1PQNA

Dominant negative human hdim1 (hdim1 1-128)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
127
structure length
127
Chain Sequence
SYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMVDIIETVYRGARKGRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spliceosomal U5 snRNP-specific 15 kDa protein
publication title Structure, stability and function of hDim1 investigated by NMR, circular dichroism and mutational analysis
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 22
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2003-06-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1pqnA00
4X0XA 2C4JA 2XPDA 4PXOA 11GSA 2FUG2 4K8MA 5L71A 4EF0A 2GTUA 3RBTA 1U88A 3HYPA 5AIXA 5GSTA 2C1YA 2CX3A 1K0CA 3O76A 3TGZA 2VCZA 4MF7A 4EC0A 5B6MA 4OD7A 2DJJA 2XBIA 2L59A 3TKQA 2G2QA 4O32A 1WWJA 1GSYA 2GQMA 3GV1A 2B7JA 4RUVA 2DJ1A 1Z9HA 1YKCA 5COHA 3Q6OA 1K3LA 1FW1A 3APSA 3L0HA 5EY6A 2PN8A 2OJLA 3BCKA 1G7OA 4K0NA 1QK8A 5HR1A 3IDVA 1X5EA 2D2ZA 3E0UA 1XZOA 1VF3A 2L5LA 1V2AA 2H73A 4ZB6A 1B8XA 3UAPA 4PUAA 1KBNA 2MBTA 1JZOA 2NTOA 1BX9A 3M9KA 2NVLA 4TXOA 3UEMA 1O6JA 5IOXA 1A23A 2VD1A 3GHAA 3KD0A 3ZL5A 5JCUA 1MEKA 2PERA 3F3QA 4EE0A 4F2IA 4F03A 1ERWA 4EL1A 2H76A 2C80A 3I69A 1JZRA 5HFGA 1T4ZA 3KEBA 2YJ7A 3V1WA 4IQAA 1FVJA 4MA9A 2F51A 3L78A 2LJRA 4N30A 4DVCA 1M2AA 3TKSC 1ZYEA 1ABAA 3FZAA 4KUNA 4G9HA 1YF1A 1Q98A 1Z7RA 2FWEA 5IMDA 4ILFA 2JZSA 4HU9A 1J9BA 2LTKA 5E59A 5INYA 2E2MA 3GX8A 4IJIA 5J9BA 3FEUA 2F9SA 3GTUA 5AGYA 3J7Yk 1FOVA 3IHQA 4FYCA 5IMZA 2VL2A 5HFIA 4G19A 3ZZXA 2M46A 2WGRA 4JBBA 1U87A 2H0GA 1PA3A 1T8EB 1EOGA 2KHPA 1GSUA 3P7XA 1F37A 3O6TA 4HUAA 5ECNB 5CAXA 5CREA 3GSSA 1WPIA 1W4VA 3D5JA 2HNLA 5D9WA 3VWUA 3D21A 2YWOA 1X9WB 2V32A 5DDLA 4EO3A 5JWRB 2HYXA 3M8NA 1PD21 2GQLA 3TKPA 4IN0A 1W89A 2OE3A 2J9HA 2PWJA 5D9VA 3HY2A 3TCOA 2NBSA 6GSTA 4TN8A 7GSSA 3F6FA 1Y6EA 5DALA 4ECJA 1SL1B 2LEGA 5F0GA 5GZZB 2IJYA 2WS2A 3LWAA 1THOA 3WGXA 2HE3A 4I8BA 1AW9A 1THXA 5D73A 4BA7A 1FAAA 3HJMA 1E6BA 3L9SA 1XWKA 3BBYA 5J4UA 3D0ZA 4ML6A 2ES7A 3ZVJA 4I6XA 3MNGA 4KGIA 2JZRA 2GZPA 2IMEA 4KNDA 2FA8A 2K8VA 4TR1B 4IGJA 4KA0A 5IPHA 3KIJA 4G10A 4I2UA 1PKZA 1S3DA 2LNTA 4YH2A 2TRXA 3G9BA 3NIVA 2WCIA 3LQ7A 3KZQA 3F4RA 1SK0A 3IBHA 1B9YC 2X8CA 1X5DA 4DSSB 2PVOC 1DUGA 2TIRA 1TK5B 4O7HA 2V41A 5ECIB 1ILOA 2H01A 3L9VA 4YQMA 3ZMKA 2KP2A 5G1LA 5FHIA 1K0MA 3WGEA 5D93A 3G7YA 3VWWA 2AAWA 3UVHA 4PQIA 3P2AA 4X43A 4MLYA 2CV4A 4V1Ag 4MP4A 4K0GA 4XTSA 5ABRA 4KDUA 3GUSA 3L9UA 2R3XA 5DAKA 1PQNA 4HJMA 2WRTA 3QFBC 1ZL9A 3NZNA 4HQZA 1S3AA 2VCXA 5DCHA 1GSSA 3IRAA 1U3AA 3C7MA 12GSA 2YCDA 4LMWA 2LRTA 3VFIA 1M9AA 3HHVA 2B1KA 2V1MA 5LCZA 2HZFA 3D6IA 2EIRA 2YP6A 2HSHA 4NMUA 2B5YA 1LU4A 4HI7A 3KH7A 1UN2A 4MMMA 4LLRA 1EZKA 4ACSA 3EVIA 5GAND 3TJKA 2I9HA 3A2XA 3QD9A 3HZ4A 4Q5NA 3FR6A 2CVDA 4TRXA 3O3TA 1CQHA 1VF4A 4XS6A 3LGCA 5HR2A 5JCGA 2LV3A 1E2YA 1URMA 1WOUA 4NXIA 3BCIA 4Q5FA 2K6VA 1TJDA 2DJ0A 2VOCA 5D9TA 4OFMA 4I2TA 1XW5A 2QKEA 3DWVA 4I5QA 2LQOA 2V6OA 1DSBA 2X8HA 4D73B 3EWLA 2FLSA 2IPAA 3DD3A 4F82A 4X1UA 2JACA 1QXHA 2P0GA 3D4TA 3D22A 1A8YA 4V2NA 2H6XA 3IXRA 4V2MA 5ECMB 4LL1B 2AJQB 2VUPA 3I6AA 2LS5A 4IHUA 2K9FA 4E8EA 2HZEA 4GRFA 4NAXA 2HRFA 4L0UA 1YQ1A 3P90A 5IMCA 4MZWA 3EU4A 4MH2A 2AB6A 3MSZA 3TJBA 1SL0B 4DSQA 2H71A 1YF0A 1Z5YE 4MPGA 4GSSA 4WEYA 2YJHA 3ZYWA 1XPVA 1OAZA 1F3BA 5LNKe 1VF1A 1GWCA 1EV4A 4L5LA 2IMKA 3UBKA 2C0EA 3Q19A 4KX4A 1T1VA 2OE1A 4EDYA 1YEXA 3QPMA 5JWOB 3IK7A 3QR6A 1F2EA 2J23A 1M2BA 3S9FA 2N5BA 2L4QA 3TKRA 3EMXA 4KB3A 3GRXA 3HD5A 3C1RA 5KN3A 13GSA 4NV2A 3LG6A 4BVXA 2IFQA 2A2SA 1N2AA 2DMMA 3FZ5A 3HZ8A 1PKWA 4GXZA 5DJLA 4POMA 3VURA 5G30A 1RK4A 1T7PB 1PMTA 17GSA 3US3A 2A2RA 2OADA 2PVQA 5F8BA 3TJGA 3RPPA 3DEXA 5GSSA 3LFLA 3FYGA 5JWQB 1FB0A 1R5AA 2DBCA 4EXJA 2DLXA 6GSWA 3KMNA 2ZNMA 4XHMA 1QUWA 2I1UA 1RW1A 2GZZA 4PQ1A 2RUFA 4ZB9A 3ZIJA 4GF0A 4OO4A 3E3EA 2Z9SA 1TTZA 3U6VA 4V2LA 3CSIA 1V98A 5DQYA 4YAPA 2HT9A 6GSYA 1HQOA 1SKWB 3FRCA 3GURA 1BJXA 3VLNA 2I4AA 3IPZA 1AAZA 4IVFA 4MZBA 3GX0A 4ECCA 4Q5QA 3GH6A 1C72A 3HKRA 3W8JA 1FG4A 4N11A 2VM1A 1RQMA 1IYHA 5IMFA 1XW9A 5IO2A 2FD3A 2KUCA 2IWTA 3H79A 4HOJA 3VK9A 1TRWA 2JSZA 3LXTA 3WT1A 2BJXA 2C3TA 3TJFA 2E7PA 2YPMA 1F9MA 4V1Ap 1OC3A 1TDIA 2KP1A 1K0AA 4HS1A 4KE3A 1WIKA 5D8IA 5H5SA 3CBUA 5IMVA 2DMLA 2VCQA 4ZBBA 5A4VA 3ERGA 1UVZA 1A24A 4WBRD 3TJJA 4QL9A 1BEDA 4ZBAA 4XS4A 2DIYA 4DEJA 4KSMA 5ID2A 4LA1A 4OCEA 4RQXA 3UARA 1HD2A 3DRNA 4CW9A 2GZYA 1GTIA 2LJKA 2YWIA 3KCMA 1ZGNA 1AQXA 2QSIA 4AJ8A 4GTUA 3GL3A 3GFKA 1X9SB 1TP9A 5CNWA 3UVTA 1HYUA 1TRVA 2OKAA 1WP0A 1XXUA 2AUVA 4YQVA 2B5XA 2ZCTA 3DXBA 4BWSA 3U5RE 1IYIA 3K8NA 1Z7PA 2XPEA 3MDKA 3QMXA 1R5PA 3RHBA 3WGDA 3FR9A 4HJ2A 4O5RA 3N5OA 2R5GA 1AC1A 1GSFA 2FGXA 5CP1A 1K0DA 1V57A 3H1NA 4WF5A 1H4OA 4ZL7A 2RIIA 1PL2A 4L8EA 5DJMA 1EEMA 2VLVA 2WFCA 5ELAA 2MYGA 2X99A 5IPGA 2ALBA 5J41A 2R4VA 1WMJA 4AJ6A 4N0VA 2IMFA 4PURA 2B5EA 2L5OA 1PX6A 20GSA 2DJ3A 3TRXA 2CX4A 1PN9A 3KH9A 4TW5A 2X64A 1QQ2A 4EKZA 2LNSA 4FH8A 3A3TA 4K9ZA 3TUEA 5KN1A 5EVOA 1OE8A 4NWYA 4O92A 2HSYA 2M80A 2F8AA 1K0OA 4F0BA 2N5AA 2OA7A 3A5WA 3FZ4A 3SWLA 1GSDA 4IQ1A 4DSRA 3CSJA 1XWCA 4LMVA 2LQQA 2B3SA 4GWRA 2P31A 1GP1A 4ML1A 3CMIA 5A5KA 1G6WA 3CSHA 5DBQA 1GSEA 1EP8A 2VO4A 2YOIA 1JZWA 1EGOA 3HJOA 2CZ3A 1O73A 2V2GA 3ZMLA 1ZYQB 4IW9A 3VPTA 2H75A 2JZTA 2H1GA 2PPTA 1K0BA 2VL2C 3CRTA 5ELGA 5IQYA 3CXGA 3HVSA 2OE0A 2EIQA 2H1BA 3G7JA 1F3AA 3M1GA 2MZCA 5G5FA 1XW6A 4K7IA 4K2DA 3ZTLA 5KN2A 3IAS2 1PRXA 4POLA 2BMXA 1NM3A 5EL8A 4TR0A 1GTUA 1OC9B 2NDOA 3KTLA 4NV5A 2RUEA 2GDRA 2C8UA 5GAPD 2CVBA 1YKAA 6GSVA 5G1KA 4TKYA 4HDEA 3DVXA 2A4VA 2NPBA 5D96A 1HNAA 3FK8A 1SD9A 1X9MB 1XWBA 6GSXA 2O87A 4IP1A 2GVPA 1KEBA 1M9BA 2JU5A 2HXKA 1HNBA 1MDJA 3M0FA 2FWGA 4ZIJA 3BJ5A 3M3MA 3HCZA 1SD8A 5B6NA 2GQKA 2ON7A 2VD0A 4GQCA 2ON5A 4ZB8A 4HEA2 1V9WA 4ZBDA 2O85A 4RI7A 3E9JB 1EP7A 2DSAA 4GQFA 2H6YA 4KAEA 3D4MA 5F07A 2VAFA 4EVMA 3IV4A 1EGRA 3GKXA 3F4SA 4AJ7A 3EMPA 1TK0B 5AN1A 2F8FA 4WXTA 5C04A 1B48A 1O7UA 2P5RA 4BVYA 4HQSA 3EYTA 2H74A 2R2JA 5CO3A 3KM6A 3VWXA 3F4TA 2H1DA 2G0FA 4KDXA 1G0TA 2MMAA 4EDZA 4OFTA 2DJ2A 3ZREA 3N9JA 3IK9A 1PGTA 1B4PA 5IOWA 2H70A 1TW9A 1SJIA 2CA8A 2JL4A 4PGTA 3UBLA 1BAYA 4ZXGA 3QFAC 1H75A 4MABA 4TOPA 4TR1A 1DE2A 3KGKA 3EU3A 4MDCA 1WE0A 3GA4A 1KTEA 1PSQA 2CAIA 3APOA 1ZOFA 4MJEA 1JFUA 3QDNA 2L4CA 3OR5A 3LYKA 4KCEA 18GSA 2LKUA 3HVVA 2H0IA 4DSSA 1AXDA 1A8LA 1J0FA 3FY7A 3QAVA 1TI3A 3F63A 4WF4A 4N0ZA 1GLQA 3A2WA 2OACA 4IP6A 3HA9A 4OWYA 1GUMA 1TXXA 1XVQA 5ECOB 1FO5A 2HRNA 2VL3A 1GL8A 4WETA 4OCFA 3TDGA 1G6YA 1GRXA 4Z7XA 1YJ6A 1UA5A 3CYNA 3P8WA 5ECRB 4XS1A 3GYKA 3C71A 4HZ2A 4PNFA 3TRQA 5F06A 1U3IA 3ZFBA 3APQA 2H0HA 4XIHA 3TRPA 3C1SA 1DBYA 4BWQA 1AIUA 2B7KA 3VI7A 2IN3A 2QC7A 1XCCA 5FWGA 1VGLA 2LUSA 5EPFA 2X8GA 4OFNA 5AIVA 1YEPA 2GGTA 1HNCA 3CRUA 4MF6A 4PX1A 3ZIVA 4I97A 2H30A 4J57E 2ZUPA 4ZL9A 14GSA 2F3MA 3DIEA 1ZCPA 3L4NA 2E0QA 2H72A 2I3YA 1O8XA 2N5FA 1JZDA 1GH2A 4TXOB 22GSA 4K6XA 2O8VB 2VLTA 2YWMA 1ON4A 2GSSA 1EEJA 3RHCA 2DIZA 3TB2A 2VIMA 4POBA 4AGSA 3RPNA 4D73A 1YZXA 1V58A 1R4WA 2R6KA 1QGVA 3RAZA 3QOUA 3BD2A 1VF2A 2WZ9A 1ZZYA 2MMZA 4JRRA 1SJ6A 5IIZA 2FNOA 1GTBA 3UOMA 3QAGA 1MDKA 4WKWA 3HXSA 4BL7A 1B9XC 1YY7A 4ECBA 3HDCA 3KP9A 4ISDA 4IS0A 2BTOT 4TR3A 3DGQA 3GH9A 5ECHB 2IMIA 1GSQA 3GTUB 1K0NA 1A2LA 2C3QA 3F3RA 5G2ZA 1M99A 1I5GA 4K7OA 2H66A 4KCAA 4FYBA 4TXVA 3GKKA 5CRHA 1TOFA 2L6DA 4GCIA 3IC4A 4KW6A 5J5NA 3PH9A 1QMVA 2PU9C 1ACVA 2GSQA 5ECKB 1SYXA 4IKHA 3TKSA 3GSTA 2JSYA 3GIXA 5A4UA 2WB9A 4OMVA 1XWGA 2LRCA 5J3RA 1AUCA 2FA4A 3PINA 1SL2B 3WD6A 2AV4A 1TK8B 3I43A 1FVKA 1OKTA 3EURA 2OBKA 3EINA 4K7NA 3WT2A 3LYPA 2VL9A 3VPQA 4HU7A 1XWAA 3UIWA 4PUFC 1M0UA 4QL7A 2MBSA 3QCPA 5DALB 4RQRA 1OC8A 2GSRA 4H86A 1OE7A 2YV7A 3Q74A 1X0RA 4E8HA 3W8SA 3ERFA 5B8AA 3ZVJD 2V6KA 2H6ZA 3ZRDA 2MMNA 3ME8A 4FYUA 1T4YA 2HLSA 3GL5A 1A2MA 4KH7A 3LEFA 4POKA 1TRUA 3FZ9A 4MJCA 1Z6MA 3F9UA 3F8UA 2C0FA 4HZ4A 4NPBA 3G7IA 5ECSA 3GNJA 2CT6A 2R37A 4MJAA 9GSSA 2IL3A 1EV9A 3KTBA 1NSWA 5E4WA 3C8EA 5ECQB 2REMA 1ST9A 2GT6A 1FHEA 4JU5A 3MAKA 3A2VA 3UJ1A 5CRGA 5ENUA 2B1LA 1R26A 3VWVA 5CRDA 1NW2A 2GLRA 1T00A 1YDKA 2C0DA 4PNGA 3M9JA 5F05A 3ZITA 1G7EA 4XCSA 2O89A 1EOHA 1O8WA 1F6MC 2L6CA 2YZHA 4ULXA 3C73A 2O7KA 1MD4A 4YQUA 1DE1A 4WR4A 5H5RA 4L5OA 4NHWA 3TOTA 1VRSD 1SKSB 1SENA 6GSSA 2PUKC 1Z3EA 1SK2A 2PBJA 5DAKB 3LORA 1GLPA 4XRDA 3ISOA 1PX7A 1V40A 2YZUA 4P3YB 3GN3A 3IA1A 10GSA 4MJBA 2AYTA 1ERVA 1OVNA 4ID0A 3DKSA 1NHYA 3IR4A 1M7TA 2VCTA 3IAM2 2WJUA 4WR5A 3ME7A 2JADA 2FHEA 4JR4A 2AHEA 4OO5A 1TI1A 1A0FA 1TRSA 2FCHA 2VM2A 1MTCA 1A0RP 5AISA 3BOAA 4WBJA 1JHBA 4MPFA 5IO0A 2CZ2A 5ECPB 1R7HA 1S3CA 4JR6A 5HR0A 4F9ZA 2GS3A 3VI5A 4G2EA 1K3OA 3LSZA 2DJKA 4RI6A 1WRYA 3LXZA 1GUHA 2H19A 2VCWA 1JLVA 1Y25A 2RM6A 1SU9A 4IELA 3ED3A 5HR3A 2FWHA 5CRWA 1J08A 1XIYA 4J56E 2YN1A 3F0IA 4MCUA 3DVWA 1OKDA 1K3YA 2XHFA 4CDOA 1CQGA 2I81A 1GTAA 3LJRA 2QGVA 2XC2A 1ZMAA 4FIWA 3J7Yb 3KXOA 1NHOA 1Q4JA 1BG5A 2YWNA 1FB6A 2H8LA 4NHZA 4FO5A 3W6GA 2YANA 3R2QA 3TOUA 4F0CA 2HZEB 4KDYA 1SK1A 1AQWA 1MD3A 2RLIA 4XRAA 5B8BA 1X5CA 2KLXA 2VLUA 5DVBA 4QQ7A 4LL4B 1O85A 3ERWA 1SYRA 1XOBA 1M2DA 4BPYA 3KJYA 3H93A 1I9DA 4CHSA 3WYWA 3DMLA 1PL1A 1GNEA 4YAVA 2LRNA 3EE2A 5B7CA 2CQ9A 4AF2A 1T3BA 3ZLPA 2DC5A 5FT3A 2HFDA 3Q18A 1ERTA 2PMTA 1TU7A 4MZCA 2WDUA 5LD0A 5G31A 5C00A 2HI7A 2EC4A 1U6TA 2LJAA 3GKMA 6GSUA 2IFQB 2XBQA 3IE3A 3KMOA 2M72A 4KSOA 4ZL8A 2YV9A 2IMDA 4L0WA 3JCML 4GSTA 2H1AA 3FR3A 4K1FA 1GULA 1OC9A 4N10A 3AY8A 5KEJA 4GLTA 1Z6NA 3QAWA 1B4QA 2IIYA 3MWHA 3I9V2 5ECLB 2TRCP 5J9CA 3FKFA 1XBSA 5DQSA 2CAQA 2RM5A 2EIOA 2FWFA 3SBCA 1QFNA 3PR8A 1A2JA 2P5QA 2OBIA 4JZQA 1XVWA 2E2GA 1KNGA 1O81A 2C3NA 3FW2A 5HFKA 5IM9A 5HQPA 4IJ3A 4EUYA 4Q5RA 3H8QA 3UL3A 1GUKA 19GSA 3F6DA 2YNXA 5D9XA 4IBPA 3UMAA 3ZFLA 5DCGA 3NOFA 3H4KA 4JEDA 2VCVA 4MH3A 5A4WA 1LJRA 1BQ7A 5CYYA 16GSA 1GNWA 2K18A 1USBA 1XOAA 2B6MA 3PGTA 4ZILA 4PQHA 3CTFA 4MK3A 1BYEA 2K8SA 3CTGA 4TR4A 2CVKA 4JE1A 3FHKA 4MF5A 1ERUA 2GSTA 1SJZA 1TU8A 1SKRB 2L57A 1N8JA 1ML6A 4ECIA 2FY6A 8GSSA 5H5QA 2C0GA 4XS4B 3KP8A 1XFLA 5ID2B 4TVEA 1LBKA 3TKSE 4GSNA 2MMOA 3GKNA 5JCWA 2PGTA 3EC3A 1AQVA 2WULA 3RDWA 2LSTA 1OYJA 1EWXA 2GT5A 3HJPA 4J2FA 5G5EA 3DYRA 1UC7A 3HVXA 1JLWA 2KOKA 1WJKA 1MDIA 5KN0A 3GMFA 1TKDB 5IMAA 3IOSA
