1PQNA

Dominant negative human hdim1 (hdim1 1-128)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
127
structure length
127
Chain Sequence
SYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMVDIIETVYRGARKGRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords Spliceosomal U5 snRNP-specific 15 kDa protein
publication title Structure, stability and function of hDim1 investigated by NMR, circular dichroism and mutational analysis
pubmed doi rcsb
source organism Homo sapiens
total genus 22
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2003-06-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1pqnA00
1Y25A 4J56E 1O73A 1GSQA 1ERVA 4IJIA 3W8SA 2VCWA 2IMDA 2FUG2 5JWRB 2C3QA 2DIZA 4N0VA 1JZOA 1VF2A 5D9TA 1RQMA 3VPTA 2DJ1A 3ZLPA 1E6BA 3TKRA 3N9JA 1G7EA 4KGIA 3ERGA 1U3AA 1UN2A 3UBLA 4I97A 4XS1A 1FW1A 1QFNA 1GLPA 3F4SA 1LU4A 1YF0A 2H76A 1XW6A 2PMTA 3MNGA 2L4CA 2H1BA 2PERA 3KJYA 2X64A 2OACA 1PN9A 2VCQA 1NSWA 1VF1A 2C3TA 1M0UA 3R2QA 3EINA 3LGCA 2F8AA 1IYIA 3APOA 2LV3A 3TGZA 1DUGA 4JR6A 1XVQA 1M99A 4MA9A 3U6VA 1QXHA 2M46A 1IYHA 1BG5A 3WD6A 2CV4A 3UEMA 1V58A 3F6FA 3Q19A 2NBSA 4ZILA 2H74A 3G7YA 4WEYA 1TU8A 4IP1A 1X5EA 5CYYA 2H0GA 2H19A 3TKSC 3VK9A 1Y6EA 2LQQA 1T3BA 1GSDA 5J41A 2HT9A 1F3BA 4EUYA 1CQGA 2H66A 1WWJA 2X8CA 4MZWA 3TKSA 3GYKA 4F9ZA 5IPGA 2KOKA 3LXZA 4HQZA 5COHA 9GSSA 1OC9A 1HD2A 4ID0A 3M8NA 4F03A 4F0BA 3TRQA 4V1Ap 4MPFA 2DLXA 1O7UA 1PRXA 4Q5RA 5ECOB 1X0RA 1K0MA 4EE0A 5ELGA 5G5EA 1I9DA 4KSOA 4IELA 3F8UA 4HJ2A 4OD7A 3VI5A 5LCZA 3EVIA 2CVKA 1GNEA 4NMUA 2GLRA 2PVQA 4RQXA 1X9SB 1TOFA 2LNSA 4LMVA 2J23A 1Q4JA 3CSIA 3IBHA 4MJBA 4LLRA 2FLSA 5CRWA 5EVOA 4N0ZA 2O7KA 1OC3A 2CAIA 20GSA 2B6MA 2K8VA 4QQ7A 2E0QA 4V2MA 4IS0A 4J57E 3IRAA 5GZZB 3ED3A 1LJRA 13GSA 4MDCA 1LBKA 1GUKA 1H75A 1ZMAA 1V9WA 1OKTA 2GSQA 4POBA 3RHCA 2WZ9A 4DSSA 3FYGA 1PL2A 1S3AA 3LJRA 3NIVA 4MJCA 1YQ1A 3KMOA 4L8EA 4ZL7A 1OAZA 4MP4A 2KHPA 2N5FA 4HQSA 5IMCA 3H79A 4G2EA 1YY7A 3HYPA 1S3CA 2RUFA 2JACA 3HXSA 1H4OA 1OE7A 1TW9A 4HJMA 4ECIA 4OFMA 2H70A 2GQMA 3FR3A 4IQAA 2HRFA 2RM6A 5G31A 4DSRA 3IOSA 2RUEA 3EYTA 4K8MA 1V40A 3US3A 2BJXA 4HZ4A 2XPDA 2YWMA 2FCHA 1A8LA 1YKAA 5JWQB 5AIVA 4BVYA 3VWVA 1XOBA 2FWFA 2LRCA 1B9YC 2MMNA 5EL8A 4KDYA 2JSZA 4PXOA 4OCEA 1SJZA 5A4VA 5CO3A 4KDUA 2DJ0A 1NHOA 3F4RA 1PX7A 3RPPA 5GSSA 1PX6A 3EMPA 4JU5A 2XBIA 2H1AA 2O85A 1FB0A 1XFLA 2K9FA 2JZSA 4PQ1A 1ON4A 6GSUA 3L78A 3UVHA 1VF3A 3L9SA 2C1YA 3EC3A 4I6XA 1ML6A 1A23A 4OO5A 3ERWA 4TR4A 2LRTA 4MZBA 2PU9C 4MF6A 4OFNA 3WYWA 4V2LA 1M2AA 4DSQA 2C0FA 5F07A 1AW9A 3GHAA 1YZXA 2LEGA 4ZBBA 1FO5A 3NOFA 3D0ZA 5KEJA 2AYTA 2TIRA 4K2DA 4K7IA 3OR5A 3RDWA 3DGQA 5J9CA 1GH2A 3KP8A 4TVEA 5CRGA 1FG4A 1EP8A 4NWYA 1G0TA 3QDNA 2WGRA 3HZ4A 2H0HA 4LL1B 4Q5QA 1NM3A 2IL3A 1A2JA 4ZL8A 1K0CA 3F3QA 2VD0A 3H1NA 4I5QA 3CSHA 3EU3A 2JSYA 1EEMA 2DIYA 4IQ1A 4Q5FA 3GV1A 3J7Yk 5F0GA 2I1UA 5H5QA 2G0FA 4L0WA 3O76A 3UJ1A 2E7PA 4IHUA 4XS4A 2IMKA 1X9WB 3RHBA 1B8XA 3PR8A 2OA7A 1SK0A 3IE3A 3CMIA 4ACSA 3GA4A 4XRDA 1AQWA 5FT3A 3ZVJD 2F8FA 2VO4A 2ALBA 4O92A 2FD3A 2GZZA 3HD5A 3IC4A 4EO3A 3ZVJA 1YDKA 3L9UA 2VLVA 2E2MA 5AIXA 1XPVA 2I4AA 4J2FA 3D21A 2R37A 1EEJA 4OCFA 4G9HA 4K7NA 1V98A 4L0UA 1R4WA 1SENA 1R5PA 4ZIJA 6GSTA 3I43A 5E4WA 3TKSE 1XXUA 1YJ6A 2EIQA 2HE3A 2R3XA 11GSA 1RW1A 5CRDA 1XWGA 3W8JA 4ISDA 2GSSA 3HVXA 4EC0A 4F2IA 4AJ8A 5DJMA 1MD4A 2FA4A 2GT6A 4YH2A 2R5GA 2XC2A 2FWGA 2L6DA 2H01A 1FVKA 1UVZA 2VM2A 4IGJA 3APQA 2CVBA 1PA3A 5J9BA 1EWXA 4CW9A 1DE1A 2MBTA 3GL3A 2ON5A 4WR5A 3L9VA 4FO5A 2MMOA 1J0FA 1M9BA 4JBBA 1M2DA 1ERWA 1B4QA 4KUNA 3M9JA 3GURA 2P0GA 5GSTA 5G2ZA 1ZCPA 5L71A 5D9XA 5HFGA 2JADA 2V32A 3KP9A 2H6ZA 3CYNA 2YJHA 1T8EB 3MSZA 1SL1B 5B7CA 1FHEA 3K8NA 1MDIA 2MBSA 3FK8A 4KDXA 4WF5A 1YF1A 1Q98A 2VLUA 5LD0A 3IPZA 3DVWA 1XWCA 2DMLA 3UAPA 5ID2A 2FWEA 5IOXA 4MJAA 1AIUA 2YP6A 2OKAA 3DXBA 4JEDA 1K0BA 4V1Ag 1TK5B 2LRNA 5IIZA 2MYGA 3ZIVA 3GRXA 3M1GA 1PMTA 2RLIA 1R7HA 5G1LA 5F05A 2RM5A 4QL7A 1SYXA 4ZBDA 2LKUA 4XS6A 4GQCA 1PL1A 4YAPA 2VL2C 5F06A 1B4PA 4XRAA 4KB3A 1XW5A 2GT5A 4MLYA 1I5GA 2V6OA 2AJQB 5J5NA 3GSSA 4AF2A 4XTSA 3D4TA 4DSSB 3ISOA 1ZL9A 5ECRB 2VL2A 1BJXA 1GSUA 2DJ2A 4BA7A 4BL7A 2M80A 3F0IA 1QMVA 1GP1A 1J08A 3VFIA 1QK8A 1EP7A 5EPFA 2KP2A 1PSQA 5B6NA 3P90A 4KCAA 2H71A 3KTLA 5IMDA 1KNGA 4YQMA 5ECLB 3I6AA 5DVBA 2H1GA 2HNLA 2WJUA 2VOCA 3TJKA 3I9V2 4PURA 2WULA 4TR1A 1SL0B 1BEDA 1VF4A 3ZL5A 2B7KA 3ZMKA 5KN3A 5E59A 3DD3A 16GSA 2AB6A 5IOWA 1TU7A 2KUCA 4OO4A 14GSA 2PN8A 3A2WA 3L4NA 5G5FA 3ZZXA 2B3SA 5ECIB 2OJLA 1K3OA 3LYPA 1USBA 2WB9A 3UMAA 1OE8A 4D73A 3IDVA 2OBIA 4O5RA 4IVFA 3TJGA 3QR6A 2K8SA 3GUSA 3F3RA 3FR9A 1HYUA 2HRNA 2HI7A 4IN0A 4ZB6A 1YKCA 5HR1A 2WFCA 1JFUA 1JLVA 5CAXA 3C1SA 4P3YB 3FY7A 4GRFA 2ZUPA 1EV4A 2L4QA 2H72A 2GZPA 3I69A 2IFQB 1XCCA 1EGRA 1X9MB 3GH6A 4WKWA 3H93A 1Z6MA 2VLTA 3GSTA 1UC7A 1PKZA 4ECBA 4LA1A 2H75A 1NHYA 3NZNA 3EURA 1EOHA 3D6IA 4QL9A 1PGTA 1E2YA 1TI3A 3HY2A 4IP6A 4OMVA 4WBJA 1HQOA 1ZOFA 4KA0A 3KGKA 4KW6A 5ECHB 3VPQA 3TOUA 2L6CA 1SYRA 4HS1A 1AQVA 2H30A 5AISA 5H5RA 4MH3A 2K18A 2LQOA 4O7HA 4PX1A 4PNGA 1PQNA 2CX4A 4AGSA 1A0RP 1TP9A 4GLTA 3WGDA 3LG6A 1XW9A 4FYCA 2OADA 4G10A 3TRXA 1WOUA 2X8HA 2IN3A 5HFKA 1TTZA 5ENUA 3ZITA 1Z9HA 4EVMA 4XS4B 5FHIA 1V57A 1HNAA 2IPAA 3TOTA 3LEFA 1GL8A 4POKA 5DAKA 4V2NA 2I81A 4ULXA 2H8LA 4MH2A 5EY6A 3BCIA 1SKRB 3LFLA 3JCML 2VCTA 5DQSA 3PH9A 2GDRA 1THXA 1ZZYA 3KH7A 1O8WA 4NAXA 2JL4A 4WF4A 3RAZA 3CBUA 3GH9A 1U6TA 3M3MA 2VAFA 2FHEA 4I8BA 1ABAA 4DVCA 4JRRA 2DJKA 1N2AA 1S3DA 1B48A 1MD3A 4TR3A 3S9FA 2F51A 1A0FA 3DMLA 1X5DA 1OVNA 4K9ZA 3A5WA 3QFBC 1TKDB 4JE1A 2F3MA 3G7JA 3VLNA 1WE0A 3A2XA 3VI7A 2V41A 2DC5A 4TXOA 2DMMA 2LS5A 6GSXA 4FYUA 2CZ3A 2R4VA 3CRTA 5ECPB 4BWQA 3ZMLA 3UIWA 1TXXA 2HZEA 2NPBA 3HHVA 3DYRA 1GSEA 1XIYA 1A8YA 1R5AA 3D4MA 3FKFA 5IO0A 3J7Yb 5KN1A 1AC1A 1GTBA 2GTUA 2JU5A 3KM6A 2IMIA 2ZCTA 1DBYA 3CRUA 2FWHA 1KTEA 3Q6OA 4RQRA 1K0OA 4TKYA 3IK7A 3QAVA 1OYJA 2QGVA 2I9HA 2O8VB 2D2ZA 1EZKA 2JZTA 1K0DA 3TUEA 1TK0B 2GQKA 3FR6A 3E0UA 2H6XA 5B6MA 4FH8A 1ERTA 1ZGNA 3G9BA 4N10A 5ID2B 4POMA 4DEJA 3QOUA 5DQYA 4XIHA 3IA1A 4HU7A 2G2QA 1XOAA 1HNBA 4IW9A 7GSSA 3GKKA 4X43A 4KNDA 2OE1A 2X99A 1TK8B 2O89A 6GSSA 2AHEA 1HNCA 2L5LA 3UOMA 6GSWA 2EC4A 1EV9A 5G30A 4OWYA 2PUKC 3TJJA 3FW2A 1WPIA 2B5EA 2QC7A 3GTUA 2P5QA 2C8UA 2WS2A 3CSJA 3C1RA 4K0GA 2CVDA 2C3NA 1KBNA 4G19A 3SWLA 2VCZA 4EDYA 1Z7RA 2L59A 4PQHA 2YZUA 1GULA 2TRXA 2GQLA 3FZAA 1QGVA 4NHWA 2B1LA 1Z6NA 1A2MA 4EKZA 4N30A 5DJLA 1Z3EA 1NW2A 5G1KA 1MTCA 4TR1B 1T7PB 2GSTA 3QCPA 2FNOA 3H4KA 3BD2A 5DCHA 4MZCA 3QAWA 4GWRA 2GGTA 4I2UA 4POLA 3UL3A 1ZYQB 3Q18A 1WIKA 4MF7A 2CZ2A 5IQYA 4F0CA 5D8IA 2NDOA 4EXJA 3TRPA 5D9VA 2CAQA 2KLXA 5HR0A 3FRCA 3WT1A 1TRSA 4HUAA 5AGYA 3QD9A 1OC9B 4ZBAA 4D73B 1T4ZA 3H8QA 3TKPA 2VCVA 3IK9A 4KE3A 4E8EA 2VM1A 1EOGA 1TRWA 2GSRA 1PKWA 3O3TA 5HR3A 1EGOA 4PUAA 4L5OA 4GSSA 3BOAA 4TOPA 3LSZA 2WDUA 2XHFA 1JZRA 3U5RE 4ZXGA 2L5OA 3APSA 1W4VA 3DKSA 3ZFBA 5CREA 22GSA 2N5BA 4Q5NA 3KXOA 5IPHA 3KCMA 4KAEA 1SU9A 4WR4A 2LUSA 1CQHA 1TRUA 2CQ9A 4TW5A 2DJJA 4JZQA 2VD1A 4ZB9A 3FZ5A 1BQ7A 1SJ6A 5JCGA 2HLSA 2B7JA 4KCEA 4L5LA 4IBPA 4PQIA 3HJOA 5ELAA 2IMFA 3EE2A 2NTOA 3BCKA 4IJ3A 1AQXA 3V1WA 4HI7A 1Z7PA 1K3LA 4MCUA 4ZB8A 5J3RA 1GTAA 5ECKB 2YV7A 1GTUA 3GX8A 3QFAC 2IJYA 3KH9A 3HCZA 1JZWA 5DBQA 1SKSB 4ML6A 2C0EA 2K6VA 2LSTA 1Z5YE 3GIXA 3HZ8A 1XWKA 1WMJA 4K7OA 2LTKA 5LNKe 3DWVA 1GUMA 4TR0A 3CTFA 4BVXA 4GTUA 3KMNA 4HU9A 1U3IA 2RIIA 5DAKB 2YV9A 4YAVA 3TDGA 1YEPA 2GS3A 3F9UA 2LJRA 1GWCA 1SKWB 3GKMA 3MDKA 1RK4A 5C04A 2MZCA 1V2AA 2EIRA 4I2TA 2VUPA 3P2AA 4CHSA 3UVTA 2MMZA 5F8BA 3A3TA 1ACVA 2CT6A 1GSFA 1ST9A 1U88A 1MEKA 5C00A 2HSHA 2H6YA 1DE2A 1TDIA 3AY8A 5D93A 2LJAA 3TJBA 2J9HA 3BBYA 4FYBA 1J9BA 4NXIA 5DALA 2E2GA 1SJIA 1WP0A 2F9SA 1G6YA 1GNWA 4WETA 4GSNA 4TXOB 1UA5A 4RI6A 3BJ5A 2HZFA 3LQ7A 1R26A 4K6XA 5ABRA 2ZNMA 3FZ9A 1AUCA 4ML1A 3VWXA 5D9WA 3IV4A 4HEA2 3GNJA 2YCDA 4YQUA 1TI1A 5DCGA 3M0FA 3EU4A 1KEBA 2HZEB 5HR2A 4TN8A 1OKDA 5HFIA 1VRSD 5A4UA 3KZQA 2YN1A 2HFDA 1QQ2A 3TKQA 1SK2A 2FA8A 1PD21 1SL2B 3QMXA 1F9MA 5JCWA 1M9AA 4PUFC 3F63A 3P7XA 3QPMA 4E8HA 2YWNA 2V2GA 4NV5A 2HSYA 2P5RA 4BWSA 4NPBA 5GAPD 4PNFA 1QUWA 6GSYA 4GQFA 4ILFA 1WRYA 3C7MA 3F4TA 3IR4A 5A5KA 1ZYEA 1SD8A 3D22A 1XBSA 1MDKA 4EDZA 5IMAA 1ERUA 1AXDA 2AUVA 5FWGA 3MWHA 2PBJA 4CDOA 1URMA 1A24A 3LORA 3GFKA 19GSA 4MABA 4NV2A 1O81A 2C4JA 3VWWA 5H5SA 1DSBA 2BMXA 2XPEA 2PVOC 3ZIJA 2FY6A 2B5XA 4H86A 4OFTA 10GSA 2IMEA 4RUVA 2NVLA 3DEXA 4WBRD 2DSAA 5A4WA 1XZOA 2PWJA 2N5AA 3FEUA 2P31A 2C0GA 3UBKA 2AAWA 4O32A 4GSTA 3GTUB 4FIWA 1XWAA 4MF5A 4Z7XA 2FGXA 2L57A 4HDEA 4KSMA 2LJKA 5IM9A 1O6JA 3KIJA 3G7IA 3ZYWA 2O87A 3PGTA 3HKRA 1MDJA 1F2EA 2OE0A 4X0XA 2X8GA 2B1KA 3Q74A 2HYXA 4LL4B 1A2LA 1OC8A 4TXVA 5IMFA 3KEBA 5CP1A 4F82A 2PPTA 2A2RA 1GUHA 4MMMA 1BYEA 2IFQA 5JCUA 1GSYA 18GSA 1F37A 1JLWA 5ECNB 2CX3A 5AN1A 1THOA 2BTOT 3ZFLA 1W89A 2IWTA 2Z9SA 3M9KA 1O8XA 2QKEA 5D73A 2YPMA 1TRVA 2GZYA 2WCIA 4MJEA 5IMVA 4EL1A 2OE3A 1K3YA 3CXGA 4X1UA 3UARA 1YEXA 4HOJA 4YQVA 3L0HA 5ECQB 5JWOB 3GN3A 1GTIA 4JR4A 3ME7A 3VWUA 1F3AA 1M7TA 4ECCA 1F6MC 2XBQA 5D96A 2YWOA 1ILOA 1N8JA 3EMXA 5DDLA 2EIOA 3GMFA 3IXRA 1B9XC 4RI7A 2DJ3A 2LNTA 1BAYA 2B5YA 1XWBA 3GKNA 3GL5A 2DBCA 4XHMA 2VL9A 5CNWA 3TCOA 3DIEA 4TRXA 4K1FA 2M72A 4PGTA 2GVPA 5B8BA 5INYA 2YOIA 3TB2A 4MPGA 3IAS2 1FOVA 3WGXA 3E3EA 4ZL9A 3HVVA 1SD9A 1T1VA 1M2BA 2VCXA 4HZ2A 1G7OA 1K0AA 2REMA 1XVWA 4N11A 2QSIA 2ON7A 2I3YA 3ZTLA 3KTBA 4BPYA 1U87A 2YANA 5HQPA 3C73A 3CTGA 1WJKA 3RPNA 3FHKA 4LMWA 2PGTA 2H0IA 2YNXA 2V1MA 3HVSA 3C8EA 2R2JA 2CA8A 2WRTA 1BX9A 2H1DA 6GSVA 2TRCP 12GSA 8GSSA 1SK1A 3DVXA 3FZ4A 3ZREA 1FVJA 3LYKA 2YZHA 3ZRDA 3F6DA 3TJFA 3E9JB 3IAM2 1VGLA 1T4YA 5CRHA 4MK3A 3IHQA 3SBCA 1T00A 1JZDA 3LWAA 5KN2A 2R6KA 3DRNA 2C80A 2A4VA 1K0NA 3QAGA 3D5JA 5IMZA 1JHBA 1FAAA 2VIMA 3O6TA 1TJDA 1X5CA 5GAND 3HDCA 1GSSA 5KN0A 1G6WA 2YWIA 3ERFA 4KH7A 3W6GA 2H73A 4WXTA 3WGEA 17GSA 3WT2A 1GRXA 3GX0A 3HJPA 2VL3A 4ECJA 4K0NA 4KX4A 4NHZA 1C72A 3VURA 5ECSA 2HXKA 4IKHA 3A2VA 3C71A 3PINA 3ME8A 1GLQA 4AJ7A 4GF0A 3MAKA 3GKXA 3HJMA 3RBTA 2OBKA 1AAZA 1FB6A 4XCSA 5IO2A 3KD0A 3P8WA 2ES7A 2IIYA 5ECMB 4AJ6A 5DALB 3EWLA 3LXTA 2A2SA 2AV4A 2C0DA 2V6KA 2YJ7A 2MMAA 4EF0A 1O85A 2JZRA 5B8AA 3HA9A 4GCIA 4GXZA 3N5OA 5J4UA 2KP1A
