2FLSA

Crystal structure of human glutaredoxin 2 complexed with glutathione
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
101
structure length
101
Chain Sequence
MPVNQIQETISDNCVVIFSKTSCSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKLLPLVHQCYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutaredoxin-2
publication title Crystal structure of Human Glutaredoxin 2 complexed with glutathione
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 35
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2006-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00462 Glutaredoxin Glutaredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2flsA00
3IK7A 1EP8A 2FD3A 1PL1A 2V41A 4MA9A 2DIYA 4HZ4A 1PMTA 3D21A 3CTGA 3QDNA 4G19A 5EY6A 3DIEA 3UMAA 1GRXA 3UEMA 1TRVA 5IIZA 1SJ6A 3KD0A 4F9ZA 2HYXA 2VCQA 2GDRA 19GSA 4K7OA 13GSA 4ZL7A 1MDKA 3ZMKA 3TOUA 2C4JA 2FCHA 3FK8A 1O73A 2JSYA 2K9FA 5B6MA 1A2MA 2L59A 5D96A 3RPNA 1NM3A 2VUPA 3US3A 1KTEA 1JLVA 1URMA 1OYJA 3ZYWA 1KEBA 2XPDA 2OE3A 2GZZA 4H86A 3ZIJA 4XRDA 4N0ZA 1XCCA 1V98A 5CP1A 3HJPA 2L4QA 1GSFA 1LBKA 4PUAA 3PH9A 4KDXA 3KTBA 4N11A 2WZ9A 5FWGA 1JLWA 1UC7A 3O6TA 3FR3A 2CVKA 3QOUA 2B7JA 4KCEA 4KH7A 1X0RA 3IBHA 3F3RA 2X8HA 1G6WA 4G10A 4MJCA 3D6IA 1S3AA 4IP6A 1GUMA 2GSTA 1LJRA 2GQLA 3TDGA 4TR1A 1WMJA 4YAVA 4YQVA 2GGTA 3P7XA 1J08A 4RI7A 4WBJA 1QXHA 1AC1A 4IW9A 2A2SA 5DJLA 4XRAA 1TK0B 1DBYA 2TRCP 4POLA 3JCML 3ZZXA 4EDZA 1YF0A 2CZ3A 2H19A 2WGRA 3E9JB 4DEJA 1BG5A 1A24A 2AB6A 2HXKA 2E0QA 5H5QA 1N8JA 1CQHA 10GSA 2P5RA 4K6XA 3M9KA 3F63A 3VWUA 2V6OA 1FW1A 2GT5A 3A2VA 4MP4A 2R4VA 1FVKA 5IO2A 3GX8A 3GN3A 4YQUA 2DJ3A 2QGVA 4HQZA 2N5AA 2GLRA 2VD0A 5IQYA 3F4TA 2IMIA 2H74A 2WFCA 2QC7A 1Z9HA 4IJIA 1FVJA 4X0XA 4ZBBA 1Z3EA 5KEJA 1OKDA 1ZYQB 1U3IA 2QKEA 3MSZA 4EUYA 1XPVA 4XS4B 2IMKA 2YV7A 4F03A 1WRYA 4KX4A 2YWOA 1B9YC 1GTAA 4AGSA 4DVCA 2K8SA 3QFBC 5ECOB 4EL1A 3EU3A 2A4VA 4CHSA 5IMAA 4FYCA 4GSSA 3FRCA 3UIWA 2FGXA 1YEXA 4GLTA 1HNCA 4O7HA 5J41A 1GTBA 3ZLPA 4I97A 5ELGA 3F4RA 3RAZA 5D8IA 3ZITA 2ZUPA 5KN1A 3GYKA 2HNLA 1USBA 4ZXGA 1I5GA 1XWCA 2XBIA 2C3NA 2DJKA 3F9UA 2VO4A 3L4NA 3FY7A 1PKZA 1HYUA 3HJMA 4GSTA 2I3YA 4ZB6A 3QFAC 1XW6A 1V57A 3QCPA 2HRFA 1Z6NA 2NVLA 1GSYA 2J23A 1U88A 2CAQA 3IOSA 1E2YA 1B4QA 4JBBA 3HDCA 1UN2A 3TRQA 1A2LA 5KN3A 1YZXA 3VWXA 3VI5A 2BMXA 2P31A 3HA9A 5DCHA 18GSA 3QD9A 1TK5B 5H5RA 5AN1A 3BCKA 4GQFA 2DMMA 1H75A 2LJRA 2PBJA 5B8BA 2VM1A 1GH2A 3UBKA 2H6ZA 2CZ2A 2OE0A 2H1BA 4KCAA 3EMXA 4HJ2A 3DVXA 1R7HA 4RQRA 2FA8A 2N5FA 3HVSA 3RDWA 5CYYA 5LCZA 2ZCTA 5FT3A 4K7IA 2EIQA 3BJ5A 3ZREA 3F6FA 3WT1A 2B1KA 2PU9C 1JZOA 4ZBDA 2HT9A 2IL3A 2H0GA 1X5CA 1ACVA 3ZFLA 1PL2A 2O85A 4IQAA 3FZ5A 4EC0A 1X9WB 3ED3A 1TOFA 3FZ4A 3L9UA 3C8EA 4OWYA 2ALBA 3LGCA 1TU7A 3TRXA 5LD0A 1PQNA 2XHFA 3DWVA 3GURA 1T8EB 2ZNMA 2R37A 4ULXA 4BPYA 5GAND 2YP6A 3KZQA 4XS1A 2FNOA 2VL3A 1SD9A 3DYRA 3WGXA 1VF2A 1M9AA 3RHBA 4PGTA 5LNKe 3RPPA 1XWBA 3BOAA 3GL3A 3MWHA 4IHUA 1K0DA 4J56E 4MMMA 1TK8B 1BEDA 3TKQA 1VF3A 1SK2A 2NPBA 4NV2A 1M2AA 4MF5A 1EV9A 2YWMA 3U6VA 1AQWA 2AJQB 3M8NA 1F6MC 3L78A 2HSYA 3A2XA 3D5JA 3KH7A 4HS1A 11GSA 3HVVA 1EEJA 3D22A 2O87A 17GSA 2YJ7A 3FZ9A 2LV3A 3GH9A 4XCSA 4WEYA 2DJ2A 4E8HA 3VPTA 5L71A 1W89A 4MJAA 5IPGA 3GL5A 2YJHA 4N30A 6GSXA 1NHYA 1M7TA 3ERFA 4ZBAA 3LEFA 4IELA 4CW9A 4KW6A 4RI6A 1XWGA 4RQXA 3ISOA 2HZFA 3NIVA 2FA4A 4HOJA 1T4ZA 2H70A 4MH3A 5CAXA 5DQSA 3H93A 4KSMA 2TRXA 5HR2A 3EU4A 2C0GA 1QGVA 1MEKA 9GSSA 4WR5A 2O89A 4OCFA 5CRWA 4PQHA 5IOWA 4ZL9A 3D4MA 3HCZA 2AV4A 3HHVA 4OFNA 1SKSB 1HNBA 3J7Yb 1O81A 5ECRB 5EVOA 3LJRA 1ZL9A 3KJYA 1F2EA 2HRNA 4I5QA 1R5PA 2IIYA 1QFNA 3IAS2 5HFGA 3SWLA 2D2ZA 2EIRA 4Q5RA 4EE0A 3WD6A 3H79A 3EINA 4JRRA 5ECSA 1XZOA 1YJ6A 2DMLA 3VPQA 4NHWA 2FHEA 4G2EA 1DE1A 2DJ0A 3A5WA 3C7MA 3W6GA 4FYBA 1SK1A 2X8CA 3E0UA 1PN9A 2OBKA 4GRFA 2YWNA 4L8EA 2GTUA 4NV5A 3HXSA 2V1MA 1OE8A 2GQKA 4Q5QA 5INYA 3VLNA 3CBUA 3F8UA 1K3LA 1BAYA 1JFUA 4WKWA 7GSSA 2JL4A 2XC2A 5DALA 1FHEA 1RQMA 2VAFA 4MPGA 2HE3A 1X5EA 3M1GA 3G7JA 4IKHA 4EKZA 1PRXA 4KGIA 1QUWA 3UVHA 2H8LA 5AISA 5ECLB 5ECNB 1SK0A 3PINA 1YEPA 4BVXA 4OFTA 5IOXA 1TJDA 4ILFA 4QL9A 1GTUA 3GH6A 1QMVA 2IMDA 5IM9A 1Q98A 4PQ1A 5DALB 2H0HA 2LTKA 2I9HA 4OO4A 5F8BA 4NPBA 1BYEA 2FWGA 3ZFBA 2GZYA 4KE3A 3PR8A 3BBYA 2YNXA 4IP1A 4DSRA 4HJMA 2H73A 2R3XA 1X5DA 1V2AA 2WJUA 4GTUA 2LJAA 2VLVA 3F3QA 3P8WA 2CVBA 5J3RA 3HD5A 5IMDA 5F07A 3W8SA 2GSQA 3HKRA 4OMVA 1SU9A 1ILOA 4MJEA 5E4WA 4ZIJA 1TP9A 4IBPA 2M72A 1YQ1A 1FOVA 1R4WA 5AGYA 3VWVA 2H0IA 2H1DA 5IMFA 1O6JA 2ON5A 3BD2A 1GWCA 1TRWA 4ZB8A 3VFIA 2IFQA 3KH9A 2YWIA 1E6BA 1V58A 20GSA 3GSSA 4HQSA 3H4KA 3EC3A 3GKKA 1GL8A 5B8AA 5IMVA 4JZQA 2G0FA 3W8JA 1U87A 1GP1A 4NMUA 3TOTA 1QQ2A 4K2DA 3CXGA 2H30A 1HD2A 3IE3A 4HEA2 3CSJA 3DGQA 2KP2A 5JCWA 5HFIA 4JU5A 2DC5A 3CYNA 1B9XC 2J9HA 2HZEA 4TR1B 2OBIA 1SL0B 4KDYA 1A2JA 3R2QA 1ZYEA 2F9SA 4XHMA 2IFQB 1ZMAA 4ECBA 1Y6EA 4IQ1A 1YY7A 4AJ8A 2RUFA 2KOKA 2I81A 2OJLA 1K3YA 1O8WA 4K7NA 2REMA 3ZTLA 4ECIA 1Z6MA 2VCWA 1TW9A 2HI7A 3WGDA 4PUFC 3ZL5A 3GRXA 3IDVA 4FH8A 3IHQA 1TTZA 2HZEB 4IS0A 3GFKA 4MZBA 1G7OA 4KNDA 1XVQA 1AXDA 3LWAA 1AQVA 1ERUA 1AAZA 2KLXA 2YANA 1IYIA 2JU5A 5HR0A 3D0ZA 1KBNA 1N2AA 4OD7A 3APOA 1VRSD 1PKWA 1PSQA 5D93A 2B7KA 3LYKA 3UVTA 4K0NA 3LXZA 3KMOA 5G5FA 4KSOA 2GZPA 3IAM2 4JR4A 1GSEA 5A4WA 12GSA 2LQQA 1IYHA 4KAEA 2KUCA 2CQ9A 1J9BA 1K0MA 2HSHA 1R5AA 4L5LA 14GSA 2RM5A 5JWQB 3GUSA 5A5KA 2L6CA 2VL9A 4ECJA 1TKDB 2JZSA 4V1Ag 5DBQA 2WCIA 1XVWA 2C8UA 2WRTA 1EP7A 3KIJA 3UOMA 3DD3A 1FG4A 2JZTA 3LSZA 2DIZA 3L9SA 3CMIA 3V1WA 2KHPA 4MABA 3FKFA 1XWKA 2F8AA 3RHCA 2A2RA 2LEGA 3IRAA 5DJMA 1ON4A 4JR6A 2QSIA 2HFDA 5ECKB 3HY2A 4DSSA 2PERA 5C00A 1O85A 3A2WA 3QAGA 3G7YA 5JCGA 3M3MA 4OO5A 3GX0A 2VCVA 4EXJA 1K0OA 3PGTA 2VIMA 4ECCA 3CRTA 6GSVA 1O8XA 1Z7RA 3FHKA 2C0DA 2K6VA 4WF4A 5ID2A 5KN2A 3EE2A 3A3TA 1ERVA 3DKSA 4MF7A 2FWHA 2C3TA 2O7KA 2CX4A 3LG6A 2H01A 3TJJA 2VCXA 3WYWA 5E59A 2CVDA 2VL2A 2IJYA 3HYPA 1DSBA 1SYXA 3TUEA 4EVMA 2LUSA 1OC8A 2YPMA 4L0UA 1G0TA 1OC3A 3GKNA 1M0UA 4IN0A 3N5OA 3TJKA 3TRPA 1SKWB 5G30A 5GSSA 4TN8A 22GSA 2B5EA 3UL3A 3GTUA 2FUG2 5J9CA 4O5RA 2B1LA 5IO0A 2H66A 4BWSA 2VOCA 4ZB9A 3VK9A 5CNWA 4QL7A 2FLSA 1THOA 4N0VA 4BA7A 2VCZA 3TKSA 1H4OA 1EOHA 4Q5NA 4PNFA 5DCGA 3ME8A 2GS3A 4I2UA 3GTUB 3CSHA 5J9BA 1EGRA 5D9XA 1NHOA 2YCDA 3C1SA 2BJXA 3IA1A 1X9MB 2LSTA 2E7PA 1UA5A 2L57A 2VCTA 3D4TA 2EIOA 4GWRA 4NWYA 2H1GA 2H75A 2OKAA 4K0GA 1OC9A 4WR4A 1A0FA 4BWQA 4IGJA 1TRSA 2I4AA 4HUAA 2LS5A 3QAVA 1F9MA 2JZRA 5COHA 4LL4B 2H6XA 5DAKA 2RLIA 1JZWA 1FAAA 1MDJA 5HQPA 2L5LA 4KB3A 4L5OA 4NHZA 2O8VB 2X99A 2PWJA 6GSYA 3DRNA 1HQOA 4E8EA 2IWTA 4XTSA 5F06A 4XS6A 2P0GA 2ON7A 3GNJA 2X8GA 2H72A 4MLYA 3DVWA 5GSTA 3ZIVA 4D73A 8GSSA 4POBA 3KM6A 3TKPA 1OC9B 3O3TA 3WT2A 1LU4A 2LKUA 5ELAA 2PVOC 2PMTA 2VM2A 3E3EA 4V2NA 1XOAA 5H5SA 3DEXA 2RUEA 3EYTA 1FB6A 6GSSA 3GA4A 4ZILA 3K8NA 5AIXA 1KNGA 1WE0A 4OFMA 5FHIA 4MDCA 3L0HA 2R2JA 1SL2B 1XBSA 4POMA 6GSUA 1NW2A 1TDIA 1PX7A 1RW1A 5DQYA 4YH2A 4WXTA 4F2IA 2VLTA 3F4SA 2GT6A 1K0AA 1EEMA 3IPZA 4JEDA 1GULA 3F0IA 1GSSA 3DMLA 4FYUA 1WJKA 3MAKA 1GSUA 1R26A 4TVEA 1V9WA 2V2GA 2VLUA 2LRNA 2YN1A 4F0BA 3KP9A 1A8LA 5G5EA 3VI7A 2CT6A 4O92A 2B5YA 1JZRA 3TCOA 4QQ7A 1F3AA 2MMAA 5G1LA 1YDKA 3EMPA 1THXA 2Z9SA 1B48A 2M46A 1FB0A 5ECHB 1GSDA 4IJ3A 3EURA 1PX6A 4I2TA 4AF2A 1QK8A 2K8VA 3VURA 4I8BA 3LORA 1Z7PA 3C71A 4MCUA 1AIUA 4ML6A 3UBLA 5CRGA 1HNAA 3FR9A 2RM6A 4NAXA 1K0BA 5DDLA 1EWXA 1OKTA 2N5BA 4FIWA 1ZZYA 1WWJA 2L4CA 3MDKA 4BL7A 3J7Yk 5B7CA 3O76A 5IMCA 1T7PB 4V2MA 3I69A 3TJFA 2F8FA 4BVYA 3CRUA 3GKXA 5D9WA 2LJKA 6GSTA 3GHAA 4ISDA 1K0CA 4Q5FA 1XXUA 4WF5A 2YZHA 2LNTA 3L9VA 1GUKA 1M9BA 1EV4A 2WDUA 4CDOA 1B4PA 2C3QA 2C0FA 1S3DA 4TR0A 4TW5A 1ERTA 2IMEA 4TRXA 1WIKA 3I6AA 1TU8A 3IC4A 4FO5A 3IR4A 1PD21 2GVPA 1OVNA 2H6YA 2C0EA 2LRCA 2AHEA 2IN3A 2X64A 2VD1A 1F3BA 2GSSA 3FR6A 4OCEA 3RBTA 1SL1B 1XOBA 2NDOA 1MTCA 4K1FA 3TGZA 1M99A 3APQA 3H1NA 2KP1A 1U3AA 5AIVA 3S9FA 1EZKA 1T00A 1M2BA 2M80A 2MMOA 1DE2A 1XW9A 4TKYA 2CAIA 1GNWA 3NZNA 4I6XA 1G6YA 1SENA 1TRUA 4RUVA 1U6TA 1AQXA 5ENUA 1X9SB 2LNSA 1FO5A 2MBSA 4WETA 1GTIA 3IXRA 2CV4A 3KP8A 5IMZA 2V6KA 4KDUA 4PNGA 3U5RE 2WB9A 4HU9A 3QAWA 1T4YA 3NOFA 2AYTA 1ST9A 2DJJA 3FW2A 1OAZA 3SBCA 4XS4A 2MBTA 1GNEA 5ECPB 1AW9A 3P2AA 2YOIA 2TIRA 3LYPA 3Q74A 1WP0A 3KTLA 1GUHA 4TR4A 5KN0A 16GSA 3UJ1A 1BX9A 5G1KA 1PGTA 3GV1A 3EVIA 2AUVA 4MZWA 2B5XA 3CSIA 6GSWA 4JE1A 2YV9A 3KXOA 4AJ6A 1GLQA 5F05A 3VWWA 4J2FA 2GSRA 5CRDA 4PURA 2E2MA 2F51A 3WGEA 4LL1B 5GZZB 2C80A 4MH2A 3ZVJA 4ML1A 3KMNA 2C1YA 4MJBA 2NTOA 5A4VA 3TKRA 1ERWA 4O32A 2B6MA 1UVZA 2CX3A 1GLPA 3I9V2 4X43A 1Q4JA 2DSAA 5GAPD 2R6KA 2ES7A 4GSNA 2NBSA 5D73A 3Q18A 5G31A 4V1Ap 3M0FA 4EF0A 2P5QA 1A8YA 1M2DA 2XPEA 4TXOA 2VL2C 2B3SA 3FZAA 4LLRA 3AY8A 2PN8A 2WULA 2V32A 3TB2A 4YAPA 4J57E 3LQ7A 3APSA 3TJBA 1A23A 5HFKA 4K9ZA 4PX1A 2GQMA 4AJ7A 1TI3A 1SJIA 2I1UA 3GKMA 3M9JA 4MK3A 3F6DA 3ME7A 1AUCA 1SJZA 3KCMA 4MPFA 3N9JA 3HZ8A 4TXOB 1SD8A 3HVXA 2FWEA 4LA1A 5ECMB 5IPHA 3FEUA 1VF4A 3OR5A 1PA3A 2OE1A 1WOUA 4DSSB 4L0WA 5C04A 4MF6A 4LMWA 3KEBA 1G7EA 5A4UA 2PGTA 3C1RA 1JHBA 4XIHA 2EC4A 4LMVA 3TKSC 2F3MA 3ZVJD 2MYGA 5HR1A 3FYGA 4YQMA 2HLSA 1O7UA 4TXVA 1V40A 2OADA 1ZOFA 1XW5A 4N10A 4ZL8A 3G7IA 5JWOB 1C72A 4GXZA 1A0RP 2FY6A 2L5OA 5ID2B 1YF1A 3C73A 1MD4A 3LXTA 3IV4A 2IPAA 4ACSA 4IVFA 3LFLA 2RIIA 3QR6A 5CRHA 1MDIA 1T1VA 3DXBA 3ERGA 3BCIA 5JCUA 4EDYA 4HI7A 1ML6A 1MD3A 1VGLA 1XFLA 1ABAA 1Z5YE 4PXOA 5ECIB 4ID0A 3QMXA 5ECQB 2OA7A 4F0CA 4NXIA 5ABRA 4HU7A 2PPTA 1RK4A 4HDEA 5D9TA 1J0FA 2JSZA 5J4UA 1YKCA 5JWRB 2H1AA 3CTFA 1T3BA 4DSQA 2DJ1A 2YZUA 1W4VA 4GCIA 5G2ZA 2CA8A 4PQIA 3G9BA 2K18A 1NSWA 2MMNA 2FWFA 3Q6OA 1OE7A 1WPIA 2L6DA 4GF0A 5CREA 3H8QA 2R5GA 4V2LA 4KA0A 2WS2A 1BQ7A 1VF1A 2BTOT 1K0NA 1S3CA 1ZCPA 1I9DA 2JACA 1TI1A 3UAPA 1CQGA 2XBQA 5DVBA 4TOPA 1EGOA 4POKA 2MZCA 3TJGA 2PVQA 3HZ4A 5EL8A 4KUNA 1BJXA 4X1UA 2LQOA 1GSQA 3GSTA 3EWLA 1JZDA 2H76A 1SYRA 1EOGA 3MNGA 2E2GA 3UARA 4WBRD 5EPFA 3ZRDA 2OACA 5J5NA 1F37A 1Y25A 3ZMLA 3ERWA 1XWAA 5DAKB 1DUGA 2H71A 2DLXA 1TXXA 2AAWA 2G2QA 4HZ2A 4G9HA 3IK9A 3P90A 1ZGNA 4K8MA 5F0GA 4TR3A 1YKAA 1SKRB 2LRTA 2JADA 2MMZA 2PUKC 4F82A 3TKSE 4GQCA 3GIXA 5CO3A 3HJOA 4D73B 4P3YB 3KGKA 4MZCA 3QPMA 2IMFA 3Q19A 3GMFA 5HR3A 1XIYA 3I43A 5D9VA 2DBCA 1K3OA 5B6NA 4Z7XA 4EO3A 1B8XA
