2FLSA

Crystal structure of human glutaredoxin 2 complexed with glutathione
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
101
structure length
101
Chain Sequence
MPVNQIQETISDNCVVIFSKTSCSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKLLPLVHQCYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Glutaredoxin-2
publication title Crystal structure of Human Glutaredoxin 2 complexed with glutathione
rcsb
source organism Homo sapiens
total genus 35
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2006-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00462 Glutaredoxin Glutaredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2flsA00
1EV9A 4XS6A 2LS5A 4Q5RA 4WETA 2VCVA 4MPGA 4IW9A 2L6DA 3CBUA 4JE1A 3EINA 1SJ6A 4TRXA 3VWWA 3GH9A 3DMLA 3QMXA 2E2GA 3F63A 2B7KA 4L8EA 5C00A 1HNAA 1DSBA 1XW6A 3UVTA 1ABAA 1DE1A 2H66A 1GP1A 2H1GA 4I6XA 3LQ7A 3GH6A 1B9XC 3IA1A 2E7PA 3F3RA 3CRUA 3LWAA 4JBBA 3IC4A 4WF4A 4E8HA 2B5YA 1WE0A 3ERWA 3RPPA 2P5RA 2KOKA 2WCIA 1TU7A 5ECLB 3JCML 1USBA 4GTUA 1M9BA 1O8XA 3UMAA 4K7IA 1QK8A 1U88A 4H86A 5JWRB 4J57E 4IBPA 4NWYA 2O85A 4XTSA 3VWVA 3VLNA 4ECIA 3FY7A 3KMOA 3O76A 4WBRD 2LNSA 4WKWA 2CVDA 1AQXA 1U3AA 1MDKA 2C3TA 4OD7A 4P3YB 5DCGA 3M9KA 5DCHA 1V9WA 5CAXA 2OA7A 4K9ZA 6GSTA 2WB9A 2VD1A 3TJBA 3DVWA 4MJBA 1X0RA 2Z9SA 3HHVA 3C73A 4KGIA 3TKSA 4MABA 3F0IA 5CYYA 3P8WA 4MJAA 1LBKA 3HD5A 4V1Ap 3LGCA 1OC9A 4WR5A 2H0IA 2XHFA 2VIMA 2YJ7A 13GSA 3KP8A 3L0HA 3BBYA 5INYA 1J9BA 1F37A 1K0MA 4K1FA 3TB2A 3HA9A 1J08A 2CAQA 5F06A 3SWLA 3TKPA 2MMNA 5IMVA 4WEYA 2FUG2 1OKDA 3TKSC 3D4TA 3VWUA 4LMVA 3S9FA 1M2AA 1YKAA 4OFTA 3VPQA 2N5FA 5DQSA 3PGTA 5F8BA 4KNDA 5CRWA 3GKKA 4MF6A 3APSA 2L5LA 2MMOA 1K0AA 2RM6A 2P31A 5ECNB 3SBCA 4ZL8A 1OC9B 4OCEA 4I2TA 2JU5A 2GSSA 2X99A 2IMKA 2EIRA 3CRTA 3M0FA 3W6GA 2FGXA 2CVBA 4D73A 2M72A 3APOA 1OC3A 5KN3A 2FNOA 7GSSA 1FB6A 1QMVA 5FWGA 2H73A 5KN0A 4Q5QA 4GCIA 3QCPA 1YEPA 2H6XA 3IE3A 5G1KA 4JRRA 4OO5A 1SL0B 5ID2A 2H1DA 1NM3A 3R2QA 1VGLA 1SK1A 2HE3A 4EF0A 2AAWA 3FZ9A 5G31A 5DVBA 4WR4A 1DE2A 4BVYA 3DWVA 1SL1B 3EC3A 2JZSA 1ZOFA 2JSYA 4IGJA 2VCZA 3I9V2 3ZL5A 2VL2C 2FWHA 3TKRA 4D73B 4ZXGA 1S3DA 3A3TA 4TW5A 4ZL9A 1JZRA 2L59A 3GUSA 2WDUA 4KDXA 5IQYA 1ML6A 4PQ1A 4EDZA 2PUKC 2KHPA 1TOFA 5G5EA 4PNFA 5ID2B 1YY7A 2VLTA 2BTOT 1YEXA 4KH7A 1C72A 4JZQA 4NPBA 2ES7A 3BCKA 1XWKA 4ID0A 2I4AA 1GSUA 4RUVA 3HKRA 3K8NA 3QD9A 4I8BA 4EE0A 5GZZB 3VI5A 3MNGA 1YF1A 1JZDA 3HVSA 3HCZA 5HFGA 4CDOA 3LEFA 4PQIA 2D2ZA 4MH3A 4XIHA 2VCXA 4PUFC 1NW2A 2GQKA 1SJZA 2H1BA 5HFKA 3Q74A 3AY8A 2PGTA 1EEJA 1PQNA 3RAZA 1YQ1A 2OE1A 5DDLA 1U6TA 1JFUA 4NV2A 1GTAA 1V57A 5B6NA 3MWHA 1PMTA 4ZB9A 3LG6A 1A24A 5EPFA 3GN3A 5IPGA 3IRAA 5ECRB 2NTOA 1OC8A 1XXUA 2KLXA 1GSYA 3ED3A 2LRTA 3EURA 4YQMA 2K8SA 4E8EA 4WXTA 1EOGA 3GIXA 4ML6A 4Z7XA 1ERWA 1GSEA 3TRQA 4PURA 4EUYA 4KB3A 1XWGA 5ECMB 1WMJA 3C1SA 1XVWA 2DLXA 4DSSA 1O7UA 5ECKB 1JLWA 5DBQA 4L5OA 3KCMA 2I3YA 1JZOA 4LLRA 2ZUPA 2HXKA 4O92A 2B6MA 4EVMA 2HRFA 1BX9A 1WJKA 2HYXA 2VLVA 2LEGA 1ACVA 1KEBA 2YCDA 2WGRA 3QFBC 2H1AA 2LRNA 4XS1A 3GV1A 2TIRA 4YQUA 3LFLA 1G7OA 1M99A 1GTBA 2VL3A 4K2DA 4PX1A 4CHSA 2OE3A 2DJ0A 2IMIA 2C1YA 4NAXA 5F0GA 3LYKA 2IMFA 4N0VA 1FW1A 4N30A 1EOHA 3CYNA 4O7HA 1V58A 1ZZYA 5G1LA 3C8EA 1TRSA 4DSSB 4XHMA 3UVHA 2DJJA 4FO5A 3GRXA 2X8HA 4BL7A 2IMDA 3FW2A 3KP9A 1G6WA 1GLQA 3ZIJA 1PN9A 3DXBA 1A2MA 2YWIA 3QPMA 2IN3A 2GS3A 3FZ5A 5AISA 1XW5A 1SL2B 4BWQA 1M7TA 1NHYA 1WPIA 2LUSA 5ECHB 2WULA 3CTGA 1FAAA 3F9UA 1ZGNA 4IVFA 3ZFBA 3GSTA 10GSA 2VOCA 3GTUB 1KNGA 5COHA 1GNWA 1XOAA 1OKTA 2MMZA 1GWCA 2HZEB 2JZRA 3C71A 2ALBA 1JZWA 2ZCTA 3VK9A 1Z6MA 2XBQA 1K0CA 1F2EA 4LMWA 4BVXA 4PNGA 1NSWA 4N11A 1O73A 2FA4A 2EIQA 5ECOB 2OBIA 2TRXA 4ZBAA 3D6IA 3C1RA 4HZ4A 4RI6A 16GSA 1A0RP 3ZITA 2CV4A 6GSWA 1THXA 1FHEA 4QQ7A 3I6AA 3I43A 3HYPA 4XRAA 2CZ3A 5IOWA 1V2AA 3F6DA 3VFIA 2KP1A 3HY2A 5EVOA 1AC1A 4L5LA 3TKQA 1TXXA 2YP6A 3LXTA 1EZKA 22GSA 3TUEA 5CRGA 3LJRA 4AJ7A 1EEMA 2XPEA 1XPVA 3BCIA 2YPMA 1AQWA 4V2LA 4OCFA 3TKSE 2WS2A 4MPFA 4LL4B 2HRNA 1OE8A 2NPBA 3G9BA 3WYWA 2DJKA 3GYKA 3P90A 4I5QA 3GX0A 2NBSA 1RK4A 2VM1A 3ZYWA 1HNCA 1ZMAA 1EP7A 3MAKA 5AN1A 4F82A 1BG5A 2L4CA 3ISOA 4GSTA 2L57A 3VPTA 4IJ3A 1NHOA 3GL3A 4YQVA 1E2YA 2OKAA 3UBLA 1M2DA 1E6BA 2VCTA 4F2IA 3W8JA 1CQHA 3TJKA 3ERFA 2B5XA 1XFLA 2H0GA 3L9UA 3RPNA 5HQPA 2N5BA 3F4RA 3RDWA 2IWTA 2CVKA 3IDVA 3WT2A 4MJEA 3ZMKA 1M0UA 4NHZA 1WP0A 1X5CA 4FIWA 4HI7A 3QAWA 3L78A 4GQFA 1T7PB 4N0ZA 2IJYA 1N8JA 3D5JA 3MDKA 2HLSA 2V41A 2LQQA 3UAPA 3GSSA 2RUFA 1TDIA 5IO0A 2OACA 4ML1A 2QSIA 1S3CA 3TRXA 3HJMA 4Q5NA 3GL5A 1SYXA 1Z7RA 2F51A 2GSRA 5ELAA 1T1VA 2JL4A 4NHWA 4NMUA 1DBYA 2GT5A 2MYGA 2F3MA 3FRCA 4TKYA 2H71A 3M8NA 1PKWA 2B3SA 5JCGA 3F4SA 1SKSB 5GAPD 3E0UA 5CREA 3FR3A 3LSZA 3UIWA 5JWQB 3APQA 2CZ2A 3IAS2 4HEA2 3CMIA 1ERVA 4OFMA 5DALA 1A2JA 3P7XA 3KIJA 5F05A 4POKA 4ECCA 1MDJA 2O7KA 3EE2A 3DRNA 1PRXA 4TXVA 5LD0A 1LJRA 3WT1A 2A2RA 3G7JA 2DMLA 3FYGA 2FCHA 2J23A 1HD2A 2YOIA 5J5NA 3MSZA 5FT3A 4KW6A 2V6OA 1QFNA 1X5EA 3PH9A 2LSTA 1T4ZA 3IXRA 3F3QA 1T3BA 2I81A 5B8AA 3P2AA 2JZTA 2GT6A 1PX7A 5G2ZA 1QUWA 2DJ1A 4RQXA 3ZLPA 1GUMA 3CTFA 1YF0A 3QDNA 5JCWA 3IOSA 1K3OA 4PQHA 1K0OA 3EVIA 3D21A 4ECJA 2C0EA 3KH9A 1GTIA 5DALB 2K6VA 1V98A 2VAFA 1J0FA 1TK5B 3GKNA 1RQMA 2FWFA 1TRWA 3ZFLA 2GDRA 3GMFA 5IPHA 1GUKA 2LKUA 2VL2A 2DBCA 1TK0B 1Y6EA 2GZZA 3GKXA 2LJAA 5J4UA 3KMNA 1MEKA 2V32A 2CX3A 4ZBBA 2H6ZA 6GSVA 3GKMA 5EY6A 1PL1A 2R4VA 2O87A 3QFAC 4FYUA 1GL8A 2J9HA 1PX6A 5LNKe 3UBKA 1BAYA 3UARA 2YANA 6GSSA 5ECSA 1UVZA 3RHCA 4ACSA 2C3QA 1TTZA 2CX4A 3D4MA 2EIOA 4HQSA 4X0XA 5E4WA 5AIVA 1XWCA 4DVCA 2A2SA 5KN1A 2HSYA 3UEMA 3KD0A 3QAVA 1Z6NA 3J7Yb 1EGRA 1YKCA 1HYUA 1XCCA 1YJ6A 1B4PA 3DKSA 2JACA 5CRHA 4HU7A 4ZB8A 4DSRA 2L5OA 4GXZA 1BYEA 1VF1A 1BQ7A 4IJIA 2G2QA 3DD3A 1EV4A 4EDYA 2HNLA 4CW9A 2WJUA 4EKZA 3ZTLA 2MBSA 2DSAA 4TR1A 4XRDA 2GVPA 2YJHA 4ZILA 3H93A 1G7EA 2CAIA 5D8IA 2RM5A 2C0FA 3TJFA 2NDOA 4HOJA 2GSTA 4RI7A 1ILOA 2EC4A 3DYRA 1Q98A 1GSDA 1O8WA 2WRTA 2HT9A 1SK2A 5J9BA 2R37A 4HUAA 1QXHA 2DC5A 4GWRA 2H76A 1EWXA 4X43A 3TRPA 3TCOA 20GSA 2O89A 3DIEA 4TR4A 1JHBA 5EL8A 3KTLA 2RLIA 1Y25A 1ZYEA 4BWSA 1F9MA 3M9JA 1GULA 1UA5A 1SYRA 2MZCA 3CSHA 1VRSD 4V2NA 3ZVJA 3US3A 1A23A 5A5KA 1K3YA 3G7YA 3FZAA 1IYIA 3CSIA 3FZ4A 2LJRA 2VUPA 3RHBA 5HR2A 2I9HA 1EGOA 3KJYA 5DJMA 1X9MB 2AJQB 4AJ8A 3HZ8A 5A4WA 1URMA 5L71A 1R26A 2BMXA 2K9FA 2PWJA 5A4UA 5IOXA 5DAKA 17GSA 1SK0A 1THOA 4L0WA 4F03A 4ZB6A 3OR5A 4MZCA 1B48A 3D22A 5CO3A 2F8AA 2FLSA 2IL3A 1X9SB 3TJJA 3ME8A 1H4OA 3EYTA 1F3BA 4L0UA 1VF3A 1XWBA 1S3AA 5IMDA 1ERUA 2FA8A 2M46A 1A2LA 4K6XA 3NIVA 3GHAA 2YWOA 4IKHA 2YV9A 1O85A 2OJLA 4EO3A 1X5DA 5G30A 2A4VA 4MDCA 3H79A 4POBA 11GSA 4J2FA 4TR3A 2PMTA 5IMCA 2BJXA 4IP6A 5E59A 4PGTA 5JCUA 4IELA 2H8LA 2AHEA 4FH8A 1KTEA 3ZIVA 4MMMA 3Q19A 1FOVA 3F4TA 3NZNA 2YNXA 1U87A 3U5RE 1Q4JA 2LTKA 1TKDB 4FYCA 4KCAA 1TRVA 2YZHA 5ECQB 4KUNA 4I97A 4NV5A 5ELGA 2CA8A 14GSA 1M2BA 5H5QA 4GQCA 6GSUA 4G10A 3EMXA 6GSXA 1GSQA 1B4QA 2YWMA 3IK9A 3KXOA 4ECBA 2R5GA 2GQMA 2FY6A 3HVXA 1IYHA 2YV7A 4AGSA 1WRYA 4Q5FA 1RW1A 2C4JA 2H70A 5ECIB 2C3NA 2TRCP 4PXOA 2KP2A 4AF2A 19GSA 2WZ9A 2GZPA 2PPTA 3EU3A 1ON4A 4IN0A 4JR4A 1XZOA 1K0BA 2MMAA 1XW9A 3ZMLA 2AUVA 3HVVA 4BPYA 2H01A 2HSHA 3ZRDA 5GSSA 1SKRB 4K8MA 2H30A 1VF4A 3KH7A 5D93A 3GA4A 4G9HA 2WFCA 1TRUA 3WGDA 1DUGA 3LORA 2V6KA 1N2AA 3TOUA 4KAEA 4EXJA 5J41A 5B7CA 1ZYQB 6GSYA 1R7HA 2B7JA 2L4QA 4G2EA 2IPAA 2REMA 2LJKA 4YAVA 3EWLA 1Z9HA 5DQYA 5IO2A 3IAM2 2R3XA 1XOBA 1SD9A 2ZNMA 1A8YA 2C0DA 3EU4A 2VCWA 3ME7A 4F9ZA 5F07A 4OWYA 1Z3EA 1GTUA 1KBNA 3D0ZA 4GLTA 1FB0A 3H1NA 1AW9A 1M9AA 2PU9C 4XCSA 1FVKA 1QQ2A 2HI7A 4BA7A 2NVLA 3UJ1A 3PINA 2VO4A 3CSJA 4HDEA 1WWJA 4TXOA 4WBJA 4TOPA 2GTUA 2GZYA 3PR8A 2DMMA 3A2WA 2E2MA 3F8UA 5HFIA 3Q6OA 3VURA 3HDCA 5D9XA 4MCUA 2VM2A 3DVXA 5KEJA 4GF0A 1GRXA 1O6JA 2B5EA 1W4VA 1ZCPA 3BD2A 1WOUA 1PD21 1VF2A 1OAZA 1WIKA 4MA9A 3IV4A 4V1Ag 3U6VA 1AIUA 2H72A 2LV3A 2P5QA 3GURA 4HJMA 3KZQA 4KCEA 4TXOB 1OVNA 1W89A 4MZBA 1K0DA 2YWNA 2X64A 5IIZA 2C80A 1OE7A 3O6TA 3J7Yk 3IBHA 2CT6A 1B8XA 2K8VA 2DIZA 3L9VA 