chains in the Genus database with same CATH superfamily
1Y25A 4J56E 1O73A 1GSQA 1ERVA 4IJIA 3W8SA 2VCWA 2IMDA 2FUG2 5JWRB 2C3QA 2DIZA 4N0VA 1JZOA 1VF2A 5D9TA 1RQMA 3VPTA 2DJ1A 3ZLPA 1E6BA 3TKRA 3N9JA 1G7EA 4KGIA 3ERGA 1U3AA 1UN2A 3UBLA 4I97A 4XS1A 1FW1A 1QFNA 1GLPA 3F4SA 1LU4A 1YF0A 2H76A 1XW6A 2PMTA 3MNGA 3R3EA 2L4CA 2H1BA 2PERA 3KJYA 2X64A 2OACA 1PN9A 2VCQA 1NSWA 1VF1A 2C3TA 1M0UA 3R2QA 3EINA 3LGCA 2F8AA 1IYIA 3APOA 2LV3A 3TGZA 1DUGA 4JR6A 1XVQA 1M99A 4MA9A 3U6VA 1QXHA 2M46A 1IYHA 1BG5A 3WD6A 2CV4A 3UEMA 1V58A 3F6FA 3Q19A 2NBSA 4ZILA 2H74A 3G7YA 4WEYA 1TU8A 4Z2TA 4IP1A 1X5EA 4BIKA 5CYYA 2H0GA 2H19A 3TKSC 3VK9A 1Y6EA 2LQQA 1T3BA 1GSDA 5J41A 2HT9A 1F3BA 4EUYA 1CQGA 2H66A 1WWJA 2X8CA 4MZWA 3TKSA 3GYKA 4F9ZA 5IPGA 2KOKA 3LXZA 4HQZA 5COHA 9GSSA 1OC9A 1HD2A 4ID0A 3M8NA 4F03A 4F0BA 3TRQA 4V1Ap 4MPFA 2DLXA 1O7UA 1PRXA 4O5QA 4Q5RA 5ECOB 1X0RA 1K0MA 4EE0A 5ELGA 5G5EA 1I9DA 4KSOA 4IELA 3F8UA 4HJ2A 4OD7A 3VI5A 5LCZA 3EVIA 2CVKA 1GNEA 4NMUA 2GLRA 2PVQA 4RQXA 1X9SB 1TOFA 2LNSA 4LMVA 2J23A 1Q4JA 3CSIA 3IBHA 4MJBA 4LLRA 2FLSA 5CRWA 5EVOA 4N0ZA 2O7KA 1OC3A 2CAIA 20GSA 2B6MA 2K8VA 4QQ7A 2E0QA 4V2MA 4IS0A 4J57E 3IRAA 5GZZB 3ED3A 1LJRA 13GSA 4MDCA 4USSA 1LBKA 1GUKA 1H75A 1ZMAA 1V9WA 1OKTA 2GSQA 4POBA 3RHCA 2WZ9A 4DSSA 3FYGA 1PL2A 1S3AA 3LJRA 3NIVA 4MJCA 1YQ1A 3KMOA 4L8EA 4ZL7A 1OAZA 4MP4A 2KHPA 2N5FA 4HQSA 5IMCA 3H79A 4G2EA 1YY7A 3HYPA 1S3CA 2RUFA 2JACA 3HXSA 1H4OA 4KF9A 1OE7A 1TW9A 4HJMA 4ECIA 4OFMA 2H70A 2GQMA 3FR3A 4IQAA 2HRFA 2RM6A 5G31A 4DSRA 3IOSA 2RUEA 3EYTA 4K8MA 1V40A 3US3A 2BJXA 4HZ4A 2XPDA 2YWMA 2FCHA 1A8LA 1YKAA 5JWQB 5AIVA 4BVYA 3VWVA 1XOBA 2FWFA 2LRCA 1B9YC 2MMNA 5EL8A 4KDYA 2JSZA 4PXOA 4OCEA 1SJZA 5A4VA 5CO3A 5KOWA 4KDUA 2DJ0A 1NHOA 3F4RA 1PX7A 3RPPA 5GSSA 1PX6A 3EMPA 4JU5A 2XBIA 2H1AA 2O85A 1FB0A 1XFLA 2K9FA 2JZSA 4PQ1A 1ON4A 6GSUA 3L78A 3UVHA 1VF3A 3L9SA 2C1YA 3EC3A 4I6XA 1ML6A 1FOHA 1A23A 4OO5A 3ERWA 4TR4A 2LRTA 4MZBA 4PTSA 2PU9C 4MF6A 4OFNA 3CQFA 3WYWA 4V2LA 1M2AA 4CY6A 4DSQA 2C0FA 5F07A 1AW9A 3GHAA 1YZXA 2LEGA 2R0GA 1PN0A 4ZBBA 1FO5A 3NOFA 3D0ZA 5KEJA 2AYTA 2TIRA 4K2DA 4K7IA 3OR5A 3RDWA 3DGQA 5J9CA 1GH2A 3KP8A 4TVEA 5CRGA 1FG4A 1EP8A 4NWYA 1G0TA 3QDNA 2WGRA 3HZ4A 2H0HA 4LL1B 4Q5QA 1NM3A 2IL3A 1A2JA 4ZL8A 1K0CA 3F3QA 2VD0A 3H1NA 4I5QA 3CSHA 3EU3A 2JSYA 1EEMA 3LW9A 2DIYA 4IQ1A 4Q5FA 3GV1A 3J7Yk 5F0GA 2I1UA 5H5QA 2G0FA 4O5UA 4L0WA 3O76A 3UJ1A 2E7PA 4G0IA 3IHGA 4IHUA 1PFOA 4XS4A 2IMKA 1X9WB 3RHBA 1B8XA 3PR8A 2OA7A 1SK0A 3IE3A 3CMIA 4ACSA 3GA4A 4XRDA 1AQWA 5FT3A 3ZVJD 2F8FA 2VO4A 2ALBA 4O92A 2FD3A 2GZZA 3HD5A 3IC4A 4EO3A 3ZVJA 1YDKA 3L9UA 2VLVA 2E2MA 1XPVA 5AIXA 2I4AA 4J2FA 3D21A 2R37A 1EEJA 4OCFA 4G9HA 4K7NA 1V98A 4L0UA 1R4WA 1SENA 1R5PA 4ZIJA 6GSTA 3I43A 5E4WA 3TKSE 1XXUA 1YJ6A 3FMWA 2EIQA 2HE3A 2R3XA 11GSA 1RW1A 5CRDA 1XWGA 5BRTA 3W8JA 4ISDA 2GSSA 3HVXA 4EC0A 4F2IA 4AJ8A 5DJMA 1MD4A 2FA4A 2GT6A 4YH2A 2R5GA 2XC2A 2FWGA 2L6DA 2H01A 1FVKA 1UVZA 2VM2A 4IGJA 3APQA 2CVBA 1PA3A 5J9BA 1EWXA 4CW9A 1DE1A 2MBTA 3GL3A 2ON5A 4WR5A 3L9VA 4FO5A 2MMOA 1J0FA 1M9BA 4JBBA 1M2DA 1ERWA 1B4QA 4KUNA 3M9JA 3GURA 2P0GA 5GSTA 5G2ZA 1ZCPA 5L71A 5D9XA 5HFGA 2JADA 2V32A 3KP9A 2H6ZA 3CYNA 2YJHA 1T8EB 3MSZA 1ZYPA 1SL1B 5B7CA 1FHEA 3K8NA 1MDIA 2MBSA 3FK8A 4KDXA 4WF5A 1YF1A 1Q98A 2VLUA 5LD0A 3IPZA 3DVWA 1XWCA 2DMLA 3UAPA 5ID2A 2FWEA 5IOXA 4MJAA 2X4AA 1AIUA 2YP6A 2OKAA 3DXBA 3IC8A 4JEDA 1K0BA 4V1Ag 1TK5B 2LRNA 5IIZA 2MYGA 3ZIVA 3GRXA 3M1GA 1PMTA 2RLIA 1R7HA 5G1LA 5F05A 2RM5A 4QL7A 1SYXA 4ZBDA 2LKUA 4XS6A 4GQCA 1PL1A 4YAPA 2VL2C 5F06A 1B4PA 4XRAA 4KB3A 1XW5A 2GT5A 4MLYA 1I5GA 2V6OA 2AJQB 5J5NA 3GSSA 4AF2A 4XTSA 3D4TA 4DSSB 3ISOA 1ZL9A 5ECRB 2VL2A 1BJXA 2DKIA 1GSUA 2DJ2A 4BA7A 4BL7A 2M80A 3F0IA 1QMVA 1GP1A 1J08A 3VFIA 1QK8A 1EP7A 5EPFA 2R0CA 2KP2A 1PSQA 5B6NA 3P90A 4KCAA 2H71A 3KTLA 5IMDA 1KNGA 4YQMA 5ECLB 2X49A 3I6AA 5DVBA 2H1GA 2HNLA 2WJUA 2VOCA 3TJKA 3I9V2 4PURA 2WULA 4TR1A 1SL0B 1BEDA 2HRKA 1VF4A 3ZL5A 2B7KA 3ZMKA 5KN3A 5E59A 3DD3A 16GSA 2AB6A 5IOWA 1TU7A 2KUCA 4OO4A 14GSA 2PN8A 3A2WA 3L4NA 1M3JA 5G5FA 3ZZXA 2A2PA 2B3SA 5ECIB 2OJLA 1K3OA 3LYPA 1USBA 2WB9A 4ICYA 3UMAA 1OE8A 1M3IA 4D73A 3IDVA 2OBIA 4O5RA 4IVFA 3TJGA 3QR6A 2K8SA 3GUSA 3F3RA 3FR9A 1HYUA 2HRNA 2HI7A 4IN0A 4ZB6A 1YKCA 1S3RA 5HR1A 2WFCA 1JFUA 1JLVA 5CAXA 3C1SA 4P3YB 3FY7A 4GRFA 2ZUPA 1EV4A 2L4QA 2H72A 2GZPA 3I69A 2IFQB 1XCCA 1EGRA 1X9MB 3GH6A 4WKWA 3H93A 1Z6MA 2VLTA 3GSTA 1UC7A 1PKZA 4ECBA 4LA1A 2H75A 1NHYA 3NZNA 3EURA 1EOHA 3D6IA 4QL9A 1PGTA 1E2YA 1TI3A 3HY2A 4IP6A 4OMVA 4WBJA 1HQOA 1ZOFA 4KA0A 3KGKA 4KW6A 5ECHB 3VPQA 3TOUA 2L6CA 1SYRA 4HS1A 1AQVA 2H30A 5AISA 5H5RA 4MH3A 2K18A 2LQOA 4O7HA 4G0LA 4PX1A 4PNGA 1PQNA 2CX4A 4AGSA 1A0RP 1TP9A 4GLTA 3WGDA 3LG6A 1XW9A 4FYCA 2OADA 4G10A 3TRXA 1WOUA 2X8HA 2IN3A 5HFKA 1TTZA 5ENUA 1XG8A 3ZITA 1Z9HA 4EVMA 4XS4B 5FHIA 1V57A 1HNAA 2IPAA 3TOTA 3LEFA 1GL8A 4POKA 5DAKA 4V2NA 5KOXA 2I81A 4ULXA 4K5RA 2H8LA 4MH2A 5EY6A 3BCIA 1SKRB 3LFLA 3JCML 2VCTA 5DQSA 3PH9A 2GDRA 1THXA 1ZZYA 3KH7A 1O8WA 4NAXA 2JL4A 4WF4A 3RAZA 3CBUA 3GH9A 1U6TA 3M3MA 2VAFA 2FHEA 4I8BA 1ABAA 4DVCA 4JRRA 2DJKA 1N2AA 1S3DA 1B48A 1MD3A 4TR3A 3S9FA 2F51A 1A0FA 3DMLA 1X5DA 1OVNA 2HRAA 4K9ZA 3A5WA 3QFBC 1TKDB 4JE1A 2F3MA 3G7JA 3VLNA 1WE0A 3A2XA 3VI7A 2V41A 2DC5A 4TXOA 2DMMA 2LS5A 3MYDA 6GSXA 4FYUA 2CZ3A 2R4VA 3CRTA 5ECPB 4BWQA 3ZMLA 3UIWA 1TXXA 2HZEA 2NPBA 3HHVA 3DYRA 1GSEA 1XIYA 1A8YA 1R5AA 3D4MA 3FKFA 5IO0A 3J7Yb 5KN1A 1AC1A 1GTBA 2GTUA 2JU5A 3KM6A 2IMIA 2ZCTA 1DBYA 3CRUA 2FWHA 1KTEA 3Q6OA 4RQRA 4G0KA 1K0OA 4TKYA 3IK7A 3QAVA 1OYJA 2QGVA 2I9HA 2O8VB 2D2ZA 1EZKA 2JZTA 1K0DA 3TUEA 1TK0B 2GQKA 3FR6A 3E0UA 2H6XA 5B6MA 4FH8A 1ERTA 1ZGNA 3G9BA 4N10A 5ID2B 4POMA 4DEJA 3QOUA 5DQYA 4XIHA 3IA1A 4HU7A 2G2QA 1XOAA 1HNBA 4IW9A 7GSSA 3GKKA 4X43A 4KNDA 2OE1A 2X99A 1TK8B 1ZYNA 2O89A 6GSSA 2AHEA 1HNCA 2L5LA 3UOMA 6GSWA 2EC4A 1EV9A 5G30A 4OWYA 2PUKC 3TJJA 3FW2A 1WPIA 2B5EA 2QC7A 3GTUA 2P5QA 2C8UA 2WS2A 3CSJA 2R0PA 3C1RA 4K0GA 2CVDA 2C3NA 1KBNA 4G19A 3EPTA 4EIQA 3SWLA 2VCZA 4EDYA 1Z7RA 2L59A 4PQHA 2YZUA 1GULA 2TRXA 2GQLA 3FZAA 1QGVA 4NHWA 2UZ8A 2B1LA 1Z6NA 1A2MA 4EKZA 4N30A 5DJLA 1Z3EA 1NW2A 5G1KA 1MTCA 4TR1B 1T7PB 2GSTA 3QCPA 2FNOA 3H4KA 3BD2A 5DCHA 4MZCA 3QAWA 4GWRA 2GGTA 4I2UA 4POLA 3UL3A 1ZYQB 3Q18A 1WIKA 4MF7A 2CZ2A 5IQYA 4F0CA 5D8IA 2NDOA 4EXJA 3TRPA 5D9VA 2CAQA 2KLXA 5HR0A 3FRCA 3WT1A 1TRSA 2QA2A 4HUAA 5AGYA 3QD9A 1OC9B 4ZBAA 4D73B 1T4ZA 3H8QA 3TKPA 2VCVA 3IK9A 4KE3A 4E8EA 2VM1A 1EOGA 1TRWA 2GSRA 1PKWA 3O3TA 5HR3A 1EGOA 4PUAA 4L5OA 4GSSA 3BOAA 4K2XA 4TOPA 3LSZA 2WDUA 2XHFA 1JZRA 3U5RE 3MIXA 4ZXGA 2L5OA 3APSA 1W4VA 3DKSA 3ZFBA 5CREA 22GSA 4FQUA 2N5BA 4Q5NA 4Z2RA 3KXOA 4CY8A 5IPHA 3KCMA 4KAEA 1SU9A 4WR4A 2LUSA 1CQHA 1TRUA 2CQ9A 4TW5A 2DJJA 4JZQA 2VD1A 4ZB9A 3FZ5A 1BQ7A 1SJ6A 5JCGA 2HLSA 2B7JA 4KCEA 4HSCX 4L5LA 4IBPA 4PQIA 3HJOA 5ELAA 2IMFA 3EE2A 2NTOA 3BCKA 4MNNA 4IJ3A 1AQXA 3V1WA 4HI7A 1Z7PA 4YKGA 1K3LA 4MCUA 4ZB8A 5J3RA 1GTAA 5ECKB 2YV7A 1GTUA 3GX8A 3QFAC 2IJYA 3KH9A 3HCZA 1JZWA 5DBQA 1SKSB 4ML6A 2C0EA 2K6VA 2LSTA 1Z5YE 3GIXA 3HZ8A 1XWKA 1WMJA 4K7OA 2LTKA 5LNKe 3DWVA 1GUMA 4TR0A 3CTFA 4BVXA 4GTUA 3KMNA 4HU9A 1U3IA 2RIIA 5DAKB 2HSMA 2YV9A 4YAVA 3TDGA 1YEPA 2GS3A 4BVYB 3F9UA 2LJRA 1GWCA 1SKWB 3GKMA 3MDKA 1RK4A 5C04A 2MZCA 1V2AA 2EIRA 4I2TA 2VUPA 3P2AA 4CHSA 2A4HA 3UVTA 2MMZA 5F8BA 3A3TA 1ACVA 2CT6A 1GSFA 1ST9A 1U88A 1MEKA 5C00A 2HSHA 2H6YA 1DE2A 1TDIA 3AY8A 5D93A 2LJAA 3TJBA 2J9HA 3BBYA 4FYBA 1J9BA 4NXIA 5DALA 2E2GA 1SJIA 1WP0A 2F9SA 1G6YA 1GNWA 4WETA 4GSNA 4TXOB 1UA5A 4RI6A 3BJ5A 2HZFA 3LQ7A 1R26A 4K6XA 5ABRA 2ZNMA 3FZ9A 1AUCA 4ML1A 3VWXA 5D9WA 3IV4A 4HEA2 3GNJA 2YCDA 4YQUA 1TI1A 5DCGA 3M0FA 3EU4A 1KEBA 2HZEB 5HR2A 4TN8A 1OKDA 5HFIA 1VRSD 5A4UA 3KZQA 2YN1A 2HFDA 1QQ2A 3TKQA 1SK2A 2FA8A 1PD21 1SL2B 3QMXA 1F9MA 5JCWA 1M9AA 4PUFC 3F63A 3P7XA 3QPMA 4E8HA 2YWNA 2V2GA 4NV5A 2HSYA 2P5RA 4BWSA 4NPBA 5GAPD 4PNFA 1QUWA 6GSYA 4GQFA 4ILFA 1WRYA 3C7MA 3F4TA 3IR4A 4X4JA 5A5KA 1ZYEA 1SD8A 3D22A 1XBSA 1MDKA 4EDZA 5IMAA 1ERUA 1AXDA 2AUVA 5FWGA 3MWHA 2PBJA 4CDOA 1URMA 1A24A 3LORA 3GFKA 19GSA 4MABA 4NV2A 1O81A 4EIPA 2C4JA 3VWWA 5H5SA 1DSBA 2BMXA 2XPEA 2PVOC 3ZIJA 2FY6A 2B5XA 4H86A 4OFTA 10GSA 2IMEA 4RUVA 2NVLA 3DEXA 4WBRD 2DSAA 5A4WA 1XZOA 2PWJA 2N5AA 3FEUA 2P31A 2C0GA 3UBKA 2AAWA 4O32A 4GSTA 3GTUB 4FIWA 1XWAA 4MF5A 4Z7XA 2FGXA 2L57A 4HDEA 4KSMA 2LJKA 5IM9A 1O6JA 3KIJA 3G7IA 3ZYWA 2O87A 3PGTA 3HKRA 1MDJA 1F2EA 2OE0A 4X0XA 2X8GA 2B1KA 3Q74A 2HYXA 4LL4B 1A2LA 1OC8A 4TXVA 5IMFA 