chains in the Genus database with same CATH superfamily
3IK7A 1EP8A 2FD3A 1PL1A 2V41A 4MA9A 2DIYA 4HZ4A 1PMTA 3D21A 3CTGA 3QDNA 4G19A 5EY6A 3DIEA 3UMAA 1GRXA 3UEMA 1TRVA 5IIZA 1SJ6A 3KD0A 4F9ZA 2HYXA 2VCQA 2GDRA 19GSA 4K7OA 13GSA 4ZL7A 1MDKA 3ZMKA 3TOUA 2C4JA 2FCHA 3FK8A 1O73A 2JSYA 2K9FA 5B6MA 1A2MA 2L59A 5D96A 3RPNA 1NM3A 2VUPA 3US3A 1KTEA 1JLVA 1URMA 1OYJA 3ZYWA 1KEBA 2XPDA 2OE3A 2GZZA 4H86A 3ZIJA 4XRDA 4N0ZA 1XCCA 1V98A 5CP1A 3HJPA 2L4QA 1GSFA 1LBKA 4PUAA 3PH9A 4KDXA 3KTBA 4N11A 2WZ9A 5FWGA 1JLWA 1UC7A 3O6TA 3FR3A 2CVKA 3QOUA 2B7JA 4KCEA 4KH7A 1X0RA 3IBHA 4BVYB 3F3RA 2X8HA 1G6WA 4G10A 4MJCA 3D6IA 1S3AA 4IP6A 1GUMA 2GSTA 1LJRA 2GQLA 3TDGA 4TR1A 1WMJA 4YAVA 4YQVA 2GGTA 3P7XA 1J08A 4RI7A 4WBJA 1QXHA 1AC1A 4IW9A 2A2SA 5DJLA 4XRAA 1TK0B 1DBYA 2TRCP 4POLA 3JCML 3ZZXA 4EDZA 1YF0A 2CZ3A 2H19A 2WGRA 3E9JB 4DEJA 1BG5A 1A24A 2AB6A 2HXKA 2E0QA 5H5QA 1N8JA 1CQHA 10GSA 2P5RA 4K6XA 3M9KA 3F63A 3VWUA 2V6OA 1FW1A 2GT5A 3A2VA 4MP4A 2R4VA 1FVKA 5IO2A 3GX8A 3GN3A 4YQUA 2DJ3A 2QGVA 4HQZA 2N5AA 2GLRA 2VD0A 5IQYA 3F4TA 2IMIA 2H74A 4HSCX 2WFCA 2QC7A 1Z9HA 4IJIA 1FVJA 4X0XA 4ZBBA 1Z3EA 5KEJA 1OKDA 1ZYQB 1U3IA 2QKEA 4O5UA 3MSZA 4K2XA 4EUYA 1XPVA 4XS4B 2IMKA 2YV7A 4F03A 1WRYA 4KX4A 2YWOA 1B9YC 1GTAA 4AGSA 2UZ8A 4DVCA 2K8SA 3QFBC 5ECOB 4EL1A 3EU3A 2A4VA 4CHSA 5IMAA 4FYCA 4GSSA 3FRCA 3UIWA 2FGXA 1YEXA 4GLTA 1HNCA 4O7HA 5J41A 1GTBA 3ZLPA 4I97A 5ELGA 3F4RA 3RAZA 5D8IA 3ZITA 2ZUPA 5KN1A 3GYKA 2HNLA 1USBA 4ZXGA 1XG8A 1I5GA 1XWCA 2XBIA 2C3NA 2DJKA 3F9UA 2VO4A 3R3EA 3L4NA 3FY7A 1PKZA 1HYUA 3HJMA 4GSTA 2I3YA 4ZB6A 3QFAC 4YKFA 1XW6A 4MNNA 2HSMA 1V57A 3QCPA 2HRFA 1Z6NA 2NVLA 1GSYA 2J23A 1U88A 2CAQA 3IOSA 1E2YA 2DKHA 1B4QA 4JBBA 3HDCA 1UN2A 3TRQA 1A2LA 5KN3A 1YZXA 3VWXA 3VI5A 2BMXA 3IHGA 2P31A 3HA9A 5DCHA 18GSA 4G0LA 3QD9A 1TK5B 5H5RA 3BCKA 5AN1A 4GQFA 2DMMA 1H75A 2LJRA 2PBJA 5B8BA 2VM1A 1GH2A 3UBKA 2H6ZA 2CZ2A 2OE0A 2H1BA 4KCAA 3EMXA 4HJ2A 3DVXA 1R7HA 4RQRA 2FA8A 2N5FA 3HVSA 3RDWA 5CYYA 5LCZA 2ZCTA 5FT3A 4K7IA 2EIQA 3BJ5A 3ZREA 3F6FA 3WT1A 2B1KA 2PU9C 1JZOA 4ZBDA 2HT9A 2IL3A 2H0GA 1X5CA 1ACVA 3ZFLA 1PL2A 2O85A 4IQAA 3FZ5A 4EC0A 1X9WB 3ED3A 1TOFA 3FZ4A 3L9UA 3C8EA 4OWYA 2ALBA 3LGCA 1TU7A 3TRXA 5LD0A 1PQNA 2XHFA 3DWVA 3GURA 1T8EB 2ZNMA 2R37A 4ULXA 4BPYA 5GAND 2YP6A 3KZQA 4XS1A 2FNOA 2VL3A 1SD9A 3DYRA 3WGXA 1VF2A 1M9AA 3RHBA 4PGTA 5LNKe 3RPPA 1XWBA 3BOAA 3GL3A 3MWHA 4IHUA 1K0DA 4J56E 4MMMA 1TK8B 1BEDA 3TKQA 4CY6A 1VF3A 1SK2A 2NPBA 4NV2A 1M2AA 4MF5A 1EV9A 2YWMA 3U6VA 1AQWA 2AJQB 2HRKA 3M8NA 1F6MC 3L78A 2HSYA 3A2XA 3D5JA 5BMUA 3KH7A 4HS1A 11GSA 3HVVA 1EEJA 3D22A 2O87A 17GSA 2YJ7A 3FZ9A 2LV3A 3GH9A 4XCSA 4WEYA 2DJ2A 4E8HA 3VPTA 5L71A 1W89A 4KF9A 4MJAA 5IPGA 3GL5A 2YJHA 4N30A 6GSXA 1NHYA 1M7TA 3ERFA 4ZBAA 3LEFA 4IELA 4CW9A 4KW6A 4RI6A 1XWGA 4RQXA 3ISOA 2HZFA 3NIVA 2FA4A 4HOJA 1T4ZA 1S3RA 2H70A 4MH3A 5CAXA 4Z2TA 5DQSA 3H93A 4KSMA 2TRXA 5HR2A 3EU4A 2C0GA 4Z2UA 1QGVA 1MEKA 9GSSA 4WR5A 2O89A 4OCFA 5CRWA 4PQHA 5IOWA 4ZL9A 3D4MA 3HCZA 2AV4A 3HHVA 4OFNA 1SKSB 1HNBA 3J7Yb 1O81A 5ECRB 5EVOA 3LJRA 1ZL9A 1PFOA 3KJYA 1F2EA 2HRNA 4I5QA 1R5PA 2IIYA 1QFNA 3IAS2 5HFGA 3SWLA 2D2ZA 2EIRA 4Q5RA 4EE0A 3WD6A 3H79A 3EINA 4JRRA 5ECSA 1XZOA 1YJ6A 2DMLA 3VPQA 4NHWA 2FHEA 4G2EA 1DE1A 2DJ0A 3A5WA 3C7MA 3W6GA 4FYBA 1SK1A 2X8CA 3E0UA 1PN9A 2OBKA 4GRFA 2YWNA 4L8EA 2GTUA 4NV5A 3HXSA 2V1MA 1OE8A 2GQKA 4Q5QA 5INYA 3VLNA 3CBUA 3F8UA 1K3LA 1BAYA 1JFUA 4WKWA 7GSSA 2JL4A 2XC2A 5DALA 1FHEA 1RQMA 2VAFA 3PPUA 4MPGA 2HE3A 1X5EA 3M1GA 3G7JA 4IKHA 4EKZA 1PRXA 4KGIA 1QUWA 3UVHA 2H8LA 5AISA 5ECLB 5ECNB 1SK0A 3PINA 1YEPA 4BVXA 4OFTA 5IOXA 1TJDA 4ILFA 4QL9A 1GTUA 3GH6A 1QMVA 2IMDA 5IM9A 1Q98A 4PQ1A 5DALB 2H0HA 2LTKA 2I9HA 4OO4A 5F8BA 4NPBA 1BYEA 2FWGA 3ZFBA 2GZYA 4KE3A 3PR8A 3BBYA 2YNXA 4IP1A 4DSRA 4HJMA 2H73A 2R3XA 1X5DA 1V2AA 2WJUA 4GTUA 2LJAA 2VLVA 3F3QA 3P8WA 2CVBA 5J3RA 3HD5A 5IMDA 5F07A 3W8SA 2GSQA 3HKRA 4OMVA 1SU9A 1ILOA 4MJEA 5E4WA 4ZIJA 1TP9A 4IBPA 2M72A 1YQ1A 1FOVA 1R4WA 5AGYA 3VWVA 2H0IA 2H1DA 5IMFA 1O6JA 2ON5A 3BD2A 1GWCA 1TRWA 4ZB8A 2A2PA 3VFIA 2IFQA 3KH9A 2YWIA 1E6BA 1V58A 20GSA 3GSSA 4HQSA 3H4KA 3EC3A 3GKKA 1GL8A 5B8AA 5IMVA 4JZQA 2G0FA 3W8JA 1U87A 1GP1A 4NMUA 3TOTA 1QQ2A 4K2DA 3CXGA 2H30A 1HD2A 3IE3A 4HEA2 3CSJA 3DGQA 2KP2A 5JCWA 5HFIA 4JU5A 2DC5A 3CYNA 1B9XC 2J9HA 2HZEA 4TR1B 2OBIA 1SL0B 4KDYA 1A2JA 3R2QA 1ZYEA 2F9SA 4XHMA 2IFQB 1ZMAA 4ECBA 1Y6EA 4IQ1A 1YY7A 4AJ8A 2RUFA 2KOKA 2I81A 2OJLA 1K3YA 1O8WA 4K7NA 2REMA 3ZTLA 4ECIA 1Z6MA 2VCWA 1TW9A 2HI7A 3WGDA 4PUFC 3ZL5A 3GRXA 3IDVA 4FH8A 3IHQA 1TTZA 2HZEB 4IS0A 3GFKA 4MZBA 1G7OA 4KNDA 4YKGA 1XVQA 1AXDA 3LWAA 1AQVA 1ERUA 1AAZA 2KLXA 1M3JA 2YANA 4ICYA 1IYIA 2JU5A 5HR0A 3D0ZA 1KBNA 1N2AA 5BRTA 4OD7A 3APOA 1VRSD 1PKWA 1PSQA 5D93A 2B7KA 3LYKA 3UVTA 4K0NA 3LXZA 3KMOA 5G5FA 4KSOA 2GZPA 3IAM2 4JR4A 1GSEA 5A4WA 12GSA 2LQQA 1IYHA 4KAEA 2KUCA 2CQ9A 1J9BA 1K0MA 2HSHA 1R5AA 4L5LA 14GSA 2RM5A 5JWQB 3GUSA 5A5KA 2L6CA 2VL9A 4ECJA 1TKDB 2JZSA 4V1Ag 5DBQA 2WCIA 1XVWA 2C8UA 2WRTA 1EP7A 3KIJA 3UOMA 3DD3A 1FG4A 2JZTA 3LSZA 2DIZA 3L9SA 3CMIA 3V1WA 2KHPA 4K5SA 4MABA 3FKFA 1PN0A 1XWKA 2F8AA 3RHCA 2A2RA 2LEGA 3IRAA 5DJMA 1ON4A 4JR6A 2QSIA 2HFDA 5ECKB 3HY2A 4DSSA 2PERA 5C00A 4O5QA 1O85A 3A2WA 3QAGA 3G7YA 5JCGA 3M3MA 4OO5A 3GX0A 2VCVA 4G0IA 1K0OA 4EXJA 3PGTA 2VIMA 4ECCA 4Z2RA 3CRTA 6GSVA 1O8XA 1Z7RA 3FHKA 2C0DA 2K6VA 4WF4A 5ID2A 5KN2A 3EE2A 3A3TA 1ERVA 3DKSA 4MF7A 2FWHA 2C3TA 2O7KA 2CX4A 3LG6A 2H01A 3TJJA 3HVNA 2VCXA 3LW9A 3WYWA 5E59A 2CVDA 2VL2A 2IJYA 3HYPA 1DSBA 1SYXA 3TUEA 4EVMA 2LUSA 1OC8A 2YPMA 4L0UA 1G0TA 1OC3A 3GKNA 1M0UA 4IN0A 3N5OA 3TJKA 3TRPA 1SKWB 5G30A 5GSSA 4TN8A 22GSA 2B5EA 3UL3A 3GTUA 2FUG2 5J9CA 4O5RA 2B1LA 5IO0A 2H66A 4BWSA 2VOCA 4ZB9A 3VK9A 5CNWA 4QL7A 2FLSA 1THOA 4EIQA 4N0VA 4BA7A 2VCZA 3TKSA 1H4OA 1EOHA 4Q5NA 4PNFA 5DCGA 3ME8A 2GS3A 4FQUA 4I2UA 3GTUB 3CSHA 5J9BA 1EGRA 5D9XA 1NHOA 2YCDA 3C1SA 2BJXA 3IA1A 1X9MB 2LSTA 2E7PA 1UA5A 2L57A 2VCTA 3D4TA 2EIOA 4GWRA 4NWYA 2H1GA 2H75A 2OKAA 4K0GA 1OC9A 4WR4A 1A0FA 4BWQA 4IGJA 1TRSA 2I4AA 4HUAA 2LS5A 3QAVA 1F9MA 2JZRA 4A5PA 5COHA 4LL4B 2H6XA 5DAKA 2RLIA 1JZWA 1FAAA 1MDJA 5HQPA 2L5LA 4KB3A 4L5OA 4NHZA 2O8VB 2X99A 2PWJA 6GSYA 3DRNA 1HQOA 4E8EA 2IWTA 4XTSA 5F06A 4XS6A 2P0GA 2ON7A 3GNJA 4BIKA 2X8GA 2H72A 4MLYA 3DVWA 5GSTA 3ZIVA 4D73A 8GSSA 4POBA 3KM6A 3TKPA 1OC9B 3O3TA 3WT2A 1LU4A 2LKUA 5ELAA 2PVOC 2PMTA 2VM2A 3E3EA 4V2NA 1XOAA 2QA2A 5H5SA 3DEXA 2RUEA 3EYTA 1M3IA 1FB6A 6GSSA 3GA4A 4ZILA 3K8NA 5AIXA 1KNGA 1WE0A 4OFMA 5FHIA 4MDCA 3L0HA 2R2JA 1SL2B 1XBSA 4POMA 6GSUA 1NW2A 1TDIA 1PX7A 1RW1A 4YH2A 5DQYA 4EIPA 4WXTA 4F2IA 2VLTA 3F4SA 2GT6A 1K0AA 1EEMA 3IPZA 4JEDA 1GULA 3F0IA 1GSSA 3DMLA 4FYUA 1FOHA 1WJKA 3MAKA 1GSUA 1R26A 4TVEA 1V9WA 2V2GA 2VLUA 2LRNA 2YN1A 4F0BA 3KP9A 1A8LA 5G5EA 3VI7A 2CT6A 4O92A 2B5YA 3EPTA 1JZRA 3TCOA 4QQ7A 1F3AA 2MMAA 5G1LA 1YDKA 3EMPA 1THXA 2Z9SA 1B48A 2M46A 1FB0A 5ECHB 1GSDA 4IJ3A 3EURA 1PX6A 4I2TA 4AF2A 1QK8A 2K8VA 3VURA 4I8BA 3LORA 1Z7PA 3C71A 4MCUA 1AIUA 4ML6A 3UBLA 5CRGA 1HNAA 3FR9A 2RM6A 4NAXA 1K0BA 2X4AA 5DDLA 1EWXA 1OKTA 2N5BA 4FIWA 1ZZYA 1WWJA 2L4CA 3MDKA 4BL7A 3J7Yk 3A5IA 5B7CA 3O76A 5IMCA 1T7PB 4V2MA 3I69A 3TJFA 2F8FA 4BVYA 3CRUA 3GKXA 5D9WA 2LJKA 6GSTA 3GHAA 4ISDA 1K0CA 4Q5FA 1XXUA 4WF5A 2YZHA 2LNTA 3L9VA 1GUKA 1M9BA 1EV4A 2WDUA 4BVXB 4CDOA 1B4PA 2C3QA 2C0FA 1S3DA 4TR0A 4TW5A 1ERTA 2IMEA 4BL7B 4TRXA 1WIKA 3I6AA 1TU8A 3IC4A 4FO5A 3IR4A 1PD21 2GVPA 1OVNA 2H6YA 2C0EA 2LRCA 2AHEA 2IN3A 2X64A 2VD1A 1F3BA 2GSSA 3FR6A 4OCEA 3RBTA 1SL1B 1XOBA 2NDOA 1MTCA 4K1FA 3TGZA 1M99A 3APQA 3H1NA 2KP1A 1U3AA 2R0CA 5AIVA 3S9FA 1EZKA 1T00A 1M2BA 2M80A 2MMOA 1DE2A 4PTSA 1XW9A 4TKYA 2CAIA 1GNWA 3NZNA 4I6XA 1G6YA 1SENA 1TRUA 4RUVA 1U6TA 1AQXA 5ENUA 1X9SB 2LNSA 1FO5A 2MBSA 4WETA 1GTIA 3IXRA 2CV4A 3KP8A 5IMZA 2V6KA 4KDUA 4PNGA 3U5RE 2WB9A 4HU9A 3QAWA 1T4YA 3NOFA 2AYTA 1ST9A 2DJJA 3FW2A 1OAZA 3SBCA 4XS4A 3MYDA 2MBTA 1GNEA 5ECPB 1AW9A 3P2AA 2YOIA 2TIRA 3LYPA 3Q74A 1WP0A 3KTLA 1GUHA 4TR4A 5KN0A 16GSA 3UJ1A 1BX9A 5G1KA 1PGTA 3GV1A 3EVIA 2AUVA 2QA1A 4MZWA 2B5XA 3CSIA 6GSWA 4JE1A 2YV9A 3KXOA 4AJ6A 1GLQA 5F05A 3VWWA 4J2FA 2GSRA 5CRDA 3MIXA 4PURA 2E2MA 2F51A 3WGEA 4LL1B 5GZZB 2C80A 4MH2A 3ZVJA 4ML1A 3KMNA 2C1YA 4MJBA 2NTOA 5A4VA 3TKRA 1ERWA 1ZYPA 2B6MA 4O32A 1UVZA 2CX3A 1GLPA 3I9V2 4X43A 1Q4JA 2DSAA 5GAPD 2R6KA 2ES7A 4GSNA 2NBSA 4X4JA 5D73A 3Q18A 5G31A 4V1Ap 3M0FA 4EF0A 2P5QA 1A8YA 1M2DA 2XPEA 4TXOA 2VL2C 2B3SA 3FZAA 4LLRA 3AY8A 2PN8A 5KOWA 