4JEDA 4JU5A 5ENUA 4FYBA 1ZL9A 3M1GA 1PA3A 1PL2A 4IP1A 3E3EA 1AAZA 4MP4A 2RIIA 3WD6A 5KN2A 4IQAA 1SD8A 2OBKA 5FHIA 4OMVA 5ABRA 4J56E 5CRDA 1JLVA 5IMFA 1GSFA 5G5FA 4GRFA 2FWGA 1CQGA 5H5SA 1YZXA 1O81A 2B1KA 1GNEA 4HU9A 5D73A 3FR9A 1SU9A 4K7OA 3L4NA 5H5RA 2LNTA 2YN1A 1LU4A 4KDYA 3M3MA 2QGVA 3GX8A 4TR0A 1HQOA 4G19A 1HNBA 5J9CA 2C0GA 4ILFA 1XIYA 2MBTA 4MH2A 3Q18A 2HFDA 4F0CA 2JADA 2N5AA 3LXZA 4MZWA 4XS4A 2O8VB 4EC0A 1H75A 2IIYA 1TI1A 4KX4A 4GSNA 5GAND 2E0QA 1Z7PA 3NOFA 3H8QA 4K0NA 3G7IA 2IMEA 1T00A 3FK8A 4K7NA 3VI7A 1GLPA 2H19A 3N5OA 4TN8A 1ERTA 5HR0A 1A0FA 3ZZXA 5D9TA 3FKFA 3QOUA 1TP9A 1AQVA 2C8UA 3LYPA 2VL9A 5D96A 2V2GA 5C04A 2L6CA 4YAPA 4ISDA 3TGZA 4LL1B 4NXIA 1U3IA 3KTBA 12GSA 1MD3A 2VD0A 4F0BA 2H0HA 5CNWA 5B8BA 3HJPA 1TU8A 1AXDA 3HXSA 3ERGA 2GSQA 4XS4B 5B6MA 2XPDA 2H75A 4O5RA 5HR3A 3ZREA 1BEDA 1A8LA 3IPZA 1Z5YE 3FHKA 1UN2A 3CXGA 1T4YA 2XC2A 2AYTA 2M80A 3A5WA 4KE3A 2R6KA 2PVQA 3N9JA 1F6MC 3O3TA 1PKZA 2KUCA 3RBTA 2G0FA 2JSZA 2PVOC 4TR1B 5CP1A 5AGYA 1MDIA 1UC7A 3GFKA 4HQZA 2H6YA 5A4VA 4WF5A 1PGTA 1TW9A 1V40A 3VWXA 1PSQA 3UOMA 1GSSA 5LCZA 4DEJA 4QL7A 3UL3A 2RUEA 2YZUA 2DIYA 2ON7A 4PUAA 4ZBDA 3ZVJD 1G0TA 2PERA 2LQOA 4K0GA 4MF5A 4RQRA 5IM9A 2VLUA 1SJIA 2OE0A 1SKWB 3FEUA 1K0NA 2IFQA 3TOTA 1GUHA 5AIXA 4MK3A 4KSOA 1XWAA 4ZIJA 4N10A 5D9WA 1R5PA 1X9WB 2DJ2A 4O32A 2CQ9A 4X1UA 3V1WA 2X8GA 2HZFA 4IQ1A 4KSMA 2P0GA 1TI3A 3WGEA 3IK7A 2R2JA 5ECPB 1FVJA 1QGVA 4AJ6A 2ON5A 2PN8A 3GTUA 4OFNA 3IR4A 3HZ4A 1SENA 2HZEA 1I5GA 2FWEA 4GSSA 2B1LA 4DSQA 4IHUA 3A2XA 3I69A 1FO5A 3E9JB 1F3AA 1FG4A 3C7MA 1MD4A 2QC7A 3GNJA 5HR1A 3BOAA 18GSA 1XVQA 2IFQB 1G6YA 2F8FA 3BJ5A 3KEBA 4MF7A 2AV4A 5DAKB 3F6FA 4OO4A 1R5AA 3WGXA 2QKEA 4HJ2A 3TDGA 1MTCA 2AB6A 2FD3A 2H74A 4ULXA 4MLYA 1TJDA 2K18A 1EP8A 3QR6A 1XBSA 2X8CA 4EL1A 1AUCA 1TK8B 8GSSA 4QL9A 5DJLA 3DGQA 1YDKA 1OYJA 2DJ3A 3KM6A 2I1UA 4LA1A 1BJXA 2FHEA 2VCQA 4JR6A 5D9VA 2GQLA 1R4WA 2V1MA 3L9SA 4IS0A 5IMAA 4V2MA 2XBIA 3DEXA 3IHQA 4YH2A 2GGTA 4POLA 4HS1A 4ZL7A 4HZ2A 1B9YC 2PBJA 1I9DA 3EMPA 4POMA 2OADA 2GLRA 4MJCA 3HJOA 3FR6A 4TVEA 3QAGA 9GSSA 4KA0A 4KDUA 1ST9A 3H4KA 2LRCA 3W8SA 3A2VA 1K3LA 2F9SA 5JWOB 3KGKA 4I2UA 5J3RA 1T8EB 5IMZA 1GH2A 5GSTA 3TJGA
chains in the Genus database with same CATH superfamily
1EV9A 1XG8A 4XS6A 2LS5A 4Q5RA 4WETA 2VCVA 4MPGA 4IW9A 2L6DA 3CBUA 4JE1A 3EINA 1SJ6A 4A5PA 4TRXA 3VWWA 3GH9A 3DMLA 3QMXA 2E2GA 3F63A 2B7KA 4L8EA 5C00A 1HNAA 1DSBA 1XW6A 3UVTA 2A2PA 1ABAA 1DE1A 2H66A 1GP1A 2H1GA 4I6XA 3LQ7A 3GH6A 1B9XC 3IA1A 2E7PA 3F3RA 3CRUA 3LWAA 4JBBA 3IC4A 4WF4A 4E8HA 4CY6A 2B5YA 1WE0A 3ERWA 3RPPA 2P5RA 5KOWA 2KOKA 2WCIA 1TU7A 5ECLB 3JCML 1USBA 4GTUA 1M9BA 1O8XA 5BMUA 3UMAA 4K7IA 1QK8A 1U88A 4H86A 5JWRB 4J57E 4IBPA 4NWYA 2O85A 4XTSA 3VWVA 3VLNA 4ECIA 3FY7A 3KMOA 3O76A 4WBRD 2LNSA 4WKWA 2CVDA 1AQXA 1U3AA 1MDKA 2C3TA 4OD7A 4P3YB 5DCGA 3M9KA 5DCHA 1V9WA 5CAXA 2OA7A 4K9ZA 6GSTA 2WB9A 2VD1A 2X4AA 3TJBA 3DVWA 4MJBA 1X0RA 2Z9SA 3HHVA 3C73A 4KGIA 3TKSA 4MABA 3F0IA 5CYYA 3P8WA 4MJAA 1LBKA 3HD5A 4V1Ap 3LGCA 4BIKA 1OC9A 4WR5A 2H0IA 2XHFA 2VIMA 2YJ7A 13GSA 3KP8A 3L0HA 3BBYA 5INYA 1J9BA 1F37A 1K0MA 4K1FA 3TB2A 3HA9A 1J08A 2CAQA 5F06A 3SWLA 3TKPA 2MMNA 5IMVA 4WEYA 2FUG2 1OKDA 3TKSC 3D4TA 4PTSA 3VWUA 4LMVA 3S9FA 1M2AA 1YKAA 4OFTA 3VPQA 2N5FA 5DQSA 3PGTA 5F8BA 4KNDA 5CRWA 3FMWA 3GKKA 4MF6A 3APSA 2L5LA 2MMOA 1K0AA 2RM6A 2P31A 5ECNB 3SBCA 4ZL8A 1OC9B 4OCEA 4I2TA 2JU5A 2GSSA 2X99A 2IMKA 2EIRA 3CRTA 3M0FA 3W6GA 2FGXA 2CVBA 4D73A 2M72A 3APOA 1OC3A 5KN3A 2FNOA 7GSSA 1FB6A 1QMVA 5FWGA 2H73A 5KN0A 4Q5QA 4YKFA 4GCIA 3QCPA 1YEPA 2R0PA 2H6XA 3IE3A 5G1KA 4JRRA 4OO5A 1SL0B 5ID2A 2H1DA 1NM3A 3R2QA 1VGLA 1SK1A 2HE3A 4EF0A 2AAWA 3FZ9A 5G31A 5DVBA 4WR4A 1DE2A 4BVYA 3DWVA 1SL1B 3EC3A 2JZSA 1ZOFA 2JSYA 4IGJA 2VCZA 3I9V2 3ZL5A 2VL2C 2FWHA 3TKRA 4D73B 4ZXGA 1S3DA 3A3TA 4TW5A 4ZL9A 1JZRA 2L59A 3GUSA 2WDUA 4KDXA 5IQYA 1ML6A 4PQ1A 4EDZA 2PUKC 2KHPA 1TOFA 5G5EA 4PNFA 5ID2B 1YY7A 2VLTA 2BTOT 1YEXA 4KH7A 1C72A 4JZQA 4NPBA 2ES7A 3BCKA 1XWKA 4BVYB 4ID0A 2I4AA 1GSUA 4RUVA 3HKRA 3K8NA 3QD9A 4I8BA 4O5QA 4EE0A 5GZZB 3VI5A 4MNNA 3MNGA 1YF1A 1JZDA 3HVSA 3HCZA 5HFGA 4CDOA 3LEFA 4PQIA 2D2ZA 4MH3A 4XIHA 2VCXA 4PUFC 1NW2A 3A5IA 2GQKA 1SJZA 2H1BA 5HFKA 3Q74A 3AY8A 2PGTA 1EEJA 1PQNA 3RAZA 1YQ1A 2OE1A 5DDLA 1U6TA 1JFUA 4NV2A 4Z2TA 1GTAA 1V57A 5B6NA 3MWHA 1PMTA 4ZB9A 3LG6A 1A24A 5EPFA 3GN3A 5IPGA 3IRAA 5ECRB 2NTOA 1ZYNA 1OC8A 1XXUA 2KLXA 1GSYA 3ED3A 2LRTA 3EURA 4YQMA 2K8SA 4E8EA 4WXTA 1EOGA 3GIXA 4ML6A 4Z7XA 1ERWA 1GSEA 3TRQA 4PURA 4EUYA 4KB3A 1XWGA 3R3EA 1WMJA 3C1SA 5ECMB 1XVWA 2DLXA 4DSSA 1O7UA 5ECKB 1JLWA 5DBQA 4L5OA 3KCMA 2I3YA 1JZOA 4LLRA 2ZUPA 2HXKA 4O92A 2B6MA 4EVMA 2HRFA 1BX9A 1WJKA 2HYXA 2VLVA 2LEGA 1ACVA 1KEBA 2YCDA 2WGRA 3QFBC 2H1AA 2LRNA 4XS1A 3GV1A 2TIRA 4YQUA 3LFLA 1G7OA 1M99A 1GTBA 2VL3A 4K2DA 4PX1A 4CHSA 2OE3A 2DJ0A 2IMIA 2C1YA 4NAXA 5F0GA 3LYKA 2IMFA 4N0VA 1FW1A 4KF9A 4N30A 1EOHA 3CYNA 4O7HA 1V58A 1ZZYA 5G1LA 3C8EA 1TRSA 4DSSB 3IC8A 4XHMA 3UVHA 2DJJA 4FO5A 3GRXA 2X8HA 4BL7A 2IMDA 3FW2A 3KP9A 1G6WA 1GLQA 3ZIJA 1PN9A 3DXBA 1A2MA 2YWIA 3QPMA 2IN3A 2GS3A 3FZ5A 5AISA 1XW5A 1SL2B 4BWQA 1M7TA 1NHYA 1WPIA 2LUSA 5ECHB 2WULA 3CTGA 1FAAA 3F9UA 3MIXA 1ZGNA 4IVFA 3ZFBA 3GSTA 10GSA 1M3IA 2VOCA 3GTUB 1KNGA 5COHA 1GNWA 1XOAA 1OKTA 2MMZA 1GWCA 2HZEB 2JZRA 3C71A 2ALBA 1JZWA 2ZCTA 3VK9A 1Z6MA 2XBQA 1K0CA 1F2EA 4LMWA 4BVXA 4PNGA 1NSWA 4N11A 1O73A 2FA4A 2EIQA 5ECOB 2OBIA 2TRXA 4ZBAA 3D6IA 3C1RA 5KOXA 4HZ4A 4RI6A 16GSA 1A0RP 3ZITA 2CV4A 6GSWA 1THXA 1FHEA 4QQ7A 3I6AA 3I43A 3HYPA 4XRAA 2CZ3A 5IOWA 1V2AA 3F6DA 3VFIA 2KP1A 3HY2A 5EVOA 1AC1A 4EIPA 4L5LA 3TKQA 1TXXA 2YP6A 3LXTA 1EZKA 22GSA 3TUEA 4BVXB 5CRGA 3LJRA 4AJ7A 1EEMA 2XPEA 1XPVA 3BCIA 2YPMA 1AQWA 4V2LA 4OCFA 3TKSE 2WS2A 4MPFA 4LL4B 2HRNA 1OE8A 2NPBA 3G9BA 3WYWA 2DJKA 3GYKA 3P90A 4I5QA 3GX0A 2NBSA 1RK4A 2VM1A 3ZYWA 1HNCA 1ZMAA 1EP7A 3MAKA 5AN1A 4F82A 1BG5A 2L4CA 3ISOA 4GSTA 2L57A 3VPTA 4IJ3A 1NHOA 3GL3A 4YQVA 1E2YA 2OKAA 3UBLA 1M2DA 1E6BA 2VCTA 4F2IA 3W8JA 1CQHA 3TJKA 3ERFA 2B5XA 1XFLA 2H0GA 3L9UA 3RPNA 5HQPA 2N5BA 3F4RA 3RDWA 2IWTA 2CVKA 3IDVA 3WT2A 4MJEA 3ZMKA 1M0UA 4NHZA 1WP0A 1X5CA 2R0CA 4FIWA 4HI7A 3QAWA 3L78A 4GQFA 1T7PB 4N0ZA 2IJYA 1N8JA 3D5JA 3MDKA 2HLSA 2V41A 2LQQA 3UAPA 3GSSA 2RUFA 1TDIA 5IO0A 2OACA 4ML1A 2QSIA 1S3CA 3TRXA 3HJMA 4Q5NA 3GL5A 1SYXA 2X49A 1Z7RA 2F51A 2GSRA 5ELAA 1T1VA 2JL4A 4NHWA 4NMUA 1DBYA 4YKGA 2GT5A 2MYGA 2F3MA 3FRCA 4TKYA 2H71A 3M8NA 1PKWA 2B3SA 5JCGA 3F4SA 1SKSB 5GAPD 3E0UA 5CREA 3FR3A 3LSZA 4K2XA 3UIWA 5JWQB 3APQA 2CZ2A 3IAS2 4HEA2 3CMIA 1ERVA 4OFMA 5DALA 1A2JA 3P7XA 1M3JA 3KIJA 5F05A 4POKA 4ECCA 1MDJA 2O7KA 3EE2A 3DRNA 1PRXA 4TXVA 5LD0A 1LJRA 3WT1A 2A2RA 3G7JA 2DMLA 3FYGA 2FCHA 2J23A 1HD2A 2YOIA 5J5NA 3MSZA 5FT3A 4KW6A 2V6OA 1QFNA 1X5EA 3PH9A 2LSTA 1T4ZA 3IXRA 3F3QA 1T3BA 2I81A 4Z2UA 5B8AA 3P2AA 2JZTA 2GT6A 1PX7A 5G2ZA 1QUWA 2DJ1A 4RQXA 3ZLPA 1GUMA 3CTFA 3PPUA 1YF0A 3QDNA 5JCWA 4FQUA 3IOSA 1K3OA 4PQHA 1K0OA 3EVIA 3D21A 4ECJA 2C0EA 3KH9A 1GTIA 5DALB 2K6VA 1V98A 2VAFA 1J0FA 1TK5B 3GKNA 1RQMA 2FWFA 1TRWA 3ZFLA 2GDRA 3GMFA 4G0KA 5IPHA 1GUKA 2LKUA 2VL2A 2DBCA 1TK0B 1Y6EA 2GZZA 3GKXA 2LJAA 5J4UA 3KMNA 1MEKA 2V32A 2CX3A 4ZBBA 2H6ZA 6GSVA 3GKMA 5EY6A 1PL1A 2R4VA 2O87A 3QFAC 4FYUA 1GL8A 2J9HA 1PX6A 5LNKe 3UBKA 1BAYA 3UARA 2YANA 6GSSA 5ECSA 1UVZA 3RHCA 4ACSA 2C3QA 1TTZA 2CX4A 3D4MA 2EIOA 4HQSA 2QA2A 4X0XA 5E4WA 5AIVA 1XWCA 4DVCA 2A2SA 5KN1A 2HSYA 3UEMA 3KD0A 3QAVA 1Z6NA 3J7Yb 1EGRA 1YKCA 1HYUA 1XCCA 1YJ6A 1B4PA 3DKSA 2JACA 5CRHA 4HU7A 4ZB8A 4DSRA 2L5OA 4GXZA 1BYEA 1VF1A 5BRTA 1BQ7A 4IJIA 2G2QA 3DD3A 1EV4A 4EDYA 2HNLA 4CW9A 1ZYPA 2WJUA 4EKZA 3ZTLA 2MBSA 2DSAA 4TR1A 4XRDA 2GVPA 2YJHA 4ZILA 3H93A 1G7EA 2CAIA 5D8IA 2RM5A 2C0FA 3TJFA 2NDOA 4HOJA 2GSTA 4RI7A 1ILOA 2EC4A 3DYRA 1Q98A 1GSDA 1O8WA 2WRTA 2HT9A 1SK2A 5J9BA 2R37A 4HUAA 1QXHA 2DC5A 4GWRA 2H76A 1EWXA 4X43A 3TRPA 3TCOA 20GSA 2O89A 3DIEA 4TR4A 1JHBA 5EL8A 3KTLA 2RLIA 1Y25A 1ZYEA 2QA1A 4BWSA 1F9MA 3M9JA 1GULA 1UA5A 1SYRA 2MZCA 3CSHA 1VRSD 4V2NA 3ZVJA 3US3A 1A23A 5A5KA 1K3YA 3G7YA 3FZAA 1IYIA 3CSIA 