chains in the Genus database with same CATH superfamily
4X0XA 2C4JA 2XPDA 4PXOA 11GSA 2FUG2 4K8MA 5L71A 4EF0A 2GTUA 3RBTA 1U88A 3HYPA 5AIXA 5GSTA 2C1YA 2CX3A 1K0CA 3O76A 3TGZA 2VCZA 4MF7A 4EC0A 5B6MA 4OD7A 2DJJA 2XBIA 2L59A 3TKQA 2G2QA 4O32A 1WWJA 1GSYA 2GQMA 3GV1A 2B7JA 4RUVA 2DJ1A 1Z9HA 1YKCA 5COHA 3Q6OA 1K3LA 1FW1A 3APSA 3L0HA 4FQUA 5EY6A 2PN8A 2OJLA 3BCKA 1G7OA 4K0NA 1QK8A 5HR1A 3IDVA 1X5EA 2D2ZA 2R0CA 3E0UA 1XZOA 1VF3A 2L5LA 1V2AA 2H73A 4ZB6A 1B8XA 3UAPA 4PUAA 1KBNA 2MBTA 1JZOA 2NTOA 1BX9A 3M9KA 2NVLA 1M3IA 4TXOA 3UEMA 1O6JA 4YKFA 5IOXA 1A23A 2VD1A 3GHAA 3KD0A 3ZL5A 5JCUA 1MEKA 2PERA 3F3QA 4EE0A 4F2IA 4F03A 1ERWA 4EL1A 2H76A 2C80A 3I69A 1JZRA 5HFGA 1T4ZA 3KEBA 2YJ7A 3V1WA 4IQAA 1FVJA 4MA9A 2F51A 3L78A 2LJRA 4N30A 4DVCA 1M2AA 3TKSC 1ZYEA 1ABAA 3FZAA 4KUNA 4G9HA 1YF1A 1Q98A 1Z7RA 2FWEA 5IMDA 4ILFA 2JZSA 4HU9A 1J9BA 2LTKA 5E59A 5INYA 2E2MA 3GX8A 4IJIA 5J9BA 3FEUA 2F9SA 3GTUA 5AGYA 3J7Yk 1FOVA 3IHQA 4FYCA 5IMZA 2VL2A 5HFIA 4G19A 3ZZXA 2M46A 2WGRA 4JBBA 1U87A 2H0GA 1PA3A 1T8EB 1EOGA 2KHPA 1GSUA 3P7XA 1F37A 3O6TA 4HUAA 5ECNB 5CAXA 5CREA 5BMUA 3GSSA 1WPIA 1W4VA 3D5JA 2HNLA 5D9WA 3VWUA 3D21A 2YWOA 1X9WB 2V32A 5DDLA 4EO3A 5JWRB 2HYXA 3M8NA 1PD21 2GQLA 3TKPA 4IN0A 1W89A 2OE3A 2J9HA 5BRTA 1PN0A 2PWJA 5D9VA 3HY2A 3TCOA 2NBSA 6GSTA 4TN8A 7GSSA 4BVYB 3F6FA 2HSMA 1Y6EA 5DALA 4ECJA 1SL1B 2LEGA 5F0GA 5GZZB 2IJYA 2WS2A 3LWAA 1THOA 3WGXA 2HE3A 4I8BA 1AW9A 1THXA 5D73A 3LW9A 4BA7A 1FAAA 3HJMA 1E6BA 3L9SA 1XWKA 3BBYA 5J4UA 3D0ZA 4ML6A 2ES7A 3ZVJA 4I6XA 3MNGA 4KGIA 2JZRA 2GZPA 2IMEA 4KNDA 2FA8A 2K8VA 4TR1B 4IGJA 4KA0A 5IPHA 3KIJA 4G10A 4I2UA 1PKZA 1S3DA 2LNTA 4YH2A 2TRXA 3G9BA 3NIVA 2WCIA 3LQ7A 3KZQA 3F4RA 1SK0A 1ZYNA 3IBHA 1B9YC 2X8CA 1X5DA 4DSSB 2PVOC 1DUGA 2TIRA 1TK5B 4O7HA 2V41A 5ECIB 1ILOA 2H01A 3L9VA 4YQMA 3ZMKA 2KP2A 5G1LA 5FHIA 1K0MA 3WGEA 5D93A 3G7YA 3VWWA 2AAWA 3UVHA 4PQIA 3P2AA 4X43A 4MLYA 2CV4A 4V1Ag 4MP4A 4K0GA 4XTSA 5ABRA 4KDUA 3GUSA 3L9UA 2R3XA 5DAKA 1PQNA 4HJMA 2WRTA 3QFBC 1ZL9A 3NZNA 4HQZA 4Z2TA 1S3AA 2VCXA 5DCHA 1GSSA 3IRAA 1U3AA 3C7MA 12GSA 2YCDA 4LMWA 2LRTA 3VFIA 1M9AA 3HHVA 2B1KA 2V1MA 5LCZA 2HZFA 3D6IA 2EIRA 2YP6A 2HSHA 4NMUA 2B5YA 1LU4A 4HI7A 3KH7A 1UN2A 4MMMA 4LLRA 1EZKA 4ACSA 3EVIA 1S3RA 5GAND 3TJKA 2I9HA 3A2XA 3QD9A 3HZ4A 4Q5NA 3FR6A 2CVDA 4TRXA 3O3TA 1CQHA 1VF4A 4XS6A 3LGCA 5HR2A 5JCGA 2LV3A 1E2YA 1URMA 1WOUA 4NXIA 3BCIA 4Q5FA 2K6VA 1TJDA 2DJ0A 2VOCA 5D9TA 4OFMA 4I2TA 1XW5A 2QKEA 3DWVA 4I5QA 2LQOA 2V6OA 1DSBA 2X8HA 4D73B 3EWLA 2FLSA 2IPAA 2QA2A 4BIKA 3DD3A 4F82A 4X1UA 2JACA 1QXHA 2P0GA 3D4TA 3D22A 1A8YA 3EPTA 4V2NA 2H6XA 3IXRA 4V2MA 5ECMB 1FOHA 4G0IA 4LL1B 2AJQB 2VUPA 3I6AA 4BL7B 2LS5A 4IHUA 2K9FA 4E8EA 2HZEA 4GRFA 4NAXA 2HRFA 4L0UA 1YQ1A 3P90A 5IMCA 4MZWA 3EU4A 4MH2A 2AB6A 3MSZA 3TJBA 1SL0B 4DSQA 2H71A 1YF0A 1Z5YE 4MPGA 1ZYPA 4GSSA 4WEYA 2YJHA 3ZYWA 1XPVA 1OAZA 1F3BA 5LNKe 1VF1A 1GWCA 1EV4A 4L5LA 2IMKA 3UBKA 2C0EA 3Q19A 4KX4A 1T1VA 2OE1A 4EDYA 1YEXA 3QPMA 5JWOB 3IK7A 3QR6A 1F2EA 2J23A 1M2BA 3S9FA 2N5BA 2L4QA 3TKRA 3EMXA 4KB3A 3GRXA 3HD5A 3C1RA 5KN3A 3R3EA 13GSA 4NV2A 3LG6A 4BVXA 2IFQA 2A2SA 1N2AA 2DMMA 3FZ5A 3HZ8A 1PKWA 4GXZA 5DJLA 4POMA 3VURA 5G30A 1RK4A 1T7PB 1PMTA 17GSA 3US3A 2A2RA 2OADA 2PVQA 5F8BA 3TJGA 3RPPA 3DEXA 5GSSA 3LFLA 3FYGA 5JWQB 1FB0A 1R5AA 2DBCA 4EXJA 2DLXA 6GSWA 3KMNA 2ZNMA 4XHMA 1QUWA 2I1UA 1RW1A 2GZZA 4PQ1A 2RUFA 4ZB9A 3ZIJA 4GF0A 4OO4A 3E3EA 2Z9SA 1TTZA 3U6VA 4V2LA 1V98A 3CSIA 5DQYA 4YAPA 2HT9A 6GSYA 1HQOA 1SKWB 3FRCA 3GURA 1BJXA 3VLNA 2I4AA 3IPZA 1AAZA 4IVFA 4MZBA 3GX0A 4ECCA 4Q5QA 3GH6A 1C72A 3HKRA 3IC8A 3W8JA 1FG4A 4N11A 2VM1A 1RQMA 1IYHA 5IMFA 1XW9A 5IO2A 2FD3A 2KUCA 2IWTA 3H79A 4HOJA 3VK9A 1TRWA 2JSZA 3LXTA 3WT1A 2BJXA 2C3TA 3TJFA 2E7PA 2YPMA 1F9MA 4V1Ap 1OC3A 1TDIA 2KP1A 1K0AA 4HS1A 4KE3A 1WIKA 5D8IA 5H5SA 3CBUA 5IMVA 2DMLA 2VCQA 4ZBBA 5A4VA 4CY8A 3ERGA 1UVZA 1A24A 3MIXA 4WBRD 3TJJA 4QL9A 1BEDA 4ZBAA 4XS4A 2DIYA 4DEJA 4G0KA 4KSMA 5ID2A 4LA1A 4OCEA 4RQXA 3UARA 1HD2A 3DRNA 4CW9A 2GZYA 1GTIA 2LJKA 2YWIA 3KCMA 2HRKA 1ZGNA 1AQXA 2QSIA 4AJ8A 4GTUA 3GL3A 3GFKA 1X9SB 1TP9A 5CNWA 2DKIA 3UVTA 1HYUA 1TRVA 2OKAA 1WP0A 4Z2UA 1XXUA 2AUVA 4YQVA 4O5UA 2B5XA 2ZCTA 3DXBA 4BWSA 3U5RE 1IYIA 3FMWA 3K8NA 1Z7PA 2XPEA 3MDKA 3QMXA 5KOWA 1R5PA 3RHBA 3WGDA 3FR9A 4HJ2A 4O5RA 3N5OA 2R5GA 1AC1A 1GSFA 2FGXA 5CP1A 1K0DA 4ICYA 1V57A 3H1NA 4WF5A 1H4OA 4ZL7A 2RIIA 1PL2A 4L8EA 5DJMA 1EEMA 2VLVA 2WFCA 5ELAA 2MYGA 2X99A 5IPGA 2ALBA 5J41A 2R4VA 1WMJA 4AJ6A 4N0VA 2IMFA 4PURA 2B5EA 2L5OA 1PX6A 20GSA 2DJ3A 3TRXA 2CX4A 3A5IA 1PN9A 4TW5A 3KH9A 2X64A 1QQ2A 4EKZA 2LNSA 4FH8A 3A3TA 4K9ZA 3TUEA 5KN1A 5EVOA 1OE8A 4NWYA 4O92A 2HSYA 2M80A 2F8AA 1K0OA 4F0BA 2N5AA 2OA7A 3A5WA 3FZ4A 3SWLA 1GSDA 4IQ1A 4DSRA 3CSJA 1XWCA 4LMVA 2LQQA 2B3SA 4GWRA 2P31A 1GP1A 4ML1A 3CMIA 5A5KA 1G6WA 3CSHA 5DBQA 1GSEA 4K5SA 1EP8A 2VO4A 2YOIA 1JZWA 1EGOA 3HJOA 2CZ3A 1O73A 2V2GA 3ZMLA 1ZYQB 4IW9A 3VPTA 2H75A 2JZTA 2H1GA 2PPTA 1K0BA 2VL2C 3CRTA 5ELGA 5IQYA 3CXGA 3HVSA 2OE0A 2EIQA 2H1BA 3G7JA 1F3AA 3M1GA 2MZCA 5G5FA 1XW6A 4K7IA 4K2DA 3ZTLA 5KN2A 1PFOA 3IAS2 1PRXA 4POLA 2BMXA 1NM3A 5EL8A 4TR0A 1GTUA 1OC9B 2NDOA 3KTLA 4NV5A 2RUEA 2GDRA 2C8UA 5GAPD 2CVBA 1YKAA 6GSVA 5G1KA 4TKYA 4HDEA 3DVXA 2A4VA 2NPBA 5D96A 1HNAA 3FK8A 1SD9A 1X9MB 1XWBA 6GSXA 2O87A 4IP1A 2GVPA 3PPUA 1KEBA 1M9BA 2JU5A 2HXKA 1HNBA 1MDJA 3M0FA 2FWGA 4ZIJA 3BJ5A 3M3MA 3HCZA 1SD8A 5B6NA 2GQKA 2ON7A 2VD0A 4GQCA 2ON5A 4ZB8A 4HEA2 1V9WA 4ZBDA 2O85A 4RI7A 3E9JB 1EP7A 2DSAA 4GQFA 2H6YA 4KAEA 3D4MA 2X49A 2QA1A 5F07A 2VAFA 4EVMA 2HRAA 3IV4A 1EGRA 3GKXA 3F4SA 1XG8A 3EMPA 4AJ7A 1TK0B 5AN1A 2F8FA 4WXTA 5C04A 1B48A 1O7UA 2P5RA 4BVYA 4HQSA 3EYTA 2H74A 2R2JA 5CO3A 3KM6A 3VWXA 3F4TA 2H1DA 2G0FA 4KDXA 1G0TA 2MMAA 4EDZA 4OFTA 2DJ2A 3ZREA 3N9JA 3IK9A 1PGTA 1B4PA 5IOWA 2H70A 1M3JA 1TW9A 1SJIA 2CA8A 2JL4A 4PGTA 3UBLA 1BAYA 4ZXGA 3QFAC 1H75A 4MABA 4TOPA 4TR1A 1DE2A 3KGKA 3EU3A 4MDCA 1WE0A 3GA4A 1KTEA 1PSQA 2CAIA 3APOA 1ZOFA 4MJEA 1JFUA 3QDNA 2L4CA 3OR5A 3LYKA 4KCEA 18GSA 2LKUA 3HVVA 2H0IA 4DSSA 1AXDA 1A8LA 1J0FA 3FY7A 3QAVA 1TI3A 2A4HA 3F63A 4WF4A 4N0ZA 4G0LA 1GLQA 3A2WA 2OACA 4IP6A 3HA9A 4OWYA 1GUMA 1TXXA 1XVQA 5ECOB 1FO5A 2HRNA 2VL3A 1GL8A 4WETA 4OCFA 3TDGA 1G6YA 1GRXA 4Z7XA 1YJ6A 1UA5A 3CYNA 3P8WA 4CY6A 5ECRB 4XS1A 3GYKA 3C71A 4HZ2A 4PNFA 3TRQA 5F06A 1U3IA 3ZFBA 4K5RA 3APQA 2H0HA 4XIHA 3TRPA 3C1SA 1DBYA 4BWQA 1AIUA 2B7KA 3VI7A 2IN3A 2QC7A 1XCCA 5FWGA 1VGLA 2LUSA 5EPFA 2X8GA 4OFNA 5AIVA 1YEPA 2GGTA 1HNCA 3CRUA 4MF6A 4PX1A 3ZIVA 4I97A 2H30A 4J57E 2ZUPA 4ZL9A 14GSA 2F3MA 3DIEA 1ZCPA 3L4NA 2E0QA 2H72A 2I3YA 1O8XA 2N5FA 1JZDA 1GH2A 4TXOB 22GSA 4K6XA 2O8VB 2VLTA 2YWMA 1ON4A 2GSSA 1EEJA 3RHCA 2DIZA 3TB2A 2VIMA 4POBA 4AGSA 3RPNA 4D73A 1YZXA 1V58A 1R4WA 2R6KA 1QGVA 3RAZA 3QOUA 3BD2A 4A5PA 1VF2A 2WZ9A 3HVNA 1ZZYA 2MMZA 4JRRA 1SJ6A 5IIZA 2FNOA 1GTBA 3UOMA 3QAGA 1MDKA 4WKWA 3HXSA 4BL7A 1B9XC 1YY7A 4ECBA 3HDCA 3KP9A 4ISDA 4IS0A 2BTOT 4TR3A 3DGQA 3GH9A 5ECHB 2IMIA 1GSQA 3GTUB 1K0NA 1A2LA 2C3QA 3F3RA 5G2ZA 1M99A 1I5GA 4K7OA 2H66A 4KCAA 4FYBA 4TXVA 3GKKA 5CRHA 1TOFA 2L6DA 4GCIA 3IC4A 4KW6A 5J5NA 3PH9A 1QMVA 2PU9C 1ACVA 2GSQA 5ECKB 1SYXA 4IKHA 3TKSA 3GSTA 2JSYA 3GIXA 5A4UA 2WB9A 4OMVA 1XWGA 2LRCA 5J3RA 1AUCA 2FA4A 3PINA 1SL2B 3WD6A 2AV4A 1TK8B 3I43A 1FVKA 1OKTA 3EURA 2OBKA 3EINA 4K7NA 3WT2A 3LYPA 2VL9A 3VPQA 4HU7A 1XWAA 3UIWA 4PUFC 1M0UA 4QL7A 2MBSA 3QCPA 5DALB 4RQRA 1OC8A 2GSRA 4H86A 1OE7A 2YV7A 3Q74A 1X0RA 4MNNA 4E8HA 3W8SA 3ERFA 5B8AA 3ZVJD 2V6KA 2H6ZA 3ZRDA 2MMNA 3ME8A 4FYUA 1T4YA 2HLSA 3GL5A 1A2MA 4KH7A 3LEFA 4YKGA 4POKA 1TRUA 3FZ9A 4MJCA 1Z6MA 3F9UA 3F8UA 2C0FA 4HZ4A 4NPBA 3G7IA 5ECSA 3GNJA 2CT6A 2R37A 2UZ8A 4MJAA 9GSSA 2IL3A 1EV9A 3KTBA 1NSWA 5E4WA 3C8EA 5ECQB 2REMA 1ST9A 2GT6A 1FHEA 4JU5A 3MAKA 5KOXA 3A2VA 3UJ1A 5CRGA 5ENUA 2B1LA 1R26A 3MYDA 3VWVA 5CRDA 1NW2A 2GLRA 1T00A 1YDKA 2C0DA 4PNGA 3M9JA 5F05A 3ZITA 1G7EA 4XCSA 2O89A 1EOHA 1O8WA 1F6MC 2L6CA 2YZHA 4ULXA 3C73A 2O7KA 1MD4A 4YQUA 1DE1A 4WR4A 5H5RA 4L5OA 4NHWA 3TOTA 1VRSD 1SKSB 1SENA 6GSSA 2PUKC 1Z3EA 1SK2A 2PBJA 5DAKB 3LORA 1GLPA 4XRDA 3ISOA 1PX7A 1V40A 2YZUA 4P3YB 3GN3A 3IA1A 10GSA 4MJBA 2AYTA 1ERVA 1OVNA 4ID0A 3DKSA 1NHYA 3IR4A 1M7TA 2VCTA 3IAM2 2WJUA 4WR5A 3ME7A 2JADA 2FHEA 4JR4A 2AHEA 4OO5A 1TI1A 1A0FA 1TRSA 2FCHA 2VM2A 1MTCA 1A0RP 5AISA 3BOAA 4WBJA 1JHBA 4MPFA 5IO0A 2CZ2A 4EIPA 5ECPB 1R7HA 1S3CA 4JR6A 5HR0A 4F9ZA 2GS3A 3VI5A 4G2EA 1K3OA 3LSZA 2DJKA 4RI6A 1WRYA 3LXZA 1GUHA 2H19A 2VCWA 4KF9A 1JLVA 1Y25A 2RM6A 1SU9A 4IELA 3ED3A 