2WULA 2V32A 3TB2A 4YAPA 4J57E 4CY8A 3LQ7A 3APSA 2R0PA 3TJBA 1A23A 5HFKA 4K9ZA 4PX1A 2GQMA 4AJ7A 1TI3A 1SJIA 2I1UA 3GKMA 3M9JA 4MK3A 3F6DA 3ME7A 1AUCA 1SJZA 3KCMA 4MPFA 3N9JA 2A4HA 3HZ8A 4TXOB 1SD8A 3HVXA 2FWEA 4LA1A 5ECMB 5IPHA 3FEUA 1VF4A 3OR5A 1PA3A 2OE1A 1WOUA 4DSSB 4L0WA 5C04A 4MF6A 4K5RA 4LMWA 3KEBA 1G7EA 5A4UA 2PGTA 3C1RA 1JHBA 4XIHA 2EC4A 4LMVA 3TKSC 2F3MA 3ZVJD 2MYGA 5HR1A 3FYGA 4YQMA 2HLSA 1O7UA 4TXVA 2R0GA 1V40A 1ZYNA 2OADA 1ZOFA 1XW5A 4N10A 4ZL8A 3G7IA 5JWOB 1C72A 4GXZA 1A0RP 2FY6A 2L5OA 5ID2B 1YF1A 3C73A 1MD4A 3LXTA 3IV4A 2IPAA 4ACSA 4IVFA 3LFLA 2RIIA 3QR6A 5CRHA 1MDIA 1T1VA 3DXBA 3ERGA 3BCIA 5JCUA 4EDYA 4HI7A 1ML6A 1MD3A 1VGLA 1XFLA 1ABAA 1Z5YE 4PXOA 5ECIB 4ID0A 3QMXA 5ECQB 2OA7A 4F0CA 4NXIA 5ABRA 4HU7A 2PPTA 1RK4A 4HDEA 5D9TA 1J0FA 2JSZA 5J4UA 3FMWA 1YKCA 5JWRB 2H1AA 3CTFA 1T3BA 4DSQA 2DJ1A 2YZUA 1W4VA 4GCIA 5G2ZA 2CA8A 4PQIA 3G9BA 2K18A 1NSWA 2MMNA 2FWFA 3Q6OA 1OE7A 1WPIA 2L6DA 4GF0A 5CREA 3H8QA 2R5GA 4G0KA 4V2LA 4KA0A 2WS2A 1BQ7A 1VF1A 2BTOT 1K0NA 1S3CA 1ZCPA 1I9DA 2JACA 1TI1A 3UAPA 1CQGA 2XBQA 5DVBA 4TOPA 1EGOA 4POKA 2MZCA 3TJGA 2PVQA 3HZ4A 5EL8A 4KUNA 1BJXA 4X1UA 2LQOA 1GSQA 2X49A 3GSTA 3EWLA 1JZDA 2H76A 1SYRA 1EOGA 3MNGA 2E2GA 3UARA 4WBRD 5EPFA 3ZRDA 2OACA 5J5NA 1F37A 1Y25A 3ZMLA 3ERWA 1XWAA 5DAKB 1DUGA 2H71A 2DLXA 1TXXA 2AAWA 5KOXA 2G2QA 4HZ2A 4G9HA 3IK9A 3P90A 1ZGNA 4K8MA 4USSA 4TR3A 5F0GA 1YKAA 1SKRB 2LRTA 2JADA 2MMZA 2PUKC 4F82A 3TKSE 3CQFA 4GQCA 3GIXA 5CO3A 3HJOA 4D73B 4P3YB 3KGKA 4MZCA 3QPMA 2IMFA 3Q19A 3GMFA 5HR3A 1XIYA 2HRAA 3I43A 3IC8A 5D9VA 2DKIA 2DBCA 1K3OA 5B6NA 4Z7XA 4EO3A 1B8XA
chains in the Genus database with same CATH topology
3IK7A 1EP8A 2FD3A 1PL1A 2V41A 4MA9A 2DIYA 4HZ4A 1PMTA 3D21A 3CTGA 3QDNA 4G19A 5EY6A 3DIEA 3UMAA 1GRXA 3UEMA 1TRVA 5IIZA 1SJ6A 3KD0A 4F9ZA 2HYXA 2VCQA 2GDRA 19GSA 4K7OA 13GSA 4ZL7A 1MDKA 3ZMKA 3TOUA 2C4JA 2FCHA 3FK8A 1O73A 2JSYA 2K9FA 5B6MA 1A2MA 2L59A 5D96A 3RPNA 1NM3A 2VUPA 3US3A 1KTEA 1JLVA 1URMA 1OYJA 3ZYWA 1KEBA 2XPDA 2OE3A 2GZZA 4H86A 3ZIJA 4XRDA 4N0ZA 1XCCA 1V98A 5CP1A 3HJPA 2L4QA 1GSFA 1LBKA 4PUAA 3PH9A 4KDXA 3KTBA 4N11A 2WZ9A 5FWGA 1JLWA 1UC7A 3O6TA 3FR3A 2CVKA 3QOUA 2B7JA 4KCEA 4KH7A 1X0RA 3IBHA 4BVYB 3F3RA 2X8HA 1G6WA 4G10A 4MJCA 3D6IA 1S3AA 4IP6A 1GUMA 2GSTA 1LJRA 2GQLA 3TDGA 4TR1A 1WMJA 4YAVA 4YQVA 2GGTA 3P7XA 1J08A 4RI7A 4WBJA 1QXHA 1AC1A 4IW9A 2A2SA 5DJLA 4XRAA 1TK0B 1DBYA 2TRCP 4POLA 3JCML 3ZZXA 4EDZA 1YF0A 2CZ3A 2H19A 2WGRA 3E9JB 4DEJA 1BG5A 1A24A 2AB6A 2HXKA 2E0QA 5H5QA 1N8JA 1CQHA 10GSA 2P5RA 4K6XA 3M9KA 3F63A 3VWUA 2V6OA 1FW1A 2GT5A 3A2VA 4MP4A 2R4VA 1FVKA 5IO2A 3GX8A 3GN3A 4YQUA 2DJ3A 2QGVA 4HQZA 2N5AA 2GLRA 2VD0A 5IQYA 3F4TA 2IMIA 2H74A 2WFCA 2QC7A 1Z9HA 4IJIA 1FVJA 4X0XA 4ZBBA 1Z3EA 5KEJA 1OKDA 1ZYQB 1U3IA 2QKEA 4O5UA 3MSZA 4K2XA 4EUYA 1XPVA 4XS4B 2IMKA 2YV7A 4F03A 1WRYA 4KX4A 2YWOA 1B9YC 1GTAA 4AGSA 2UZ8A 4DVCA 2K8SA 3QFBC 5ECOB 4EL1A 3EU3A 2A4VA 4CHSA 5IMAA 4FYCA 4GSSA 3FRCA 3UIWA 2FGXA 1YEXA 4GLTA 1HNCA 4O7HA 5J41A 1GTBA 3ZLPA 4I97A 5ELGA 3F4RA 3RAZA 5D8IA 3ZITA 2ZUPA 5KN1A 3GYKA 2HNLA 1USBA 4ZXGA 1I5GA 1XWCA 2XBIA 2C3NA 2DJKA 3F9UA 2VO4A 3R3EA 3L4NA 3FY7A 1PKZA 1HYUA 3HJMA 4GSTA 2I3YA 4ZB6A 3QFAC 4YKFA 1XW6A 4MNNA 2HSMA 1V57A 3QCPA 2HRFA 1Z6NA 2NVLA 1GSYA 2J23A 1U88A 2CAQA 3IOSA 1E2YA 2DKHA 1B4QA 4JBBA 3HDCA 1UN2A 3TRQA 1A2LA 5KN3A 1YZXA 3VWXA 3VI5A 2BMXA 3IHGA 2P31A 3HA9A 5DCHA 18GSA 4G0LA 3QD9A 1TK5B 5H5RA 3BCKA 5AN1A 4GQFA 2DMMA 1H75A 2LJRA 2PBJA 5B8BA 2VM1A 1GH2A 3UBKA 2H6ZA 2CZ2A 2OE0A 2H1BA 4KCAA 3EMXA 4HJ2A 3DVXA 1R7HA 4RQRA 2FA8A 2N5FA 3HVSA 3RDWA 5CYYA 5LCZA 2ZCTA 5FT3A 4K7IA 2EIQA 3BJ5A 3ZREA 3F6FA 3WT1A 2B1KA 2PU9C 1JZOA 4ZBDA 2HT9A 2IL3A 2H0GA 1X5CA 1ACVA 3ZFLA 1PL2A 2O85A 4IQAA 3FZ5A 4EC0A 1X9WB 3ED3A 1TOFA 3FZ4A 3L9UA 3C8EA 4OWYA 2ALBA 3LGCA 1TU7A 3TRXA 5LD0A 1PQNA 2XHFA 3DWVA 3GURA 1T8EB 2ZNMA 2R37A 4ULXA 4BPYA 5GAND 2YP6A 3KZQA 4XS1A 2FNOA 2VL3A 1SD9A 3DYRA 3WGXA 1VF2A 1M9AA 3RHBA 4PGTA 5LNKe 3RPPA 1XWBA 3BOAA 3GL3A 3MWHA 4IHUA 1K0DA 4J56E 4MMMA 1TK8B 1BEDA 3TKQA 4CY6A 1VF3A 1SK2A 2NPBA 4NV2A 1M2AA 4MF5A 1EV9A 2YWMA 3U6VA 1AQWA 2AJQB 2HRKA 3M8NA 1F6MC 3L78A 2HSYA 3A2XA 3D5JA 5BMUA 3KH7A 4HS1A 11GSA 3HVVA 1EEJA 3D22A 2O87A 17GSA 2YJ7A 3FZ9A 2LV3A 3GH9A 4XCSA 4WEYA 2DJ2A 4E8HA 3VPTA 5L71A 1W89A 4KF9A 4MJAA 5IPGA 3GL5A 2YJHA 4N30A 6GSXA 1NHYA 1M7TA 3ERFA 4ZBAA 3LEFA 4IELA 4CW9A 4KW6A 4RI6A 1XWGA 4RQXA 3ISOA 2HZFA 3NIVA 2FA4A 4HOJA 1T4ZA 2H70A 4MH3A 5CAXA 4Z2TA 5DQSA 3H93A 4KSMA 2TRXA 5HR2A 3EU4A 2C0GA 4Z2UA 1QGVA 1MEKA 9GSSA 4WR5A 2O89A 4OCFA 5CRWA 4PQHA 5IOWA 4ZL9A 3D4MA 3HCZA 2AV4A 3HHVA 4OFNA 1SKSB 1HNBA 3J7Yb 1O81A 5ECRB 5EVOA 3LJRA 1ZL9A 3KJYA 1F2EA 2HRNA 4I5QA 1R5PA 2IIYA 1QFNA 3IAS2 5HFGA 3SWLA 2D2ZA 2EIRA 4Q5RA 4EE0A 3WD6A 3H79A 3EINA 4JRRA 5ECSA 1XZOA 1YJ6A 2DMLA 3VPQA 4NHWA 2FHEA 4G2EA 1DE1A 2DJ0A 3A5WA 3C7MA 3W6GA 4FYBA 1SK1A 2X8CA 3E0UA 1PN9A 2OBKA 4GRFA 2YWNA 4L8EA 2GTUA 4NV5A 3HXSA 2V1MA 1OE8A 2GQKA 4Q5QA 5INYA 3VLNA 3CBUA 3F8UA 1K3LA 1BAYA 1JFUA 4WKWA 7GSSA 2JL4A 2XC2A 5DALA 1FHEA 1RQMA 2VAFA 3PPUA 4MPGA 2HE3A 1X5EA 3M1GA 3G7JA 4IKHA 4EKZA 1PRXA 4KGIA 1QUWA 3UVHA 2H8LA 5AISA 5ECLB 5ECNB 1SK0A 3PINA 1YEPA 4BVXA 4OFTA 5IOXA 1TJDA 4ILFA 4QL9A 1GTUA 3GH6A 1QMVA 2IMDA 5IM9A 1Q98A 4PQ1A 5DALB 2H0HA 2LTKA 2I9HA 4OO4A 5F8BA 4NPBA 1BYEA 2FWGA 3ZFBA 2GZYA 4KE3A 3PR8A 3BBYA 2YNXA 4IP1A 4DSRA 4HJMA 2H73A 2R3XA 1X5DA 1V2AA 2WJUA 4GTUA 2LJAA 2VLVA 3F3QA 3P8WA 2CVBA 5J3RA 3HD5A 5IMDA 5F07A 3W8SA 2GSQA 3HKRA 4OMVA 1SU9A 1ILOA 4MJEA 5E4WA 4ZIJA 1TP9A 4IBPA 2M72A 1YQ1A 1FOVA 1R4WA 5AGYA 3VWVA 2H0IA 2H1DA 5IMFA 1O6JA 2ON5A 3BD2A 1GWCA 1TRWA 4ZB8A 2A2PA 3VFIA 2IFQA 3KH9A 2YWIA 1E6BA 1V58A 20GSA 3GSSA 4HQSA 3H4KA 3EC3A 3GKKA 1GL8A 5B8AA 5IMVA 4JZQA 2G0FA 3W8JA 1U87A 1GP1A 4NMUA 3TOTA 1QQ2A 4K2DA 3CXGA 2H30A 1HD2A 3IE3A 4HEA2 3CSJA 3DGQA 2KP2A 5JCWA 5HFIA 4JU5A 2DC5A 3CYNA 1B9XC 2J9HA 2HZEA 4TR1B 2OBIA 1SL0B 4KDYA 1A2JA 3R2QA 1ZYEA 2F9SA 4XHMA 2IFQB 1ZMAA 4ECBA 1Y6EA 4IQ1A 1YY7A 4AJ8A 2RUFA 2KOKA 2I81A 2OJLA 1K3YA 1O8WA 4K7NA 2REMA 3ZTLA 4ECIA 1Z6MA 2VCWA 1TW9A 2HI7A 3WGDA 4PUFC 3ZL5A 3GRXA 3IDVA 4FH8A 3IHQA 1TTZA 2HZEB 4IS0A 3GFKA 4MZBA 1G7OA 4KNDA 4YKGA 1XVQA 1AXDA 3LWAA 1AQVA 1ERUA 1AAZA 2KLXA 2YANA 4ICYA 1IYIA 2JU5A 5HR0A 3D0ZA 1KBNA 1N2AA 5BRTA 4OD7A 3APOA 1VRSD 1PKWA 1PSQA 5D93A 2B7KA 3LYKA 3UVTA 4K0NA 3LXZA 3KMOA 5G5FA 4KSOA 2GZPA 3IAM2 4JR4A 1GSEA 5A4WA 12GSA 2LQQA 1IYHA 4KAEA 2KUCA 2CQ9A 1J9BA 1K0MA 2HSHA 1R5AA 4L5LA 14GSA 2RM5A 5JWQB 3GUSA 5A5KA 2L6CA 2VL9A 4ECJA 1TKDB 2JZSA 4V1Ag 5DBQA 2WCIA 1XVWA 2C8UA 2WRTA 1EP7A 3KIJA 3UOMA 3DD3A 1FG4A 2JZTA 3LSZA 2DIZA 3L9SA 3CMIA 3V1WA 2KHPA 4K5SA 4MABA 3FKFA 1PN0A 1XWKA 2F8AA 3RHCA 2A2RA 2LEGA 3IRAA 5DJMA 1ON4A 4JR6A 2QSIA 2HFDA 5ECKB 3HY2A 4DSSA 2PERA 5C00A 4O5QA 1O85A 3A2WA 3QAGA 3G7YA 5JCGA 3M3MA 4OO5A 3GX0A 2VCVA 4G0IA 1K0OA 4EXJA 3PGTA 2VIMA 4ECCA 4Z2RA 3CRTA 6GSVA 1O8XA 1Z7RA 3FHKA 2C0DA 2K6VA 4WF4A 5ID2A 5KN2A 3EE2A 3A3TA 1ERVA 3DKSA 4MF7A 2FWHA 2C3TA 2O7KA 2CX4A 3LG6A 2H01A 3TJJA 2VCXA 3LW9A 3WYWA 5E59A 2CVDA 2VL2A 2IJYA 3HYPA 1DSBA 1SYXA 3TUEA 4EVMA 2LUSA 1OC8A 2YPMA 4L0UA 1G0TA 1OC3A 3GKNA 1M0UA 4IN0A 3N5OA 3TJKA 3TRPA 1SKWB 5G30A 5GSSA 4TN8A 22GSA 2B5EA 3UL3A 3GTUA 2FUG2 5J9CA 4O5RA 2B1LA 5IO0A 2H66A 4BWSA 2VOCA 4ZB9A 3VK9A 5CNWA 4QL7A 2FLSA 1THOA 4EIQA 4N0VA 4BA7A 2VCZA 3TKSA 1H4OA 1EOHA 4Q5NA 4PNFA 5DCGA 3ME8A 2GS3A 4FQUA 4I2UA 3GTUB 3CSHA 5J9BA 1EGRA 5D9XA 1NHOA 2YCDA 3C1SA 2BJXA 3IA1A 1X9MB 2LSTA 2E7PA 1UA5A 2L57A 2VCTA 3D4TA 2EIOA 4GWRA 4NWYA 2H1GA 2H75A 2OKAA 4K0GA 1OC9A 4WR4A 1A0FA 4BWQA 4IGJA 1TRSA 2I4AA 4HUAA 2LS5A 3QAVA 1F9MA 2JZRA 4A5PA 5COHA 4LL4B 2H6XA 5DAKA 2RLIA 1JZWA 1FAAA 1MDJA 5HQPA 2L5LA 4KB3A 4L5OA 4NHZA 2O8VB 2X99A 2PWJA 6GSYA 3DRNA 1HQOA 4E8EA 2IWTA 4XTSA 5F06A 4XS6A 2P0GA 2ON7A 3GNJA 2X8GA 2H72A 4MLYA 3DVWA 5GSTA 3ZIVA 4D73A 8GSSA 4POBA 3KM6A 3TKPA 1OC9B 3O3TA 3WT2A 1LU4A 2LKUA 5ELAA 2PVOC 2PMTA 2VM2A 3E3EA 4V2NA 1XOAA 2QA2A 5H5SA 3DEXA 2RUEA 3EYTA 1FB6A 6GSSA 3GA4A 4ZILA 3K8NA 5AIXA 1KNGA 1WE0A 4OFMA 5FHIA 4MDCA 3L0HA 2R2JA 1SL2B 1XBSA 4POMA 6GSUA 1NW2A 1TDIA 1PX7A 1RW1A 4YH2A 5DQYA 4EIPA 4WXTA 4F2IA 2VLTA 3F4SA 2GT6A 1K0AA 1EEMA 3IPZA 4JEDA 1GULA 3F0IA 1GSSA 3DMLA 4FYUA 1FOHA 1WJKA 3MAKA 1GSUA 1R26A 4TVEA 1V9WA 2V2GA 2VLUA 2LRNA 2YN1A 4F0BA 3KP9A 1A8LA 5G5EA 3VI7A 2CT6A 4O92A 2B5YA 3EPTA 1JZRA 3TCOA 4QQ7A 1F3AA 2MMAA 5G1LA 1YDKA 3EMPA 1THXA 2Z9SA 1B48A 2M46A 1FB0A 5ECHB 1GSDA 4IJ3A 3EURA 1PX6A 4I2TA 4AF2A 1QK8A 2K8VA 3VURA 4I8BA 3LORA 1Z7PA 3C71A 4MCUA 1AIUA 4ML6A 3UBLA 5CRGA 1HNAA 3FR9A 2RM6A 4NAXA 1K0BA 2X4AA 5DDLA 1EWXA 1OKTA 2N5BA 4FIWA 1ZZYA 1WWJA 2L4CA 3MDKA 4BL7A 3J7Yk 3A5IA 5B7CA 3O76A 5IMCA 1T7PB 4V2MA 3I69A 3TJFA 2F8FA 4BVYA 3CRUA 3GKXA 5D9WA 2LJKA 6GSTA 3GHAA 4ISDA 1K0CA 4Q5FA 1XXUA 4WF5A 2YZHA 2LNTA 3L9VA 1GUKA 1M9BA 1EV4A 2WDUA 4BVXB 4CDOA 1B4PA 2C3QA 2C0FA 1S3DA 4TR0A 4TW5A 1ERTA 2IMEA 4BL7B 4TRXA 1WIKA 3I6AA 1TU8A 3IC4A 4FO5A 3IR4A 1PD21 2GVPA 1OVNA 2H6YA 2C0EA 2LRCA 2AHEA 2IN3A 2X64A 2VD1A 1F3BA 2GSSA 3FR6A 4OCEA 3RBTA 1SL1B 1XOBA 2NDOA 1MTCA 4K1FA 3TGZA 1M99A 3APQA 3H1NA 2KP1A 1U3AA 2R0CA 5AIVA 3S9FA 1EZKA 1T00A 1M2BA 2M80A 2MMOA 1DE2A 4PTSA 1XW9A 4TKYA 2CAIA 1GNWA 3NZNA 4I6XA 1G6YA 1SENA 1TRUA 4RUVA 1U6TA 1AQXA 5ENUA 1X9SB 2LNSA 1FO5A 2MBSA 4WETA 1GTIA 3IXRA 2CV4A 3KP8A 5IMZA 2V6KA 4KDUA 4PNGA 