2FLSA

Crystal structure of human glutaredoxin 2 complexed with glutathione
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
101
structure length
101
Chain Sequence
b'MPVNQIQETISDNCVVIFSKTSCSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKLLPLVHQCYL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutaredoxin-2
publication title Crystal structure of Human Glutaredoxin 2 complexed with glutathione
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 35
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2006-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00462 Glutaredoxin Glutaredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2flsA00
2R3XA 2P0GA 1GLQA 4IGJA 4G19A 1XWCA 4DSSB 3CTFA 3D0ZA 2HRNA 2YJHA 6GSSA 5AN1A 2R5GA 3CSIA 5D73A 1KBNA 3E0UA 2N5FA 2D2ZA 2H1AA 3GMFA 3ZITA 5GSTA 2L57A 3M8NA 2LS5A 1T3BA 2VAFA 2AHEA 3RAZA 2EIQA 4ML1A 2JU5A 1KEBA 4KGIA 2RUEA 4P3YB 4N10A 4KUNA 2VL2C 2H6YA 3BCIA 1LU4A 3IHQA 2H8LA 3BD2A 4MLYA 1B8XA 1NW2A 5DBQA 3WT1A 1K3YA 5EY6A 2FWGA 4G9HA 3ISOA 2K6VA 3GV1A 4I2UA 2BMXA 2FD3A 3CMIA 3P8WA 2OADA 1EOHA 1M9AA 1T4YA 3QAVA 1PX6A 4MABA 4WKWA 3FYGA 2H19A 2VCXA 4F9ZA 5G31A 3GX8A 1UVZA 4BVYA 5ECSA 2GVPA 1TRVA 1HNCA 3ZMKA 1F6MC 1UA5A 4QQ7A 5GAPD 3TKRA 1TXXA 3DGQA 1NHOA 1GP1A 3M9KA 2XHFA 3EMXA 2MBSA 2AUVA 3M3MA 3UBKA 2MMAA 2IN3A 2NVLA 4HI7A 2H75A 3LJRA 2V1MA 1T8EB 3N9JA 3EU3A 3LXTA 1H75A 3W8JA 3MDKA 4RI7A 4ECJA 3V1WA 5J41A 4IJ3A 4H86A 1R26A 3CRTA 4KCAA 4K0GA 1AAZA 1K0MA 1OAZA 2H01A 1JZOA 4ZL8A 2LNSA 3FY7A 3KIJA 1RK4A 2R6KA 4JR4A 4MF6A 4X0XA 2GQMA 2A4VA 2KUCA 4ILFA 1XIYA 5A4WA 2C8UA 1BQ7A 1QXHA 4JZQA 1GUKA 3R2QA 4TR4A 2LTKA 2GZPA 2I9HA 3F4RA 1GSUA 5CRDA 2DJJA 1V58A 2HRFA 2IFQB 4GSSA 5IIZA 4MP4A 1G6YA 1MEKA 5DALA 3G7YA 3L9SA 1A2MA 1PX7A 5J9BA 1PL2A 2M46A 2PU9C 3E9JB 4LL4B 4Q5FA 1LJRA 4XRAA 3TJGA 3ZYWA 4KNDA 4DSSA 3L78A 1OVNA 3KD0A 3KZQA 2YANA 5D96A 4IBPA 4AJ8A 3GKKA 1PD21 2HNLA 5F06A 4K7IA 5HQPA 5IOWA 4POLA 4EUYA 1Y25A 1Y6EA 2FWFA 2JL4A 5ELGA 4GQCA 2HZEB 4TR0A 2KLXA 1TJDA 1TP9A 2BJXA 3QAWA 4KSOA 5JCGA 2HZFA 5C00A 4ID0A 2AAWA 1JZDA 2JACA 4HQZA 2YJ7A 19GSA 1X9SB 3KCMA 1B48A 2X99A 1TI1A 1A2LA 3A2VA 4GXZA 4POBA 2G0FA 2LUSA 3QFBC 1GUHA 1O7UA 4YQVA 5D93A 3IV4A 4TXOB 4Z7XA 3EMPA 5DDLA 3GKNA 2K8VA 3HJPA 2E7PA 2FY6A 2WZ9A 1ZZYA 6GSXA 4ZBBA 3ZFLA 3PGTA 2N5BA 2ON5A 5ELAA 3LYKA 2DC5A 5ECRB 5ECLB 3EWLA 3FR9A 3IK7A 3TKSC 5E4WA 5IMDA 4IW9A 1AC1A 1SD8A 2BTOT 2HXKA 2IMEA 3EVIA 3APQA 1FB0A 4OO5A 1JLWA 5KN3A 3HYPA 5G1KA 3WD6A 3UOMA 4MF5A 2FWHA 3EU4A 1YKAA 1A23A 5INYA 1A8YA 3I69A 1BAYA 3C1SA 5GAND 1DE2A 3H93A 2LEGA 1A0RP 4XIHA 1YJ6A 1O6JA 5A4UA 5HR0A 1H4OA 2GSRA 3F9UA 2O8VB 3EYTA 1K0BA 4TOPA 1QMVA 4AGSA 5COHA 3TJFA 2H6XA 2R2JA 2CVBA 3JCML 4WXTA 1SK1A 5ECMB 4YAVA 1WOUA 2EIRA 2PVOC 3BOAA 1DBYA 2OJLA 3C8EA 3VURA 5IMFA 4IJIA 1A0FA 3ZIVA 3QDNA 5IO2A 2B5XA 4JBBA 2H1DA 3UVHA 5E59A 4IHUA 4HU7A 3H8QA 1SD9A 4KSMA 2IFQA 5H5RA 1HQOA 5CP1A 1ZMAA 3IC4A 1R5PA 4OWYA 1OC3A 1K0OA 3CXGA 1K3LA 5G5FA 3ZMLA 4OCEA 3U6VA 1EV9A 4JRRA 5G2ZA 2OBKA 2M72A 4BL7A 5B6NA 1O73A 3TJBA 2YWOA 3SBCA 3GH6A 1VF4A 3GURA 4ECIA 2IMFA 1J08A 1U88A 3KMNA 2VOCA 1PQNA 1U3AA 1YQ1A 2B7KA 1X5CA 2VUPA 3DVXA 1C72A 4CDOA 4KW6A 16GSA 2HZEA 1FO5A 1OKDA 5HR3A 4EL1A 5J4UA 2ON7A 2VCTA 2OE0A 4TR1B 3TJKA 3RHBA 3GFKA 4KE3A 3U5RE 3ZREA 4NHWA 4TKYA 5DJMA 4IVFA 1AUCA 4ACSA 4V2NA 5F0GA 1SYXA 5C04A 4ECBA 3QMXA 2C0EA 3DWVA 2VCQA 4FYBA 4POKA 3TRXA 4KAEA 3GIXA 4TXOA 4XHMA 2H76A 4XS6A 4IS0A 4IQ1A 3ME8A 2CT6A 1BEDA 2FHEA 3KMOA 4N11A 4L0UA 3GA4A 5DQYA 2VLUA 2RM6A 1SU9A 3HD5A 2PPTA 3N5OA 22GSA 1K0CA 2R4VA 3LQ7A 1JFUA 2GQLA 1XOBA 4RQRA 2F8AA 2WFCA 3Q19A 1AIUA 2VO4A 1TK8B 2YV9A 3GTUB 2AJQB 1E6BA 5ECKB 3GSSA 3KH7A 3GN3A 4PGTA 1ML6A 3A2WA 1FW1A 1ERUA 4Q5QA 3DEXA 3TUEA 3KGKA 5EVOA 2LRNA 3GKXA 4N0VA 2YN1A 2DJ1A 4OD7A 5IMZA 1N2AA 5L71A 2J23A 2QGVA 1PMTA 1TKDB 2O87A 4GF0A 3EINA 1YEXA 2MZCA 1GSYA 4LMWA 3A2XA 4NV5A 2YWIA 5DALB 4MJBA 5DCGA 1R5AA 1TRUA 4GSTA 1XVQA 4XTSA 2JSYA 2CZ3A 4I97A 2A2SA 3NIVA 2B7JA 2K18A 1B9XC 3D22A 4F82A 3O6TA 1EP8A 1WWJA 1ZOFA 5JWQB 2V6OA 5IQYA 1ERWA 3F6DA 1SKSB 4HUAA 2B5YA 1V2AA 3PH9A 1TK5B 3IAS2 1TU8A 1SK0A 2IMKA 2LNTA 4OFMA 2P5RA 4ML6A 3PINA 3F8UA 3US3A 2AB6A 3CTGA 4HZ2A 3L0HA 1ST9A 4XRDA 1U3IA 3QD9A 4EC0A 1PL1A 1G7EA 3IDVA 2NBSA 2WDUA 1THOA 1FVKA 1TW9A 3TKSA 1WE0A 5IPGA 4TXVA 4TR1A 4IP6A 2I81A 3SWLA 2VIMA 2XPEA 3GX0A 3MWHA 2EIOA 4TR3A 3I9V2 3NOFA 3TRPA 4E8EA 1OKTA 3VWXA 2GGTA 5HR1A 1B4QA 4OCFA 4ZXGA 3IOSA 3L4NA 2FLSA 4PX1A 5JWOB 5D9XA 4ZIJA 1SJ6A 3GHAA 4V1Ap 4K7NA 1E2YA 2VM2A 2QSIA 3UJ1A 2HE3A 5HFIA 1YZXA 2OE3A 5B7CA 1BJXA 4GLTA 1I5GA 2YCDA 6GSVA 4K0NA 2GZYA 1URMA 2CA8A 4FO5A 3O3TA 3CYNA 1U6TA 4ZB8A 5ENUA 2YP6A 5F07A 1GUMA 2NPBA 5IPHA 2PERA 1ERTA 5LCZA 4KB3A 1J9BA 4MH3A 1XWBA 5KN0A 3GTUA 4YAPA 1NHYA 3APSA 2L59A 3G7JA 2A2RA 3ERGA 1KNGA 17GSA 3GL5A 5ECIB 3UMAA 1TRSA 2WULA 4OO4A 2I1UA 1CQHA 3FKFA 4KH7A 2RIIA 2HT9A 2E2MA 1K0AA 5ECPB 3DYRA 4K7OA 3KTBA 2LQOA 5AIVA 1PKWA 5GZZB 4I8BA 2REMA 2WJUA 2PMTA 4K6XA 4MH2A 1F3AA 3TOTA 2H0IA 5FWGA 4PQIA 1XBSA 3DVWA 3IK9A 1JHBA 4NPBA 4F2IA 1SYRA 3DRNA 1A8LA 4N0ZA 3NZNA 4AJ7A 1FVJA 4IN0A 2ZCTA 1QK8A 4XS4B 2FA8A 2YOIA 3VFIA 3WGDA 4GRFA 3TGZA 5IO0A 2IL3A 1V40A 4O32A 2C4JA 3GH9A 1O81A 1T4ZA 1K3OA 2YWNA 1VF2A 2XBQA 4N30A 3WYWA 1FB6A 2L4CA 5CYYA 3F3QA 1WRYA 2H70A 4NMUA 1GNEA 1EOGA 1M2AA 3LORA 1A2JA 4MJCA 2P31A 1G0TA 3BBYA 2FNOA 1X9MB 4RI6A 4MK3A 5D9TA 9GSSA 1XWGA 1ON4A 2CQ9A 4LMVA 3KEBA 1U87A 1OE8A 2H0GA 3GRXA 1OYJA 4IP1A 2O85A 1TRWA 1TTZA 5B8BA 4BWSA 4X1UA 3FRCA 2QC7A 5ECNB 3Q74A 1ILOA 2HLSA 3D4MA 2X8GA 4EKZA 3VWUA 3KJYA 1PKZA 3VI7A 2VCZA 1XPVA 3UVTA 4AF2A 1PN9A 2KP2A 4PNFA 2H73A 4LLRA 4QL7A 5DCHA 4BPYA 3F6FA 1QGVA 1TI3A 4HOJA 1OC8A 2H74A 3HKRA 4IQAA 3H79A 1PSQA 5KEJA 4YH2A 2CV4A 2WCIA 1GSDA 5ID2B 4WF4A 2KOKA 4EDYA 1EP7A 3M9JA 1ZCPA 2WS2A 1RQMA 2F8FA 4F03A 1JZRA 2C0FA 1ERVA 3L9VA 5KN2A 1SKRB 5G1LA 2GLRA 4MPFA 3G9BA 4V2MA 2AYTA 4MZCA 3D21A 4WBJA 1XWKA 4J2FA 1XW9A 3S9FA 1YDKA 2DJ3A 5F05A 4O7HA 1W4VA 1FG4A 2HYXA 3VLNA 1Z6MA 4HZ4A 8GSSA 1J0FA 2H71A 1GSEA 1AXDA 2DMMA 5HFKA 1IYHA 5CRGA 2GSTA 1EGRA 1AQVA 2GT5A 1M7TA 1HYUA 4Q5NA 3HZ4A 4K1FA 3ZVJD 3LSZA 2CAIA 3QR6A 2C80A 2YZUA 1BG5A 1Z9HA 3FEUA 3M1GA 4GWRA 2F3MA 3G7IA 3PR8A 4MA9A 3RBTA 2B3SA 4XS4A 1XFLA 2VCWA 3Q6OA 4NAXA 1M9BA 4EO3A 3CSHA 2RM5A 2LKUA 4MF7A 4PQHA 3HZ8A 4EE0A 3WGEA 3QCPA 1AQWA 1T7PB 1GL8A 3UL3A 2XC2A 3QFAC 2V41A 3ZRDA 2MMOA 2C3NA 4KX4A 3VK9A 1V57A 4PNGA 2PWJA 4IELA 2MMZA 4ISDA 1WJKA 3ERFA 3F4TA 4LL1B 5DAKB 4V1Ag 1K0DA 3HY2A 4TVEA 4X43A 1QUWA 1XXUA 3HVVA 4NHZA 2GSQA 4HS1A 3I6AA 2TRCP 2VL3A 2K9FA 2L6CA 1GH2A 2VD1A 4I2TA 3HJMA 2C3TA 4ZBAA 5A4VA 1VGLA 3IAM2 1T1VA 3KM6A 3F3RA 1TK0B 2YWMA 3ZLPA 6GSUA 2GZZA 2K8SA 2L6DA 5B6MA 3TKSE 1EV4A 5ABRA 2GQKA 3AY8A 5ID2A 4AJ6A 3L9UA 3IA1A 4J57E 4KA0A 4OFNA 4DEJA 1EGOA 1F3BA 2CVDA 3IXRA 2Z9SA 1SJZA 1T00A 2VLTA 2B1KA 2GTUA 4KDYA 2L4QA 1SJIA 3FR6A 3UAPA 3K8NA 1ZL9A 2DJ2A 4BWQA 5ECOB 5DJLA 1X9WB 4WETA 3J7Yk 1VF1A 5KN1A 4EF0A 2ZNMA 1DE1A 3FZ9A 4ZB6A 3IRAA 1AW9A 1GSFA 3TOUA 3VPQA 3RPPA 2O7KA 1F37A 2QKEA 3GKMA 3TJJA 2B1LA 4DSQA 3FZ5A 1UC7A 7GSSA 4DVCA 1XW5A 5JCWA 3FK8A 5ECHB 6GSTA 3J7Yb 13GSA 1OC9B 2H72A 1MTCA 5D9VA 1S3AA 4HEA2 1IYIA 2F9SA 1MDKA 5EL8A 3DMLA 3KP9A 3GYKA 4L5LA 2DJKA 3BJ5A 5H5QA 4ECCA 1FOVA 3P7XA 2C1YA 1TDIA 4E8HA 5B8AA 3VI5A 1F2EA 2H0HA 4PXOA 1Z3EA 2OKAA 5EPFA 2NTOA 2CAQA 2RLIA 1MD4A 3MAKA 2HI7A 4D73A 3CRUA 3ZTLA 2X64A 5HFGA 4K8MA 1JZWA 3DXBA 3RDWA 1Z7PA 3RPNA 2F51A 1ZYQB 2VD0A 2LJKA 3O76A 2XBIA 4K9ZA 3TKQA 2RUFA 1W89A 1GTIA 4WBRD 3DIEA 1QFNA 3QAGA 20GSA 2FUG2 14GSA 3MSZA 2R37A 2I3YA 1WP0A 3KTLA 5DAKA 3D5JA 2VM1A 2VCVA 3RHCA 1R7HA 2WB9A 2OACA 2C0DA 4HJ2A 4FIWA 5ECQB 3HCZA 3D6IA 3EC3A 1DSBA 1PA3A 3KXOA 2B5EA 5AGYA 2OBIA 4TW5A 5IM9A 2DBCA 3ZZXA 1X5DA 3ME7A 4MDCA 1K0NA 1M2BA 2PN8A 2WGRA 1G6WA 4EXJA 1YY7A 4O92A 3Q18A 2JZTA 2HSYA 4CHSA 1SK2A 3E3EA 3IBHA 1B4PA 4I5QA 4HQSA 1LBKA 1ZYEA 2L5OA 3UIWA 4ZILA 1YKCA 1JLVA 5H5SA 1YF1A 4V2LA 2L5LA 2DJ0A 1SL0B 1VRSD 3KP8A 1EWXA 2WRTA 4HDEA 2YNXA 3MNGA 1MDIA 2V32A 1MDJA 1XZOA 2H1GA 4WR4A 3CSJA 3HA9A 3GNJA 1SENA 3F0IA 3BCKA 2LRTA 2KHPA 2FA4A 2YV7A 4K2DA 3GUSA 3TRQA 2HFDA 1CQGA 1FHEA 1M0UA 5JCUA 4RUVA 2FWEA 4MZBA 3C73A 1ABAA 4G10A 2H6ZA 4YQMA 4OMVA 1Q4JA 3VWWA 3CBUA 4IKHA 2PVQA 5IMAA 2TRXA 3C71A 1HD2A 5CREA 3ZL5A 1TOFA 2JSZA 1GWCA 2CX3A 4GQFA 6GSWA 4MMMA 4NWYA 1M99A 1G7OA 3FZAA 2OA7A 4FYCA 1OC9A 1ACVA 5CO3A 5HR2A 5CRHA 4XS1A 1VF3A 2GS3A 5J3RA 5G5EA 3LFLA 2MYGA 5D9WA 2P5QA 4MJAA 2NDOA 3UBLA 2LJAA 2FCHA 1ZGNA 3KH9A 2DLXA 4F0BA 4ZBDA 4MZWA 2JZSA 4ZL7A 4L8EA 4GCIA 5IOXA 1WPIA 5AISA 5IMVA 2GSSA 1WMJA 3WGXA 2IWTA 1R4WA 4NV2A 1XCCA 3GSTA 1Q98A 3ZFBA 3C1RA 10GSA 2LQQA 5DQSA 1AQXA 1GULA 2LV3A 2JADA 4ZL9A 5AIXA 2IJYA 4G2EA 4ZB9A 3LEFA 1X5EA 4QL9A 2C0GA 3HVSA 3H1NA 2VL9A 2CX4A 1V9WA 2CZ2A 2MMNA 4O5RA 2IMDA 1QQ2A 2M80A 4GSNA 1GTBA 1GNWA 2GT6A 4BVXA 1BX9A 1TU7A 1XOAA 4L5OA 4HJMA 4F0CA 4MJEA 2JZRA 2ZUPA 3IE3A 3ERWA 3M0FA 3FHKA 3D4TA 5J5NA 4JEDA 2I4AA 2HSHA 4CW9A 3W8SA 4XCSA 3FZ4A 4Q5RA 4EDZA 1KTEA 3QOUA 2E0QA 3ED3A 2LJRA 2G2QA 3FR3A 12GSA 2IPAA 3DD3A 1DUGA 4ULXA 4JE1A 3VWVA 4J56E 3GL3A 1BYEA 5LNKe 3HJOA 1MD3A 1XWAA 1HNBA 18GSA 1YEPA 4RQXA 5FHIA 3I43A 1USBA 4TRXA 5FT3A 2IIYA 1RW1A 2PBJA 3F4SA 1GTAA 1GTUA 2PGTA 2VLVA 2VL2A 3LGCA 1UN2A 1EEMA 3LXZA 3IR4A 1WIKA 1Z7RA 1XVWA 3EE2A 5J9CA 2ES7A 4L0WA 2X8HA 1O8XA 4KDUA 2C3QA 4PQ1A 2LSTA 4PUFC 4D73B 1Z5YE 3LYPA 3HDCA 2O89A 1NSWA 4MCUA 4TN8A 1M2DA 2XPDA 3LWAA 1B9YC 4BA7A 3A3TA 2B6MA 3TB2A 3FW2A 3TCOA 1PRXA 1GSQA 2CVKA 4NXIA 1A24A 3QPMA 2LRCA 2X8CA 1SKWB 1THXA 4KDXA 1Z6NA 2YZHA 4WF5A 3VPTA 2N5AA 1OE7A 3UEMA 4LA1A 1HNAA 1GRXA 5JWRB 5D8IA 5DVBA 4JR6A 2FGXA 3HVXA 1FAAA 1GSSA 4FYUA 3ZIJA 1F9MA 3LG6A 4I6XA 5CNWA 2GDRA 3TKPA 4WR5A 2E2GA 3DKSA 4DSRA 3C7MA 1EZKA 3P2AA 5F8BA 1YF0A 1SL2B 3IPZA 2OE1A 2H1BA 4PURA 1X0RA 3UARA 1S3CA 4GTUA 2J9HA 5CAXA 1S3DA 2ALBA 4HU9A 11GSA 3F63A 4YQUA 4EVMA 2YPMA 2IMIA 1EEJA 1I9DA 1XW6A 3A5WA 2H30A 3P90A 4PUAA 2EC4A 5A5KA 2PUKC 4OFTA 3WT2A 1NM3A 1PGTA 4POMA 1GLPA 5GSSA 1O85A 4MPGA 1N8JA 2DSAA 2AV4A 4KCEA 5G30A 3EURA 2TIRA 2DIYA 4WEYA 1SL1B 2V6KA 5CRWA 3W6GA 3HXSA 1O8WA 2MBTA 3APOA 3H4KA 4FH8A 3TDGA 3OR5A 4JU5A 2H66A 2KP1A 2DIZA 3ZVJA 2DMLA 3HHVA 5LD0A 2V2GA 5IMCA 6GSYA 1V98A