5HR3A 2FWHA 5CRWA 1J08A 2R0GA 1XIYA 4J56E 2YN1A 4PTSA 3F0IA 4MCUA 3DVWA 1OKDA 1K3YA 2XHFA 4CDOA 1CQGA 2I81A 1GTAA 3LJRA 2QGVA 2XC2A 1ZMAA 4FIWA 3J7Yb 3KXOA 1NHOA 1Q4JA 1BG5A 2YWNA 1FB6A 2H8LA 4NHZA 4FO5A 3W6GA 2YANA 3R2QA 3TOUA 4F0CA 2HZEB 4KDYA 1SK1A 1AQWA 1MD3A 2RLIA 4XRAA 5B8BA 1X5CA 2KLXA 2VLUA 5DVBA 4QQ7A 4LL4B 1O85A 3ERWA 1SYRA 1XOBA 1M2DA 4BPYA 3KJYA 3H93A 1I9DA 4CHSA 3WYWA 3DMLA 1PL1A 1GNEA 4YAVA 2LRNA 3EE2A 5B7CA 2CQ9A 4AF2A 1T3BA 3ZLPA 2DC5A 5FT3A 4USSA 2HFDA 3Q18A 1ERTA 2PMTA 1TU7A 4MZCA 2WDUA 3IHGA 5LD0A 5G31A 5C00A 2HI7A 2EC4A 1U6TA 4Z2RA 2LJAA 3GKMA 6GSUA 4BVXB 2IFQB 2XBQA 3IE3A 3KMOA 2M72A 4KSOA 4ZL8A 2YV9A 2IMDA 4L0WA 3JCML 4GSTA 2H1AA 3FR3A 4K1FA 1GULA 1OC9A 4N10A 3AY8A 5KEJA 4GLTA 1Z6NA 3QAWA 1B4QA 2IIYA 3MWHA 3I9V2 5ECLB 2TRCP 5J9CA 3FKFA 1XBSA 5DQSA 2CAQA 2RM5A 2A2PA 2EIOA 2FWFA 3SBCA 1QFNA 3PR8A 1A2JA 2P5QA 2OBIA 4JZQA 1XVWA 2E2GA 1KNGA 1O81A 2C3NA 3FW2A 5HFKA 5IM9A 4K2XA 5HQPA 4IJ3A 4EUYA 4Q5RA 3H8QA 3UL3A 1GUKA 19GSA 3F6DA 2YNXA 5D9XA 4IBPA 3UMAA 3ZFLA 5DCGA 3NOFA 3H4KA 4JEDA 2VCVA 4MH3A 5A4WA 1LJRA 2R0PA 1BQ7A 4HSCX 5CYYA 16GSA 1GNWA 2K18A 1USBA 1XOAA 2B6MA 3PGTA 4EIQA 4ZILA 4PQHA 3CTFA 4MK3A 1BYEA 2K8SA 3CTGA 4TR4A 2CVKA 4JE1A 3FHKA 4MF5A 1ERUA 2GSTA 1SJZA 1TU8A 1SKRB 2L57A 1N8JA 1ML6A 4ECIA 2FY6A 8GSSA 5H5QA 2C0GA 4XS4B 3KP8A 1XFLA 5ID2B 4TVEA 1LBKA 3TKSE 4GSNA 2MMOA 3GKNA 5JCWA 4X4JA 2PGTA 3EC3A 1AQVA 2WULA 3RDWA 2LSTA 1OYJA 3CQFA 1EWXA 2GT5A 3HJPA 4J2FA 5G5EA 2DKHA 3DYRA 1UC7A 3HVXA 1JLWA 2KOKA 1WJKA 2X4AA 1MDIA 5KN0A 3GMFA 1TKDB 4O5QA 5IMAA 3IOSA
chains in the Genus database with same CATH topology
4X0XA 2C4JA 2XPDA 4PXOA 11GSA 2FUG2 4K8MA 5L71A 4EF0A 2GTUA 3RBTA 1U88A 3HYPA 5AIXA 5GSTA 2C1YA 2CX3A 1K0CA 3O76A 3TGZA 2VCZA 4MF7A 4EC0A 5B6MA 4OD7A 2DJJA 2XBIA 2L59A 3TKQA 2G2QA 4O32A 1WWJA 1GSYA 2GQMA 3GV1A 2B7JA 4RUVA 2DJ1A 1Z9HA 1YKCA 5COHA 3Q6OA 1K3LA 1FW1A 3APSA 3L0HA 4FQUA 5EY6A 2PN8A 2OJLA 3BCKA 1G7OA 4K0NA 1QK8A 5HR1A 3IDVA 1X5EA 2D2ZA 2R0CA 3E0UA 1XZOA 1VF3A 2L5LA 1V2AA 2H73A 4ZB6A 1B8XA 3UAPA 4PUAA 1KBNA 2MBTA 1JZOA 2NTOA 1BX9A 3M9KA 2NVLA 4TXOA 3UEMA 1O6JA 4YKFA 5IOXA 1A23A 2VD1A 3GHAA 3KD0A 3ZL5A 5JCUA 1MEKA 2PERA 3F3QA 4EE0A 4F2IA 4F03A 1ERWA 4EL1A 2H76A 2C80A 3I69A 1JZRA 5HFGA 1T4ZA 3KEBA 2YJ7A 3V1WA 4IQAA 1FVJA 4MA9A 2F51A 3L78A 2LJRA 4N30A 4DVCA 1M2AA 3TKSC 1ZYEA 1ABAA 3FZAA 4KUNA 4G9HA 1YF1A 1Q98A 1Z7RA 2FWEA 5IMDA 4ILFA 2JZSA 4HU9A 1J9BA 2LTKA 5E59A 5INYA 2E2MA 3GX8A 4IJIA 5J9BA 3FEUA 2F9SA 3GTUA 5AGYA 3J7Yk 1FOVA 3IHQA 4FYCA 5IMZA 2VL2A 5HFIA 4G19A 3ZZXA 2M46A 2WGRA 4JBBA 1U87A 2H0GA 1PA3A 1T8EB 1EOGA 2KHPA 1GSUA 3P7XA 1F37A 3O6TA 4HUAA 5ECNB 5CAXA 5CREA 5BMUA 3GSSA 1WPIA 1W4VA 3D5JA 2HNLA 5D9WA 3VWUA 3D21A 2YWOA 1X9WB 2V32A 5DDLA 4EO3A 5JWRB 2HYXA 3M8NA 1PD21 2GQLA 3TKPA 4IN0A 1W89A 2OE3A 2J9HA 5BRTA 1PN0A 2PWJA 5D9VA 3HY2A 3TCOA 2NBSA 6GSTA 4TN8A 7GSSA 4BVYB 3F6FA 2HSMA 1Y6EA 5DALA 4ECJA 1SL1B 2LEGA 5F0GA 5GZZB 2IJYA 2WS2A 3LWAA 1THOA 3WGXA 2HE3A 4I8BA 1AW9A 1THXA 5D73A 3LW9A 4BA7A 1FAAA 3HJMA 1E6BA 3L9SA 1XWKA 3BBYA 5J4UA 3D0ZA 4ML6A 2ES7A 3ZVJA 4I6XA 3MNGA 4KGIA 2JZRA 2GZPA 2IMEA 4KNDA 2FA8A 2K8VA 4TR1B 4IGJA 4KA0A 5IPHA 3KIJA 4G10A 4I2UA 1PKZA 1S3DA 2LNTA 4YH2A 2TRXA 3G9BA 3NIVA 2WCIA 3LQ7A 3KZQA 3F4RA 1SK0A 1ZYNA 3IBHA 1B9YC 2X8CA 1X5DA 4DSSB 2PVOC 1DUGA 2TIRA 1TK5B 4O7HA 2V41A 5ECIB 1ILOA 2H01A 3L9VA 4YQMA 3ZMKA 2KP2A 5G1LA 5FHIA 1K0MA 3WGEA 5D93A 3G7YA 3VWWA 2AAWA 3UVHA 4PQIA 3P2AA 4X43A 4MLYA 2CV4A 4V1Ag 4MP4A 4K0GA 4XTSA 5ABRA 4KDUA 3GUSA 3L9UA 2R3XA 5DAKA 1PQNA 4HJMA 2WRTA 3QFBC 1ZL9A 3NZNA 4HQZA 4Z2TA 1S3AA 2VCXA 5DCHA 1GSSA 3IRAA 1U3AA 3C7MA 12GSA 2YCDA 4LMWA 2LRTA 3VFIA 1M9AA 3HHVA 2B1KA 2V1MA 5LCZA 2HZFA 3D6IA 2EIRA 2YP6A 2HSHA 4NMUA 2B5YA 1LU4A 4HI7A 3KH7A 1UN2A 4MMMA 4LLRA 1EZKA 4ACSA 3EVIA 5GAND 3TJKA 2I9HA 3A2XA 3QD9A 3HZ4A 4Q5NA 3FR6A 2CVDA 4TRXA 3O3TA 1CQHA 1VF4A 4XS6A 3LGCA 5HR2A 5JCGA 2LV3A 1E2YA 1URMA 1WOUA 4NXIA 3BCIA 4Q5FA 2K6VA 1TJDA 2DJ0A 2VOCA 5D9TA 4OFMA 4I2TA 1XW5A 2QKEA 3DWVA 4I5QA 2LQOA 2V6OA 1DSBA 2X8HA 4D73B 3EWLA 2FLSA 2IPAA 2QA2A 3DD3A 4F82A 4X1UA 2JACA 1QXHA 2P0GA 3D4TA 3D22A 1A8YA 3EPTA 4V2NA 2H6XA 3IXRA 4V2MA 5ECMB 1FOHA 4G0IA 4LL1B 2AJQB 2VUPA 3I6AA 4BL7B 2LS5A 4IHUA 2K9FA 4E8EA 2HZEA 4GRFA 4NAXA 2HRFA 4L0UA 1YQ1A 3P90A 5IMCA 4MZWA 3EU4A 4MH2A 2AB6A 3MSZA 3TJBA 1SL0B 4DSQA 2H71A 1YF0A 1Z5YE 4MPGA 1ZYPA 4GSSA 4WEYA 2YJHA 3ZYWA 1XPVA 1OAZA 1F3BA 5LNKe 1VF1A 1GWCA 1EV4A 4L5LA 2IMKA 3UBKA 2C0EA 3Q19A 4KX4A 1T1VA 2OE1A 4EDYA 1YEXA 3QPMA 5JWOB 3IK7A 3QR6A 1F2EA 2J23A 1M2BA 3S9FA 2N5BA 2L4QA 3TKRA 3EMXA 4KB3A 3GRXA 3HD5A 3C1RA 5KN3A 3R3EA 13GSA 4NV2A 3LG6A 4BVXA 2IFQA 2A2SA 1N2AA 2DMMA 3FZ5A 3HZ8A 1PKWA 4GXZA 5DJLA 4POMA 3VURA 5G30A 1RK4A 1T7PB 1PMTA 17GSA 3US3A 2A2RA 2OADA 2PVQA 5F8BA 3TJGA 3RPPA 3DEXA 5GSSA 3LFLA 3FYGA 5JWQB 1FB0A 1R5AA 2DBCA 4EXJA 2DLXA 6GSWA 3KMNA 2ZNMA 4XHMA 1QUWA 2I1UA 1RW1A 2GZZA 4PQ1A 2RUFA 4ZB9A 3ZIJA 4GF0A 4OO4A 3E3EA 2Z9SA 1TTZA 3U6VA 4V2LA 1V98A 3CSIA 5DQYA 4YAPA 2HT9A 6GSYA 1HQOA 1SKWB 3FRCA 3GURA 1BJXA 3VLNA 2I4AA 3IPZA 1AAZA 4IVFA 4MZBA 3GX0A 4ECCA 4Q5QA 3GH6A 1C72A 3HKRA 3IC8A 3W8JA 1FG4A 4N11A 2VM1A 1RQMA 1IYHA 5IMFA 1XW9A 5IO2A 2FD3A 2KUCA 2IWTA 3H79A 4HOJA 3VK9A 1TRWA 2JSZA 3LXTA 3WT1A 2BJXA 2C3TA 3TJFA 2E7PA 2YPMA 1F9MA 4V1Ap 1OC3A 1TDIA 2KP1A 1K0AA 4HS1A 4KE3A 1WIKA 5D8IA 5H5SA 3CBUA 5IMVA 2DMLA 2VCQA 4ZBBA 5A4VA 4CY8A 3ERGA 1UVZA 1A24A 3MIXA 4WBRD 3TJJA 4QL9A 1BEDA 4ZBAA 4XS4A 2DIYA 4DEJA 4G0KA 4KSMA 5ID2A 4LA1A 4OCEA 4RQXA 3UARA 1HD2A 3DRNA 4CW9A 2GZYA 1GTIA 2LJKA 2YWIA 3KCMA 2HRKA 1ZGNA 1AQXA 2QSIA 4AJ8A 4GTUA 3GL3A 3GFKA 1X9SB 1TP9A 5CNWA 2DKIA 3UVTA 1HYUA 1TRVA 2OKAA 1WP0A 4Z2UA 1XXUA 2AUVA 4YQVA 4O5UA 2B5XA 2ZCTA 3DXBA 4BWSA 3U5RE 1IYIA 3FMWA 3K8NA 1Z7PA 2XPEA 3MDKA 3QMXA 5KOWA 1R5PA 3RHBA 3WGDA 3FR9A 4HJ2A 4O5RA 3N5OA 2R5GA 1AC1A 1GSFA 2FGXA 5CP1A 1K0DA 4ICYA 1V57A 3H1NA 4WF5A 1H4OA 4ZL7A 2RIIA 1PL2A 4L8EA 5DJMA 1EEMA 2VLVA 2WFCA 5ELAA 2MYGA 2X99A 5IPGA 2ALBA 5J41A 2R4VA 1WMJA 4AJ6A 4N0VA 2IMFA 4PURA 2B5EA 2L5OA 1PX6A 20GSA 2DJ3A 3TRXA 2CX4A 3A5IA 1PN9A 3KH9A 4TW5A 2X64A 1QQ2A 4EKZA 2LNSA 4FH8A 3A3TA 4K9ZA 3TUEA 5KN1A 5EVOA 1OE8A 4NWYA 4O92A 2HSYA 2M80A 2F8AA 1K0OA 4F0BA 2N5AA 2OA7A 3A5WA 3FZ4A 3SWLA 1GSDA 4IQ1A 4DSRA 3CSJA 1XWCA 4LMVA 2LQQA 2B3SA 4GWRA 2P31A 1GP1A 4ML1A 3CMIA 5A5KA 1G6WA 3CSHA 5DBQA 1GSEA 4K5SA 1EP8A 2VO4A 2YOIA 1JZWA 1EGOA 3HJOA 2CZ3A 1O73A 2V2GA 3ZMLA 1ZYQB 4IW9A 3VPTA 2H75A 2JZTA 2H1GA 2PPTA 1K0BA 2VL2C 3CRTA 5ELGA 5IQYA 3CXGA 3HVSA 2OE0A 2EIQA 2H1BA 3G7JA 1F3AA 3M1GA 2MZCA 5G5FA 1XW6A 4K7IA 4K2DA 3ZTLA 5KN2A 3IAS2 1PRXA 4POLA 2BMXA 1NM3A 5EL8A 4TR0A 1GTUA 1OC9B 2NDOA 3KTLA 4NV5A 2RUEA 2GDRA 2C8UA 5GAPD 2CVBA 1YKAA 6GSVA 5G1KA 4TKYA 4HDEA 3DVXA 2A4VA 2NPBA 5D96A 1HNAA 3FK8A 1SD9A 1X9MB 1XWBA 6GSXA 2O87A 4IP1A 2GVPA 3PPUA 1KEBA 1M9BA 2JU5A 2HXKA 1HNBA 1MDJA 3M0FA 2FWGA 4ZIJA 3BJ5A 3M3MA 3HCZA 1SD8A 5B6NA 2GQKA 2ON7A 2VD0A 4GQCA 2ON5A 4ZB8A 4HEA2 1V9WA 4ZBDA 2O85A 4RI7A 3E9JB 1EP7A 2DSAA 4GQFA 2H6YA 4KAEA 3D4MA 2X49A 2QA1A 5F07A 2VAFA 4EVMA 2HRAA 3IV4A 1EGRA 3GKXA 3F4SA 4AJ7A 3EMPA 1TK0B 5AN1A 2F8FA 4WXTA 5C04A 1B48A 1O7UA 2P5RA 4BVYA 4HQSA 3EYTA 2H74A 2R2JA 5CO3A 3KM6A 3VWXA 3F4TA 2H1DA 2G0FA 4KDXA 1G0TA 2MMAA 4EDZA 4OFTA 2DJ2A 3ZREA 3N9JA 3IK9A 1PGTA 1B4PA 5IOWA 2H70A 1TW9A 1SJIA 2CA8A 2JL4A 4PGTA 3UBLA 1BAYA 4ZXGA 3QFAC 1H75A 4MABA 4TOPA 4TR1A 1DE2A 3KGKA 3EU3A 4MDCA 1WE0A 3GA4A 1KTEA 1PSQA 2CAIA 3APOA 1ZOFA 4MJEA 1JFUA 3QDNA 2L4CA 3OR5A 3LYKA 4KCEA 18GSA 2LKUA 3HVVA 2H0IA 4DSSA 1AXDA 1A8LA 1J0FA 3FY7A 3QAVA 1TI3A 2A4HA 3F63A 4WF4A 4N0ZA 4G0LA 1GLQA 3A2WA 2OACA 4IP6A 3HA9A 4OWYA 1GUMA 1TXXA 1XVQA 5ECOB 1FO5A 2HRNA 2VL3A 1GL8A 4WETA 4OCFA 3TDGA 1G6YA 1GRXA 4Z7XA 1YJ6A 1UA5A 3CYNA 3P8WA 4CY6A 5ECRB 4XS1A 3GYKA 3C71A 4HZ2A 4PNFA 3TRQA 5F06A 1U3IA 3ZFBA 4K5RA 3APQA 2H0HA 4XIHA 3TRPA 3C1SA 1DBYA 4BWQA 1AIUA 2B7KA 3VI7A 2IN3A 2QC7A 1XCCA 5FWGA 1VGLA 2LUSA 5EPFA 2X8GA 4OFNA 5AIVA 1YEPA 2GGTA 1HNCA 3CRUA 4MF6A 4PX1A 3ZIVA 4I97A 2H30A 4J57E 2ZUPA 4ZL9A 14GSA 2F3MA 3DIEA 1ZCPA 3L4NA 2E0QA 2H72A 2I3YA 1O8XA 2N5FA 1JZDA 1GH2A 4TXOB 22GSA 4K6XA 2O8VB 2VLTA 2YWMA 1ON4A 2GSSA 1EEJA 3RHCA 2DIZA 3TB2A 2VIMA 4POBA 4AGSA 3RPNA 4D73A 1YZXA 1V58A 1R4WA 2R6KA 1QGVA 3RAZA 3QOUA 3BD2A 4A5PA 1VF2A 2WZ9A 1ZZYA 2MMZA 4JRRA 1SJ6A 5IIZA 2FNOA 1GTBA 3UOMA 3QAGA 1MDKA 4WKWA 3HXSA 4BL7A 1B9XC 1YY7A 4ECBA 3HDCA 3KP9A 4ISDA 4IS0A 2BTOT 4TR3A 3DGQA 3GH9A 5ECHB 2IMIA 1GSQA 3GTUB 1K0NA 1A2LA 2C3QA 3F3RA 5G2ZA 1M99A 1I5GA 4K7OA 2H66A 4KCAA 4FYBA 4TXVA 3GKKA 5CRHA 1TOFA 2L6DA 4GCIA 3IC4A 4KW6A 5J5NA 3PH9A 1QMVA 2PU9C 1ACVA 2GSQA 5ECKB 1SYXA 4IKHA 3TKSA 3GSTA 2JSYA 3GIXA 5A4UA 2WB9A 4OMVA 1XWGA 2LRCA 5J3RA 1AUCA 2FA4A 3PINA 1SL2B 3WD6A 2AV4A 1TK8B 3I43A 1FVKA 1OKTA 3EURA 2OBKA 3EINA 4K7NA 3WT2A 3LYPA 2VL9A 3VPQA 4HU7A 1XWAA 3UIWA 4PUFC 1M0UA 4QL7A 2MBSA 3QCPA 5DALB 4RQRA 1OC8A 2GSRA 4H86A 1OE7A 2YV7A 3Q74A 1X0RA 4MNNA 4E8HA 3W8SA 3ERFA 5B8AA 3ZVJD 2V6KA 2H6ZA 3ZRDA 2MMNA 3ME8A 4FYUA 1T4YA 2HLSA 3GL5A 1A2MA 4KH7A 3LEFA 4YKGA 4POKA 1TRUA 3FZ9A 4MJCA 1Z6MA 3F9UA 3F8UA 2C0FA 4HZ4A 4NPBA 3G7IA 5ECSA 3GNJA 2CT6A 2R37A 2UZ8A 4MJAA 9GSSA 2IL3A 1EV9A 3KTBA 1NSWA 5E4WA 3C8EA 5ECQB 2REMA 1ST9A 2GT6A 1FHEA 4JU5A 3MAKA 5KOXA 3A2VA 3UJ1A 5CRGA 5ENUA 2B1LA 1R26A 3MYDA 3VWVA 5CRDA 1NW2A 2GLRA 