3U5RE 2WB9A 4HU9A 3QAWA 1T4YA 3NOFA 2AYTA 1ST9A 2DJJA 3FW2A 1OAZA 3SBCA 4XS4A 3MYDA 2MBTA 1GNEA 5ECPB 1AW9A 3P2AA 2YOIA 2TIRA 3LYPA 3Q74A 1WP0A 3KTLA 1GUHA 4TR4A 5KN0A 16GSA 3UJ1A 1BX9A 5G1KA 1PGTA 3GV1A 3EVIA 2AUVA 2QA1A 4MZWA 2B5XA 3CSIA 6GSWA 4JE1A 2YV9A 3KXOA 4AJ6A 1GLQA 5F05A 3VWWA 4J2FA 2GSRA 5CRDA 3MIXA 4PURA 2E2MA 2F51A 3WGEA 4LL1B 5GZZB 2C80A 4MH2A 3ZVJA 4ML1A 3KMNA 2C1YA 4MJBA 2NTOA 5A4VA 3TKRA 1ERWA 1ZYPA 2B6MA 4O32A 1UVZA 2CX3A 1GLPA 3I9V2 4X43A 1Q4JA 2DSAA 5GAPD 2R6KA 2ES7A 4GSNA 2NBSA 4X4JA 5D73A 3Q18A 5G31A 4V1Ap 3M0FA 4EF0A 2P5QA 1A8YA 1M2DA 2XPEA 4TXOA 2VL2C 2B3SA 3FZAA 4LLRA 3AY8A 2PN8A 5KOWA 2WULA 2V32A 3TB2A 4YAPA 4J57E 4CY8A 3LQ7A 3APSA 2R0PA 3TJBA 1A23A 5HFKA 4K9ZA 4PX1A 2GQMA 4AJ7A 1TI3A 1SJIA 2I1UA 3GKMA 3M9JA 4MK3A 3F6DA 3ME7A 1AUCA 1SJZA 3KCMA 4MPFA 3N9JA 2A4HA 3HZ8A 4TXOB 1SD8A 3HVXA 2FWEA 4LA1A 5ECMB 5IPHA 3FEUA 1VF4A 3OR5A 1PA3A 2OE1A 1WOUA 4DSSB 4L0WA 5C04A 4MF6A 4K5RA 4LMWA 3KEBA 1G7EA 5A4UA 2PGTA 3C1RA 1JHBA 4XIHA 2EC4A 4LMVA 3TKSC 2F3MA 3ZVJD 2MYGA 5HR1A 3FYGA 4YQMA 2HLSA 1O7UA 4TXVA 2R0GA 1V40A 1ZYNA 2OADA 1ZOFA 1XW5A 4N10A 4ZL8A 3G7IA 5JWOB 1C72A 4GXZA 1A0RP 2FY6A 2L5OA 5ID2B 1YF1A 3C73A 1MD4A 3LXTA 3IV4A 2IPAA 4ACSA 4IVFA 3LFLA 2RIIA 3QR6A 5CRHA 1MDIA 1T1VA 3DXBA 3ERGA 3BCIA 5JCUA 4EDYA 4HI7A 1ML6A 1MD3A 1VGLA 1XFLA 1ABAA 1Z5YE 4PXOA 5ECIB 4ID0A 3QMXA 5ECQB 2OA7A 4F0CA 4NXIA 5ABRA 4HU7A 2PPTA 1RK4A 4HDEA 5D9TA 1J0FA 2JSZA 5J4UA 3FMWA 1YKCA 5JWRB 2H1AA 3CTFA 1T3BA 4DSQA 2DJ1A 2YZUA 1W4VA 4GCIA 5G2ZA 2CA8A 4PQIA 3G9BA 2K18A 1NSWA 2MMNA 2FWFA 3Q6OA 1OE7A 1WPIA 2L6DA 4GF0A 5CREA 3H8QA 2R5GA 4G0KA 4V2LA 4KA0A 2WS2A 1BQ7A 1VF1A 2BTOT 1K0NA 1S3CA 1ZCPA 1I9DA 2JACA 1TI1A 3UAPA 1CQGA 2XBQA 5DVBA 4TOPA 1EGOA 4POKA 2MZCA 3TJGA 2PVQA 3HZ4A 5EL8A 4KUNA 1BJXA 4X1UA 2LQOA 1GSQA 2X49A 3GSTA 3EWLA 1JZDA 2H76A 1SYRA 1EOGA 3MNGA 2E2GA 3UARA 4WBRD 5EPFA 3ZRDA 2OACA 5J5NA 1F37A 1Y25A 3ZMLA 3ERWA 1XWAA 5DAKB 1DUGA 2H71A 2DLXA 1TXXA 2AAWA 5KOXA 2G2QA 4HZ2A 4G9HA 3IK9A 3P90A 1ZGNA 4K8MA 4USSA 4TR3A 5F0GA 1YKAA 1SKRB 2LRTA 2JADA 2MMZA 2PUKC 4F82A 3TKSE 4GQCA 3GIXA 5CO3A 3HJOA 4D73B 4P3YB 3KGKA 4MZCA 3QPMA 2IMFA 3Q19A 3GMFA 5HR3A 1XIYA 2HRAA 3I43A 3IC8A 5D9VA 2DKIA 2DBCA 1K3OA 5B6NA 4Z7XA 4EO3A 1B8XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IK7 A;  1EP8 A;  2FD3 A;  1PL1 A;  2V41 A;  4MA9 A;  2DIY A;  4HZ4 A;  1PMT A;  3D21 A;  3CTG A;  3QDN A;  4G19 A;  5EY6 A;  3DIE A;  3UMA A;  1GRX A;  3UEM A;  1TRV A;  5IIZ A;  1SJ6 A;  3KD0 A;  4F9Z A;  2HYX A;  2VCQ A;  2GDR A;  19GS A;  4K7O A;  13GS A;  4ZL7 A;  1MDK A;  3ZMK A;  3TOU A;  2C4J A;  2FCH A;  3FK8 A;  1O73 A;  2JSY A;  2K9F A;  5B6M A;  1A2M A;  2L59 A;  5D96 A;  3RPN A;  1NM3 A;  2VUP A;  3US3 A;  1KTE A;  1JLV A;  1URM A;  1OYJ A;  3ZYW A;  1KEB A;  2XPD A;  2OE3 A;  2GZZ A;  4H86 A;  3ZIJ A;  4XRD A;  4N0Z A;  1XCC A;  1V98 A;  5CP1 A;  3HJP A;  2L4Q A;  1GSF A;  1LBK A;  4PUA A;  3PH9 A;  4KDX A;  3KTB A;  4N11 A;  2WZ9 A;  5FWG A;  1JLW A;  1UC7 A;  3O6T A;  3FR3 A;  2CVK A;  3QOU A;  2B7J A;  4KCE A;  4KH7 A;  1X0R A;  3IBH A;  3F3R A;  2X8H A;  1G6W A;  4G10 A;  4MJC A;  3D6I A;  1S3A A;  4IP6 A;  1GUM A;  2GST A;  1LJR A;  2GQL A;  3TDG A;  4TR1 A;  1WMJ A;  4YAV A;  4YQV A;  2GGT A;  3P7X A;  1J08 A;  4RI7 A;  4WBJ A;  1QXH A;  1AC1 A;  4IW9 A;  2A2S A;  5DJL A;  4XRA A;  1TK0 B;  1DBY A;  2TRC P;  4POL A;  3JCM L;  3ZZX A;  4EDZ A;  1YF0 A;  2CZ3 A;  2H19 A;  2WGR A;  3E9J B;  4DEJ A;  1BG5 A;  1A24 A;  2AB6 A;  2HXK A;  2E0Q A;  5H5Q A;  1N8J A;  1CQH A;  10GS A;  2P5R A;  4K6X A;  3M9K A;  3F63 A;  3VWU A;  2V6O A;  1FW1 A;  2GT5 A;  3A2V A;  4MP4 A;  2R4V A;  1FVK A;  5IO2 A;  3GX8 A;  3GN3 A;  4YQU A;  2DJ3 A;  2QGV A;  4HQZ A;  2N5A A;  2GLR A;  2VD0 A;  5IQY A;  3F4T A;  2IMI A;  2H74 A;  2WFC A;  2QC7 A;  1Z9H A;  4IJI A;  1FVJ A;  4X0X A;  4ZBB A;  1Z3E A;  5KEJ A;  1OKD A;  1ZYQ B;  1U3I A;  2QKE A;  3MSZ A;  4EUY A;  1XPV A;  4XS4 B;  2IMK A;  2YV7 A;  4F03 A;  1WRY A;  4KX4 A;  2YWO A;  1B9Y C;  1GTA A;  4AGS A;  4DVC A;  2K8S A;  3QFB C;  5ECO B;  4EL1 A;  3EU3 A;  2A4V A;  4CHS A;  5IMA A;  4FYC A;  4GSS A;  3FRC A;  3UIW A;  2FGX A;  1YEX A;  4GLT A;  1HNC A;  4O7H A;  5J41 A;  1GTB A;  3ZLP A;  4I97 A;  5ELG A;  3F4R A;  3RAZ A;  5D8I A;  3ZIT A;  2ZUP A;  5KN1 A;  3GYK A;  2HNL A;  1USB A;  4ZXG A;  1I5G A;  1XWC A;  2XBI A;  2C3N A;  2DJK A;  3F9U A;  2VO4 A;  3L4N A;  3FY7 A;  1PKZ A;  1HYU A;  3HJM A;  4GST A;  2I3Y A;  4ZB6 A;  3QFA C;  1XW6 A;  1V57 A;  3QCP A;  2HRF A;  1Z6N A;  2NVL A;  1GSY A;  2J23 A;  1U88 A;  2CAQ A;  3IOS A;  1E2Y A;  1B4Q A;  4JBB A;  3HDC A;  1UN2 A;  3TRQ A;  1A2L A;  5KN3 A;  1YZX A;  3VWX A;  3VI5 A;  2BMX A;  2P31 A;  3HA9 A;  5DCH A;  18GS A;  3QD9 A;  1TK5 B;  5H5R A;  5AN1 A;  3BCK A;  4GQF A;  2DMM A;  1H75 A;  2LJR A;  2PBJ A;  5B8B A;  2VM1 A;  1GH2 A;  3UBK A;  2H6Z A;  2CZ2 A;  2OE0 A;  2H1B A;  4KCA A;  3EMX A;  4HJ2 A;  3DVX A;  1R7H A;  4RQR A;  2FA8 A;  2N5F A;  3HVS A;  3RDW A;  5CYY A;  5LCZ A;  2ZCT A;  5FT3 A;  4K7I A;  2EIQ A;  3BJ5 A;  3ZRE A;  3F6F A;  3WT1 A;  2B1K A;  2PU9 C;  1JZO A;  4ZBD A;  2HT9 A;  2IL3 A;  2H0G A;  1X5C A;  1ACV A;  3ZFL A;  1PL2 A;  2O85 A;  4IQA A;  3FZ5 A;  4EC0 A;  1X9W B;  3ED3 A;  1TOF A;  3FZ4 A;  3L9U A;  3C8E A;  4OWY A;  2ALB A;  3LGC A;  1TU7 A;  3TRX A;  5LD0 A;  1PQN A;  2XHF A;  3DWV A;  3GUR A;  1T8E B;  2ZNM A;  2R37 A;  4ULX A;  4BPY A;  5GAN D;  2YP6 A;  3KZQ A;  4XS1 A;  2FNO A;  2VL3 A;  1SD9 A;  3DYR A;  3WGX A;  1VF2 A;  1M9A A;  3RHB A;  4PGT A;  5LNK e;  3RPP A;  1XWB A;  3BOA A;  3GL3 A;  3MWH A;  4IHU A;  1K0D A;  4J56 E;  4MMM A;  1TK8 B;  1BED A;  3TKQ A;  1VF3 A;  1SK2 A;  2NPB A;  4NV2 A;  1M2A A;  4MF5 A;  1EV9 A;  2YWM A;  3U6V A;  1AQW A;  2AJQ B;  3M8N A;  1F6M C;  3L78 A;  2HSY A;  3A2X A;  3D5J A;  3KH7 A;  4HS1 A;  11GS A;  3HVV A;  1EEJ A;  3D22 A;  2O87 A;  17GS A;  2YJ7 A;  3FZ9 A;  2LV3 A;  3GH9 A;  4XCS A;  4WEY A;  2DJ2 A;  4E8H A;  3VPT A;  5L71 A;  1W89 A;  4MJA A;  5IPG A;  3GL5 A;  2YJH A;  4N30 A;  6GSX A;  1NHY A;  1M7T A;  3ERF A;  4ZBA A;  3LEF A;  4IEL A;  4CW9 A;  4KW6 A;  4RI6 A;  1XWG A;  4RQX A;  3ISO A;  2HZF A;  3NIV A;  2FA4 A;  4HOJ A;  1T4Z A;  2H70 A;  4MH3 A;  5CAX A;  5DQS A;  3H93 A;  4KSM A;  2TRX A;  5HR2 A;  3EU4 A;  2C0G A;  1QGV A;  1MEK A;  9GSS A;  4WR5 A;  2O89 A;  4OCF A;  5CRW A;  4PQH A;  5IOW A;  4ZL9 A;  3D4M A;  3HCZ A;  2AV4 A;  3HHV A;  4OFN A;  1SKS B;  1HNB A;  3J7Y b;  1O81 A;  5ECR B;  5EVO A;  3LJR A;  1ZL9 A;  3KJY A;  1F2E A;  2HRN A;  4I5Q A;  1R5P A;  2IIY A;  1QFN A;  3IAS 2;  5HFG A;  3SWL A;  2D2Z A;  2EIR A;  4Q5R A;  4EE0 A;  3WD6 A;  3H79 A;  3EIN A;  4JRR A;  5ECS A;  1XZO A;  1YJ6 A;  2DML A;  3VPQ A;  4NHW A;  2FHE A;  4G2E A;  1DE1 A;  2DJ0 A;  3A5W A;  3C7M A;  3W6G A;  4FYB A;  1SK1 A;  2X8C A;  3E0U A;  1PN9 A;  2OBK A;  4GRF A;  2YWN A;  4L8E A;  2GTU A;  4NV5 A;  3HXS A;  2V1M A;  1OE8 A;  2GQK A;  4Q5Q A;  5INY A;  3VLN A;  3CBU A;  3F8U A;  1K3L A;  1BAY A;  1JFU A;  4WKW A;  7GSS A;  2JL4 A;  2XC2 A;  5DAL A;  1FHE A;  1RQM A;  2VAF A;  4MPG A;  2HE3 A;  1X5E A;  3M1G A;  3G7J A;  4IKH A;  4EKZ A;  1PRX A;  4KGI A;  1QUW A;  3UVH A;  2H8L A;  5AIS A;  5ECL B;  5ECN B;  1SK0 A;  3PIN A;  1YEP A;  4BVX A;  4OFT A;  5IOX A;  1TJD A;  4ILF A;  4QL9 A;  1GTU A;  3GH6 A;  1QMV A;  2IMD A;  5IM9 A;  1Q98 A;  4PQ1 A;  5DAL B;  2H0H A;  2LTK A;  2I9H A;  4OO4 A;  5F8B A;  4NPB A;  1BYE A;  2FWG A;  3ZFB A;  2GZY A;  4KE3 A;  3PR8 A;  3BBY A;  2YNX A;  4IP1 A;  4DSR A;  4HJM A;  2H73 A;  2R3X A;  1X5D A;  1V2A A;  2WJU A;  4GTU A;  2LJA A;  2VLV A;  3F3Q A;  3P8W A;  2CVB A;  5J3R A;  3HD5 A;  5IMD A;  5F07 A;  3W8S A;  2GSQ A;  3HKR A;  4OMV A;  1SU9 A;  1ILO A;  4MJE A;  5E4W A;  4ZIJ A;  1TP9 A;  4IBP A;  2M72 A;  1YQ1 A;  1FOV A;  1R4W A;  5AGY A;  3VWV A;  2H0I A;  2H1D A;  5IMF A;  1O6J A;  2ON5 A;  3BD2 A;  1GWC A;  1TRW A;  4ZB8 A;  3VFI A;  2IFQ A;  3KH9 A;  2YWI A;  1E6B A;  1V58 A;  20GS A;  3GSS A;  4HQS A;  3H4K A;  3EC3 A;  3GKK A;  1GL8 A;  5B8A A;  5IMV A;  4JZQ A;  2G0F A;  3W8J A;  1U87 A;  1GP1 A;  4NMU A;  3TOT A;  1QQ2 A;  4K2D A;  3CXG A;  2H30 A;  1HD2 A;  3IE3 A;  4HEA 2;  3CSJ A;  3DGQ A;  2KP2 A;  5JCW A;  5HFI A;  4JU5 A;  2DC5 A;  3CYN A;  1B9X C;  2J9H A;  2HZE A;  4TR1 B;  2OBI A;  1SL0 B;  4KDY A;  1A2J A;  3R2Q A;  1ZYE A;  2F9S A;  4XHM A;  2IFQ B;  1ZMA A;  4ECB A;  1Y6E A;  4IQ1 A;  1YY7 A;  4AJ8 A;  2RUF A;  2KOK A;  2I81 A;  2OJL A;  1K3Y A;  1O8W A;  4K7N A;  2REM A;  3ZTL A;  4ECI A;  1Z6M A;  2VCW A;  1TW9 A;  2HI7 A;  3WGD A;  4PUF C;  3ZL5 A;  3GRX A;  3IDV A;  4FH8 A;  3IHQ A;  1TTZ A;  2HZE B;  4IS0 A;  3GFK A;  4MZB A;  1G7O A;  4KND A;  1XVQ A;  1AXD A;  3LWA A;  1AQV A;  1ERU A;  1AAZ A;  2KLX A;  2YAN A;  1IYI A;  2JU5 A;  5HR0 A;  3D0Z A;  1KBN A;  1N2A A;  4OD7 A;  3APO A;  1VRS D;  1PKW A;  1PSQ A;  5D93 A;  2B7K A;  3LYK A;  3UVT A;  4K0N A;  3LXZ A;  3KMO A;  5G5F A;  4KSO A;  2GZP A;  3IAM 2;  4JR4 A;  1GSE A;  5A4W A;  12GS A;  2LQQ A;  1IYH A;  4KAE A;  2KUC A;  2CQ9 A;  1J9B A;  1K0M A;  2HSH A;  1R5A A;  4L5L A;  14GS A;  2RM5 A;  5JWQ B;  3GUS A;  