chains in the Genus database with same CATH superfamily
2R3XA 2P0GA 1GLQA 4IGJA 4G19A 1XWCA 4DSSB 3CTFA 3D0ZA 2HRNA 2YJHA 6GSSA 5AN1A 2R5GA 3CSIA 5D73A 1KBNA 3E0UA 2N5FA 2D2ZA 2H1AA 3GMFA 3ZITA 5GSTA 2L57A 3M8NA 2LS5A 1T3BA 2VAFA 2AHEA 3RAZA 2EIQA 4ML1A 2JU5A 1KEBA 4KGIA 2RUEA 4P3YB 4N10A 4KUNA 2VL2C 2H6YA 3BCIA 1LU4A 3IHQA 2H8LA 3BD2A 4MLYA 1B8XA 1NW2A 2QA2A 5DBQA 3WT1A 1K3YA 5EY6A 2FWGA 4G9HA 3ISOA 2K6VA 3GV1A 4I2UA 2BMXA 2FD3A 3CMIA 3P8WA 2OADA 1EOHA 1M9AA 1T4YA 3QAVA 1PX6A 1XG8A 4WKWA 4MABA 3FYGA 2H19A 2VCXA 4ICYA 4F9ZA 5G31A 3GX8A 1UVZA 4BVYA 5ECSA 2GVPA 1TRVA 1HNCA 3ZMKA 1F6MC 1UA5A 4QQ7A 5GAPD 3TKRA 1TXXA 3DGQA 1NHOA 1GP1A 3M9KA 2XHFA 3EMXA 2MBSA 2AUVA 3M3MA 4MNNA 3UBKA 2MMAA 2IN3A 2NVLA 4HI7A 2H75A 3LJRA 2V1MA 1T8EB 3N9JA 3EU3A 3LXTA 1H75A 3W8JA 3MDKA 4RI7A 4ECJA 4BIKA 3V1WA 5J41A 4IJ3A 4H86A 1R26A 3CRTA 4KCAA 4K0GA 1AAZA 4O5UA 1K0MA 1OAZA 2H01A 1JZOA 4ZL8A 2LNSA 3FY7A 3KIJA 1RK4A 2R6KA 4JR4A 4MF6A 4X0XA 2GQMA 2A4VA 2KUCA 4ILFA 1XIYA 5A4WA 2C8UA 1BQ7A 1QXHA 4JZQA 1GUKA 3R2QA 4TR4A 2LTKA 2GZPA 2I9HA 3F4RA 1GSUA 5CRDA 2DJJA 1V58A 2HRFA 2IFQB 4GSSA 5IIZA 4USSA 4MP4A 1G6YA 1MEKA 5DALA 3G7YA 3L9SA 1A2MA 1PX7A 5J9BA 1PL2A 2M46A 2PU9C 3E9JB 4LL4B 4Q5FA 1LJRA 4XRAA 3TJGA 4BL7B 3ZYWA 2A2PA 4KNDA 4DSSA 3L78A 1OVNA 3KD0A 3KZQA 1M3IA 2YANA 5D96A 4IBPA 4AJ8A 3GKKA 1PD21 2HNLA 5F06A 4K7IA 5HQPA 5IOWA 4POLA 4EUYA 1Y25A 1Y6EA 2FWFA 2JL4A 5ELGA 4GQCA 2HZEB 4TR0A 2KLXA 1TJDA 1TP9A 2BJXA 3QAWA 4KSOA 5JCGA 2HZFA 5C00A 4ID0A 2AAWA 1JZDA 2JACA 4HQZA 2YJ7A 19GSA 1X9SB 3KCMA 1B48A 2X99A 1TI1A 2R0GA 1A2LA 3A2VA 4GXZA 4POBA 2G0FA 2LUSA 3QFBC 1GUHA 1O7UA 4YQVA 5D93A 3IV4A 4TXOB 4Z7XA 3EMPA 5DDLA 3GKNA 2K8VA 4A5PA 3HJPA 3FMWA 2E7PA 2FY6A 2WZ9A 1ZZYA 6GSXA 4ZBBA 3ZFLA 3PGTA 2N5BA 2ON5A 4EIQA 5ELAA 3LYKA 2DC5A 5ECRB 5ECLB 3EWLA 3FR9A 3IK7A 3TKSC 5E4WA 5IMDA 4IW9A 1AC1A 1SD8A 2BTOT 2HXKA 2IMEA 3EVIA 3APQA 1FB0A 4OO5A 1JLWA 5KN3A 3HYPA 5G1KA 2QA1A 3WD6A 3UOMA 4MF5A 2FWHA 3EU4A 1YKAA 1A23A 5INYA 1A8YA 3I69A 1BAYA 3C1SA 5GAND 1DE2A 3H93A 2LEGA 1A0RP 4XIHA 1YJ6A 1O6JA 5A4UA 5HR0A 2DKHA 1H4OA 2GSRA 3F9UA 2O8VB 2A4HA 3EYTA 1K0BA 4TOPA 1QMVA 4AGSA 5COHA 3TJFA 2H6XA 2R2JA 2CVBA 3JCML 4WXTA 1SK1A 5ECMB 4YAVA 1WOUA 5KOWA 2EIRA 2PVOC 3BOAA 1DBYA 2OJLA 3C8EA 3VURA 5IMFA 4IJIA 1A0FA 3ZIVA 2UZ8A 3QDNA 5IO2A 2B5XA 4JBBA 2H1DA 3UVHA 5E59A 4IHUA 4HU7A 3H8QA 1SD9A 4KSMA 2IFQA 5H5RA 1HQOA 5CP1A 1ZMAA 3IC4A 1R5PA 4OWYA 1OC3A 1K0OA 3CXGA 1K3LA 5G5FA 3ZMLA 4OCEA 3U6VA 1EV9A 4JRRA 5G2ZA 2OBKA 2M72A 4BL7A 5B6NA 1O73A 3TJBA 2YWOA 2R0PA 3SBCA 3GH6A 1VF4A 3GURA 4ECIA 2IMFA 1J08A 1U88A 3KMNA 2VOCA 1PQNA 1U3AA 1YQ1A 2B7KA 1X5CA 2VUPA 3DVXA 1C72A 4CDOA 4KW6A 16GSA 2HZEA 1FO5A 1OKDA 5HR3A 4EL1A 5J4UA 2ON7A 2VCTA 2OE0A 4TR1B 3TJKA 3RHBA 3GFKA 4KE3A 3U5RE 3ZREA 4NHWA 4TKYA 5DJMA 4IVFA 1AUCA 4ACSA 4V2NA 5F0GA 1SYXA 5C04A 4ECBA 3QMXA 2C0EA 3DWVA 2VCQA 4FYBA 4POKA 3TRXA 4KAEA 3GIXA 4TXOA 4XHMA 2H76A 4XS6A 5BMUA 4IS0A 4IQ1A 3ME8A 2CT6A 1BEDA 2FHEA 3KMOA 4N11A 4L0UA 3IC8A 3GA4A 5DQYA 2VLUA 2RM6A 1SU9A 3HD5A 2PPTA 3N5OA 22GSA 1K0CA 2R4VA 3LQ7A 1JFUA 2GQLA 1XOBA 4RQRA 3CQFA 2F8AA 2WFCA 3Q19A 1AIUA 2VO4A 1TK8B 2YV9A 3GTUB 2AJQB 1E6BA 5ECKB 3GSSA 3KH7A 3GN3A 4PGTA 1ML6A 3A2WA 1FW1A 2X4AA 1ERUA 4Q5QA 3DEXA 3TUEA 3KGKA 5EVOA 2LRNA 3GKXA 4N0VA 2YN1A 2DJ1A 4OD7A 5IMZA 1N2AA 5L71A 2J23A 2QGVA 1PMTA 1TKDB 2O87A 4GF0A 3EINA 1YEXA 2MZCA 1GSYA 4LMWA 3A2XA 4NV5A 2YWIA 5DALB 4MJBA 5DCGA 1R5AA 1TRUA 4GSTA 2HSMA 1XVQA 4XTSA 2JSYA 2CZ3A 4I97A 4O5QA 2A2SA 3NIVA 2B7JA 2K18A 1B9XC 3D22A 4F82A 3O6TA 1EP8A 1WWJA 1ZOFA 3EPTA 5JWQB 2V6OA 5IQYA 1ERWA 3F6DA 1SKSB 4HUAA 2B5YA 1V2AA 3PH9A 1TK5B 3IAS2 1TU8A 1SK0A 2IMKA 2LNTA 4OFMA 2P5RA 4ML6A 3PINA 3F8UA 3US3A 2AB6A 3CTGA 4HZ2A 3L0HA 1ST9A 4XRDA 1U3IA 3QD9A 4EC0A 1PL1A 1G7EA 3IDVA 2NBSA 2WDUA 1THOA 1FVKA 1TW9A 3TKSA 1WE0A 5IPGA 4TXVA 4TR1A 2HRKA 4IP6A 2I81A 4FQUA 3SWLA 2VIMA 2XPEA 3GX0A 3MWHA 2EIOA 4TR3A 3I9V2 3NOFA 3TRPA 4E8EA 1OKTA 3VWXA 2GGTA 5HR1A 1B4QA 4OCFA 4ZXGA 3IOSA 3L4NA 2FLSA 4PX1A 5JWOB 5D9XA 4ZIJA 1SJ6A 3GHAA 4V1Ap 4K7NA 1E2YA 2VM2A 2QSIA 3UJ1A 2HE3A 5HFIA 1YZXA 1FOHA 2OE3A 5B7CA 1BJXA 4GLTA 1I5GA 2YCDA 6GSVA 4K0NA 2GZYA 1URMA 2CA8A 4FO5A 3O3TA 3CYNA 1U6TA 4ZB8A 5ENUA 3IHGA 2YP6A 5F07A 1GUMA 2NPBA 5IPHA 2PERA 1ERTA 5LCZA 4KB3A 1J9BA 4MH3A 1XWBA 5KN0A 3GTUA 4YAPA 1NHYA 3APSA 2L59A 3G7JA 2A2RA 3ERGA 1KNGA 17GSA 3GL5A 5ECIB 3UMAA 1TRSA 2WULA 4OO4A 2I1UA 1CQHA 3FKFA 4KH7A 2RIIA 4PTSA 2HT9A 2E2MA 4Z2RA 1K0AA 5ECPB 3DYRA 4K7OA 3KTBA 2LQOA 5AIVA 1PKWA 5GZZB 4I8BA 2REMA 2WJUA 2PMTA 4K6XA 4MH2A 1F3AA 3TOTA 2H0IA 5FWGA 4PQIA 1XBSA 3DVWA 3IK9A 1JHBA 1ZYNA 4NPBA 4F2IA 1SYRA 3DRNA 1A8LA 4N0ZA 3NZNA 4AJ7A 1FVJA 4IN0A 2ZCTA 1QK8A 4XS4B 2FA8A 2YOIA 3VFIA 3WGDA 4GRFA 3TGZA 5IO0A 4X4JA 2IL3A 1V40A 4O32A 2C4JA 3GH9A 1O81A 1T4ZA 1K3OA 2YWNA 1VF2A 2XBQA 2HRAA 4N30A 3WYWA 1FB6A 2L4CA 5CYYA 3F3QA 1WRYA 2H70A 4NMUA 1GNEA 1EOGA 1M2AA 3LORA 1A2JA 4MJCA 2P31A 1G0TA 3BBYA 2FNOA 1X9MB 4RI6A 4MK3A 5D9TA 9GSSA 1XWGA 1ON4A 2CQ9A 4LMVA 3KEBA 1U87A 1OE8A 2H0GA 3GRXA 1OYJA 4IP1A 2O85A 1TRWA 1TTZA 5B8BA 4BWSA 4X1UA 3FRCA 1PFOA 2QC7A 5ECNB 3Q74A 1ILOA 2HLSA 3D4MA 2X8GA 4EKZA 3VWUA 3KJYA 1PKZA 3VI7A 2VCZA 1XPVA 3UVTA 4AF2A 1PN9A 2KP2A 4PNFA 2H73A 4LLRA 4QL7A 5DCHA 4G0KA 4BPYA 3F6FA 1QGVA 1TI3A 4HOJA 1OC8A 2H74A 3HKRA 4IQAA 3H79A 1PSQA 5KEJA 4YH2A 2CV4A 2WCIA 1GSDA 5ID2B 4WF4A 2KOKA 4EDYA 1EP7A 3M9JA 1ZCPA 2WS2A 1RQMA 2F8FA 4F03A 1JZRA 2C0FA 1ERVA 3L9VA 5KN2A 1SKRB 5G1LA 2GLRA 4MPFA 3G9BA 4V2MA 2AYTA 4MZCA 3D21A 4WBJA 1XWKA 4J2FA 1XW9A 3S9FA 1YDKA 2DJ3A 1M3JA 5F05A 4K5SA 4O7HA 1W4VA 1FG4A 2HYXA 3VLNA 1Z6MA 4HZ4A 8GSSA 1J0FA 2H71A 1GSEA 1AXDA 2DMMA 5HFKA 1IYHA 5CRGA 2GSTA 1EGRA 1AQVA 2GT5A 1M7TA 1ZYPA 1HYUA 4Q5NA 3HZ4A 4K1FA 3ZVJD 3LSZA 2CAIA 3QR6A 2C80A 2YZUA 1BG5A 1Z9HA 3FEUA 3M1GA 4GWRA 2F3MA 3G7IA 4KF9A 3PR8A 4MA9A 3RBTA 2B3SA 4XS4A 1XFLA 2VCWA 3Q6OA 4NAXA 1M9BA 4EO3A 3CSHA 2RM5A 2LKUA 4MF7A 4HSCX 4PQHA 3HZ8A 4EE0A 3WGEA 3QCPA 1AQWA 1T7PB 1GL8A 3UL3A 2XC2A 3QFAC 2V41A 3ZRDA 2MMOA 2C3NA 4KX4A 3VK9A 1V57A 4PNGA 2PWJA 4IELA 2MMZA 4ISDA 1WJKA 3PPUA 3ERFA 3F4TA 4LL1B 5DAKB 4CY8A 4V1Ag 1K0DA 3HY2A 4TVEA 3MIXA 4X43A 1QUWA 1XXUA 3HVVA 4NHZA 2GSQA 4HS1A 3I6AA 2TRCP 2VL3A 5KOXA 2K9FA 2L6CA 1GH2A 2VD1A 4I2TA 3HJMA 2C3TA 4ZBAA 5A4VA 1VGLA 3IAM2 1T1VA 3KM6A 3F3RA 1TK0B 2YWMA 3ZLPA 6GSUA 2GZZA 2K8SA 2L6DA 5B6MA 3TKSE 3MYDA 1EV4A 5ABRA 2GQKA 3AY8A 5ID2A 4AJ6A 3L9UA 3IA1A 4J57E 4KA0A 4OFNA 4DEJA 1EGOA 1F3BA 2CVDA 3IXRA 3R3EA 2Z9SA 1SJZA 1T00A 2VLTA 1S3RA 2B1KA 2GTUA 4KDYA 2L4QA 1SJIA 3FR6A 3UAPA 3K8NA 1ZL9A 4G0IA 2DJ2A 4BWQA 5ECOB 5DJLA 1X9WB 4WETA 3J7Yk 1VF1A 5KN1A 4EF0A 2ZNMA 1DE1A 3FZ9A 4ZB6A 3IRAA 1AW9A 1GSFA 3TOUA 3VPQA 3RPPA 2X49A 4YKFA 2O7KA 1F37A 2QKEA 3GKMA 3TJJA 2B1LA 4DSQA 3FZ5A 1UC7A 7GSSA 4DVCA 1XW5A 5JCWA 3FK8A 5ECHB 6GSTA 3J7Yb 13GSA 1OC9B 2H72A 1MTCA 5D9VA 1S3AA 4HEA2 1IYIA 2F9SA 1MDKA 5EL8A 3DMLA 3KP9A 3GYKA 4L5LA 2DJKA 3BJ5A 5H5QA 4ECCA 1FOVA 3P7XA 2C1YA 1TDIA 4E8HA 2DKIA 5B8AA 3VI5A 1F2EA 2H0HA 4PXOA 1Z3EA 2OKAA 5EPFA 2NTOA 2CAQA 2RLIA 1MD4A 3MAKA 2HI7A 4D73A 3CRUA 3ZTLA 2X64A 5HFGA 4K8MA 1JZWA 3DXBA 3RDWA 1Z7PA 3RPNA 2F51A 1ZYQB 2VD0A 2LJKA 3O76A 2XBIA 4K9ZA 3TKQA 2RUFA 1W89A 1GTIA 4WBRD 3DIEA 1QFNA 3QAGA 20GSA 2FUG2 14GSA 3MSZA 2R37A 2I3YA 1WP0A 3KTLA 5DAKA 3D5JA 2VM1A 2VCVA 3RHCA 1R7HA 2WB9A 2OACA 2C0DA 4HJ2A 4FIWA 5ECQB 3HCZA 4BVXB 3D6IA 3EC3A 1DSBA 1PA3A 3KXOA 2B5EA 5AGYA 2OBIA 4TW5A 5IM9A 2DBCA 3ZZXA 3LW9A 1X5DA 3ME7A 4MDCA 1K0NA 1M2BA 2PN8A 2WGRA 1G6WA 4EXJA 1YY7A 4O92A 3Q18A 2JZTA 2HSYA 4CHSA 1SK2A 3E3EA 3IBHA 1B4PA 4I5QA 4HQSA 1LBKA 1ZYEA 5BRTA 2L5OA 3UIWA 4ZILA 1YKCA 1JLVA 5H5SA 1YF1A 4V2LA 2L5LA 2DJ0A 1SL0B 1VRSD 3KP8A 1EWXA 2WRTA 4HDEA 2YNXA 3MNGA 1MDIA 2V32A 1MDJA 1XZOA 2H1GA 4WR4A 3CSJA 3HA9A 3GNJA 1SENA 3F0IA 3BCKA 2LRTA 2KHPA 2FA4A 2YV7A 4K2DA 3GUSA 3TRQA 2HFDA 1CQGA 1FHEA 1M0UA 5JCUA 4RUVA 2FWEA 4MZBA 3C73A 1ABAA 4G10A 2H6ZA 4YQMA 4OMVA 1Q4JA 3VWWA 3CBUA 4IKHA 2PVQA 5IMAA 2TRXA 3HVNA 3C71A 1HD2A 5CREA 3ZL5A 1TOFA 2JSZA 1GWCA 2CX3A 4GQFA 6GSWA 4MMMA 4NWYA 1M99A 1G7OA 4Z2TA 3FZAA 2OA7A 4FYCA 1OC9A 1ACVA 1PN0A 5CO3A 5HR2A 5CRHA 4XS1A 1VF3A 2GS3A 5J3RA 5G5EA 3LFLA 2MYGA 5D9WA 2P5QA 4MJAA 2NDOA 3UBLA 2LJAA 2FCHA 1ZGNA 3KH9A 2DLXA 4F0BA 4ZBDA 4MZWA 2JZSA 4ZL7A 4L8EA 4GCIA 5IOXA 1WPIA 5AISA 5IMVA 2GSSA 1WMJA 3WGXA 2IWTA 1R4WA 4NV2A 1XCCA 3GSTA 4EIPA 1Q98A 3ZFBA 3C1RA 10GSA 2LQQA 5DQSA 