3KEBA 5CP1A 4F82A 2PPTA 2A2RA 1GUHA 4MMMA 1BYEA 2IFQA 5JCUA 1GSYA 18GSA 2QA1A 1F37A 1JLWA 5ECNB 2CX3A 5AN1A 1THOA 2BTOT 3ZFLA 1W89A 2IWTA 2Z9SA 3M9KA 1O8XA 2QKEA 5D73A 2YPMA 1TRVA 2GZYA 2WCIA 4MJEA 5IMVA 4EL1A 2OE3A 1K3YA 3CXGA 4X1UA 3UARA 1YEXA 4HOJA 4YQVA 3L0HA 5ECQB 5JWOB 3GN3A 1GTIA 4JR4A 3ME7A 3VWUA 1F3AA 1M7TA 4ECCA 1F6MC 2XBQA 5D96A 2YWOA 1ILOA 1N8JA 3EMXA 5DDLA 2EIOA 3GMFA 3IXRA 1B9XC 4RI7A 2DJ3A 2LNTA 1BAYA 2B5YA 1XWBA 3GKNA 3GL5A 2DBCA 4XHMA 2VL9A 5CNWA 3TCOA 3DIEA 5BMUA 4TRXA 4K1FA 2M72A 4PGTA 2GVPA 5B8BA 5INYA 2YOIA 3TB2A 4MPGA 3IAS2 1FOVA 3WGXA 3E3EA 4ZL9A 3HVVA 1SD9A 1T1VA 1M2BA 2VCXA 4HZ2A 1G7OA 1K0AA 2REMA 1XVWA 4N11A 2QSIA 2ON7A 2I3YA 3ZTLA 3KTBA 4BPYA 1U87A 2YANA 5HQPA 3C73A 3CTGA 1WJKA 2DKHA 3RPNA 3FHKA 4LMWA 2PGTA 2H0IA 2YNXA 2V1MA 3HVSA 3C8EA 2R2JA 4BL7B 3A5IA 2CA8A 2WRTA 1BX9A 2H1DA 6GSVA 2TRCP 12GSA 8GSSA 1SK1A 3DVXA 3FZ4A 3ZREA 1FVJA 4A5PA 3LYKA 2YZHA 3ZRDA 4K5SA 3F6DA 3TJFA 3E9JB 3IAM2 1VGLA 1T4YA 5CRHA 4MK3A 3IHQA 4BVXB 3SBCA 1T00A 1JZDA 3LWAA 5KN2A 2R6KA 3DRNA 2C80A 2A4VA 1K0NA 3QAGA 3D5JA 5IMZA 1JHBA 3PPUA 1FAAA 2VIMA 3O6TA 1TJDA 1X5CA 5GAND 3HDCA 1GSSA 5KN0A 1G6WA 2YWIA 3ERFA 4KH7A 3W6GA 2H73A 4WXTA 3WGEA 17GSA 3WT2A 1GRXA 3GX0A 3HJPA 2VL3A 4ECJA 4K0NA 4KX4A 4NHZA 1C72A 3VURA 5ECSA 2HXKA 4IKHA 3A2VA 3C71A 3PINA 3ME8A 1GLQA 4AJ7A 4GF0A 3MAKA 3GKXA 3HJMA 3RBTA 2OBKA 1AAZA 1FB6A 3HVNA 4XCSA 5IO2A 4Z2UA 3KD0A 3P8WA 2ES7A 2IIYA 5ECMB 4AJ6A 5DALB 3EWLA 3LXTA 4YKFA 2A2SA 2AV4A 2C0DA 2V6KA 2YJ7A 2MMAA 4EF0A 1O85A 2JZRA 5B8AA 3HA9A 4GCIA 4GXZA 3N5OA 5J4UA 2KP1A
chains in the Genus database with same CATH topology
1Y25A 4J56E 1O73A 1GSQA 1ERVA 4IJIA 3W8SA 2VCWA 2IMDA 2FUG2 5JWRB 2C3QA 2DIZA 4N0VA 1JZOA 1VF2A 5D9TA 1RQMA 3VPTA 2DJ1A 3ZLPA 1E6BA 3TKRA 3N9JA 1G7EA 4KGIA 3ERGA 1U3AA 1UN2A 3UBLA 4I97A 4XS1A 1FW1A 1QFNA 1GLPA 3F4SA 1LU4A 1YF0A 2H76A 1XW6A 2PMTA 3MNGA 3R3EA 2L4CA 2H1BA 2PERA 3KJYA 2X64A 2OACA 1PN9A 2VCQA 1NSWA 1VF1A 2C3TA 1M0UA 3R2QA 3EINA 3LGCA 2F8AA 1IYIA 3APOA 2LV3A 3TGZA 1DUGA 4JR6A 1XVQA 1M99A 4MA9A 3U6VA 1QXHA 2M46A 1IYHA 1BG5A 3WD6A 2CV4A 3UEMA 1V58A 3F6FA 3Q19A 2NBSA 4ZILA 2H74A 3G7YA 4WEYA 1TU8A 4Z2TA 4IP1A 1X5EA 5CYYA 2H0GA 2H19A 3TKSC 3VK9A 1Y6EA 2LQQA 1T3BA 1GSDA 5J41A 2HT9A 1F3BA 4EUYA 1CQGA 2H66A 1WWJA 2X8CA 4MZWA 3TKSA 3GYKA 4F9ZA 5IPGA 2KOKA 3LXZA 4HQZA 5COHA 9GSSA 1OC9A 1HD2A 4ID0A 3M8NA 4F03A 4F0BA 3TRQA 4V1Ap 4MPFA 2DLXA 1O7UA 1PRXA 4O5QA 4Q5RA 5ECOB 1X0RA 1K0MA 4EE0A 5ELGA 5G5EA 1I9DA 4KSOA 4IELA 3F8UA 4HJ2A 4OD7A 3VI5A 5LCZA 3EVIA 2CVKA 1GNEA 4NMUA 2GLRA 2PVQA 4RQXA 1X9SB 1TOFA 2LNSA 4LMVA 2J23A 1Q4JA 3CSIA 3IBHA 4MJBA 4LLRA 2FLSA 5CRWA 5EVOA 4N0ZA 2O7KA 1OC3A 2CAIA 20GSA 2B6MA 2K8VA 4QQ7A 2E0QA 4V2MA 4IS0A 4J57E 3IRAA 5GZZB 3ED3A 1LJRA 13GSA 4MDCA 4USSA 1LBKA 1GUKA 1H75A 1ZMAA 1V9WA 1OKTA 2GSQA 4POBA 3RHCA 2WZ9A 4DSSA 3FYGA 1PL2A 1S3AA 3LJRA 3NIVA 4MJCA 1YQ1A 3KMOA 4L8EA 4ZL7A 1OAZA 4MP4A 2KHPA 2N5FA 4HQSA 5IMCA 3H79A 4G2EA 1YY7A 3HYPA 1S3CA 2RUFA 2JACA 3HXSA 1H4OA 4KF9A 1OE7A 1TW9A 4HJMA 4ECIA 4OFMA 2H70A 2GQMA 3FR3A 4IQAA 2HRFA 2RM6A 5G31A 4DSRA 3IOSA 2RUEA 3EYTA 4K8MA 1V40A 3US3A 2BJXA 4HZ4A 2XPDA 2YWMA 2FCHA 1A8LA 1YKAA 5JWQB 5AIVA 4BVYA 3VWVA 1XOBA 2FWFA 2LRCA 1B9YC 2MMNA 5EL8A 4KDYA 2JSZA 4PXOA 4OCEA 1SJZA 5A4VA 5CO3A 5KOWA 4KDUA 2DJ0A 1NHOA 3F4RA 1PX7A 3RPPA 5GSSA 1PX6A 3EMPA 4JU5A 2XBIA 2H1AA 2O85A 1FB0A 1XFLA 2K9FA 2JZSA 4PQ1A 1ON4A 6GSUA 3L78A 3UVHA 1VF3A 3L9SA 2C1YA 3EC3A 4I6XA 1ML6A 1FOHA 1A23A 4OO5A 3ERWA 4TR4A 2LRTA 4MZBA 4PTSA 2PU9C 4MF6A 4OFNA 3WYWA 4V2LA 1M2AA 4CY6A 4DSQA 2C0FA 5F07A 1AW9A 3GHAA 1YZXA 2LEGA 2R0GA 1PN0A 4ZBBA 1FO5A 3NOFA 3D0ZA 5KEJA 2AYTA 2TIRA 4K2DA 4K7IA 3OR5A 3RDWA 3DGQA 5J9CA 1GH2A 3KP8A 4TVEA 5CRGA 1FG4A 1EP8A 4NWYA 1G0TA 3QDNA 2WGRA 3HZ4A 2H0HA 4LL1B 4Q5QA 1NM3A 2IL3A 1A2JA 4ZL8A 1K0CA 3F3QA 2VD0A 3H1NA 4I5QA 3CSHA 3EU3A 2JSYA 1EEMA 3LW9A 2DIYA 4IQ1A 4Q5FA 3GV1A 3J7Yk 5F0GA 2I1UA 5H5QA 2G0FA 4O5UA 4L0WA 3O76A 3UJ1A 2E7PA 4G0IA 3IHGA 4IHUA 4XS4A 2IMKA 1X9WB 3RHBA 1B8XA 3PR8A 2OA7A 1SK0A 3IE3A 3CMIA 4ACSA 3GA4A 4XRDA 1AQWA 5FT3A 3ZVJD 2F8FA 2VO4A 2ALBA 4O92A 2FD3A 2GZZA 3HD5A 3IC4A 4EO3A 3ZVJA 1YDKA 3L9UA 2VLVA 2E2MA 5AIXA 1XPVA 2I4AA 4J2FA 3D21A 2R37A 1EEJA 4OCFA 4G9HA 4K7NA 1V98A 4L0UA 1R4WA 1SENA 1R5PA 4ZIJA 6GSTA 3I43A 5E4WA 3TKSE 1XXUA 1YJ6A 3FMWA 2EIQA 2HE3A 2R3XA 11GSA 1RW1A 5CRDA 1XWGA 5BRTA 3W8JA 4ISDA 2GSSA 3HVXA 4EC0A 4F2IA 4AJ8A 5DJMA 1MD4A 2FA4A 2GT6A 4YH2A 2R5GA 2XC2A 2FWGA 2L6DA 2H01A 1FVKA 1UVZA 2VM2A 4IGJA 3APQA 2CVBA 1PA3A 5J9BA 1EWXA 4CW9A 1DE1A 2MBTA 3GL3A 2ON5A 4WR5A 3L9VA 4FO5A 2MMOA 1J0FA 1M9BA 4JBBA 1M2DA 1ERWA 1B4QA 4KUNA 3M9JA 3GURA 2P0GA 5GSTA 5G2ZA 1ZCPA 5L71A 5D9XA 5HFGA 2JADA 2V32A 3KP9A 2H6ZA 3CYNA 2YJHA 1T8EB 3MSZA 1ZYPA 1SL1B 5B7CA 1FHEA 3K8NA 1MDIA 2MBSA 3FK8A 4KDXA 4WF5A 1YF1A 1Q98A 2VLUA 5LD0A 3IPZA 3DVWA 1XWCA 2DMLA 3UAPA 5ID2A 2FWEA 5IOXA 4MJAA 2X4AA 1AIUA 2YP6A 2OKAA 3DXBA 3IC8A 4JEDA 1K0BA 4V1Ag 1TK5B 2LRNA 5IIZA 2MYGA 3ZIVA 3GRXA 3M1GA 1PMTA 2RLIA 1R7HA 5G1LA 5F05A 2RM5A 4QL7A 1SYXA 4ZBDA 2LKUA 4XS6A 4GQCA 1PL1A 4YAPA 2VL2C 5F06A 1B4PA 4XRAA 4KB3A 1XW5A 2GT5A 4MLYA 1I5GA 2V6OA 2AJQB 5J5NA 3GSSA 4AF2A 4XTSA 3D4TA 4DSSB 3ISOA 1ZL9A 5ECRB 2VL2A 1BJXA 2DKIA 1GSUA 2DJ2A 4BA7A 4BL7A 2M80A 3F0IA 1QMVA 1GP1A 1J08A 3VFIA 1QK8A 1EP7A 5EPFA 2R0CA 2KP2A 1PSQA 5B6NA 3P90A 4KCAA 2H71A 3KTLA 5IMDA 1KNGA 4YQMA 5ECLB 2X49A 3I6AA 5DVBA 2H1GA 2HNLA 2WJUA 2VOCA 3TJKA 3I9V2 4PURA 2WULA 4TR1A 1SL0B 1BEDA 2HRKA 1VF4A 3ZL5A 2B7KA 3ZMKA 5KN3A 5E59A 3DD3A 16GSA 2AB6A 5IOWA 1TU7A 2KUCA 4OO4A 14GSA 2PN8A 3A2WA 3L4NA 5G5FA 3ZZXA 2A2PA 2B3SA 5ECIB 2OJLA 1K3OA 3LYPA 1USBA 2WB9A 4ICYA 3UMAA 1OE8A 4D73A 3IDVA 2OBIA 4O5RA 4IVFA 3TJGA 3QR6A 2K8SA 3GUSA 3F3RA 3FR9A 1HYUA 2HRNA 2HI7A 4IN0A 4ZB6A 1YKCA 5HR1A 2WFCA 1JFUA 1JLVA 5CAXA 3C1SA 4P3YB 3FY7A 4GRFA 2ZUPA 1EV4A 2L4QA 2H72A 2GZPA 3I69A 2IFQB 1XCCA 1EGRA 1X9MB 3GH6A 4WKWA 3H93A 1Z6MA 2VLTA 3GSTA 1UC7A 1PKZA 4ECBA 4LA1A 2H75A 1NHYA 3NZNA 3EURA 1EOHA 3D6IA 4QL9A 1PGTA 1E2YA 1TI3A 3HY2A 4IP6A 4OMVA 4WBJA 1HQOA 1ZOFA 4KA0A 3KGKA 4KW6A 5ECHB 3VPQA 3TOUA 2L6CA 1SYRA 4HS1A 1AQVA 2H30A 5AISA 5H5RA 4MH3A 2K18A 2LQOA 4O7HA 4G0LA 4PX1A 4PNGA 1PQNA 2CX4A 4AGSA 1A0RP 1TP9A 4GLTA 3WGDA 3LG6A 1XW9A 4FYCA 2OADA 4G10A 3TRXA 1WOUA 2X8HA 2IN3A 5HFKA 1TTZA 5ENUA 3ZITA 1Z9HA 4EVMA 4XS4B 5FHIA 1V57A 1HNAA 2IPAA 3TOTA 3LEFA 1GL8A 4POKA 5DAKA 4V2NA 5KOXA 2I81A 4ULXA 4K5RA 2H8LA 4MH2A 5EY6A 3BCIA 1SKRB 3LFLA 3JCML 2VCTA 5DQSA 3PH9A 2GDRA 1THXA 1ZZYA 3KH7A 1O8WA 4NAXA 2JL4A 4WF4A 3RAZA 3CBUA 3GH9A 1U6TA 3M3MA 2VAFA 2FHEA 4I8BA 1ABAA 4DVCA 4JRRA 2DJKA 1N2AA 1S3DA 1B48A 1MD3A 4TR3A 3S9FA 2F51A 1A0FA 3DMLA 1X5DA 1OVNA 2HRAA 4K9ZA 3A5WA 3QFBC 1TKDB 4JE1A 2F3MA 3G7JA 3VLNA 1WE0A 3A2XA 3VI7A 2V41A 2DC5A 4TXOA 2DMMA 2LS5A 3MYDA 6GSXA 4FYUA 2CZ3A 2R4VA 3CRTA 5ECPB 4BWQA 3ZMLA 3UIWA 1TXXA 2HZEA 2NPBA 3HHVA 3DYRA 1GSEA 1XIYA 1A8YA 1R5AA 3D4MA 3FKFA 5IO0A 3J7Yb 5KN1A 1AC1A 1GTBA 2GTUA 2JU5A 3KM6A 2IMIA 2ZCTA 1DBYA 3CRUA 2FWHA 1KTEA 3Q6OA 4RQRA 4G0KA 1K0OA 4TKYA 3IK7A 3QAVA 1OYJA 2QGVA 2I9HA 2O8VB 2D2ZA 1EZKA 2JZTA 1K0DA 3TUEA 1TK0B 2GQKA 3FR6A 3E0UA 2H6XA 5B6MA 4FH8A 1ERTA 1ZGNA 3G9BA 4N10A 5ID2B 4POMA 4DEJA 3QOUA 5DQYA 4XIHA 3IA1A 4HU7A 2G2QA 1XOAA 1HNBA 4IW9A 7GSSA 3GKKA 4X43A 4KNDA 2OE1A 2X99A 1TK8B 1ZYNA 2O89A 6GSSA 2AHEA 1HNCA 2L5LA 3UOMA 6GSWA 2EC4A 1EV9A 5G30A 4OWYA 2PUKC 3TJJA 3FW2A 1WPIA 2B5EA 2QC7A 3GTUA 2P5QA 2C8UA 2WS2A 3CSJA 2R0PA 3C1RA 4K0GA 2CVDA 2C3NA 1KBNA 4G19A 3EPTA 4EIQA 3SWLA 2VCZA 4EDYA 1Z7RA 2L59A 4PQHA 2YZUA 1GULA 2TRXA 2GQLA 3FZAA 1QGVA 4NHWA 2UZ8A 2B1LA 1Z6NA 1A2MA 4EKZA 4N30A 5DJLA 1Z3EA 1NW2A 5G1KA 1MTCA 4TR1B 1T7PB 2GSTA 3QCPA 2FNOA 3H4KA 3BD2A 5DCHA 4MZCA 3QAWA 4GWRA 2GGTA 4I2UA 4POLA 3UL3A 1ZYQB 3Q18A 1WIKA 4MF7A 2CZ2A 5IQYA 4F0CA 5D8IA 2NDOA 4EXJA 3TRPA 5D9VA 2CAQA 2KLXA 5HR0A 3FRCA 3WT1A 1TRSA 2QA2A 4HUAA 5AGYA 3QD9A 1OC9B 4ZBAA 4D73B 1T4ZA 3H8QA 3TKPA 2VCVA 3IK9A 4KE3A 4E8EA 2VM1A 1EOGA 1TRWA 2GSRA 1PKWA 3O3TA 5HR3A 1EGOA 4PUAA 4L5OA 4GSSA 3BOAA 4K2XA 4TOPA 3LSZA 2WDUA 2XHFA 1JZRA 3U5RE 3MIXA 4ZXGA 2L5OA 3APSA 1W4VA 3DKSA 3ZFBA 5CREA 22GSA 4FQUA 2N5BA 4Q5NA 4Z2RA 3KXOA 4CY8A 5IPHA 3KCMA 4KAEA 1SU9A 4WR4A 2LUSA 1CQHA 1TRUA 2CQ9A 4TW5A 2DJJA 4JZQA 2VD1A 4ZB9A 3FZ5A 1BQ7A 1SJ6A 5JCGA 2HLSA 2B7JA 4KCEA 4L5LA 4IBPA 4PQIA 3HJOA 5ELAA 2IMFA 3EE2A 2NTOA 3BCKA 4MNNA 4IJ3A 1AQXA 3V1WA 4HI7A 1Z7PA 4YKGA 1K3LA 4MCUA 4ZB8A 5J3RA 1GTAA 5ECKB 2YV7A 1GTUA 3GX8A 3QFAC 2IJYA 3KH9A 3HCZA 1JZWA 5DBQA 1SKSB 4ML6A 2C0EA 2K6VA 2LSTA 1Z5YE 3GIXA 3HZ8A 1XWKA 1WMJA 4K7OA 2LTKA 5LNKe 3DWVA 1GUMA 4TR0A 3CTFA 4BVXA 4GTUA 3KMNA 4HU9A 1U3IA 2RIIA 5DAKB 2HSMA 2YV9A 4YAVA 3TDGA 1YEPA 2GS3A 4BVYB 3F9UA 2LJRA 1GWCA 1SKWB 3GKMA 3MDKA 1RK4A 5C04A 2MZCA 1V2AA 2EIRA 4I2TA 2VUPA 3P2AA 4CHSA 2A4HA 3UVTA 2MMZA 5F8BA 3A3TA 1ACVA 2CT6A 1GSFA 1ST9A 1U88A 1MEKA 5C00A 2HSHA 2H6YA 1DE2A 1TDIA 3AY8A 5D93A 2LJAA 3TJBA 2J9HA 3BBYA 4FYBA 1J9BA 4NXIA 5DALA 2E2GA 1SJIA 1WP0A 2F9SA 1G6YA 1GNWA 4WETA 4GSNA 4TXOB 1UA5A 4RI6A 3BJ5A 2HZFA 3LQ7A 1R26A 4K6XA 5ABRA 2ZNMA 3FZ9A 1AUCA 4ML1A 3VWXA 5D9WA 3IV4A 4HEA2 3GNJA 2YCDA 4YQUA 1TI1A 5DCGA 3M0FA 3EU4A 1KEBA 2HZEB 5HR2A 4TN8A 1OKDA 5HFIA 1VRSD 5A4UA 3KZQA 2YN1A 2HFDA 1QQ2A 3TKQA 1SK2A 2FA8A 1PD21 1SL2B 3QMXA 1F9MA 5JCWA 1M9AA 4PUFC 3F63A 3P7XA 3QPMA 