1T00A 1YDKA 2C0DA 4PNGA 3M9JA 5F05A 3ZITA 1G7EA 4XCSA 2O89A 1EOHA 1O8WA 1F6MC 2L6CA 2YZHA 4ULXA 3C73A 2O7KA 1MD4A 4YQUA 1DE1A 4WR4A 5H5RA 4L5OA 4NHWA 3TOTA 1VRSD 1SKSB 1SENA 6GSSA 2PUKC 1Z3EA 1SK2A 2PBJA 5DAKB 3LORA 1GLPA 4XRDA 3ISOA 1PX7A 1V40A 2YZUA 4P3YB 3GN3A 3IA1A 10GSA 4MJBA 2AYTA 1ERVA 1OVNA 4ID0A 3DKSA 1NHYA 3IR4A 1M7TA 2VCTA 3IAM2 2WJUA 4WR5A 3ME7A 2JADA 2FHEA 4JR4A 2AHEA 4OO5A 1TI1A 1A0FA 1TRSA 2FCHA 2VM2A 1MTCA 1A0RP 5AISA 3BOAA 4WBJA 1JHBA 4MPFA 5IO0A 2CZ2A 4EIPA 5ECPB 1R7HA 1S3CA 4JR6A 5HR0A 4F9ZA 2GS3A 3VI5A 4G2EA 1K3OA 3LSZA 2DJKA 4RI6A 1WRYA 3LXZA 1GUHA 2H19A 2VCWA 4KF9A 1JLVA 1Y25A 2RM6A 1SU9A 4IELA 3ED3A 5HR3A 2FWHA 5CRWA 1J08A 2R0GA 1XIYA 4J56E 2YN1A 4PTSA 3F0IA 4MCUA 3DVWA 1OKDA 1K3YA 2XHFA 4CDOA 1CQGA 2I81A 1GTAA 3LJRA 2QGVA 2XC2A 1ZMAA 4FIWA 3J7Yb 3KXOA 1NHOA 1Q4JA 1BG5A 2YWNA 1FB6A 2H8LA 4NHZA 4FO5A 3W6GA 2YANA 3R2QA 3TOUA 4F0CA 2HZEB 4KDYA 1SK1A 1AQWA 1MD3A 2RLIA 4XRAA 5B8BA 1X5CA 2KLXA 2VLUA 5DVBA 4QQ7A 4LL4B 1O85A 3ERWA 1SYRA 1XOBA 1M2DA 4BPYA 3KJYA 3H93A 1I9DA 4CHSA 3WYWA 3DMLA 1PL1A 1GNEA 4YAVA 2LRNA 3EE2A 5B7CA 2CQ9A 4AF2A 1T3BA 3ZLPA 2DC5A 5FT3A 4USSA 2HFDA 3Q18A 1ERTA 2PMTA 1TU7A 4MZCA 2WDUA 3IHGA 5LD0A 5G31A 5C00A 2HI7A 2EC4A 1U6TA 4Z2RA 2LJAA 3GKMA 6GSUA 4BVXB 2IFQB 2XBQA 3IE3A 3KMOA 2M72A 4KSOA 4ZL8A 2YV9A 2IMDA 4L0WA 3JCML 4GSTA 2H1AA 3FR3A 4K1FA 1GULA 1OC9A 4N10A 3AY8A 5KEJA 4GLTA 1Z6NA 3QAWA 1B4QA 2IIYA 3MWHA 3I9V2 5ECLB 2TRCP 5J9CA 3FKFA 1XBSA 5DQSA 2CAQA 2RM5A 2A2PA 2EIOA 2FWFA 3SBCA 1QFNA 3PR8A 1A2JA 2P5QA 2OBIA 4JZQA 1XVWA 2E2GA 1KNGA 1O81A 2C3NA 3FW2A 5HFKA 5IM9A 4K2XA 5HQPA 4IJ3A 4EUYA 4Q5RA 3H8QA 3UL3A 1GUKA 19GSA 3F6DA 2YNXA 5D9XA 4IBPA 3UMAA 3ZFLA 5DCGA 3NOFA 3H4KA 4JEDA 2VCVA 4MH3A 5A4WA 1LJRA 2R0PA 1BQ7A 5CYYA 16GSA 1GNWA 2K18A 1USBA 1XOAA 2B6MA 3PGTA 4EIQA 4ZILA 4PQHA 3CTFA 4MK3A 1BYEA 2K8SA 3CTGA 4TR4A 2CVKA 4JE1A 3FHKA 4MF5A 1ERUA 2GSTA 1SJZA 1TU8A 1SKRB 2L57A 1N8JA 1ML6A 4ECIA 2FY6A 8GSSA 5H5QA 2C0GA 4XS4B 3KP8A 1XFLA 5ID2B 4TVEA 1LBKA 3TKSE 4GSNA 2MMOA 3GKNA 5JCWA 4X4JA 2PGTA 3EC3A 1AQVA 2WULA 3RDWA 2LSTA 1OYJA 1EWXA 2GT5A 3HJPA 4J2FA 5G5EA 2DKHA 3DYRA 1UC7A 3HVXA 1JLWA 2KOKA 1WJKA 2X4AA 1MDIA 5KN0A 3GMFA 1TKDB 4O5QA 5IMAA 3IOSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X0X A;  2C4J A;  2XPD A;  4PXO A;  11GS A;  2FUG 2;  4K8M A;  5L71 A;  4EF0 A;  2GTU A;  3RBT A;  1U88 A;  3HYP A;  5AIX A;  5GST A;  2C1Y A;  2CX3 A;  1K0C A;  3O76 A;  3TGZ A;  2VCZ A;  4MF7 A;  4EC0 A;  5B6M A;  4OD7 A;  2DJJ A;  2XBI A;  2L59 A;  3TKQ A;  2G2Q A;  4O32 A;  1WWJ A;  1GSY A;  2GQM A;  3GV1 A;  2B7J A;  4RUV A;  2DJ1 A;  1Z9H A;  1YKC A;  5COH A;  3Q6O A;  1K3L A;  1FW1 A;  3APS A;  3L0H A;  5EY6 A;  2PN8 A;  2OJL A;  3BCK A;  1G7O A;  4K0N A;  1QK8 A;  5HR1 A;  3IDV A;  1X5E A;  2D2Z A;  3E0U A;  1XZO A;  1VF3 A;  2L5L A;  1V2A A;  2H73 A;  4ZB6 A;  1B8X A;  3UAP A;  4PUA A;  1KBN A;  2MBT A;  1JZO A;  2NTO A;  1BX9 A;  3M9K A;  2NVL A;  4TXO A;  3UEM A;  1O6J A;  5IOX A;  1A23 A;  2VD1 A;  3GHA A;  3KD0 A;  3ZL5 A;  5JCU A;  1MEK A;  2PER A;  3F3Q A;  4EE0 A;  4F2I A;  4F03 A;  1ERW A;  4EL1 A;  2H76 A;  2C80 A;  3I69 A;  1JZR A;  5HFG A;  1T4Z A;  3KEB A;  2YJ7 A;  3V1W A;  4IQA A;  1FVJ A;  4MA9 A;  2F51 A;  3L78 A;  2LJR A;  4N30 A;  4DVC A;  1M2A A;  3TKS C;  1ZYE A;  1ABA A;  3FZA A;  4KUN A;  4G9H A;  1YF1 A;  1Q98 A;  1Z7R A;  2FWE A;  5IMD A;  4ILF A;  2JZS A;  4HU9 A;  1J9B A;  2LTK A;  5E59 A;  5INY A;  2E2M A;  3GX8 A;  4IJI A;  5J9B A;  3FEU A;  2F9S A;  3GTU A;  5AGY A;  3J7Y k;  1FOV A;  3IHQ A;  4FYC A;  5IMZ A;  2VL2 A;  5HFI A;  4G19 A;  3ZZX A;  2M46 A;  2WGR A;  4JBB A;  1U87 A;  2H0G A;  1PA3 A;  1T8E B;  1EOG A;  2KHP A;  1GSU A;  3P7X A;  1F37 A;  3O6T A;  4HUA A;  5ECN B;  5CAX A;  5CRE A;  3GSS A;  1WPI A;  1W4V A;  3D5J A;  2HNL A;  5D9W A;  3VWU A;  3D21 A;  2YWO A;  1X9W B;  2V32 A;  5DDL A;  4EO3 A;  5JWR B;  2HYX A;  3M8N A;  1PD2 1;  2GQL A;  3TKP A;  4IN0 A;  1W89 A;  2OE3 A;  2J9H A;  2PWJ A;  5D9V A;  3HY2 A;  3TCO A;  2NBS A;  6GST A;  4TN8 A;  7GSS A;  3F6F A;  1Y6E A;  5DAL A;  4ECJ A;  1SL1 B;  2LEG A;  5F0G A;  5GZZ B;  2IJY A;  2WS2 A;  3LWA A;  1THO A;  3WGX A;  2HE3 A;  4I8B A;  1AW9 A;  1THX A;  5D73 A;  4BA7 A;  1FAA A;  3HJM A;  1E6B A;  3L9S A;  1XWK A;  3BBY A;  5J4U A;  3D0Z A;  4ML6 A;  2ES7 A;  3ZVJ A;  4I6X A;  3MNG A;  4KGI A;  2JZR A;  2GZP A;  2IME A;  4KND A;  2FA8 A;  2K8V A;  4TR1 B;  4IGJ A;  4KA0 A;  5IPH A;  3KIJ A;  4G10 A;  4I2U A;  1PKZ A;  1S3D A;  2LNT A;  4YH2 A;  2TRX A;  3G9B A;  3NIV A;  2WCI A;  3LQ7 A;  3KZQ A;  3F4R A;  1SK0 A;  3IBH A;  1B9Y C;  2X8C A;  1X5D A;  4DSS B;  2PVO C;  1DUG A;  2TIR A;  1TK5 B;  4O7H A;  2V41 A;  5ECI B;  1ILO A;  2H01 A;  3L9V A;  4YQM A;  3ZMK A;  2KP2 A;  5G1L A;  5FHI A;  1K0M A;  3WGE A;  5D93 A;  3G7Y A;  3VWW A;  2AAW A;  3UVH A;  4PQI A;  3P2A A;  4X43 A;  4MLY A;  2CV4 A;  4V1A g;  4MP4 A;  4K0G A;  4XTS A;  5ABR A;  4KDU A;  3GUS A;  3L9U A;  2R3X A;  5DAK A;  1PQN A;  4HJM A;  2WRT A;  3QFB C;  1ZL9 A;  3NZN A;  4HQZ A;  1S3A A;  2VCX A;  5DCH A;  1GSS A;  3IRA A;  1U3A A;  3C7M A;  12GS A;  2YCD A;  4LMW A;  2LRT A;  3VFI A;  1M9A A;  3HHV A;  2B1K A;  2V1M A;  5LCZ A;  2HZF A;  3D6I A;  2EIR A;  2YP6 A;  2HSH A;  4NMU A;  2B5Y A;  1LU4 A;  4HI7 A;  3KH7 A;  1UN2 A;  4MMM A;  4LLR A;  1EZK A;  4ACS A;  3EVI A;  5GAN D;  3TJK A;  2I9H A;  3A2X A;  3QD9 A;  3HZ4 A;  4Q5N A;  3FR6 A;  2CVD A;  4TRX A;  3O3T A;  1CQH A;  1VF4 A;  4XS6 A;  3LGC A;  5HR2 A;  5JCG A;  2LV3 A;  1E2Y A;  1URM A;  1WOU A;  4NXI A;  3BCI A;  4Q5F A;  2K6V A;  1TJD A;  2DJ0 A;  2VOC A;  5D9T A;  4OFM A;  4I2T A;  1XW5 A;  2QKE A;  3DWV A;  4I5Q A;  2LQO A;  2V6O A;  1DSB A;  2X8H A;  4D73 B;  3EWL A;  2FLS A;  2IPA A;  3DD3 A;  4F82 A;  4X1U A;  2JAC A;  1QXH A;  2P0G A;  3D4T A;  3D22 A;  1A8Y A;  4V2N A;  2H6X A;  3IXR A;  4V2M A;  5ECM B;  4LL1 B;  2AJQ B;  2VUP A;  3I6A A;  2LS5 A;  4IHU A;  2K9F A;  4E8E A;  2HZE A;  4GRF A;  4NAX A;  2HRF A;  4L0U A;  1YQ1 A;  3P90 A;  5IMC A;  4MZW A;  3EU4 A;  4MH2 A;  2AB6 A;  3MSZ A;  3TJB A;  1SL0 B;  4DSQ A;  2H71 A;  1YF0 A;  1Z5Y E;  4MPG A;  4GSS A;  4WEY A;  2YJH A;  3ZYW A;  1XPV A;  1OAZ A;  1F3B A;  5LNK e;  1VF1 A;  1GWC A;  1EV4 A;  4L5L A;  2IMK A;  3UBK A;  2C0E A;  3Q19 A;  4KX4 A;  1T1V A;  2OE1 A;  4EDY A;  1YEX A;  3QPM A;  5JWO B;  3IK7 A;  3QR6 A;  1F2E A;  2J23 A;  1M2B A;  3S9F A;  2N5B A;  2L4Q A;  3TKR A;  3EMX A;  4KB3 A;  3GRX A;  3HD5 A;  3C1R A;  5KN3 A;  13GS A;  4NV2 A;  3LG6 A;  4BVX A;  2IFQ A;  2A2S A;  1N2A A;  2DMM A;  3FZ5 A;  3HZ8 A;  1PKW A;  4GXZ A;  5DJL A;  4POM A;  3VUR A;  5G30 A;  1RK4 A;  1T7P B;  1PMT A;  17GS A;  3US3 A;  2A2R A;  2OAD A;  2PVQ A;  5F8B A;  3TJG A;  3RPP A;  3DEX A;  5GSS A;  3LFL A;  3FYG A;  5JWQ B;  1FB0 A;  1R5A A;  2DBC A;  4EXJ A;  2DLX A;  6GSW A;  3KMN A;  2ZNM A;  4XHM A;  1QUW A;  2I1U A;  1RW1 A;  2GZZ A;  4PQ1 A;  2RUF A;  4ZB9 A;  3ZIJ A;  4GF0 A;  4OO4 A;  3E3E A;  2Z9S A;  1TTZ A;  3U6V A;  4V2L A;  3CSI A;  1V98 A;  5DQY A;  4YAP A;  2HT9 A;  6GSY A;  1HQO A;  1SKW B;  3FRC A;  3GUR A;  1BJX A;  3VLN A;  2I4A A;  3IPZ A;  1AAZ A;  4IVF A;  4MZB A;  3GX0 A;  4ECC A;  4Q5Q A;  3GH6 A;  1C72 A;  3HKR A;  3W8J A;  1FG4 A;  4N11 A;  2VM1 A;  1RQM A;  1IYH A;  5IMF A;  1XW9 A;  5IO2 A;  2FD3 A;  2KUC A;  2IWT A;  3H79 A;  4HOJ A;  3VK9 A;  1TRW A;  2JSZ A;  3LXT A;  3WT1 A;  2BJX A;  2C3T A;  3TJF A;  2E7P A;  2YPM A;  1F9M A;  4V1A p;  1OC3 A;  1TDI A;  2KP1 A;  1K0A A;  4HS1 A;  4KE3 A;  1WIK A;  5D8I A;  5H5S A;  3CBU A;  5IMV A;  2DML A;  2VCQ A;  4ZBB A;  5A4V A;  3ERG A;  1UVZ A;  1A24 A;  4WBR D;  3TJJ A;  4QL9 A;  1BED A;  4ZBA A;  4XS4 A;  2DIY A;  4DEJ A;  4KSM A;  5ID2 A;  4LA1 A;  4OCE A;  4RQX A;  3UAR A;  1HD2 A;  3DRN A;  4CW9 A;  2GZY A;  1GTI A;  2LJK A;  2YWI A;  3KCM A;  1ZGN A;  1AQX A;  2QSI A;  4AJ8 A;  4GTU A;  3GL3 A;  3GFK A;  1X9S B;  1TP9 A;  5CNW A;  3UVT A;  1HYU A;  1TRV A;  2OKA A;  1WP0 A;  1XXU A;  2AUV A;  4YQV A;  2B5X A;  2ZCT A;  3DXB A;  4BWS A;  3U5R E;  1IYI A;  3K8N A;  1Z7P A;  2XPE A;  3MDK A;  3QMX A;  1R5P A;  3RHB A;  3WGD A;  3FR9 A;  4HJ2 A;  4O5R A;  3N5O A;  2R5G A;  1AC1 A;  1GSF A;  2FGX A;  5CP1 A;  1K0D A;  1V57 A;  3H1N A;  4WF5 A;  1H4O A;  4ZL7 A;  2RII A;  1PL2 A;  4L8E A;  5DJM A;  1EEM A;  2VLV A;  2WFC A;  5ELA A;  2MYG A;  2X99 A;  5IPG A;  2ALB A;  5J41 A;  2R4V A;  1WMJ A;  4AJ6 A;  4N0V A;  2IMF A;  4PUR A;  2B5E A;  2L5O A;  1PX6 A;  20GS A;  2DJ3 A;  3TRX A;  2CX4 A;  1PN9 A;  3KH9 A;  4TW5 A;  2X64 A;  1QQ2 A;  4EKZ A;  2LNS A;  4FH8 A;  3A3T A;  4K9Z A;  3TUE A;  5KN1 A;  5EVO A;  1OE8 A;  4NWY A;  4O92 A;  2HSY A;  2M80 A;  2F8A A;  1K0O A;  4F0B A;  2N5A A;  2OA7 A;  3A5W A;  3FZ4 A;  3SWL A;  1GSD A;  4IQ1 A;  4DSR A;  3CSJ A;  1XWC A;  4LMV A;  2LQQ A;  2B3S A;  4GWR A;  2P31 A;  1GP1 A;  4ML1 A;  3CMI A;  5A5K A;  1G6W A;  3CSH A;  5DBQ A;  1GSE A;  1EP8 A;  2VO4 A;  2YOI A;  1JZW A;  1EGO A;  3HJO A;  2CZ3 A;  1O73 A;  2V2G A;  3ZML A;  1ZYQ B;  4IW9 A;  3VPT A;  2H75 A;  2JZT A;  2H1G A;  2PPT A;  1K0B A;  2VL2 C;  3CRT A;  5ELG A;  5IQY A;  3CXG A;  3HVS