1AQXA 1GULA 2LV3A 2JADA 4ZL9A 5AIXA 2IJYA 4G2EA 4ZB9A 3LEFA 1X5EA 4QL9A 2C0GA 3HVSA 3H1NA 2VL9A 2CX4A 1V9WA 2CZ2A 2MMNA 4O5RA 2IMDA 1QQ2A 2M80A 4GSNA 1GTBA 1GNWA 2GT6A 4BVXA 1BX9A 1TU7A 1XOAA 4L5OA 4HJMA 4F0CA 4MJEA 2JZRA 2ZUPA 3IE3A 3ERWA 3M0FA 3FHKA 3D4TA 5J5NA 4JEDA 2I4AA 4K5RA 2HSHA 4CW9A 3W8SA 4XCSA 3FZ4A 4Q5RA 4EDZA 1KTEA 3QOUA 2E0QA 3ED3A 2LJRA 2G2QA 3FR3A 12GSA 2IPAA 3DD3A 4CY6A 1DUGA 4ULXA 4JE1A 3VWVA 4J56E 3GL3A 1BYEA 5LNKe 3HJOA 1MD3A 4G0LA 1XWAA 1HNBA 18GSA 1YEPA 4RQXA 5FHIA 3I43A 1USBA 4TRXA 5FT3A 2IIYA 1RW1A 2PBJA 3F4SA 1GTAA 1GTUA 2PGTA 2VLVA 2VL2A 3LGCA 1UN2A 1EEMA 3LXZA 3IR4A 1WIKA 1Z7RA 1XVWA 3EE2A 5J9CA 2ES7A 2R0CA 4L0WA 2X8HA 1O8XA 4KDUA 2C3QA 4PQ1A 2LSTA 4PUFC 4D73B 1Z5YE 3LYPA 3HDCA 2O89A 4K2XA 1NSWA 4MCUA 4TN8A 1M2DA 2XPDA 3LWAA 1B9YC 4BA7A 3A3TA 2B6MA 3TB2A 3FW2A 3TCOA 1PRXA 1GSQA 2CVKA 4NXIA 1A24A 3QPMA 2LRCA 2X8CA 1SKWB 1THXA 4KDXA 4BVYB 1Z6NA 2YZHA 4WF5A 3VPTA 2N5AA 1OE7A 3UEMA 4LA1A 1HNAA 1GRXA 5JWRB 5D8IA 5DVBA 4JR6A 2FGXA 3HVXA 4Z2UA 1FAAA 1GSSA 4FYUA 3ZIJA 1F9MA 3LG6A 4I6XA 5CNWA 2GDRA 3TKPA 4WR5A 2E2GA 3DKSA 4DSRA 3C7MA 1EZKA 3P2AA 5F8BA 1YF0A 1SL2B 3IPZA 2OE1A 2H1BA 4PURA 1X0RA 3UARA 1S3CA 4GTUA 2J9HA 5CAXA 1S3DA 2ALBA 4HU9A 11GSA 3F63A 4YQUA 4EVMA 2YPMA 2IMIA 1EEJA 1I9DA 1XW6A 3A5WA 2H30A 3P90A 4PUAA 2EC4A 5A5KA 2PUKC 3A5IA 4OFTA 3WT2A 1NM3A 1PGTA 4POMA 1GLPA 5GSSA 4YKGA 1O85A 4MPGA 1N8JA 2DSAA 2AV4A 4KCEA 5G30A 3EURA 2TIRA 2DIYA 4WEYA 1SL1B 2V6KA 5CRWA 3W6GA 3HXSA 1O8WA 2MBTA 3APOA 3H4KA 4FH8A 3TDGA 3OR5A 4JU5A 2H66A 2KP1A 2DIZA 3ZVJA 2DMLA 3HHVA 5LD0A 2V2GA 5IMCA 6GSYA 1V98A
chains in the Genus database with same CATH topology
2R3XA 2P0GA 1GLQA 4IGJA 4G19A 1XWCA 4DSSB 3CTFA 3D0ZA 2HRNA 2YJHA 6GSSA 5AN1A 2R5GA 3CSIA 5D73A 1KBNA 3E0UA 2N5FA 2D2ZA 2H1AA 3GMFA 3ZITA 5GSTA 2L57A 3M8NA 2LS5A 1T3BA 2VAFA 2AHEA 3RAZA 2EIQA 4ML1A 2JU5A 1KEBA 4KGIA 2RUEA 4P3YB 4N10A 4KUNA 2VL2C 2H6YA 3BCIA 1LU4A 3IHQA 2H8LA 3BD2A 4MLYA 1B8XA 1NW2A 2QA2A 5DBQA 3WT1A 1K3YA 5EY6A 2FWGA 4G9HA 3ISOA 2K6VA 3GV1A 4I2UA 2BMXA 2FD3A 3CMIA 3P8WA 2OADA 1EOHA 1M9AA 1T4YA 3QAVA 1PX6A 4MABA 4WKWA 3FYGA 2H19A 2VCXA 4ICYA 4F9ZA 5G31A 3GX8A 1UVZA 4BVYA 5ECSA 2GVPA 1TRVA 1HNCA 3ZMKA 1F6MC 1UA5A 4QQ7A 5GAPD 3TKRA 1TXXA 3DGQA 1NHOA 1GP1A 3M9KA 2XHFA 3EMXA 2MBSA 2AUVA 3M3MA 4MNNA 3UBKA 2MMAA 2IN3A 2NVLA 4HI7A 2H75A 3LJRA 2V1MA 1T8EB 3N9JA 3EU3A 3LXTA 1H75A 3W8JA 3MDKA 4RI7A 4ECJA 3V1WA 5J41A 4IJ3A 4H86A 1R26A 3CRTA 4KCAA 4K0GA 1AAZA 4O5UA 1K0MA 1OAZA 2H01A 1JZOA 4ZL8A 2LNSA 3FY7A 3KIJA 1RK4A 2R6KA 4JR4A 4MF6A 4X0XA 2GQMA 2A4VA 2KUCA 4ILFA 1XIYA 5A4WA 2C8UA 1BQ7A 1QXHA 4JZQA 1GUKA 3R2QA 4TR4A 2LTKA 2GZPA 2I9HA 3F4RA 1GSUA 5CRDA 2DJJA 1V58A 2HRFA 2IFQB 4GSSA 5IIZA 4USSA 4MP4A 1G6YA 1MEKA 5DALA 3G7YA 3L9SA 1A2MA 1PX7A 5J9BA 1PL2A 2M46A 2PU9C 3E9JB 4LL4B 4Q5FA 1LJRA 4XRAA 3TJGA 4BL7B 3ZYWA 2A2PA 4KNDA 4DSSA 3L78A 1OVNA 3KD0A 3KZQA 2YANA 5D96A 4IBPA 4AJ8A 3GKKA 1PD21 2HNLA 5F06A 4K7IA 5HQPA 5IOWA 4POLA 4EUYA 1Y25A 1Y6EA 2FWFA 2JL4A 5ELGA 4GQCA 2HZEB 4TR0A 2KLXA 1TJDA 1TP9A 2BJXA 3QAWA 4KSOA 5JCGA 2HZFA 5C00A 4ID0A 2AAWA 1JZDA 2JACA 4HQZA 2YJ7A 19GSA 1X9SB 3KCMA 1B48A 2X99A 1TI1A 2R0GA 1A2LA 3A2VA 4GXZA 4POBA 2G0FA 2LUSA 3QFBC 1GUHA 1O7UA 4YQVA 5D93A 3IV4A 4TXOB 4Z7XA 3EMPA 5DDLA 3GKNA 2K8VA 4A5PA 3HJPA 3FMWA 2E7PA 2FY6A 2WZ9A 1ZZYA 6GSXA 4ZBBA 3ZFLA 3PGTA 2N5BA 2ON5A 4EIQA 5ELAA 3LYKA 2DC5A 5ECRB 5ECLB 3EWLA 3FR9A 3IK7A 3TKSC 5E4WA 5IMDA 4IW9A 1AC1A 1SD8A 2BTOT 2HXKA 2IMEA 3EVIA 3APQA 1FB0A 4OO5A 1JLWA 5KN3A 3HYPA 5G1KA 2QA1A 3WD6A 3UOMA 4MF5A 2FWHA 3EU4A 1YKAA 1A23A 5INYA 1A8YA 3I69A 1BAYA 3C1SA 5GAND 1DE2A 3H93A 2LEGA 1A0RP 4XIHA 1YJ6A 1O6JA 5A4UA 5HR0A 2DKHA 1H4OA 2GSRA 3F9UA 2O8VB 2A4HA 3EYTA 1K0BA 4TOPA 1QMVA 4AGSA 5COHA 3TJFA 2H6XA 2R2JA 2CVBA 3JCML 4WXTA 1SK1A 5ECMB 4YAVA 1WOUA 5KOWA 2EIRA 2PVOC 3BOAA 1DBYA 2OJLA 3C8EA 3VURA 5IMFA 4IJIA 1A0FA 3ZIVA 2UZ8A 3QDNA 5IO2A 2B5XA 4JBBA 2H1DA 3UVHA 5E59A 4IHUA 4HU7A 3H8QA 1SD9A 4KSMA 2IFQA 5H5RA 1HQOA 5CP1A 1ZMAA 3IC4A 1R5PA 4OWYA 1OC3A 1K0OA 3CXGA 1K3LA 5G5FA 3ZMLA 4OCEA 3U6VA 1EV9A 4JRRA 5G2ZA 2OBKA 2M72A 4BL7A 5B6NA 1O73A 3TJBA 2YWOA 2R0PA 3SBCA 3GH6A 1VF4A 3GURA 4ECIA 2IMFA 1J08A 1U88A 3KMNA 2VOCA 1PQNA 1U3AA 1YQ1A 2B7KA 1X5CA 2VUPA 3DVXA 1C72A 4CDOA 4KW6A 16GSA 2HZEA 1FO5A 1OKDA 5HR3A 4EL1A 5J4UA 2ON7A 2VCTA 2OE0A 4TR1B 3TJKA 3RHBA 3GFKA 4KE3A 3U5RE 3ZREA 4NHWA 4TKYA 5DJMA 4IVFA 1AUCA 4ACSA 4V2NA 5F0GA 1SYXA 5C04A 4ECBA 3QMXA 2C0EA 3DWVA 2VCQA 4FYBA 4POKA 3TRXA 4KAEA 3GIXA 4TXOA 4XHMA 2H76A 4XS6A 5BMUA 4IS0A 4IQ1A 3ME8A 2CT6A 1BEDA 2FHEA 3KMOA 4N11A 4L0UA 3IC8A 3GA4A 5DQYA 2VLUA 2RM6A 1SU9A 3HD5A 2PPTA 3N5OA 22GSA 1K0CA 2R4VA 3LQ7A 1JFUA 2GQLA 1XOBA 4RQRA 2F8AA 2WFCA 3Q19A 1AIUA 2VO4A 1TK8B 2YV9A 3GTUB 2AJQB 1E6BA 5ECKB 3GSSA 3KH7A 3GN3A 4PGTA 1ML6A 3A2WA 1FW1A 2X4AA 1ERUA 4Q5QA 3DEXA 3TUEA 3KGKA 5EVOA 2LRNA 3GKXA 4N0VA 2YN1A 2DJ1A 4OD7A 5IMZA 1N2AA 5L71A 2J23A 2QGVA 1PMTA 1TKDB 2O87A 4GF0A 3EINA 1YEXA 2MZCA 1GSYA 4LMWA 3A2XA 4NV5A 2YWIA 5DALB 4MJBA 5DCGA 1R5AA 1TRUA 4GSTA 2HSMA 1XVQA 4XTSA 2JSYA 2CZ3A 4I97A 4O5QA 2A2SA 3NIVA 2B7JA 2K18A 1B9XC 3D22A 4F82A 3O6TA 1EP8A 1WWJA 1ZOFA 3EPTA 5JWQB 2V6OA 5IQYA 1ERWA 3F6DA 1SKSB 4HUAA 2B5YA 1V2AA 3PH9A 1TK5B 3IAS2 1TU8A 1SK0A 2IMKA 2LNTA 4OFMA 2P5RA 4ML6A 3PINA 3F8UA 3US3A 2AB6A 3CTGA 4HZ2A 3L0HA 1ST9A 4XRDA 1U3IA 3QD9A 4EC0A 1PL1A 1G7EA 3IDVA 2NBSA 2WDUA 1THOA 1FVKA 1TW9A 3TKSA 1WE0A 5IPGA 4TXVA 4TR1A 2HRKA 4IP6A 2I81A 4FQUA 3SWLA 2VIMA 2XPEA 3GX0A 3MWHA 2EIOA 4TR3A 3I9V2 3NOFA 3TRPA 4E8EA 1OKTA 3VWXA 2GGTA 5HR1A 1B4QA 4OCFA 4ZXGA 3IOSA 3L4NA 2FLSA 4PX1A 5JWOB 5D9XA 4ZIJA 1SJ6A 3GHAA 4V1Ap 4K7NA 1E2YA 2VM2A 2QSIA 3UJ1A 2HE3A 5HFIA 1YZXA 1FOHA 2OE3A 5B7CA 1BJXA 4GLTA 1I5GA 2YCDA 6GSVA 4K0NA 2GZYA 1URMA 2CA8A 4FO5A 3O3TA 3CYNA 1U6TA 4ZB8A 5ENUA 3IHGA 2YP6A 5F07A 1GUMA 2NPBA 5IPHA 2PERA 1ERTA 5LCZA 4KB3A 1J9BA 4MH3A 1XWBA 5KN0A 3GTUA 4YAPA 1NHYA 3APSA 2L59A 3G7JA 2A2RA 3ERGA 1KNGA 17GSA 3GL5A 5ECIB 3UMAA 1TRSA 2WULA 4OO4A 2I1UA 1CQHA 3FKFA 4KH7A 2RIIA 4PTSA 2HT9A 2E2MA 4Z2RA 1K0AA 5ECPB 3DYRA 4K7OA 3KTBA 2LQOA 5AIVA 1PKWA 5GZZB 4I8BA 2REMA 2WJUA 2PMTA 4K6XA 4MH2A 1F3AA 3TOTA 2H0IA 5FWGA 4PQIA 1XBSA 3DVWA 3IK9A 1JHBA 1ZYNA 4NPBA 4F2IA 1SYRA 3DRNA 1A8LA 4N0ZA 3NZNA 4AJ7A 1FVJA 4IN0A 2ZCTA 1QK8A 4XS4B 2FA8A 2YOIA 3VFIA 3WGDA 4GRFA 3TGZA 5IO0A 4X4JA 2IL3A 1V40A 4O32A 2C4JA 3GH9A 1O81A 1T4ZA 1K3OA 2YWNA 1VF2A 2XBQA 2HRAA 4N30A 3WYWA 1FB6A 2L4CA 5CYYA 3F3QA 1WRYA 2H70A 4NMUA 1GNEA 1EOGA 1M2AA 3LORA 1A2JA 4MJCA 2P31A 1G0TA 3BBYA 2FNOA 1X9MB 4RI6A 4MK3A 5D9TA 9GSSA 1XWGA 1ON4A 2CQ9A 4LMVA 3KEBA 1U87A 1OE8A 2H0GA 3GRXA 1OYJA 4IP1A 2O85A 1TRWA 1TTZA 5B8BA 4BWSA 4X1UA 3FRCA 2QC7A 5ECNB 3Q74A 1ILOA 2HLSA 3D4MA 2X8GA 4EKZA 3VWUA 3KJYA 1PKZA 3VI7A 2VCZA 1XPVA 3UVTA 4AF2A 1PN9A 2KP2A 4PNFA 2H73A 4LLRA 4QL7A 5DCHA 4G0KA 4BPYA 3F6FA 1QGVA 1TI3A 4HOJA 1OC8A 2H74A 3HKRA 4IQAA 3H79A 1PSQA 5KEJA 4YH2A 2CV4A 2WCIA 1GSDA 5ID2B 4WF4A 2KOKA 4EDYA 1EP7A 3M9JA 1ZCPA 2WS2A 1RQMA 2F8FA 4F03A 1JZRA 2C0FA 1ERVA 3L9VA 5KN2A 1SKRB 5G1LA 2GLRA 4MPFA 3G9BA 4V2MA 2AYTA 4MZCA 3D21A 4WBJA 1XWKA 4J2FA 1XW9A 3S9FA 1YDKA 2DJ3A 5F05A 4K5SA 4O7HA 1W4VA 1FG4A 2HYXA 3VLNA 1Z6MA 4HZ4A 8GSSA 1J0FA 2H71A 1GSEA 1AXDA 2DMMA 5HFKA 1IYHA 5CRGA 2GSTA 1EGRA 1AQVA 2GT5A 1M7TA 1ZYPA 1HYUA 4Q5NA 3HZ4A 4K1FA 3ZVJD 3LSZA 2CAIA 3QR6A 2C80A 2YZUA 1BG5A 1Z9HA 3FEUA 3M1GA 4GWRA 2F3MA 3G7IA 4KF9A 3PR8A 4MA9A 3RBTA 2B3SA 4XS4A 1XFLA 2VCWA 3Q6OA 4NAXA 1M9BA 4EO3A 3CSHA 2RM5A 2LKUA 4MF7A 4PQHA 3HZ8A 4EE0A 3WGEA 3QCPA 1AQWA 1T7PB 1GL8A 3UL3A 2XC2A 3QFAC 2V41A 3ZRDA 2MMOA 2C3NA 4KX4A 3VK9A 1V57A 4PNGA 2PWJA 4IELA 2MMZA 4ISDA 1WJKA 3PPUA 3ERFA 3F4TA 4LL1B 5DAKB 4CY8A 4V1Ag 1K0DA 3HY2A 4TVEA 3MIXA 4X43A 1QUWA 1XXUA 3HVVA 4NHZA 2GSQA 4HS1A 3I6AA 2TRCP 2VL3A 5KOXA 2K9FA 2L6CA 1GH2A 2VD1A 4I2TA 3HJMA 2C3TA 4ZBAA 5A4VA 1VGLA 3IAM2 1T1VA 3KM6A 3F3RA 1TK0B 2YWMA 3ZLPA 6GSUA 2GZZA 2K8SA 2L6DA 5B6MA 3TKSE 3MYDA 1EV4A 5ABRA 2GQKA 3AY8A 5ID2A 4AJ6A 3L9UA 3IA1A 4J57E 4KA0A 4OFNA 4DEJA 1EGOA 1F3BA 2CVDA 3IXRA 3R3EA 2Z9SA 1SJZA 1T00A 2VLTA 2B1KA 2GTUA 4KDYA 2L4QA 1SJIA 3FR6A 3UAPA 3K8NA 1ZL9A 4G0IA 2DJ2A 4BWQA 5ECOB 5DJLA 1X9WB 4WETA 3J7Yk 1VF1A 5KN1A 4EF0A 2ZNMA 1DE1A 3FZ9A 4ZB6A 3IRAA 1AW9A 1GSFA 3TOUA 3VPQA 3RPPA 2X49A 4YKFA 2O7KA 1F37A 2QKEA 3GKMA 3TJJA 2B1LA 4DSQA 3FZ5A 1UC7A 7GSSA 4DVCA 1XW5A 5JCWA 3FK8A 5ECHB 6GSTA 3J7Yb 13GSA 1OC9B 2H72A 1MTCA 5D9VA 1S3AA 4HEA2 1IYIA 2F9SA 1MDKA 5EL8A 3DMLA 3KP9A 3GYKA 4L5LA 2DJKA 3BJ5A 5H5QA 4ECCA 1FOVA 3P7XA 2C1YA 1TDIA 4E8HA 2DKIA 5B8AA 3VI5A 1F2EA 2H0HA 4PXOA 1Z3EA 2OKAA 5EPFA 2NTOA 2CAQA 2RLIA 1MD4A 3MAKA 2HI7A 4D73A 3CRUA 3ZTLA 2X64A 5HFGA 4K8MA 1JZWA 3DXBA 3RDWA 1Z7PA 3RPNA 2F51A 1ZYQB 2VD0A 2LJKA 3O76A 2XBIA 4K9ZA 3TKQA 2RUFA 1W89A 1GTIA 4WBRD 3DIEA 1QFNA 3QAGA 20GSA 2FUG2 14GSA 3MSZA 2R37A 2I3YA 1WP0A 3KTLA 5DAKA 3D5JA 2VM1A 2VCVA 3RHCA 1R7HA 2WB9A 2OACA 2C0DA 4HJ2A 4FIWA 5ECQB 3HCZA 4BVXB 3D6IA 3EC3A 1DSBA 1PA3A 3KXOA 2B5EA 5AGYA 2OBIA 4TW5A 5IM9A 2DBCA 3ZZXA 3LW9A 1X5DA 3ME7A 4MDCA 1K0NA 1M2BA 2PN8A 2WGRA 1G6WA 4EXJA 1YY7A 4O92A 3Q18A 2JZTA 2HSYA 4CHSA 1SK2A 3E3EA 3IBHA 1B4PA 4I5QA 4HQSA 1LBKA 1ZYEA 5BRTA 2L5OA 3UIWA 4ZILA 1YKCA 1JLVA 5H5SA 1YF1A 4V2LA 2L5LA 2DJ0A 1SL0B 1VRSD 3KP8A 1EWXA 2WRTA 4HDEA 2YNXA 3MNGA 1MDIA 2V32A 1MDJA 1XZOA 