4E8HA 2YWNA 2V2GA 4NV5A 2HSYA 2P5RA 4BWSA 4NPBA 5GAPD 4PNFA 1QUWA 6GSYA 4GQFA 4ILFA 1WRYA 3C7MA 3F4TA 3IR4A 4X4JA 5A5KA 1ZYEA 1SD8A 3D22A 1XBSA 1MDKA 4EDZA 5IMAA 1ERUA 1AXDA 2AUVA 5FWGA 3MWHA 2PBJA 4CDOA 1URMA 1A24A 3LORA 3GFKA 19GSA 4MABA 4NV2A 1O81A 4EIPA 2C4JA 3VWWA 5H5SA 1DSBA 2BMXA 2XPEA 2PVOC 3ZIJA 2FY6A 2B5XA 4H86A 4OFTA 10GSA 2IMEA 4RUVA 2NVLA 3DEXA 4WBRD 2DSAA 5A4WA 1XZOA 2PWJA 2N5AA 3FEUA 2P31A 2C0GA 3UBKA 2AAWA 4O32A 4GSTA 3GTUB 4FIWA 1XWAA 4MF5A 4Z7XA 2FGXA 2L57A 4HDEA 4KSMA 2LJKA 5IM9A 1O6JA 3KIJA 3G7IA 3ZYWA 2O87A 3PGTA 3HKRA 1MDJA 1F2EA 2OE0A 4X0XA 2X8GA 2B1KA 3Q74A 2HYXA 4LL4B 1A2LA 1OC8A 4TXVA 5IMFA 3KEBA 5CP1A 4F82A 2PPTA 2A2RA 1GUHA 4MMMA 1BYEA 2IFQA 5JCUA 1GSYA 18GSA 2QA1A 1F37A 1JLWA 5ECNB 2CX3A 5AN1A 1THOA 2BTOT 3ZFLA 1W89A 2IWTA 2Z9SA 3M9KA 1O8XA 2QKEA 5D73A 2YPMA 1TRVA 2GZYA 2WCIA 4MJEA 5IMVA 4EL1A 2OE3A 1K3YA 3CXGA 4X1UA 3UARA 1YEXA 4HOJA 4YQVA 3L0HA 5ECQB 5JWOB 3GN3A 1GTIA 4JR4A 3ME7A 3VWUA 1F3AA 1M7TA 4ECCA 1F6MC 2XBQA 5D96A 2YWOA 1ILOA 1N8JA 3EMXA 5DDLA 2EIOA 3GMFA 3IXRA 1B9XC 4RI7A 2DJ3A 2LNTA 1BAYA 2B5YA 1XWBA 3GKNA 3GL5A 2DBCA 4XHMA 2VL9A 5CNWA 3TCOA 3DIEA 5BMUA 4TRXA 4K1FA 2M72A 4PGTA 2GVPA 5B8BA 5INYA 2YOIA 3TB2A 4MPGA 3IAS2 1FOVA 3WGXA 3E3EA 4ZL9A 3HVVA 1SD9A 1T1VA 1M2BA 2VCXA 4HZ2A 1G7OA 1K0AA 2REMA 1XVWA 4N11A 2QSIA 2ON7A 2I3YA 3ZTLA 3KTBA 4BPYA 1U87A 2YANA 5HQPA 3C73A 3CTGA 1WJKA 2DKHA 3RPNA 3FHKA 4LMWA 2PGTA 2H0IA 2YNXA 2V1MA 3HVSA 3C8EA 2R2JA 4BL7B 3A5IA 2CA8A 2WRTA 1BX9A 2H1DA 6GSVA 2TRCP 12GSA 8GSSA 1SK1A 3DVXA 3FZ4A 3ZREA 1FVJA 4A5PA 3LYKA 2YZHA 3ZRDA 4K5SA 3F6DA 3TJFA 3E9JB 3IAM2 1VGLA 1T4YA 5CRHA 4MK3A 3IHQA 4BVXB 3SBCA 1T00A 1JZDA 3LWAA 5KN2A 2R6KA 3DRNA 2C80A 2A4VA 1K0NA 3QAGA 3D5JA 5IMZA 1JHBA 3PPUA 1FAAA 2VIMA 3O6TA 1TJDA 1X5CA 5GAND 3HDCA 1GSSA 5KN0A 1G6WA 2YWIA 3ERFA 4KH7A 3W6GA 2H73A 4WXTA 3WGEA 17GSA 3WT2A 1GRXA 3GX0A 3HJPA 2VL3A 4ECJA 4K0NA 4KX4A 4NHZA 1C72A 3VURA 5ECSA 2HXKA 4IKHA 3A2VA 3C71A 3PINA 3ME8A 1GLQA 4AJ7A 4GF0A 3MAKA 3GKXA 3HJMA 3RBTA 2OBKA 1AAZA 1FB6A 4XCSA 5IO2A 4Z2UA 3KD0A 3P8WA 2ES7A 2IIYA 5ECMB 4AJ6A 5DALB 3EWLA 3LXTA 4YKFA 2A2SA 2AV4A 2C0DA 2V6KA 2YJ7A 2MMAA 4EF0A 1O85A 2JZRA 5B8AA 3HA9A 4GCIA 4GXZA 3N5OA 5J4UA 2KP1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y25 A;  4J56 E;  1O73 A;  1GSQ A;  1ERV A;  4IJI A;  3W8S A;  2VCW A;  2IMD A;  2FUG 2;  5JWR B;  2C3Q A;  2DIZ A;  4N0V A;  1JZO A;  1VF2 A;  5D9T A;  1RQM A;  3VPT A;  2DJ1 A;  3ZLP A;  1E6B A;  3TKR A;  3N9J A;  1G7E A;  4KGI A;  3ERG A;  1U3A A;  1UN2 A;  3UBL A;  4I97 A;  4XS1 A;  1FW1 A;  1QFN A;  1GLP A;  3F4S A;  1LU4 A;  1YF0 A;  2H76 A;  1XW6 A;  2PMT A;  3MNG A;  2L4C A;  2H1B A;  2PER A;  3KJY A;  2X64 A;  2OAC A;  1PN9 A;  2VCQ A;  1NSW A;  1VF1 A;  2C3T A;  1M0U A;  3R2Q A;  3EIN A;  3LGC A;  2F8A A;  1IYI A;  3APO A;  2LV3 A;  3TGZ A;  1DUG A;  4JR6 A;  1XVQ A;  1M99 A;  4MA9 A;  3U6V A;  1QXH A;  2M46 A;  1IYH A;  1BG5 A;  3WD6 A;  2CV4 A;  3UEM A;  1V58 A;  3F6F A;  3Q19 A;  2NBS A;  4ZIL A;  2H74 A;  3G7Y A;  4WEY A;  1TU8 A;  4IP1 A;  1X5E A;  5CYY A;  2H0G A;  2H19 A;  3TKS C;  3VK9 A;  1Y6E A;  2LQQ A;  1T3B A;  1GSD A;  5J41 A;  2HT9 A;  1F3B A;  4EUY A;  1CQG A;  2H66 A;  1WWJ A;  2X8C A;  4MZW A;  3TKS A;  3GYK A;  4F9Z A;  5IPG A;  2KOK A;  3LXZ A;  4HQZ A;  5COH A;  9GSS A;  1OC9 A;  1HD2 A;  4ID0 A;  3M8N A;  4F03 A;  4F0B A;  3TRQ A;  4V1A p;  4MPF A;  2DLX A;  1O7U A;  1PRX A;  4Q5R A;  5ECO B;  1X0R A;  1K0M A;  4EE0 A;  5ELG A;  5G5E A;  1I9D A;  4KSO A;  4IEL A;  3F8U A;  4HJ2 A;  4OD7 A;  3VI5 A;  5LCZ A;  3EVI A;  2CVK A;  1GNE A;  4NMU A;  2GLR A;  2PVQ A;  4RQX A;  1X9S B;  1TOF A;  2LNS A;  4LMV A;  2J23 A;  1Q4J A;  3CSI A;  3IBH A;  4MJB A;  4LLR A;  2FLS A;  5CRW A;  5EVO A;  4N0Z A;  2O7K A;  1OC3 A;  2CAI A;  20GS A;  2B6M A;  2K8V A;  4QQ7 A;  2E0Q A;  4V2M A;  4IS0 A;  4J57 E;  3IRA A;  5GZZ B;  3ED3 A;  1LJR A;  13GS A;  4MDC A;  1LBK A;  1GUK A;  1H75 A;  1ZMA A;  1V9W A;  1OKT A;  2GSQ A;  4POB A;  3RHC A;  2WZ9 A;  4DSS A;  3FYG A;  1PL2 A;  1S3A A;  3LJR A;  3NIV A;  4MJC A;  1YQ1 A;  3KMO A;  4L8E A;  4ZL7 A;  1OAZ A;  4MP4 A;  2KHP A;  2N5F A;  4HQS A;  5IMC A;  3H79 A;  4G2E A;  1YY7 A;  3HYP A;  1S3C A;  2RUF A;  2JAC A;  3HXS A;  1H4O A;  1OE7 A;  1TW9 A;  4HJM A;  4ECI A;  4OFM A;  2H70 A;  2GQM A;  3FR3 A;  4IQA A;  2HRF A;  2RM6 A;  5G31 A;  4DSR A;  3IOS A;  2RUE A;  3EYT A;  4K8M A;  1V40 A;  3US3 A;  2BJX A;  4HZ4 A;  2XPD A;  2YWM A;  2FCH A;  1A8L A;  1YKA A;  5JWQ B;  5AIV A;  4BVY A;  3VWV A;  1XOB A;  2FWF A;  2LRC A;  1B9Y C;  2MMN A;  5EL8 A;  4KDY A;  2JSZ A;  4PXO A;  4OCE A;  1SJZ A;  5A4V A;  5CO3 A;  4KDU A;  2DJ0 A;  1NHO A;  3F4R A;  1PX7 A;  3RPP A;  5GSS A;  1PX6 A;  3EMP A;  4JU5 A;  2XBI A;  2H1A A;  2O85 A;  1FB0 A;  1XFL A;  2K9F A;  2JZS A;  4PQ1 A;  1ON4 A;  6GSU A;  3L78 A;  3UVH A;  1VF3 A;  3L9S A;  2C1Y A;  3EC3 A;  4I6X A;  1ML6 A;  1A23 A;  4OO5 A;  3ERW A;  4TR4 A;  2LRT A;  4MZB A;  2PU9 C;  4MF6 A;  4OFN A;  3WYW A;  4V2L A;  1M2A A;  4DSQ A;  2C0F A;  5F07 A;  1AW9 A;  3GHA A;  1YZX A;  2LEG A;  4ZBB A;  1FO5 A;  3NOF A;  3D0Z A;  5KEJ A;  2AYT A;  2TIR A;  4K2D A;  4K7I A;  3OR5 A;  3RDW A;  3DGQ A;  5J9C A;  1GH2 A;  3KP8 A;  4TVE A;  5CRG A;  1FG4 A;  1EP8 A;  4NWY A;  1G0T A;  3QDN A;  2WGR A;  3HZ4 A;  2H0H A;  4LL1 B;  4Q5Q A;  1NM3 A;  2IL3 A;  1A2J A;  4ZL8 A;  1K0C A;  3F3Q A;  2VD0 A;  3H1N A;  4I5Q A;  3CSH A;  3EU3 A;  2JSY A;  1EEM A;  2DIY A;  4IQ1 A;  4Q5F A;  3GV1 A;  3J7Y k;  5F0G A;  2I1U A;  5H5Q A;  2G0F A;  4L0W A;  3O76 A;  3UJ1 A;  2E7P A;  4IHU A;  4XS4 A;  2IMK A;  1X9W B;  3RHB A;  1B8X A;  3PR8 A;  2OA7 A;  1SK0 A;  3IE3 A;  3CMI A;  4ACS A;  3GA4 A;  4XRD A;  1AQW A;  5FT3 A;  3ZVJ D;  2F8F A;  2VO4 A;  2ALB A;  4O92 A;  2FD3 A;  2GZZ A;  3HD5 A;  3IC4 A;  4EO3 A;  3ZVJ A;  1YDK A;  3L9U A;  2VLV A;  2E2M A;  5AIX A;  1XPV A;  2I4A A;  4J2F A;  3D21 A;  2R37 A;  1EEJ A;  4OCF A;  4G9H A;  4K7N A;  1V98 A;  4L0U A;  1R4W A;  1SEN A;  1R5P A;  4ZIJ A;  6GST A;  3I43 A;  5E4W A;  3TKS E;  1XXU A;  1YJ6 A;  2EIQ A;  2HE3 A;  2R3X A;  11GS A;  1RW1 A;  5CRD A;  1XWG A;  3W8J A;  4ISD A;  2GSS A;  3HVX A;  4EC0 A;  4F2I A;  4AJ8 A;  5DJM A;  1MD4 A;  2FA4 A;  2GT6 A;  4YH2 A;  2R5G A;  2XC2 A;  2FWG A;  2L6D A;  2H01 A;  1FVK A;  1UVZ A;  2VM2 A;  4IGJ A;  3APQ A;  2CVB A;  1PA3 A;  5J9B A;  1EWX A;  4CW9 A;  1DE1 A;  2MBT A;  3GL3 A;  2ON5 A;  4WR5 A;  3L9V A;  4FO5 A;  2MMO A;  1J0F A;  1M9B A;  4JBB A;  1M2D A;  1ERW A;  1B4Q A;  4KUN A;  3M9J A;  3GUR A;  2P0G A;  5GST A;  5G2Z A;  1ZCP A;  5L71 A;  5D9X A;  5HFG A;  2JAD A;  2V32 A;  3KP9 A;  2H6Z A;  3CYN A;  2YJH A;  1T8E B;  3MSZ A;  1SL1 B;  5B7C A;  1FHE A;  3K8N A;  1MDI A;  2MBS A;  3FK8 A;  4KDX A;  4WF5 A;  1YF1 A;  1Q98 A;  2VLU A;  5LD0 A;  3IPZ A;  3DVW A;  1XWC A;  2DML A;  3UAP A;  5ID2 A;  2FWE A;  5IOX A;  4MJA A;  1AIU A;  2YP6 A;  2OKA A;  3DXB A;  4JED A;  1K0B A;  4V1A g;  1TK5 B;  2LRN A;  5IIZ A;  2MYG A;  3ZIV A;  3GRX A;  3M1G A;  1PMT A;  2RLI A;  1R7H A;  5G1L A;  5F05 A;  2RM5 A;  4QL7 A;  1SYX A;  4ZBD A;  2LKU A;  4XS6 A;  4GQC A;  1PL1 A;  4YAP A;  2VL2 C;  5F06 A;  1B4P A;  4XRA A;  4KB3 A;  1XW5 A;  2GT5 A;  4MLY A;  1I5G A;  2V6O A;  2AJQ B;  5J5N A;  3GSS A;  4AF2 A;  4XTS A;  3D4T A;  4DSS B;  3ISO A;  1ZL9 A;  5ECR B;  2VL2 A;  1BJX A;  1GSU A;  2DJ2 A;  4BA7 A;  4BL7 A;  2M80 A;  3F0I A;  1QMV A;  1GP1 A;  1J08 A;  3VFI A;  1QK8 A;  1EP7 A;  5EPF A;  2KP2 A;  1PSQ A;  5B6N A;  3P90 A;  4KCA A;  2H71 A;  3KTL A;  5IMD A;  1KNG A;  4YQM A;  5ECL B;  3I6A A;  5DVB A;  2H1G A;  2HNL A;  2WJU A;  2VOC A;  3TJK A;  3I9V 2;  4PUR A;  2WUL A;  4TR1 A;  1SL0 B;  1BED A;  1VF4 A;  3ZL5 A;  2B7K A;  3ZMK A;  5KN3 A;  5E59 A;  3DD3 A;  16GS A;  2AB6 A;  5IOW A;  1TU7 A;  2KUC A;  4OO4 A;  14GS A;  2PN8 A;  3A2W A;  3L4N A;  5G5F A;  3ZZX A;  2B3S A;  5ECI B;  2OJL A;  1K3O A;  3LYP A;  1USB A;  2WB9 A;  3UMA A;  1OE8 A;  4D73 A;  3IDV A;  2OBI A;  4O5R A;  4IVF A;  3TJG A;  3QR6 A;  2K8S A;  3GUS A;  3F3R A;  3FR9 A;  1HYU A;  2HRN A;  2HI7 A;  4IN0 A;  4ZB6 A;  1YKC A;  5HR1 A;  2WFC A;  1JFU A;  1JLV A;  5CAX A;  3C1S A;  4P3Y B;  3FY7 A;  4GRF A;  2ZUP A;  1EV4 A;  2L4Q A;  2H72 A;  2GZP A;  3I69 A;  2IFQ B;  1XCC A;  1EGR A;  1X9M B;  3GH6 A;  4WKW A;  3H93 A;  1Z6M A;  2VLT A;  3GST A;  1UC7 A;  1PKZ A;  4ECB A;  4LA1 A;  2H75 A;  1NHY A;  3NZN A;  3EUR A;  1EOH A;  3D6I A;  4QL9 A;  1PGT A;  1E2Y A;  1TI3 A;  3HY2 A;  4IP6 A;  4OMV A;  4WBJ A;  1HQO A;  1ZOF A;  4KA0 A;  3KGK A;  4KW6 A;  5ECH B;  3VPQ A;  3TOU A;  2L6C A;  1SYR A;  4HS1 A;  1AQV A;  2H30 A;  5AIS A;  5H5R A;  4MH3 A;  2K18 A;  2LQO A;  4O7H A;  4PX1 A;  4PNG A;  1PQN A;  2CX4 A;  4AGS A;  1A0R P;  1TP9 A;  4GLT A;  3WGD A;  3LG6 A;  1XW9 A;  4FYC A;  2OAD A;  4G10 A;  3TRX A;  1WOU A;  2X8H A;  2IN3 A;  5HFK A;  1TTZ A;  5ENU A;  3ZIT A;  1Z9H A;  4EVM A;  4XS4 B;  5FHI A;  1V57 A;  1HNA A;  2IPA A;  3TOT A;  3LEF A;  1GL8 A;  4POK A;  5DAK A;  4V2N A;  2I81 A;  4ULX A;  2H8L A;  4MH2 A;  5EY6 A;  3BCI A;  1SKR B;  3LFL A;  3JCM L;  2VCT A;  5DQS A;  3PH9 A;  2GDR A;  1THX A;  