A;  2OE0 A;  2EIQ A;  2H1B A;  3G7J A;  1F3A A;  3M1G A;  2MZC A;  5G5F A;  1XW6 A;  4K7I A;  4K2D A;  3ZTL A;  5KN2 A;  3IAS 2;  1PRX A;  4POL A;  2BMX A;  1NM3 A;  5EL8 A;  4TR0 A;  1GTU A;  1OC9 B;  2NDO A;  3KTL A;  4NV5 A;  2RUE A;  2GDR A;  2C8U A;  5GAP D;  2CVB A;  1YKA A;  6GSV A;  5G1K A;  4TKY A;  4HDE A;  3DVX A;  2A4V A;  2NPB A;  5D96 A;  1HNA A;  3FK8 A;  1SD9 A;  1X9M B;  1XWB A;  6GSX A;  2O87 A;  4IP1 A;  2GVP A;  1KEB A;  1M9B A;  2JU5 A;  2HXK A;  1HNB A;  1MDJ A;  3M0F A;  2FWG A;  4ZIJ A;  3BJ5 A;  3M3M A;  3HCZ A;  1SD8 A;  5B6N A;  2GQK A;  2ON7 A;  2VD0 A;  4GQC A;  2ON5 A;  4ZB8 A;  4HEA 2;  1V9W A;  4ZBD A;  2O85 A;  4RI7 A;  3E9J B;  1EP7 A;  2DSA A;  4GQF A;  2H6Y A;  4KAE A;  3D4M A;  5F07 A;  2VAF A;  4EVM A;  3IV4 A;  1EGR A;  3GKX A;  3F4S A;  4AJ7 A;  3EMP A;  1TK0 B;  5AN1 A;  2F8F A;  4WXT A;  5C04 A;  1B48 A;  1O7U A;  2P5R A;  4BVY A;  4HQS A;  3EYT A;  2H74 A;  2R2J A;  5CO3 A;  3KM6 A;  3VWX A;  3F4T A;  2H1D A;  2G0F A;  4KDX A;  1G0T A;  2MMA A;  4EDZ A;  4OFT A;  2DJ2 A;  3ZRE A;  3N9J A;  3IK9 A;  1PGT A;  1B4P A;  5IOW A;  2H70 A;  1TW9 A;  1SJI A;  2CA8 A;  2JL4 A;  4PGT A;  3UBL A;  1BAY A;  4ZXG A;  3QFA C;  1H75 A;  4MAB A;  4TOP A;  4TR1 A;  1DE2 A;  3KGK A;  3EU3 A;  4MDC A;  1WE0 A;  3GA4 A;  1KTE A;  1PSQ A;  2CAI A;  3APO A;  1ZOF A;  4MJE A;  1JFU A;  3QDN A;  2L4C A;  3OR5 A;  3LYK A;  4KCE A;  18GS A;  2LKU A;  3HVV A;  2H0I A;  4DSS A;  1AXD A;  1A8L A;  1J0F A;  3FY7 A;  3QAV A;  1TI3 A;  3F63 A;  4WF4 A;  4N0Z A;  1GLQ A;  3A2W A;  2OAC A;  4IP6 A;  3HA9 A;  4OWY A;  1GUM A;  1TXX A;  1XVQ A;  5ECO B;  1FO5 A;  2HRN A;  2VL3 A;  1GL8 A;  4WET A;  4OCF A;  3TDG A;  1G6Y A;  1GRX A;  4Z7X A;  1YJ6 A;  1UA5 A;  3CYN A;  3P8W A;  5ECR B;  4XS1 A;  3GYK A;  3C71 A;  4HZ2 A;  4PNF A;  3TRQ A;  5F06 A;  1U3I A;  3ZFB A;  3APQ A;  2H0H A;  4XIH A;  3TRP A;  3C1S A;  1DBY A;  4BWQ A;  1AIU A;  2B7K A;  3VI7 A;  2IN3 A;  2QC7 A;  1XCC A;  5FWG A;  1VGL A;  2LUS A;  5EPF A;  2X8G A;  4OFN A;  5AIV A;  1YEP A;  2GGT A;  1HNC A;  3CRU A;  4MF6 A;  4PX1 A;  3ZIV A;  4I97 A;  2H30 A;  4J57 E;  2ZUP A;  4ZL9 A;  14GS A;  2F3M A;  3DIE A;  1ZCP A;  3L4N A;  2E0Q A;  2H72 A;  2I3Y A;  1O8X A;  2N5F A;  1JZD A;  1GH2 A;  4TXO B;  22GS A;  4K6X A;  2O8V B;  2VLT A;  2YWM A;  1ON4 A;  2GSS A;  1EEJ A;  3RHC A;  2DIZ A;  3TB2 A;  2VIM A;  4POB A;  4AGS A;  3RPN A;  4D73 A;  1YZX A;  1V58 A;  1R4W A;  2R6K A;  1QGV A;  3RAZ A;  3QOU A;  3BD2 A;  1VF2 A;  2WZ9 A;  1ZZY A;  2MMZ A;  4JRR A;  1SJ6 A;  5IIZ A;  2FNO A;  1GTB A;  3UOM A;  3QAG A;  1MDK A;  4WKW A;  3HXS A;  4BL7 A;  1B9X C;  1YY7 A;  4ECB A;  3HDC A;  3KP9 A;  4ISD A;  4IS0 A;  2BTO T;  4TR3 A;  3DGQ A;  3GH9 A;  5ECH B;  2IMI A;  1GSQ A;  3GTU B;  1K0N A;  1A2L A;  2C3Q A;  3F3R A;  5G2Z A;  1M99 A;  1I5G A;  4K7O A;  2H66 A;  4KCA A;  4FYB A;  4TXV A;  3GKK A;  5CRH A;  1TOF A;  2L6D A;  4GCI A;  3IC4 A;  4KW6 A;  5J5N A;  3PH9 A;  1QMV A;  2PU9 C;  1ACV A;  2GSQ A;  5ECK B;  1SYX A;  4IKH A;  3TKS A;  3GST A;  2JSY A;  3GIX A;  5A4U A;  2WB9 A;  4OMV A;  1XWG A;  2LRC A;  5J3R A;  1AUC A;  2FA4 A;  3PIN A;  1SL2 B;  3WD6 A;  2AV4 A;  1TK8 B;  3I43 A;  1FVK A;  1OKT A;  3EUR A;  2OBK A;  3EIN A;  4K7N A;  3WT2 A;  3LYP A;  2VL9 A;  3VPQ A;  4HU7 A;  1XWA A;  3UIW A;  4PUF C;  1M0U A;  4QL7 A;  2MBS A;  3QCP A;  5DAL B;  4RQR A;  1OC8 A;  2GSR A;  4H86 A;  1OE7 A;  2YV7 A;  3Q74 A;  1X0R A;  4E8H A;  3W8S A;  3ERF A;  5B8A A;  3ZVJ D;  2V6K A;  2H6Z A;  3ZRD A;  2MMN A;  3ME8 A;  4FYU A;  1T4Y A;  2HLS A;  3GL5 A;  1A2M A;  4KH7 A;  3LEF A;  4POK A;  1TRU A;  3FZ9 A;  4MJC A;  1Z6M A;  3F9U A;  3F8U A;  2C0F A;  4HZ4 A;  4NPB A;  3G7I A;  5ECS A;  3GNJ A;  2CT6 A;  2R37 A;  4MJA A;  9GSS A;  2IL3 A;  1EV9 A;  3KTB A;  1NSW A;  5E4W A;  3C8E A;  5ECQ B;  2REM A;  1ST9 A;  2GT6 A;  1FHE A;  4JU5 A;  3MAK A;  3A2V A;  3UJ1 A;  5CRG A;  5ENU A;  2B1L A;  1R26 A;  3VWV A;  5CRD A;  1NW2 A;  2GLR A;  1T00 A;  1YDK A;  2C0D A;  4PNG A;  3M9J A;  5F05 A;  3ZIT A;  1G7E A;  4XCS A;  2O89 A;  1EOH A;  1O8W A;  1F6M C;  2L6C A;  2YZH A;  4ULX A;  3C73 A;  2O7K A;  1MD4 A;  4YQU A;  1DE1 A;  4WR4 A;  5H5R A;  4L5O A;  4NHW A;  3TOT A;  1VRS D;  1SKS B;  1SEN A;  6GSS A;  2PUK C;  1Z3E A;  1SK2 A;  2PBJ A;  5DAK B;  3LOR A;  1GLP A;  4XRD A;  3ISO A;  1PX7 A;  1V40 A;  2YZU A;  4P3Y B;  3GN3 A;  3IA1 A;  10GS A;  4MJB A;  2AYT A;  1ERV A;  1OVN A;  4ID0 A;  3DKS A;  1NHY A;  3IR4 A;  1M7T A;  2VCT A;  3IAM 2;  2WJU A;  4WR5 A;  3ME7 A;  2JAD A;  2FHE A;  4JR4 A;  2AHE A;  4OO5 A;  1TI1 A;  1A0F A;  1TRS A;  2FCH A;  2VM2 A;  1MTC A;  1A0R P;  5AIS A;  3BOA A;  4WBJ A;  1JHB A;  4MPF A;  5IO0 A;  2CZ2 A;  5ECP B;  1R7H A;  1S3C A;  4JR6 A;  5HR0 A;  4F9Z A;  2GS3 A;  3VI5 A;  4G2E A;  1K3O A;  3LSZ A;  2DJK A;  4RI6 A;  1WRY A;  3LXZ A;  1GUH A;  2H19 A;  2VCW A;  1JLV A;  1Y25 A;  2RM6 A;  1SU9 A;  4IEL A;  3ED3 A;  5HR3 A;  2FWH A;  5CRW A;  1J08 A;  1XIY A;  4J56 E;  2YN1 A;  3F0I A;  4MCU A;  3DVW A;  1OKD A;  1K3Y A;  2XHF A;  4CDO A;  1CQG A;  2I81 A;  1GTA A;  3LJR A;  2QGV A;  2XC2 A;  1ZMA A;  4FIW A;  3J7Y b;  3KXO A;  1NHO A;  1Q4J A;  1BG5 A;  2YWN A;  1FB6 A;  2H8L A;  4NHZ A;  4FO5 A;  3W6G A;  2YAN A;  3R2Q A;  3TOU A;  4F0C A;  2HZE B;  4KDY A;  1SK1 A;  1AQW A;  1MD3 A;  2RLI A;  4XRA A;  5B8B A;  1X5C A;  2KLX A;  2VLU A;  5DVB A;  4QQ7 A;  4LL4 B;  1O85 A;  3ERW A;  1SYR A;  1XOB A;  1M2D A;  4BPY A;  3KJY A;  3H93 A;  1I9D A;  4CHS A;  3WYW A;  3DML A;  1PL1 A;  1GNE A;  4YAV A;  2LRN A;  3EE2 A;  5B7C A;  2CQ9 A;  4AF2 A;  1T3B A;  3ZLP A;  2DC5 A;  5FT3 A;  2HFD A;  3Q18 A;  1ERT A;  2PMT A;  1TU7 A;  4MZC A;  2WDU A;  5LD0 A;  5G31 A;  5C00 A;  2HI7 A;  2EC4 A;  1U6T A;  2LJA A;  3GKM A;  6GSU A;  2IFQ B;  2XBQ A;  3IE3 A;  3KMO A;  2M72 A;  4KSO A;  4ZL8 A;  2YV9 A;  2IMD A;  4L0W A;  3JCM L;  4GST A;  2H1A A;  3FR3 A;  4K1F A;  1GUL A;  1OC9 A;  4N10 A;  3AY8 A;  5KEJ A;  4GLT A;  1Z6N A;  3QAW A;  1B4Q A;  2IIY A;  3MWH A;  3I9V 2;  5ECL B;  2TRC P;  5J9C A;  3FKF A;  1XBS A;  5DQS A;  2CAQ A;  2RM5 A;  2EIO A;  2FWF A;  3SBC A;  1QFN A;  3PR8 A;  1A2J A;  2P5Q A;  2OBI A;  4JZQ A;  1XVW A;  2E2G A;  1KNG A;  1O81 A;  2C3N A;  3FW2 A;  5HFK A;  5IM9 A;  5HQP A;  4IJ3 A;  4EUY A;  4Q5R A;  3H8Q A;  3UL3 A;  1GUK A;  19GS A;  3F6D A;  2YNX A;  5D9X A;  4IBP A;  3UMA A;  3ZFL A;  5DCG A;  3NOF A;  3H4K A;  4JED A;  2VCV A;  4MH3 A;  5A4W A;  1LJR A;  1BQ7 A;  5CYY A;  16GS A;  1GNW A;  2K18 A;  1USB A;  1XOA A;  2B6M A;  3PGT A;  4ZIL A;  4PQH A;  3CTF A;  4MK3 A;  1BYE A;  2K8S A;  3CTG A;  4TR4 A;  2CVK A;  4JE1 A;  3FHK A;  4MF5 A;  1ERU A;  2GST A;  1SJZ A;  1TU8 A;  1SKR B;  2L57 A;  1N8J A;  1ML6 A;  4ECI A;  2FY6 A;  8GSS A;  5H5Q A;  2C0G A;  4XS4 B;  3KP8 A;  1XFL A;  5ID2 B;  4TVE A;  1LBK A;  3TKS E;  4GSN A;  2MMO A;  3GKN A;  5JCW A;  2PGT A;  3EC3 A;  1AQV A;  2WUL A;  3RDW A;  2LST A;  1OYJ A;  1EWX A;  2GT5 A;  3HJP A;  4J2F A;  5G5E A;  3DYR A;  1UC7 A;  3HVX A;  1JLW A;  2KOK A;  1WJK A;  1MDI A;  5KN0 A;  3GMF A;  1TKD B;  5IMA A;  3IOS A; 
#chains in the Genus database with same CATH topology
 4X0X A;  2C4J A;  2XPD A;  4PXO A;  11GS A;  2FUG 2;  4K8M A;  5L71 A;  4EF0 A;  2GTU A;  3RBT A;  1U88 A;  3HYP A;  5AIX A;  5GST A;  2C1Y A;  2CX3 A;  1K0C A;  3O76 A;  3TGZ A;  2VCZ A;  4MF7 A;  4EC0 A;  5B6M A;  4OD7 A;  2DJJ A;  2XBI A;  2L59 A;  3TKQ A;  2G2Q A;  4O32 A;  1WWJ A;  1GSY A;  2GQM A;  3GV1 A;  2B7J A;  4RUV A;  2DJ1 A;  1Z9H A;  1YKC A;  5COH A;  3Q6O A;  1K3L A;  1FW1 A;  3APS A;  3L0H A;  4FQU A;  5EY6 A;  2PN8 A;  2OJL A;  3BCK A;  1G7O A;  4K0N A;  1QK8 A;  5HR1 A;  3IDV A;  1X5E A;  2D2Z A;  2R0C A;  3E0U A;  1XZO A;  1VF3 A;  2L5L A;  1V2A A;  2H73 A;  4ZB6 A;  1B8X A;  3UAP A;  4PUA A;  1KBN A;  2MBT A;  1JZO A;  2NTO A;  1BX9 A;  3M9K A;  2NVL A;  1M3I A;  4TXO A;  3UEM A;  1O6J A;  4YKF A;  5IOX A;  1A23 A;  2VD1 A;  3GHA A;  3KD0 A;  3ZL5 A;  5JCU A;  1MEK A;  2PER A;  3F3Q A;  4EE0 A;  4F2I A;  4F03 A;  1ERW A;  4EL1 A;  2H76 A;  2C80 A;  3I69 A;  1JZR A;  5HFG A;  1T4Z A;  3KEB A;  2YJ7 A;  3V1W A;  4IQA A;  1FVJ A;  4MA9 A;  2F51 A;  3L78 A;  2LJR A;  4N30 A;  4DVC A;  1M2A A;  3TKS C;  1ZYE A;  1ABA A;  3FZA A;  4KUN A;  4G9H A;  1YF1 A;  1Q98 A;  1Z7R A;  2FWE A;  5IMD A;  4ILF A;  2JZS A;  4HU9 A;  1J9B A;  2LTK A;  5E59 A;  5INY A;  2E2M A;  3GX8 A;  4IJI A;  5J9B A;  3FEU A;  2F9S A;  3GTU A;  5AGY A;  3J7Y k;  1FOV A;  3IHQ A;  4FYC A;  5IMZ A;  2VL2 A;  5HFI A;  4G19 A;  3ZZX A;  2M46 A;  2WGR A;  4JBB A;  1U87 A;  2H0G A;  1PA3 A;  1T8E B;  1EOG A;  2KHP A;  1GSU A;  3P7X A;  1F37 A;  3O6T A;  4HUA A;  5ECN B;  5CAX A;  5CRE A;  5BMU A;  3GSS A;  1WPI A;  1W4V A;  3D5J A;  2HNL A;  5D9W A;  3VWU A;  3D21 A;  2YWO A;  1X9W B;  2V32 A;  5DDL A;  4EO3 A;  5JWR B;  2HYX A;  3M8N A;  1PD2 1;  2GQL A;  3TKP A;  4IN0 A;  1W89 A;  2OE3 A;  2J9H A;  5BRT A;  1PN0 A;  2PWJ A;  5D9V A;  3HY2 A;  3TCO A;  2NBS A;  6GST A;  4TN8 A;  7GSS A;  4BVY B;  3F6F A;  2HSM A;  1Y6E A;  5DAL A;  4ECJ A;  1SL1 B;  2LEG A;  5F0G A;  5GZZ B;  2IJY