3FZ4A 2LJRA 2VUPA 3RHBA 5HR2A 2I9HA 1EGOA 4K5SA 3KJYA 5DJMA 1X9MB 2AJQB 2UZ8A 1FOHA 4AJ8A 3HZ8A 5A4WA 1URMA 5L71A 1R26A 2BMXA 2K9FA 2PWJA 5A4UA 5IOXA 5DAKA 17GSA 1SK0A 1THOA 4L0WA 4F03A 4ZB6A 3OR5A 4MZCA 1B48A 3D22A 5CO3A 2F8AA 2FLSA 2IL3A 1X9SB 3TJJA 3ME8A 1H4OA 3EYTA 1F3BA 4L0UA 1VF3A 1XWBA 1S3AA 5IMDA 1ERUA 2FA8A 2M46A 3IHGA 1A2LA 4K6XA 3NIVA 3GHAA 2YWOA 4IKHA 2YV9A 1O85A 2OJLA 4EO3A 1X5DA 5G30A 2A4VA 4MDCA 1PFOA 3H79A 4POBA 11GSA 4J2FA 4TR3A 2PMTA 1PN0A 5IMCA 2BJXA 4IP6A 4O5UA 5E59A 4PGTA 5JCUA 4IELA 4BL7B 2H8LA 2AHEA 4FH8A 1KTEA 3ZIVA 4MMMA 3Q19A 1FOVA 3F4TA 3NZNA 2YNXA 1U87A 3U5RE 1Q4JA 2LTKA 1TKDB 4FYCA 4KCAA 4CY8A 1TRVA 2YZHA 5ECQB 4KUNA 4I97A 4NV5A 5ELGA 2CA8A 14GSA 1M2BA 5H5QA 4GQCA 6GSUA 4G10A 3EMXA 6GSXA 1GSQA 1B4QA 2YWMA 3IK9A 3KXOA 4ECBA 2R5GA 2GQMA 2FY6A 3HVXA 1IYHA 2YV7A 4AGSA 1WRYA 4Q5FA 1RW1A 2C4JA 2H70A 5ECIB 2C3NA 2TRCP 4PXOA 2KP2A 4AF2A 19GSA 2WZ9A 2GZPA 2PPTA 3EU3A 1ON4A 4IN0A 3MYDA 4JR4A 1K0BA 1XZOA 2MMAA 1XW9A 3ZMLA 3EPTA 2AUVA 3HVVA 4BPYA 2H01A 2HSHA 3ZRDA 5GSSA 4EIQA 4K8MA 1SKRB 2H30A 1VF4A 3KH7A 5D93A 3GA4A 4G9HA 2WFCA 1TRUA 3WGDA 1DUGA 3LORA 2V6KA 1N2AA 3TOUA 4KAEA 4EXJA 5J41A 5B7CA 1ZYQB 2A4HA 6GSYA 1R7HA 2B7JA 2L4QA 4G2EA 2IPAA 2REMA 4Z2RA 2LJKA 4YAVA 3EWLA 1Z9HA 5DQYA 5IO2A 3IAM2 2R3XA 1XOBA 1SD9A 2ZNMA 1A8YA 2C0DA 3EU4A 2VCWA 3ME7A 4F9ZA 5F07A 4OWYA 1Z3EA 1GTUA 1KBNA 3D0ZA 4GLTA 1FB0A 3H1NA 1AW9A 1M9AA 2PU9C 4XCSA 1FVKA 1QQ2A 2HI7A 4BA7A 2NVLA 3UJ1A 3PINA 2VO4A 3CSJA 4HDEA 1WWJA 4TXOA 4WBJA 4TOPA 2HSMA 2GTUA 2GZYA 3PR8A 2DMMA 3A2WA 2E2MA 3F8UA 5HFIA 3Q6OA 3VURA 3HDCA 5D9XA 4MCUA 2VM2A 3DVXA 5KEJA 4GF0A 1GRXA 1O6JA 2B5EA 1W4VA 1ZCPA 3BD2A 1WOUA 1PD21 1VF2A 1OAZA 1WIKA 4MA9A 3IV4A 4HSCX 4V1Ag 3U6VA 1AIUA 2H72A 2LV3A 2P5QA 3GURA 4HJMA 3KZQA 4KCEA 4TXOB 1OVNA 1W89A 4MZBA 1K0DA 2YWNA 2X64A 4K5RA 5IIZA 2C80A 1OE7A 3O6TA 3J7Yk 2DKHA 3IBHA 2CT6A 1B8XA 2K8VA 2DIZA 3L9VA 4JEDA 4JU5A 5ENUA 4FYBA 1ZL9A 3M1GA 1PA3A 1PL2A 4IP1A 3E3EA 1AAZA 4MP4A 2RIIA 3WD6A 5KN2A 4IQAA 1SD8A 2OBKA 5FHIA 4OMVA 5ABRA 4J56E 5CRDA 1JLVA 3LW9A 5IMFA 1GSFA 5G5FA 4GRFA 2FWGA 1CQGA 5H5SA 1YZXA 1O81A 2B1KA 4G0LA 1GNEA 4HU9A 5D73A 3FR9A 1SU9A 4K7OA 3L4NA 5H5RA 2LNTA 2YN1A 1LU4A 3HVNA 4KDYA 3M3MA 3CQFA 2QGVA 3GX8A 4TR0A 2HRKA 1HQOA 4G19A 1HNBA 5J9CA 2C0GA 4ILFA 1XIYA 2MBTA 4MH2A 3Q18A 2HFDA 4F0CA 2JADA 2N5AA 3LXZA 4MZWA 4XS4A 2O8VB 4EC0A 1H75A 2IIYA 1TI1A 4KX4A 4GSNA 5GAND 2E0QA 1Z7PA 3NOFA 3H8QA 4K0NA 3G7IA 2IMEA 1T00A 3FK8A 4K7NA 3VI7A 1GLPA 2H19A 3N5OA 4TN8A 1ERTA 5HR0A 1A0FA 3ZZXA 5D9TA 4ICYA 3FKFA 3QOUA 1TP9A 1AQVA 2C8UA 3LYPA 2VL9A 5D96A 2V2GA 5C04A 2L6CA 4YAPA 4ISDA 3TGZA 4LL1B 4NXIA 1U3IA 3KTBA 12GSA 1MD3A 2VD0A 4F0BA 2H0HA 5CNWA 5B8BA 3HJPA 1TU8A 1AXDA 4G0IA 3HXSA 3ERGA 2GSQA 4XS4B 5B6MA 2XPDA 2H75A 4O5RA 5HR3A 3ZREA 1BEDA 1A8LA 3IPZA 1Z5YE 3FHKA 1UN2A 3CXGA 1T4YA 2XC2A 2AYTA 2M80A 3A5WA 4KE3A 2R6KA 2PVQA 3N9JA 1F6MC 3O3TA 1PKZA 2KUCA 3RBTA 2G0FA 2JSZA 2PVOC 4TR1B 5CP1A 5AGYA 1MDIA 1UC7A 3GFKA 4HQZA 2H6YA 5A4VA 4WF5A 1PGTA 1TW9A 1V40A 3VWXA 1PSQA 3UOMA 1GSSA 5LCZA 4DEJA 4QL7A 3UL3A 2RUEA 2YZUA 2DIYA 2ON7A 2HRAA 4PUAA 4ZBDA 3ZVJD 1G0TA 2PERA 2LQOA 4K0GA 4MF5A 4RQRA 5IM9A 2VLUA 1SJIA 2OE0A 1SKWB 3FEUA 1K0NA 2IFQA 3TOTA 1GUHA 5AIXA 4MK3A 4KSOA 1XWAA 4ZIJA 4N10A 4USSA 5D9WA 1R5PA 1X9WB 2DJ2A 4O32A 2CQ9A 4X1UA 3V1WA 2X8GA 2HZFA 4IQ1A 4KSMA 2P0GA 1TI3A 3WGEA 3IK7A 2R2JA 5ECPB 1FVJA 1S3RA 1QGVA 4AJ6A 2ON5A 2PN8A 3GTUA 4OFNA 3IR4A 3HZ4A 1SENA 2HZEA 1I5GA 2FWEA 4GSSA 2B1LA 4DSQA 4IHUA 3A2XA 3I69A 1FO5A 3E9JB 2DKIA 1F3AA 4X4JA 1FG4A 3C7MA 1MD4A 2QC7A 3GNJA 5HR1A 3BOAA 18GSA 1XVQA 2IFQB 1G6YA 2F8FA 3BJ5A 3KEBA 4MF7A 2AV4A 5DAKB 3F6FA 4OO4A 1R5AA 2R0GA 3WGXA 2QKEA 4HJ2A 3TDGA 1MTCA 2AB6A 2FD3A 2H74A 4ULXA 4MLYA 1TJDA 2K18A 1EP8A 3QR6A 1XBSA 2X8CA 4EL1A 1AUCA 1TK8B 8GSSA 4QL9A 5DJLA 3DGQA 1YDKA 1OYJA 2DJ3A 3KM6A 2I1UA 4LA1A 1BJXA 2FHEA 2VCQA 4JR6A 5D9VA 2GQLA 1R4WA 2V1MA 3L9SA 4IS0A 5IMAA 4V2MA 2XBIA 3DEXA 3IHQA 4YH2A 2GGTA 4POLA 4HS1A 4ZL7A 4HZ2A 1B9YC 2PBJA 1I9DA 3EMPA 4POMA 2OADA 2GLRA 4MJCA 3HJOA 3FR6A 4TVEA 3QAGA 9GSSA 4KA0A 4KDUA 1ST9A 3H4KA 2LRCA 3W8SA 3A2VA 1K3LA 2F9SA 5JWOB 3KGKA 4I2UA 5J3RA 1T8EB 5IMZA 1GH2A 5GSTA 3TJGA
chains in the Genus database with same CATH topology
1EV9A 4XS6A 2LS5A 4Q5RA 4WETA 2VCVA 4MPGA 4IW9A 2L6DA 3CBUA 4JE1A 3EINA 1SJ6A 4A5PA 4TRXA 3VWWA 3GH9A 3DMLA 3QMXA 2E2GA 3F63A 2B7KA 4L8EA 5C00A 1HNAA 1DSBA 1XW6A 3UVTA 2A2PA 1ABAA 1DE1A 2H66A 1GP1A 2H1GA 4I6XA 3LQ7A 3GH6A 1B9XC 3IA1A 2E7PA 3F3RA 3CRUA 3LWAA 4JBBA 3IC4A 4WF4A 4E8HA 4CY6A 2B5YA 1WE0A 3ERWA 3RPPA 2P5RA 5KOWA 2KOKA 2WCIA 1TU7A 5ECLB 3JCML 1USBA 4GTUA 1M9BA 1O8XA 5BMUA 3UMAA 4K7IA 1QK8A 1U88A 4H86A 5JWRB 4J57E 4IBPA 4NWYA 2O85A 4XTSA 3VWVA 3VLNA 4ECIA 3FY7A 3KMOA 3O76A 4WBRD 2LNSA 4WKWA 2CVDA 1AQXA 1U3AA 1MDKA 2C3TA 4OD7A 4P3YB 5DCGA 3M9KA 5DCHA 1V9WA 5CAXA 2OA7A 4K9ZA 6GSTA 2WB9A 2VD1A 2X4AA 3TJBA 3DVWA 4MJBA 1X0RA 2Z9SA 3HHVA 3C73A 4KGIA 3TKSA 4MABA 3F0IA 5CYYA 3P8WA 4MJAA 1LBKA 3HD5A 4V1Ap 3LGCA 1OC9A 4WR5A 2H0IA 2XHFA 2VIMA 2YJ7A 13GSA 3KP8A 3L0HA 3BBYA 5INYA 1J9BA 1F37A 1K0MA 4K1FA 3TB2A 3HA9A 1J08A 2CAQA 5F06A 3SWLA 3TKPA 2MMNA 5IMVA 4WEYA 2FUG2 1OKDA 3TKSC 3D4TA 4PTSA 3VWUA 4LMVA 3S9FA 1M2AA 1YKAA 4OFTA 3VPQA 2N5FA 5DQSA 3PGTA 5F8BA 4KNDA 5CRWA 3FMWA 3GKKA 4MF6A 3APSA 2L5LA 2MMOA 1K0AA 2RM6A 2P31A 5ECNB 3SBCA 4ZL8A 1OC9B 4OCEA 4I2TA 2JU5A 2GSSA 2X99A 2IMKA 2EIRA 3CRTA 3M0FA 3W6GA 2FGXA 2CVBA 4D73A 2M72A 3APOA 1OC3A 5KN3A 2FNOA 7GSSA 1FB6A 1QMVA 5FWGA 2H73A 5KN0A 4Q5QA 4YKFA 4GCIA 3QCPA 1YEPA 2R0PA 2H6XA 3IE3A 5G1KA 4JRRA 4OO5A 1SL0B 5ID2A 2H1DA 1NM3A 3R2QA 1VGLA 1SK1A 2HE3A 4EF0A 2AAWA 3FZ9A 5G31A 5DVBA 4WR4A 1DE2A 4BVYA 3DWVA 1SL1B 3EC3A 2JZSA 1ZOFA 2JSYA 4IGJA 2VCZA 3I9V2 3ZL5A 2VL2C 2FWHA 3TKRA 4D73B 4ZXGA 1S3DA 3A3TA 4TW5A 4ZL9A 1JZRA 2L59A 3GUSA 2WDUA 4KDXA 5IQYA 1ML6A 4PQ1A 4EDZA 2PUKC 2KHPA 1TOFA 5G5EA 4PNFA 5ID2B 1YY7A 2VLTA 2BTOT 1YEXA 4KH7A 1C72A 4JZQA 4NPBA 2ES7A 3BCKA 1XWKA 4BVYB 4ID0A 2I4AA 1GSUA 4RUVA 3HKRA 3K8NA 3QD9A 4I8BA 4O5QA 4EE0A 5GZZB 3VI5A 4MNNA 3MNGA 1YF1A 1JZDA 3HVSA 3HCZA 5HFGA 4CDOA 3LEFA 4PQIA 2D2ZA 4MH3A 4XIHA 2VCXA 4PUFC 1NW2A 3A5IA 2GQKA 1SJZA 2H1BA 5HFKA 3Q74A 3AY8A 2PGTA 1EEJA 1PQNA 3RAZA 1YQ1A 2OE1A 5DDLA 1U6TA 1JFUA 4NV2A 4Z2TA 1GTAA 1V57A 5B6NA 3MWHA 1PMTA 4ZB9A 3LG6A 1A24A 5EPFA 3GN3A 5IPGA 3IRAA 5ECRB 2NTOA 1ZYNA 1OC8A 1XXUA 2KLXA 1GSYA 3ED3A 2LRTA 3EURA 4YQMA 2K8SA 4E8EA 4WXTA 1EOGA 3GIXA 4ML6A 4Z7XA 1ERWA 1GSEA 3TRQA 4PURA 4EUYA 4KB3A 1XWGA 3R3EA 1WMJA 3C1SA 5ECMB 1XVWA 2DLXA 4DSSA 1O7UA 5ECKB 1JLWA 5DBQA 4L5OA 3KCMA 2I3YA 1JZOA 4LLRA 2ZUPA 2HXKA 4O92A 2B6MA 4EVMA 2HRFA 1BX9A 1WJKA 2HYXA 2VLVA 2LEGA 1ACVA 1KEBA 2YCDA 2WGRA 3QFBC 2H1AA 2LRNA 4XS1A 3GV1A 2TIRA 4YQUA 3LFLA 1G7OA 1M99A 1GTBA 2VL3A 4K2DA 4PX1A 4CHSA 2OE3A 2DJ0A 2IMIA 2C1YA 4NAXA 5F0GA 3LYKA 2IMFA 4N0VA 1FW1A 4KF9A 4N30A 1EOHA 3CYNA 4O7HA 1V58A 1ZZYA 5G1LA 3C8EA 1TRSA 4DSSB 3IC8A 4XHMA 3UVHA 2DJJA 4FO5A 3GRXA 2X8HA 4BL7A 2IMDA 3FW2A 3KP9A 1G6WA 1GLQA 3ZIJA 1PN9A 3DXBA 1A2MA 2YWIA 3QPMA 2IN3A 2GS3A 3FZ5A 5AISA 1XW5A 1SL2B 4BWQA 1M7TA 1NHYA 1WPIA 2LUSA 5ECHB 2WULA 3CTGA 1FAAA 3F9UA 3MIXA 1ZGNA 4IVFA 3ZFBA 3GSTA 10GSA 2VOCA 3GTUB 1KNGA 5COHA 1GNWA 1XOAA 1OKTA 2MMZA 1GWCA 2HZEB 2JZRA 3C71A 2ALBA 1JZWA 2ZCTA 3VK9A 1Z6MA 2XBQA 1K0CA 1F2EA 4LMWA 4BVXA 4PNGA 1NSWA 4N11A 1O73A 2FA4A 2EIQA 5ECOB 2OBIA 2TRXA 4ZBAA 3D6IA 3C1RA 5KOXA 4HZ4A 4RI6A 16GSA 1A0RP 3ZITA 2CV4A 6GSWA 1THXA 1FHEA 4QQ7A 3I6AA 3I43A 3HYPA 4XRAA 2CZ3A 5IOWA 1V2AA 3F6DA 3VFIA 2KP1A 3HY2A 5EVOA 1AC1A 4EIPA 4L5LA 3TKQA 1TXXA 2YP6A 3LXTA 1EZKA 22GSA 3TUEA 4BVXB 5CRGA 3LJRA 4AJ7A 1EEMA 2XPEA 1XPVA 3BCIA 2YPMA 1AQWA 4V2LA 4OCFA 3TKSE 2WS2A 4MPFA 4LL4B 2HRNA 1OE8A 2NPBA 3G9BA 3WYWA 2DJKA 3GYKA 3P90A 4I5QA 3GX0A 2NBSA 1RK4A 2VM1A 3ZYWA 1HNCA 1ZMAA 1EP7A 3MAKA 5AN1A 4F82A 1BG5A 2L4CA 3ISOA 4GSTA 2L57A 3VPTA 4IJ3A 1NHOA 3GL3A 4YQVA 1E2YA 2OKAA 3UBLA 1M2DA 1E6BA 2VCTA 4F2IA 3W8JA 1CQHA 3TJKA 3ERFA 2B5XA 1XFLA 2H0GA 3L9UA 3RPNA 5HQPA 2N5BA 3F4RA 