1ZZY A;  3KH7 A;  1O8W A;  4NAX A;  2JL4 A;  4WF4 A;  3RAZ A;  3CBU A;  3GH9 A;  1U6T A;  3M3M A;  2VAF A;  2FHE A;  4I8B A;  1ABA A;  4DVC A;  4JRR A;  2DJK A;  1N2A A;  1S3D A;  1B48 A;  1MD3 A;  4TR3 A;  3S9F A;  2F51 A;  1A0F A;  3DML A;  1X5D A;  1OVN A;  4K9Z A;  3A5W A;  3QFB C;  1TKD B;  4JE1 A;  2F3M A;  3G7J A;  3VLN A;  1WE0 A;  3A2X A;  3VI7 A;  2V41 A;  2DC5 A;  4TXO A;  2DMM A;  2LS5 A;  6GSX A;  4FYU A;  2CZ3 A;  2R4V A;  3CRT A;  5ECP B;  4BWQ A;  3ZML A;  3UIW A;  1TXX A;  2HZE A;  2NPB A;  3HHV A;  3DYR A;  1GSE A;  1XIY A;  1A8Y A;  1R5A A;  3D4M A;  3FKF A;  5IO0 A;  3J7Y b;  5KN1 A;  1AC1 A;  1GTB A;  2GTU A;  2JU5 A;  3KM6 A;  2IMI A;  2ZCT A;  1DBY A;  3CRU A;  2FWH A;  1KTE A;  3Q6O A;  4RQR A;  1K0O A;  4TKY A;  3IK7 A;  3QAV A;  1OYJ A;  2QGV A;  2I9H A;  2O8V B;  2D2Z A;  1EZK A;  2JZT A;  1K0D A;  3TUE A;  1TK0 B;  2GQK A;  3FR6 A;  3E0U A;  2H6X A;  5B6M A;  4FH8 A;  1ERT A;  1ZGN A;  3G9B A;  4N10 A;  5ID2 B;  4POM A;  4DEJ A;  3QOU A;  5DQY A;  4XIH A;  3IA1 A;  4HU7 A;  2G2Q A;  1XOA A;  1HNB A;  4IW9 A;  7GSS A;  3GKK A;  4X43 A;  4KND A;  2OE1 A;  2X99 A;  1TK8 B;  2O89 A;  6GSS A;  2AHE A;  1HNC A;  2L5L A;  3UOM A;  6GSW A;  2EC4 A;  1EV9 A;  5G30 A;  4OWY A;  2PUK C;  3TJJ A;  3FW2 A;  1WPI A;  2B5E A;  2QC7 A;  3GTU A;  2P5Q A;  2C8U A;  2WS2 A;  3CSJ A;  3C1R A;  4K0G A;  2CVD A;  2C3N A;  1KBN A;  4G19 A;  3SWL A;  2VCZ A;  4EDY A;  1Z7R A;  2L59 A;  4PQH A;  2YZU A;  1GUL A;  2TRX A;  2GQL A;  3FZA A;  1QGV A;  4NHW A;  2B1L A;  1Z6N A;  1A2M A;  4EKZ A;  4N30 A;  5DJL A;  1Z3E A;  1NW2 A;  5G1K A;  1MTC A;  4TR1 B;  1T7P B;  2GST A;  3QCP A;  2FNO A;  3H4K A;  3BD2 A;  5DCH A;  4MZC A;  3QAW A;  4GWR A;  2GGT A;  4I2U A;  4POL A;  3UL3 A;  1ZYQ B;  3Q18 A;  1WIK A;  4MF7 A;  2CZ2 A;  5IQY A;  4F0C A;  5D8I A;  2NDO A;  4EXJ A;  3TRP A;  5D9V A;  2CAQ A;  2KLX A;  5HR0 A;  3FRC A;  3WT1 A;  1TRS A;  4HUA A;  5AGY A;  3QD9 A;  1OC9 B;  4ZBA A;  4D73 B;  1T4Z A;  3H8Q A;  3TKP A;  2VCV A;  3IK9 A;  4KE3 A;  4E8E A;  2VM1 A;  1EOG A;  1TRW A;  2GSR A;  1PKW A;  3O3T A;  5HR3 A;  1EGO A;  4PUA A;  4L5O A;  4GSS A;  3BOA A;  4TOP A;  3LSZ A;  2WDU A;  2XHF A;  1JZR A;  3U5R E;  4ZXG A;  2L5O A;  3APS A;  1W4V A;  3DKS A;  3ZFB A;  5CRE A;  22GS A;  2N5B A;  4Q5N A;  3KXO A;  5IPH A;  3KCM A;  4KAE A;  1SU9 A;  4WR4 A;  2LUS A;  1CQH A;  1TRU A;  2CQ9 A;  4TW5 A;  2DJJ A;  4JZQ A;  2VD1 A;  4ZB9 A;  3FZ5 A;  1BQ7 A;  1SJ6 A;  5JCG A;  2HLS A;  2B7J A;  4KCE A;  4L5L A;  4IBP A;  4PQI A;  3HJO A;  5ELA A;  2IMF A;  3EE2 A;  2NTO A;  3BCK A;  4IJ3 A;  1AQX A;  3V1W A;  4HI7 A;  1Z7P A;  1K3L A;  4MCU A;  4ZB8 A;  5J3R A;  1GTA A;  5ECK B;  2YV7 A;  1GTU A;  3GX8 A;  3QFA C;  2IJY A;  3KH9 A;  3HCZ A;  1JZW A;  5DBQ A;  1SKS B;  4ML6 A;  2C0E A;  2K6V A;  2LST A;  1Z5Y E;  3GIX A;  3HZ8 A;  1XWK A;  1WMJ A;  4K7O A;  2LTK A;  5LNK e;  3DWV A;  1GUM A;  4TR0 A;  3CTF A;  4BVX A;  4GTU A;  3KMN A;  4HU9 A;  1U3I A;  2RII A;  5DAK B;  2YV9 A;  4YAV A;  3TDG A;  1YEP A;  2GS3 A;  3F9U A;  2LJR A;  1GWC A;  1SKW B;  3GKM A;  3MDK A;  1RK4 A;  5C04 A;  2MZC A;  1V2A A;  2EIR A;  4I2T A;  2VUP A;  3P2A A;  4CHS A;  3UVT A;  2MMZ A;  5F8B A;  3A3T A;  1ACV A;  2CT6 A;  1GSF A;  1ST9 A;  1U88 A;  1MEK A;  5C00 A;  2HSH A;  2H6Y A;  1DE2 A;  1TDI A;  3AY8 A;  5D93 A;  2LJA A;  3TJB A;  2J9H A;  3BBY A;  4FYB A;  1J9B A;  4NXI A;  5DAL A;  2E2G A;  1SJI A;  1WP0 A;  2F9S A;  1G6Y A;  1GNW A;  4WET A;  4GSN A;  4TXO B;  1UA5 A;  4RI6 A;  3BJ5 A;  2HZF A;  3LQ7 A;  1R26 A;  4K6X A;  5ABR A;  2ZNM A;  3FZ9 A;  1AUC A;  4ML1 A;  3VWX A;  5D9W A;  3IV4 A;  4HEA 2;  3GNJ A;  2YCD A;  4YQU A;  1TI1 A;  5DCG A;  3M0F A;  3EU4 A;  1KEB A;  2HZE B;  5HR2 A;  4TN8 A;  1OKD A;  5HFI A;  1VRS D;  5A4U A;  3KZQ A;  2YN1 A;  2HFD A;  1QQ2 A;  3TKQ A;  1SK2 A;  2FA8 A;  1PD2 1;  1SL2 B;  3QMX A;  1F9M A;  5JCW A;  1M9A A;  4PUF C;  3F63 A;  3P7X A;  3QPM A;  4E8H A;  2YWN A;  2V2G A;  4NV5 A;  2HSY A;  2P5R A;  4BWS A;  4NPB A;  5GAP D;  4PNF A;  1QUW A;  6GSY A;  4GQF A;  4ILF A;  1WRY A;  3C7M A;  3F4T A;  3IR4 A;  5A5K A;  1ZYE A;  1SD8 A;  3D22 A;  1XBS A;  1MDK A;  4EDZ A;  5IMA A;  1ERU A;  1AXD A;  2AUV A;  5FWG A;  3MWH A;  2PBJ A;  4CDO A;  1URM A;  1A24 A;  3LOR A;  3GFK A;  19GS A;  4MAB A;  4NV2 A;  1O81 A;  2C4J A;  3VWW A;  5H5S A;  1DSB A;  2BMX A;  2XPE A;  2PVO C;  3ZIJ A;  2FY6 A;  2B5X A;  4H86 A;  4OFT A;  10GS A;  2IME A;  4RUV A;  2NVL A;  3DEX A;  4WBR D;  2DSA A;  5A4W A;  1XZO A;  2PWJ A;  2N5A A;  3FEU A;  2P31 A;  2C0G A;  3UBK A;  2AAW A;  4O32 A;  4GST A;  3GTU B;  4FIW A;  1XWA A;  4MF5 A;  4Z7X A;  2FGX A;  2L57 A;  4HDE A;  4KSM A;  2LJK A;  5IM9 A;  1O6J A;  3KIJ A;  3G7I A;  3ZYW A;  2O87 A;  3PGT A;  3HKR A;  1MDJ A;  1F2E A;  2OE0 A;  4X0X A;  2X8G A;  2B1K A;  3Q74 A;  2HYX A;  4LL4 B;  1A2L A;  1OC8 A;  4TXV A;  5IMF A;  3KEB A;  5CP1 A;  4F82 A;  2PPT A;  2A2R A;  1GUH A;  4MMM A;  1BYE A;  2IFQ A;  5JCU A;  1GSY A;  18GS A;  1F37 A;  1JLW A;  5ECN B;  2CX3 A;  5AN1 A;  1THO A;  2BTO T;  3ZFL A;  1W89 A;  2IWT A;  2Z9S A;  3M9K A;  1O8X A;  2QKE A;  5D73 A;  2YPM A;  1TRV A;  2GZY A;  2WCI A;  4MJE A;  5IMV A;  4EL1 A;  2OE3 A;  1K3Y A;  3CXG A;  4X1U A;  3UAR A;  1YEX A;  4HOJ A;  4YQV A;  3L0H A;  5ECQ B;  5JWO B;  3GN3 A;  1GTI A;  4JR4 A;  3ME7 A;  3VWU A;  1F3A A;  1M7T A;  4ECC A;  1F6M C;  2XBQ A;  5D96 A;  2YWO A;  1ILO A;  1N8J A;  3EMX A;  5DDL A;  2EIO A;  3GMF A;  3IXR A;  1B9X C;  4RI7 A;  2DJ3 A;  2LNT A;  1BAY A;  2B5Y A;  1XWB A;  3GKN A;  3GL5 A;  2DBC A;  4XHM A;  2VL9 A;  5CNW A;  3TCO A;  3DIE A;  4TRX A;  4K1F A;  2M72 A;  4PGT A;  2GVP A;  5B8B A;  5INY A;  2YOI A;  3TB2 A;  4MPG A;  3IAS 2;  1FOV A;  3WGX A;  3E3E A;  4ZL9 A;  3HVV A;  1SD9 A;  1T1V A;  1M2B A;  2VCX A;  4HZ2 A;  1G7O A;  1K0A A;  2REM A;  1XVW A;  4N11 A;  2QSI A;  2ON7 A;  2I3Y A;  3ZTL A;  3KTB A;  4BPY A;  1U87 A;  2YAN A;  5HQP A;  3C73 A;  3CTG A;  1WJK A;  3RPN A;  3FHK A;  4LMW A;  2PGT A;  2H0I A;  2YNX A;  2V1M A;  3HVS A;  3C8E A;  2R2J A;  2CA8 A;  2WRT A;  1BX9 A;  2H1D A;  6GSV A;  2TRC P;  12GS A;  8GSS A;  1SK1 A;  3DVX A;  3FZ4 A;  3ZRE A;  1FVJ A;  3LYK A;  2YZH A;  3ZRD A;  3F6D A;  3TJF A;  3E9J B;  3IAM 2;  1VGL A;  1T4Y A;  5CRH A;  4MK3 A;  3IHQ A;  3SBC A;  1T00 A;  1JZD A;  3LWA A;  5KN2 A;  2R6K A;  3DRN A;  2C80 A;  2A4V A;  1K0N A;  3QAG A;  3D5J A;  5IMZ A;  1JHB A;  1FAA A;  2VIM A;  3O6T A;  1TJD A;  1X5C A;  5GAN D;  3HDC A;  1GSS A;  5KN0 A;  1G6W A;  2YWI A;  3ERF A;  4KH7 A;  3W6G A;  2H73 A;  4WXT A;  3WGE A;  17GS A;  3WT2 A;  1GRX A;  3GX0 A;  3HJP A;  2VL3 A;  4ECJ A;  4K0N A;  4KX4 A;  4NHZ A;  1C72 A;  3VUR A;  5ECS A;  2HXK A;  4IKH A;  3A2V A;  3C71 A;  3PIN A;  3ME8 A;  1GLQ A;  4AJ7 A;  4GF0 A;  3MAK A;  3GKX A;  3HJM A;  3RBT A;  2OBK A;  1AAZ A;  1FB6 A;  4XCS A;  5IO2 A;  3KD0 A;  3P8W A;  2ES7 A;  2IIY A;  5ECM B;  4AJ6 A;  5DAL B;  3EWL A;  3LXT A;  2A2S A;  2AV4 A;  2C0D A;  2V6K A;  2YJ7 A;  2MMA A;  4EF0 A;  1O85 A;  2JZR A;  5B8A A;  3HA9 A;  4GCI A;  4GXZ A;  3N5O A;  5J4U A;  2KP1 A; 
#chains in the Genus database with same CATH topology
 1Y25 A;  4J56 E;  1O73 A;  1GSQ A;  1ERV A;  4IJI A;  3W8S A;  2VCW A;  2IMD A;  2FUG 2;  5JWR B;  2C3Q A;  2DIZ A;  4N0V A;  1JZO A;  1VF2 A;  5D9T A;  1RQM A;  3VPT A;  2DJ1 A;  3ZLP A;  1E6B A;  3TKR A;  3N9J A;  1G7E A;  4KGI A;  3ERG A;  1U3A A;  1UN2 A;  3UBL A;  4I97 A;  4XS1 A;  1FW1 A;  1QFN A;  1GLP A;  3F4S A;  1LU4 A;  1YF0 A;  2H76 A;  1XW6 A;  2PMT A;  3MNG A;  3R3E A;  2L4C A;  2H1B A;  2PER A;  3KJY A;  2X64 A;  2OAC A;  1PN9 A;  2VCQ A;  1NSW A;  1VF1 A;  2C3T A;  1M0U A;  3R2Q A;  3EIN A;  3LGC A;  2F8A A;  1IYI A;  3APO A;  2LV3 A;  3TGZ A;  1DUG A;  4JR6 A;  1XVQ A;  1M99 A;  4MA9 A;  3U6V A;  1QXH A;  2M46 A;  1IYH A;  1BG5 A;  3WD6 A;  2CV4 A;  3UEM A;  1V58 A;  3F6F A;  3Q19 A;  2NBS A;  4ZIL A;  2H74 A;  3G7Y A;  4WEY A;  1TU8 A;  4Z2T A;  4IP1 A;  1X5E A;  4BIK A;  5CYY A;  2H0G A;  2H19 A;  3TKS C;  3VK9 A;  1Y6E A;  2LQQ A;  1T3B A;  1GSD A;  5J41 A;  2HT9 A;  1F3B A;  4EUY A;  1CQG A;  2H66 A;  1WWJ A;  2X8C A;  4MZW A;  3TKS A;  3GYK A;  4F9Z A;  5IPG A;  2KOK A;  3LXZ A;  4HQZ A;  5COH A;  9GSS A;  1OC9 A;  1HD2 A;  4ID0 A;  3M8N A;  4F03 A;  4F0B A;  3TRQ A;  4V1A p;  4MPF A;  2DLX A;  1O7U A;  1PRX A;  4O5Q A;  4Q5R A;  5ECO B;  1X0R A;  1K0M A;  4EE0 A;  5ELG A;  5G5E A;  1I9D A;  4KSO A;  4IEL A;  3F8U A;  4HJ2 A;  4OD7 A;  3VI5 A;  5LCZ A;  3EVI A;  2CVK A;  1GNE A;  4NMU A;  2GLR A;  2PVQ A;  4RQX A;  1X9S B;  1TOF A;  2LNS A;  4LMV A;  2J23 A;  1Q4J A;  3CSI A;  3IBH A;  4MJB A;  4LLR A;  2FLS A;  5CRW A;  5EVO A;  4N0Z A;  2O7K A;  1OC3 A;  2CAI A;  20GS A;  2B6M A;  2K8V A;  4QQ7 A;  2E0Q A;  4V2M A;  4IS0 A;  4J57 E;  3IRA A;  5GZZ B;  3ED3 A;  1LJR A;  13GS A;  4MDC A;  4USS A;  1LBK A;  1GUK A;  1H75 A;  1ZMA A;  1V9W A;  1OKT A;  2GSQ A;  4POB A;  3RHC A;  2WZ9 A;  4DSS A;  3FYG A;  1PL2 A;  1S3A A;  3LJR A;  3NIV A;  4MJC A;  1YQ1 A;  3KMO A;  4L8E A;  4ZL7 A;  1OAZ A;  4MP4 A;  2KHP A;  2N5F A;  4HQS A;  5IMC A;  