  4POM A;  2V41 A;  4KSM A;  3MNG A;  3LXT A;  2H72 A;  1GL8 A;  3O6T A;  3HDC A;  3HJO A;  3QCP A;  5COH A;  2R5G A;  2NBS A;  5ECP B;  4X1U A;  5F8B A;  1K3Y A;  2VL2 A;  2BJX A;  1RK4 A;  4JR6 A;  4IN0 A;  2NPB A;  3HA9 A;  2E2M A;  1V9W A;  1JZW A;  3GTU A;  1UVZ A;  2IFQ B;  3FR9 A;  2IMI A;  1RQM A;  3CYN A;  3ZFL A;  3CSH A;  3N5O A;  4K5R A;  3KGK A;  3IAM 2;  3F0I A;  5ENU A;  2WDU A;  4RQR A;  1FOH A;  4D73 B;  3BD2 A;  1C72 A;  2PGT A;  5B6N A;  1TXX A;  1M2B A;  5CO3 A;  4PNF A;  4K7O A;  3LG6 A;  1T1V A;  4GWR A;  3GX8 A;  2GTU A;  2GGT A;  1W4V A;  4I6X A;  4YAV A;  5JCG A;  4QL7 A;  5CRH A;  3C73 A;  1AIU A;  4F0C A;  1X9M B;  3HCZ A;  2A4H A;  3GFK A;  4XRA A;  5HFK A;  2ZNM A;  2EIQ A;  1ZYE A;  3EWL A;  4EIQ A;  3Q19 A;  3H79 A;  2GZZ A;  3LQ7 A;  5ELG A;  2JU5 A;  3FZA A;  5BMU A;  4G10 A;  4ACS A;  4HI7 A;  4IEL A;  6GSU A;  5DDL A;  4I8B A;  4POL A;  1WRY A;  4WF4 A;  2IMK A;  5B8B A;  5ID2 B;  1HNA A;  5B8A A;  1OC9 A;  2HZE B;  3J7Y b;  2DIY A;  1XOB A;  6GSX A;  4XS1 A;  1NW2 A;  4RI7 A;  5CNW A;  5IOX A;  2YZU A;  2E0Q A;  4OO4 A;  1ML6 A;  2OBK A;  3CTG A;  5F05 A;  3HJP A;  5JWO B;  3WGD A;  4JBB A;  3HZ8 A;  4WR5 A;  1TOF A;  1VGL A;  2DMM A;  2VCZ A;  3I43 A;  1V98 A;  3D21 A;  1XOA A;  2X49 A;  5FT3 A;  4K0N A;  4PQ1 A;  3RHC A;  5AGY A;  1FVK A;  3ED3 A;  1ZYN A;  3DGQ A;  5C04 A;  3GRX A;  4HJM A;  3MYD A;  3ZTL A;  4X0X A;  4TOP A;  1W89 A;  1TRU A;  3D6I A;  4EXJ A;  2HRK A;  3GMF A;  4KW6 A;  5KN1 A;  1OKT A;  2WUL A;  5J9C A;  2H76 A;  1PQN A;  3HKR A;  4K2D A;  4FYC A;  5J41 A;  1G0T A;  8GSS A;  3L9V A;  4NHZ A;  5HFI A;  2GVP A;  3M9J A;  1EGR A;  4G0L A;  1R5A A;  3IDV A;  2C3T A;  4MPF A;  2HT9 A;  2YP6 A;  5DVB A;  2GDR A;  2VL9 A;  1DE2 A;  3TB2 A;  2WGR A;  2QSI A;  1BYE A;  1JLV A;  5HQP A;  1GSF A;  2DJ1 A;  1HYU A;  2CVD A;  3L78 A;  3TJG A;  2H19 A;  1SJZ A;  2CA8 A;  9GSS A;  2MMZ A;  1GUH A;  1ON4 A;  2XPD A;  2DIZ A;  3GH6 A;  1O8X A;  2YV9 A;  2GLR A;  