3RDWA 2IWTA 2CVKA 3IDVA 3WT2A 4MJEA 3ZMKA 1M0UA 4NHZA 1WP0A 1X5CA 2R0CA 4FIWA 4HI7A 3QAWA 3L78A 4GQFA 1T7PB 4N0ZA 2IJYA 1N8JA 3D5JA 3MDKA 2HLSA 2V41A 2LQQA 3UAPA 3GSSA 2RUFA 1TDIA 5IO0A 2OACA 4ML1A 2QSIA 1S3CA 3TRXA 3HJMA 4Q5NA 3GL5A 1SYXA 2X49A 1Z7RA 2F51A 2GSRA 5ELAA 1T1VA 2JL4A 4NHWA 4NMUA 1DBYA 4YKGA 2GT5A 2MYGA 2F3MA 3FRCA 4TKYA 2H71A 3M8NA 1PKWA 2B3SA 5JCGA 3F4SA 1SKSB 5GAPD 3E0UA 5CREA 3FR3A 3LSZA 4K2XA 3UIWA 5JWQB 3APQA 2CZ2A 3IAS2 4HEA2 3CMIA 1ERVA 4OFMA 5DALA 1A2JA 3P7XA 3KIJA 5F05A 4POKA 4ECCA 1MDJA 2O7KA 3EE2A 3DRNA 1PRXA 4TXVA 5LD0A 1LJRA 3WT1A 2A2RA 3G7JA 2DMLA 3FYGA 2FCHA 2J23A 1HD2A 2YOIA 5J5NA 3MSZA 5FT3A 4KW6A 2V6OA 1QFNA 1X5EA 3PH9A 2LSTA 1T4ZA 3IXRA 3F3QA 1T3BA 2I81A 4Z2UA 5B8AA 3P2AA 2JZTA 2GT6A 1PX7A 5G2ZA 1QUWA 2DJ1A 4RQXA 3ZLPA 1GUMA 3CTFA 3PPUA 1YF0A 3QDNA 5JCWA 4FQUA 3IOSA 1K3OA 4PQHA 1K0OA 3EVIA 3D21A 4ECJA 2C0EA 3KH9A 1GTIA 5DALB 2K6VA 1V98A 2VAFA 1J0FA 1TK5B 3GKNA 1RQMA 2FWFA 1TRWA 3ZFLA 2GDRA 3GMFA 4G0KA 5IPHA 1GUKA 2LKUA 2VL2A 2DBCA 1TK0B 1Y6EA 2GZZA 3GKXA 2LJAA 5J4UA 3KMNA 1MEKA 2V32A 2CX3A 4ZBBA 2H6ZA 6GSVA 3GKMA 5EY6A 1PL1A 2R4VA 2O87A 3QFAC 4FYUA 1GL8A 2J9HA 1PX6A 5LNKe 3UBKA 1BAYA 3UARA 2YANA 6GSSA 5ECSA 1UVZA 3RHCA 4ACSA 2C3QA 1TTZA 2CX4A 3D4MA 2EIOA 4HQSA 2QA2A 4X0XA 5E4WA 5AIVA 1XWCA 4DVCA 2A2SA 5KN1A 2HSYA 3UEMA 3KD0A 3QAVA 1Z6NA 3J7Yb 1EGRA 1YKCA 1HYUA 1XCCA 1YJ6A 1B4PA 3DKSA 2JACA 5CRHA 4HU7A 4ZB8A 4DSRA 2L5OA 4GXZA 1BYEA 1VF1A 5BRTA 1BQ7A 4IJIA 2G2QA 3DD3A 1EV4A 4EDYA 2HNLA 4CW9A 1ZYPA 2WJUA 4EKZA 3ZTLA 2MBSA 2DSAA 4TR1A 4XRDA 2GVPA 2YJHA 4ZILA 3H93A 1G7EA 2CAIA 5D8IA 2RM5A 2C0FA 3TJFA 2NDOA 4HOJA 2GSTA 4RI7A 1ILOA 2EC4A 3DYRA 1Q98A 1GSDA 1O8WA 2WRTA 2HT9A 1SK2A 5J9BA 2R37A 4HUAA 1QXHA 2DC5A 4GWRA 2H76A 1EWXA 4X43A 3TRPA 3TCOA 20GSA 2O89A 3DIEA 4TR4A 1JHBA 5EL8A 3KTLA 2RLIA 1Y25A 1ZYEA 2QA1A 4BWSA 1F9MA 3M9JA 1GULA 1UA5A 1SYRA 2MZCA 3CSHA 1VRSD 4V2NA 3ZVJA 3US3A 1A23A 5A5KA 1K3YA 3G7YA 3FZAA 1IYIA 3CSIA 3FZ4A 2LJRA 2VUPA 3RHBA 5HR2A 2I9HA 1EGOA 4K5SA 3KJYA 5DJMA 1X9MB 2AJQB 2UZ8A 1FOHA 4AJ8A 3HZ8A 5A4WA 1URMA 5L71A 1R26A 2BMXA 2K9FA 2PWJA 5A4UA 5IOXA 5DAKA 17GSA 1SK0A 1THOA 4L0WA 4F03A 4ZB6A 3OR5A 4MZCA 1B48A 3D22A 5CO3A 2F8AA 2FLSA 2IL3A 1X9SB 3TJJA 3ME8A 1H4OA 3EYTA 1F3BA 4L0UA 1VF3A 1XWBA 1S3AA 5IMDA 1ERUA 2FA8A 2M46A 3IHGA 1A2LA 4K6XA 3NIVA 3GHAA 2YWOA 4IKHA 2YV9A 1O85A 2OJLA 4EO3A 1X5DA 5G30A 2A4VA 4MDCA 3H79A 4POBA 11GSA 4J2FA 4TR3A 2PMTA 1PN0A 5IMCA 2BJXA 4IP6A 4O5UA 5E59A 4PGTA 5JCUA 4IELA 4BL7B 2H8LA 2AHEA 4FH8A 1KTEA 3ZIVA 4MMMA 3Q19A 1FOVA 3F4TA 3NZNA 2YNXA 1U87A 3U5RE 1Q4JA 2LTKA 1TKDB 4FYCA 4KCAA 4CY8A 1TRVA 2YZHA 5ECQB 4KUNA 4I97A 4NV5A 5ELGA 2CA8A 14GSA 1M2BA 5H5QA 4GQCA 6GSUA 4G10A 3EMXA 6GSXA 1GSQA 1B4QA 2YWMA 3IK9A 3KXOA 4ECBA 2R5GA 2GQMA 2FY6A 3HVXA 1IYHA 2YV7A 4AGSA 1WRYA 4Q5FA 1RW1A 2C4JA 2H70A 5ECIB 2C3NA 2TRCP 4PXOA 2KP2A 4AF2A 19GSA 2WZ9A 2GZPA 2PPTA 3EU3A 1ON4A 4IN0A 3MYDA 4JR4A 1XZOA 1K0BA 2MMAA 1XW9A 3ZMLA 3EPTA 2AUVA 3HVVA 4BPYA 2H01A 2HSHA 3ZRDA 5GSSA 4EIQA 4K8MA 1SKRB 2H30A 1VF4A 3KH7A 5D93A 3GA4A 4G9HA 2WFCA 1TRUA 3WGDA 1DUGA 3LORA 2V6KA 1N2AA 3TOUA 4KAEA 4EXJA 5J41A 5B7CA 1ZYQB 2A4HA 6GSYA 1R7HA 2B7JA 2L4QA 4G2EA 2IPAA 2REMA 4Z2RA 2LJKA 4YAVA 3EWLA 1Z9HA 5DQYA 5IO2A 3IAM2 2R3XA 1XOBA 1SD9A 2ZNMA 1A8YA 2C0DA 3EU4A 2VCWA 3ME7A 4F9ZA 5F07A 4OWYA 1Z3EA 1GTUA 1KBNA 3D0ZA 4GLTA 1FB0A 3H1NA 1AW9A 1M9AA 2PU9C 4XCSA 1FVKA 1QQ2A 2HI7A 4BA7A 2NVLA 3UJ1A 3PINA 2VO4A 3CSJA 4HDEA 1WWJA 4TXOA 4WBJA 4TOPA 2HSMA 2GTUA 2GZYA 3PR8A 2DMMA 3A2WA 2E2MA 3F8UA 5HFIA 3Q6OA 3VURA 3HDCA 5D9XA 4MCUA 2VM2A 3DVXA 5KEJA 4GF0A 1GRXA 1O6JA 2B5EA 1W4VA 1ZCPA 3BD2A 1WOUA 1PD21 1VF2A 1OAZA 1WIKA 4MA9A 3IV4A 4V1Ag 3U6VA 1AIUA 2H72A 2LV3A 2P5QA 3GURA 4HJMA 3KZQA 4KCEA 4TXOB 1OVNA 1W89A 4MZBA 1K0DA 2YWNA 2X64A 4K5RA 5IIZA 2C80A 1OE7A 3O6TA 3J7Yk 2DKHA 3IBHA 2CT6A 1B8XA 2K8VA 2DIZA 3L9VA 4JEDA 4JU5A 5ENUA 4FYBA 1ZL9A 3M1GA 1PA3A 1PL2A 4IP1A 3E3EA 1AAZA 4MP4A 2RIIA 3WD6A 5KN2A 4IQAA 1SD8A 2OBKA 5FHIA 4OMVA 5ABRA 4J56E 5CRDA 1JLVA 3LW9A 5IMFA 1GSFA 5G5FA 4GRFA 2FWGA 1CQGA 5H5SA 1YZXA 1O81A 2B1KA 4G0LA 1GNEA 4HU9A 5D73A 3FR9A 1SU9A 4K7OA 3L4NA 5H5RA 2LNTA 2YN1A 1LU4A 4KDYA 3M3MA 2QGVA 3GX8A 4TR0A 2HRKA 1HQOA 4G19A 1HNBA 5J9CA 2C0GA 4ILFA 1XIYA 2MBTA 4MH2A 3Q18A 2HFDA 4F0CA 2JADA 2N5AA 3LXZA 4MZWA 4XS4A 2O8VB 4EC0A 1H75A 2IIYA 1TI1A 4KX4A 4GSNA 5GAND 2E0QA 1Z7PA 3NOFA 3H8QA 4K0NA 3G7IA 2IMEA 1T00A 3FK8A 4K7NA 3VI7A 1GLPA 2H19A 3N5OA 4TN8A 1ERTA 5HR0A 1A0FA 3ZZXA 5D9TA 4ICYA 3FKFA 3QOUA 1TP9A 1AQVA 2C8UA 3LYPA 2VL9A 5D96A 2V2GA 5C04A 2L6CA 4YAPA 4ISDA 3TGZA 4LL1B 4NXIA 1U3IA 3KTBA 12GSA 1MD3A 2VD0A 4F0BA 2H0HA 5CNWA 5B8BA 3HJPA 1TU8A 1AXDA 4G0IA 3HXSA 3ERGA 2GSQA 4XS4B 5B6MA 2XPDA 2H75A 4O5RA 5HR3A 3ZREA 1BEDA 1A8LA 3IPZA 1Z5YE 3FHKA 1UN2A 3CXGA 1T4YA 2XC2A 2AYTA 2M80A 3A5WA 4KE3A 2R6KA 2PVQA 3N9JA 1F6MC 3O3TA 1PKZA 2KUCA 3RBTA 2G0FA 2JSZA 2PVOC 4TR1B 5CP1A 5AGYA 1MDIA 1UC7A 3GFKA 4HQZA 2H6YA 5A4VA 4WF5A 1PGTA 1TW9A 1V40A 3VWXA 1PSQA 3UOMA 1GSSA 5LCZA 4DEJA 4QL7A 3UL3A 2RUEA 2YZUA 2DIYA 2ON7A 2HRAA 4PUAA 4ZBDA 3ZVJD 1G0TA 2PERA 2LQOA 4K0GA 4MF5A 4RQRA 5IM9A 2VLUA 1SJIA 2OE0A 1SKWB 3FEUA 1K0NA 2IFQA 3TOTA 1GUHA 5AIXA 4MK3A 4KSOA 1XWAA 4ZIJA 4N10A 4USSA 5D9WA 1R5PA 1X9WB 2DJ2A 4O32A 2CQ9A 4X1UA 3V1WA 2X8GA 2HZFA 4IQ1A 4KSMA 2P0GA 1TI3A 3WGEA 3IK7A 2R2JA 5ECPB 1FVJA 1QGVA 4AJ6A 2ON5A 2PN8A 3GTUA 4OFNA 3IR4A 3HZ4A 1SENA 2HZEA 1I5GA 2FWEA 4GSSA 2B1LA 4DSQA 4IHUA 3A2XA 3I69A 1FO5A 3E9JB 2DKIA 1F3AA 4X4JA 1FG4A 3C7MA 1MD4A 2QC7A 3GNJA 5HR1A 3BOAA 18GSA 1XVQA 2IFQB 1G6YA 2F8FA 3BJ5A 3KEBA 4MF7A 2AV4A 5DAKB 3F6FA 4OO4A 1R5AA 2R0GA 3WGXA 2QKEA 4HJ2A 3TDGA 1MTCA 2AB6A 2FD3A 2H74A 4ULXA 4MLYA 1TJDA 2K18A 1EP8A 3QR6A 1XBSA 2X8CA 4EL1A 1AUCA 1TK8B 8GSSA 4QL9A 5DJLA 3DGQA 1YDKA 1OYJA 2DJ3A 3KM6A 2I1UA 4LA1A 1BJXA 2FHEA 2VCQA 4JR6A 5D9VA 2GQLA 1R4WA 2V1MA 3L9SA 4IS0A 5IMAA 4V2MA 2XBIA 3DEXA 3IHQA 4YH2A 2GGTA 4POLA 4HS1A 4ZL7A 4HZ2A 1B9YC 2PBJA 1I9DA 3EMPA 4POMA 2OADA 2GLRA 4MJCA 3HJOA 3FR6A 4TVEA 3QAGA 9GSSA 4KA0A 4KDUA 1ST9A 3H4KA 2LRCA 3W8SA 3A2VA 1K3LA 2F9SA 5JWOB 3KGKA 4I2UA 5J3RA 1T8EB 5IMZA 1GH2A 5GSTA 3TJGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EV9 A;  4XS6 A;  2LS5 A;  4Q5R A;  4WET A;  2VCV A;  4MPG A;  4IW9 A;  2L6D A;  3CBU A;  4JE1 A;  3EIN A;  1SJ6 A;  4TRX A;  3VWW A;  3GH9 A;  3DML A;  3QMX A;  2E2G A;  3F63 A;  2B7K A;  4L8E A;  5C00 A;  1HNA A;  1DSB A;  1XW6 A;  3UVT A;  1ABA A;  1DE1 A;  2H66 A;  1GP1 A;  2H1G A;  4I6X A;  3LQ7 A;  3GH6 A;  1B9X C;  3IA1 A;  2E7P A;  3F3R A;  3CRU A;  3LWA A;  4JBB A;  3IC4 A;  4WF4 A;  4E8H A;  2B5Y A;  1WE0 A;  3ERW A;  3RPP A;  2P5R A;  2KOK A;  2WCI A;  1TU7 A;  5ECL B;  3JCM L;  1USB A;  4GTU A;  1M9B A;  1O8X A;  3UMA A;  4K7I A;  1QK8 A;  1U88 A;  4H86 A;  5JWR B;  4J57 E;  4IBP A;  4NWY A;  2O85 A;  4XTS A;  3VWV A;  3VLN A;  4ECI A;  3FY7 A;  3KMO A;  3O76 A;  4WBR D;  2LNS A;  4WKW A;  2CVD A;  1AQX A;  1U3A A;  1MDK A;  2C3T A;  4OD7 A;  4P3Y B;  5DCG A;  3M9K A;  5DCH A;  1V9W A;  5CAX A;  2OA7 A;  4K9Z A;  6GST A;  2WB9 A;  2VD1 A;  3TJB A;  3DVW A;  4MJB A;  1X0R A;  2Z9S A;  3HHV A;  3C73 A;  4KGI A;  3TKS A;  4MAB A;  3F0I A;  5CYY A;  3P8W A;  4MJA A;  1LBK A;  3HD5 A;  4V1A p;  3LGC A;  1OC9 A;  4WR5 A;  2H0I A;  2XHF A;  2VIM A;  2YJ7 A;  13GS A;  3KP8 A;  3L0H A;  3BBY A;  5INY A;  1J9B A;  1F37 A;  1K0M A;  4K1F A;  3TB2 A;  3HA9 A;  1J08 A;  2CAQ A;  5F06 A;  3SWL A;  3TKP A;  2MMN A;  5IMV A;  4WEY A;  2FUG 2;  1OKD A;  3TKS C;  3D4T A;  3VWU A;  4LMV A;  3S9F A;  1M2A A;  1YKA A;  4OFT A;  3VPQ A;  2N5F A;  5DQS A;  3PGT A;  5F8B A;  4KND A;  5CRW A;  3GKK A;  4MF6 A;  3APS A;  2L5L A;  2MMO A;  1K0A A;  2RM6 A;  2P31 A;  5ECN B;  3SBC A;  4ZL8 A;  1OC9 B;  4OCE A;  4I2T A;  2JU5 A;  2GSS A;  2X99 A;  2IMK A;  2EIR A;  3CRT A;  3M0F A;  3W6G A;  2FGX A;  2CVB A;  4D73 A;  2M72 A;  3APO A;  1OC3 A;  5KN3 A;  2FNO A;  7GSS A;  1FB6 A;  1QMV A;  5FWG A;  2H73 A;  5KN0 A;  4Q5Q