3H79 A;  4G2E A;  1YY7 A;  3HYP A;  1S3C A;  2RUF A;  2JAC A;  3HXS A;  1H4O A;  4KF9 A;  1OE7 A;  1TW9 A;  4HJM A;  4ECI A;  4OFM A;  2H70 A;  2GQM A;  3FR3 A;  4IQA A;  2HRF A;  2RM6 A;  5G31 A;  4DSR A;  3IOS A;  2RUE A;  3EYT A;  4K8M A;  1V40 A;  3US3 A;  2BJX A;  4HZ4 A;  2XPD A;  2YWM A;  2FCH A;  1A8L A;  1YKA A;  5JWQ B;  5AIV A;  4BVY A;  3VWV A;  1XOB A;  2FWF A;  2LRC A;  1B9Y C;  2MMN A;  5EL8 A;  4KDY A;  2JSZ A;  4PXO A;  4OCE A;  1SJZ A;  5A4V A;  5CO3 A;  5KOW A;  4KDU A;  2DJ0 A;  1NHO A;  3F4R A;  1PX7 A;  3RPP A;  5GSS A;  1PX6 A;  3EMP A;  4JU5 A;  2XBI A;  2H1A A;  2O85 A;  1FB0 A;  1XFL A;  2K9F A;  2JZS A;  4PQ1 A;  1ON4 A;  6GSU A;  3L78 A;  3UVH A;  1VF3 A;  3L9S A;  2C1Y A;  3EC3 A;  4I6X A;  1ML6 A;  1FOH A;  1A23 A;  4OO5 A;  3ERW A;  4TR4 A;  2LRT A;  4MZB A;  4PTS A;  2PU9 C;  4MF6 A;  4OFN A;  3CQF A;  3WYW A;  4V2L A;  1M2A A;  4CY6 A;  4DSQ A;  2C0F A;  5F07 A;  1AW9 A;  3GHA A;  1YZX A;  2LEG A;  2R0G A;  1PN0 A;  4ZBB A;  1FO5 A;  3NOF A;  3D0Z A;  5KEJ A;  2AYT A;  2TIR A;  4K2D A;  4K7I A;  3OR5 A;  3RDW A;  3DGQ A;  5J9C A;  1GH2 A;  3KP8 A;  4TVE A;  5CRG A;  1FG4 A;  1EP8 A;  4NWY A;  1G0T A;  3QDN A;  2WGR A;  3HZ4 A;  2H0H A;  4LL1 B;  4Q5Q A;  1NM3 A;  2IL3 A;  1A2J A;  4ZL8 A;  1K0C A;  3F3Q A;  2VD0 A;  3H1N A;  4I5Q A;  3CSH A;  3EU3 A;  2JSY A;  1EEM A;  3LW9 A;  2DIY A;  4IQ1 A;  4Q5F A;  3GV1 A;  3J7Y k;  5F0G A;  2I1U A;  5H5Q A;  2G0F A;  4O5U A;  4L0W A;  3O76 A;  3UJ1 A;  2E7P A;  4G0I A;  3IHG A;  4IHU A;  1PFO A;  4XS4 A;  2IMK A;  1X9W B;  3RHB A;  1B8X A;  3PR8 A;  2OA7 A;  1SK0 A;  3IE3 A;  3CMI A;  4ACS A;  3GA4 A;  4XRD A;  1AQW A;  5FT3 A;  3ZVJ D;  2F8F A;  2VO4 A;  2ALB A;  4O92 A;  2FD3 A;  2GZZ A;  3HD5 A;  3IC4 A;  4EO3 A;  3ZVJ A;  1YDK A;  3L9U A;  2VLV A;  2E2M A;  1XPV A;  5AIX A;  2I4A A;  4J2F A;  3D21 A;  2R37 A;  1EEJ A;  4OCF A;  4G9H A;  4K7N A;  1V98 A;  4L0U A;  1R4W A;  1SEN A;  1R5P A;  4ZIJ A;  6GST A;  3I43 A;  5E4W A;  3TKS E;  1XXU A;  1YJ6 A;  3FMW A;  2EIQ A;  2HE3 A;  2R3X A;  11GS A;  1RW1 A;  5CRD A;  1XWG A;  5BRT A;  3W8J A;  4ISD A;  2GSS A;  3HVX A;  4EC0 A;  4F2I A;  4AJ8 A;  5DJM A;  1MD4 A;  2FA4 A;  2GT6 A;  4YH2 A;  2R5G A;  2XC2 A;  2FWG A;  2L6D A;  2H01 A;  1FVK A;  1UVZ A;  2VM2 A;  4IGJ A;  3APQ A;  2CVB A;  1PA3 A;  5J9B A;  1EWX A;  4CW9 A;  1DE1 A;  2MBT A;  3GL3 A;  2ON5 A;  4WR5 A;  3L9V A;  4FO5 A;  2MMO A;  1J0F A;  1M9B A;  4JBB A;  1M2D A;  1ERW A;  1B4Q A;  4KUN A;  3M9J A;  3GUR A;  2P0G A;  5GST A;  5G2Z A;  1ZCP A;  5L71 A;  5D9X A;  5HFG A;  2JAD A;  2V32 A;  3KP9 A;  2H6Z A;  3CYN A;  2YJH A;  1T8E B;  3MSZ A;  1ZYP A;  1SL1 B;  5B7C A;  1FHE A;  3K8N A;  1MDI A;  2MBS A;  3FK8 A;  4KDX A;  4WF5 A;  1YF1 A;  1Q98 A;  2VLU A;  5LD0 A;  3IPZ A;  3DVW A;  1XWC A;  2DML A;  3UAP A;  5ID2 A;  2FWE A;  5IOX A;  4MJA A;  2X4A A;  1AIU A;  2YP6 A;  2OKA A;  3DXB A;  3IC8 A;  4JED A;  1K0B A;  4V1A g;  1TK5 B;  2LRN A;  5IIZ A;  2MYG A;  3ZIV A;  3GRX A;  3M1G A;  1PMT A;  2RLI A;  1R7H A;  5G1L A;  5F05 A;  2RM5 A;  4QL7 A;  1SYX A;  4ZBD A;  2LKU A;  4XS6 A;  4GQC A;  1PL1 A;  4YAP A;  2VL2 C;  5F06 A;  1B4P A;  4XRA A;  4KB3 A;  1XW5 A;  2GT5 A;  4MLY A;  1I5G A;  2V6O A;  2AJQ B;  5J5N A;  3GSS A;  4AF2 A;  4XTS A;  3D4T A;  4DSS B;  3ISO A;  1ZL9 A;  5ECR B;  2VL2 A;  1BJX A;  2DKI A;  1GSU A;  2DJ2 A;  4BA7 A;  4BL7 A;  2M80 A;  3F0I A;  1QMV A;  1GP1 A;  1J08 A;  3VFI A;  1QK8 A;  1EP7 A;  5EPF A;  2R0C A;  2KP2 A;  1PSQ A;  5B6N A;  3P90 A;  4KCA A;  2H71 A;  3KTL A;  5IMD A;  1KNG A;  4YQM A;  5ECL B;  2X49 A;  3I6A A;  5DVB A;  2H1G A;  2HNL A;  2WJU A;  2VOC A;  3TJK A;  3I9V 2;  4PUR A;  2WUL A;  4TR1 A;  1SL0 B;  1BED A;  2HRK A;  1VF4 A;  3ZL5 A;  2B7K A;  3ZMK A;  5KN3 A;  5E59 A;  3DD3 A;  16GS A;  2AB6 A;  5IOW A;  1TU7 A;  2KUC A;  4OO4 A;  14GS A;  2PN8 A;  3A2W A;  3L4N A;  1M3J A;  5G5F A;  3ZZX A;  2A2P A;  2B3S A;  5ECI B;  2OJL A;  1K3O A;  3LYP A;  1USB A;  2WB9 A;  4ICY A;  3UMA A;  1OE8 A;  1M3I A;  4D73 A;  3IDV A;  2OBI A;  4O5R A;  4IVF A;  3TJG A;  3QR6 A;  2K8S A;  3GUS A;  3F3R A;  3FR9 A;  1HYU A;  2HRN A;  2HI7 A;  4IN0 A;  4ZB6 A;  1YKC A;  1S3R A;  5HR1 A;  2WFC A;  1JFU A;  1JLV A;  5CAX A;  3C1S A;  4P3Y B;  3FY7 A;  4GRF A;  2ZUP A;  1EV4 A;  2L4Q A;  2H72 A;  2GZP A;  3I69 A;  2IFQ B;  1XCC A;  1EGR A;  1X9M B;  3GH6 A;  4WKW A;  3H93 A;  1Z6M A;  2VLT A;  3GST A;  1UC7 A;  1PKZ A;  4ECB A;  4LA1 A;  2H75 A;  1NHY A;  3NZN A;  3EUR A;  1EOH A;  3D6I A;  4QL9 A;  1PGT A;  1E2Y A;  1TI3 A;  3HY2 A;  4IP6 A;  4OMV A;  4WBJ A;  1HQO A;  1ZOF A;  4KA0 A;  3KGK A;  4KW6 A;  5ECH B;  3VPQ A;  3TOU A;  2L6C A;  1SYR A;  4HS1 A;  1AQV A;  2H30 A;  5AIS A;  5H5R A;  4MH3 A;  2K18 A;  2LQO A;  4O7H A;  4G0L A;  4PX1 A;  4PNG A;  1PQN A;  2CX4 A;  4AGS A;  1A0R P;  1TP9 A;  4GLT A;  3WGD A;  3LG6 A;  1XW9 A;  4FYC A;  2OAD A;  4G10 A;  3TRX A;  1WOU A;  2X8H A;  2IN3 A;  5HFK A;  1TTZ A;  5ENU A;  1XG8 A;  3ZIT A;  1Z9H A;  4EVM A;  4XS4 B;  5FHI A;  1V57 A;  1HNA A;  2IPA A;  3TOT A;  3LEF A;  1GL8 A;  4POK A;  5DAK A;  4V2N A;  5KOX A;  2I81 A;  4ULX A;  4K5R A;  2H8L A;  4MH2 A;  5EY6 A;  3BCI A;  1SKR B;  3LFL A;  3JCM L;  2VCT A;  5DQS A;  3PH9 A;  2GDR A;  1THX A;  1ZZY A;  3KH7 A;  1O8W A;  4NAX A;  2JL4 A;  4WF4 A;  3RAZ A;  3CBU A;  3GH9 A;  1U6T A;  3M3M A;  2VAF A;  2FHE A;  4I8B A;  1ABA A;  4DVC A;  4JRR A;  2DJK A;  1N2A A;  1S3D A;  1B48 A;  1MD3 A;  4TR3 A;  3S9F A;  2F51 A;  1A0F A;  3DML A;  1X5D A;  1OVN A;  2HRA A;  4K9Z A;  3A5W A;  3QFB C;  1TKD B;  4JE1 A;  2F3M A;  3G7J A;  3VLN A;  1WE0 A;  3A2X A;  3VI7 A;  2V41 A;  2DC5 A;  4TXO A;  2DMM A;  2LS5 A;  3MYD A;  6GSX A;  4FYU A;  2CZ3 A;  2R4V A;  3CRT A;  5ECP B;  4BWQ A;  3ZML A;  3UIW A;  1TXX A;  2HZE A;  2NPB A;  3HHV A;  3DYR A;  1GSE A;  1XIY A;  1A8Y A;  1R5A A;  3D4M A;  3FKF A;  5IO0 A;  3J7Y b;  5KN1 A;  1AC1 A;  1GTB A;  2GTU A;  2JU5 A;  3KM6 A;  2IMI A;  2ZCT A;  1DBY A;  3CRU A;  2FWH A;  1KTE A;  3Q6O A;  4RQR A;  4G0K A;  1K0O A;  4TKY A;  3IK7 A;  3QAV A;  1OYJ A;  2QGV A;  2I9H A;  2O8V B;  2D2Z A;  1EZK A;  2JZT A;  1K0D A;  3TUE A;  1TK0 B;  2GQK A;  3FR6 A;  3E0U A;  2H6X A;  5B6M A;  4FH8 A;  1ERT A;  1ZGN A;  3G9B A;  4N10 A;  5ID2 B;  4POM A;  4DEJ A;  3QOU A;  5DQY A;  4XIH A;  3IA1 A;  4HU7 A;  2G2Q A;  1XOA A;  1HNB A;  4IW9 A;  7GSS A;  3GKK A;  4X43 A;  4KND A;  2OE1 A;  2X99 A;  1TK8 B;  1ZYN A;  2O89 A;  6GSS A;  2AHE A;  1HNC A;  2L5L A;  3UOM A;  6GSW A;  2EC4 A;  1EV9 A;  5G30 A;  4OWY A;  2PUK C;  3TJJ A;  3FW2 A;  1WPI A;  2B5E A;  2QC7 A;  3GTU A;  2P5Q A;  2C8U A;  2WS2 A;  3CSJ A;  2R0P A;  3C1R A;  4K0G A;  2CVD A;  2C3N A;  1KBN A;  4G19 A;  3EPT A;  4EIQ A;  3SWL A;  2VCZ A;  4EDY A;  1Z7R A;  2L59 A;  4PQH A;  2YZU A;  1GUL A;  2TRX A;  2GQL A;  3FZA A;  1QGV A;  4NHW A;  2UZ8 A;  2B1L A;  1Z6N A;  1A2M A;  4EKZ A;  4N30 A;  5DJL A;  1Z3E A;  1NW2 A;  5G1K A;  1MTC A;  4TR1 B;  1T7P B;  2GST A;  3QCP A;  2FNO A;  3H4K A;  3BD2 A;  5DCH A;  4MZC A;  3QAW A;  4GWR A;  2GGT A;  4I2U A;  4POL A;  3UL3 A;  1ZYQ B;  3Q18 A;  1WIK A;  4MF7 A;  2CZ2 A;  5IQY A;  4F0C A;  5D8I A;  2NDO A;  4EXJ A;  3TRP A;  5D9V A;  2CAQ A;  2KLX A;  5HR0 A;  3FRC A;  3WT1 A;  1TRS A;  2QA2 A;  4HUA A;  5AGY A;  3QD9 A;  1OC9 B;  4ZBA A;  4D73 B;  1T4Z A;  3H8Q A;  3TKP A;  2VCV A;  3IK9 A;  4KE3 A;  4E8E A;  2VM1 A;  1EOG A;  1TRW A;  2GSR A;  1PKW A;  3O3T A;  5HR3 A;  1EGO A;  4PUA A;  4L5O A;  4GSS A;  3BOA A;  4K2X A;  4TOP A;  3LSZ A;  2WDU A;  2XHF A;  1JZR A;  3U5R E;  3MIX A;  4ZXG A;  2L5O A;  3APS A;  1W4V A;  3DKS A;  3ZFB A;  5CRE A;  22GS A;  4FQU A;  2N5B A;  4Q5N A;  4Z2R A;  3KXO A;  4CY8 A;  5IPH A;  3KCM A;  4KAE A;  1SU9 A;  4WR4 A;  2LUS A;  1CQH A;  1TRU A;  2CQ9 A;  4TW5 A;  2DJJ A;  4JZQ A;  2VD1 A;  4ZB9 A;  3FZ5 A;  1BQ7 A;  1SJ6 A;  5JCG A;  2HLS A;  2B7J A;  4KCE A;  4HSC X;  4L5L A;  4IBP A;  4PQI A;  3HJO A;  5ELA A;  2IMF A;  3EE2 A;  2NTO A;  3BCK A;  4MNN A;  4IJ3 A;  1AQX A;  3V1W A;  4HI7 A;  1Z7P A;  4YKG A;  1K3L A;  4MCU A;  4ZB8 A;  5J3R A;  1GTA A;  5ECK B;  2YV7 A;  1GTU A;  3GX8 A;  3QFA C;  2IJY A;  3KH9 A;  3HCZ A;  1JZW A;  5DBQ A;  1SKS B;  4ML6 A;  2C0E A;  2K6V A;  2LST A;  1Z5Y E;  3GIX A;  3HZ8 A;  1XWK A;  1WMJ A;  4K7O A;  2LTK A;  5LNK e;  3DWV A;  1GUM A;  4TR0 A;  3CTF A;  4BVX A;  4GTU A;  3KMN A;  4HU9 A;  1U3I A;  2RII A;  5DAK B;  2HSM A;  2YV9 A;  4YAV A;  3TDG A;  1YEP A;  2GS3 A;  4BVY B;  3F9U A;  2LJR A;  1GWC A;  1SKW B;  3GKM A;  3MDK A;  1RK4 A;  5C04 A;  2MZC A;  1V2A A;  2EIR A;  4I2T A;  2VUP A;  3P2A A;  4CHS A;  2A4H A;  3UVT A;  2MMZ A;  5F8B A;  3A3T A;  1ACV A;  2CT6 A;  1GSF A;  1ST9 A;  1U88 A;  1MEK A;  5C00 A;  2HSH A;  2H6Y A;  1DE2 A;  1TDI A;  3AY8 A;  5D93 A;  2LJA A;  3TJB A;  2J9H A;  3BBY A;  4FYB A;  1J9B A;  4NXI A;  5DAL A;  2E2G A;  1SJI A;  1WP0 A;  2F9S A;  1G6Y A;  1GNW A;  4WET A;  4GSN A;  4TXO B;  1UA5 A;  4RI6 A;  3BJ5 A;  2HZF A;  3LQ7 A;  1R26 A;  4K6X A;  5ABR A;  2ZNM A;  3FZ9 A;  1AUC A;  4ML1 A;  3VWX A;  5D9W A;  3IV4 A;  4HEA 2;  3GNJ A;  2YCD A;  