5A5K A;  2L6C A;  2VL9 A;  4ECJ A;  1TKD B;  2JZS A;  4V1A g;  5DBQ A;  2WCI A;  1XVW A;  2C8U A;  2WRT A;  1EP7 A;  3KIJ A;  3UOM A;  3DD3 A;  1FG4 A;  2JZT A;  3LSZ A;  2DIZ A;  3L9S A;  3CMI A;  3V1W A;  2KHP A;  4MAB A;  3FKF A;  1XWK A;  2F8A A;  3RHC A;  2A2R A;  2LEG A;  3IRA A;  5DJM A;  1ON4 A;  4JR6 A;  2QSI A;  2HFD A;  5ECK B;  3HY2 A;  4DSS A;  2PER A;  5C00 A;  1O85 A;  3A2W A;  3QAG A;  3G7Y A;  5JCG A;  3M3M A;  4OO5 A;  3GX0 A;  2VCV A;  4EXJ A;  1K0O A;  3PGT A;  2VIM A;  4ECC A;  3CRT A;  6GSV A;  1O8X A;  1Z7R A;  3FHK A;  2C0D A;  2K6V A;  4WF4 A;  5ID2 A;  5KN2 A;  3EE2 A;  3A3T A;  1ERV A;  3DKS A;  4MF7 A;  2FWH A;  2C3T A;  2O7K A;  2CX4 A;  3LG6 A;  2H01 A;  3TJJ A;  2VCX A;  3WYW A;  5E59 A;  2CVD A;  2VL2 A;  2IJY A;  3HYP A;  1DSB A;  1SYX A;  3TUE A;  4EVM A;  2LUS A;  1OC8 A;  2YPM A;  4L0U A;  1G0T A;  1OC3 A;  3GKN A;  1M0U A;  4IN0 A;  3N5O A;  3TJK A;  3TRP A;  1SKW B;  5G30 A;  5GSS A;  4TN8 A;  22GS A;  2B5E A;  3UL3 A;  3GTU A;  2FUG 2;  5J9C A;  4O5R A;  2B1L A;  5IO0 A;  2H66 A;  4BWS A;  2VOC A;  4ZB9 A;  3VK9 A;  5CNW A;  4QL7 A;  2FLS A;  1THO A;  4N0V A;  4BA7 A;  2VCZ A;  3TKS A;  1H4O A;  1EOH A;  4Q5N A;  4PNF A;  5DCG A;  3ME8 A;  2GS3 A;  4I2U A;  3GTU B;  3CSH A;  5J9B A;  1EGR A;  5D9X A;  1NHO A;  2YCD A;  3C1S A;  2BJX A;  3IA1 A;  1X9M B;  2LST A;  2E7P A;  1UA5 A;  2L57 A;  2VCT A;  3D4T A;  2EIO A;  4GWR A;  4NWY A;  2H1G A;  2H75 A;  2OKA A;  4K0G A;  1OC9 A;  4WR4 A;  1A0F A;  4BWQ A;  4IGJ A;  1TRS A;  2I4A A;  4HUA A;  2LS5 A;  3QAV A;  1F9M A;  2JZR A;  5COH A;  4LL4 B;  2H6X A;  5DAK A;  2RLI A;  1JZW A;  1FAA A;  1MDJ A;  5HQP A;  2L5L A;  4KB3 A;  4L5O A;  4NHZ A;  2O8V B;  2X99 A;  2PWJ A;  6GSY A;  3DRN A;  1HQO A;  4E8E A;  2IWT A;  4XTS A;  5F06 A;  4XS6 A;  2P0G A;  2ON7 A;  3GNJ A;  2X8G A;  2H72 A;  4MLY A;  3DVW A;  5GST A;  3ZIV A;  4D73 A;  8GSS A;  4POB A;  3KM6 A;  3TKP A;  1OC9 B;  3O3T A;  3WT2 A;  1LU4 A;  2LKU A;  5ELA A;  2PVO C;  2PMT A;  2VM2 A;  3E3E A;  4V2N A;  1XOA A;  5H5S A;  3DEX A;  2RUE A;  3EYT A;  1FB6 A;  6GSS A;  3GA4 A;  4ZIL A;  3K8N A;  5AIX A;  1KNG A;  1WE0 A;  4OFM A;  5FHI A;  4MDC A;  3L0H A;  2R2J A;  1SL2 B;  1XBS A;  4POM A;  6GSU A;  1NW2 A;  1TDI A;  1PX7 A;  1RW1 A;  5DQY A;  4YH2 A;  4WXT A;  4F2I A;  2VLT A;  3F4S A;  2GT6 A;  1K0A A;  1EEM A;  3IPZ A;  4JED A;  1GUL A;  3F0I A;  1GSS A;  3DML A;  4FYU A;  1WJK A;  3MAK A;  1GSU A;  1R26 A;  4TVE A;  1V9W A;  2V2G A;  2VLU A;  2LRN A;  2YN1 A;  4F0B A;  3KP9 A;  1A8L A;  5G5E A;  3VI7 A;  2CT6 A;  4O92 A;  2B5Y A;  1JZR A;  3TCO A;  4QQ7 A;  1F3A A;  2MMA A;  5G1L A;  1YDK A;  3EMP A;  1THX A;  2Z9S A;  1B48 A;  2M46 A;  1FB0 A;  5ECH B;  1GSD A;  4IJ3 A;  3EUR A;  1PX6 A;  4I2T A;  4AF2 A;  1QK8 A;  2K8V A;  3VUR A;  4I8B A;  3LOR A;  1Z7P A;  3C71 A;  4MCU A;  1AIU A;  4ML6 A;  3UBL A;  5CRG A;  1HNA A;  3FR9 A;  2RM6 A;  4NAX A;  1K0B A;  5DDL A;  1EWX A;  1OKT A;  2N5B A;  4FIW A;  1ZZY A;  1WWJ A;  2L4C A;  3MDK A;  4BL7 A;  3J7Y k;  5B7C A;  3O76 A;  5IMC A;  1T7P B;  4V2M A;  3I69 A;  3TJF A;  2F8F A;  4BVY A;  3CRU A;  3GKX A;  5D9W A;  2LJK A;  6GST A;  3GHA A;  4ISD A;  1K0C A;  4Q5F A;  1XXU A;  4WF5 A;  2YZH A;  2LNT A;  3L9V A;  1GUK A;  1M9B A;  1EV4 A;  2WDU A;  4CDO A;  1B4P A;  2C3Q A;  2C0F A;  1S3D A;  4TR0 A;  4TW5 A;  1ERT A;  2IME A;  4TRX A;  1WIK A;  3I6A A;  1TU8 A;  3IC4 A;  4FO5 A;  3IR4 A;  1PD2 1;  2GVP A;  1OVN A;  2H6Y A;  2C0E A;  2LRC A;  2AHE A;  2IN3 A;  2X64 A;  2VD1 A;  1F3B A;  2GSS A;  3FR6 A;  4OCE A;  3RBT A;  1SL1 B;  1XOB A;  2NDO A;  1MTC A;  4K1F A;  3TGZ A;  1M99 A;  3APQ A;  3H1N A;  2KP1 A;  1U3A A;  5AIV A;  3S9F A;  1EZK A;  1T00 A;  1M2B A;  2M80 A;  2MMO A;  1DE2 A;  1XW9 A;  4TKY A;  2CAI A;  1GNW A;  3NZN A;  4I6X A;  1G6Y A;  1SEN A;  1TRU A;  4RUV A;  1U6T A;  1AQX A;  5ENU A;  1X9S B;  2LNS A;  1FO5 A;  2MBS A;  4WET A;  1GTI A;  3IXR A;  2CV4 A;  3KP8 A;  5IMZ A;  2V6K A;  4KDU A;  4PNG A;  3U5R E;  2WB9 A;  4HU9 A;  3QAW A;  1T4Y A;  3NOF A;  2AYT A;  1ST9 A;  2DJJ A;  3FW2 A;  1OAZ A;  3SBC A;  4XS4 A;  2MBT A;  1GNE A;  5ECP B;  1AW9 A;  3P2A A;  2YOI A;  2TIR A;  3LYP A;  3Q74 A;  1WP0 A;  3KTL A;  1GUH A;  4TR4 A;  5KN0 A;  16GS A;  3UJ1 A;  1BX9 A;  5G1K A;  1PGT A;  3GV1 A;  3EVI A;  2AUV A;  4MZW A;  2B5X A;  3CSI A;  6GSW A;  4JE1 A;  2YV9 A;  3KXO A;  4AJ6 A;  1GLQ A;  5F05 A;  3VWW A;  4J2F A;  2GSR A;  5CRD A;  4PUR A;  2E2M A;  2F51 A;  3WGE A;  4LL1 B;  5GZZ B;  2C80 A;  4MH2 A;  3ZVJ A;  4ML1 A;  3KMN A;  2C1Y A;  4MJB A;  2NTO A;  5A4V A;  3TKR A;  1ERW A;  4O32 A;  2B6M A;  1UVZ A;  2CX3 A;  1GLP A;  3I9V 2;  4X43 A;  1Q4J A;  2DSA A;  5GAP D;  2R6K A;  2ES7 A;  4GSN A;  2NBS A;  5D73 A;  3Q18 A;  5G31 A;  4V1A p;  3M0F A;  4EF0 A;  2P5Q A;  1A8Y A;  1M2D A;  2XPE A;  4TXO A;  2VL2 C;  2B3S A;  3FZA A;  4LLR A;  3AY8 A;  2PN8 A;  2WUL A;  2V32 A;  3TB2 A;  4YAP A;  4J57 E;  3LQ7 A;  3APS A;  3TJB A;  1A23 A;  5HFK A;  4K9Z A;  4PX1 A;  2GQM A;  4AJ7 A;  1TI3 A;  1SJI A;  2I1U A;  3GKM A;  3M9J A;  4MK3 A;  3F6D A;  3ME7 A;  1AUC A;  1SJZ A;  3KCM A;  4MPF A;  3N9J A;  3HZ8 A;  4TXO B;  1SD8 A;  3HVX A;  2FWE A;  4LA1 A;  5ECM B;  5IPH A;  3FEU A;  1VF4 A;  3OR5 A;  1PA3 A;  2OE1 A;  1WOU A;  4DSS B;  4L0W A;  5C04 A;  4MF6 A;  4LMW A;  3KEB A;  1G7E A;  5A4U A;  2PGT A;  3C1R A;  1JHB A;  4XIH A;  2EC4 A;  4LMV A;  3TKS C;  2F3M A;  3ZVJ D;  2MYG A;  5HR1 A;  3FYG A;  4YQM A;  2HLS A;  1O7U A;  4TXV A;  1V40 A;  2OAD A;  1ZOF A;  1XW5 A;  4N10 A;  4ZL8 A;  3G7I A;  5JWO B;  1C72 A;  4GXZ A;  1A0R P;  2FY6 A;  2L5O A;  5ID2 B;  1YF1 A;  3C73 A;  1MD4 A;  3LXT A;  3IV4 A;  2IPA A;  4ACS A;  4IVF A;  3LFL A;  2RII A;  3QR6 A;  5CRH A;  1MDI A;  1T1V A;  3DXB A;  3ERG A;  3BCI A;  5JCU A;  4EDY A;  4HI7 A;  1ML6 A;  1MD3 A;  1VGL A;  1XFL A;  1ABA A;  1Z5Y E;  4PXO A;  5ECI B;  4ID0 A;  3QMX A;  5ECQ B;  2OA7 A;  4F0C A;  4NXI A;  5ABR A;  4HU7 A;  2PPT A;  1RK4 A;  4HDE A;  5D9T A;  1J0F A;  2JSZ A;  5J4U A;  1YKC A;  5JWR B;  2H1A A;  3CTF A;  1T3B A;  4DSQ A;  2DJ1 A;  2YZU A;  1W4V A;  4GCI A;  5G2Z A;  2CA8 A;  4PQI A;  3G9B A;  2K18 A;  1NSW A;  2MMN A;  2FWF A;  3Q6O A;  1OE7 A;  1WPI A;  2L6D A;  4GF0 A;  5CRE A;  3H8Q A;  2R5G A;  4V2L A;  4KA0 A;  2WS2 A;  1BQ7 A;  1VF1 A;  2BTO T;  1K0N A;  1S3C A;  1ZCP A;  1I9D A;  2JAC A;  1TI1 A;  3UAP A;  1CQG A;  2XBQ A;  5DVB A;  4TOP A;  1EGO A;  4POK A;  2MZC A;  3TJG A;  2PVQ A;  3HZ4 A;  5EL8 A;  4KUN A;  1BJX A;  4X1U A;  2LQO A;  1GSQ A;  3GST A;  3EWL A;  1JZD A;  2H76 A;  1SYR A;  1EOG A;  3MNG A;  2E2G A;  3UAR A;  4WBR D;  5EPF A;  3ZRD A;  2OAC A;  5J5N A;  1F37 A;  1Y25 A;  3ZML A;  3ERW A;  1XWA A;  5DAK B;  1DUG A;  2H71 A;  2DLX A;  1TXX A;  2AAW A;  2G2Q A;  4HZ2 A;  4G9H A;  3IK9 A;  3P90 A;  1ZGN A;  4K8M A;  5F0G A;  4TR3 A;  1YKA A;  1SKR B;  2LRT A;  2JAD A;  2MMZ A;  2PUK C;  4F82 A;  3TKS E;  4GQC A;  3GIX A;  5CO3 A;  3HJO A;  4D73 B;  4P3Y B;  3KGK A;  4MZC A;  3QPM A;  2IMF A;  3Q19 A;  3GMF A;  5HR3 A;  1XIY A;  3I43 A;  5D9V A;  2DBC A;  1K3O A;  5B6N A;  4Z7X A;  4EO3 A;  1B8X A; 
#chains in the Genus database with same CATH topology
 3IK7 A;  1EP8 A;  2FD3 A;  1PL1 A;  2V41 A;  4MA9 A;  2DIY A;  4HZ4 A;  1PMT A;  3D21 A;  3CTG A;  3QDN A;  4G19 A;  5EY6 A;  3DIE A;  3UMA A;  1GRX A;  3UEM A;  1TRV A;  5IIZ A;  1SJ6 A;  3KD0 A;  4F9Z A;  2HYX A;  2VCQ A;  2GDR A;  19GS A;  4K7O A;  13GS A;  4ZL7 A;  1MDK A;  3ZMK A;  3TOU A;  2C4J A;  2FCH A;  3FK8 A;  1O73 A;  2JSY A;  2K9F A;  5B6M A;  1A2M A;  2L59 A;  5D96 A;  3RPN A;  1NM3 A;  2VUP A;  3US3 A;  1KTE A;  1JLV A;  1URM A;  1OYJ A;  3ZYW A;  1KEB A;  2XPD A;  2OE3 A;  2GZZ A;  4H86 A;  3ZIJ A;  4XRD A;  4N0Z A;  1XCC A;  1V98 A;  5CP1 A;  3HJP A;  2L4Q A;  1GSF A;  1LBK A;  4PUA A;  3PH9 A;  4KDX A;  3KTB A;  4N11 A;  2WZ9 A;  5FWG A;  1JLW A;  1UC7 A;  3O6T A;  3FR3 A;  2CVK A;  3QOU A;  2B7J A;  4KCE A;  4KH7 A;  1X0R A;  3IBH A;  4BVY B;  3F3R A;  2X8H A;  1G6W A;  4G10 A;  4MJC A;  3D6I A;  1S3A A;  4IP6 A;  1GUM A;  2GST A;  1LJR A;  2GQL A;  3TDG A;  4TR1 A;  1WMJ A;  4YAV A;  4YQV A;  2GGT A;  3P7X A;  1J08 A;  4RI7 A;  4WBJ A;  1QXH A;  1AC1 A;  4IW9 A;  2A2S A;  5DJL A;  4XRA A;  1TK0 B;  1DBY A;  2TRC P;  4POL A;  3JCM L;  3ZZX A;  4EDZ A;  1YF0 A;  2CZ3 A;  2H19 A;  2WGR A;  3E9J B;  4DEJ A;  1BG5 A;  1A24 A;  2AB6 A;  2HXK A;  2E0Q A;  5H5Q A;  1N8J A;  1CQH A;  10GS A;  2P5R A;  4K6X A;  3M9K A;  3F63 A;  3VWU A;  2V6O A;  1FW1 A;  2GT5 A;  3A2V A;  4MP4 A;  2R4V A;  1FVK A;  5IO2 A;  3GX8 A;  3GN3 A;  4YQU A;  2DJ3 A;  2QGV A;  4HQZ A;  2N5A A;  2GLR A;  2VD0 A;  5IQY A;  3F4T A;  2IMI A;  2H74 A;  4HSC X;  2WFC A;  2QC7 A;  1Z9H A;  4IJI A;  1FVJ A;  4X0X A;  4ZBB A;  1Z3E A;  5KEJ A;  1OKD A;  1ZYQ B;  1U3I A;  2QKE A;  4O5U A;  3MSZ A;  4K2X A;  4EUY A;  1XPV A;  4XS4 B;  2IMK A;  2YV7 A;  4F03 A;  1WRY A;  4KX4 A;  2YWO A;  1B9Y C;  1GTA A;  4AGS A;  2UZ8 A;  4DVC A;  2K8S A;  3QFB C;  5ECO B;  4EL1 A;  3EU3 A;  2A4V A;  4CHS A;  5IMA A;  4FYC A;  4GSS A;  3FRC A;  3UIW A;  2FGX A;  1YEX A;  4GLT A;  1HNC