A;  4GCI A;  3QCP A;  1YEP A;  2H6X A;  3IE3 A;  5G1K A;  4JRR A;  4OO5 A;  1SL0 B;  5ID2 A;  2H1D A;  1NM3 A;  3R2Q A;  1VGL A;  1SK1 A;  2HE3 A;  4EF0 A;  2AAW A;  3FZ9 A;  5G31 A;  5DVB A;  4WR4 A;  1DE2 A;  4BVY A;  3DWV A;  1SL1 B;  3EC3 A;  2JZS A;  1ZOF A;  2JSY A;  4IGJ A;  2VCZ A;  3I9V 2;  3ZL5 A;  2VL2 C;  2FWH A;  3TKR A;  4D73 B;  4ZXG A;  1S3D A;  3A3T A;  4TW5 A;  4ZL9 A;  1JZR A;  2L59 A;  3GUS A;  2WDU A;  4KDX A;  5IQY A;  1ML6 A;  4PQ1 A;  4EDZ A;  2PUK C;  2KHP A;  1TOF A;  5G5E A;  4PNF A;  5ID2 B;  1YY7 A;  2VLT A;  2BTO T;  1YEX A;  4KH7 A;  1C72 A;  4JZQ A;  4NPB A;  2ES7 A;  3BCK A;  1XWK A;  4ID0 A;  2I4A A;  1GSU A;  4RUV A;  3HKR A;  3K8N A;  3QD9 A;  4I8B A;  4EE0 A;  5GZZ B;  3VI5 A;  3MNG A;  1YF1 A;  1JZD A;  3HVS A;  3HCZ A;  5HFG A;  4CDO A;  3LEF A;  4PQI A;  2D2Z A;  4MH3 A;  4XIH A;  2VCX A;  4PUF C;  1NW2 A;  2GQK A;  1SJZ A;  2H1B A;  5HFK A;  3Q74 A;  3AY8 A;  2PGT A;  1EEJ A;  1PQN A;  3RAZ A;  1YQ1 A;  2OE1 A;  5DDL A;  1U6T A;  1JFU A;  4NV2 A;  1GTA A;  1V57 A;  5B6N A;  3MWH A;  1PMT A;  4ZB9 A;  3LG6 A;  1A24 A;  5EPF A;  3GN3 A;  5IPG A;  3IRA A;  5ECR B;  2NTO A;  1OC8 A;  1XXU A;  2KLX A;  1GSY A;  3ED3 A;  2LRT A;  3EUR A;  4YQM A;  2K8S A;  4E8E A;  4WXT A;  1EOG A;  3GIX A;  4ML6 A;  4Z7X A;  1ERW A;  1GSE A;  3TRQ A;  4PUR A;  4EUY A;  4KB3 A;  1XWG A;  5ECM B;  1WMJ A;  3C1S A;  1XVW A;  2DLX A;  4DSS A;  1O7U A;  5ECK B;  1JLW A;  5DBQ A;  4L5O A;  3KCM A;  2I3Y A;  1JZO A;  4LLR A;  2ZUP A;  2HXK A;  4O92 A;  2B6M A;  4EVM A;  2HRF A;  1BX9 A;  1WJK A;  2HYX A;  2VLV A;  2LEG A;  1ACV A;  1KEB A;  2YCD A;  2WGR A;  3QFB C;  2H1A A;  2LRN A;  4XS1 A;  3GV1 A;  2TIR A;  4YQU A;  3LFL A;  1G7O A;  1M99 A;  1GTB A;  2VL3 A;  4K2D A;  4PX1 A;  4CHS A;  2OE3 A;  2DJ0 A;  2IMI A;  2C1Y A;  4NAX A;  5F0G A;  3LYK A;  2IMF A;  4N0V A;  1FW1 A;  4N30 A;  1EOH A;  3CYN A;  4O7H A;  1V58 A;  1ZZY A;  5G1L A;  3C8E A;  1TRS A;  4DSS B;  4XHM A;  3UVH A;  2DJJ A;  4FO5 A;  3GRX A;  2X8H A;  4BL7 A;  2IMD A;  3FW2 A;  3KP9 A;  1G6W A;  1GLQ A;  3ZIJ A;  1PN9 A;  3DXB A;  1A2M A;  2YWI A;  3QPM A;  2IN3 A;  2GS3 A;  3FZ5 A;  5AIS A;  1XW5 A;  1SL2 B;  4BWQ A;  1M7T A;  1NHY A;  1WPI A;  2LUS A;  5ECH B;  2WUL A;  3CTG A;  1FAA A;  3F9U A;  1ZGN A;  4IVF A;  3ZFB A;  3GST A;  10GS A;  2VOC A;  3GTU B;  1KNG A;  5COH A;  1GNW A;  1XOA A;  1OKT A;  2MMZ A;  1GWC A;  2HZE B;  2JZR A;  3C71 A;  2ALB A;  1JZW A;  2ZCT A;  3VK9 A;  1Z6M A;  2XBQ A;  1K0C A;  1F2E A;  4LMW A;  4BVX A;  4PNG A;  1NSW A;  4N11 A;  1O73 A;  2FA4 A;  2EIQ A;  5ECO B;  2OBI A;  2TRX A;  4ZBA A;  3D6I A;  3C1R A;  4HZ4 A;  4RI6 A;  16GS A;  1A0R P;  3ZIT A;  2CV4 A;  6GSW A;  1THX A;  1FHE A;  4QQ7 A;  3I6A A;  3I43 A;  3HYP A;  4XRA A;  2CZ3 A;  5IOW A;  1V2A A;  3F6D A;  3VFI A;  2KP1 A;  3HY2 A;  5EVO A;  1AC1 A;  4L5L A;  3TKQ A;  1TXX A;  2YP6 A;  3LXT A;  1EZK A;  22GS A;  3TUE A;  5CRG A;  3LJR A;  4AJ7 A;  1EEM A;  2XPE A;  1XPV A;  3BCI A;  2YPM A;  1AQW A;  4V2L A;  4OCF A;  3TKS E;  2WS2 A;  4MPF A;  4LL4 B;  2HRN A;  1OE8 A;  2NPB A;  3G9B A;  3WYW A;  2DJK A;  3GYK A;  3P90 A;  4I5Q A;  3GX0 A;  2NBS A;  1RK4 A;  2VM1 A;  3ZYW A;  1HNC A;  1ZMA A;  1EP7 A;  3MAK A;  5AN1 A;  4F82 A;  1BG5 A;  2L4C A;  3ISO A;  4GST A;  2L57 A;  3VPT A;  4IJ3 A;  1NHO A;  3GL3 A;  4YQV A;  1E2Y A;  2OKA A;  3UBL A;  1M2D A;  1E6B A;  2VCT A;  4F2I A;  3W8J A;  1CQH A;  3TJK A;  3ERF A;  2B5X A;  1XFL A;  2H0G A;  3L9U A;  3RPN A;  5HQP A;  2N5B A;  3F4R A;  3RDW A;  2IWT A;  2CVK A;  3IDV A;  3WT2 A;  4MJE A;  3ZMK A;  1M0U A;  4NHZ A;  1WP0 A;  1X5C A;  4FIW A;  4HI7 A;  3QAW A;  3L78 A;  4GQF A;  1T7P B;  4N0Z A;  2IJY A;  1N8J A;  3D5J A;  3MDK A;  2HLS A;  2V41 A;  2LQQ A;  3UAP A;  3GSS A;  2RUF A;  1TDI A;  5IO0 A;  2OAC A;  4ML1 A;  2QSI A;  1S3C A;  3TRX A;  3HJM A;  4Q5N A;  3GL5 A;  1SYX A;  1Z7R A;  2F51 A;  2GSR A;  5ELA A;  1T1V A;  2JL4 A;  4NHW A;  4NMU A;  1DBY A;  2GT5 A;  2MYG A;  2F3M A;  3FRC A;  4TKY A;  2H71 A;  3M8N A;  1PKW A;  2B3S A;  5JCG A;  3F4S A;  1SKS B;  5GAP D;  3E0U A;  5CRE A;  3FR3 A;  3LSZ A;  3UIW A;  5JWQ B;  3APQ A;  2CZ2 A;  3IAS 2;  4HEA 2;  3CMI A;  1ERV A;  4OFM A;  5DAL A;  1A2J A;  3P7X A;  3KIJ A;  5F05 A;  4POK A;  4ECC A;  1MDJ A;  2O7K A;  3EE2 A;  3DRN A;  1PRX A;  4TXV A;  5LD0 A;  1LJR A;  3WT1 A;  2A2R A;  3G7J A;  2DML A;  3FYG A;  2FCH A;  2J23 A;  1HD2 A;  2YOI A;  5J5N A;  3MSZ A;  5FT3 A;  4KW6 A;  2V6O A;  1QFN A;  1X5E A;  3PH9 A;  2LST A;  1T4Z A;  3IXR A;  3F3Q A;  1T3B A;  2I81 A;  5B8A A;  3P2A A;  2JZT A;  2GT6 A;  1PX7 A;  5G2Z A;  1QUW A;  2DJ1 A;  4RQX A;  3ZLP A;  1GUM A;  3CTF A;  1YF0 A;  3QDN A;  5JCW A;  3IOS A;  1K3O A;  4PQH A;  1K0O A;  3EVI A;  3D21 A;  4ECJ A;  2C0E A;  3KH9 A;  1GTI A;  5DAL B;  2K6V A;  1V98 A;  2VAF A;  1J0F A;  1TK5 B;  3GKN A;  1RQM A;  2FWF A;  1TRW A;  3ZFL A;  2GDR A;  3GMF A;  5IPH A;  1GUK A;  2LKU A;  2VL2 A;  2DBC A;  1TK0 B;  1Y6E A;  2GZZ A;  3GKX A;  2LJA A;  5J4U A;  3KMN A;  1MEK A;  2V32 A;  2CX3 A;  4ZBB A;  2H6Z A;  6GSV A;  3GKM A;  5EY6 A;  1PL1 A;  2R4V A;  2O87 A;  3QFA C;  4FYU A;  1GL8 A;  2J9H A;  1PX6 A;  5LNK e;  3UBK A;  1BAY A;  3UAR A;  2YAN A;  6GSS A;  5ECS A;  1UVZ A;  3RHC A;  4ACS A;  2C3Q A;  1TTZ A;  2CX4 A;  3D4M A;  2EIO A;  4HQS A;  4X0X A;  5E4W A;  5AIV A;  1XWC A;  4DVC A;  2A2S A;  5KN1 A;  2HSY A;  3UEM A;  3KD0 A;  3QAV A;  1Z6N A;  3J7Y b;  1EGR A;  1YKC A;  1HYU A;  1XCC A;  1YJ6 A;  1B4P A;  3DKS A;  2JAC A;  5CRH A;  4HU7 A;  4ZB8 A;  4DSR A;  2L5O A;  4GXZ A;  1BYE A;  1VF1 A;  1BQ7 A;  4IJI A;  2G2Q A;  3DD3 A;  1EV4 A;  4EDY A;  2HNL A;  4CW9 A;  2WJU A;  4EKZ A;  3ZTL A;  2MBS A;  2DSA A;  4TR1 A;  4XRD A;  2GVP A;  2YJH A;  4ZIL A;  3H93 A;  1G7E A;  2CAI A;  5D8I A;  2RM5 A;  2C0F A;  3TJF A;  2NDO A;  4HOJ A;  2GST A;  4RI7 A;  1ILO A;  2EC4 A;  3DYR A;  1Q98 A;  1GSD A;  1O8W A;  2WRT A;  2HT9 A;  1SK2 A;  5J9B A;  2R37 A;  4HUA A;  1QXH A;  2DC5 A;  4GWR A;  2H76 A;  1EWX A;  4X43 A;  3TRP A;  3TCO A;  20GS A;  2O89 A;  3DIE A;  4TR4 A;  1JHB A;  5EL8 A;  3KTL A;  2RLI A;  1Y25 A;  1ZYE A;  4BWS A;  1F9M A;  3M9J A;  1GUL A;  1UA5 A;  1SYR A;  2MZC A;  3CSH A;  1VRS D;  4V2N A;  3ZVJ A;  3US3 A;  1A23 A;  5A5K A;  1K3Y A;  3G7Y A;  3FZA A;  1IYI A;  3CSI A;  3FZ4 A;  2LJR A;  2VUP A;  3RHB A;  5HR2 A;  2I9H A;  1EGO A;  3KJY A;  5DJM A;  1X9M B;  2AJQ B;  4AJ8 A;  3HZ8 A;  5A4W A;  1URM A;  5L71 A;  1R26 A;  2BMX A;  2K9F A;  2PWJ A;  5A4U A;  5IOX A;  5DAK A;  17GS A;  1SK0 A;  1THO A;  4L0W A;  4F03 A;  4ZB6 A;  3OR5 A;  4MZC A;  1B48 A;  3D22 A;  5CO3 A;  2F8A A;  2FLS A;  2IL3 A;  1X9S B;  3TJJ A;  3ME8 A;  1H4O A;  3EYT A;  1F3B A;  4L0U A;  1VF3 A;  1XWB A;  1S3A A;  5IMD A;  1ERU A;  2FA8 A;  2M46 A;  1A2L A;  4K6X A;  3NIV A;  3GHA A;  2YWO A;  4IKH A;  2YV9 A;  1O85 A;  2OJL A;  4EO3 A;  1X5D A;  5G30 A;  2A4V A;  4MDC A;  3H79 A;  4POB A;  11GS A;  4J2F A;  4TR3 A;  2PMT A;  5IMC A;  2BJX A;  4IP6 A;  5E59 A;  4PGT A;  5JCU A;  4IEL A;  2H8L A;  2AHE A;  4FH8 A;  1KTE A;  3ZIV A;  4MMM A;  3Q19 A;  1FOV A;  3F4T A;  3NZN A;  2YNX A;  1U87 A;  3U5R E;  1Q4J A;  2LTK A;  1TKD B;  4FYC A;  4KCA A;  1TRV A;  2YZH A;  5ECQ B;  4KUN A;  4I97 A;  4NV5 A;  5ELG A;  2CA8 A;  14GS A;  1M2B A;  5H5Q A;  4GQC A;  6GSU A;  4G10 A;  3EMX A;  6GSX A;  1GSQ A;  1B4Q A;  2YWM A;  3IK9 A;  3KXO A;  4ECB A;  2R5G A;  2GQM A;  2FY6 A;  3HVX A;  1IYH A;  2YV7 A;  4AGS A;  1WRY A;  4Q5F A;  1RW1 A;  2C4J A;  2H70 A;  5ECI B;  2C3N A;  2TRC P;  4PXO A;  2KP2 A;  4AF2 A;  19GS A;  2WZ9 A;  2GZP A;  2PPT A;  3EU3 A;  1ON4 A;  4IN0 A;  4JR4 A;  1XZO A;  1K0B A;  2MMA A;  1XW9 A;  3ZML A;  2AUV A;  3HVV A;  4BPY A;  2H01 A;  2HSH A;  3ZRD A;  5GSS A;  1SKR B;  4K8M A;  2H30 A;  1VF4 A;  3KH7 A;  5D93 A;  3GA4 A;  4G9H A;  2WFC A;  1TRU