4YQU A;  1TI1 A;  5DCG A;  3M0F A;  3EU4 A;  1KEB A;  2HZE B;  5HR2 A;  4TN8 A;  1OKD A;  5HFI A;  1VRS D;  5A4U A;  3KZQ A;  2YN1 A;  2HFD A;  1QQ2 A;  3TKQ A;  1SK2 A;  2FA8 A;  1PD2 1;  1SL2 B;  3QMX A;  1F9M A;  5JCW A;  1M9A A;  4PUF C;  3F63 A;  3P7X A;  3QPM A;  4E8H A;  2YWN A;  2V2G A;  4NV5 A;  2HSY A;  2P5R A;  4BWS A;  4NPB A;  5GAP D;  4PNF A;  1QUW A;  6GSY A;  4GQF A;  4ILF A;  1WRY A;  3C7M A;  3F4T A;  3IR4 A;  4X4J A;  5A5K A;  1ZYE A;  1SD8 A;  3D22 A;  1XBS A;  1MDK A;  4EDZ A;  5IMA A;  1ERU A;  1AXD A;  2AUV A;  5FWG A;  3MWH A;  2PBJ A;  4CDO A;  1URM A;  1A24 A;  3LOR A;  3GFK A;  19GS A;  4MAB A;  4NV2 A;  1O81 A;  4EIP A;  2C4J A;  3VWW A;  5H5S A;  1DSB A;  2BMX A;  2XPE A;  2PVO C;  3ZIJ A;  2FY6 A;  2B5X A;  4H86 A;  4OFT A;  10GS A;  2IME A;  4RUV A;  2NVL A;  3DEX A;  4WBR D;  2DSA A;  5A4W A;  1XZO A;  2PWJ A;  2N5A A;  3FEU A;  2P31 A;  2C0G A;  3UBK A;  2AAW A;  4O32 A;  4GST A;  3GTU B;  4FIW A;  1XWA A;  4MF5 A;  4Z7X A;  2FGX A;  2L57 A;  4HDE A;  4KSM A;  2LJK A;  5IM9 A;  1O6J A;  3KIJ A;  3G7I A;  3ZYW A;  2O87 A;  3PGT A;  3HKR A;  1MDJ A;  1F2E A;  2OE0 A;  4X0X A;  2X8G A;  2B1K A;  3Q74 A;  2HYX A;  4LL4 B;  1A2L A;  1OC8 A;  4TXV A;  5IMF A;  3KEB A;  5CP1 A;  4F82 A;  2PPT A;  2A2R A;  1GUH A;  4MMM A;  1BYE A;  2IFQ A;  5JCU A;  1GSY A;  18GS A;  2QA1 A;  1F37 A;  1JLW A;  5ECN B;  2CX3 A;  5AN1 A;  1THO A;  2BTO T;  3ZFL A;  1W89 A;  2IWT A;  2Z9S A;  3M9K A;  1O8X A;  2QKE A;  5D73 A;  2YPM A;  1TRV A;  2GZY A;  2WCI A;  4MJE A;  5IMV A;  4EL1 A;  2OE3 A;  1K3Y A;  3CXG A;  4X1U A;  3UAR A;  1YEX A;  4HOJ A;  4YQV A;  3L0H A;  5ECQ B;  5JWO B;  3GN3 A;  1GTI A;  4JR4 A;  3ME7 A;  3VWU A;  1F3A A;  1M7T A;  4ECC A;  1F6M C;  2XBQ A;  5D96 A;  2YWO A;  1ILO A;  1N8J A;  3EMX A;  5DDL A;  2EIO A;  3GMF A;  3IXR A;  1B9X C;  4RI7 A;  2DJ3 A;  2LNT A;  1BAY A;  2B5Y A;  1XWB A;  3GKN A;  3GL5 A;  2DBC A;  4XHM A;  2VL9 A;  5CNW A;  3TCO A;  3DIE A;  5BMU A;  4TRX A;  4K1F A;  2M72 A;  4PGT A;  2GVP A;  5B8B A;  5INY A;  2YOI A;  3TB2 A;  4MPG A;  3IAS 2;  1FOV A;  3WGX A;  3E3E A;  4ZL9 A;  3HVV A;  1SD9 A;  1T1V A;  1M2B A;  2VCX A;  4HZ2 A;  1G7O A;  1K0A A;  2REM A;  1XVW A;  4N11 A;  2QSI A;  2ON7 A;  2I3Y A;  3ZTL A;  3KTB A;  4BPY A;  1U87 A;  2YAN A;  5HQP A;  3C73 A;  3CTG A;  1WJK A;  2DKH A;  3RPN A;  3FHK A;  4LMW A;  2PGT A;  2H0I A;  2YNX A;  2V1M A;  3HVS A;  3C8E A;  2R2J A;  4BL7 B;  3A5I A;  2CA8 A;  2WRT A;  1BX9 A;  2H1D A;  6GSV A;  2TRC P;  12GS A;  8GSS A;  1SK1 A;  3DVX A;  3FZ4 A;  3ZRE A;  1FVJ A;  4A5P A;  3LYK A;  2YZH A;  3ZRD A;  4K5S A;  3F6D A;  3TJF A;  3E9J B;  3IAM 2;  1VGL A;  1T4Y A;  5CRH A;  4MK3 A;  3IHQ A;  4BVX B;  3SBC A;  1T00 A;  1JZD A;  3LWA A;  5KN2 A;  2R6K A;  3DRN A;  2C80 A;  2A4V A;  1K0N A;  3QAG A;  3D5J A;  5IMZ A;  1JHB A;  3PPU A;  1FAA A;  2VIM A;  3O6T A;  1TJD A;  1X5C A;  5GAN D;  3HDC A;  1GSS A;  5KN0 A;  1G6W A;  2YWI A;  3ERF A;  4KH7 A;  3W6G A;  2H73 A;  4WXT A;  3WGE A;  17GS A;  3WT2 A;  1GRX A;  3GX0 A;  3HJP A;  2VL3 A;  4ECJ A;  4K0N A;  4KX4 A;  4NHZ A;  1C72 A;  3VUR A;  5ECS A;  2HXK A;  4IKH A;  3A2V A;  3C71 A;  3PIN A;  3ME8 A;  1GLQ A;  4AJ7 A;  4GF0 A;  3MAK A;  3GKX A;  3HJM A;  3RBT A;  2OBK A;  1AAZ A;  1FB6 A;  3HVN A;  4XCS A;  5IO2 A;  4Z2U A;  3KD0 A;  3P8W A;  2ES7 A;  2IIY A;  5ECM B;  4AJ6 A;  5DAL B;  3EWL A;  3LXT A;  4YKF A;  2A2S A;  2AV4 A;  2C0D A;  2V6K A;  2YJ7 A;  2MMA A;  4EF0 A;  1O85 A;  2JZR A;  5B8A A;  3HA9 A;  4GCI A;  4GXZ A;  3N5O A;  5J4U A;  2KP1 A; 
#chains in the Genus database with same CATH homology
 1Y25 A;  4J56 E;  1O73 A;  1GSQ A;  1ERV A;  4IJI A;  3W8S A;  2VCW A;  2IMD A;  2FUG 2;  5JWR B;  2C3Q A;  2DIZ A;  4N0V A;  1JZO A;  1VF2 A;  5D9T A;  1RQM A;  3VPT A;  2DJ1 A;  3ZLP A;  1E6B A;  3TKR A;  3N9J A;  1G7E A;  4KGI A;  3ERG A;  1U3A A;  1UN2 A;  3UBL A;  4I97 A;  4XS1 A;  1FW1 A;  1QFN A;  1GLP A;  3F4S A;  1LU4 A;  1YF0 A;  2H76 A;  1XW6 A;  2PMT A;  3MNG A;  3R3E A;  2L4C A;  2H1B A;  2PER A;  3KJY A;  2X64 A;  2OAC A;  1PN9 A;  2VCQ A;  1NSW A;  1VF1 A;  2C3T A;  1M0U A;  3R2Q A;  3EIN A;  3LGC A;  2F8A A;  1IYI A;  3APO A;  2LV3 A;  3TGZ A;  1DUG A;  4JR6 A;  1XVQ A;  1M99 A;  4MA9 A;  3U6V A;  1QXH A;  2M46 A;  1IYH A;  1BG5 A;  3WD6 A;  2CV4 A;  3UEM A;  1V58 A;  3F6F A;  3Q19 A;  2NBS A;  4ZIL A;  2H74 A;  3G7Y A;  4WEY A;  1TU8 A;  4Z2T A;  4IP1 A;  1X5E A;  5CYY A;  2H0G A;  2H19 A;  3TKS C;  3VK9 A;  1Y6E A;  2LQQ A;  1T3B A;  1GSD A;  5J41 A;  2HT9 A;  1F3B A;  4EUY A;  1CQG A;  2H66 A;  1WWJ A;  2X8C A;  4MZW A;  3TKS A;  3GYK A;  4F9Z A;  5IPG A;  2KOK A;  3LXZ A;  4HQZ A;  5COH A;  9GSS A;  1OC9 A;  1HD2 A;  4ID0 A;  3M8N A;  4F03 A;  4F0B A;  3TRQ A;  4V1A p;  4MPF A;  2DLX A;  1O7U A;  1PRX A;  4O5Q A;  4Q5R A;  5ECO B;  1X0R A;  1K0M A;  4EE0 A;  5ELG A;  5G5E A;  1I9D A;  4KSO A;  4IEL A;  3F8U A;  4HJ2 A;  4OD7 A;  3VI5 A;  5LCZ A;  3EVI A;  2CVK A;  1GNE A;  4NMU A;  2GLR A;  2PVQ A;  4RQX A;  1X9S B;  1TOF A;  2LNS A;  4LMV A;  2J23 A;  1Q4J A;  3CSI A;  3IBH A;  4MJB A;  4LLR A;  2FLS A;  5CRW A;  5EVO A;  4N0Z A;  2O7K A;  1OC3 A;  2CAI A;  20GS A;  2B6M A;  2K8V A;  4QQ7 A;  2E0Q A;  4V2M A;  4IS0 A;  4J57 E;  3IRA A;  5GZZ B;  3ED3 A;  1LJR A;  13GS A;  4MDC A;  4USS A;  1LBK A;  1GUK A;  1H75 A;  1ZMA A;  1V9W A;  1OKT A;  2GSQ A;  4POB A;  3RHC A;  2WZ9 A;  4DSS A;  3FYG A;  1PL2 A;  1S3A A;  3LJR A;  3NIV A;  4MJC A;  1YQ1 A;  3KMO A;  4L8E A;  4ZL7 A;  1OAZ A;  4MP4 A;  2KHP A;  2N5F A;  4HQS A;  5IMC A;  3H79 A;  4G2E A;  1YY7 A;  3HYP A;  1S3C A;  2RUF A;  2JAC A;  3HXS A;  1H4O A;  4KF9 A;  1OE7 A;  1TW9 A;  4HJM A;  4ECI A;  4OFM A;  2H70 A;  2GQM A;  3FR3 A;  4IQA A;  2HRF A;  2RM6 A;  5G31 A;  4DSR A;  3IOS A;  2RUE A;  3EYT A;  4K8M A;  1V40 A;  3US3 A;  2BJX A;  4HZ4 A;  2XPD A;  2YWM A;  2FCH A;  1A8L A;  1YKA A;  5JWQ B;  5AIV A;  4BVY A;  3VWV A;  1XOB A;  2FWF A;  2LRC A;  1B9Y C;  2MMN A;  5EL8 A;  4KDY A;  2JSZ A;  4PXO A;  4OCE A;  1SJZ A;  5A4V A;  5CO3 A;  5KOW A;  4KDU A;  2DJ0 A;  1NHO A;  3F4R A;  1PX7 A;  3RPP A;  5GSS A;  1PX6 A;  3EMP A;  4JU5 A;  2XBI A;  2H1A A;  2O85 A;  1FB0 A;  1XFL A;  2K9F A;  2JZS A;  4PQ1 A;  1ON4 A;  6GSU A;  3L78 A;  3UVH A;  1VF3 A;  3L9S A;  2C1Y A;  3EC3 A;  4I6X A;  1ML6 A;  1FOH A;  1A23 A;  4OO5 A;  3ERW A;  4TR4 A;  2LRT A;  4MZB A;  4PTS A;  2PU9 C;  4MF6 A;  4OFN A;  3WYW A;  4V2L A;  1M2A A;  4CY6 A;  4DSQ A;  2C0F A;  5F07 A;  1AW9 A;  3GHA A;  1YZX A;  2LEG A;  2R0G A;  1PN0 A;  4ZBB A;  1FO5 A;  3NOF A;  3D0Z A;  5KEJ A;  2AYT A;  2TIR A;  4K2D A;  4K7I A;  3OR5 A;  3RDW A;  3DGQ A;  5J9C A;  1GH2 A;  3KP8 A;  4TVE A;  5CRG A;  1FG4 A;  1EP8 A;  4NWY A;  1G0T A;  3QDN A;  2WGR A;  3HZ4 A;  2H0H A;  4LL1 B;  4Q5Q A;  1NM3 A;  2IL3 A;  1A2J A;  4ZL8 A;  1K0C A;  3F3Q A;  2VD0 A;  3H1N A;  4I5Q A;  3CSH A;  3EU3 A;  2JSY A;  1EEM A;  3LW9 A;  2DIY A;  4IQ1 A;  4Q5F A;  3GV1 A;  3J7Y k;  5F0G A;  2I1U A;  5H5Q A;  2G0F A;  4O5U A;  4L0W A;  3O76 A;  3UJ1 A;  2E7P A;  4G0I A;  3IHG A;  4IHU A;  4XS4 A;  2IMK A;  1X9W B;  3RHB A;  1B8X A;  3PR8 A;  2OA7 A;  1SK0 A;  3IE3 A;  3CMI A;  4ACS A;  3GA4 A;  4XRD A;  1AQW A;  5FT3 A;  3ZVJ D;  2F8F A;  2VO4 A;  2ALB A;  4O92 A;  2FD3 A;  2GZZ A;  3HD5 A;  3IC4 A;  4EO3 A;  3ZVJ A;  1YDK A;  3L9U A;  2VLV A;  2E2M A;  5AIX A;  1XPV A;  2I4A A;  4J2F A;  3D21 A;  2R37 A;  1EEJ A;  4OCF A;  4G9H A;  4K7N A;  1V98 A;  4L0U A;  1R4W A;  1SEN A;  1R5P A;  4ZIJ A;  6GST A;  3I43 A;  5E4W A;  3TKS E;  1XXU A;  1YJ6 A;  3FMW A;  2EIQ A;  2HE3 A;  2R3X A;  11GS A;  1RW1 A;  5CRD A;  1XWG A;  5BRT A;  3W8J A;  4ISD A;  2GSS A;  3HVX A;  4EC0 A;  4F2I A;  4AJ8 A;  5DJM A;  1MD4 A;  2FA4 A;  2GT6 A;  4YH2 A;  2R5G A;  2XC2 A;  2FWG A;  2L6D A;  2H01 A;  1FVK A;  1UVZ A;  2VM2 A;  4IGJ A;  3APQ A;  2CVB A;  1PA3 A;  5J9B A;  1EWX A;  4CW9 A;  1DE1 A;  2MBT A;  3GL3 A;  2ON5 A;  4WR5 A;  3L9V A;  4FO5 A;  2MMO A;  1J0F A;  1M9B A;  4JBB A;  1M2D A;  1ERW A;  1B4Q A;  4KUN A;  3M9J A;  3GUR A;  2P0G A;  5GST A;  5G2Z A;  1ZCP A;  5L71 A;  5D9X A;  5HFG A;  2JAD A;  2V32 A;  3KP9 A;  2H6Z A;  3CYN A;  2YJH A;  1T8E B;  3MSZ A;  1ZYP A;  1SL1 B;  5B7C A;  1FHE A;  3K8N A;  1MDI A;  2MBS A;  3FK8 A;  4KDX A;  4WF5 A;  1YF1 A;  1Q98 A;  2VLU A;  5LD0 A;  3IPZ A;  3DVW A;  1XWC A;  2DML A;  3UAP A;  5ID2 A;  2FWE A;  5IOX A;  4MJA A;  2X4A A;  1AIU A;  2YP6 A;  2OKA A;  3DXB A;  3IC8 A;  4JED A;  1K0B A;  4V1A g;  1TK5 B;  2LRN A;  5IIZ A;  2MYG A;  3ZIV A;  3GRX A;  3M1G A;  1PMT A;  2RLI A;  1R7H A;  5G1L A;  5F05 A;  2RM5 A;  4QL7 A;  1SYX A;  4ZBD A;  2LKU A;  4XS6 A;  4GQC A;  1PL1 A;  4YAP A;  2VL2 C;  5F06 A;  1B4P A;  4XRA A;  4KB3 A;  1XW5 A;  2GT5 A;  4MLY A;  1I5G A;  2V6O A;  2AJQ B;  5J5N A;  3GSS A;  4AF2 A;  4XTS A;  3D4T A;  4DSS B;  3ISO A;  1ZL9 A;  5ECR B;  2VL2 A;  1BJX A;  2DKI A;  1GSU A;  2DJ2 A;  4BA7 A;  4BL7 A;  2M80 A;  3F0I A;  1QMV A;  1GP1 A;  1J08 A;  3VFI A;  1QK8 A;  1EP7 A;  5EPF A;  2R0C A;  2KP2 A;  1PSQ A;  5B6N A;  3P90 A;  4KCA A;  2H71 A;  3KTL A;  5IMD A;  1KNG