A;  2WS2 A;  3LWA A;  1THO A;  3WGX A;  2HE3 A;  4I8B A;  1AW9 A;  1THX A;  5D73 A;  3LW9 A;  4BA7 A;  1FAA A;  3HJM A;  1E6B A;  3L9S A;  1XWK A;  3BBY A;  5J4U A;  3D0Z A;  4ML6 A;  2ES7 A;  3ZVJ A;  4I6X A;  3MNG A;  4KGI A;  2JZR A;  2GZP A;  2IME A;  4KND A;  2FA8 A;  2K8V A;  4TR1 B;  4IGJ A;  4KA0 A;  5IPH A;  3KIJ A;  4G10 A;  4I2U A;  1PKZ A;  1S3D A;  2LNT A;  4YH2 A;  2TRX A;  3G9B A;  3NIV A;  2WCI A;  3LQ7 A;  3KZQ A;  3F4R A;  1SK0 A;  1ZYN A;  3IBH A;  1B9Y C;  2X8C A;  1X5D A;  4DSS B;  2PVO C;  1DUG A;  2TIR A;  1TK5 B;  4O7H A;  2V41 A;  5ECI B;  1ILO A;  2H01 A;  3L9V A;  4YQM A;  3ZMK A;  2KP2 A;  5G1L A;  5FHI A;  1K0M A;  3WGE A;  5D93 A;  3G7Y A;  3VWW A;  2AAW A;  3UVH A;  4PQI A;  3P2A A;  4X43 A;  4MLY A;  2CV4 A;  4V1A g;  4MP4 A;  4K0G A;  4XTS A;  5ABR A;  4KDU A;  3GUS A;  3L9U A;  2R3X A;  5DAK A;  1PQN A;  4HJM A;  2WRT A;  3QFB C;  1ZL9 A;  3NZN A;  4HQZ A;  4Z2T A;  1S3A A;  2VCX A;  5DCH A;  1GSS A;  3IRA A;  1U3A A;  3C7M A;  12GS A;  2YCD A;  4LMW A;  2LRT A;  3VFI A;  1M9A A;  3HHV A;  2B1K A;  2V1M A;  5LCZ A;  2HZF A;  3D6I A;  2EIR A;  2YP6 A;  2HSH A;  4NMU A;  2B5Y A;  1LU4 A;  4HI7 A;  3KH7 A;  1UN2 A;  4MMM A;  4LLR A;  1EZK A;  4ACS A;  3EVI A;  1S3R A;  5GAN D;  3TJK A;  2I9H A;  3A2X A;  3QD9 A;  3HZ4 A;  4Q5N A;  3FR6 A;  2CVD A;  4TRX A;  3O3T A;  1CQH A;  1VF4 A;  4XS6 A;  3LGC A;  5HR2 A;  5JCG A;  2LV3 A;  1E2Y A;  1URM A;  1WOU A;  4NXI A;  3BCI A;  4Q5F A;  2K6V A;  1TJD A;  2DJ0 A;  2VOC A;  5D9T A;  4OFM A;  4I2T A;  1XW5 A;  2QKE A;  3DWV A;  4I5Q A;  2LQO A;  2V6O A;  1DSB A;  2X8H A;  4D73 B;  3EWL A;  2FLS A;  2IPA A;  2QA2 A;  4BIK A;  3DD3 A;  4F82 A;  4X1U A;  2JAC A;  1QXH A;  2P0G A;  3D4T A;  3D22 A;  1A8Y A;  3EPT A;  4V2N A;  2H6X A;  3IXR A;  4V2M A;  5ECM B;  1FOH A;  4G0I A;  4LL1 B;  2AJQ B;  2VUP A;  3I6A A;  4BL7 B;  2LS5 A;  4IHU A;  2K9F A;  4E8E A;  2HZE A;  4GRF A;  4NAX A;  2HRF A;  4L0U A;  1YQ1 A;  3P90 A;  5IMC A;  4MZW A;  3EU4 A;  4MH2 A;  2AB6 A;  3MSZ A;  3TJB A;  1SL0 B;  4DSQ A;  2H71 A;  1YF0 A;  1Z5Y E;  4MPG A;  1ZYP A;  4GSS A;  4WEY A;  2YJH A;  3ZYW A;  1XPV A;  1OAZ A;  1F3B A;  5LNK e;  1VF1 A;  1GWC A;  1EV4 A;  4L5L A;  2IMK A;  3UBK A;  2C0E A;  3Q19 A;  4KX4 A;  1T1V A;  2OE1 A;  4EDY A;  1YEX A;  3QPM A;  5JWO B;  3IK7 A;  3QR6 A;  1F2E A;  2J23 A;  1M2B A;  3S9F A;  2N5B A;  2L4Q A;  3TKR A;  3EMX A;  4KB3 A;  3GRX A;  3HD5 A;  3C1R A;  5KN3 A;  3R3E A;  13GS A;  4NV2 A;  3LG6 A;  4BVX A;  2IFQ A;  2A2S A;  1N2A A;  2DMM A;  3FZ5 A;  3HZ8 A;  1PKW A;  4GXZ A;  5DJL A;  4POM A;  3VUR A;  5G30 A;  1RK4 A;  1T7P B;  1PMT A;  17GS A;  3US3 A;  2A2R A;  2OAD A;  2PVQ A;  5F8B A;  3TJG A;  3RPP A;  3DEX A;  5GSS A;  3LFL A;  3FYG A;  5JWQ B;  1FB0 A;  1R5A A;  2DBC A;  4EXJ A;  2DLX A;  6GSW A;  3KMN A;  2ZNM A;  4XHM A;  1QUW A;  2I1U A;  1RW1 A;  2GZZ A;  4PQ1 A;  2RUF A;  4ZB9 A;  3ZIJ A;  4GF0 A;  4OO4 A;  3E3E A;  2Z9S A;  1TTZ A;  3U6V A;  4V2L A;  1V98 A;  3CSI A;  5DQY A;  4YAP A;  2HT9 A;  6GSY A;  1HQO A;  1SKW B;  3FRC A;  3GUR A;  1BJX A;  3VLN A;  2I4A A;  3IPZ A;  1AAZ A;  4IVF A;  4MZB A;  3GX0 A;  4ECC A;  4Q5Q A;  3GH6 A;  1C72 A;  3HKR A;  3IC8 A;  3W8J A;  1FG4 A;  4N11 A;  2VM1 A;  1RQM A;  1IYH A;  5IMF A;  1XW9 A;  5IO2 A;  2FD3 A;  2KUC A;  2IWT A;  3H79 A;  4HOJ A;  3VK9 A;  1TRW A;  2JSZ A;  3LXT A;  3WT1 A;  2BJX A;  2C3T A;  3TJF A;  2E7P A;  2YPM A;  1F9M A;  4V1A p;  1OC3 A;  1TDI A;  2KP1 A;  1K0A A;  4HS1 A;  4KE3 A;  1WIK A;  5D8I A;  5H5S A;  3CBU A;  5IMV A;  2DML A;  2VCQ A;  4ZBB A;  5A4V A;  4CY8 A;  3ERG A;  1UVZ A;  1A24 A;  3MIX A;  4WBR D;  3TJJ A;  4QL9 A;  1BED A;  4ZBA A;  4XS4 A;  2DIY A;  4DEJ A;  4G0K A;  4KSM A;  5ID2 A;  4LA1 A;  4OCE A;  4RQX A;  3UAR A;  1HD2 A;  3DRN A;  4CW9 A;  2GZY A;  1GTI A;  2LJK A;  2YWI A;  3KCM A;  2HRK A;  1ZGN A;  1AQX A;  2QSI A;  4AJ8 A;  4GTU A;  3GL3 A;  3GFK A;  1X9S B;  1TP9 A;  5CNW A;  2DKI A;  3UVT A;  1HYU A;  1TRV A;  2OKA A;  1WP0 A;  4Z2U A;  1XXU A;  2AUV A;  4YQV A;  4O5U A;  2B5X A;  2ZCT A;  3DXB A;  4BWS A;  3U5R E;  1IYI A;  3FMW A;  3K8N A;  1Z7P A;  2XPE A;  3MDK A;  3QMX A;  5KOW A;  1R5P A;  3RHB A;  3WGD A;  3FR9 A;  4HJ2 A;  4O5R A;  3N5O A;  2R5G A;  1AC1 A;  1GSF A;  2FGX A;  5CP1 A;  1K0D A;  4ICY A;  1V57 A;  3H1N A;  4WF5 A;  1H4O A;  4ZL7 A;  2RII A;  1PL2 A;  4L8E A;  5DJM A;  1EEM A;  2VLV A;  2WFC A;  5ELA A;  2MYG A;  2X99 A;  5IPG A;  2ALB A;  5J41 A;  2R4V A;  1WMJ A;  4AJ6 A;  4N0V A;  2IMF A;  4PUR A;  2B5E A;  2L5O A;  1PX6 A;  20GS A;  2DJ3 A;  3TRX A;  2CX4 A;  3A5I A;  1PN9 A;  4TW5 A;  3KH9 A;  2X64 A;  1QQ2 A;  4EKZ A;  2LNS A;  4FH8 A;  3A3T A;  4K9Z A;  3TUE A;  5KN1 A;  5EVO A;  1OE8 A;  4NWY A;  4O92 A;  2HSY A;  2M80 A;  2F8A A;  1K0O A;  4F0B A;  2N5A A;  2OA7 A;  3A5W A;  3FZ4 A;  3SWL A;  1GSD A;  4IQ1 A;  4DSR A;  3CSJ A;  1XWC A;  4LMV A;  2LQQ A;  2B3S A;  4GWR A;  2P31 A;  1GP1 A;  4ML1 A;  3CMI A;  5A5K A;  1G6W A;  3CSH A;  5DBQ A;  1GSE A;  4K5S A;  1EP8 A;  2VO4 A;  2YOI A;  1JZW A;  1EGO A;  3HJO A;  2CZ3 A;  1O73 A;  2V2G A;  3ZML A;  1ZYQ B;  4IW9 A;  3VPT A;  2H75 A;  2JZT A;  2H1G A;  2PPT A;  1K0B A;  2VL2 C;  3CRT A;  5ELG A;  5IQY A;  3CXG A;  3HVS A;  2OE0 A;  2EIQ A;  2H1B A;  3G7J A;  1F3A A;  3M1G A;  2MZC A;  5G5F A;  1XW6 A;  4K7I A;  4K2D A;  3ZTL A;  5KN2 A;  1PFO A;  3IAS 2;  1PRX A;  4POL A;  2BMX A;  1NM3 A;  5EL8 A;  4TR0 A;  1GTU A;  1OC9 B;  2NDO A;  3KTL A;  4NV5 A;  2RUE A;  2GDR A;  2C8U A;  5GAP D;  2CVB A;  1YKA A;  6GSV A;  5G1K A;  4TKY A;  4HDE A;  3DVX A;  2A4V A;  2NPB A;  5D96 A;  1HNA A;  3FK8 A;  1SD9 A;  1X9M B;  1XWB A;  6GSX A;  2O87 A;  4IP1 A;  2GVP A;  3PPU A;  1KEB A;  1M9B A;  2JU5 A;  2HXK A;  1HNB A;  1MDJ A;  3M0F A;  2FWG A;  4ZIJ A;  3BJ5 A;  3M3M A;  3HCZ A;  1SD8 A;  5B6N A;  2GQK A;  2ON7 A;  2VD0 A;  4GQC A;  2ON5 A;  4ZB8 A;  4HEA 2;  1V9W A;  4ZBD A;  2O85 A;  4RI7 A;  3E9J B;  1EP7 A;  2DSA A;  4GQF A;  2H6Y A;  4KAE A;  3D4M A;  2X49 A;  2QA1 A;  5F07 A;  2VAF A;  4EVM A;  2HRA A;  3IV4 A;  1EGR A;  3GKX A;  3F4S A;  1XG8 A;  3EMP A;  4AJ7 A;  1TK0 B;  5AN1 A;  2F8F A;  4WXT A;  5C04 A;  1B48 A;  1O7U A;  2P5R A;  4BVY A;  4HQS A;  3EYT A;  2H74 A;  2R2J A;  5CO3 A;  3KM6 A;  3VWX A;  3F4T A;  2H1D A;  2G0F A;  4KDX A;  1G0T A;  2MMA A;  4EDZ A;  4OFT A;  2DJ2 A;  3ZRE A;  3N9J A;  3IK9 A;  1PGT A;  1B4P A;  5IOW A;  2H70 A;  1M3J A;  1TW9 A;  1SJI A;  2CA8 A;  2JL4 A;  4PGT A;  3UBL A;  1BAY A;  4ZXG A;  3QFA C;  1H75 A;  4MAB A;  4TOP A;  4TR1 A;  1DE2 A;  3KGK A;  3EU3 A;  4MDC A;  1WE0 A;  3GA4 A;  1KTE A;  1PSQ A;  2CAI A;  3APO A;  1ZOF A;  4MJE A;  1JFU A;  3QDN A;  2L4C A;  3OR5 A;  3LYK A;  4KCE A;  18GS A;  2LKU A;  3HVV A;  2H0I A;  4DSS A;  1AXD A;  1A8L A;  1J0F A;  3FY7 A;  3QAV A;  1TI3 A;  2A4H A;  3F63 A;  4WF4 A;  4N0Z A;  4G0L A;  1GLQ A;  3A2W A;  2OAC A;  4IP6 A;  3HA9 A;  4OWY A;  1GUM A;  1TXX A;  1XVQ A;  5ECO B;  1FO5 A;  2HRN A;  2VL3 A;  1GL8 A;  4WET A;  4OCF A;  3TDG A;  1G6Y A;  1GRX A;  4Z7X A;  1YJ6 A;  1UA5 A;  3CYN A;  3P8W A;  4CY6 A;  5ECR B;  4XS1 A;  3GYK A;  3C71 A;  4HZ2 A;  4PNF A;  3TRQ A;  5F06 A;  1U3I A;  3ZFB A;  4K5R A;  3APQ A;  2H0H A;  4XIH A;  3TRP A;  3C1S A;  1DBY A;  4BWQ A;  1AIU A;  2B7K A;  3VI7 A;  2IN3 A;  2QC7 A;  1XCC A;  5FWG A;  1VGL A;  2LUS A;  5EPF A;  2X8G A;  4OFN A;  5AIV A;  1YEP A;  2GGT A;  1HNC A;  3CRU A;  4MF6 A;  4PX1 A;  3ZIV A;  4I97 A;  2H30 A;  4J57 E;  2ZUP A;  4ZL9 A;  14GS A;  2F3M A;  3DIE A;  1ZCP A;  3L4N A;  2E0Q A;  2H72 A;  2I3Y A;  1O8X A;  2N5F A;  1JZD A;  1GH2 A;  4TXO B;  22GS A;  4K6X A;  2O8V B;  2VLT A;  2YWM A;  1ON4 A;  2GSS A;  1EEJ A;  3RHC A;  2DIZ A;  3TB2 A;  2VIM A;  4POB A;  4AGS A;  3RPN A;  4D73 A;  1YZX A;  1V58 A;  1R4W A;  2R6K A;  1QGV A;  3RAZ A;  3QOU A;  3BD2 A;  4A5P A;  1VF2 A;  2WZ9 A;  3HVN A;  1ZZY A;  2MMZ A;  4JRR A;  1SJ6 A;  5IIZ A;  2FNO A;  1GTB A;  3UOM A;  3QAG A;  1MDK A;  4WKW A;  3HXS A;  4BL7 A;  1B9X C;  1YY7 A;  4ECB A;  3HDC A;  3KP9 A;  4ISD A;  4IS0 A;  2BTO T;  4TR3 A;  3DGQ A;  3GH9 A;  5ECH B;  2IMI A;  1GSQ A;  3GTU B;  1K0N A;  1A2L A;  2C3Q A;  3F3R A;  5G2Z A;  1M99 A;  1I5G A;  4K7O A;  2H66 A;  4KCA A;  4FYB A;  4TXV A;  3GKK A;  5CRH A;  1TOF A;  2L6D A;  4GCI A;  3IC4 A;  4KW6 A;  5J5N A;  3PH9 A;  1QMV A;  2PU9 C;  1ACV A;  2GSQ A;  5ECK B;  1SYX A;  4IKH A;  3TKS A;  3GST A;  2JSY A;  3GIX A;  5A4U A;  2WB9 A;  4OMV A;  1XWG A;  2LRC A;  5J3R A;  1AUC A;  2FA4 A;  3PIN A;  1SL2 B;  3WD6 A;  2AV4 A;  1TK8 B;  3I43 A;  1FVK A;  1OKT A;  3EUR A;  2OBK A;  3EIN A;  4K7N A;  3WT2 A;  3LYP A;  2VL9 A;  3VPQ A;  4HU7 A;  1XWA A;  3UIW A;  4PUF C;  1M0U A;  4QL7 A;  2MBS A;  3QCP A;  5DAL B;  4RQR A;  1OC8 A;  2GSR A;  4H86 A;  1OE7 A;  2YV7 A;  3Q74 A;  1X0R A;  4MNN A;  4E8H A;  3W8S A;  3ERF A;  5B8A A;  3ZVJ D;  2V6K A;  2H6Z A;  3ZRD A;  2MMN A;  3ME8 A;  4FYU A;  1T4Y A;  2HLS A;  3GL5 A;  1A2M A;  4KH7 A;  3LEF A;  4YKG A;  4POK A;  1TRU A;  3FZ9 A;  4MJC A;  1Z6M A;  3F9U A;  3F8U A;  2C0F A;  4HZ4 A;  4NPB A;  3G7I A;  5ECS A;  3GNJ A;  