2FHE A;  4BL7 B;  3K8N A;  3G7Y A;  1AUC A;  1EP8 A;  3GKK A;  2RUF A;  2CVB A;  5G2Z A;  4LL4 B;  4XS4 A;  3KM6 A;  2OE0 A;  1YKA A;  1B9X C;  4TR1 B;  3A2V A;  3TKP A;  2L4Q A;  1FB0 A;  1SD8 A;  3KMO A;  2HSY A;  7GSS A;  2A4V A;  3Q18 A;  3LFL A;  3FZ5 A;  3TRX A;  1G7E A;  5IM9 A;  1FO5 A;  1X5C A;  3PPU A;  5FWG A;  1K3L A;  2K9F A;  1QFN A;  2ON5 A;  2LEG A;  3W8J A;  1A0F A;  2R6K A;  4ID0 A;  5D93 A;  5GSS A;  2I9H A;  2AB6 A;  1OVN A;  2CQ9 A;  1PX6 A;  4EE0 A;  3GIX A;  5FHI A;  1SJI A;  1EEJ A;  1B48 A;  2QA1 A;  2KP2 A;  4IW9 A;  1A2M A;  4PTS A;  4WF5 A;  4HZ4 A;  1A8L A;  2H66 A;  3TOT A;  3US3 A;  2UZ8 A;  3FZ4 A;  3EVI A;  4N11 A;  4YQU A;  1LU4 A;  4MCU A;  2HYX A;  3KTL A;  1G7O A;  3D22 A;  2RLI A;  2HRF A;  5JCU A;  1M0U A;  4K2X A;  2VAF A;  5AIV A;  3IBH A;  4HEA 2;  3EMP A;  4JE1 A;  1G6W A;  2O89 A;  3H8Q A;  2GZY A;  2R0G A;  2TRX A;  1F37 A;  2KUC A;  2DLX A;  3IAS 2;  3DML A;  4X4J A;  1KEB A;  4JR4 A;  2R4V A;  5GZZ B;  2FY6 A;  3VFI A;  5DCG A;  5ECH B;  1T00 A;  3GUS A;  1ZYQ B;  3HY2 A;  5DAK A;  2K8V A;  4TR0 A;  3ZL5 A;  3HVS A;  3ME7 A;  3WD6 A;  3U5R E;  3SBC A;  2TRC P;  3QMX A;  1T8E B;  1X9W B;  1WPI A;  2A2R A;  3GH9 A;  2H1A A;  3UVT A;  6GST A;  1NHY A;  2C3N A;  3ZML A;  4F03 A;  2A2P A;  3F6D A;  1QUW A;  5IOW A;  2DJJ A;  3RBT A;  3N9J A;  3H4K A;  1YJ6 A;  4YQM A;  2IMD A;  1V2A A;  2I1U A;  2XPE A;  2MYG A;  3QAV A;  3FR6 A;  19GS A;  4BVY A;  3M3M A;  3F3Q A;  3ZVJ A;  4I5Q A;  1EV9 A;  2HRA A;  1U6T A;  2WFC A;  3KH9 A;  4Z2T A;  3EU3 A;  2B5E A;  4KDY A;  4P3Y B;  1SKS B;  1FHE A;  3LGC A;  3DD3 A;  2V6O A;  5D9V A;  3KMN A;  2LNT A;  5ECK B;  3ERG A;  4POK A;  2C4J A;  1MD4 A;  1U3A A;  2LJA A;  2NTO A;  2REM A;  4G0I A;  1PA3 A;  2OKA A;  1BAY A;  1GNE A;  3L9U A;  2EIO A;  5D8I A;  1USB A;  1VF1 A;  3G9B A;  1X5D A;  2L5O A;  3R2Q A;  5A4V A;  3UBK A;  3A3T A;  2HZF A;  3L4N A;  3DIE A;  2E7P A;  4N0Z A;  3F6F A;  5HR2 A;  2L57 A;  4BVX A;  1A2L A;  4YKG