2H1GA 4WR4A 3CSJA 3HA9A 3GNJA 1SENA 3F0IA 3BCKA 2LRTA 2KHPA 2FA4A 2YV7A 4K2DA 3GUSA 3TRQA 2HFDA 1CQGA 1FHEA 1M0UA 5JCUA 4RUVA 2FWEA 4MZBA 3C73A 1ABAA 4G10A 2H6ZA 4YQMA 4OMVA 1Q4JA 3VWWA 3CBUA 4IKHA 2PVQA 5IMAA 2TRXA 3C71A 1HD2A 5CREA 3ZL5A 1TOFA 2JSZA 1GWCA 2CX3A 4GQFA 6GSWA 4MMMA 4NWYA 1M99A 1G7OA 4Z2TA 3FZAA 2OA7A 4FYCA 1OC9A 1ACVA 1PN0A 5CO3A 5HR2A 5CRHA 4XS1A 1VF3A 2GS3A 5J3RA 5G5EA 3LFLA 2MYGA 5D9WA 2P5QA 4MJAA 2NDOA 3UBLA 2LJAA 2FCHA 1ZGNA 3KH9A 2DLXA 4F0BA 4ZBDA 4MZWA 2JZSA 4ZL7A 4L8EA 4GCIA 5IOXA 1WPIA 5AISA 5IMVA 2GSSA 1WMJA 3WGXA 2IWTA 1R4WA 4NV2A 1XCCA 3GSTA 4EIPA 1Q98A 3ZFBA 3C1RA 10GSA 2LQQA 5DQSA 1AQXA 1GULA 2LV3A 2JADA 4ZL9A 5AIXA 2IJYA 4G2EA 4ZB9A 3LEFA 1X5EA 4QL9A 2C0GA 3HVSA 3H1NA 2VL9A 2CX4A 1V9WA 2CZ2A 2MMNA 4O5RA 2IMDA 1QQ2A 2M80A 4GSNA 1GTBA 1GNWA 2GT6A 4BVXA 1BX9A 1TU7A 1XOAA 4L5OA 4HJMA 4F0CA 4MJEA 2JZRA 2ZUPA 3IE3A 3ERWA 3M0FA 3FHKA 3D4TA 5J5NA 4JEDA 2I4AA 4K5RA 2HSHA 4CW9A 3W8SA 4XCSA 3FZ4A 4Q5RA 4EDZA 1KTEA 3QOUA 2E0QA 3ED3A 2LJRA 2G2QA 3FR3A 12GSA 2IPAA 3DD3A 4CY6A 1DUGA 4ULXA 4JE1A 3VWVA 4J56E 3GL3A 1BYEA 5LNKe 3HJOA 1MD3A 4G0LA 1XWAA 1HNBA 18GSA 1YEPA 4RQXA 5FHIA 3I43A 1USBA 4TRXA 5FT3A 2IIYA 1RW1A 2PBJA 3F4SA 1GTAA 1GTUA 2PGTA 2VLVA 2VL2A 3LGCA 1UN2A 1EEMA 3LXZA 3IR4A 1WIKA 1Z7RA 1XVWA 3EE2A 5J9CA 2ES7A 2R0CA 4L0WA 2X8HA 1O8XA 4KDUA 2C3QA 4PQ1A 2LSTA 4PUFC 4D73B 1Z5YE 3LYPA 3HDCA 2O89A 4K2XA 1NSWA 4MCUA 4TN8A 1M2DA 2XPDA 3LWAA 1B9YC 4BA7A 3A3TA 2B6MA 3TB2A 3FW2A 3TCOA 1PRXA 1GSQA 2CVKA 4NXIA 1A24A 3QPMA 2LRCA 2X8CA 1SKWB 1THXA 4KDXA 4BVYB 1Z6NA 2YZHA 4WF5A 3VPTA 2N5AA 1OE7A 3UEMA 4LA1A 1HNAA 1GRXA 5JWRB 5D8IA 5DVBA 4JR6A 2FGXA 3HVXA 4Z2UA 1FAAA 1GSSA 4FYUA 3ZIJA 1F9MA 3LG6A 4I6XA 5CNWA 2GDRA 3TKPA 4WR5A 2E2GA 3DKSA 4DSRA 3C7MA 1EZKA 3P2AA 5F8BA 1YF0A 1SL2B 3IPZA 2OE1A 2H1BA 4PURA 1X0RA 3UARA 1S3CA 4GTUA 2J9HA 5CAXA 1S3DA 2ALBA 4HU9A 11GSA 3F63A 4YQUA 4EVMA 2YPMA 2IMIA 1EEJA 1I9DA 1XW6A 3A5WA 2H30A 3P90A 4PUAA 2EC4A 5A5KA 2PUKC 3A5IA 4OFTA 3WT2A 1NM3A 1PGTA 4POMA 1GLPA 5GSSA 4YKGA 1O85A 4MPGA 1N8JA 2DSAA 2AV4A 4KCEA 5G30A 3EURA 2TIRA 2DIYA 4WEYA 1SL1B 2V6KA 5CRWA 3W6GA 3HXSA 1O8WA 2MBTA 3APOA 3H4KA 4FH8A 3TDGA 3OR5A 4JU5A 2H66A 2KP1A 2DIZA 3ZVJA 2DMLA 3HHVA 5LD0A 2V2GA 5IMCA 6GSYA 1V98A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R3X A;  2P0G A;  1GLQ A;  4IGJ A;  4G19 A;  1XWC A;  4DSS B;  3CTF A;  3D0Z A;  2HRN A;  2YJH A;  6GSS A;  5AN1 A;  2R5G A;  3CSI A;  5D73 A;  1KBN A;  3E0U A;  2N5F A;  2D2Z A;  2H1A A;  3GMF A;  3ZIT A;  5GST A;  2L57 A;  3M8N A;  2LS5 A;  1T3B A;  2VAF A;  2AHE A;  3RAZ A;  2EIQ A;  4ML1 A;  2JU5 A;  1KEB A;  4KGI A;  2RUE A;  4P3Y B;  4N10 A;  4KUN A;  2VL2 C;  2H6Y A;  3BCI A;  1LU4 A;  3IHQ A;  2H8L A;  3BD2 A;  4MLY A;  1B8X A;  1NW2 A;  5DBQ A;  3WT1 A;  1K3Y A;  5EY6 A;  2FWG A;  4G9H A;  3ISO A;  2K6V A;  3GV1 A;  4I2U A;  2BMX A;  2FD3 A;  3CMI A;  3P8W A;  2OAD A;  1EOH A;  1M9A A;  1T4Y A;  3QAV A;  1PX6 A;  4MAB A;  4WKW A;  3FYG A;  2H19 A;  2VCX A;  4F9Z A;  5G31 A;  3GX8 A;  1UVZ A;  4BVY A;  5ECS A;  2GVP A;  1TRV A;  1HNC A;  3ZMK A;  1F6M C;  1UA5 A;  4QQ7 A;  5GAP D;  3TKR A;  1TXX A;  3DGQ A;  1NHO A;  1GP1 A;  3M9K A;  2XHF A;  3EMX A;  2MBS A;  2AUV A;  3M3M A;  3UBK A;  2MMA A;  2IN3 A;  2NVL A;  4HI7 A;  2H75 A;  3LJR A;  2V1M A;  1T8E B;  3N9J A;  3EU3 A;  3LXT A;  1H75 A;  3W8J A;  3MDK A;  4RI7 A;  4ECJ A;  3V1W A;  5J41 A;  4IJ3 A;  4H86 A;  1R26 A;  3CRT A;  4KCA A;  4K0G A;  1AAZ A;  1K0M A;  1OAZ A;  2H01 A;  1JZO A;  4ZL8 A;  2LNS A;  3FY7 A;  3KIJ A;  1RK4 A;  2R6K A;  4JR4 A;  4MF6 A;  4X0X A;  2GQM A;  2A4V A;  2KUC A;  4ILF A;  1XIY A;  5A4W A;  2C8U A;  1BQ7 A;  1QXH A;  4JZQ A;  1GUK A;  3R2Q A;  4TR4 A;  2LTK A;  2GZP A;  2I9H A;  3F4R A;  1GSU A;  5CRD A;  2DJJ A;  1V58 A;  2HRF A;  2IFQ B;  4GSS A;  5IIZ A;  4MP4 A;  1G6Y A;  1MEK A;  5DAL A;  3G7Y A;  3L9S A;  1A2M A;  1PX7 A;  5J9B A;  1PL2 A;  2M46 A;  2PU9 C;  3E9J B;  4LL4 B;  4Q5F A;  1LJR A;  4XRA A;  3TJG A;  3ZYW A;  4KND A;  4DSS A;  3L78 A;  1OVN A;  3KD0 A;  3KZQ A;  2YAN A;  5D96 A;  4IBP A;  4AJ8 A;  3GKK A;  1PD2 1;  2HNL A;  5F06 A;  4K7I A;  5HQP A;  5IOW A;  4POL A;  4EUY A;  1Y25 A;  1Y6E A;  2FWF A;  2JL4 A;  5ELG A;  4GQC A;  2HZE B;  4TR0 A;  2KLX A;  1TJD A;  1TP9 A;  2BJX A;  3QAW A;  4KSO A;  5JCG A;  2HZF A;  5C00 A;  4ID0 A;  2AAW A;  1JZD A;  2JAC A;  4HQZ A;  2YJ7 A;  19GS A;  1X9S B;  3KCM A;  1B48 A;  2X99 A;  1TI1 A;  1A2L A;  3A2V A;  4GXZ A;  4POB A;  2G0F A;  2LUS A;  3QFB C;  1GUH A;  1O7U A;  4YQV A;  5D93 A;  3IV4 A;  4TXO B;  4Z7X A;  3EMP A;  5DDL A;  3GKN A;  2K8V A;  3HJP A;  2E7P A;  2FY6 A;  2WZ9 A;  1ZZY A;  6GSX A;  4ZBB A;  3ZFL A;  3PGT A;  2N5B A;  2ON5 A;  5ELA A;  3LYK A;  2DC5 A;  5ECR B;  5ECL B;  3EWL A;  3FR9 A;  3IK7 A;  3TKS C;  5E4W A;  5IMD A;  4IW9 A;  1AC1 A;  1SD8 A;  2BTO T;  2HXK A;  2IME A;  3EVI A;  3APQ A;  1FB0 A;  4OO5 A;  1JLW A;  5KN3 A;  3HYP A;  5G1K A;  3WD6 A;  3UOM A;  4MF5 A;  2FWH A;  3EU4 A;  1YKA A;  1A23 A;  5INY A;  1A8Y A;  3I69 A;  1BAY A;  3C1S A;  5GAN D;  1DE2 A;  3H93 A;  2LEG A;  1A0R P;  4XIH A;  1YJ6 A;  1O6J A;  5A4U A;  5HR0 A;  1H4O A;  2GSR A;  3F9U A;  2O8V B;  3EYT A;  1K0B A;  4TOP A;  1QMV A;  4AGS A;  5COH A;  3TJF A;  2H6X A;  2R2J A;  2CVB A;  3JCM L;  4WXT A;  1SK1 A;  5ECM B;  4YAV A;  1WOU A;  2EIR A;  2PVO C;  3BOA A;  1DBY A;  2OJL A;  3C8E A;  3VUR A;  5IMF A;  4IJI A;  1A0F A;  3ZIV A;  3QDN A;  5IO2 A;  2B5X A;  4JBB A;  2H1D A;  3UVH A;  5E59 A;  4IHU A;  4HU7 A;  3H8Q A;  1SD9 A;  4KSM A;  2IFQ A;  5H5R A;  1HQO A;  5CP1 A;  1ZMA A;  3IC4 A;  1R5P A;  4OWY A;  1OC3 A;  1K0O A;  3CXG A;  1K3L A;  5G5F A;  3ZML A;  4OCE A;  3U6V A;  1EV9 A;  4JRR A;  5G2Z A;  2OBK A;  2M72 A;  4BL7 A;  5B6N A;  1O73 A;  3TJB A;  2YWO A;  3SBC A;  3GH6 A;  1VF4 A;  3GUR A;  4ECI A;  2IMF A;  1J08 A;  1U88 A;  3KMN A;  2VOC A;  1PQN A;  1U3A A;  1YQ1 A;  2B7K A;  1X5C A;  2VUP A;  3DVX A;  1C72 A;  4CDO A;  4KW6 A;  16GS A;  2HZE A;  1FO5 A;  1OKD A;  5HR3 A;  4EL1 A;  5J4U A;  2ON7 A;  2VCT A;  2OE0 A;  4TR1 B;  3TJK A;  3RHB A;  3GFK A;  4KE3 A;  3U5R E;  3ZRE A;  4NHW A;  4TKY A;  5DJM A;  4IVF A;  1AUC A;  4ACS A;  4V2N A;  5F0G A;  1SYX A;  5C04 A;  4ECB A;  3QMX A;  2C0E A;  3DWV A;  2VCQ A;  4FYB A;  4POK A;  3TRX A;  4KAE A;  3GIX A;  4TXO A;  4XHM A;  2H76 A;  4XS6 A;  4IS0 A;  4IQ1 A;  3ME8 A;  2CT6 A;  1BED A;  2FHE A;  3KMO A;  4N11 A;  4L0U A;  3GA4 A;  5DQY A;  2VLU A;  2RM6 A;  1SU9 A;  3HD5 A;  2PPT A;  3N5O A;  22GS A;  1K0C A;  2R4V A;  3LQ7 A;  1JFU A;  2GQL A;  1XOB A;  4RQR A;  2F8A A;  2WFC A;  3Q19 A;  1AIU A;  2VO4 A;  1TK8 B;  2YV9 A;  3GTU B;  2AJQ B;  1E6B A;  5ECK B;  3GSS A;  3KH7 A;  3GN3 A;  4PGT A;  1ML6 A;  3A2W A;  1FW1 A;  1ERU A;  4Q5Q A;  3DEX A;  3TUE A;  3KGK A;  5EVO A;  2LRN A;  3GKX A;  4N0V A;  2YN1 A;  2DJ1 A;  4OD7 A;  5IMZ A;  1N2A A;  5L71 A;  2J23 A;  2QGV A;  1PMT A;  1TKD B;  2O87 A;  4GF0 A;  3EIN A;  1YEX A;  2MZC A;  1GSY A;  4LMW A;  3A2X A;  4NV5 A;  2YWI A;  5DAL B;  4MJB A;  5DCG A;  1R5A A;  1TRU A;  4GST A;  1XVQ A;  4XTS A;  2JSY A;  2CZ3 A;  4I97 A;  2A2S A;  3NIV A;  2B7J A;  2K18 A;  1B9X C;  3D22 A;  4F82 A;  3O6T A;  1EP8 A;  1WWJ A;  1ZOF A;  5JWQ B;  2V6O A;  5IQY A;  1ERW A;  3F6D A;  1SKS B;  4HUA A;  2B5Y A;  1V2A A;  3PH9 A;  1TK5 B;  3IAS 2;  1TU8 A;  1SK0 A;  2IMK A;  2LNT A;  4OFM A;  2P5R A;  4ML6 A;  3PIN A;  3F8U A;  3US3 A;  2AB6 A;  3CTG A;  4HZ2 A;  3L0H A;  1ST9 A;  4XRD A;  1U3I A;  3QD9 A;  4EC0 A;  1PL1 A;  1G7E A;  3IDV A;  2NBS A;  2WDU A;  1THO A;  1FVK A;  1TW9 A;  3TKS A;  1WE0 A;  5IPG A;  4TXV A;  4TR1 A;  4IP6 A;  2I81 A;  3SWL A;  2VIM A;  2XPE A;  3GX0 A;  3MWH A;  2EIO A;  4TR3 A;  3I9V 2;  3NOF A;  3TRP A;  4E8E A;  1OKT A;  3VWX A;  2GGT A;  5HR1 A;  1B4Q A;  4OCF A;  4ZXG A;  3IOS A;  3L4N A;  2FLS A;  4PX1 A;  5JWO B;  5D9X A;  4ZIJ A;  1SJ6 A;  3GHA A;  4V1A p;  4K7N A;  1E2Y A;  2VM2 A;  2QSI A;  3UJ1 A;  2HE3 A;  5HFI A;  1YZX A;  2OE3 A;  5B7C A;  1BJX A;  4GLT A;  1I5G A;  2YCD A;  6GSV A;  4K0N A;  2GZY A;  1URM A;  2CA8 A;  4FO5 A;  3O3T A;  3CYN A;  1U6T A;  4ZB8 A;  5ENU A;  2YP6 A;  5F07 A;  1GUM A;  2NPB A;  5IPH A;  2PER A;  1ERT A;  5LCZ A;  4KB3 A;  1J9B A;  4MH3 A;  1XWB A;  5KN0 A;  3GTU A;  4YAP A;  1NHY A;  3APS A;  2L59 A;  3G7J A;  2A2R A;  3ERG A;  1KNG A;  17GS A;  3GL5 A;  5ECI B;  3UMA A;  1TRS A;  2WUL A;  4OO4 A;  2I1U A;  1CQH A;  3FKF A;  4KH7 A;  2RII A;  2HT9 A;  2E2M A;  1K0A A;  5ECP B;  3DYR A;  4K7O A;  3KTB A;  2LQO A;  5AIV A;  1PKW A;  5GZZ B;  4I8B A;  2REM A;  2WJU A;  2PMT A;  4K6X A;  4MH2 A;  1F3A A;  3TOT A;  2H0I A;  5FWG A;  4PQI A;  1XBS A;  3DVW A;  3IK9 A;  1JHB A;  4NPB A;  4F2I A;  1SYR A;  3DRN A;  1A8L A;  4N0Z A;  3NZN A;  4AJ7 A;  1FVJ A;  4IN0 A;  2ZCT A;  1QK8 A;  4XS4 B;  2FA8 A;  2YOI A;  3VFI A;  3WGD A;  4GRF A;  3TGZ A;  5IO0 A;  2IL3 A;  1V40 A;  4O32 A;  2C4J A;  3GH9 A;  1O81 A;  1T4Z A;  1K3O A;  2YWN A;  1VF2 A;  2XBQ A;  4N30 A;  3WYW A;  1FB6 A;  2L4C A;  5CYY A;  3F3Q A;  1WRY A;  2H70 A;  4NMU A;  1GNE A;  1EOG A;  1M2A A;  3LOR A;  1A2J A;  4MJC A;  2P31 A;  1G0T A;  3BBY