2CT6 A;  2R37 A;  2UZ8 A;  4MJA A;  9GSS A;  2IL3 A;  1EV9 A;  3KTB A;  1NSW A;  5E4W A;  3C8E A;  5ECQ B;  2REM A;  1ST9 A;  2GT6 A;  1FHE A;  4JU5 A;  3MAK A;  5KOX A;  3A2V A;  3UJ1 A;  5CRG A;  5ENU A;  2B1L A;  1R26 A;  3MYD A;  3VWV A;  5CRD A;  1NW2 A;  2GLR A;  1T00 A;  1YDK A;  2C0D A;  4PNG A;  3M9J A;  5F05 A;  3ZIT A;  1G7E A;  4XCS A;  2O89 A;  1EOH A;  1O8W A;  1F6M C;  2L6C A;  2YZH A;  4ULX A;  3C73 A;  2O7K A;  1MD4 A;  4YQU A;  1DE1 A;  4WR4 A;  5H5R A;  4L5O A;  4NHW A;  3TOT A;  1VRS D;  1SKS B;  1SEN A;  6GSS A;  2PUK C;  1Z3E A;  1SK2 A;  2PBJ A;  5DAK B;  3LOR A;  1GLP A;  4XRD A;  3ISO A;  1PX7 A;  1V40 A;  2YZU A;  4P3Y B;  3GN3 A;  3IA1 A;  10GS A;  4MJB A;  2AYT A;  1ERV A;  1OVN A;  4ID0 A;  3DKS A;  1NHY A;  3IR4 A;  1M7T A;  2VCT A;  3IAM 2;  2WJU A;  4WR5 A;  3ME7 A;  2JAD A;  2FHE A;  4JR4 A;  2AHE A;  4OO5 A;  1TI1 A;  1A0F A;  1TRS A;  2FCH A;  2VM2 A;  1MTC A;  1A0R P;  5AIS A;  3BOA A;  4WBJ A;  1JHB A;  4MPF A;  5IO0 A;  2CZ2 A;  4EIP A;  5ECP B;  1R7H A;  1S3C A;  4JR6 A;  5HR0 A;  4F9Z A;  2GS3 A;  3VI5 A;  4G2E A;  1K3O A;  3LSZ A;  2DJK A;  4RI6 A;  1WRY A;  3LXZ A;  1GUH A;  2H19 A;  2VCW A;  4KF9 A;  1JLV A;  1Y25 A;  2RM6 A;  1SU9 A;  4IEL A;  3ED3 A;  5HR3 A;  2FWH A;  5CRW A;  1J08 A;  2R0G A;  1XIY A;  4J56 E;  2YN1 A;  4PTS A;  3F0I A;  4MCU A;  3DVW A;  1OKD A;  1K3Y A;  2XHF A;  4CDO A;  1CQG A;  2I81 A;  1GTA A;  3LJR A;  2QGV A;  2XC2 A;  1ZMA A;  4FIW A;  3J7Y b;  3KXO A;  1NHO A;  1Q4J A;  1BG5 A;  2YWN A;  1FB6 A;  2H8L A;  4NHZ A;  4FO5 A;  3W6G A;  2YAN A;  3R2Q A;  3TOU A;  4F0C A;  2HZE B;  4KDY A;  1SK1 A;  1AQW A;  1MD3 A;  2RLI A;  4XRA A;  5B8B A;  1X5C A;  2KLX A;  2VLU A;  5DVB A;  4QQ7 A;  4LL4 B;  1O85 A;  3ERW A;  1SYR A;  1XOB A;  1M2D A;  4BPY A;  3KJY A;  3H93 A;  1I9D A;  4CHS A;  3WYW A;  3DML A;  1PL1 A;  1GNE A;  4YAV A;  2LRN A;  3EE2 A;  5B7C A;  2CQ9 A;  4AF2 A;  1T3B A;  3ZLP A;  2DC5 A;  5FT3 A;  4USS A;  2HFD A;  3Q18 A;  1ERT A;  2PMT A;  1TU7 A;  4MZC A;  2WDU A;  3IHG A;  5LD0 A;  5G31 A;  5C00 A;  2HI7 A;  2EC4 A;  1U6T A;  4Z2R A;  2LJA A;  3GKM A;  6GSU A;  4BVX B;  2IFQ B;  2XBQ A;  3IE3 A;  3KMO A;  2M72 A;  4KSO A;  4ZL8 A;  2YV9 A;  2IMD A;  4L0W A;  3JCM L;  4GST A;  2H1A A;  3FR3 A;  4K1F A;  1GUL A;  1OC9 A;  4N10 A;  3AY8 A;  5KEJ A;  4GLT A;  1Z6N A;  3QAW A;  1B4Q A;  2IIY A;  3MWH A;  3I9V 2;  5ECL B;  2TRC P;  5J9C A;  3FKF A;  1XBS A;  5DQS A;  2CAQ A;  2RM5 A;  2A2P A;  2EIO A;  2FWF A;  3SBC A;  1QFN A;  3PR8 A;  1A2J A;  2P5Q A;  2OBI A;  4JZQ A;  1XVW A;  2E2G A;  1KNG A;  1O81 A;  2C3N A;  3FW2 A;  5HFK A;  5IM9 A;  4K2X A;  5HQP A;  4IJ3 A;  4EUY A;  4Q5R A;  3H8Q A;  3UL3 A;  1GUK A;  19GS A;  3F6D A;  2YNX A;  5D9X A;  4IBP A;  3UMA A;  3ZFL A;  5DCG A;  3NOF A;  3H4K A;  4JED A;  2VCV A;  4MH3 A;  5A4W A;  1LJR A;  2R0P A;  1BQ7 A;  4HSC X;  5CYY A;  16GS A;  1GNW A;  2K18 A;  1USB A;  1XOA A;  2B6M A;  3PGT A;  4EIQ A;  4ZIL A;  4PQH A;  3CTF A;  4MK3 A;  1BYE A;  2K8S A;  3CTG A;  4TR4 A;  2CVK A;  4JE1 A;  3FHK A;  4MF5 A;  1ERU A;  2GST A;  1SJZ A;  1TU8 A;  1SKR B;  2L57 A;  1N8J A;  1ML6 A;  4ECI A;  2FY6 A;  8GSS A;  5H5Q A;  2C0G A;  4XS4 B;  3KP8 A;  1XFL A;  5ID2 B;  4TVE A;  1LBK A;  3TKS E;  4GSN A;  2MMO A;  3GKN A;  5JCW A;  4X4J A;  2PGT A;  3EC3 A;  1AQV A;  2WUL A;  3RDW A;  2LST A;  1OYJ A;  3CQF A;  1EWX A;  2GT5 A;  3HJP A;  4J2F A;  5G5E A;  2DKH A;  3DYR A;  1UC7 A;  3HVX A;  1JLW A;  2KOK A;  1WJK A;  2X4A A;  1MDI A;  5KN0 A;  3GMF A;  1TKD B;  4O5Q A;  5IMA A;  3IOS A; 
#chains in the Genus database with same CATH homology
 4X0X A;  2C4J A;  2XPD A;  4PXO A;  11GS A;  2FUG 2;  4K8M A;  5L71 A;  4EF0 A;  2GTU A;  3RBT A;  1U88 A;  3HYP A;  5AIX A;  5GST A;  2C1Y A;  2CX3 A;  1K0C A;  3O76 A;  3TGZ A;  2VCZ A;  4MF7 A;  4EC0 A;  5B6M A;  4OD7 A;  2DJJ A;  2XBI A;  2L59 A;  3TKQ A;  2G2Q A;  4O32 A;  1WWJ A;  1GSY A;  2GQM A;  3GV1 A;  2B7J A;  4RUV A;  2DJ1 A;  1Z9H A;  1YKC A;  5COH A;  3Q6O A;  1K3L A;  1FW1 A;  3APS A;  3L0H A;  4FQU A;  5EY6 A;  2PN8 A;  2OJL A;  3BCK A;  1G7O A;  4K0N A;  1QK8 A;  5HR1 A;  3IDV A;  1X5E A;  2D2Z A;  2R0C A;  3E0U A;  1XZO A;  1VF3 A;  2L5L A;  1V2A A;  2H73 A;  4ZB6 A;  1B8X A;  3UAP A;  4PUA A;  1KBN A;  2MBT A;  1JZO A;  2NTO A;  1BX9 A;  3M9K A;  2NVL A;  4TXO A;  3UEM A;  1O6J A;  4YKF A;  5IOX A;  1A23 A;  2VD1 A;  3GHA A;  3KD0 A;  3ZL5 A;  5JCU A;  1MEK A;  2PER A;  3F3Q A;  4EE0 A;  4F2I A;  4F03 A;  1ERW A;  4EL1 A;  2H76 A;  2C80 A;  3I69 A;  1JZR A;  5HFG A;  1T4Z A;  3KEB A;  2YJ7 A;  3V1W A;  4IQA A;  1FVJ A;  4MA9 A;  2F51 A;  3L78 A;  2LJR A;  4N30 A;  4DVC A;  1M2A A;  3TKS C;  1ZYE A;  1ABA A;  3FZA A;  4KUN A;  4G9H A;  1YF1 A;  1Q98 A;  1Z7R A;  2FWE A;  5IMD A;  4ILF A;  2JZS A;  4HU9 A;  1J9B A;  2LTK A;  5E59 A;  5INY A;  2E2M A;  3GX8 A;  4IJI A;  5J9B A;  3FEU A;  2F9S A;  3GTU A;  5AGY A;  3J7Y k;  1FOV A;  3IHQ A;  4FYC A;  5IMZ A;  2VL2 A;  5HFI A;  4G19 A;  3ZZX A;  2M46 A;  2WGR A;  4JBB A;  1U87 A;  2H0G A;  1PA3 A;  1T8E B;  1EOG A;  2KHP A;  1GSU A;  3P7X A;  1F37 A;  3O6T A;  4HUA A;  5ECN B;  5CAX A;  5CRE A;  5BMU A;  3GSS A;  1WPI A;  1W4V A;  3D5J A;  2HNL A;  5D9W A;  3VWU A;  3D21 A;  2YWO A;  1X9W B;  2V32 A;  5DDL A;  4EO3 A;  5JWR B;  2HYX A;  3M8N A;  1PD2 1;  2GQL A;  3TKP A;  4IN0 A;  1W89 A;  2OE3 A;  2J9H A;  5BRT A;  1PN0 A;  2PWJ A;  5D9V A;  3HY2 A;  3TCO A;  2NBS A;  6GST A;  4TN8 A;  7GSS A;  4BVY B;  3F6F A;  2HSM A;  1Y6E A;  5DAL A;  4ECJ A;  1SL1 B;  2LEG A;  5F0G A;  5GZZ B;  2IJY A;  2WS2 A;  3LWA A;  1THO A;  3WGX A;  2HE3 A;  4I8B A;  1AW9 A;  1THX A;  5D73 A;  3LW9 A;  4BA7 A;  1FAA A;  3HJM A;  1E6B A;  3L9S A;  1XWK A;  3BBY A;  5J4U A;  3D0Z A;  4ML6 A;  2ES7 A;  3ZVJ A;  4I6X A;  3MNG A;  4KGI A;  2JZR A;  2GZP A;  2IME A;  4KND A;  2FA8 A;  2K8V A;  4TR1 B;  4IGJ A;  4KA0 A;  5IPH A;  3KIJ A;  4G10 A;  4I2U A;  1PKZ A;  1S3D A;  2LNT A;  4YH2 A;  2TRX A;  3G9B A;  3NIV A;  2WCI A;  3LQ7 A;  3KZQ A;  3F4R A;  1SK0 A;  1ZYN A;  3IBH A;  1B9Y C;  2X8C A;  1X5D A;  4DSS B;  2PVO C;  1DUG A;  2TIR A;  1TK5 B;  4O7H A;  2V41 A;  5ECI B;  1ILO A;  2H01 A;  3L9V A;  4YQM A;  3ZMK A;  2KP2 A;  5G1L A;  5FHI A;  1K0M A;  3WGE A;  5D93 A;  3G7Y A;  3VWW A;  2AAW A;  3UVH A;  4PQI A;  3P2A A;  4X43 A;  4MLY A;  2CV4 A;  4V1A g;  4MP4 A;  4K0G A;  4XTS A;  5ABR A;  4KDU A;  3GUS A;  3L9U A;  2R3X A;  5DAK A;  1PQN A;  4HJM A;  2WRT A;  3QFB C;  1ZL9 A;  3NZN A;  4HQZ A;  4Z2T A;  1S3A A;  2VCX A;  5DCH A;  1GSS A;  3IRA A;  1U3A A;  3C7M A;  12GS A;  2YCD A;  4LMW A;  2LRT A;  3VFI A;  1M9A A;  3HHV A;  2B1K A;  2V1M A;  5LCZ A;  2HZF A;  3D6I A;  2EIR A;  2YP6 A;  2HSH A;  4NMU A;  2B5Y A;  1LU4 A;  4HI7 A;  3KH7 A;  1UN2 A;  4MMM A;  4LLR A;  1EZK A;  4ACS A;  3EVI A;  5GAN D;  3TJK A;  2I9H A;  3A2X A;  3QD9 A;  3HZ4 A;  4Q5N A;  3FR6 A;  2CVD A;  4TRX A;  3O3T A;  1CQH A;  1VF4 A;  4XS6 A;  3LGC A;  5HR2 A;  5JCG A;  2LV3 A;  1E2Y A;  1URM A;  1WOU A;  4NXI A;  3BCI A;  4Q5F A;  2K6V A;  1TJD A;  2DJ0 A;  2VOC A;  5D9T A;  4OFM A;  4I2T A;  1XW5 A;  2QKE A;  3DWV A;  4I5Q A;  2LQO A;  2V6O A;  1DSB A;  2X8H A;  4D73 B;  3EWL A;  2FLS A;  2IPA A;  2QA2 A;  3DD3 A;  4F82 A;  4X1U A;  2JAC A;  1QXH A;  2P0G A;  3D4T A;  3D22 A;  1A8Y A;  3EPT A;  4V2N A;  2H6X A;  3IXR A;  4V2M A;  5ECM B;  1FOH A;  4G0I A;  4LL1 B;  2AJQ B;  2VUP A;  3I6A A;  4BL7 B;  2LS5 A;  4IHU A;  2K9F A;  4E8E A;  2HZE A;  4GRF A;  4NAX A;  2HRF A;  4L0U A;  1YQ1 A;  3P90 A;  5IMC A;  4MZW A;  3EU4 A;  4MH2 A;  2AB6 A;  3MSZ A;  3TJB A;  1SL0 B;  4DSQ A;  2H71 A;  1YF0 A;  1Z5Y E;  4MPG A;  1ZYP A;  4GSS A;  4WEY A;  2YJH A;  3ZYW A;  1XPV A;  1OAZ A;  1F3B A;  5LNK e;  1VF1 A;  1GWC A;  1EV4 A;  4L5L A;  2IMK A;  3UBK A;  2C0E A;  3Q19 A;  4KX4 A;  1T1V A;  2OE1 A;  4EDY A;  1YEX A;  3QPM A;  5JWO B;  3IK7 A;  3QR6 A;  1F2E A;  2J23 A;  1M2B A;  3S9F A;  2N5B A;  2L4Q A;  3TKR A;  3EMX A;  4KB3 A;  3GRX A;  3HD5 A;  3C1R A;  5KN3 A;  3R3E A;  13GS A;  4NV2 A;  3LG6 A;  4BVX A;  2IFQ A;  2A2S A;  1N2A A;  2DMM A;  3FZ5 A;  3HZ8 A;  1PKW A;  4GXZ A;  5DJL A;  4POM A;  3VUR A;  5G30 A;  1RK4 A;  1T7P B;  1PMT A;  17GS A;  3US3 A;  2A2R A;  2OAD A;  2PVQ A;  5F8B A;  3TJG A;  3RPP A;  3DEX A;  5GSS A;  3LFL A;  3FYG A;  5JWQ B;  1FB0 A;  1R5A A;  2DBC A;  4EXJ A;  2DLX A;  6GSW A;  3KMN A;  2ZNM A;  4XHM A;  1QUW A;  2I1U A;  1RW1 A;  2GZZ A;  4PQ1 A;  2RUF A;  4ZB9 A;  3ZIJ A;  4GF0 A;  4OO4 A;  3E3E A;  2Z9S A;  1TTZ A;  3U6V A;  4V2L A;  1V98 A;  3CSI A;  5DQY A;  4YAP A;  2HT9 A;  6GSY A;  1HQO A;  1SKW B;  3FRC A;  3GUR A;  1BJX A;  3VLN A;  2I4A A;  3IPZ A;  1AAZ A;  4IVF A;  4MZB A;  3GX0 A;  4ECC A;  4Q5Q A;  3GH6 A;  1C72 A;  3HKR A;  3IC8 A;  3W8J A;  1FG4 A;  4N11 A;  2VM1 A;  1RQM A;  1IYH A;  5IMF A;  1XW9 A;  5IO2 A;  2FD3 A;  2KUC A;  2IWT A;  3H79 A;  4HOJ A;  3VK9 A;  1TRW A;  2JSZ A;  3LXT A;  3WT1 A;  2BJX A;  2C3T A;  3TJF A;  2E7P A;  2YPM A;  1F9M A;  4V1A p;  1OC3 A;  1TDI A;  2KP1 A;  1K0A A;  4HS1 A;  4KE3 A;  1WIK A;  5D8I A;  5H5S A;  3CBU A;  5IMV A;  2DML A;  