A;  2K18 A;  2FWF A;  3CMI A;  1ERW A;  2GS3 A;  3L9S A;  4I2T A;  1GRX A;  1SD9 A;  4HJ2 A;  1XZO A;  5KN2 A;  4L0U A;  4K7N A;  3C1S A;  4CDO A;  2M80 A;  1E6B A;  4KH7 A;  4KDX A;  1YZX A;  1K0A A;  2OJL A;  3IRA A;  1O73 A;  3IC8 A;  4LMV A;  3HXS A;  4V1A p;  4N30 A;  2YOI A;  1LJR A;  2O7K A;  3GTU B;  3ZIJ A;  1A24 A;  3EYT A;  5HR3 A;  4TW5 A;  5ABR A;  3LEF A;  4F2I A;  1T3B A;  4FO5 A;  3C8E A;  3CSI A;  1OYJ A;  3FR3 A;  5INY A;  5IQY A;  4TR3 A;  5DAL A;  3D0Z A;  3EUR A;  1F9M A;  1M99 A;  1XVQ A;  2YN1 A;  3ZIT A;  3TJJ A;  2B6M A;  4G19 A;  5IIZ A;  1GH2 A;  3NIV A;  5IO2 A;  1O85 A;  2PBJ A;  5DQS A;  1FG4 A;  1HNC A;  4TKY A;  2HNL A;  5IMA A;  3I69 A;  1ZL9 A;  3IPZ A;  3H93 A;  1J0F A;  1O8W A;  4OCE A;  3R3E A;  1QXH A;  2YJH A;  4KB3 A;  4RUV A;  4NHW A;  4EDZ A;  1XWC A;  3FMW A;  3M9K A;  1IYH A;  3GNJ A;  1GUK A;  2D2Z A;  4KCA A;  5D9W A;  3EC3 A;  4NAX A;  2N5A A;  1PL2 A;  2JAC A;  3ZVJ D;  3SWL A;  2B1L A;  2WRT A;  1R4W A;  2LUS A;  2ZUP A;  1OC9 B;  3MAK A;  2P5R A;  1Z7R A;  1PX7 A;  1YKC A;  3J7Y k;  1OKD A;  4KF9 A;  1YEP A;  10GS A;  3IK7 A;  5G30 A;  1E2Y A;  4BPY A;  4ZXG A;  1FOV A;  2ES7 A;  1JFU A;  5IO0 A;  1S3D A;  2VCT A;  5IPG A;  4XIH A;  5G1L A;  1Y6E A;  2FA4 A;  4TXO A;  1NHO A;  4DSS A;  3LW9 A;  1HD2 A;  4EIP A;  3TKS E;  4PUF C;  4J57 E;  5GST A;  4NV5 A;  4Q5R A;  1A0R P;  4ZB9 A;  5BRT A;  1QQ2 A;  2FGX A;  2N5B A;  3KCM A;  3RPN A;  1TK0 B;  4XHM A;  1Z7P A;  3QD9 A;  1R26 A;  4PUA A;  3GST A;  1PN9 A;  3D5J A;  2CVK A;  1PKW A;  4F0B A;  5ECR B;  2H74 A;  14GS A;  4ISD A;  1S3C A;  1ZGN A;  2DSA A;  5CRE A;  1TTZ A;  2X64 A;  4AJ6 A;  1AC1 A;  3CRU A;  2CX3 A;  5DBQ A;  3F3R A;  3EMX A;  2OBI A;  2WB9 A;  2MBT A;  3KD0 A;  1RW1 A;  3TKS C;  3EIN A;  1XVW A;  4ZL8 A;  1TI3 A;  4ZL9 A;  2VLU A;  2AV4 A;  1S3A A;  4ILF A;  1BED A;  2GST A;  4HQZ A;  4HQS A;  2JZT A;  1T4Y A;  3E9J B;  1U88 A;  3BJ5 A;  5G31 A;  1ERU A;  4J2F A;  1GSY A;  2KOK A;  4ECC A;  