A;  4O7H A;  5J41 A;  1GTB A;  3ZLP A;  4I97 A;  5ELG A;  3F4R A;  3RAZ A;  5D8I A;  3ZIT A;  2ZUP A;  5KN1 A;  3GYK A;  2HNL A;  1USB A;  4ZXG A;  1XG8 A;  1I5G A;  1XWC A;  2XBI A;  2C3N A;  2DJK A;  3F9U A;  2VO4 A;  3R3E A;  3L4N A;  3FY7 A;  1PKZ A;  1HYU A;  3HJM A;  4GST A;  2I3Y A;  4ZB6 A;  3QFA C;  4YKF A;  1XW6 A;  4MNN A;  2HSM A;  1V57 A;  3QCP A;  2HRF A;  1Z6N A;  2NVL A;  1GSY A;  2J23 A;  1U88 A;  2CAQ A;  3IOS A;  1E2Y A;  2DKH A;  1B4Q A;  4JBB A;  3HDC A;  1UN2 A;  3TRQ A;  1A2L A;  5KN3 A;  1YZX A;  3VWX A;  3VI5 A;  2BMX A;  3IHG A;  2P31 A;  3HA9 A;  5DCH A;  18GS A;  4G0L A;  3QD9 A;  1TK5 B;  5H5R A;  3BCK A;  5AN1 A;  4GQF A;  2DMM A;  1H75 A;  2LJR A;  2PBJ A;  5B8B A;  2VM1 A;  1GH2 A;  3UBK A;  2H6Z A;  2CZ2 A;  2OE0 A;  2H1B A;  4KCA A;  3EMX A;  4HJ2 A;  3DVX A;  1R7H A;  4RQR A;  2FA8 A;  2N5F A;  3HVS A;  3RDW A;  5CYY A;  5LCZ A;  2ZCT A;  5FT3 A;  4K7I A;  2EIQ A;  3BJ5 A;  3ZRE A;  3F6F A;  3WT1 A;  2B1K A;  2PU9 C;  1JZO A;  4ZBD A;  2HT9 A;  2IL3 A;  2H0G A;  1X5C A;  1ACV A;  3ZFL A;  1PL2 A;  2O85 A;  4IQA A;  3FZ5 A;  4EC0 A;  1X9W B;  3ED3 A;  1TOF A;  3FZ4 A;  3L9U A;  3C8E A;  4OWY A;  2ALB A;  3LGC A;  1TU7 A;  3TRX A;  5LD0 A;  1PQN A;  2XHF A;  3DWV A;  3GUR A;  1T8E B;  2ZNM A;  2R37 A;  4ULX A;  4BPY A;  5GAN D;  2YP6 A;  3KZQ A;  4XS1 A;  2FNO A;  2VL3 A;  1SD9 A;  3DYR A;  3WGX A;  1VF2 A;  1M9A A;  3RHB A;  4PGT A;  5LNK e;  3RPP A;  1XWB A;  3BOA A;  3GL3 A;  3MWH A;  4IHU A;  1K0D A;  4J56 E;  4MMM A;  1TK8 B;  1BED A;  3TKQ A;  4CY6 A;  1VF3 A;  1SK2 A;  2NPB A;  4NV2 A;  1M2A A;  4MF5 A;  1EV9 A;  2YWM A;  3U6V A;  1AQW A;  2AJQ B;  2HRK A;  3M8N A;  1F6M C;  3L78 A;  2HSY A;  3A2X A;  3D5J A;  5BMU A;  3KH7 A;  4HS1 A;  11GS A;  3HVV A;  1EEJ A;  3D22 A;  2O87 A;  17GS A;  2YJ7 A;  3FZ9 A;  2LV3 A;  3GH9 A;  4XCS A;  4WEY A;  2DJ2 A;  4E8H A;  3VPT A;  5L71 A;  1W89 A;  4KF9 A;  4MJA A;  5IPG A;  3GL5 A;  2YJH A;  4N30 A;  6GSX A;  1NHY A;  1M7T A;  3ERF A;  4ZBA A;  3LEF A;  4IEL A;  4CW9 A;  4KW6 A;  4RI6 A;  1XWG A;  4RQX A;  3ISO A;  2HZF A;  3NIV A;  2FA4 A;  4HOJ A;  1T4Z A;  1S3R A;  2H70 A;  4MH3 A;  5CAX A;  4Z2T A;  5DQS A;  3H93 A;  4KSM A;  2TRX A;  5HR2 A;  3EU4 A;  2C0G A;  4Z2U A;  1QGV A;  1MEK A;  9GSS A;  4WR5 A;  2O89 A;  4OCF A;  5CRW A;  4PQH A;  5IOW A;  4ZL9 A;  3D4M A;  3HCZ A;  2AV4 A;  3HHV A;  4OFN A;  1SKS B;  1HNB A;  3J7Y b;  1O81 A;  5ECR B;  5EVO A;  3LJR A;  1ZL9 A;  1PFO A;  3KJY A;  1F2E A;  2HRN A;  4I5Q A;  1R5P A;  2IIY A;  1QFN A;  3IAS 2;  5HFG A;  3SWL A;  2D2Z A;  2EIR A;  4Q5R A;  4EE0 A;  3WD6 A;  3H79 A;  3EIN A;  4JRR A;  5ECS A;  1XZO A;  1YJ6 A;  2DML A;  3VPQ A;  4NHW A;  2FHE A;  4G2E A;  1DE1 A;  2DJ0 A;  3A5W A;  3C7M A;  3W6G A;  4FYB A;  1SK1 A;  2X8C A;  3E0U A;  1PN9 A;  2OBK A;  4GRF A;  2YWN A;  4L8E A;  2GTU A;  4NV5 A;  3HXS A;  2V1M A;  1OE8 A;  2GQK A;  4Q5Q A;  5INY A;  3VLN A;  3CBU A;  3F8U A;  1K3L A;  1BAY A;  1JFU A;  4WKW A;  7GSS A;  2JL4 A;  2XC2 A;  5DAL A;  1FHE A;  1RQM A;  2VAF A;  3PPU A;  4MPG A;  2HE3 A;  1X5E A;  3M1G A;  3G7J A;  4IKH A;  4EKZ A;  1PRX A;  4KGI A;  1QUW A;  3UVH A;  2H8L A;  5AIS A;  5ECL B;  5ECN B;  1SK0 A;  3PIN A;  1YEP A;  4BVX A;  4OFT A;  5IOX A;  1TJD A;  4ILF A;  4QL9 A;  1GTU A;  3GH6 A;  1QMV A;  2IMD A;  5IM9 A;  1Q98 A;  4PQ1 A;  5DAL B;  2H0H A;  2LTK A;  2I9H A;  4OO4 A;  5F8B A;  4NPB A;  1BYE A;  2FWG A;  3ZFB A;  2GZY A;  4KE3 A;  3PR8 A;  3BBY A;  2YNX A;  4IP1 A;  4DSR A;  4HJM A;  2H73 A;  2R3X A;  1X5D A;  1V2A A;  2WJU A;  4GTU A;  2LJA A;  2VLV A;  3F3Q A;  3P8W A;  2CVB A;  5J3R A;  3HD5 A;  5IMD A;  5F07 A;  3W8S A;  2GSQ A;  3HKR A;  4OMV A;  1SU9 A;  1ILO A;  4MJE A;  5E4W A;  4ZIJ A;  1TP9 A;  4IBP A;  2M72 A;  1YQ1 A;  1FOV A;  1R4W A;  5AGY A;  3VWV A;  2H0I A;  2H1D A;  5IMF A;  1O6J A;  2ON5 A;  3BD2 A;  1GWC A;  1TRW A;  4ZB8 A;  2A2P A;  3VFI A;  2IFQ A;  3KH9 A;  2YWI A;  1E6B A;  1V58 A;  20GS A;  3GSS A;  4HQS A;  3H4K A;  3EC3 A;  3GKK A;  1GL8 A;  5B8A A;  5IMV A;  4JZQ A;  2G0F A;  3W8J A;  1U87 A;  1GP1 A;  4NMU A;  3TOT A;  1QQ2 A;  4K2D A;  3CXG A;  2H30 A;  1HD2 A;  3IE3 A;  4HEA 2;  3CSJ A;  3DGQ A;  2KP2 A;  5JCW A;  5HFI A;  4JU5 A;  2DC5 A;  3CYN A;  1B9X C;  2J9H A;  2HZE A;  4TR1 B;  2OBI A;  1SL0 B;  4KDY A;  1A2J A;  3R2Q A;  1ZYE A;  2F9S A;  4XHM A;  2IFQ B;  1ZMA A;  4ECB A;  1Y6E A;  4IQ1 A;  1YY7 A;  4AJ8 A;  2RUF A;  2KOK A;  2I81 A;  2OJL A;  1K3Y A;  1O8W A;  4K7N A;  2REM A;  3ZTL A;  4ECI A;  1Z6M A;  2VCW A;  1TW9 A;  2HI7 A;  3WGD A;  4PUF C;  3ZL5 A;  3GRX A;  3IDV A;  4FH8 A;  3IHQ A;  1TTZ A;  2HZE B;  4IS0 A;  3GFK A;  4MZB A;  1G7O A;  4KND A;  4YKG A;  1XVQ A;  1AXD A;  3LWA A;  1AQV A;  1ERU A;  1AAZ A;  2KLX A;  1M3J A;  2YAN A;  4ICY A;  1IYI A;  2JU5 A;  5HR0 A;  3D0Z A;  1KBN A;  1N2A A;  5BRT A;  4OD7 A;  3APO A;  1VRS D;  1PKW A;  1PSQ A;  5D93 A;  2B7K A;  3LYK A;  3UVT A;  4K0N A;  3LXZ A;  3KMO A;  5G5F A;  4KSO A;  2GZP A;  3IAM 2;  4JR4 A;  1GSE A;  5A4W A;  12GS A;  2LQQ A;  1IYH A;  4KAE A;  2KUC A;  2CQ9 A;  1J9B A;  1K0M A;  2HSH A;  1R5A A;  4L5L A;  14GS A;  2RM5 A;  5JWQ B;  3GUS A;  5A5K A;  2L6C A;  2VL9 A;  4ECJ A;  1TKD B;  2JZS A;  4V1A g;  5DBQ A;  2WCI A;  1XVW A;  2C8U A;  2WRT A;  1EP7 A;  3KIJ A;  3UOM A;  3DD3 A;  1FG4 A;  2JZT A;  3LSZ A;  2DIZ A;  3L9S A;  3CMI A;  3V1W A;  2KHP A;  4K5S A;  4MAB A;  3FKF A;  1PN0 A;  1XWK A;  2F8A A;  3RHC A;  2A2R A;  2LEG A;  3IRA A;  5DJM A;  1ON4 A;  4JR6 A;  2QSI A;  2HFD A;  5ECK B;  3HY2 A;  4DSS A;  2PER A;  5C00 A;  4O5Q A;  1O85 A;  3A2W A;  3QAG A;  3G7Y A;  5JCG A;  3M3M A;  4OO5 A;  3GX0 A;  2VCV A;  4G0I A;  1K0O A;  4EXJ A;  3PGT A;  2VIM A;  4ECC A;  4Z2R A;  3CRT A;  6GSV A;  1O8X A;  1Z7R A;  3FHK A;  2C0D A;  2K6V A;  4WF4 A;  5ID2 A;  5KN2 A;  3EE2 A;  3A3T A;  1ERV A;  3DKS A;  4MF7 A;  2FWH A;  2C3T A;  2O7K A;  2CX4 A;  3LG6 A;  2H01 A;  3TJJ A;  3HVN A;  2VCX A;  3LW9 A;  3WYW A;  5E59 A;  2CVD A;  2VL2 A;  2IJY A;  3HYP A;  1DSB A;  1SYX A;  3TUE A;  4EVM A;  2LUS A;  1OC8 A;  2YPM A;  4L0U A;  1G0T A;  1OC3 A;  3GKN A;  1M0U A;  4IN0 A;  3N5O A;  3TJK A;  3TRP A;  1SKW B;  5G30 A;  5GSS A;  4TN8 A;  22GS A;  2B5E A;  3UL3 A;  3GTU A;  2FUG 2;  5J9C A;  4O5R A;  2B1L A;  5IO0 A;  2H66 A;  4BWS A;  2VOC A;  4ZB9 A;  3VK9 A;  5CNW A;  4QL7 A;  2FLS A;  1THO A;  4EIQ A;  4N0V A;  4BA7 A;  2VCZ A;  3TKS A;  1H4O A;  1EOH A;  4Q5N A;  4PNF A;  5DCG A;  3ME8 A;  2GS3 A;  4FQU A;  4I2U A;  3GTU B;  3CSH A;  5J9B A;  1EGR A;  5D9X A;  1NHO A;  2YCD A;  3C1S A;  2BJX A;  3IA1 A;  1X9M B;  2LST A;  2E7P A;  1UA5 A;  2L57 A;  2VCT A;  3D4T A;  2EIO A;  4GWR A;  4NWY A;  2H1G A;  2H75 A;  2OKA A;  4K0G A;  1OC9 A;  4WR4 A;  1A0F A;  4BWQ A;  4IGJ A;  1TRS A;  2I4A A;  4HUA A;  2LS5 A;  3QAV A;  1F9M A;  2JZR A;  4A5P A;  5COH A;  4LL4 B;  2H6X A;  5DAK A;  2RLI A;  1JZW A;  1FAA A;  1MDJ A;  5HQP A;  2L5L A;  4KB3 A;  4L5O A;  4NHZ A;  2O8V B;  2X99 A;  2PWJ A;  6GSY A;  3DRN A;  1HQO A;  4E8E A;  2IWT A;  4XTS A;  5F06 A;  4XS6 A;  2P0G A;  2ON7 A;  3GNJ A;  4BIK A;  2X8G A;  2H72 A;  4MLY A;  3DVW A;  5GST A;  3ZIV A;  4D73 A;  8GSS A;  4POB A;  3KM6 A;  3TKP A;  1OC9 B;  3O3T A;  3WT2 A;  1LU4 A;  2LKU A;  5ELA A;  2PVO C;  2PMT A;  2VM2 A;  3E3E A;  4V2N A;  1XOA A;  2QA2 A;  5H5S A;  3DEX A;  2RUE A;  3EYT A;  1M3I A;  1FB6 A;  6GSS A;  3GA4 A;  4ZIL A;  3K8N A;  5AIX A;  1KNG A;  1WE0 A;  4OFM A;  5FHI A;  4MDC A;  3L0H A;  2R2J A;  1SL2 B;  1XBS A;  4POM A;  6GSU A;  1NW2 A;  1TDI A;  1PX7 A;  1RW1 A;  4YH2 A;  5DQY A;  4EIP A;  4WXT A;  4F2I A;  2VLT A;  3F4S A;  2GT6 A;  1K0A A;  1EEM A;  3IPZ A;  4JED A;  1GUL A;  3F0I A;  1GSS A;  3DML A;  4FYU A;  1FOH A;  1WJK A;  3MAK A;  1GSU A;  1R26 A;  4TVE A;  1V9W A;  2V2G A;  2VLU A;  2LRN A;  2YN1 A;  4F0B A;  3KP9 A;  1A8L A;  5G5E A;  3VI7 A;  2CT6 A;  4O92 A;  2B5Y A;  3EPT A;  1JZR A;  3TCO A;  4QQ7 A;  1F3A A;  2MMA A;  5G1L A;  1YDK A;  3EMP A;  1THX A;  2Z9S A;  1B48 A;  2M46 A;  1FB0 A;  5ECH B;  1GSD A;  4IJ3 A;  3EUR A;  1PX6 A;  4I2T A;  4AF2 A;  1QK8 A;  2K8V A;  3VUR A;  4I8B A;  3LOR A;  1Z7P A;  3C71 A;  4MCU A;  1AIU A;  4ML6 A;  3UBL A;  5CRG A;  1HNA A;  3FR9 A;  2RM6 A;  4NAX A;  1K0B A;  2X4A A;  5DDL A;  1EWX A;  1OKT A;  2N5B A;  4FIW A;  1ZZY A;  1WWJ A;  2L4C A;  3MDK A;  4BL7 A;  3J7Y k;  3A5I A;  5B7C A;  3O76 A;  5IMC A;  1T7P B;  4V2M A;  3I69 A;  3TJF A;  2F8F A;  4BVY A;  3CRU A;  3GKX A;  5D9W A;  2LJK A;  6GST A;  3GHA A;  4ISD A;  1K0C A;  4Q5F A;  1XXU A;  4WF5 A;  2YZH A;  2LNT A;  3L9V A;  1GUK A;  1M9B A;  1EV4 A;  2WDU A;  4BVX B;  4CDO A;  1B4P A;  2C3Q A;  2C0F A;  1S3D A;  4TR0 A;  4TW5 A;  1ERT A;  2IME A;  4BL7 B;  4TRX A;  1WIK A;  3I6A A;  1TU8 A;  3IC4 A;  4FO5 A;  3IR4 A;  1PD2 1;  2GVP A;  1OVN A;  2H6Y A;  2C0E A;  2LRC A;  2AHE A;  2IN3 A;  2X64 A;  2VD1 A;  1F3B A;  2GSS A;  3FR6 A;  4OCE A;  3RBT A;  1SL1 B;  1XOB A;  2NDO A;  1MTC A;  4K1F A;  3TGZ A;  1M99 A;  3APQ A;  3H1N A;  2KP1 A;  1U3A A;  2R0C A;  5AIV A;  3S9F A;  1EZK A;  1T00 A;  1M2B A;  2M80 A;  2MMO A;  1DE2 A;  