A;  3WGD A;  1DUG A;  3LOR A;  2V6K A;  1N2A A;  3TOU A;  4KAE A;  4EXJ A;  5J41 A;  5B7C A;  1ZYQ B;  6GSY A;  1R7H A;  2B7J A;  2L4Q A;  4G2E A;  2IPA A;  2REM A;  2LJK A;  4YAV A;  3EWL A;  1Z9H A;  5DQY A;  5IO2 A;  3IAM 2;  2R3X A;  1XOB A;  1SD9 A;  2ZNM A;  1A8Y A;  2C0D A;  3EU4 A;  2VCW A;  3ME7 A;  4F9Z A;  5F07 A;  4OWY A;  1Z3E A;  1GTU A;  1KBN A;  3D0Z A;  4GLT A;  1FB0 A;  3H1N A;  1AW9 A;  1M9A A;  2PU9 C;  4XCS A;  1FVK A;  1QQ2 A;  2HI7 A;  4BA7 A;  2NVL A;  3UJ1 A;  3PIN A;  2VO4 A;  3CSJ A;  4HDE A;  1WWJ A;  4TXO A;  4WBJ A;  4TOP A;  2GTU A;  2GZY A;  3PR8 A;  2DMM A;  3A2W A;  2E2M A;  3F8U A;  5HFI A;  3Q6O A;  3VUR A;  3HDC A;  5D9X A;  4MCU A;  2VM2 A;  3DVX A;  5KEJ A;  4GF0 A;  1GRX A;  1O6J A;  2B5E A;  1W4V A;  1ZCP A;  3BD2 A;  1WOU A;  1PD2 1;  1VF2 A;  1OAZ A;  1WIK A;  4MA9 A;  3IV4 A;  4V1A g;  3U6V A;  1AIU A;  2H72 A;  2LV3 A;  2P5Q A;  3GUR A;  4HJM A;  3KZQ A;  4KCE A;  4TXO B;  1OVN A;  1W89 A;  4MZB A;  1K0D A;  2YWN A;  2X64 A;  5IIZ A;  2C80 A;  1OE7 A;  3O6T A;  3J7Y k;  3IBH A;  2CT6 A;  1B8X A;  2K8V A;  2DIZ A;  3L9V A;  4JED A;  4JU5 A;  5ENU A;  4FYB A;  1ZL9 A;  3M1G A;  1PA3 A;  1PL2 A;  4IP1 A;  3E3E A;  1AAZ A;  4MP4 A;  2RII A;  3WD6 A;  5KN2 A;  4IQA A;  1SD8 A;  2OBK A;  5FHI A;  4OMV A;  5ABR A;  4J56 E;  5CRD A;  1JLV A;  5IMF A;  1GSF A;  5G5F A;  4GRF A;  2FWG A;  1CQG A;  5H5S A;  1YZX A;  1O81 A;  2B1K A;  1GNE A;  4HU9 A;  5D73 A;  3FR9 A;  1SU9 A;  4K7O A;  3L4N A;  5H5R A;  2LNT A;  2YN1 A;  1LU4 A;  4KDY A;  3M3M A;  2QGV A;  3GX8 A;  4TR0 A;  1HQO A;  4G19 A;  1HNB A;  5J9C A;  2C0G A;  4ILF A;  1XIY A;  2MBT A;  4MH2 A;  3Q18 A;  2HFD A;  4F0C A;  2JAD A;  2N5A A;  3LXZ A;  4MZW A;  4XS4 A;  2O8V B;  4EC0 A;  1H75 A;  2IIY A;  1TI1 A;  4KX4 A;  4GSN A;  5GAN D;  2E0Q A;  1Z7P A;  3NOF A;  3H8Q A;  4K0N A;  3G7I A;  2IME A;  1T00 A;  3FK8 A;  4K7N A;  3VI7 A;  1GLP A;  2H19 A;  3N5O A;  4TN8 A;  1ERT A;  5HR0 A;  1A0F A;  3ZZX A;  5D9T A;  3FKF A;  3QOU A;  1TP9 A;  1AQV A;  2C8U A;  3LYP A;  2VL9 A;  5D96 A;  2V2G A;  5C04 A;  2L6C A;  4YAP A;  4ISD A;  3TGZ A;  4LL1 B;  4NXI A;  1U3I A;  3KTB A;  12GS A;  1MD3 A;  2VD0 A;  4F0B A;  2H0H A;  5CNW A;  5B8B A;  3HJP A;  1TU8 A;  1AXD A;  3HXS A;  3ERG A;  2GSQ A;  4XS4 B;  5B6M A;  2XPD A;  2H75 A;  4O5R A;  5HR3 A;  3ZRE A;  1BED A;  1A8L A;  3IPZ A;  1Z5Y E;  3FHK A;  1UN2 A;  3CXG A;  1T4Y A;  2XC2 A;  2AYT A;  2M80 A;  3A5W A;  4KE3 A;  2R6K A;  2PVQ A;  3N9J A;  1F6M C;  3O3T A;  1PKZ A;  2KUC A;  3RBT A;  2G0F A;  2JSZ A;  2PVO C;  4TR1 B;  5CP1 A;  5AGY A;  1MDI A;  1UC7 A;  3GFK A;  4HQZ A;  2H6Y A;  5A4V A;  4WF5 A;  1PGT A;  1TW9 A;  1V40 A;  3VWX A;  1PSQ A;  3UOM A;  1GSS A;  5LCZ A;  4DEJ A;  4QL7 A;  3UL3 A;  2RUE A;  2YZU A;  2DIY A;  2ON7 A;  4PUA A;  4ZBD A;  3ZVJ D;  1G0T A;  2PER A;  2LQO A;  4K0G A;  4MF5 A;  4RQR A;  5IM9 A;  2VLU A;  1SJI A;  2OE0 A;  1SKW B;  3FEU A;  1K0N A;  2IFQ A;  3TOT A;  1GUH A;  5AIX A;  4MK3 A;  4KSO A;  1XWA A;  4ZIJ A;  4N10 A;  5D9W A;  1R5P A;  1X9W B;  2DJ2 A;  4O32 A;  2CQ9 A;  4X1U A;  3V1W A;  2X8G A;  2HZF A;  4IQ1 A;  4KSM A;  2P0G A;  1TI3 A;  3WGE A;  3IK7 A;  2R2J A;  5ECP B;  1FVJ A;  1QGV A;  4AJ6 A;  2ON5 A;  2PN8 A;  3GTU A;  4OFN A;  3IR4 A;  3HZ4 A;  1SEN A;  2HZE A;  1I5G A;  2FWE A;  4GSS A;  2B1L A;  4DSQ A;  4IHU A;  3A2X A;  3I69 A;  1FO5 A;  3E9J B;  1F3A A;  1FG4 A;  3C7M A;  1MD4 A;  2QC7 A;  3GNJ A;  5HR1 A;  3BOA A;  18GS A;  1XVQ A;  2IFQ B;  1G6Y A;  2F8F A;  3BJ5 A;  3KEB A;  4MF7 A;  2AV4 A;  5DAK B;  3F6F A;  4OO4 A;  1R5A A;  3WGX A;  2QKE A;  4HJ2 A;  3TDG A;  1MTC A;  2AB6 A;  2FD3 A;  2H74 A;  4ULX A;  4MLY A;  1TJD A;  2K18 A;  1EP8 A;  3QR6 A;  1XBS A;  2X8C A;  4EL1 A;  1AUC A;  1TK8 B;  8GSS A;  4QL9 A;  5DJL A;  3DGQ A;  1YDK A;  1OYJ A;  2DJ3 A;  3KM6 A;  2I1U A;  4LA1 A;  1BJX A;  2FHE A;  2VCQ A;  4JR6 A;  5D9V A;  2GQL A;  1R4W A;  2V1M A;  3L9S A;  4IS0 A;  5IMA A;  4V2M A;  2XBI A;  3DEX A;  3IHQ A;  4YH2 A;  2GGT A;  4POL A;  4HS1 A;  4ZL7 A;  4HZ2 A;  1B9Y C;  2PBJ A;  1I9D A;  3EMP A;  4POM A;  2OAD A;  2GLR A;  4MJC A;  3HJO A;  3FR6 A;  4TVE A;  3QAG A;  9GSS A;  4KA0 A;  4KDU A;  1ST9 A;  3H4K A;  2LRC A;  3W8S A;  3A2V A;  1K3L A;  2F9S A;  5JWO B;  3KGK A;  4I2U A;  5J3R A;  1T8E B;  5IMZ A;  1GH2 A;  5GST A;  3TJG A; 
#chains in the Genus database with same CATH topology
 1EV9 A;  1XG8 A;  4XS6 A;  2LS5 A;  4Q5R A;  4WET A;  2VCV A;  4MPG A;  4IW9 A;  2L6D A;  3CBU A;  4JE1 A;  3EIN A;  1SJ6 A;  4A5P A;  4TRX A;  3VWW A;  3GH9 A;  3DML A;  3QMX A;  2E2G A;  3F63 A;  2B7K A;  4L8E A;  5C00 A;  1HNA A;  1DSB A;  1XW6 A;  3UVT A;  2A2P A;  1ABA A;  1DE1 A;  2H66 A;  1GP1 A;  2H1G A;  4I6X A;  3LQ7 A;  3GH6 A;  1B9X C;  3IA1 A;  2E7P A;  3F3R A;  3CRU A;  3LWA A;  4JBB A;  3IC4 A;  4WF4 A;  4E8H A;  4CY6 A;  2B5Y A;  1WE0 A;  3ERW A;  3RPP A;  2P5R A;  5KOW A;  2KOK A;  2WCI A;  1TU7 A;  5ECL B;  3JCM L;  1USB A;  4GTU A;  1M9B A;  1O8X A;  5BMU A;  3UMA A;  4K7I A;  1QK8 A;  1U88 A;  4H86 A;  5JWR B;  4J57 E;  4IBP A;  4NWY A;  2O85 A;  4XTS A;  3VWV A;  3VLN A;  4ECI A;  3FY7 A;  3KMO A;  3O76 A;  4WBR D;  2LNS A;  4WKW A;  2CVD A;  1AQX A;  1U3A A;  1MDK A;  2C3T A;  4OD7 A;  4P3Y B;  5DCG A;  3M9K A;  5DCH A;  1V9W A;  5CAX A;  2OA7 A;  4K9Z A;  6GST A;  2WB9 A;  2VD1 A;  2X4A A;  3TJB A;  3DVW A;  4MJB A;  1X0R A;  2Z9S A;  3HHV A;  3C73 A;  4KGI A;  3TKS A;  4MAB A;  3F0I A;  5CYY A;  3P8W A;  4MJA A;  1LBK A;  3HD5 A;  4V1A p;  3LGC A;  4BIK A;  1OC9 A;  4WR5 A;  2H0I A;  2XHF A;  2VIM A;  2YJ7 A;  13GS A;  3KP8 A;  3L0H A;  3BBY A;  5INY A;  1J9B A;  1F37 A;  1K0M A;  4K1F A;  3TB2 A;  3HA9 A;  1J08 A;  2CAQ A;  5F06 A;  3SWL A;  3TKP A;  2MMN A;  5IMV A;  4WEY A;  2FUG 2;  1OKD A;  3TKS C;  3D4T A;  4PTS A;  3VWU A;  4LMV A;  3S9F A;  1M2A A;  1YKA A;  4OFT A;  3VPQ A;  2N5F A;  5DQS A;  3PGT A;  5F8B A;  4KND A;  5CRW A;  3FMW A;  3GKK A;  4MF6 A;  3APS A;  2L5L A;  2MMO A;  1K0A A;  2RM6 A;  2P31 A;  5ECN B;  3SBC A;  4ZL8 A;  1OC9 B;  4OCE A;  4I2T A;  2JU5 A;  2GSS A;  2X99 A;  2IMK A;  2EIR A;  3CRT A;  3M0F A;  3W6G A;  2FGX A;  2CVB A;  4D73 A;  2M72 A;  3APO A;  1OC3 A;  5KN3 A;  2FNO A;  7GSS A;  1FB6 A;  1QMV A;  5FWG A;  2H73 A;  5KN0 A;  4Q5Q A;  4YKF A;  4GCI A;  3QCP A;  1YEP A;  2R0P A;  2H6X A;  3IE3 A;  5G1K A;  4JRR A;  4OO5 A;  1SL0 B;  5ID2 A;  2H1D A;  1NM3 A;  3R2Q A;  1VGL A;  1SK1 A;  2HE3 A;  4EF0 A;  2AAW A;  3FZ9 A;  5G31 A;  5DVB A;  4WR4 A;  1DE2 A;  4BVY A;  3DWV A;  1SL1 B;  3EC3 A;  2JZS A;  1ZOF A;  2JSY A;  4IGJ A;  2VCZ A;  3I9V 2;  3ZL5 A;  2VL2 C;  2FWH A;  3TKR A;  4D73 B;  4ZXG A;  1S3D A;  3A3T A;  4TW5 A;  4ZL9 A;  1JZR A;  2L59 A;  3GUS A;  2WDU A;  4KDX A;  5IQY A;  1ML6 A;  4PQ1 A;  4EDZ A;  2PUK C;  2KHP A;  1TOF A;  5G5E A;  4PNF A;  5ID2 B;  1YY7 A;  2VLT A;  2BTO T;  1YEX A;  4KH7 A;  1C72 A;  4JZQ A;  4NPB A;  2ES7 A;  3BCK A;  1XWK A;  4BVY B;  4ID0 A;  2I4A A;  1GSU A;  4RUV A;  3HKR A;  3K8N A;  3QD9 A;  4I8B A;  4O5Q A;  4EE0 A;  5GZZ B;  3VI5 A;  4MNN A;  3MNG A;  1YF1 A;  1JZD A;  3HVS A;  3HCZ A;  5HFG A;  4CDO A;  3LEF A;  4PQI A;  2D2Z A;  4MH3 A;  4XIH A;  2VCX A;  4PUF C;  1NW2 A;  3A5I A;  2GQK A;  1SJZ A;  2H1B A;  5HFK A;  3Q74 A;  3AY8 A;  2PGT A;  1EEJ A;  1PQN A;  3RAZ A;  1YQ1 A;  2OE1 A;  5DDL A;  1U6T A;  1JFU A;  4NV2 A;  4Z2T A;  1GTA A;  1V57 A;  5B6N A;  3MWH A;  1PMT A;  4ZB9 A;  3LG6 A;  1A24 A;  5EPF A;  3GN3 A;  5IPG A;  3IRA A;  5ECR B;  2NTO A;  1ZYN A;  1OC8 A;  1XXU A;  2KLX A;  1GSY A;  3ED3 A;  2LRT A;  3EUR A;  4YQM A;  2K8S A;  4E8E A;  4WXT A;  1EOG A;  3GIX A;  4ML6 A;  4Z7X A;  1ERW A;  1GSE A;  3TRQ A;  4PUR A;  4EUY A;  4KB3 A;  1XWG A;  3R3E A;  1WMJ A;  3C1S A;  5ECM B;  1XVW A;  2DLX A;  4DSS A;  1O7U A;  5ECK B;  1JLW A;  5DBQ A;  4L5O A;  3KCM A;  2I3Y A;  