2MZC A;  3W6G A;  2R2J A;  1CQH A;  4KSO A;  4O5R A;  4XS4 B;  2XHF A;  1U3I A;  3CTF A;  2HXK A;  4WBJ A;  2FNO A;  2YWI A;  3KXO A;  4YAP A;  1JZD A;  2F3M A;  3GUR A;  2PVQ A;  5G5F A;  5ECQ B;  1QK8 A;  2JZR A;  5ECI B;  4A5P A;  1EGO A;  1T4Z A;  2QKE A;  1X5E A;  2KP1 A;  1YEX A;  3I6A A;  4K0G A;  4PQI A;  1TRV A;  4CW9 A;  3VK9 A;  4NWY A;  2C0E A;  2H75 A;  2DKH A;  2GQK A;  2IPA A;  3FZ9 A;  2PER A;  3UL3 A;  2VL3 A;  4MA9 A;  1ERV A;  4EUY A;  5KN3 A;  3IR4 A;  2V2G A;  3UMA A;  3TOU A;  3D4T A;  3C7M A;  5IMC A;  2ZCT A;  1FW1 A;  3A5I A;  2AUV A;  2R3X A;  4HOJ A;  4O7H A;  1JLW A;  3WGE A;  4IQ1 A;  4EC0 A;  4ZB6 A;  5B6M A;  4JZQ A;  4H86 A;  1B8X A;  2YNX A;  3ZLP A;  1PN0 A;  3QAW A;  4MLY A;  3GKX A;  1UA5 A;  4ZBB A;  3LSZ A;  3UAP A;  5LCZ A;  1ZCP A;  4XRD A;  4LL1 B;  5D9T A;  5G1K A;  1FVJ A;  4FYB A;  3F4R A;  4CY6 A;  2H6Z A;  2KLX A;  1Q4J A;  3D4M A;  1BQ7 A;  4L8E A;  3P90 A;  3CRT A;  4KAE A;  3AY8 A;  5DAK B;  5J5N A;  4KUN A;  5G5E A;  4Z2U A;  4MNN A;  2OAC A;  2OE1 A;  2VCV A;  5A4W A;  3APO A;  2F8F A;  3PIN A;  2VOC A;  4GF0 A;  2PVO C;  2L6C A;  3LYK A;  4MF7 A;  1ZOF A;  1MDJ A;  3RPP A;  1HNB A;  3HD5 A;  4MH2 A;  5DJL A;  3APQ A;  4OFT A;  4MZB A;  2DKI A;  1XWG A;  2A2S A;  2VCQ A;  2JL4 A;  2CAI A;  2XBQ A;  4ZIL A;  5A5K A;  2B5Y A;  3BBY A;  2YWO A;  1R5P A;  3CSJ A;  1K0N A;  1EV4 A;  4BVY B;  2OA7 A;  1EWX A;  1GLQ A;  2QC7 A;  1SK1 A;  2C1Y A;  2LTK A;  2PUK C;  3ZYW A;  2CT6 A;  3RAZ A;  3QDN A;  1GUM A;  2V32 A;  4MAB A;  4XTS A;  5EL8 A;  3QOU A;  5JWR B;  1OE7 A;  2OAD A;  2CX4 A;  2QGV A;  5AN1 A;  1WP0 A;  3ZFB A;  3IHQ A;  1Y25 A;  3PH9 A;  1T7P B;  3ME8 A;  3L0H A;  4QQ7 A;  2KHP A;  1X0R A;  3I9V 2;  2H6X A;  2H8L A;  1PKZ A;  1THO A;  3DVX A;  5KOX A;  2B5X A;  3WYW A;  5DJM A;  5J4U A;  5ECL B;  3F8U A;  4IHU A;  1WWJ A;  4HS1 A;  1M9A A;  3KIJ A;  4NPB A;  1B4Q A;  5ELA A;  1THX A;  1A8Y A;  3BOA A;  2VCX A;  4MF5 A;  5JWQ B;  1XWA A;  4BVX B;  2H1D