A;  4YQM A;  5ECL B;  2X49 A;  3I6A A;  5DVB A;  2H1G A;  2HNL A;  2WJU A;  2VOC A;  3TJK A;  3I9V 2;  4PUR A;  2WUL A;  4TR1 A;  1SL0 B;  1BED A;  2HRK A;  1VF4 A;  3ZL5 A;  2B7K A;  3ZMK A;  5KN3 A;  5E59 A;  3DD3 A;  16GS A;  2AB6 A;  5IOW A;  1TU7 A;  2KUC A;  4OO4 A;  14GS A;  2PN8 A;  3A2W A;  3L4N A;  5G5F A;  3ZZX A;  2A2P A;  2B3S A;  5ECI B;  2OJL A;  1K3O A;  3LYP A;  1USB A;  2WB9 A;  4ICY A;  3UMA A;  1OE8 A;  4D73 A;  3IDV A;  2OBI A;  4O5R A;  4IVF A;  3TJG A;  3QR6 A;  2K8S A;  3GUS A;  3F3R A;  3FR9 A;  1HYU A;  2HRN A;  2HI7 A;  4IN0 A;  4ZB6 A;  1YKC A;  5HR1 A;  2WFC A;  1JFU A;  1JLV A;  5CAX A;  3C1S A;  4P3Y B;  3FY7 A;  4GRF A;  2ZUP A;  1EV4 A;  2L4Q A;  2H72 A;  2GZP A;  3I69 A;  2IFQ B;  1XCC A;  1EGR A;  1X9M B;  3GH6 A;  4WKW A;  3H93 A;  1Z6M A;  2VLT A;  3GST A;  1UC7 A;  1PKZ A;  4ECB A;  4LA1 A;  2H75 A;  1NHY A;  3NZN A;  3EUR A;  1EOH A;  3D6I A;  4QL9 A;  1PGT A;  1E2Y A;  1TI3 A;  3HY2 A;  4IP6 A;  4OMV A;  4WBJ A;  1HQO A;  1ZOF A;  4KA0 A;  3KGK A;  4KW6 A;  5ECH B;  3VPQ A;  3TOU A;  2L6C A;  1SYR A;  4HS1 A;  1AQV A;  2H30 A;  5AIS A;  5H5R A;  4MH3 A;  2K18 A;  2LQO A;  4O7H A;  4G0L A;  4PX1 A;  4PNG A;  1PQN A;  2CX4 A;  4AGS A;  1A0R P;  1TP9 A;  4GLT A;  3WGD A;  3LG6 A;  1XW9 A;  4FYC A;  2OAD A;  4G10 A;  3TRX A;  1WOU A;  2X8H A;  2IN3 A;  5HFK A;  1TTZ A;  5ENU A;  3ZIT A;  1Z9H A;  4EVM A;  4XS4 B;  5FHI A;  1V57 A;  1HNA A;  2IPA A;  3TOT A;  3LEF A;  1GL8 A;  4POK A;  5DAK A;  4V2N A;  5KOX A;  2I81 A;  4ULX A;  4K5R A;  2H8L A;  4MH2 A;  5EY6 A;  3BCI A;  1SKR B;  3LFL A;  3JCM L;  2VCT A;  5DQS A;  3PH9 A;  2GDR A;  1THX A;  1ZZY A;  3KH7 A;  1O8W A;  4NAX A;  2JL4 A;  4WF4 A;  3RAZ A;  3CBU A;  3GH9 A;  1U6T A;  3M3M A;  2VAF A;  2FHE A;  4I8B A;  1ABA A;  4DVC A;  4JRR A;  2DJK A;  1N2A A;  1S3D A;  1B48 A;  1MD3 A;  4TR3 A;  3S9F A;  2F51 A;  1A0F A;  3DML A;  1X5D A;  1OVN A;  2HRA A;  4K9Z A;  3A5W A;  3QFB C;  1TKD B;  4JE1 A;  2F3M A;  3G7J A;  3VLN A;  1WE0 A;  3A2X A;  3VI7 A;  2V41 A;  2DC5 A;  4TXO A;  2DMM A;  2LS5 A;  3MYD A;  6GSX A;  4FYU A;  2CZ3 A;  2R4V A;  3CRT A;  5ECP B;  4BWQ A;  3ZML A;  3UIW A;  1TXX A;  2HZE A;  2NPB A;  3HHV A;  3DYR A;  1GSE A;  1XIY A;  1A8Y A;  1R5A A;  3D4M A;  3FKF A;  5IO0 A;  3J7Y b;  5KN1 A;  1AC1 A;  1GTB A;  2GTU A;  2JU5 A;  3KM6 A;  2IMI A;  2ZCT A;  1DBY A;  3CRU A;  2FWH A;  1KTE A;  3Q6O A;  4RQR A;  4G0K A;  1K0O A;  4TKY A;  3IK7 A;  3QAV A;  1OYJ A;  2QGV A;  2I9H A;  2O8V B;  2D2Z A;  1EZK A;  2JZT A;  1K0D A;  3TUE A;  1TK0 B;  2GQK A;  3FR6 A;  3E0U A;  2H6X A;  5B6M A;  4FH8 A;  1ERT A;  1ZGN A;  3G9B A;  4N10 A;  5ID2 B;  4POM A;  4DEJ A;  3QOU A;  5DQY A;  4XIH A;  3IA1 A;  4HU7 A;  2G2Q A;  1XOA A;  1HNB A;  4IW9 A;  7GSS A;  3GKK A;  4X43 A;  4KND A;  2OE1 A;  2X99 A;  1TK8 B;  1ZYN A;  2O89 A;  6GSS A;  2AHE A;  1HNC A;  2L5L A;  3UOM A;  6GSW A;  2EC4 A;  1EV9 A;  5G30 A;  4OWY A;  2PUK C;  3TJJ A;  3FW2 A;  1WPI A;  2B5E A;  2QC7 A;  3GTU A;  2P5Q A;  2C8U A;  2WS2 A;  3CSJ A;  2R0P A;  3C1R A;  4K0G A;  2CVD A;  2C3N A;  1KBN A;  4G19 A;  3EPT A;  4EIQ A;  3SWL A;  2VCZ A;  4EDY A;  1Z7R A;  2L59 A;  4PQH A;  2YZU A;  1GUL A;  2TRX A;  2GQL A;  3FZA A;  1QGV A;  4NHW A;  2UZ8 A;  2B1L A;  1Z6N A;  1A2M A;  4EKZ A;  4N30 A;  5DJL A;  1Z3E A;  1NW2 A;  5G1K A;  1MTC A;  4TR1 B;  1T7P B;  2GST A;  3QCP A;  2FNO A;  3H4K A;  3BD2 A;  5DCH A;  4MZC A;  3QAW A;  4GWR A;  2GGT A;  4I2U A;  4POL A;  3UL3 A;  1ZYQ B;  3Q18 A;  1WIK A;  4MF7 A;  2CZ2 A;  5IQY A;  4F0C A;  5D8I A;  2NDO A;  4EXJ A;  3TRP A;  5D9V A;  2CAQ A;  2KLX A;  5HR0 A;  3FRC A;  3WT1 A;  1TRS A;  2QA2 A;  4HUA A;  5AGY A;  3QD9 A;  1OC9 B;  4ZBA A;  4D73 B;  1T4Z A;  3H8Q A;  3TKP A;  2VCV A;  3IK9 A;  4KE3 A;  4E8E A;  2VM1 A;  1EOG A;  1TRW A;  2GSR A;  1PKW A;  3O3T A;  5HR3 A;  1EGO A;  4PUA A;  4L5O A;  4GSS A;  3BOA A;  4K2X A;  4TOP A;  3LSZ A;  2WDU A;  2XHF A;  1JZR A;  3U5R E;  3MIX A;  4ZXG A;  2L5O A;  3APS A;  1W4V A;  3DKS A;  3ZFB A;  5CRE A;  22GS A;  4FQU A;  2N5B A;  4Q5N A;  4Z2R A;  3KXO A;  4CY8 A;  5IPH A;  3KCM A;  4KAE A;  1SU9 A;  4WR4 A;  2LUS A;  1CQH A;  1TRU A;  2CQ9 A;  4TW5 A;  2DJJ A;  4JZQ A;  2VD1 A;  4ZB9 A;  3FZ5 A;  1BQ7 A;  1SJ6 A;  5JCG A;  2HLS A;  2B7J A;  4KCE A;  4L5L A;  4IBP A;  4PQI A;  3HJO A;  5ELA A;  2IMF A;  3EE2 A;  2NTO A;  3BCK A;  4MNN A;  4IJ3 A;  1AQX A;  3V1W A;  4HI7 A;  1Z7P A;  4YKG A;  1K3L A;  4MCU A;  4ZB8 A;  5J3R A;  1GTA A;  5ECK B;  2YV7 A;  1GTU A;  3GX8 A;  3QFA C;  2IJY A;  3KH9 A;  3HCZ A;  1JZW A;  5DBQ A;  1SKS B;  4ML6 A;  2C0E A;  2K6V A;  2LST A;  1Z5Y E;  3GIX A;  3HZ8 A;  1XWK A;  1WMJ A;  4K7O A;  2LTK A;  5LNK e;  3DWV A;  1GUM A;  4TR0 A;  3CTF A;  4BVX A;  4GTU A;  3KMN A;  4HU9 A;  1U3I A;  2RII A;  5DAK B;  2HSM A;  2YV9 A;  4YAV A;  3TDG A;  1YEP A;  2GS3 A;  4BVY B;  3F9U A;  2LJR A;  1GWC A;  1SKW B;  3GKM A;  3MDK A;  1RK4 A;  5C04 A;  2MZC A;  1V2A A;  2EIR A;  4I2T A;  2VUP A;  3P2A A;  4CHS A;  2A4H A;  3UVT A;  2MMZ A;  5F8B A;  3A3T A;  1ACV A;  2CT6 A;  1GSF A;  1ST9 A;  1U88 A;  1MEK A;  5C00 A;  2HSH A;  2H6Y A;  1DE2 A;  1TDI A;  3AY8 A;  5D93 A;  2LJA A;  3TJB A;  2J9H A;  3BBY A;  4FYB A;  1J9B A;  4NXI A;  5DAL A;  2E2G A;  1SJI A;  1WP0 A;  2F9S A;  1G6Y A;  1GNW A;  4WET A;  4GSN A;  4TXO B;  1UA5 A;  4RI6 A;  3BJ5 A;  2HZF A;  3LQ7 A;  1R26 A;  4K6X A;  5ABR A;  2ZNM A;  3FZ9 A;  1AUC A;  4ML1 A;  3VWX A;  5D9W A;  3IV4 A;  4HEA 2;  3GNJ A;  2YCD A;  4YQU A;  1TI1 A;  5DCG A;  3M0F A;  3EU4 A;  1KEB A;  2HZE B;  5HR2 A;  4TN8 A;  1OKD A;  5HFI A;  1VRS D;  5A4U A;  3KZQ A;  2YN1 A;  2HFD A;  1QQ2 A;  3TKQ A;  1SK2 A;  2FA8 A;  1PD2 1;  1SL2 B;  3QMX A;  1F9M A;  5JCW A;  1M9A A;  4PUF C;  3F63 A;  3P7X A;  3QPM A;  4E8H A;  2YWN A;  2V2G A;  4NV5 A;  2HSY A;  2P5R A;  4BWS A;  4NPB A;  5GAP D;  4PNF A;  1QUW A;  6GSY A;  4GQF A;  4ILF A;  1WRY A;  3C7M A;  3F4T A;  3IR4 A;  4X4J A;  5A5K A;  1ZYE A;  1SD8 A;  3D22 A;  1XBS A;  1MDK A;  4EDZ A;  5IMA A;  1ERU A;  1AXD A;  2AUV A;  5FWG A;  3MWH A;  2PBJ A;  4CDO A;  1URM A;  1A24 A;  3LOR A;  3GFK A;  19GS A;  4MAB A;  4NV2 A;  1O81 A;  4EIP A;  2C4J A;  3VWW A;  5H5S A;  1DSB A;  2BMX A;  2XPE A;  2PVO C;  3ZIJ A;  2FY6 A;  2B5X A;  4H86 A;  4OFT A;  10GS A;  2IME A;  4RUV A;  2NVL A;  3DEX A;  4WBR D;  2DSA A;  5A4W A;  1XZO A;  2PWJ A;  2N5A A;  3FEU A;  2P31 A;  2C0G A;  3UBK A;  2AAW A;  4O32 A;  4GST A;  3GTU B;  4FIW A;  1XWA A;  4MF5 A;  4Z7X A;  2FGX A;  2L57 A;  4HDE A;  4KSM A;  2LJK A;  5IM9 A;  1O6J A;  3KIJ A;  3G7I A;  3ZYW A;  2O87 A;  3PGT A;  3HKR A;  1MDJ A;  1F2E A;  2OE0 A;  4X0X A;  2X8G A;  2B1K A;  3Q74 A;  2HYX A;  4LL4 B;  1A2L A;  1OC8 A;  4TXV A;  5IMF A;  3KEB A;  5CP1 A;  4F82 A;  2PPT A;  2A2R A;  1GUH A;  4MMM A;  1BYE A;  2IFQ A;  5JCU A;  1GSY A;  18GS A;  2QA1 A;  1F37 A;  1JLW A;  5ECN B;  2CX3 A;  5AN1 A;  1THO A;  2BTO T;  3ZFL A;  1W89 A;  2IWT A;  2Z9S A;  3M9K A;  1O8X A;  2QKE A;  5D73 A;  2YPM A;  1TRV A;  2GZY A;  2WCI A;  4MJE A;  5IMV A;  4EL1 A;  2OE3 A;  1K3Y A;  3CXG A;  4X1U A;  3UAR A;  1YEX A;  4HOJ A;  4YQV A;  3L0H A;  5ECQ B;  5JWO B;  3GN3 A;  1GTI A;  4JR4 A;  3ME7 A;  3VWU A;  1F3A A;  1M7T A;  4ECC A;  1F6M C;  2XBQ A;  5D96 A;  2YWO A;  1ILO A;  1N8J A;  3EMX A;  5DDL A;  2EIO A;  3GMF A;  3IXR A;  1B9X C;  4RI7 A;  2DJ3 A;  2LNT A;  1BAY A;  2B5Y A;  1XWB A;  3GKN A;  3GL5 A;  2DBC A;  4XHM A;  2VL9 A;  5CNW A;  3TCO A;  3DIE A;  5BMU A;  4TRX A;  4K1F A;  2M72 A;  4PGT A;  2GVP A;  5B8B A;  5INY A;  2YOI A;  3TB2 A;  4MPG A;  3IAS 2;  1FOV A;  3WGX A;  3E3E A;  4ZL9 A;  3HVV A;  1SD9 A;  1T1V A;  1M2B A;  2VCX A;  4HZ2 A;  1G7O A;  1K0A A;  2REM A;  1XVW A;  4N11 A;  2QSI A;  2ON7 A;  2I3Y A;  3ZTL A;  3KTB A;  4BPY A;  1U87 A;  2YAN A;  5HQP A;  3C73 A;  3CTG A;  1WJK A;  2DKH A;  3RPN A;  3FHK A;  4LMW A;  2PGT A;  2H0I A;  2YNX A;  2V1M A;  3HVS A;  3C8E A;  2R2J A;  4BL7 B;  3A5I A;  2CA8 A;  2WRT A;  1BX9 A;  2H1D A;  6GSV A;  2TRC P;  12GS A;  8GSS A;  1SK1 A;  3DVX A;  3FZ4 A;  3ZRE A;  1FVJ A;  4A5P A;  3LYK A;  2YZH A;  3ZRD A;  4K5S A;  3F6D A;  3TJF A;  3E9J B;  3IAM 2;  1VGL A;  1T4Y A;  5CRH A;  4MK3 A;  3IHQ A;  4BVX B;  3SBC A;  1T00 A;  1JZD A;  3LWA A;  5KN2 A;  2R6K A;  3DRN A;  2C80 A;  2A4V A;  1K0N A;  3QAG A;  3D5J A;  5IMZ A;  1JHB A;  3PPU A;  1FAA A;  2VIM A;  3O6T A;  1TJD A;  1X5C A;  5GAN D;  3HDC A;  1GSS A;  5KN0 A;  1G6W A;  2YWI A;  3ERF A;  4KH7 A;  3W6G A;  2H73 A;  4WXT A;  3WGE A;  17GS A;  3WT2 A;  1GRX A;  3GX0 A;  3HJP A;  2VL3 A;  4ECJ A;  4K0N A;  4KX4 A;  4NHZ A;  1C72 A;  3VUR A;  5ECS A;  2HXK A;  4IKH A;  3A2V A;  3C71 A;  3PIN A;  3ME8 A;  1GLQ A;  4AJ7 A;  4GF0 A;  3MAK A;  3GKX A;  3HJM A;  3RBT A;  2OBK A;  1AAZ A;  1FB6 A;  4XCS A;  5IO2 A;  4Z2U A;  3KD0 A;  3P8W A;  2ES7 A;  2IIY A;  5ECM B;  4AJ6 A;  5DAL B;  3EWL A;  3LXT A;  4YKF A;  2A2S A;  2AV4 A;  2C0D A;  2V6K A;  2YJ7 A;  2MMA A;  4EF0 A;  1O85 A;  2JZR A;  5B8A A;  3HA9 A;  4GCI A;  4GXZ A;  3N5O A;  5J4U A;  2KP1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...