4PTS A;  1XW9 A;  4TKY A;  2CAI A;  1GNW A;  3NZN A;  4I6X A;  1G6Y A;  1SEN A;  1TRU A;  4RUV A;  1U6T A;  1AQX A;  5ENU A;  1X9S B;  2LNS A;  1FO5 A;  2MBS A;  4WET A;  1GTI A;  3IXR A;  2CV4 A;  3KP8 A;  5IMZ A;  2V6K A;  4KDU A;  4PNG A;  3U5R E;  2WB9 A;  4HU9 A;  3QAW A;  1T4Y A;  3NOF A;  2AYT A;  1ST9 A;  2DJJ A;  3FW2 A;  1OAZ A;  3SBC A;  4XS4 A;  3MYD A;  2MBT A;  1GNE A;  5ECP B;  1AW9 A;  3P2A A;  2YOI A;  2TIR A;  3LYP A;  3Q74 A;  1WP0 A;  3KTL A;  1GUH A;  4TR4 A;  5KN0 A;  16GS A;  3UJ1 A;  1BX9 A;  5G1K A;  1PGT A;  3GV1 A;  3EVI A;  2AUV A;  2QA1 A;  4MZW A;  2B5X A;  3CSI A;  6GSW A;  4JE1 A;  2YV9 A;  3KXO A;  4AJ6 A;  1GLQ A;  5F05 A;  3VWW A;  4J2F A;  2GSR A;  5CRD A;  3MIX A;  4PUR A;  2E2M A;  2F51 A;  3WGE A;  4LL1 B;  5GZZ B;  2C80 A;  4MH2 A;  3ZVJ A;  4ML1 A;  3KMN A;  2C1Y A;  4MJB A;  2NTO A;  5A4V A;  3TKR A;  1ERW A;  1ZYP A;  2B6M A;  4O32 A;  1UVZ A;  2CX3 A;  1GLP A;  3I9V 2;  4X43 A;  1Q4J A;  2DSA A;  5GAP D;  2R6K A;  2ES7 A;  4GSN A;  2NBS A;  4X4J A;  5D73 A;  3Q18 A;  5G31 A;  4V1A p;  3M0F A;  4EF0 A;  2P5Q A;  1A8Y A;  1M2D A;  2XPE A;  4TXO A;  2VL2 C;  2B3S A;  3FZA A;  4LLR A;  3AY8 A;  2PN8 A;  5KOW A;  2WUL A;  2V32 A;  3TB2 A;  4YAP A;  4J57 E;  4CY8 A;  3LQ7 A;  3APS A;  2R0P A;  3TJB A;  1A23 A;  5HFK A;  4K9Z A;  4PX1 A;  2GQM A;  4AJ7 A;  1TI3 A;  1SJI A;  2I1U A;  3GKM A;  3M9J A;  4MK3 A;  3F6D A;  3ME7 A;  1AUC A;  1SJZ A;  3KCM A;  4MPF A;  3N9J A;  2A4H A;  3HZ8 A;  4TXO B;  1SD8 A;  3HVX A;  2FWE A;  4LA1 A;  5ECM B;  5IPH A;  3FEU A;  1VF4 A;  3OR5 A;  1PA3 A;  2OE1 A;  1WOU A;  4DSS B;  4L0W A;  5C04 A;  4MF6 A;  4K5R A;  4LMW A;  3KEB A;  1G7E A;  5A4U A;  2PGT A;  3C1R A;  1JHB A;  4XIH A;  2EC4 A;  4LMV A;  3TKS C;  2F3M A;  3ZVJ D;  2MYG A;  5HR1 A;  3FYG A;  4YQM A;  2HLS A;  1O7U A;  4TXV A;  2R0G A;  1V40 A;  1ZYN A;  2OAD A;  1ZOF A;  1XW5 A;  4N10 A;  4ZL8 A;  3G7I A;  5JWO B;  1C72 A;  4GXZ A;  1A0R P;  2FY6 A;  2L5O A;  5ID2 B;  1YF1 A;  3C73 A;  1MD4 A;  3LXT A;  3IV4 A;  2IPA A;  4ACS A;  4IVF A;  3LFL A;  2RII A;  3QR6 A;  5CRH A;  1MDI A;  1T1V A;  3DXB A;  3ERG A;  3BCI A;  5JCU A;  4EDY A;  4HI7 A;  1ML6 A;  1MD3 A;  1VGL A;  1XFL A;  1ABA A;  1Z5Y E;  4PXO A;  5ECI B;  4ID0 A;  3QMX A;  5ECQ B;  2OA7 A;  4F0C A;  4NXI A;  5ABR A;  4HU7 A;  2PPT A;  1RK4 A;  4HDE A;  5D9T A;  1J0F A;  2JSZ A;  5J4U A;  3FMW A;  1YKC A;  5JWR B;  2H1A A;  3CTF A;  1T3B A;  4DSQ A;  2DJ1 A;  2YZU A;  1W4V A;  4GCI A;  5G2Z A;  2CA8 A;  4PQI A;  3G9B A;  2K18 A;  1NSW A;  2MMN A;  2FWF A;  3Q6O A;  1OE7 A;  1WPI A;  2L6D A;  4GF0 A;  5CRE A;  3H8Q A;  2R5G A;  4G0K A;  4V2L A;  4KA0 A;  2WS2 A;  1BQ7 A;  1VF1 A;  2BTO T;  1K0N A;  1S3C A;  1ZCP A;  1I9D A;  2JAC A;  1TI1 A;  3UAP A;  1CQG A;  2XBQ A;  5DVB A;  4TOP A;  1EGO A;  4POK A;  2MZC A;  3TJG A;  2PVQ A;  3HZ4 A;  5EL8 A;  4KUN A;  1BJX A;  4X1U A;  2LQO A;  1GSQ A;  2X49 A;  3GST A;  3EWL A;  1JZD A;  2H76 A;  1SYR A;  1EOG A;  3MNG A;  2E2G A;  3UAR A;  4WBR D;  5EPF A;  3ZRD A;  2OAC A;  5J5N A;  1F37 A;  1Y25 A;  3ZML A;  3ERW A;  1XWA A;  5DAK B;  1DUG A;  2H71 A;  2DLX A;  1TXX A;  2AAW A;  5KOX A;  2G2Q A;  4HZ2 A;  4G9H A;  3IK9 A;  3P90 A;  1ZGN A;  4K8M A;  4USS A;  4TR3 A;  5F0G A;  1YKA A;  1SKR B;  2LRT A;  2JAD A;  2MMZ A;  2PUK C;  4F82 A;  3TKS E;  3CQF A;  4GQC A;  3GIX A;  5CO3 A;  3HJO A;  4D73 B;  4P3Y B;  3KGK A;  4MZC A;  3QPM A;  2IMF A;  3Q19 A;  3GMF A;  5HR3 A;  1XIY A;  2HRA A;  3I43 A;  3IC8 A;  5D9V A;  2DKI A;  2DBC A;  1K3O A;  5B6N A;  4Z7X A;  4EO3 A;  1B8X A; 
#chains in the Genus database with same CATH homology
 3IK7 A;  1EP8 A;  2FD3 A;  1PL1 A;  2V41 A;  4MA9 A;  2DIY A;  4HZ4 A;  1PMT A;  3D21 A;  3CTG A;  3QDN A;  4G19 A;  5EY6 A;  3DIE A;  3UMA A;  1GRX A;  3UEM A;  1TRV A;  5IIZ A;  1SJ6 A;  3KD0 A;  4F9Z A;  2HYX A;  2VCQ A;  2GDR A;  19GS A;  4K7O A;  13GS A;  4ZL7 A;  1MDK A;  3ZMK A;  3TOU A;  2C4J A;  2FCH A;  3FK8 A;  1O73 A;  2JSY A;  2K9F A;  5B6M A;  1A2M A;  2L59 A;  5D96 A;  3RPN A;  1NM3 A;  2VUP A;  3US3 A;  1KTE A;  1JLV A;  1URM A;  1OYJ A;  3ZYW A;  1KEB A;  2XPD A;  2OE3 A;  2GZZ A;  4H86 A;  3ZIJ A;  4XRD A;  4N0Z A;  1XCC A;  1V98 A;  5CP1 A;  3HJP A;  2L4Q A;  1GSF A;  1LBK A;  4PUA A;  3PH9 A;  4KDX A;  3KTB A;  4N11 A;  2WZ9 A;  5FWG A;  1JLW A;  1UC7 A;  3O6T A;  3FR3 A;  2CVK A;  3QOU A;  2B7J A;  4KCE A;  4KH7 A;  1X0R A;  3IBH A;  4BVY B;  3F3R A;  2X8H A;  1G6W A;  4G10 A;  4MJC A;  3D6I A;  1S3A A;  4IP6 A;  1GUM A;  2GST A;  1LJR A;  2GQL A;  3TDG A;  4TR1 A;  1WMJ A;  4YAV A;  4YQV A;  2GGT A;  3P7X A;  1J08 A;  4RI7 A;  4WBJ A;  1QXH A;  1AC1 A;  4IW9 A;  2A2S A;  5DJL A;  4XRA A;  1TK0 B;  1DBY A;  2TRC P;  4POL A;  3JCM L;  3ZZX A;  4EDZ A;  1YF0 A;  2CZ3 A;  2H19 A;  2WGR A;  3E9J B;  4DEJ A;  1BG5 A;  1A24 A;  2AB6 A;  2HXK A;  2E0Q A;  5H5Q A;  1N8J A;  1CQH A;  10GS A;  2P5R A;  4K6X A;  3M9K A;  3F63 A;  3VWU A;  2V6O A;  1FW1 A;  2GT5 A;  3A2V A;  4MP4 A;  2R4V A;  1FVK A;  5IO2 A;  3GX8 A;  3GN3 A;  4YQU A;  2DJ3 A;  2QGV A;  4HQZ A;  2N5A A;  2GLR A;  2VD0 A;  5IQY A;  3F4T A;  2IMI A;  2H74 A;  2WFC A;  2QC7 A;  1Z9H A;  4IJI A;  1FVJ A;  4X0X A;  4ZBB A;  1Z3E A;  5KEJ A;  1OKD A;  1ZYQ B;  1U3I A;  2QKE A;  4O5U A;  3MSZ A;  4K2X A;  4EUY A;  1XPV A;  4XS4 B;  2IMK A;  2YV7 A;  4F03 A;  1WRY A;  4KX4 A;  2YWO A;  1B9Y C;  1GTA A;  4AGS A;  2UZ8 A;  4DVC A;  2K8S A;  3QFB C;  5ECO B;  4EL1 A;  3EU3 A;  2A4V A;  4CHS A;  5IMA A;  4FYC A;  4GSS A;  3FRC A;  3UIW A;  2FGX A;  1YEX A;  4GLT A;  1HNC A;  4O7H A;  5J41 A;  1GTB A;  3ZLP A;  4I97 A;  5ELG A;  3F4R A;  3RAZ A;  5D8I A;  3ZIT A;  2ZUP A;  5KN1 A;  3GYK A;  2HNL A;  1USB A;  4ZXG A;  1I5G A;  1XWC A;  2XBI A;  2C3N A;  2DJK A;  3F9U A;  2VO4 A;  3R3E A;  3L4N A;  3FY7 A;  1PKZ A;  1HYU A;  3HJM A;  4GST A;  2I3Y A;  4ZB6 A;  3QFA C;  4YKF A;  1XW6 A;  4MNN A;  2HSM A;  1V57 A;  3QCP A;  2HRF A;  1Z6N A;  2NVL A;  1GSY A;  2J23 A;  1U88 A;  2CAQ A;  3IOS A;  1E2Y A;  2DKH A;  1B4Q A;  4JBB A;  3HDC A;  1UN2 A;  3TRQ A;  1A2L A;  5KN3 A;  1YZX A;  3VWX A;  3VI5 A;  2BMX A;  3IHG A;  2P31 A;  3HA9 A;  5DCH A;  18GS A;  4G0L A;  3QD9 A;  1TK5 B;  5H5R A;  3BCK A;  5AN1 A;  4GQF A;  2DMM A;  1H75 A;  2LJR A;  2PBJ A;  5B8B A;  2VM1 A;  1GH2 A;  3UBK A;  2H6Z A;  2CZ2 A;  2OE0 A;  2H1B A;  4KCA A;  3EMX A;  4HJ2 A;  3DVX A;  1R7H A;  4RQR A;  2FA8 A;  2N5F A;  3HVS A;  3RDW A;  5CYY A;  5LCZ A;  2ZCT A;  5FT3 A;  4K7I A;  2EIQ A;  3BJ5 A;  3ZRE A;  3F6F A;  3WT1 A;  2B1K A;  2PU9 C;  1JZO A;  4ZBD A;  2HT9 A;  2IL3 A;  2H0G A;  1X5C A;  1ACV A;  3ZFL A;  1PL2 A;  2O85 A;  4IQA A;  3FZ5 A;  4EC0 A;  1X9W B;  3ED3 A;  1TOF A;  3FZ4 A;  3L9U A;  3C8E A;  4OWY A;  2ALB A;  3LGC A;  1TU7 A;  3TRX A;  5LD0 A;  1PQN A;  2XHF A;  3DWV A;  3GUR A;  1T8E B;  2ZNM A;  2R37 A;  4ULX A;  4BPY A;  5GAN D;  2YP6 A;  3KZQ A;  4XS1 A;  2FNO A;  2VL3 A;  1SD9 A;  3DYR A;  3WGX A;  1VF2 A;  1M9A A;  3RHB A;  4PGT A;  5LNK e;  3RPP A;  1XWB A;  3BOA A;  3GL3 A;  3MWH A;  4IHU A;  1K0D A;  4J56 E;  4MMM A;  1TK8 B;  1BED A;  3TKQ A;  4CY6 A;  1VF3 A;  1SK2 A;  2NPB A;  4NV2 A;  1M2A A;  4MF5 A;  1EV9 A;  2YWM A;  3U6V A;  1AQW A;  2AJQ B;  2HRK A;  3M8N A;  1F6M C;  3L78 A;  2HSY A;  3A2X A;  3D5J A;  5BMU A;  3KH7 A;  4HS1 A;  11GS A;  3HVV A;  1EEJ A;  3D22 A;  2O87 A;  17GS A;  2YJ7 A;  3FZ9 A;  2LV3 A;  3GH9 A;  4XCS A;  4WEY A;  2DJ2 A;  4E8H A;  3VPT A;  5L71 A;  1W89 A;  4KF9 A;  4MJA A;  5IPG A;  3GL5 A;  2YJH A;  4N30 A;  6GSX A;  1NHY A;  1M7T A;  3ERF A;  4ZBA A;  3LEF A;  4IEL A;  4CW9 A;  4KW6 A;  4RI6 A;  1XWG A;  4RQX A;  3ISO A;  2HZF A;  3NIV A;  2FA4 A;  4HOJ A;  1T4Z A;  2H70 A;  4MH3 A;  5CAX A;  4Z2T A;  5DQS A;  3H93 A;  4KSM A;  2TRX A;  5HR2 A;  3EU4 A;  2C0G A;  4Z2U A;  1QGV A;  1MEK A;  9GSS A;  4WR5 A;  2O89 A;  4OCF A;  5CRW A;  4PQH A;  5IOW A;  4ZL9 A;  3D4M A;  3HCZ A;  2AV4 A;  3HHV A;  4OFN A;  1SKS B;  1HNB A;  3J7Y b;  1O81 A;  5ECR B;  5EVO A;  3LJR A;  1ZL9 A;  3KJY A;  1F2E A;  2HRN A;  4I5Q A;  1R5P A;  2IIY A;  1QFN A;  3IAS 2;  5HFG A;  3SWL A;  2D2Z A;  2EIR A;  4Q5R A;  4EE0 A;  3WD6 A;  3H79 A;  3EIN A;  4JRR A;  5ECS A;  1XZO A;  1YJ6 A;  2DML A;  3VPQ A;  4NHW A;  2FHE A;  4G2E A;  1DE1 A;  2DJ0 A;  3A5W A;  3C7M A;  3W6G A;  4FYB A;  1SK1 A;  2X8C A;  3E0U A;  1PN9 A;  2OBK A;  4GRF A;  2YWN A;  4L8E A;  2GTU A;  4NV5 A;  3HXS A;  2V1M A;  1OE8 A;  2GQK A;  4Q5Q A;  5INY A;  3VLN A;  3CBU A;  3F8U A;  1K3L A;  1BAY A;  1JFU A;  4WKW A;  7GSS A;  2JL4 A;  2XC2 A;  5DAL A;  1FHE A;  1RQM A;  2VAF A;  3PPU A;  4MPG A;  2HE3 A;  1X5E A;  3M1G A;  3G7J A;  4IKH A;  4EKZ A;  1PRX A;  4KGI A;  1QUW A;  3UVH A;  2H8L A;  5AIS A;  5ECL B;  5ECN B;  1SK0 A;  3PIN A;  1YEP A;  4BVX A;  4OFT A;  5IOX A;  1TJD A;  4ILF A;  4QL9 A;  1GTU A;  3GH6 A;  1QMV A;  2IMD A;  5IM9 A;  1Q98 A;  4PQ1 A;  5DAL B;  2H0H A;  2LTK A;  2I9H A;  4OO4 A;  5F8B A;  4NPB A;  1BYE A;  2FWG A;  3ZFB A;  2GZY A;  4KE3 A;  3PR8 A;  3BBY A;  2YNX A;  4IP1 A;  4DSR A;  4HJM A;  2H73 A;  2R3X A;  1X5D A;  1V2A A;  2WJU A;  4GTU A;  2LJA A;  