A;  2YV7 A;  3E3E A;  2GZP A;  4MP4 A;  2GQL A;  3ZRD A;  1F2E A;  3HZ4 A;  2JSY A;  3TGZ A;  3O76 A;  3UEM A;  4DSR A;  4N0V A;  1GNW A;  4PUR A;  1DBY A;  2FCH A;  3UAR A;  1GTA A;  6GSS A;  1F3A A;  3VWU A;  4MMM A;  2H70 A;  1TRS A;  4POB A;  5KEJ A;  1QMV A;  4ZIJ A;  4O5Q A;  1Z5Y E;  3KP9 A;  1VF3 A;  5ECN B;  2DC5 A;  4I97 A;  2EC4 A;  2L59 A;  1SL0 B;  2X8G A;  4LLR A;  1SL1 B;  4TN8 A;  1AQX A;  2C0G A;  5CAX A;  1F6M C;  1PSQ A;  3IV4 A;  3TKQ A;  5EPF A;  3M8N A;  5DAL B;  1TK5 B;  2VCW A;  5HR0 A;  1BJX A;  4WKW A;  1XWK A;  2MBS A;  4O32 A;  2K8S A;  1ZMA A;  4EO3 A;  1GSD A;  1YF1 A;  2DJ0 A;  4MF6 A;  1WMJ A;  4AJ8 A;  3DVW A;  2L4C A;  4TRX A;  4HZ2 A;  2RM6 A;  3EU4 A;  3C1R A;  1U87 A;  4ULX A;  3LJR A;  1HQO A;  1XW6 A;  4FQU A;  3UBL A;  2IMF A;  4K6X A;  4HU9 A;  3DWV A;  2C8U A;  4JRR A;  3P7X A;  2DBC A;  6GSW A;  3VI5 A;  1O6J A;  4OFM A;  2PN8 A;  1UC7 A;  3JCM L;  4YQV A;  1LBK A;  3S9F A;  5LNK e;  3MSZ A;  4GRF A;  4JU5 A;  1N8J A;  4WET A;  3EPT A;  2H0I A;  3VPT A;  3LXZ A;  4JED A;  4EF0 A;  3U6V A;  2G0F A;  4BWQ A;  3GYK A;  5IMD A;  2RII A;  2TIR A;  2IL3 A;  4MJE A;  1IYI A;  2CAQ A;  3GSS A;  1VF4 A;  4TXO B;  5AIS A;  4G0K A;  4DSS B;  2N5F A;  1GTB A;  2HFD A;  2F8A A;  5H5S A;  3IE3 A;  3QPM A;  2X8H A;  3TUE A;  3FW2 A;  4MZW A;  2VD0 A;  3A2X A;  2AAW A;  1F3B A;  2GSS A;  1KNG A;  3LWA A;  2LQQ A;  3M0F A;  2ON7 A;  4IQA A;  4GTU A;  5H5R A;  3VWV A;  4RQX A;  3DXB A;  2LV3 A;  1MTC A;  3GL5 A;  1AXD A;  4EKZ A;  2FA8 A;  1K0D A;  1CQG A;  3UIW A;  2WS2 A;  3W8S A;  1KTE A;  4IVF A;  3FRC A;  2LJK A;  1MEK A;  5CYY A;  4K7I A;  5J9B A;  1TU7 A;  4IJI A;  2EIR A;  2X8C A;  1ERT A;  1EEM A;  2G2Q A;  3HHV A;  1H4O A;  1SK0 A;  2VLT A;  3HVX A;  2VL2 C;  1YF0 A;  3KJY A;  2WJU A;  1BX9 A;  2IME A;  2HRN A;  4YH2 A;  2DML A;  3APS A;  2H1G A;  3F4T A;  1OAZ A;  4GQF A;  4RI6 A;  5D96 A;  3RDW A;  4OWY A;  2X99 A;  2VM2 A;  2X4A A;  2P31 A;  4NXI A;  1AQW A;  3GKM A;  