A;  2FNO A;  1X9M B;  4RI6 A;  4MK3 A;  5D9T A;  9GSS A;  1XWG A;  1ON4 A;  2CQ9 A;  4LMV A;  3KEB A;  1U87 A;  1OE8 A;  2H0G A;  3GRX A;  1OYJ A;  4IP1 A;  2O85 A;  1TRW A;  1TTZ A;  5B8B A;  4BWS A;  4X1U A;  3FRC A;  2QC7 A;  5ECN B;  3Q74 A;  1ILO A;  2HLS A;  3D4M A;  2X8G A;  4EKZ A;  3VWU A;  3KJY A;  1PKZ A;  3VI7 A;  2VCZ A;  1XPV A;  3UVT A;  4AF2 A;  1PN9 A;  2KP2 A;  4PNF A;  2H73 A;  4LLR A;  4QL7 A;  5DCH A;  4BPY A;  3F6F A;  1QGV A;  1TI3 A;  4HOJ A;  1OC8 A;  2H74 A;  3HKR A;  4IQA A;  3H79 A;  1PSQ A;  5KEJ A;  4YH2 A;  2CV4 A;  2WCI A;  1GSD A;  5ID2 B;  4WF4 A;  2KOK A;  4EDY A;  1EP7 A;  3M9J A;  1ZCP A;  2WS2 A;  1RQM A;  2F8F A;  4F03 A;  1JZR A;  2C0F A;  1ERV A;  3L9V A;  5KN2 A;  1SKR B;  5G1L A;  2GLR A;  4MPF A;  3G9B A;  4V2M A;  2AYT A;  4MZC A;  3D21 A;  4WBJ A;  1XWK A;  4J2F A;  1XW9 A;  3S9F A;  1YDK A;  2DJ3 A;  5F05 A;  4O7H A;  1W4V A;  1FG4 A;  2HYX A;  3VLN A;  1Z6M A;  4HZ4 A;  8GSS A;  1J0F A;  2H71 A;  1GSE A;  1AXD A;  2DMM A;  5HFK A;  1IYH A;  5CRG A;  2GST A;  1EGR A;  1AQV A;  2GT5 A;  1M7T A;  1HYU A;  4Q5N A;  3HZ4 A;  4K1F A;  3ZVJ D;  3LSZ A;  2CAI A;  3QR6 A;  2C80 A;  2YZU A;  1BG5 A;  1Z9H A;  3FEU A;  3M1G A;  4GWR A;  2F3M A;  3G7I A;  3PR8 A;  4MA9 A;  3RBT A;  2B3S A;  4XS4 A;  1XFL A;  2VCW A;  3Q6O A;  4NAX A;  1M9B A;  4EO3 A;  3CSH A;  2RM5 A;  2LKU A;  4MF7 A;  4PQH A;  3HZ8 A;  4EE0 A;  3WGE A;  3QCP A;  1AQW A;  1T7P B;  1GL8 A;  3UL3 A;  2XC2 A;  3QFA C;  2V41 A;  3ZRD A;  2MMO A;  2C3N A;  4KX4 A;  3VK9 A;  1V57 A;  4PNG A;  2PWJ A;  4IEL A;  2MMZ A;  4ISD A;  1WJK A;  3ERF A;  3F4T A;  4LL1 B;  5DAK B;  4V1A g;  1K0D A;  3HY2 A;  4TVE A;  4X43 A;  1QUW A;  1XXU A;  3HVV A;  4NHZ A;  2GSQ A;  4HS1 A;  3I6A A;  2TRC P;  2VL3 A;  2K9F A;  2L6C A;  1GH2 A;  2VD1 A;  4I2T A;  3HJM A;  2C3T A;  4ZBA A;  5A4V A;  1VGL A;  3IAM 2;  1T1V A;  3KM6 A;  3F3R A;  1TK0 B;  2YWM A;  3ZLP A;  6GSU A;  2GZZ A;  2K8S A;  2L6D A;  5B6M A;  3TKS E;  1EV4 A;  5ABR A;  2GQK A;  3AY8 A;  5ID2 A;  4AJ6 A;  3L9U A;  3IA1 A;  4J57 E;  4KA0 A;  4OFN A;  4DEJ A;  1EGO A;  1F3B A;  2CVD A;  3IXR A;  2Z9S A;  1SJZ A;  1T00 A;  2VLT A;  2B1K A;  2GTU A;  4KDY A;  2L4Q A;  1SJI A;  3FR6 A;  3UAP A;  3K8N A;  1ZL9 A;  2DJ2 A;  4BWQ A;  5ECO B;  5DJL A;  1X9W B;  4WET A;  3J7Y k;  1VF1 A;  5KN1 A;  4EF0 A;  2ZNM A;  1DE1 A;  3FZ9 A;  4ZB6 A;  3IRA A;  1AW9 A;  1GSF A;  3TOU A;  3VPQ A;  3RPP A;  2O7K A;  1F37 A;  2QKE A;  3GKM A;  3TJJ A;  2B1L A;  4DSQ A;  3FZ5 A;  1UC7 A;  7GSS A;  4DVC A;  1XW5 A;  5JCW A;  3FK8 A;  5ECH B;  6GST A;  3J7Y b;  13GS A;  1OC9 B;  2H72 A;  1MTC A;  5D9V A;  1S3A A;  4HEA 2;  1IYI A;  2F9S A;  1MDK A;  5EL8 A;  3DML A;  3KP9 A;  3GYK A;  4L5L A;  2DJK A;  3BJ5 A;  5H5Q A;  4ECC A;  1FOV A;  3P7X A;  2C1Y A;  1TDI A;  4E8H A;  5B8A A;  3VI5 A;  1F2E A;  2H0H A;  4PXO A;  1Z3E A;  2OKA A;  5EPF A;  2NTO A;  2CAQ A;  2RLI A;  1MD4 A;  3MAK A;  2HI7 A;  4D73 A;  3CRU A;  3ZTL A;  2X64 A;  5HFG A;  4K8M A;  1JZW A;  3DXB A;  3RDW A;  1Z7P A;  3RPN A;  2F51 A;  1ZYQ B;  2VD0 A;  2LJK A;  3O76 A;  2XBI A;  4K9Z A;  3TKQ A;  2RUF A;  1W89 A;  1GTI A;  4WBR D;  3DIE A;  1QFN A;  3QAG A;  20GS A;  2FUG 2;  14GS A;  3MSZ A;  2R37 A;  2I3Y A;  1WP0 A;  3KTL A;  5DAK A;  3D5J A;  2VM1 A;  2VCV A;  3RHC A;  1R7H A;  2WB9 A;  2OAC A;  2C0D A;  4HJ2 A;  4FIW A;  5ECQ B;  3HCZ A;  3D6I A;  3EC3 A;  1DSB A;  1PA3 A;  3KXO A;  2B5E A;  5AGY A;  2OBI A;  4TW5 A;  5IM9 A;  2DBC A;  3ZZX A;  1X5D A;  3ME7 A;  4MDC A;  1K0N A;  1M2B A;  2PN8 A;  2WGR A;  1G6W A;  4EXJ A;  1YY7 A;  4O92 A;  3Q18 A;  2JZT A;  2HSY A;  4CHS A;  1SK2 A;  3E3E A;  3IBH A;  1B4P A;  4I5Q A;  4HQS A;  1LBK A;  1ZYE A;  2L5O A;  3UIW A;  4ZIL A;  1YKC A;  1JLV A;  5H5S A;  1YF1 A;  4V2L A;  2L5L A;  2DJ0 A;  1SL0 B;  1VRS D;  3KP8 A;  1EWX A;  2WRT A;  4HDE A;  2YNX A;  3MNG A;  1MDI A;  2V32 A;  1MDJ A;  1XZO A;  2H1G A;  4WR4 A;  3CSJ A;  3HA9 A;  3GNJ A;  1SEN A;  3F0I A;  3BCK A;  2LRT A;  2KHP A;  2FA4 A;  2YV7 A;  4K2D A;  3GUS A;  3TRQ A;  2HFD A;  1CQG A;  1FHE A;  1M0U A;  5JCU A;  4RUV A;  2FWE A;  4MZB A;  3C73 A;  1ABA A;  4G10 A;  2H6Z A;  4YQM A;  4OMV A;  1Q4J A;  3VWW A;  3CBU A;  4IKH A;  2PVQ A;  5IMA A;  2TRX A;  3C71 A;  1HD2 A;  5CRE A;  3ZL5 A;  1TOF A;  2JSZ A;  1GWC A;  2CX3 A;  4GQF A;  6GSW A;  4MMM A;  4NWY A;  1M99 A;  1G7O A;  3FZA A;  2OA7 A;  4FYC A;  1OC9 A;  1ACV A;  5CO3 A;  5HR2 A;  5CRH A;  4XS1 A;  1VF3 A;  2GS3 A;  5J3R A;  5G5E A;  3LFL A;  2MYG A;  5D9W A;  2P5Q A;  4MJA A;  2NDO A;  3UBL A;  2LJA A;  2FCH A;  1ZGN A;  3KH9 A;  2DLX A;  4F0B A;  4ZBD A;  4MZW A;  2JZS A;  4ZL7 A;  4L8E A;  4GCI A;  5IOX A;  1WPI A;  5AIS A;  5IMV A;  2GSS A;  1WMJ A;  3WGX A;  2IWT A;  1R4W A;  4NV2 A;  1XCC A;  3GST A;  1Q98 A;  3ZFB A;  3C1R A;  10GS A;  2LQQ A;  5DQS A;  1AQX A;  1GUL A;  2LV3 A;  2JAD A;  4ZL9 A;  5AIX A;  2IJY A;  4G2E A;  4ZB9 A;  3LEF A;  1X5E A;  4QL9 A;  2C0G A;  3HVS A;  3H1N A;  2VL9 A;  2CX4 A;  1V9W A;  2CZ2 A;  2MMN A;  4O5R A;  2IMD A;  1QQ2 A;  2M80 A;  4GSN A;  1GTB A;  1GNW A;  2GT6 A;  4BVX A;  1BX9 A;  1TU7 A;  1XOA A;  4L5O A;  4HJM A;  4F0C A;  4MJE A;  2JZR A;  2ZUP A;  3IE3 A;  3ERW A;  3M0F A;  3FHK A;  3D4T A;  5J5N A;  4JED A;  2I4A A;  2HSH A;  4CW9 A;  3W8S A;  4XCS A;  3FZ4 A;  4Q5R A;  4EDZ A;  1KTE A;  3QOU A;  2E0Q A;  3ED3 A;  2LJR A;  2G2Q A;  3FR3 A;  12GS A;  2IPA A;  3DD3 A;  1DUG A;  4ULX A;  4JE1 A;  3VWV A;  4J56 E;  3GL3 A;  1BYE A;  5LNK e;  3HJO A;  1MD3 A;  1XWA A;  1HNB A;  18GS A;  1YEP A;  4RQX A;  5FHI A;  3I43 A;  1USB A;  4TRX A;  5FT3 A;  2IIY A;  1RW1 A;  2PBJ A;  3F4S A;  1GTA A;  1GTU A;  2PGT A;  2VLV A;  2VL2 A;  3LGC A;  1UN2 A;  1EEM A;  3LXZ A;  3IR4 A;  1WIK A;  1Z7R A;  1XVW A;  3EE2 A;  5J9C A;  2ES7 A;  4L0W A;  2X8H A;  1O8X A;  4KDU A;  2C3Q A;  4PQ1 A;  2LST A;  4PUF C;  4D73 B;  1Z5Y E;  3LYP A;  3HDC A;  2O89 A;  1NSW A;  4MCU A;  4TN8 A;  1M2D A;  2XPD A;  3LWA A;  1B9Y C;  4BA7 A;  3A3T A;  2B6M A;  3TB2 A;  3FW2 A;  3TCO A;  1PRX A;  1GSQ A;  2CVK A;  4NXI A;  1A24 A;  3QPM A;  2LRC A;  2X8C A;  1SKW B;  1THX A;  4KDX A;  1Z6N A;  2YZH A;  4WF5 A;  3VPT A;  2N5A A;  1OE7 A;  3UEM A;  4LA1 A;  1HNA A;  1GRX A;  5JWR B;  5D8I A;  5DVB A;  4JR6 A;  2FGX A;  3HVX A;  1FAA A;  1GSS A;  4FYU A;  3ZIJ A;  1F9M A;  3LG6 A;  4I6X A;  5CNW A;  2GDR A;  3TKP A;  4WR5 A;  2E2G A;  3DKS A;  4DSR A;  3C7M A;  1EZK A;  3P2A A;  5F8B A;  1YF0 A;  1SL2 B;  3IPZ A;  2OE1 A;  2H1B A;  4PUR A;  1X0R A;  3UAR A;  1S3C A;  4GTU A;  2J9H A;  5CAX A;  1S3D A;  2ALB A;  4HU9 A;  11GS A;  3F63 A;  4YQU A;  4EVM A;  2YPM A;  2IMI A;  1EEJ A;  1I9D A;  1XW6 A;  3A5W A;  2H30 A;  3P90 A;  4PUA A;  2EC4 A;  5A5K A;  2PUK C;  4OFT A;  3WT2 A;  1NM3 A;  1PGT A;  4POM A;  1GLP A;  5GSS A;  1O85 A;  4MPG A;  1N8J A;  2DSA A;  2AV4 A;  4KCE A;  5G30 A;  3EUR A;  2TIR A;  2DIY A;  4WEY A;  1SL1 B;  2V6K A;  5CRW A;  3W6G A;  3HXS A;  1O8W A;  2MBT A;  3APO A;  3H4K A;  4FH8 A;  3TDG A;  3OR5 A;  4JU5 A;  2H66 A;  2KP1 A;  2DIZ A;  3ZVJ A;  2DML A;  3HHV A;  5LD0 A;  2V2G A;  5IMC A;  6GSY A;  1V98 A; 
#chains in the Genus database with same CATH topology
 2R3X A;  2P0G A;  1GLQ A;  4IGJ A;  4G19 A;  1XWC A;  4DSS B;  3CTF A;  3D0Z A;  2HRN A;  2YJH A;  6GSS A;  5AN1 A;  2R5G A;  3CSI A;  5D73 A;  1KBN A;  3E0U A;  2N5F A;  2D2Z A;  2H1A A;  3GMF A;  3ZIT A;  5GST A;  2L57 A;  3M8N A;  2LS5 A;  1T3B A;  2VAF A;  2AHE A;  3RAZ A;  2EIQ A;  4ML1 A;  2JU5 A;  1KEB A;  4KGI A;  2RUE A;  4P3Y B;  4N10 A;  4KUN A;  2VL2 C;  2H6Y A;  3BCI A;  1LU4 A;  3IHQ A;  2H8L A;  3BD2 A;  4MLY A;  1B8X A;  1NW2 A;  2QA2 A;  5DBQ A;  3WT1 A;  1K3Y A;  5EY6 A;  2FWG A;  4G9H A;  3ISO A;  2K6V A;  3GV1 A;  4I2U A;  2BMX A;  2FD3 A;  3CMI A;  3P8W A;  2OAD A;  1EOH A;  1M9A A;  1T4Y A;  3QAV A;  1PX6 A;  1XG8 A;  4WKW A;  4MAB A;  3FYG A;  2H19 A;  2VCX A;  4ICY A;  4F9Z A;  5G31 A;  3GX8 A;  1UVZ A;  4BVY A;  5ECS A;  2GVP A;  1TRV A;  1HNC A;  3ZMK A;  1F6M C;  1UA5 A;  4QQ7 A;  5GAP D;  3TKR A;  1TXX A;  3DGQ A;  1NHO A;  1GP1 A;  3M9K A;  2XHF A;  3EMX A;  2MBS A;  2AUV A;  3M3M A;  4MNN A;  3UBK A;  2MMA A;  2IN3 A;  2NVL A;  4HI7 A;  2H75 A;  3LJR A;  2V1M A;  1T8E B;  3N9J A;  3EU3 A;  3LXT A;  1H75 A;  3W8J A;  3MDK A;  4RI7 A;  4ECJ A;  4BIK A;  3V1W A;  5J41 A;  4IJ3 A;  4H86 A;  1R26 A;  3CRT A;  4KCA A;  4K0G A;  1AAZ A;  4O5U A;  1K0M A;  1OAZ A;  2H01 A;  1JZO A;  4ZL8 A;  2LNS A;  3FY7 A;  3KIJ A;  1RK4 A;  2R6K A;  4JR4 A;  4MF6 A;  4X0X A;  2GQM A;  2A4V A;  2KUC A;  4ILF A;  1XIY A;  5A4W A;  2C8U A;  1BQ7 A;  1QXH A;  4JZQ A;  1GUK A;  3R2Q A;  4TR4 A;  2LTK A;  2GZP A;  2I9H A;  3F4R A;  1GSU A;  5CRD A;  2DJJ A;  1V58 A;  2HRF A;  2IFQ B;  4GSS A;  5IIZ A;  4USS A;  4MP4 A;  1G6Y A;  1MEK A;  5DAL A;  3G7Y A;  3L9S A;  1A2M A;  1PX7 A;  5J9B A;  1PL2 A;  2M46 A;  2PU9 C;  3E9J B;  4LL4 B;  4Q5F A;  1LJR A;  4XRA A;  3TJG A;  4BL7 B;  3ZYW A;  2A2P A;  4KND A;  4DSS A;  3L78 A;  1OVN A;  3KD0 A;  3KZQ A;  1M3I A;  2YAN A;  5D96 A;  4IBP A;  4AJ8 A;  3GKK A;  1PD2 1;  2HNL A;  5F06 A;  4K7I A;  