1JZO A;  4LLR A;  2ZUP A;  2HXK A;  4O92 A;  2B6M A;  4EVM A;  2HRF A;  1BX9 A;  1WJK A;  2HYX A;  2VLV A;  2LEG A;  1ACV A;  1KEB A;  2YCD A;  2WGR A;  3QFB C;  2H1A A;  2LRN A;  4XS1 A;  3GV1 A;  2TIR A;  4YQU A;  3LFL A;  1G7O A;  1M99 A;  1GTB A;  2VL3 A;  4K2D A;  4PX1 A;  4CHS A;  2OE3 A;  2DJ0 A;  2IMI A;  2C1Y A;  4NAX A;  5F0G A;  3LYK A;  2IMF A;  4N0V A;  1FW1 A;  4KF9 A;  4N30 A;  1EOH A;  3CYN A;  4O7H A;  1V58 A;  1ZZY A;  5G1L A;  3C8E A;  1TRS A;  4DSS B;  3IC8 A;  4XHM A;  3UVH A;  2DJJ A;  4FO5 A;  3GRX A;  2X8H A;  4BL7 A;  2IMD A;  3FW2 A;  3KP9 A;  1G6W A;  1GLQ A;  3ZIJ A;  1PN9 A;  3DXB A;  1A2M A;  2YWI A;  3QPM A;  2IN3 A;  2GS3 A;  3FZ5 A;  5AIS A;  1XW5 A;  1SL2 B;  4BWQ A;  1M7T A;  1NHY A;  1WPI A;  2LUS A;  5ECH B;  2WUL A;  3CTG A;  1FAA A;  3F9U A;  3MIX A;  1ZGN A;  4IVF A;  3ZFB A;  3GST A;  10GS A;  1M3I A;  2VOC A;  3GTU B;  1KNG A;  5COH A;  1GNW A;  1XOA A;  1OKT A;  2MMZ A;  1GWC A;  2HZE B;  2JZR A;  3C71 A;  2ALB A;  1JZW A;  2ZCT A;  3VK9 A;  1Z6M A;  2XBQ A;  1K0C A;  1F2E A;  4LMW A;  4BVX A;  4PNG A;  1NSW A;  4N11 A;  1O73 A;  2FA4 A;  2EIQ A;  5ECO B;  2OBI A;  2TRX A;  4ZBA A;  3D6I A;  3C1R A;  5KOX A;  4HZ4 A;  4RI6 A;  16GS A;  1A0R P;  3ZIT A;  2CV4 A;  6GSW A;  1THX A;  1FHE A;  4QQ7 A;  3I6A A;  3I43 A;  3HYP A;  4XRA A;  2CZ3 A;  5IOW A;  1V2A A;  3F6D A;  3VFI A;  2KP1 A;  3HY2 A;  5EVO A;  1AC1 A;  4EIP A;  4L5L A;  3TKQ A;  1TXX A;  2YP6 A;  3LXT A;  1EZK A;  22GS A;  3TUE A;  4BVX B;  5CRG A;  3LJR A;  4AJ7 A;  1EEM A;  2XPE A;  1XPV A;  3BCI A;  2YPM A;  1AQW A;  4V2L A;  4OCF A;  3TKS E;  2WS2 A;  4MPF A;  4LL4 B;  2HRN A;  1OE8 A;  2NPB A;  3G9B A;  3WYW A;  2DJK A;  3GYK A;  3P90 A;  4I5Q A;  3GX0 A;  2NBS A;  1RK4 A;  2VM1 A;  3ZYW A;  1HNC A;  1ZMA A;  1EP7 A;  3MAK A;  5AN1 A;  4F82 A;  1BG5 A;  2L4C A;  3ISO A;  4GST A;  2L57 A;  3VPT A;  4IJ3 A;  1NHO A;  3GL3 A;  4YQV A;  1E2Y A;  2OKA A;  3UBL A;  1M2D A;  1E6B A;  2VCT A;  4F2I A;  3W8J A;  1CQH A;  3TJK A;  3ERF A;  2B5X A;  1XFL A;  2H0G A;  3L9U A;  3RPN A;  5HQP A;  2N5B A;  3F4R A;  3RDW A;  2IWT A;  2CVK A;  3IDV A;  3WT2 A;  4MJE A;  3ZMK A;  1M0U A;  4NHZ A;  1WP0 A;  1X5C A;  2R0C A;  4FIW A;  4HI7 A;  3QAW A;  3L78 A;  4GQF A;  1T7P B;  4N0Z A;  2IJY A;  1N8J A;  3D5J A;  3MDK A;  2HLS A;  2V41 A;  2LQQ A;  3UAP A;  3GSS A;  2RUF A;  1TDI A;  5IO0 A;  2OAC A;  4ML1 A;  2QSI A;  1S3C A;  3TRX A;  3HJM A;  4Q5N A;  3GL5 A;  1SYX A;  2X49 A;  1Z7R A;  2F51 A;  2GSR A;  5ELA A;  1T1V A;  2JL4 A;  4NHW A;  4NMU A;  1DBY A;  4YKG A;  2GT5 A;  2MYG A;  2F3M A;  3FRC A;  4TKY A;  2H71 A;  3M8N A;  1PKW A;  2B3S A;  5JCG A;  3F4S A;  1SKS B;  5GAP D;  3E0U A;  5CRE A;  3FR3 A;  3LSZ A;  4K2X A;  3UIW A;  5JWQ B;  3APQ A;  2CZ2 A;  3IAS 2;  4HEA 2;  3CMI A;  1ERV A;  4OFM A;  5DAL A;  1A2J A;  3P7X A;  1M3J A;  3KIJ A;  5F05 A;  4POK A;  4ECC A;  1MDJ A;  2O7K A;  3EE2 A;  3DRN A;  1PRX A;  4TXV A;  5LD0 A;  1LJR A;  3WT1 A;  2A2R A;  3G7J A;  2DML A;  3FYG A;  2FCH A;  2J23 A;  1HD2 A;  2YOI A;  5J5N A;  3MSZ A;  5FT3 A;  4KW6 A;  2V6O A;  1QFN A;  1X5E A;  3PH9 A;  2LST A;  1T4Z A;  3IXR A;  3F3Q A;  1T3B A;  2I81 A;  4Z2U A;  5B8A A;  3P2A A;  2JZT A;  2GT6 A;  1PX7 A;  5G2Z A;  1QUW A;  2DJ1 A;  4RQX A;  3ZLP A;  1GUM A;  3CTF A;  3PPU A;  1YF0 A;  3QDN A;  5JCW A;  4FQU A;  3IOS A;  1K3O A;  4PQH A;  1K0O A;  3EVI A;  3D21 A;  4ECJ A;  2C0E A;  3KH9 A;  1GTI A;  5DAL B;  2K6V A;  1V98 A;  2VAF A;  1J0F A;  1TK5 B;  3GKN A;  1RQM A;  2FWF A;  1TRW A;  3ZFL A;  2GDR A;  3GMF A;  4G0K A;  5IPH A;  1GUK A;  2LKU A;  2VL2 A;  2DBC A;  1TK0 B;  1Y6E A;  2GZZ A;  3GKX A;  2LJA A;  5J4U A;  3KMN A;  1MEK A;  2V32 A;  2CX3 A;  4ZBB A;  2H6Z A;  6GSV A;  3GKM A;  5EY6 A;  1PL1 A;  2R4V A;  2O87 A;  3QFA C;  4FYU A;  1GL8 A;  2J9H A;  1PX6 A;  5LNK e;  3UBK A;  1BAY A;  3UAR A;  2YAN A;  6GSS A;  5ECS A;  1UVZ A;  3RHC A;  4ACS A;  2C3Q A;  1TTZ A;  2CX4 A;  3D4M A;  2EIO A;  4HQS A;  2QA2 A;  4X0X A;  5E4W A;  5AIV A;  1XWC A;  4DVC A;  2A2S A;  5KN1 A;  2HSY A;  3UEM A;  3KD0 A;  3QAV A;  1Z6N A;  3J7Y b;  1EGR A;  1YKC A;  1HYU A;  1XCC A;  1YJ6 A;  1B4P A;  3DKS A;  2JAC A;  5CRH A;  4HU7 A;  4ZB8 A;  4DSR A;  2L5O A;  4GXZ A;  1BYE A;  1VF1 A;  5BRT A;  1BQ7 A;  4IJI A;  2G2Q A;  3DD3 A;  1EV4 A;  4EDY A;  2HNL A;  4CW9 A;  1ZYP A;  2WJU A;  4EKZ A;  3ZTL A;  2MBS A;  2DSA A;  4TR1 A;  4XRD A;  2GVP A;  2YJH A;  4ZIL A;  3H93 A;  1G7E A;  2CAI A;  5D8I A;  2RM5 A;  2C0F A;  3TJF A;  2NDO A;  4HOJ A;  2GST A;  4RI7 A;  1ILO A;  2EC4 A;  3DYR A;  1Q98 A;  1GSD A;  1O8W A;  2WRT A;  2HT9 A;  1SK2 A;  5J9B A;  2R37 A;  4HUA A;  1QXH A;  2DC5 A;  4GWR A;  2H76 A;  1EWX A;  4X43 A;  3TRP A;  3TCO A;  20GS A;  2O89 A;  3DIE A;  4TR4 A;  1JHB A;  5EL8 A;  3KTL A;  2RLI A;  1Y25 A;  1ZYE A;  2QA1 A;  4BWS A;  1F9M A;  3M9J A;  1GUL A;  1UA5 A;  1SYR A;  2MZC A;  3CSH A;  1VRS D;  4V2N A;  3ZVJ A;  3US3 A;  1A23 A;  5A5K A;  1K3Y A;  3G7Y A;  3FZA A;  1IYI A;  3CSI A;  3FZ4 A;  2LJR A;  2VUP A;  3RHB A;  5HR2 A;  2I9H A;  1EGO A;  4K5S A;  3KJY A;  5DJM A;  1X9M B;  2AJQ B;  2UZ8 A;  1FOH A;  4AJ8 A;  3HZ8 A;  5A4W A;  1URM A;  5L71 A;  1R26 A;  2BMX A;  2K9F A;  2PWJ A;  5A4U A;  5IOX A;  5DAK A;  17GS A;  1SK0 A;  1THO A;  4L0W A;  4F03 A;  4ZB6 A;  3OR5 A;  4MZC A;  1B48 A;  3D22 A;  5CO3 A;  2F8A A;  2FLS A;  2IL3 A;  1X9S B;  3TJJ A;  3ME8 A;  1H4O A;  3EYT A;  1F3B A;  4L0U A;  1VF3 A;  1XWB A;  1S3A A;  5IMD A;  1ERU A;  2FA8 A;  2M46 A;  3IHG A;  1A2L A;  4K6X A;  3NIV A;  3GHA A;  2YWO A;  4IKH A;  2YV9 A;  1O85 A;  2OJL A;  4EO3 A;  1X5D A;  5G30 A;  2A4V A;  4MDC A;  1PFO A;  3H79 A;  4POB A;  11GS A;  4J2F A;  4TR3 A;  2PMT A;  1PN0 A;  5IMC A;  2BJX A;  4IP6 A;  4O5U A;  5E59 A;  4PGT A;  5JCU A;  4IEL A;  4BL7 B;  2H8L A;  2AHE A;  4FH8 A;  1KTE A;  3ZIV A;  4MMM A;  3Q19 A;  1FOV A;  3F4T A;  3NZN A;  2YNX A;  1U87 A;  3U5R E;  1Q4J A;  2LTK A;  1TKD B;  4FYC A;  4KCA A;  4CY8 A;  1TRV A;  2YZH A;  5ECQ B;  4KUN A;  4I97 A;  4NV5 A;  5ELG A;  2CA8 A;  14GS A;  1M2B A;  5H5Q A;  4GQC A;  6GSU A;  4G10 A;  3EMX A;  6GSX A;  1GSQ A;  1B4Q A;  2YWM A;  3IK9 A;  3KXO A;  4ECB A;  2R5G A;  2GQM A;  2FY6 A;  3HVX A;  1IYH A;  2YV7 A;  4AGS A;  1WRY A;  4Q5F A;  1RW1 A;  2C4J A;  2H70 A;  5ECI B;  2C3N A;  2TRC P;  4PXO A;  2KP2 A;  4AF2 A;  19GS A;  2WZ9 A;  2GZP A;  2PPT A;  3EU3 A;  1ON4 A;  4IN0 A;  3MYD A;  4JR4 A;  1K0B A;  1XZO A;  2MMA A;  1XW9 A;  3ZML A;  3EPT A;  2AUV A;  3HVV A;  4BPY A;  2H01 A;  2HSH A;  3ZRD A;  5GSS A;  4EIQ A;  4K8M A;  1SKR B;  2H30 A;  1VF4 A;  3KH7 A;  5D93 A;  3GA4 A;  4G9H A;  2WFC A;  1TRU A;  3WGD A;  1DUG A;  3LOR A;  2V6K A;  1N2A A;  3TOU A;  4KAE A;  4EXJ A;  5J41 A;  5B7C A;  1ZYQ B;  2A4H A;  6GSY A;  1R7H A;  2B7J A;  2L4Q A;  4G2E A;  2IPA A;  2REM A;  4Z2R A;  2LJK A;  4YAV A;  3EWL A;  1Z9H A;  5DQY A;  5IO2 A;  3IAM 2;  2R3X A;  1XOB A;  1SD9 A;  2ZNM A;  1A8Y A;  2C0D A;  3EU4 A;  2VCW A;  3ME7 A;  4F9Z A;  5F07 A;  4OWY A;  1Z3E A;  1GTU A;  1KBN A;  3D0Z A;  4GLT A;  1FB0 A;  3H1N A;  1AW9 A;  1M9A A;  2PU9 C;  4XCS A;  1FVK A;  1QQ2 A;  2HI7 A;  4BA7 A;  2NVL A;  3UJ1 A;  3PIN A;  2VO4 A;  3CSJ A;  4HDE A;  1WWJ A;  4TXO A;  4WBJ A;  4TOP A;  2HSM A;  2GTU A;  2GZY A;  3PR8 A;  2DMM A;  3A2W A;  2E2M A;  3F8U A;  5HFI A;  3Q6O A;  3VUR A;  3HDC A;  5D9X A;  4MCU A;  2VM2 A;  3DVX A;  5KEJ A;  4GF0 A;  1GRX A;  1O6J A;  2B5E A;  1W4V A;  1ZCP A;  3BD2 A;  1WOU A;  1PD2 1;  1VF2 A;  1OAZ A;  1WIK A;  4MA9 A;  3IV4 A;  4HSC X;  4V1A g;  3U6V A;  1AIU A;  2H72 A;  2LV3 A;  2P5Q A;  3GUR A;  4HJM A;  3KZQ A;  4KCE A;  4TXO B;  1OVN A;  1W89 A;  4MZB A;  1K0D A;  2YWN A;  2X64 A;  4K5R A;  5IIZ A;  2C80 A;  1OE7 A;  3O6T A;  3J7Y k;  2DKH A;  3IBH A;  2CT6 A;  1B8X A;  2K8V A;  2DIZ A;  3L9V A;  4JED A;  4JU5 A;  