3ZMK A;  1AAZ A;  5CRG A;  2HI7 A;  4GQC A;  3IK9 A;  4ZBA A;  1V57 A;  12GS A;  4KE3 A;  1Z6M A;  4F9Z A;  1O81 A;  20GS A;  5JCW A;  1Z3E A;  1GLP A;  2YWN A;  2FLS A;  3DRN A;  1FAA A;  1EOH A;  1OC8 A;  2YPM A;  2JZS A;  1MD3 A;  2H0H A;  2NDO A;  3IOS A;  3KZQ A;  4EVM A;  4OFN A;  5A4U A;  2R0P A;  1TDI A;  1SK2 A;  5DQY A;  2LRN A;  1B4P A;  3O3T A;  2BMX A;  4ZL7 A;  3PR8 A;  1VRS D;  1GWC A;  2YWM A;  3MIX A;  3TKS A;  1NSW A;  4LA1 A;  3MWH A;  1GSS A;  1ZZY A;  4DVC A;  3C71 A;  2FWH A;  1XCC A;  2O85 A;  4TXV A;  3TCO A;  1PD2 1;  2O8V B;  3QR6 A;  1UN2 A;  5EVO A;  1K0C A;  4KDU A;  4G9H A;  4LMW A;  4KA0 A;  1SJ6 A;  3G7J A;  2F9S A;  2IFQ A;  3H1N A;  2XC2 A;  2B3S A;  4CY8 A;  2L6D A;  4GXZ A;  4XCS A;  4I2U A;  1Z9H A;  4ECB A;  2GT5 A;  4D73 A;  3GN3 A;  3NZN A;  2C80 A;  1V40 A;  2JSZ A;  2LKU A;  2J23 A;  18GS A;  2VUP A;  4J56 E;  1YQ1 A;  1X9S B;  3P2A A;  2P5Q A;  4KCE A;  4Z7X A;  5J3R A;  4N10 A;  1SKW B;  4Q5Q A;  1ZYP A;  3HYP A;  1SYR A;  5EY6 A;  2O87 A;  3VWW A;  1ABA A;  5ECM B;  2JAD A;  1A23 A;  1Z6N A;  2H1B A;  4MK3 A;  4GCI A;  11GS A;  2GSR A;  1MDK A;  1PMT A;  3GKN A;  2RUE A;  1GTI A;  1TI1 A;  5L71 A;  1Q98 A;  2DJK A;  3KP8 A;  3QFA C;  2QA2 A;  3HJM A;  3HVV A;  2MMN A;  3IC4 A;  3CXG A;  4OMV A;  5ID2 A;  5E4W A;  2AJQ B;  3VUR A;  4L0W A;  1N2A A;  1SKR B;  3ZIV A;  4AJ7 A;  4AF2 A;  2VD1 A;  2HZE A;  3VI7 A;  2PU9 C;  5GAP D;  2AHE A;  3VLN A;  2H6Y A;  2OE3 A;  3EE2 A;  1J9B A;  4MH3 A;  1XW5 A;  4ICY A;  1EOG A;  4MJB A;  3A2W A;  1XIY A;  4AGS A;  1J08 A;  1O7U A;  5ECS A;  3E0U A;  2H01 A;  2C3Q A;  4GST A;  4K5S A;  4MJA A;  1ACV A;  5IMZ A;  3DYR A;  3TRP A;  3ZRE A;  1R7H A;  1V58 A;  4O92 A;  4V2N A;  2K6V A;  3FY7 A;  2YZH A;  2LS5 A;  1XFL A;  1M2A A;  2FWG A;  3IA1 A;  2LQO A;  1TRW A;  5IPH A;  3DKS A;  2V6K A;  5H5Q A;  5LD0 A;  3G7I A;  1PL1 A;  4KX4 A;  3GA4 A;  1EP7 A;  3QFB C;  5E59 A;  1JHB A;  4OCF A;  4ML1 A;  3WT2 A;  2CZ3 A;  3TRQ A;  1TW9 