5HQP A;  5IOW A;  4POL A;  4EUY A;  1Y25 A;  1Y6E A;  2FWF A;  2JL4 A;  5ELG A;  4GQC A;  2HZE B;  4TR0 A;  2KLX A;  1TJD A;  1TP9 A;  2BJX A;  3QAW A;  4KSO A;  5JCG A;  2HZF A;  5C00 A;  4ID0 A;  2AAW A;  1JZD A;  2JAC A;  4HQZ A;  2YJ7 A;  19GS A;  1X9S B;  3KCM A;  1B48 A;  2X99 A;  1TI1 A;  2R0G A;  1A2L A;  3A2V A;  4GXZ A;  4POB A;  2G0F A;  2LUS A;  3QFB C;  1GUH A;  1O7U A;  4YQV A;  5D93 A;  3IV4 A;  4TXO B;  4Z7X A;  3EMP A;  5DDL A;  3GKN A;  2K8V A;  4A5P A;  3HJP A;  3FMW A;  2E7P A;  2FY6 A;  2WZ9 A;  1ZZY A;  6GSX A;  4ZBB A;  3ZFL A;  3PGT A;  2N5B A;  2ON5 A;  4EIQ A;  5ELA A;  3LYK A;  2DC5 A;  5ECR B;  5ECL B;  3EWL A;  3FR9 A;  3IK7 A;  3TKS C;  5E4W A;  5IMD A;  4IW9 A;  1AC1 A;  1SD8 A;  2BTO T;  2HXK A;  2IME A;  3EVI A;  3APQ A;  1FB0 A;  4OO5 A;  1JLW A;  5KN3 A;  3HYP A;  5G1K A;  2QA1 A;  3WD6 A;  3UOM A;  4MF5 A;  2FWH A;  3EU4 A;  1YKA A;  1A23 A;  5INY A;  1A8Y A;  3I69 A;  1BAY A;  3C1S A;  5GAN D;  1DE2 A;  3H93 A;  2LEG A;  1A0R P;  4XIH A;  1YJ6 A;  1O6J A;  5A4U A;  5HR0 A;  2DKH A;  1H4O A;  2GSR A;  3F9U A;  2O8V B;  2A4H A;  3EYT A;  1K0B A;  4TOP A;  1QMV A;  4AGS A;  5COH A;  3TJF A;  2H6X A;  2R2J A;  2CVB A;  3JCM L;  4WXT A;  1SK1 A;  5ECM B;  4YAV A;  1WOU A;  5KOW A;  2EIR A;  2PVO C;  3BOA A;  1DBY A;  2OJL A;  3C8E A;  3VUR A;  5IMF A;  4IJI A;  1A0F A;  3ZIV A;  2UZ8 A;  3QDN A;  5IO2 A;  2B5X A;  4JBB A;  2H1D A;  3UVH A;  5E59 A;  4IHU A;  4HU7 A;  3H8Q A;  1SD9 A;  4KSM A;  2IFQ A;  5H5R A;  1HQO A;  5CP1 A;  1ZMA A;  3IC4 A;  1R5P A;  4OWY A;  1OC3 A;  1K0O A;  3CXG A;  1K3L A;  5G5F A;  3ZML A;  4OCE A;  3U6V A;  1EV9 A;  4JRR A;  5G2Z A;  2OBK A;  2M72 A;  4BL7 A;  5B6N A;  1O73 A;  3TJB A;  2YWO A;  2R0P A;  3SBC A;  3GH6 A;  1VF4 A;  3GUR A;  4ECI A;  2IMF A;  1J08 A;  1U88 A;  3KMN A;  2VOC A;  1PQN A;  1U3A A;  1YQ1 A;  2B7K A;  1X5C A;  2VUP A;  3DVX A;  1C72 A;  4CDO A;  4KW6 A;  16GS A;  2HZE A;  1FO5 A;  1OKD A;  5HR3 A;  4EL1 A;  5J4U A;  2ON7 A;  2VCT A;  2OE0 A;  4TR1 B;  3TJK A;  3RHB A;  3GFK A;  4KE3 A;  3U5R E;  3ZRE A;  4NHW A;  4TKY A;  5DJM A;  4IVF A;  1AUC A;  4ACS A;  4V2N A;  5F0G A;  1SYX A;  5C04 A;  4ECB A;  3QMX A;  2C0E A;  3DWV A;  2VCQ A;  4FYB A;  4POK A;  3TRX A;  4KAE A;  3GIX A;  4TXO A;  4XHM A;  2H76 A;  4XS6 A;  5BMU A;  4IS0 A;  4IQ1 A;  3ME8 A;  2CT6 A;  1BED A;  2FHE A;  3KMO A;  4N11 A;  4L0U A;  3IC8 A;  3GA4 A;  5DQY A;  2VLU A;  2RM6 A;  1SU9 A;  3HD5 A;  2PPT A;  3N5O A;  22GS A;  1K0C A;  2R4V A;  3LQ7 A;  1JFU A;  2GQL A;  1XOB A;  4RQR A;  3CQF A;  2F8A A;  2WFC A;  3Q19 A;  1AIU A;  2VO4 A;  1TK8 B;  2YV9 A;  3GTU B;  2AJQ B;  1E6B A;  5ECK B;  3GSS A;  3KH7 A;  3GN3 A;  4PGT A;  1ML6 A;  3A2W A;  1FW1 A;  2X4A A;  1ERU A;  4Q5Q A;  3DEX A;  3TUE A;  3KGK A;  5EVO A;  2LRN A;  3GKX A;  4N0V A;  2YN1 A;  2DJ1 A;  4OD7 A;  5IMZ A;  1N2A A;  5L71 A;  2J23 A;  2QGV A;  1PMT A;  1TKD B;  2O87 A;  4GF0 A;  3EIN A;  1YEX A;  2MZC A;  1GSY A;  4LMW A;  3A2X A;  4NV5 A;  2YWI A;  5DAL B;  4MJB A;  5DCG A;  1R5A A;  1TRU A;  4GST A;  2HSM A;  1XVQ A;  4XTS A;  2JSY A;  2CZ3 A;  4I97 A;  4O5Q A;  2A2S A;  3NIV A;  2B7J A;  2K18 A;  1B9X C;  3D22 A;  4F82 A;  3O6T A;  1EP8 A;  1WWJ A;  1ZOF A;  3EPT A;  5JWQ B;  2V6O A;  5IQY A;  1ERW A;  3F6D A;  1SKS B;  4HUA A;  2B5Y A;  1V2A A;  3PH9 A;  1TK5 B;  3IAS 2;  1TU8 A;  1SK0 A;  2IMK A;  2LNT A;  4OFM A;  2P5R A;  4ML6 A;  3PIN A;  3F8U A;  3US3 A;  2AB6 A;  3CTG A;  4HZ2 A;  3L0H A;  1ST9 A;  4XRD A;  1U3I A;  3QD9 A;  4EC0 A;  1PL1 A;  1G7E A;  3IDV A;  2NBS A;  2WDU A;  1THO A;  1FVK A;  1TW9 A;  3TKS A;  1WE0 A;  5IPG A;  4TXV A;  4TR1 A;  2HRK A;  4IP6 A;  2I81 A;  4FQU A;  3SWL A;  2VIM A;  2XPE A;  3GX0 A;  3MWH A;  2EIO A;  4TR3 A;  3I9V 2;  3NOF A;  3TRP A;  4E8E A;  1OKT A;  3VWX A;  2GGT A;  5HR1 A;  1B4Q A;  4OCF A;  4ZXG A;  3IOS A;  3L4N A;  2FLS A;  4PX1 A;  5JWO B;  5D9X A;  4ZIJ A;  1SJ6 A;  3GHA A;  4V1A p;  4K7N A;  1E2Y A;  2VM2 A;  2QSI A;  3UJ1 A;  2HE3 A;  5HFI A;  1YZX A;  1FOH A;  2OE3 A;  5B7C A;  1BJX A;  4GLT A;  1I5G A;  2YCD A;  6GSV A;  4K0N A;  2GZY A;  1URM A;  2CA8 A;  4FO5 A;  3O3T A;  3CYN A;  1U6T A;  4ZB8 A;  5ENU A;  3IHG A;  2YP6 A;  5F07 A;  1GUM A;  2NPB A;  5IPH A;  2PER A;  1ERT A;  5LCZ A;  4KB3 A;  1J9B A;  4MH3 A;  1XWB A;  5KN0 A;  3GTU A;  4YAP A;  1NHY A;  3APS A;  2L59 A;  3G7J A;  2A2R A;  3ERG A;  1KNG A;  17GS A;  3GL5 A;  5ECI B;  3UMA A;  1TRS A;  2WUL A;  4OO4 A;  2I1U A;  1CQH A;  3FKF A;  4KH7 A;  2RII A;  4PTS A;  2HT9 A;  2E2M A;  4Z2R A;  1K0A A;  5ECP B;  3DYR A;  4K7O A;  3KTB A;  2LQO A;  5AIV A;  1PKW A;  5GZZ B;  4I8B A;  2REM A;  2WJU A;  2PMT A;  4K6X A;  4MH2 A;  1F3A A;  3TOT A;  2H0I A;  5FWG A;  4PQI A;  1XBS A;  3DVW A;  3IK9 A;  1JHB A;  1ZYN A;  4NPB A;  4F2I A;  1SYR A;  3DRN A;  1A8L A;  4N0Z A;  3NZN A;  4AJ7 A;  1FVJ A;  4IN0 A;  2ZCT A;  1QK8 A;  4XS4 B;  2FA8 A;  2YOI A;  3VFI A;  3WGD A;  4GRF A;  3TGZ A;  5IO0 A;  4X4J A;  2IL3 A;  1V40 A;  4O32 A;  2C4J A;  3GH9 A;  1O81 A;  1T4Z A;  1K3O A;  2YWN A;  1VF2 A;  2XBQ A;  2HRA A;  4N30 A;  3WYW A;  1FB6 A;  2L4C A;  5CYY A;  3F3Q A;  1WRY A;  2H70 A;  4NMU A;  1GNE A;  1EOG A;  1M2A A;  3LOR A;  1A2J A;  4MJC A;  2P31 A;  1G0T A;  3BBY A;  2FNO A;  1X9M B;  4RI6 A;  4MK3 A;  5D9T A;  9GSS A;  1XWG A;  1ON4 A;  2CQ9 A;  4LMV A;  3KEB A;  1U87 A;  1OE8 A;  2H0G A;  3GRX A;  1OYJ A;  4IP1 A;  2O85 A;  1TRW A;  1TTZ A;  5B8B A;  4BWS A;  4X1U A;  3FRC A;  1PFO A;  2QC7 A;  5ECN B;  3Q74 A;  1ILO A;  2HLS A;  3D4M A;  2X8G A;  4EKZ A;  3VWU A;  3KJY A;  1PKZ A;  3VI7 A;  2VCZ A;  1XPV A;  3UVT A;  4AF2 A;  1PN9 A;  2KP2 A;  4PNF A;  2H73 A;  4LLR A;  4QL7 A;  5DCH A;  4G0K A;  4BPY A;  3F6F A;  1QGV A;  1TI3 A;  4HOJ A;  1OC8 A;  2H74 A;  3HKR A;  4IQA A;  3H79 A;  1PSQ A;  5KEJ A;  4YH2 A;  2CV4 A;  2WCI A;  1GSD A;  5ID2 B;  4WF4 A;  2KOK A;  4EDY A;  1EP7 A;  3M9J A;  1ZCP A;  2WS2 A;  1RQM A;  2F8F A;  4F03 A;  1JZR A;  2C0F A;  1ERV A;  3L9V A;  5KN2 A;  1SKR B;  5G1L A;  2GLR A;  4MPF A;  3G9B A;  4V2M A;  2AYT A;  4MZC A;  3D21 A;  4WBJ A;  1XWK A;  4J2F A;  1XW9 A;  3S9F A;  1YDK A;  2DJ3 A;  1M3J A;  5F05 A;  4K5S A;  4O7H A;  1W4V A;  1FG4 A;  2HYX A;  3VLN A;  1Z6M A;  4HZ4 A;  8GSS A;  1J0F A;  2H71 A;  1GSE A;  1AXD A;  2DMM A;  5HFK A;  1IYH A;  5CRG A;  2GST A;  1EGR A;  1AQV A;  2GT5 A;  1M7T A;  1ZYP A;  1HYU A;  4Q5N A;  3HZ4 A;  4K1F A;  3ZVJ D;  3LSZ A;  2CAI A;  3QR6 A;  2C80 A;  2YZU A;  1BG5 A;  1Z9H A;  3FEU A;  3M1G A;  4GWR A;  2F3M A;  3G7I A;  4KF9 A;  3PR8 A;  4MA9 A;  3RBT A;  2B3S A;  4XS4 A;  1XFL A;  2VCW A;  3Q6O A;  4NAX A;  1M9B A;  4EO3 A;  3CSH A;  2RM5 A;  2LKU A;  4MF7 A;  4HSC X;  4PQH A;  3HZ8 A;  4EE0 A;  3WGE A;  3QCP A;  1AQW A;  1T7P B;  1GL8 A;  3UL3 A;  2XC2 A;  3QFA C;  2V41 A;  3ZRD A;  2MMO A;  2C3N A;  4KX4 A;  3VK9 A;  1V57 A;  4PNG A;  2PWJ A;  4IEL A;  2MMZ A;  4ISD A;  1WJK A;  3PPU A;  3ERF A;  3F4T A;  4LL1 B;  5DAK B;  4CY8 A;  4V1A g;  1K0D A;  3HY2 A;  4TVE A;  3MIX A;  4X43 A;  1QUW A;  1XXU A;  3HVV A;  4NHZ A;  2GSQ A;  4HS1 A;  3I6A A;  2TRC P;  2VL3 A;  5KOX A;  2K9F A;  2L6C A;  1GH2 A;  2VD1 A;  4I2T A;  3HJM A;  2C3T A;  4ZBA A;  5A4V A;  1VGL A;  3IAM 2;  1T1V A;  3KM6 A;  3F3R A;  1TK0 B;  2YWM A;  3ZLP A;  6GSU A;  2GZZ A;  2K8S A;  2L6D A;  5B6M A;  3TKS E;  3MYD A;  1EV4 A;  5ABR A;  2GQK A;  3AY8 A;  5ID2 A;  4AJ6 A;  3L9U A;  3IA1 A;  4J57 E;  4KA0 A;  4OFN A;  4DEJ A;  1EGO A;  1F3B A;  2CVD A;  3IXR A;  3R3E A;  2Z9S A;  1SJZ A;  1T00 A;  2VLT A;  1S3R A;  2B1K A;  2GTU A;  4KDY A;  2L4Q A;  1SJI A;  3FR6 A;  3UAP A;  3K8N A;  1ZL9 A;  4G0I A;  2DJ2 A;  4BWQ A;  5ECO B;  5DJL A;  1X9W B;  4WET A;  3J7Y k;  1VF1 A;  5KN1 A;  4EF0 A;  2ZNM A;  1DE1 A;  3FZ9 A;  4ZB6 A;  3IRA A;  1AW9 A;  1GSF A;  3TOU A;  3VPQ A;  3RPP A;  2X49 A;  4YKF A;  2O7K A;  1F37 A;  2QKE A;  3GKM A;  3TJJ A;  2B1L A;  4DSQ A;  3FZ5 A;  1UC7 A;  7GSS A;  4DVC A;  1XW5 A;  5JCW A;  3FK8 A;  5ECH B;  6GST A;  3J7Y b;  13GS A;  1OC9 B;  2H72 A;  1MTC A;  5D9V A;  1S3A A;  4HEA 2;  1IYI A;  2F9S A;  1MDK A;  5EL8 A;  3DML A;  3KP9 A;  3GYK A;  4L5L A;  2DJK A;  3BJ5 A;  5H5Q A;  4ECC A;  1FOV A;  3P7X A;  2C1Y A;  1TDI A;  4E8H A;  2DKI A;  5B8A A;  3VI5 A;  1F2E A;  2H0H A;  4PXO A;  1Z3E A;  2OKA A;  5EPF A;  2NTO A;  2CAQ A;  2RLI A;  1MD4 A;  3MAK A;  2HI7 A;  4D73 A;  3CRU A;  3ZTL A;  2X64 A;  5HFG A;  4K8M A;  1JZW A;  3DXB A;  3RDW A;  1Z7P A;  3RPN A;  2F51 A;  1ZYQ B;  2VD0 A;  2LJK A;  3O76 A;  2XBI A;  4K9Z A;  3TKQ A;  2RUF A;  1W89 A;  1GTI A;  4WBR D;  3DIE A;  1QFN A;  3QAG A;  20GS A;  2FUG 2;  14GS A;  3MSZ A;  2R37 A;  2I3Y A;  1WP0 A;  3KTL A;  5DAK A;  3D5J A;  2VM1 A;  2VCV A;  3RHC A;  1R7H A;  2WB9 A;  2OAC A;  2C0D A;  4HJ2 A;  4FIW A;  5ECQ B;  3HCZ A;  4BVX B;  3D6I A;  3EC3 A;  1DSB A;  1PA3 A;  3KXO A;  2B5E A;  5AGY A;  2OBI A;  4TW5 A;  5IM9 A;  2DBC A;  3ZZX A;  3LW9 A;  1X5D A;  3ME7 A;  4MDC A;  1K0N A;  1M2B A;  2PN8 A;  2WGR A;  1G6W A;  4EXJ A;  1YY7 A;  4O92 A;  3Q18 A;  2JZT A;  2HSY A;  4CHS A;  1SK2 A;  3E3E A;  3IBH A;  1B4P A;  4I5Q