2VLV A;  3F3Q A;  3P8W A;  2CVB A;  5J3R A;  3HD5 A;  5IMD A;  5F07 A;  3W8S A;  2GSQ A;  3HKR A;  4OMV A;  1SU9 A;  1ILO A;  4MJE A;  5E4W A;  4ZIJ A;  1TP9 A;  4IBP A;  2M72 A;  1YQ1 A;  1FOV A;  1R4W A;  5AGY A;  3VWV A;  2H0I A;  2H1D A;  5IMF A;  1O6J A;  2ON5 A;  3BD2 A;  1GWC A;  1TRW A;  4ZB8 A;  2A2P A;  3VFI A;  2IFQ A;  3KH9 A;  2YWI A;  1E6B A;  1V58 A;  20GS A;  3GSS A;  4HQS A;  3H4K A;  3EC3 A;  3GKK A;  1GL8 A;  5B8A A;  5IMV A;  4JZQ A;  2G0F A;  3W8J A;  1U87 A;  1GP1 A;  4NMU A;  3TOT A;  1QQ2 A;  4K2D A;  3CXG A;  2H30 A;  1HD2 A;  3IE3 A;  4HEA 2;  3CSJ A;  3DGQ A;  2KP2 A;  5JCW A;  5HFI A;  4JU5 A;  2DC5 A;  3CYN A;  1B9X C;  2J9H A;  2HZE A;  4TR1 B;  2OBI A;  1SL0 B;  4KDY A;  1A2J A;  3R2Q A;  1ZYE A;  2F9S A;  4XHM A;  2IFQ B;  1ZMA A;  4ECB A;  1Y6E A;  4IQ1 A;  1YY7 A;  4AJ8 A;  2RUF A;  2KOK A;  2I81 A;  2OJL A;  1K3Y A;  1O8W A;  4K7N A;  2REM A;  3ZTL A;  4ECI A;  1Z6M A;  2VCW A;  1TW9 A;  2HI7 A;  3WGD A;  4PUF C;  3ZL5 A;  3GRX A;  3IDV A;  4FH8 A;  3IHQ A;  1TTZ A;  2HZE B;  4IS0 A;  3GFK A;  4MZB A;  1G7O A;  4KND A;  4YKG A;  1XVQ A;  1AXD A;  3LWA A;  1AQV A;  1ERU A;  1AAZ A;  2KLX A;  2YAN A;  4ICY A;  1IYI A;  2JU5 A;  5HR0 A;  3D0Z A;  1KBN A;  1N2A A;  5BRT A;  4OD7 A;  3APO A;  1VRS D;  1PKW A;  1PSQ A;  5D93 A;  2B7K A;  3LYK A;  3UVT A;  4K0N A;  3LXZ A;  3KMO A;  5G5F A;  4KSO A;  2GZP A;  3IAM 2;  4JR4 A;  1GSE A;  5A4W A;  12GS A;  2LQQ A;  1IYH A;  4KAE A;  2KUC A;  2CQ9 A;  1J9B A;  1K0M A;  2HSH A;  1R5A A;  4L5L A;  14GS A;  2RM5 A;  5JWQ B;  3GUS A;  5A5K A;  2L6C A;  2VL9 A;  4ECJ A;  1TKD B;  2JZS A;  4V1A g;  5DBQ A;  2WCI A;  1XVW A;  2C8U A;  2WRT A;  1EP7 A;  3KIJ A;  3UOM A;  3DD3 A;  1FG4 A;  2JZT A;  3LSZ A;  2DIZ A;  3L9S A;  3CMI A;  3V1W A;  2KHP A;  4K5S A;  4MAB A;  3FKF A;  1PN0 A;  1XWK A;  2F8A A;  3RHC A;  2A2R A;  2LEG A;  3IRA A;  5DJM A;  1ON4 A;  4JR6 A;  2QSI A;  2HFD A;  5ECK B;  3HY2 A;  4DSS A;  2PER A;  5C00 A;  4O5Q A;  1O85 A;  3A2W A;  3QAG A;  3G7Y A;  5JCG A;  3M3M A;  4OO5 A;  3GX0 A;  2VCV A;  4G0I A;  1K0O A;  4EXJ A;  3PGT A;  2VIM A;  4ECC A;  4Z2R A;  3CRT A;  6GSV A;  1O8X A;  1Z7R A;  3FHK A;  2C0D A;  2K6V A;  4WF4 A;  5ID2 A;  5KN2 A;  3EE2 A;  3A3T A;  1ERV A;  3DKS A;  4MF7 A;  2FWH A;  2C3T A;  2O7K A;  2CX4 A;  3LG6 A;  2H01 A;  3TJJ A;  2VCX A;  3LW9 A;  3WYW A;  5E59 A;  2CVD A;  2VL2 A;  2IJY A;  3HYP A;  1DSB A;  1SYX A;  3TUE A;  4EVM A;  2LUS A;  1OC8 A;  2YPM A;  4L0U A;  1G0T A;  1OC3 A;  3GKN A;  1M0U A;  4IN0 A;  3N5O A;  3TJK A;  3TRP A;  1SKW B;  5G30 A;  5GSS A;  4TN8 A;  22GS A;  2B5E A;  3UL3 A;  3GTU A;  2FUG 2;  5J9C A;  4O5R A;  2B1L A;  5IO0 A;  2H66 A;  4BWS A;  2VOC A;  4ZB9 A;  3VK9 A;  5CNW A;  4QL7 A;  2FLS A;  1THO A;  4EIQ A;  4N0V A;  4BA7 A;  2VCZ A;  3TKS A;  1H4O A;  1EOH A;  4Q5N A;  4PNF A;  5DCG A;  3ME8 A;  2GS3 A;  4FQU A;  4I2U A;  3GTU B;  3CSH A;  5J9B A;  1EGR A;  5D9X A;  1NHO A;  2YCD A;  3C1S A;  2BJX A;  3IA1 A;  1X9M B;  2LST A;  2E7P A;  1UA5 A;  2L57 A;  2VCT A;  3D4T A;  2EIO A;  4GWR A;  4NWY A;  2H1G A;  2H75 A;  2OKA A;  4K0G A;  1OC9 A;  4WR4 A;  1A0F A;  4BWQ A;  4IGJ A;  1TRS A;  2I4A A;  4HUA A;  2LS5 A;  3QAV A;  1F9M A;  2JZR A;  4A5P A;  5COH A;  4LL4 B;  2H6X A;  5DAK A;  2RLI A;  1JZW A;  1FAA A;  1MDJ A;  5HQP A;  2L5L A;  4KB3 A;  4L5O A;  4NHZ A;  2O8V B;  2X99 A;  2PWJ A;  6GSY A;  3DRN A;  1HQO A;  4E8E A;  2IWT A;  4XTS A;  5F06 A;  4XS6 A;  2P0G A;  2ON7 A;  3GNJ A;  2X8G A;  2H72 A;  4MLY A;  3DVW A;  5GST A;  3ZIV A;  4D73 A;  8GSS A;  4POB A;  3KM6 A;  3TKP A;  1OC9 B;  3O3T A;  3WT2 A;  1LU4 A;  2LKU A;  5ELA A;  2PVO C;  2PMT A;  2VM2 A;  3E3E A;  4V2N A;  1XOA A;  2QA2 A;  5H5S A;  3DEX A;  2RUE A;  3EYT A;  1FB6 A;  6GSS A;  3GA4 A;  4ZIL A;  3K8N A;  5AIX A;  1KNG A;  1WE0 A;  4OFM A;  5FHI A;  4MDC A;  3L0H A;  2R2J A;  1SL2 B;  1XBS A;  4POM A;  6GSU A;  1NW2 A;  1TDI A;  1PX7 A;  1RW1 A;  4YH2 A;  5DQY A;  4EIP A;  4WXT A;  4F2I A;  2VLT A;  3F4S A;  2GT6 A;  1K0A A;  1EEM A;  3IPZ A;  4JED A;  1GUL A;  3F0I A;  1GSS A;  3DML A;  4FYU A;  1FOH A;  1WJK A;  3MAK A;  1GSU A;  1R26 A;  4TVE A;  1V9W A;  2V2G A;  2VLU A;  2LRN A;  2YN1 A;  4F0B A;  3KP9 A;  1A8L A;  5G5E A;  3VI7 A;  2CT6 A;  4O92 A;  2B5Y A;  3EPT A;  1JZR A;  3TCO A;  4QQ7 A;  1F3A A;  2MMA A;  5G1L A;  1YDK A;  3EMP A;  1THX A;  2Z9S A;  1B48 A;  2M46 A;  1FB0 A;  5ECH B;  1GSD A;  4IJ3 A;  3EUR A;  1PX6 A;  4I2T A;  4AF2 A;  1QK8 A;  2K8V A;  3VUR A;  4I8B A;  3LOR A;  1Z7P A;  3C71 A;  4MCU A;  1AIU A;  4ML6 A;  3UBL A;  5CRG A;  1HNA A;  3FR9 A;  2RM6 A;  4NAX A;  1K0B A;  2X4A A;  5DDL A;  1EWX A;  1OKT A;  2N5B A;  4FIW A;  1ZZY A;  1WWJ A;  2L4C A;  3MDK A;  4BL7 A;  3J7Y k;  3A5I A;  5B7C A;  3O76 A;  5IMC A;  1T7P B;  4V2M A;  3I69 A;  3TJF A;  2F8F A;  4BVY A;  3CRU A;  3GKX A;  5D9W A;  2LJK A;  6GST A;  3GHA A;  4ISD A;  1K0C A;  4Q5F A;  1XXU A;  4WF5 A;  2YZH A;  2LNT A;  3L9V A;  1GUK A;  1M9B A;  1EV4 A;  2WDU A;  4BVX B;  4CDO A;  1B4P A;  2C3Q A;  2C0F A;  1S3D A;  4TR0 A;  4TW5 A;  1ERT A;  2IME A;  4BL7 B;  4TRX A;  1WIK A;  3I6A A;  1TU8 A;  3IC4 A;  4FO5 A;  3IR4 A;  1PD2 1;  2GVP A;  1OVN A;  2H6Y A;  2C0E A;  2LRC A;  2AHE A;  2IN3 A;  2X64 A;  2VD1 A;  1F3B A;  2GSS A;  3FR6 A;  4OCE A;  3RBT A;  1SL1 B;  1XOB A;  2NDO A;  1MTC A;  4K1F A;  3TGZ A;  1M99 A;  3APQ A;  3H1N A;  2KP1 A;  1U3A A;  2R0C A;  5AIV A;  3S9F A;  1EZK A;  1T00 A;  1M2B A;  2M80 A;  2MMO A;  1DE2 A;  4PTS A;  1XW9 A;  4TKY A;  2CAI A;  1GNW A;  3NZN A;  4I6X A;  1G6Y A;  1SEN A;  1TRU A;  4RUV A;  1U6T A;  1AQX A;  5ENU A;  1X9S B;  2LNS A;  1FO5 A;  2MBS A;  4WET A;  1GTI A;  3IXR A;  2CV4 A;  3KP8 A;  5IMZ A;  2V6K A;  4KDU A;  4PNG A;  3U5R E;  2WB9 A;  4HU9 A;  3QAW A;  1T4Y A;  3NOF A;  2AYT A;  1ST9 A;  2DJJ A;  3FW2 A;  1OAZ A;  3SBC A;  4XS4 A;  3MYD A;  2MBT A;  1GNE A;  5ECP B;  1AW9 A;  3P2A A;  2YOI A;  2TIR A;  3LYP A;  3Q74 A;  1WP0 A;  3KTL A;  1GUH A;  4TR4 A;  5KN0 A;  16GS A;  3UJ1 A;  1BX9 A;  5G1K A;  1PGT A;  3GV1 A;  3EVI A;  2AUV A;  2QA1 A;  4MZW A;  2B5X A;  3CSI A;  6GSW A;  4JE1 A;  2YV9 A;  3KXO A;  4AJ6 A;  1GLQ A;  5F05 A;  3VWW A;  4J2F A;  2GSR A;  5CRD A;  3MIX A;  4PUR A;  2E2M A;  2F51 A;  3WGE A;  4LL1 B;  5GZZ B;  2C80 A;  4MH2 A;  3ZVJ A;  4ML1 A;  3KMN A;  2C1Y A;  4MJB A;  2NTO A;  5A4V A;  3TKR A;  1ERW A;  1ZYP A;  2B6M A;  4O32 A;  1UVZ A;  2CX3 A;  1GLP A;  3I9V 2;  4X43 A;  1Q4J A;  2DSA A;  5GAP D;  2R6K A;  2ES7 A;  4GSN A;  2NBS A;  4X4J A;  5D73 A;  3Q18 A;  5G31 A;  4V1A p;  3M0F A;  4EF0 A;  2P5Q A;  1A8Y A;  1M2D A;  2XPE A;  4TXO A;  2VL2 C;  2B3S A;  3FZA A;  4LLR A;  3AY8 A;  2PN8 A;  5KOW A;  2WUL A;  2V32 A;  3TB2 A;  4YAP A;  4J57 E;  4CY8 A;  3LQ7 A;  3APS A;  2R0P A;  3TJB A;  1A23 A;  5HFK A;  4K9Z A;  4PX1 A;  2GQM A;  4AJ7 A;  1TI3 A;  1SJI A;  2I1U A;  3GKM A;  3M9J A;  4MK3 A;  3F6D A;  3ME7 A;  1AUC A;  1SJZ A;  3KCM A;  4MPF A;  3N9J A;  2A4H A;  3HZ8 A;  4TXO B;  1SD8 A;  3HVX A;  2FWE A;  4LA1 A;  5ECM B;  5IPH A;  3FEU A;  1VF4 A;  3OR5 A;  1PA3 A;  2OE1 A;  1WOU A;  4DSS B;  4L0W A;  5C04 A;  4MF6 A;  4K5R A;  4LMW A;  3KEB A;  1G7E A;  5A4U A;  2PGT A;  3C1R A;  1JHB A;  4XIH A;  2EC4 A;  4LMV A;  3TKS C;  2F3M A;  3ZVJ D;  2MYG A;  5HR1 A;  3FYG A;  4YQM A;  2HLS A;  1O7U A;  4TXV A;  2R0G A;  1V40 A;  1ZYN A;  2OAD A;  1ZOF A;  1XW5 A;  4N10 A;  4ZL8 A;  3G7I A;  5JWO B;  1C72 A;  4GXZ A;  1A0R P;  2FY6 A;  2L5O A;  5ID2 B;  1YF1 A;  3C73 A;  1MD4 A;  3LXT A;  3IV4 A;  2IPA A;  4ACS A;  4IVF A;  3LFL A;  2RII A;  3QR6 A;  5CRH A;  1MDI A;  1T1V A;  3DXB A;  3ERG A;  3BCI A;  5JCU A;  4EDY A;  4HI7 A;  1ML6 A;  1MD3 A;  1VGL A;  1XFL A;  1ABA A;  1Z5Y E;  4PXO A;  5ECI B;  4ID0 A;  3QMX A;  5ECQ B;  2OA7 A;  4F0C A;  4NXI A;  5ABR A;  4HU7 A;  2PPT A;  1RK4 A;  4HDE A;  5D9T A;  1J0F A;  2JSZ A;  5J4U A;  3FMW A;  1YKC A;  5JWR B;  2H1A A;  3CTF A;  1T3B A;  4DSQ A;  2DJ1 A;  2YZU A;  1W4V A;  4GCI A;  5G2Z A;  2CA8 A;  4PQI A;  3G9B A;  2K18 A;  1NSW A;  2MMN A;  2FWF A;  3Q6O A;  1OE7 A;  1WPI A;  2L6D A;  4GF0 A;  5CRE A;  3H8Q A;  2R5G A;  4G0K A;  4V2L A;  4KA0 A;  2WS2 A;  1BQ7 A;  1VF1 A;  2BTO T;  1K0N A;  1S3C A;  1ZCP A;  1I9D A;  2JAC A;  1TI1 A;  3UAP A;  1CQG A;  2XBQ A;  5DVB A;  4TOP A;  1EGO A;  4POK A;  2MZC A;  3TJG A;  2PVQ A;  3HZ4 A;  5EL8 A;  4KUN A;  1BJX A;  4X1U A;  2LQO A;  1GSQ A;  2X49 A;  3GST A;  3EWL A;  1JZD A;  2H76 A;  1SYR A;  1EOG A;  3MNG A;  2E2G A;  3UAR A;  4WBR D;  5EPF A;  3ZRD A;  2OAC A;  5J5N A;  1F37 A;  1Y25 A;  3ZML A;  3ERW A;  1XWA A;  5DAK B;  1DUG A;  2H71 A;  2DLX A;  1TXX A;  2AAW A;  5KOX A;  2G2Q A;  4HZ2 A;  4G9H A;  3IK9 A;  3P90 A;  1ZGN A;  4K8M A;  4USS A;  4TR3 A;  5F0G A;  1YKA A;  1SKR B;  2LRT A;  2JAD A;  2MMZ A;  2PUK C;  4F82 A;  3TKS E;  4GQC A;  3GIX A;  5CO3 A;  3HJO A;  4D73 B;  4P3Y B;  3KGK A;  4MZC A;  3QPM A;  2IMF A;  3Q19 A;  3GMF A;  5HR3 A;  1XIY A;  2HRA A;  3I43 A;  3IC8 A;  5D9V A;  2DKI A;  2DBC A;  1K3O A;  5B6N A;  4Z7X A;  4EO3 A;  1B8X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...