2VCQ A;  4ZBB A;  5A4V A;  4CY8 A;  3ERG A;  1UVZ A;  1A24 A;  3MIX A;  4WBR D;  3TJJ A;  4QL9 A;  1BED A;  4ZBA A;  4XS4 A;  2DIY A;  4DEJ A;  4G0K A;  4KSM A;  5ID2 A;  4LA1 A;  4OCE A;  4RQX A;  3UAR A;  1HD2 A;  3DRN A;  4CW9 A;  2GZY A;  1GTI A;  2LJK A;  2YWI A;  3KCM A;  2HRK A;  1ZGN A;  1AQX A;  2QSI A;  4AJ8 A;  4GTU A;  3GL3 A;  3GFK A;  1X9S B;  1TP9 A;  5CNW A;  2DKI A;  3UVT A;  1HYU A;  1TRV A;  2OKA A;  1WP0 A;  4Z2U A;  1XXU A;  2AUV A;  4YQV A;  4O5U A;  2B5X A;  2ZCT A;  3DXB A;  4BWS A;  3U5R E;  1IYI A;  3FMW A;  3K8N A;  1Z7P A;  2XPE A;  3MDK A;  3QMX A;  5KOW A;  1R5P A;  3RHB A;  3WGD A;  3FR9 A;  4HJ2 A;  4O5R A;  3N5O A;  2R5G A;  1AC1 A;  1GSF A;  2FGX A;  5CP1 A;  1K0D A;  4ICY A;  1V57 A;  3H1N A;  4WF5 A;  1H4O A;  4ZL7 A;  2RII A;  1PL2 A;  4L8E A;  5DJM A;  1EEM A;  2VLV A;  2WFC A;  5ELA A;  2MYG A;  2X99 A;  5IPG A;  2ALB A;  5J41 A;  2R4V A;  1WMJ A;  4AJ6 A;  4N0V A;  2IMF A;  4PUR A;  2B5E A;  2L5O A;  1PX6 A;  20GS A;  2DJ3 A;  3TRX A;  2CX4 A;  3A5I A;  1PN9 A;  3KH9 A;  4TW5 A;  2X64 A;  1QQ2 A;  4EKZ A;  2LNS A;  4FH8 A;  3A3T A;  4K9Z A;  3TUE A;  5KN1 A;  5EVO A;  1OE8 A;  4NWY A;  4O92 A;  2HSY A;  2M80 A;  2F8A A;  1K0O A;  4F0B A;  2N5A A;  2OA7 A;  3A5W A;  3FZ4 A;  3SWL A;  1GSD A;  4IQ1 A;  4DSR A;  3CSJ A;  1XWC A;  4LMV A;  2LQQ A;  2B3S A;  4GWR A;  2P31 A;  1GP1 A;  4ML1 A;  3CMI A;  5A5K A;  1G6W A;  3CSH A;  5DBQ A;  1GSE A;  4K5S A;  1EP8 A;  2VO4 A;  2YOI A;  1JZW A;  1EGO A;  3HJO A;  2CZ3 A;  1O73 A;  2V2G A;  3ZML A;  1ZYQ B;  4IW9 A;  3VPT A;  2H75 A;  2JZT A;  2H1G A;  2PPT A;  1K0B A;  2VL2 C;  3CRT A;  5ELG A;  5IQY A;  3CXG A;  3HVS A;  2OE0 A;  2EIQ A;  2H1B A;  3G7J A;  1F3A A;  3M1G A;  2MZC A;  5G5F A;  1XW6 A;  4K7I A;  4K2D A;  3ZTL A;  5KN2 A;  3IAS 2;  1PRX A;  4POL A;  2BMX A;  1NM3 A;  5EL8 A;  4TR0 A;  1GTU A;  1OC9 B;  2NDO A;  3KTL A;  4NV5 A;  2RUE A;  2GDR A;  2C8U A;  5GAP D;  2CVB A;  1YKA A;  6GSV A;  5G1K A;  4TKY A;  4HDE A;  3DVX A;  2A4V A;  2NPB A;  5D96 A;  1HNA A;  3FK8 A;  1SD9 A;  1X9M B;  1XWB A;  6GSX A;  2O87 A;  4IP1 A;  2GVP A;  3PPU A;  1KEB A;  1M9B A;  2JU5 A;  2HXK A;  1HNB A;  1MDJ A;  3M0F A;  2FWG A;  4ZIJ A;  3BJ5 A;  3M3M A;  3HCZ A;  1SD8 A;  5B6N A;  2GQK A;  2ON7 A;  2VD0 A;  4GQC A;  2ON5 A;  4ZB8 A;  4HEA 2;  1V9W A;  4ZBD A;  2O85 A;  4RI7 A;  3E9J B;  1EP7 A;  2DSA A;  4GQF A;  2H6Y A;  4KAE A;  3D4M A;  2X49 A;  2QA1 A;  5F07 A;  2VAF A;  4EVM A;  2HRA A;  3IV4 A;  1EGR A;  3GKX A;  3F4S A;  4AJ7 A;  3EMP A;  1TK0 B;  5AN1 A;  2F8F A;  4WXT A;  5C04 A;  1B48 A;  1O7U A;  2P5R A;  4BVY A;  4HQS A;  3EYT A;  2H74 A;  2R2J A;  5CO3 A;  3KM6 A;  3VWX A;  3F4T A;  2H1D A;  2G0F A;  4KDX A;  1G0T A;  2MMA A;  4EDZ A;  4OFT A;  2DJ2 A;  3ZRE A;  3N9J A;  3IK9 A;  1PGT A;  1B4P A;  5IOW A;  2H70 A;  1TW9 A;  1SJI A;  2CA8 A;  2JL4 A;  4PGT A;  3UBL A;  1BAY A;  4ZXG A;  3QFA C;  1H75 A;  4MAB A;  4TOP A;  4TR1 A;  1DE2 A;  3KGK A;  3EU3 A;  4MDC A;  1WE0 A;  3GA4 A;  1KTE A;  1PSQ A;  2CAI A;  3APO A;  1ZOF A;  4MJE A;  1JFU A;  3QDN A;  2L4C A;  3OR5 A;  3LYK A;  4KCE A;  18GS A;  2LKU A;  3HVV A;  2H0I A;  4DSS A;  1AXD A;  1A8L A;  1J0F A;  3FY7 A;  3QAV A;  1TI3 A;  2A4H A;  3F63 A;  4WF4 A;  4N0Z A;  4G0L A;  1GLQ A;  3A2W A;  2OAC A;  4IP6 A;  3HA9 A;  4OWY A;  1GUM A;  1TXX A;  1XVQ A;  5ECO B;  1FO5 A;  2HRN A;  2VL3 A;  1GL8 A;  4WET A;  4OCF A;  3TDG A;  1G6Y A;  1GRX A;  4Z7X A;  1YJ6 A;  1UA5 A;  3CYN A;  3P8W A;  4CY6 A;  5ECR B;  4XS1 A;  3GYK A;  3C71 A;  4HZ2 A;  4PNF A;  3TRQ A;  5F06 A;  1U3I A;  3ZFB A;  4K5R A;  3APQ A;  2H0H A;  4XIH A;  3TRP A;  3C1S A;  1DBY A;  4BWQ A;  1AIU A;  2B7K A;  3VI7 A;  2IN3 A;  2QC7 A;  1XCC A;  5FWG A;  1VGL A;  2LUS A;  5EPF A;  2X8G A;  4OFN A;  5AIV A;  1YEP A;  2GGT A;  1HNC A;  3CRU A;  4MF6 A;  4PX1 A;  3ZIV A;  4I97 A;  2H30 A;  4J57 E;  2ZUP A;  4ZL9 A;  14GS A;  2F3M A;  3DIE A;  1ZCP A;  3L4N A;  2E0Q A;  2H72 A;  2I3Y A;  1O8X A;  2N5F A;  1JZD A;  1GH2 A;  4TXO B;  22GS A;  4K6X A;  2O8V B;  2VLT A;  2YWM A;  1ON4 A;  2GSS A;  1EEJ A;  3RHC A;  2DIZ A;  3TB2 A;  2VIM A;  4POB A;  4AGS A;  3RPN A;  4D73 A;  1YZX A;  1V58 A;  1R4W A;  2R6K A;  1QGV A;  3RAZ A;  3QOU A;  3BD2 A;  4A5P A;  1VF2 A;  2WZ9 A;  1ZZY A;  2MMZ A;  4JRR A;  1SJ6 A;  5IIZ A;  2FNO A;  1GTB A;  3UOM A;  3QAG A;  1MDK A;  4WKW A;  3HXS A;  4BL7 A;  1B9X C;  1YY7 A;  4ECB A;  3HDC A;  3KP9 A;  4ISD A;  4IS0 A;  2BTO T;  4TR3 A;  3DGQ A;  3GH9 A;  5ECH B;  2IMI A;  1GSQ A;  3GTU B;  1K0N A;  1A2L A;  2C3Q A;  3F3R A;  5G2Z A;  1M99 A;  1I5G A;  4K7O A;  2H66 A;  4KCA A;  4FYB A;  4TXV A;  3GKK A;  5CRH A;  1TOF A;  2L6D A;  4GCI A;  3IC4 A;  4KW6 A;  5J5N A;  3PH9 A;  1QMV A;  2PU9 C;  1ACV A;  2GSQ A;  5ECK B;  1SYX A;  4IKH A;  3TKS A;  3GST A;  2JSY A;  3GIX A;  5A4U A;  2WB9 A;  4OMV A;  1XWG A;  2LRC A;  5J3R A;  1AUC A;  2FA4 A;  3PIN A;  1SL2 B;  3WD6 A;  2AV4 A;  1TK8 B;  3I43 A;  1FVK A;  1OKT A;  3EUR A;  2OBK A;  3EIN A;  4K7N A;  3WT2 A;  3LYP A;  2VL9 A;  3VPQ A;  4HU7 A;  1XWA A;  3UIW A;  4PUF C;  1M0U A;  4QL7 A;  2MBS A;  3QCP A;  5DAL B;  4RQR A;  1OC8 A;  2GSR A;  4H86 A;  1OE7 A;  2YV7 A;  3Q74 A;  1X0R A;  4MNN A;  4E8H A;  3W8S A;  3ERF A;  5B8A A;  3ZVJ D;  2V6K A;  2H6Z A;  3ZRD A;  2MMN A;  3ME8 A;  4FYU A;  1T4Y A;  2HLS A;  3GL5 A;  1A2M A;  4KH7 A;  3LEF A;  4YKG A;  4POK A;  1TRU A;  3FZ9 A;  4MJC A;  1Z6M A;  3F9U A;  3F8U A;  2C0F A;  4HZ4 A;  4NPB A;  3G7I A;  5ECS A;  3GNJ A;  2CT6 A;  2R37 A;  2UZ8 A;  4MJA A;  9GSS A;  2IL3 A;  1EV9 A;  3KTB A;  1NSW A;  5E4W A;  3C8E A;  5ECQ B;  2REM A;  1ST9 A;  2GT6 A;  1FHE A;  4JU5 A;  3MAK A;  5KOX A;  3A2V A;  3UJ1 A;  5CRG A;  5ENU A;  2B1L A;  1R26 A;  3MYD A;  3VWV A;  5CRD A;  1NW2 A;  2GLR A;  1T00 A;  1YDK A;  2C0D A;  4PNG A;  3M9J A;  5F05 A;  3ZIT A;  1G7E A;  4XCS A;  2O89 A;  1EOH A;  1O8W A;  1F6M C;  2L6C A;  2YZH A;  4ULX A;  3C73 A;  2O7K A;  1MD4 A;  4YQU A;  1DE1 A;  4WR4 A;  5H5R A;  4L5O A;  4NHW A;  3TOT A;  1VRS D;  1SKS B;  1SEN A;  6GSS A;  2PUK C;  1Z3E A;  1SK2 A;  2PBJ A;  5DAK B;  3LOR A;  1GLP A;  4XRD A;  3ISO A;  1PX7 A;  1V40 A;  2YZU A;  4P3Y B;  3GN3 A;  3IA1 A;  10GS A;  4MJB A;  2AYT A;  1ERV A;  1OVN A;  4ID0 A;  3DKS A;  1NHY A;  3IR4 A;  1M7T A;  2VCT A;  3IAM 2;  2WJU A;  4WR5 A;  3ME7 A;  2JAD A;  2FHE A;  4JR4 A;  2AHE A;  4OO5 A;  1TI1 A;  1A0F A;  1TRS A;  2FCH A;  2VM2 A;  1MTC A;  1A0R P;  5AIS A;  3BOA A;  4WBJ A;  1JHB A;  4MPF A;  5IO0 A;  2CZ2 A;  4EIP A;  5ECP B;  1R7H A;  1S3C A;  4JR6 A;  5HR0 A;  4F9Z A;  2GS3 A;  3VI5 A;  4G2E A;  1K3O A;  3LSZ A;  2DJK A;  4RI6 A;  1WRY A;  3LXZ A;  1GUH A;  2H19 A;  2VCW A;  4KF9 A;  1JLV A;  1Y25 A;  2RM6 A;  1SU9 A;  4IEL A;  3ED3 A;  5HR3 A;  2FWH A;  5CRW A;  1J08 A;  2R0G A;  1XIY A;  4J56 E;  2YN1 A;  4PTS A;  3F0I A;  4MCU A;  3DVW A;  1OKD A;  1K3Y A;  2XHF A;  4CDO A;  1CQG A;  2I81 A;  1GTA A;  3LJR A;  2QGV A;  2XC2 A;  1ZMA A;  4FIW A;  3J7Y b;  3KXO A;  1NHO A;  1Q4J A;  1BG5 A;  2YWN A;  1FB6 A;  2H8L A;  4NHZ A;  4FO5 A;  3W6G A;  2YAN A;  3R2Q A;  3TOU A;  4F0C A;  2HZE B;  4KDY A;  1SK1 A;  1AQW A;  1MD3 A;  2RLI A;  4XRA A;  5B8B A;  1X5C A;  2KLX A;  2VLU A;  5DVB A;  4QQ7 A;  4LL4 B;  1O85 A;  3ERW A;  1SYR A;  1XOB A;  1M2D A;  4BPY A;  3KJY A;  3H93 A;  1I9D A;  4CHS A;  3WYW A;  3DML A;  1PL1 A;  1GNE A;  4YAV A;  2LRN A;  3EE2 A;  5B7C A;  2CQ9 A;  4AF2 A;  1T3B A;  3ZLP A;  2DC5 A;  5FT3 A;  4USS A;  2HFD A;  3Q18 A;  1ERT A;  2PMT A;  1TU7 A;  4MZC A;  2WDU A;  3IHG A;  5LD0 A;  5G31 A;  5C00 A;  2HI7 A;  2EC4 A;  1U6T A;  4Z2R A;  2LJA A;  3GKM A;  6GSU A;  4BVX B;  2IFQ B;  2XBQ A;  3IE3 A;  3KMO A;  2M72 A;  4KSO A;  4ZL8 A;  2YV9 A;  2IMD A;  4L0W A;  3JCM L;  4GST A;  2H1A A;  3FR3 A;  4K1F A;  1GUL A;  1OC9 A;  4N10 A;  3AY8 A;  5KEJ A;  4GLT A;  1Z6N A;  3QAW A;  1B4Q A;  2IIY A;  3MWH A;  3I9V 2;  5ECL B;  2TRC P;  5J9C A;  3FKF A;  1XBS A;  5DQS A;  2CAQ A;  2RM5 A;  2A2P A;  2EIO A;  2FWF A;  3SBC A;  1QFN A;  3PR8 A;  1A2J A;  2P5Q A;  2OBI A;  4JZQ A;  1XVW A;  2E2G A;  1KNG A;  1O81 A;  2C3N A;  3FW2 A;  5HFK A;  5IM9 A;  4K2X A;  5HQP A;  4IJ3 A;  4EUY A;  4Q5R A;  3H8Q A;  3UL3 A;  1GUK A;  19GS A;  3F6D A;  2YNX A;  5D9X A;  4IBP A;  3UMA A;  3ZFL A;  5DCG A;  3NOF A;  3H4K A;  4JED A;  2VCV A;  4MH3 A;  5A4W A;  1LJR A;  2R0P A;  1BQ7 A;  5CYY A;  16GS A;  1GNW A;  2K18 A;  1USB A;  1XOA A;  2B6M A;  3PGT A;  4EIQ A;  4ZIL A;  4PQH A;  3CTF A;  4MK3 A;  1BYE A;  2K8S A;  3CTG A;  4TR4 A;  2CVK A;  4JE1 A;  3FHK A;  4MF5 A;  1ERU A;  2GST A;  1SJZ A;  1TU8 A;  1SKR B;  2L57 A;  1N8J A;  1ML6 A;  4ECI A;  2FY6 A;  8GSS A;  5H5Q A;  2C0G A;  4XS4 B;  3KP8 A;  1XFL A;  5ID2 B;  4TVE A;  1LBK A;  3TKS E;  4GSN A;  2MMO A;  3GKN A;  5JCW A;  4X4J A;  2PGT A;  3EC3 A;  1AQV A;  2WUL A;  3RDW A;  2LST A;  1OYJ A;  1EWX A;  2GT5 A;  3HJP A;  4J2F A;  5G5E A;  2DKH A;  3DYR A;  1UC7 A;  3HVX A;  1JLW A;  2KOK A;  1WJK A;  2X4A A;  1MDI A;  5KN0 A;  3GMF A;  1TKD B;  4O5Q A;  5IMA A;  3IOS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...