A;  4HQS A;  1LBK A;  1ZYE A;  5BRT A;  2L5O A;  3UIW A;  4ZIL A;  1YKC A;  1JLV A;  5H5S A;  1YF1 A;  4V2L A;  2L5L A;  2DJ0 A;  1SL0 B;  1VRS D;  3KP8 A;  1EWX A;  2WRT A;  4HDE A;  2YNX A;  3MNG A;  1MDI A;  2V32 A;  1MDJ A;  1XZO A;  2H1G A;  4WR4 A;  3CSJ A;  3HA9 A;  3GNJ A;  1SEN A;  3F0I A;  3BCK A;  2LRT A;  2KHP A;  2FA4 A;  2YV7 A;  4K2D A;  3GUS A;  3TRQ A;  2HFD A;  1CQG A;  1FHE A;  1M0U A;  5JCU A;  4RUV A;  2FWE A;  4MZB A;  3C73 A;  1ABA A;  4G10 A;  2H6Z A;  4YQM A;  4OMV A;  1Q4J A;  3VWW A;  3CBU A;  4IKH A;  2PVQ A;  5IMA A;  2TRX A;  3HVN A;  3C71 A;  1HD2 A;  5CRE A;  3ZL5 A;  1TOF A;  2JSZ A;  1GWC A;  2CX3 A;  4GQF A;  6GSW A;  4MMM A;  4NWY A;  1M99 A;  1G7O A;  4Z2T A;  3FZA A;  2OA7 A;  4FYC A;  1OC9 A;  1ACV A;  1PN0 A;  5CO3 A;  5HR2 A;  5CRH A;  4XS1 A;  1VF3 A;  2GS3 A;  5J3R A;  5G5E A;  3LFL A;  2MYG A;  5D9W A;  2P5Q A;  4MJA A;  2NDO A;  3UBL A;  2LJA A;  2FCH A;  1ZGN A;  3KH9 A;  2DLX A;  4F0B A;  4ZBD A;  4MZW A;  2JZS A;  4ZL7 A;  4L8E A;  4GCI A;  5IOX A;  1WPI A;  5AIS A;  5IMV A;  2GSS A;  1WMJ A;  3WGX A;  2IWT A;  1R4W A;  4NV2 A;  1XCC A;  3GST A;  4EIP A;  1Q98 A;  3ZFB A;  3C1R A;  10GS A;  2LQQ A;  5DQS A;  1AQX A;  1GUL A;  2LV3 A;  2JAD A;  4ZL9 A;  5AIX A;  2IJY A;  4G2E A;  4ZB9 A;  3LEF A;  1X5E A;  4QL9 A;  2C0G A;  3HVS A;  3H1N A;  2VL9 A;  2CX4 A;  1V9W A;  2CZ2 A;  2MMN A;  4O5R A;  2IMD A;  1QQ2 A;  2M80 A;  4GSN A;  1GTB A;  1GNW A;  2GT6 A;  4BVX A;  1BX9 A;  1TU7 A;  1XOA A;  4L5O A;  4HJM A;  4F0C A;  4MJE A;  2JZR A;  2ZUP A;  3IE3 A;  3ERW A;  3M0F A;  3FHK A;  3D4T A;  5J5N A;  4JED A;  2I4A A;  4K5R A;  2HSH A;  4CW9 A;  3W8S A;  4XCS A;  3FZ4 A;  4Q5R A;  4EDZ A;  1KTE A;  3QOU A;  2E0Q A;  3ED3 A;  2LJR A;  2G2Q A;  3FR3 A;  12GS A;  2IPA A;  3DD3 A;  4CY6 A;  1DUG A;  4ULX A;  4JE1 A;  3VWV A;  4J56 E;  3GL3 A;  1BYE A;  5LNK e;  3HJO A;  1MD3 A;  4G0L A;  1XWA A;  1HNB A;  18GS A;  1YEP A;  4RQX A;  5FHI A;  3I43 A;  1USB A;  4TRX A;  5FT3 A;  2IIY A;  1RW1 A;  2PBJ A;  3F4S A;  1GTA A;  1GTU A;  2PGT A;  2VLV A;  2VL2 A;  3LGC A;  1UN2 A;  1EEM A;  3LXZ A;  3IR4 A;  1WIK A;  1Z7R A;  1XVW A;  3EE2 A;  5J9C A;  2ES7 A;  2R0C A;  4L0W A;  2X8H A;  1O8X A;  4KDU A;  2C3Q A;  4PQ1 A;  2LST A;  4PUF C;  4D73 B;  1Z5Y E;  3LYP A;  3HDC A;  2O89 A;  4K2X A;  1NSW A;  4MCU A;  4TN8 A;  1M2D A;  2XPD A;  3LWA A;  1B9Y C;  4BA7 A;  3A3T A;  2B6M A;  3TB2 A;  3FW2 A;  3TCO A;  1PRX A;  1GSQ A;  2CVK A;  4NXI A;  1A24 A;  3QPM A;  2LRC A;  2X8C A;  1SKW B;  1THX A;  4KDX A;  4BVY B;  1Z6N A;  2YZH A;  4WF5 A;  3VPT A;  2N5A A;  1OE7 A;  3UEM A;  4LA1 A;  1HNA A;  1GRX A;  5JWR B;  5D8I A;  5DVB A;  4JR6 A;  2FGX A;  3HVX A;  4Z2U A;  1FAA A;  1GSS A;  4FYU A;  3ZIJ A;  1F9M A;  3LG6 A;  4I6X A;  5CNW A;  2GDR A;  3TKP A;  4WR5 A;  2E2G A;  3DKS A;  4DSR A;  3C7M A;  1EZK A;  3P2A A;  5F8B A;  1YF0 A;  1SL2 B;  3IPZ A;  2OE1 A;  2H1B A;  4PUR A;  1X0R A;  3UAR A;  1S3C A;  4GTU A;  2J9H A;  5CAX A;  1S3D A;  2ALB A;  4HU9 A;  11GS A;  3F63 A;  4YQU A;  4EVM A;  2YPM A;  2IMI A;  1EEJ A;  1I9D A;  1XW6 A;  3A5W A;  2H30 A;  3P90 A;  4PUA A;  2EC4 A;  5A5K A;  2PUK C;  3A5I A;  4OFT A;  3WT2 A;  1NM3 A;  1PGT A;  4POM A;  1GLP A;  5GSS A;  4YKG A;  1O85 A;  4MPG A;  1N8J A;  2DSA A;  2AV4 A;  4KCE A;  5G30 A;  3EUR A;  2TIR A;  2DIY A;  4WEY A;  1SL1 B;  2V6K A;  5CRW A;  3W6G A;  3HXS A;  1O8W A;  2MBT A;  3APO A;  3H4K A;  4FH8 A;  3TDG A;  3OR5 A;  4JU5 A;  2H66 A;  2KP1 A;  2DIZ A;  3ZVJ A;  2DML A;  3HHV A;  5LD0 A;  2V2G A;  5IMC A;  6GSY A;  1V98 A; 
#chains in the Genus database with same CATH homology
 2R3X A;  2P0G A;  1GLQ A;  4IGJ A;  4G19 A;  1XWC A;  4DSS B;  3CTF A;  3D0Z A;  2HRN A;  2YJH A;  6GSS A;  5AN1 A;  2R5G A;  3CSI A;  5D73 A;  1KBN A;  3E0U A;  2N5F A;  2D2Z A;  2H1A A;  3GMF A;  3ZIT A;  5GST A;  2L57 A;  3M8N A;  2LS5 A;  1T3B A;  2VAF A;  2AHE A;  3RAZ A;  2EIQ A;  4ML1 A;  2JU5 A;  1KEB A;  4KGI A;  2RUE A;  4P3Y B;  4N10 A;  4KUN A;  2VL2 C;  2H6Y A;  3BCI A;  1LU4 A;  3IHQ A;  2H8L A;  3BD2 A;  4MLY A;  1B8X A;  1NW2 A;  2QA2 A;  5DBQ A;  3WT1 A;  1K3Y A;  5EY6 A;  2FWG A;  4G9H A;  3ISO A;  2K6V A;  3GV1 A;  4I2U A;  2BMX A;  2FD3 A;  3CMI A;  3P8W A;  2OAD A;  1EOH A;  1M9A A;  1T4Y A;  3QAV A;  1PX6 A;  4MAB A;  4WKW A;  3FYG A;  2H19 A;  2VCX A;  4ICY A;  4F9Z A;  5G31 A;  3GX8 A;  1UVZ A;  4BVY A;  5ECS A;  2GVP A;  1TRV A;  1HNC A;  3ZMK A;  1F6M C;  1UA5 A;  4QQ7 A;  5GAP D;  3TKR A;  1TXX A;  3DGQ A;  1NHO A;  1GP1 A;  3M9K A;  2XHF A;  3EMX A;  2MBS A;  2AUV A;  3M3M A;  4MNN A;  3UBK A;  2MMA A;  2IN3 A;  2NVL A;  4HI7 A;  2H75 A;  3LJR A;  2V1M A;  1T8E B;  3N9J A;  3EU3 A;  3LXT A;  1H75 A;  3W8J A;  3MDK A;  4RI7 A;  4ECJ A;  3V1W A;  5J41 A;  4IJ3 A;  4H86 A;  1R26 A;  3CRT A;  4KCA A;  4K0G A;  1AAZ A;  4O5U A;  1K0M A;  1OAZ A;  2H01 A;  1JZO A;  4ZL8 A;  2LNS A;  3FY7 A;  3KIJ A;  1RK4 A;  2R6K A;  4JR4 A;  4MF6 A;  4X0X A;  2GQM A;  2A4V A;  2KUC A;  4ILF A;  1XIY A;  5A4W A;  2C8U A;  1BQ7 A;  1QXH A;  4JZQ A;  1GUK A;  3R2Q A;  4TR4 A;  2LTK A;  2GZP A;  2I9H A;  3F4R A;  1GSU A;  5CRD A;  2DJJ A;  1V58 A;  2HRF A;  2IFQ B;  4GSS A;  5IIZ A;  4USS A;  4MP4 A;  1G6Y A;  1MEK A;  5DAL A;  3G7Y A;  3L9S A;  1A2M A;  1PX7 A;  5J9B A;  1PL2 A;  2M46 A;  2PU9 C;  3E9J B;  4LL4 B;  4Q5F A;  1LJR A;  4XRA A;  3TJG A;  4BL7 B;  3ZYW A;  2A2P A;  4KND A;  4DSS A;  3L78 A;  1OVN A;  3KD0 A;  3KZQ A;  2YAN A;  5D96 A;  4IBP A;  4AJ8 A;  3GKK A;  1PD2 1;  2HNL A;  5F06 A;  4K7I A;  5HQP A;  5IOW A;  4POL A;  4EUY A;  1Y25 A;  1Y6E A;  2FWF A;  2JL4 A;  5ELG A;  4GQC A;  2HZE B;  4TR0 A;  2KLX A;  1TJD A;  1TP9 A;  2BJX A;  3QAW A;  4KSO A;  5JCG A;  2HZF A;  5C00 A;  4ID0 A;  2AAW A;  1JZD A;  2JAC A;  4HQZ A;  2YJ7 A;  19GS A;  1X9S B;  3KCM A;  1B48 A;  2X99 A;  1TI1 A;  2R0G A;  1A2L A;  3A2V A;  4GXZ A;  4POB A;  2G0F A;  2LUS A;  3QFB C;  1GUH A;  1O7U A;  4YQV A;  5D93 A;  3IV4 A;  4TXO B;  4Z7X A;  3EMP A;  5DDL A;  3GKN A;  2K8V A;  4A5P A;  3HJP A;  3FMW A;  2E7P A;  2FY6 A;  2WZ9 A;  1ZZY A;  6GSX A;  4ZBB A;  3ZFL A;  3PGT A;  2N5B A;  2ON5 A;  4EIQ A;  5ELA A;  3LYK A;  2DC5 A;  5ECR B;  5ECL B;  3EWL A;  3FR9 A;  3IK7 A;  3TKS C;  5E4W A;  5IMD A;  4IW9 A;  1AC1 A;  1SD8 A;  2BTO T;  2HXK A;  2IME A;  3EVI A;  3APQ A;  1FB0 A;  4OO5 A;  1JLW A;  5KN3 A;  3HYP A;  5G1K A;  2QA1 A;  3WD6 A;  3UOM A;  4MF5 A;  2FWH A;  3EU4 A;  1YKA A;  1A23 A;  5INY A;  1A8Y A;  3I69 A;  1BAY A;  3C1S A;  5GAN D;  1DE2 A;  3H93 A;  2LEG A;  1A0R P;  4XIH A;  1YJ6 A;  1O6J A;  5A4U A;  5HR0 A;  2DKH A;  1H4O A;  2GSR A;  3F9U A;  2O8V B;  2A4H A;  3EYT A;  1K0B A;  4TOP A;  1QMV A;  4AGS A;  5COH A;  3TJF A;  2H6X A;  2R2J A;  2CVB A;  3JCM L;  4WXT A;  1SK1 A;  5ECM B;  4YAV A;  1WOU A;  5KOW A;  2EIR A;  2PVO C;  3BOA A;  1DBY A;  2OJL A;  3C8E A;  3VUR A;  5IMF A;  4IJI A;  1A0F A;  3ZIV A;  2UZ8 A;  3QDN A;  5IO2 A;  2B5X A;  4JBB A;  2H1D A;  3UVH A;  5E59 A;  4IHU A;  4HU7 A;  3H8Q A;  1SD9 A;  4KSM A;  2IFQ A;  5H5R A;  1HQO A;  5CP1 A;  1ZMA A;  3IC4 A;  1R5P A;  4OWY A;  1OC3 A;  1K0O A;  3CXG A;  1K3L A;  5G5F A;  3ZML A;  4OCE A;  3U6V A;  1EV9 A;  4JRR A;  5G2Z A;  2OBK A;  2M72 A;  4BL7 A;  5B6N A;  1O73 A;  3TJB A;  2YWO A;  2R0P A;  3SBC A;  3GH6 A;  1VF4 A;  3GUR A;  4ECI A;  2IMF A;  1J08 A;  1U88 A;  3KMN A;  2VOC A;  1PQN A;  1U3A A;  1YQ1 A;  2B7K A;  1X5C A;  2VUP A;  3DVX A;  1C72 A;  4CDO A;  4KW6 A;  16GS A;  2HZE A;  1FO5 A;  1OKD A;  5HR3 A;  4EL1 A;  5J4U A;  2ON7 A;  2VCT A;  2OE0 A;  4TR1 B;  3TJK A;  3RHB A;  3GFK A;  4KE3 A;  3U5R E;  3ZRE A;  4NHW A;  4TKY A;  5DJM A;  4IVF A;  1AUC A;  4ACS A;  4V2N A;  5F0G A;  1SYX A;  5C04 A;  4ECB A;  3QMX A;  2C0E A;  3DWV A;  2VCQ A;  4FYB A;  4POK A;  3TRX A;  4KAE A;  3GIX A;  4TXO A;  4XHM A;  2H76 A;  4XS6 A;  5BMU A;  4IS0 A;  4IQ1 A;  3ME8 A;  2CT6 A;  1BED A;  2FHE A;  3KMO A;  4N11 A;  4L0U A;  3IC8 A;  3GA4 A;  5DQY A;  2VLU A;  2RM6 A;  1SU9 A;  3HD5 A;  2PPT A;  3N5O A;  22GS A;  1K0C A;  2R4V A;  3LQ7 A;  1JFU A;  2GQL A;  1XOB A;  4RQR A;  2F8A A;  2WFC A;  3Q19 A;  1AIU A;  2VO4 A;  1TK8 B;  2YV9 A;  3GTU B;  2AJQ B;  1E6B A;  5ECK B;  3GSS A;  3KH7 A;  3GN3 A;  4PGT A;  1ML6 A;  3A2W A;  1FW1 A;  2X4A A;  1ERU A;  4Q5Q A;  3DEX A;  3TUE A;  3KGK A;  5EVO A;  2LRN A;  3GKX A;  4N0V A;  2YN1 A;  2DJ1 A;  4OD7 A;  5IMZ A;  1N2A A;  5L71 A;  2J23 A;  2QGV A;  1PMT A;  1TKD B;  2O87 A;  4GF0 A;  3EIN A;  1YEX A;  2MZC A;  1GSY A;  4LMW A;  3A2X A;  4NV5 A;  2YWI A;  5DAL B;  4MJB A;  5DCG A;  1R5A A;  1TRU A;  4GST A;  2HSM A;  1XVQ A;  4XTS A;  2JSY A;  2CZ3 A;  4I97 A;  4O5Q A;  2A2S A;  3NIV A;  2B7J A;  2K18 A;  1B9X C;  3D22 A;  4F82 A;  3O6T A;  1EP8 A;  1WWJ A;  1ZOF A;  3EPT A;  5JWQ B;  2V6O A;  5IQY A;  1ERW A;  3F6D A;  1SKS B;  4HUA A;  2B5Y A;  1V2A A;  3PH9 A;  1TK5 B;  3IAS 2;  1TU8 A;  1SK0 A;  2IMK A;  2LNT A;  4OFM A;  2P5R A;  4ML6 A;  3PIN A;  3F8U A;  3US3 A;  2AB6 A;  3CTG A;  4HZ2 A;  3L0H A;  1ST9 A;  4XRD A;  1U3I A;  3QD9 A;  4EC0 A;  1PL1 A;  1G7E A;  3IDV A;  2NBS A;  2WDU A;  1THO A;  