A;  1SU9 A;  4OD7 A;  5CRD A;  2GSQ A;  16GS A;  2HSM A;  1KBN A;  3VPQ A;  2H71 A;  5IMF A;  2LJR A;  3BCK A;  5KOW A;  2H0G A;  4G2E A;  3WT1 A;  3KEB A;  4E8H A;  4EDY A;  2DJ2 A;  1SYX A;  1K0B A;  4E8E A;  2VM1 A;  2IIY A;  4QL9 A;  4K9Z A;  4ECI A;  2C0F A;  4ML6 A;  1TU8 A;  5GAN D;  2IJY A;  3UVH A;  2IN3 A;  4ECJ A;  4XS6 A;  5KN0 A;  2VLV A;  4IP6 A;  2MMO A;  2CV4 A;  2PWJ A;  2IWT A;  2LRT A;  4TVE A;  3V1W A;  1MDI A;  1TKD B;  2HSH A;  3MDK A;  4Z2R A;  4BL7 A;  2FUG 2;  4Q5F A;  2LST A;  4YKF A;  4Q5N A;  3UJ1 A;  3F63 A;  2M72 A;  2I4A A;  6GSY A;  4TR1 A;  3LYP A;  3OR5 A;  4GSN A;  6GSV A;  2YCD A;  4USS A;  3ISO A;  1M9B A;  4HUA A;  3NOF A;  4KGI A;  1ST9 A;  1I5G A;  3CBU A;  5D9X A;  2HLS A;  4PNG A;  1K3O A;  1XWB A;  2PPT A;  4HU7 A;  3ERW A;  1SEN A;  2FD3 A;  2B1K A;  4MJC A;  1GUL A;  3BCI A;  3GX0 A;  2C0D A;  2LRC A;  2R37 A;  2NVL A;  2M46 A;  2B7J A;  4WEY A;  3GL3 A;  1GSU A;  3DEX A;  3IXR A;  4OO5 A;  3WGX A;  2F51 A;  4DEJ A;  2ALB A;  4K1F A;  1PRX A;  4V2L A;  3QAG A;  3UOM A;  2E2G A;  4PXO A;  1I9D A;  1PGT A;  4WR4 A;  2WZ9 A;  1YDK A;  2AYT A;  4DSQ A;  3FHK A;  4FYU A;  2L5L A;  3RHB A;  5B7C A;  2GQM A;  4PQH A;  2I3Y A;  1JZR A;  4GLT A;  2CZ2 A;  3TJK A;  5DCH A;  1BG5 A;  1YY7 A;  3ZZX A;  4KND A;  1A2J A;  4FH8 A;  4GSS A;  4ZB8 A;  1WJK A;  4TR4 A;  4PX1 A;  1OE8 A;  3Q74 A;  2WCI A;  4L5O A;  4NV2 A;  2J9H A;  1B9Y C;  5ECO B;  1VF2 A;  4BWS A;  5HR1 A;  3GHA A;  1GP1 A;  2RM5 A;  4L5L A;  4NMU A;  5D73 A;  4X43 A;  1SL2 B;  4MPG A;  1URM A;  3ERF A;  5CRW A;  4WBR D;  1XPV A;  4ZBD A;  1FB6 A;  2LNS A;  1M7T A;  4CHS A;  3F4S A;  2YJ7 A;  4V1A g;  2GT6 A;  3Q6O A;  1DUG A;  1JZO A;  1DE1 A;  3TDG A;  5F0G A;  4BA7 A;  3A5W A;  1WOU A;  1WIK A;  1OC3 A;  2YAN A;  5F06 A;  1ILO A;  3FK8 A;  2FWE A;  5F07 A;  1TK8 B;  4IGJ A;  3FYG A;  1H75 A;  2PMT A;  13GS A;  2VO4 A;  4PGT A;  2B7K A;  4IS0 A;  4F82 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...