1FVK A;  1TW9 A;  3TKS A;  1WE0 A;  5IPG A;  4TXV A;  4TR1 A;  2HRK A;  4IP6 A;  2I81 A;  4FQU A;  3SWL A;  2VIM A;  2XPE A;  3GX0 A;  3MWH A;  2EIO A;  4TR3 A;  3I9V 2;  3NOF A;  3TRP A;  4E8E A;  1OKT A;  3VWX A;  2GGT A;  5HR1 A;  1B4Q A;  4OCF A;  4ZXG A;  3IOS A;  3L4N A;  2FLS A;  4PX1 A;  5JWO B;  5D9X A;  4ZIJ A;  1SJ6 A;  3GHA A;  4V1A p;  4K7N A;  1E2Y A;  2VM2 A;  2QSI A;  3UJ1 A;  2HE3 A;  5HFI A;  1YZX A;  1FOH A;  2OE3 A;  5B7C A;  1BJX A;  4GLT A;  1I5G A;  2YCD A;  6GSV A;  4K0N A;  2GZY A;  1URM A;  2CA8 A;  4FO5 A;  3O3T A;  3CYN A;  1U6T A;  4ZB8 A;  5ENU A;  3IHG A;  2YP6 A;  5F07 A;  1GUM A;  2NPB A;  5IPH A;  2PER A;  1ERT A;  5LCZ A;  4KB3 A;  1J9B A;  4MH3 A;  1XWB A;  5KN0 A;  3GTU A;  4YAP A;  1NHY A;  3APS A;  2L59 A;  3G7J A;  2A2R A;  3ERG A;  1KNG A;  17GS A;  3GL5 A;  5ECI B;  3UMA A;  1TRS A;  2WUL A;  4OO4 A;  2I1U A;  1CQH A;  3FKF A;  4KH7 A;  2RII A;  4PTS A;  2HT9 A;  2E2M A;  4Z2R A;  1K0A A;  5ECP B;  3DYR A;  4K7O A;  3KTB A;  2LQO A;  5AIV A;  1PKW A;  5GZZ B;  4I8B A;  2REM A;  2WJU A;  2PMT A;  4K6X A;  4MH2 A;  1F3A A;  3TOT A;  2H0I A;  5FWG A;  4PQI A;  1XBS A;  3DVW A;  3IK9 A;  1JHB A;  1ZYN A;  4NPB A;  4F2I A;  1SYR A;  3DRN A;  1A8L A;  4N0Z A;  3NZN A;  4AJ7 A;  1FVJ A;  4IN0 A;  2ZCT A;  1QK8 A;  4XS4 B;  2FA8 A;  2YOI A;  3VFI A;  3WGD A;  4GRF A;  3TGZ A;  5IO0 A;  4X4J A;  2IL3 A;  1V40 A;  4O32 A;  2C4J A;  3GH9 A;  1O81 A;  1T4Z A;  1K3O A;  2YWN A;  1VF2 A;  2XBQ A;  2HRA A;  4N30 A;  3WYW A;  1FB6 A;  2L4C A;  5CYY A;  3F3Q A;  1WRY A;  2H70 A;  4NMU A;  1GNE A;  1EOG A;  1M2A A;  3LOR A;  1A2J A;  4MJC A;  2P31 A;  1G0T A;  3BBY A;  2FNO A;  1X9M B;  4RI6 A;  4MK3 A;  5D9T A;  9GSS A;  1XWG A;  1ON4 A;  2CQ9 A;  4LMV A;  3KEB A;  1U87 A;  1OE8 A;  2H0G A;  3GRX A;  1OYJ A;  4IP1 A;  2O85 A;  1TRW A;  1TTZ A;  5B8B A;  4BWS A;  4X1U A;  3FRC A;  2QC7 A;  5ECN B;  3Q74 A;  1ILO A;  2HLS A;  3D4M A;  2X8G A;  4EKZ A;  3VWU A;  3KJY A;  1PKZ A;  3VI7 A;  2VCZ A;  1XPV A;  3UVT A;  4AF2 A;  1PN9 A;  2KP2 A;  4PNF A;  2H73 A;  4LLR A;  4QL7 A;  5DCH A;  4G0K A;  4BPY A;  3F6F A;  1QGV A;  1TI3 A;  4HOJ A;  1OC8 A;  2H74 A;  3HKR A;  4IQA A;  3H79 A;  1PSQ A;  5KEJ A;  4YH2 A;  2CV4 A;  2WCI A;  1GSD A;  5ID2 B;  4WF4 A;  2KOK A;  4EDY A;  1EP7 A;  3M9J A;  1ZCP A;  2WS2 A;  1RQM A;  2F8F A;  4F03 A;  1JZR A;  2C0F A;  1ERV A;  3L9V A;  5KN2 A;  1SKR B;  5G1L A;  2GLR A;  4MPF A;  3G9B A;  4V2M A;  2AYT A;  4MZC A;  3D21 A;  4WBJ A;  1XWK A;  4J2F A;  1XW9 A;  3S9F A;  1YDK A;  2DJ3 A;  5F05 A;  4K5S A;  4O7H A;  1W4V A;  1FG4 A;  2HYX A;  3VLN A;  1Z6M A;  4HZ4 A;  8GSS A;  1J0F A;  2H71 A;  1GSE A;  1AXD A;  2DMM A;  5HFK A;  1IYH A;  5CRG A;  2GST A;  1EGR A;  1AQV A;  2GT5 A;  1M7T A;  1ZYP A;  1HYU A;  4Q5N A;  3HZ4 A;  4K1F A;  3ZVJ D;  3LSZ A;  2CAI A;  3QR6 A;  2C80 A;  2YZU A;  1BG5 A;  1Z9H A;  3FEU A;  3M1G A;  4GWR A;  2F3M A;  3G7I A;  4KF9 A;  3PR8 A;  4MA9 A;  3RBT A;  2B3S A;  4XS4 A;  1XFL A;  2VCW A;  3Q6O A;  4NAX A;  1M9B A;  4EO3 A;  3CSH A;  2RM5 A;  2LKU A;  4MF7 A;  4PQH A;  3HZ8 A;  4EE0 A;  3WGE A;  3QCP A;  1AQW A;  1T7P B;  1GL8 A;  3UL3 A;  2XC2 A;  3QFA C;  2V41 A;  3ZRD A;  2MMO A;  2C3N A;  4KX4 A;  3VK9 A;  1V57 A;  4PNG A;  2PWJ A;  4IEL A;  2MMZ A;  4ISD A;  1WJK A;  3PPU A;  3ERF A;  3F4T A;  4LL1 B;  5DAK B;  4CY8 A;  4V1A g;  1K0D A;  3HY2 A;  4TVE A;  3MIX A;  4X43 A;  1QUW A;  1XXU A;  3HVV A;  4NHZ A;  2GSQ A;  4HS1 A;  3I6A A;  2TRC P;  2VL3 A;  5KOX A;  2K9F A;  2L6C A;  1GH2 A;  2VD1 A;  4I2T A;  3HJM A;  2C3T A;  4ZBA A;  5A4V A;  1VGL A;  3IAM 2;  1T1V A;  3KM6 A;  3F3R A;  1TK0 B;  2YWM A;  3ZLP A;  6GSU A;  2GZZ A;  2K8S A;  2L6D A;  5B6M A;  3TKS E;  3MYD A;  1EV4 A;  5ABR A;  2GQK A;  3AY8 A;  5ID2 A;  4AJ6 A;  3L9U A;  3IA1 A;  4J57 E;  4KA0 A;  4OFN A;  4DEJ A;  1EGO A;  1F3B A;  2CVD A;  3IXR A;  3R3E A;  2Z9S A;  1SJZ A;  1T00 A;  2VLT A;  2B1K A;  2GTU A;  4KDY A;  2L4Q A;  1SJI A;  3FR6 A;  3UAP A;  3K8N A;  1ZL9 A;  4G0I A;  2DJ2 A;  4BWQ A;  5ECO B;  5DJL A;  1X9W B;  4WET A;  3J7Y k;  1VF1 A;  5KN1 A;  4EF0 A;  2ZNM A;  1DE1 A;  3FZ9 A;  4ZB6 A;  3IRA A;  1AW9 A;  1GSF A;  3TOU A;  3VPQ A;  3RPP A;  2X49 A;  4YKF A;  2O7K A;  1F37 A;  2QKE A;  3GKM A;  3TJJ A;  2B1L A;  4DSQ A;  3FZ5 A;  1UC7 A;  7GSS A;  4DVC A;  1XW5 A;  5JCW A;  3FK8 A;  5ECH B;  6GST A;  3J7Y b;  13GS A;  1OC9 B;  2H72 A;  1MTC A;  5D9V A;  1S3A A;  4HEA 2;  1IYI A;  2F9S A;  1MDK A;  5EL8 A;  3DML A;  3KP9 A;  3GYK A;  4L5L A;  2DJK A;  3BJ5 A;  5H5Q A;  4ECC A;  1FOV A;  3P7X A;  2C1Y A;  1TDI A;  4E8H A;  2DKI A;  5B8A A;  3VI5 A;  1F2E A;  2H0H A;  4PXO A;  1Z3E A;  2OKA A;  5EPF A;  2NTO A;  2CAQ A;  2RLI A;  1MD4 A;  3MAK A;  2HI7 A;  4D73 A;  3CRU A;  3ZTL A;  2X64 A;  5HFG A;  4K8M A;  1JZW A;  3DXB A;  3RDW A;  1Z7P A;  3RPN A;  2F51 A;  1ZYQ B;  2VD0 A;  2LJK A;  3O76 A;  2XBI A;  4K9Z A;  3TKQ A;  2RUF A;  1W89 A;  1GTI A;  4WBR D;  3DIE A;  1QFN A;  3QAG A;  20GS A;  2FUG 2;  14GS A;  3MSZ A;  2R37 A;  2I3Y A;  1WP0 A;  3KTL A;  5DAK A;  3D5J A;  2VM1 A;  2VCV A;  3RHC A;  1R7H A;  2WB9 A;  2OAC A;  2C0D A;  4HJ2 A;  4FIW A;  5ECQ B;  3HCZ A;  4BVX B;  3D6I A;  3EC3 A;  1DSB A;  1PA3 A;  3KXO A;  2B5E A;  5AGY A;  2OBI A;  4TW5 A;  5IM9 A;  2DBC A;  3ZZX A;  3LW9 A;  1X5D A;  3ME7 A;  4MDC A;  1K0N A;  1M2B A;  2PN8 A;  2WGR A;  1G6W A;  4EXJ A;  1YY7 A;  4O92 A;  3Q18 A;  2JZT A;  2HSY A;  4CHS A;  1SK2 A;  3E3E A;  3IBH A;  1B4P A;  4I5Q A;  4HQS A;  1LBK A;  1ZYE A;  5BRT A;  2L5O A;  3UIW A;  4ZIL A;  1YKC A;  1JLV A;  5H5S A;  1YF1 A;  4V2L A;  2L5L A;  2DJ0 A;  1SL0 B;  1VRS D;  3KP8 A;  1EWX A;  2WRT A;  4HDE A;  2YNX A;  3MNG A;  1MDI A;  2V32 A;  1MDJ A;  1XZO A;  2H1G A;  4WR4 A;  3CSJ A;  3HA9 A;  3GNJ A;  1SEN A;  3F0I A;  3BCK A;  2LRT A;  2KHP A;  2FA4 A;  2YV7 A;  4K2D A;  3GUS A;  3TRQ A;  2HFD A;  1CQG A;  1FHE A;  1M0U A;  5JCU A;  4RUV A;  2FWE A;  4MZB A;  3C73 A;  1ABA A;  4G10 A;  2H6Z A;  4YQM A;  4OMV A;  1Q4J A;  3VWW A;  3CBU A;  4IKH A;  2PVQ A;  5IMA A;  2TRX A;  3C71 A;  1HD2 A;  5CRE A;  3ZL5 A;  1TOF A;  2JSZ A;  1GWC A;  2CX3 A;  4GQF A;  6GSW A;  4MMM A;  4NWY A;  1M99 A;  1G7O A;  4Z2T A;  3FZA A;  2OA7 A;  4FYC A;  1OC9 A;  1ACV A;  1PN0 A;  5CO3 A;  5HR2 A;  5CRH A;  4XS1 A;  1VF3 A;  2GS3 A;  5J3R A;  5G5E A;  3LFL A;  2MYG A;  5D9W A;  2P5Q A;  4MJA A;  2NDO A;  3UBL A;  2LJA A;  2FCH A;  1ZGN A;  3KH9 A;  2DLX A;  4F0B A;  4ZBD A;  4MZW A;  2JZS A;  4ZL7 A;  4L8E A;  4GCI A;  5IOX A;  1WPI A;  5AIS A;  5IMV A;  2GSS A;  1WMJ A;  3WGX A;  2IWT A;  1R4W A;  4NV2 A;  1XCC A;  3GST A;  4EIP A;  1Q98 A;  3ZFB A;  3C1R A;  10GS A;  2LQQ A;  5DQS A;  1AQX A;  1GUL A;  2LV3 A;  2JAD A;  4ZL9 A;  5AIX A;  2IJY A;  4G2E A;  4ZB9 A;  3LEF A;  1X5E A;  4QL9 A;  2C0G A;  3HVS A;  3H1N A;  2VL9 A;  2CX4 A;  1V9W A;  2CZ2 A;  2MMN A;  4O5R A;  2IMD A;  1QQ2 A;  2M80 A;  4GSN A;  1GTB A;  1GNW A;  2GT6 A;  4BVX A;  1BX9 A;  1TU7 A;  1XOA A;  4L5O A;  4HJM A;  4F0C A;  4MJE A;  2JZR A;  2ZUP A;  3IE3 A;  3ERW A;  3M0F A;  3FHK A;  3D4T A;  5J5N A;  4JED A;  2I4A A;  4K5R A;  2HSH A;  4CW9 A;  3W8S A;  4XCS A;  3FZ4 A;  4Q5R A;  4EDZ A;  1KTE A;  3QOU A;  2E0Q A;  3ED3 A;  2LJR A;  2G2Q A;  3FR3 A;  12GS A;  2IPA A;  3DD3 A;  4CY6 A;  1DUG A;  4ULX A;  4JE1 A;  3VWV A;  4J56 E;  3GL3 A;  1BYE A;  5LNK e;  3HJO A;  1MD3 A;  4G0L A;  1XWA A;  1HNB A;  18GS A;  1YEP A;  4RQX A;  5FHI A;  3I43 A;  1USB A;  4TRX A;  5FT3 A;  2IIY A;  1RW1 A;  2PBJ A;  3F4S A;  1GTA A;  1GTU A;  2PGT A;  2VLV A;  2VL2 A;  3LGC A;  1UN2 A;  1EEM A;  3LXZ A;  3IR4 A;  1WIK A;  1Z7R A;  1XVW A;  3EE2 A;  5J9C A;  2ES7 A;  2R0C A;  4L0W A;  2X8H A;  1O8X A;  4KDU A;  2C3Q A;  4PQ1 A;  2LST A;  4PUF C;  4D73 B;  1Z5Y E;  3LYP A;  3HDC A;  2O89 A;  4K2X A;  1NSW A;  4MCU A;  4TN8 A;  1M2D A;  2XPD A;  3LWA A;  1B9Y C;  4BA7 A;  3A3T A;  2B6M A;  3TB2 A;  3FW2 A;  3TCO A;  1PRX A;  1GSQ A;  2CVK A;  4NXI A;  1A24 A;  3QPM A;  2LRC A;  2X8C A;  1SKW B;  1THX A;  4KDX A;  4BVY B;  1Z6N A;  2YZH A;  4WF5 A;  3VPT A;  2N5A A;  1OE7 A;  3UEM A;  4LA1 A;  1HNA A;  1GRX A;  5JWR B;  5D8I A;  5DVB A;  4JR6 A;  2FGX A;  3HVX A;  4Z2U A;  1FAA A;  1GSS A;  4FYU A;  3ZIJ A;  1F9M A;  3LG6 A;  4I6X A;  5CNW A;  2GDR A;  3TKP A;  4WR5 A;  2E2G A;  3DKS A;  4DSR A;  3C7M A;  1EZK A;  3P2A A;  5F8B A;  1YF0 A;  1SL2 B;  3IPZ A;  2OE1 A;  2H1B A;  4PUR A;  1X0R A;  3UAR A;  1S3C A;  4GTU A;  2J9H A;  5CAX A;  1S3D A;  2ALB A;  4HU9 A;  11GS A;  3F63 A;  4YQU A;  4EVM A;  2YPM A;  2IMI A;  1EEJ A;  1I9D A;  1XW6 A;  3A5W A;  2H30 A;  3P90 A;  4PUA A;  2EC4 A;  5A5K A;  2PUK C;  3A5I A;  4OFT A;  3WT2 A;  1NM3 A;  1PGT A;  4POM A;  1GLP A;  5GSS A;  4YKG A;  1O85 A;  4MPG A;  1N8J A;  2DSA A;  2AV4 A;  4KCE A;  5G30 A;  3EUR A;  2TIR A;  2DIY A;  4WEY A;  1SL1 B;  2V6K A;  5CRW A;  3W6G A;  3HXS A;  1O8W A;  2MBT A;  3APO A;  3H4K A;  4FH8 A;  3TDG A;  3OR5 A;  4JU5 A;  2H66 A;  2KP1 A;  2DIZ A;  3ZVJ A;  2DML A;  3HHV A;  5LD0 A;  2V2G A;  5IMC A;  6GSY A;  1V98 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...