5ENU A;  4FYB A;  1ZL9 A;  3M1G A;  1PA3 A;  1PL2 A;  4IP1 A;  3E3E A;  1AAZ A;  4MP4 A;  2RII A;  3WD6 A;  5KN2 A;  4IQA A;  1SD8 A;  2OBK A;  5FHI A;  4OMV A;  5ABR A;  4J56 E;  5CRD A;  1JLV A;  3LW9 A;  5IMF A;  1GSF A;  5G5F A;  4GRF A;  2FWG A;  1CQG A;  5H5S A;  1YZX A;  1O81 A;  2B1K A;  4G0L A;  1GNE A;  4HU9 A;  5D73 A;  3FR9 A;  1SU9 A;  4K7O A;  3L4N A;  5H5R A;  2LNT A;  2YN1 A;  1LU4 A;  3HVN A;  4KDY A;  3M3M A;  3CQF A;  2QGV A;  3GX8 A;  4TR0 A;  2HRK A;  1HQO A;  4G19 A;  1HNB A;  5J9C A;  2C0G A;  4ILF A;  1XIY A;  2MBT A;  4MH2 A;  3Q18 A;  2HFD A;  4F0C A;  2JAD A;  2N5A A;  3LXZ A;  4MZW A;  4XS4 A;  2O8V B;  4EC0 A;  1H75 A;  2IIY A;  1TI1 A;  4KX4 A;  4GSN A;  5GAN D;  2E0Q A;  1Z7P A;  3NOF A;  3H8Q A;  4K0N A;  3G7I A;  2IME A;  1T00 A;  3FK8 A;  4K7N A;  3VI7 A;  1GLP A;  2H19 A;  3N5O A;  4TN8 A;  1ERT A;  5HR0 A;  1A0F A;  3ZZX A;  5D9T A;  4ICY A;  3FKF A;  3QOU A;  1TP9 A;  1AQV A;  2C8U A;  3LYP A;  2VL9 A;  5D96 A;  2V2G A;  5C04 A;  2L6C A;  4YAP A;  4ISD A;  3TGZ A;  4LL1 B;  4NXI A;  1U3I A;  3KTB A;  12GS A;  1MD3 A;  2VD0 A;  4F0B A;  2H0H A;  5CNW A;  5B8B A;  3HJP A;  1TU8 A;  1AXD A;  4G0I A;  3HXS A;  3ERG A;  2GSQ A;  4XS4 B;  5B6M A;  2XPD A;  2H75 A;  4O5R A;  5HR3 A;  3ZRE A;  1BED A;  1A8L A;  3IPZ A;  1Z5Y E;  3FHK A;  1UN2 A;  3CXG A;  1T4Y A;  2XC2 A;  2AYT A;  2M80 A;  3A5W A;  4KE3 A;  2R6K A;  2PVQ A;  3N9J A;  1F6M C;  3O3T A;  1PKZ A;  2KUC A;  3RBT A;  2G0F A;  2JSZ A;  2PVO C;  4TR1 B;  5CP1 A;  5AGY A;  1MDI A;  1UC7 A;  3GFK A;  4HQZ A;  2H6Y A;  5A4V A;  4WF5 A;  1PGT A;  1TW9 A;  1V40 A;  3VWX A;  1PSQ A;  3UOM A;  1GSS A;  5LCZ A;  4DEJ A;  4QL7 A;  3UL3 A;  2RUE A;  2YZU A;  2DIY A;  2ON7 A;  2HRA A;  4PUA A;  4ZBD A;  3ZVJ D;  1G0T A;  2PER A;  2LQO A;  4K0G A;  4MF5 A;  4RQR A;  5IM9 A;  2VLU A;  1SJI A;  2OE0 A;  1SKW B;  3FEU A;  1K0N A;  2IFQ A;  3TOT A;  1GUH A;  5AIX A;  4MK3 A;  4KSO A;  1XWA A;  4ZIJ A;  4N10 A;  4USS A;  5D9W A;  1R5P A;  1X9W B;  2DJ2 A;  4O32 A;  2CQ9 A;  4X1U A;  3V1W A;  2X8G A;  2HZF A;  4IQ1 A;  4KSM A;  2P0G A;  1TI3 A;  3WGE A;  3IK7 A;  2R2J A;  5ECP B;  1FVJ A;  1S3R A;  1QGV A;  4AJ6 A;  2ON5 A;  2PN8 A;  3GTU A;  4OFN A;  3IR4 A;  3HZ4 A;  1SEN A;  2HZE A;  1I5G A;  2FWE A;  4GSS A;  2B1L A;  4DSQ A;  4IHU A;  3A2X A;  3I69 A;  1FO5 A;  3E9J B;  2DKI A;  1F3A A;  4X4J A;  1FG4 A;  3C7M A;  1MD4 A;  2QC7 A;  3GNJ A;  5HR1 A;  3BOA A;  18GS A;  1XVQ A;  2IFQ B;  1G6Y A;  2F8F A;  3BJ5 A;  3KEB A;  4MF7 A;  2AV4 A;  5DAK B;  3F6F A;  4OO4 A;  1R5A A;  2R0G A;  3WGX A;  2QKE A;  4HJ2 A;  3TDG A;  1MTC A;  2AB6 A;  2FD3 A;  2H74 A;  4ULX A;  4MLY A;  1TJD A;  2K18 A;  1EP8 A;  3QR6 A;  1XBS A;  2X8C A;  4EL1 A;  1AUC A;  1TK8 B;  8GSS A;  4QL9 A;  5DJL A;  3DGQ A;  1YDK A;  1OYJ A;  2DJ3 A;  3KM6 A;  2I1U A;  4LA1 A;  1BJX A;  2FHE A;  2VCQ A;  4JR6 A;  5D9V A;  2GQL A;  1R4W A;  2V1M A;  3L9S A;  4IS0 A;  5IMA A;  4V2M A;  2XBI A;  3DEX A;  3IHQ A;  4YH2 A;  2GGT A;  4POL A;  4HS1 A;  4ZL7 A;  4HZ2 A;  1B9Y C;  2PBJ A;  1I9D A;  3EMP A;  4POM A;  2OAD A;  2GLR A;  4MJC A;  3HJO A;  3FR6 A;  4TVE A;  3QAG A;  9GSS A;  4KA0 A;  4KDU A;  1ST9 A;  3H4K A;  2LRC A;  3W8S A;  3A2V A;  1K3L A;  2F9S A;  5JWO B;  3KGK A;  4I2U A;  5J3R A;  1T8E B;  5IMZ A;  1GH2 A;  5GST A;  3TJG A; 
#chains in the Genus database with same CATH homology
 1EV9 A;  4XS6 A;  2LS5 A;  4Q5R A;  4WET A;  2VCV A;  4MPG A;  4IW9 A;  2L6D A;  3CBU A;  4JE1 A;  3EIN A;  1SJ6 A;  4A5P A;  4TRX A;  3VWW A;  3GH9 A;  3DML A;  3QMX A;  2E2G A;  3F63 A;  2B7K A;  4L8E A;  5C00 A;  1HNA A;  1DSB A;  1XW6 A;  3UVT A;  2A2P A;  1ABA A;  1DE1 A;  2H66 A;  1GP1 A;  2H1G A;  4I6X A;  3LQ7 A;  3GH6 A;  1B9X C;  3IA1 A;  2E7P A;  3F3R A;  3CRU A;  3LWA A;  4JBB A;  3IC4 A;  4WF4 A;  4E8H A;  4CY6 A;  2B5Y A;  1WE0 A;  3ERW A;  3RPP A;  2P5R A;  5KOW A;  2KOK A;  2WCI A;  1TU7 A;  5ECL B;  3JCM L;  1USB A;  4GTU A;  1M9B A;  1O8X A;  5BMU A;  3UMA A;  4K7I A;  1QK8 A;  1U88 A;  4H86 A;  5JWR B;  4J57 E;  4IBP A;  4NWY A;  2O85 A;  4XTS A;  3VWV A;  3VLN A;  4ECI A;  3FY7 A;  3KMO A;  3O76 A;  4WBR D;  2LNS A;  4WKW A;  2CVD A;  1AQX A;  1U3A A;  1MDK A;  2C3T A;  4OD7 A;  4P3Y B;  5DCG A;  3M9K A;  5DCH A;  1V9W A;  5CAX A;  2OA7 A;  4K9Z A;  6GST A;  2WB9 A;  2VD1 A;  2X4A A;  3TJB A;  3DVW A;  4MJB A;  1X0R A;  2Z9S A;  3HHV A;  3C73 A;  4KGI A;  3TKS A;  4MAB A;  3F0I A;  5CYY A;  3P8W A;  4MJA A;  1LBK A;  3HD5 A;  4V1A p;  3LGC A;  1OC9 A;  4WR5 A;  2H0I A;  2XHF A;  2VIM A;  2YJ7 A;  13GS A;  3KP8 A;  3L0H A;  3BBY A;  5INY A;  1J9B A;  1F37 A;  1K0M A;  4K1F A;  3TB2 A;  3HA9 A;  1J08 A;  2CAQ A;  5F06 A;  3SWL A;  3TKP A;  2MMN A;  5IMV A;  4WEY A;  2FUG 2;  1OKD A;  3TKS C;  3D4T A;  4PTS A;  3VWU A;  4LMV A;  3S9F A;  1M2A A;  1YKA A;  4OFT A;  3VPQ A;  2N5F A;  5DQS A;  3PGT A;  5F8B A;  4KND A;  5CRW A;  3FMW A;  3GKK A;  4MF6 A;  3APS A;  2L5L A;  2MMO A;  1K0A A;  2RM6 A;  2P31 A;  5ECN B;  3SBC A;  4ZL8 A;  1OC9 B;  4OCE A;  4I2T A;  2JU5 A;  2GSS A;  2X99 A;  2IMK A;  2EIR A;  3CRT A;  3M0F A;  3W6G A;  2FGX A;  2CVB A;  4D73 A;  2M72 A;  3APO A;  1OC3 A;  5KN3 A;  2FNO A;  7GSS A;  1FB6 A;  1QMV A;  5FWG A;  2H73 A;  5KN0 A;  4Q5Q A;  4YKF A;  4GCI A;  3QCP A;  1YEP A;  2R0P A;  2H6X A;  3IE3 A;  5G1K A;  4JRR A;  4OO5 A;  1SL0 B;  5ID2 A;  2H1D A;  1NM3 A;  3R2Q A;  1VGL A;  1SK1 A;  2HE3 A;  4EF0 A;  2AAW A;  3FZ9 A;  5G31 A;  5DVB A;  4WR4 A;  1DE2 A;  4BVY A;  3DWV A;  1SL1 B;  3EC3 A;  2JZS A;  1ZOF A;  2JSY A;  4IGJ A;  2VCZ A;  3I9V 2;  3ZL5 A;  2VL2 C;  2FWH A;  3TKR A;  4D73 B;  4ZXG A;  1S3D A;  3A3T A;  4TW5 A;  4ZL9 A;  1JZR A;  2L59 A;  3GUS A;  2WDU A;  4KDX A;  5IQY A;  1ML6 A;  4PQ1 A;  4EDZ A;  2PUK C;  2KHP A;  1TOF A;  5G5E A;  4PNF A;  5ID2 B;  1YY7 A;  2VLT A;  2BTO T;  1YEX A;  4KH7 A;  1C72 A;  4JZQ A;  4NPB A;  2ES7 A;  3BCK A;  1XWK A;  4BVY B;  4ID0 A;  2I4A A;  1GSU A;  4RUV A;  3HKR A;  3K8N A;  3QD9 A;  4I8B A;  4O5Q A;  4EE0 A;  5GZZ B;  3VI5 A;  4MNN A;  3MNG A;  1YF1 A;  1JZD A;  3HVS A;  3HCZ A;  5HFG A;  4CDO A;  3LEF A;  4PQI A;  2D2Z A;  4MH3 A;  4XIH A;  2VCX A;  4PUF C;  1NW2 A;  3A5I A;  2GQK A;  1SJZ A;  2H1B A;  5HFK A;  3Q74 A;  3AY8 A;  2PGT A;  1EEJ A;  1PQN A;  3RAZ A;  1YQ1 A;  2OE1 A;  5DDL A;  1U6T A;  1JFU A;  4NV2 A;  4Z2T A;  1GTA A;  1V57 A;  5B6N A;  3MWH A;  1PMT A;  4ZB9 A;  3LG6 A;  1A24 A;  5EPF A;  3GN3 A;  5IPG A;  3IRA A;  5ECR B;  2NTO A;  1ZYN A;  1OC8 A;  1XXU A;  2KLX A;  1GSY A;  3ED3 A;  2LRT A;  3EUR A;  4YQM A;  2K8S A;  4E8E A;  4WXT A;  1EOG A;  3GIX A;  4ML6 A;  4Z7X A;  1ERW A;  1GSE A;  3TRQ A;  4PUR A;  4EUY A;  4KB3 A;  1XWG A;  3R3E A;  1WMJ A;  3C1S A;  5ECM B;  1XVW A;  2DLX A;  4DSS A;  1O7U A;  5ECK B;  1JLW A;  5DBQ A;  4L5O A;  3KCM A;  2I3Y A;  1JZO A;  4LLR A;  2ZUP A;  2HXK A;  4O92 A;  2B6M A;  4EVM A;  2HRF A;  1BX9 A;  1WJK A;  2HYX A;  2VLV A;  2LEG A;  1ACV A;  1KEB A;  2YCD A;  2WGR A;  3QFB C;  2H1A A;  2LRN A;  4XS1 A;  3GV1 A;  2TIR A;  4YQU A;  3LFL A;  1G7O A;  1M99 A;  1GTB A;  2VL3 A;  4K2D A;  4PX1 A;  4CHS A;  2OE3 A;  2DJ0 A;  2IMI A;  2C1Y A;  4NAX A;  5F0G A;  3LYK A;  2IMF A;  4N0V A;  1FW1 A;  4KF9 A;  4N30 A;  1EOH A;  3CYN A;  4O7H A;  1V58 A;  1ZZY A;  5G1L A;  3C8E A;  1TRS A;  4DSS B;  3IC8 A;  4XHM A;  3UVH A;  2DJJ A;  4FO5 A;  3GRX A;  2X8H A;  4BL7 A;  2IMD A;  3FW2 A;  3KP9 A;  1G6W A;  1GLQ A;  3ZIJ A;  1PN9 A;  3DXB A;  1A2M A;  2YWI A;  3QPM A;  2IN3 A;  2GS3 A;  3FZ5 A;  5AIS A;  1XW5 A;  1SL2 B;  4BWQ A;  1M7T A;  1NHY A;  1WPI A;  2LUS A;  5ECH B;  2WUL A;  3CTG A;  1FAA A;  3F9U A;  3MIX A;  1ZGN A;  4IVF A;  3ZFB A;  3GST A;  10GS A;  2VOC A;  3GTU B;  1KNG A;  5COH A;  1GNW A;  1XOA A;  1OKT A;  2MMZ A;  1GWC A;  2HZE B;  2JZR A;  3C71 A;  2ALB A;  1JZW A;  2ZCT A;  3VK9 A;  1Z6M A;  2XBQ A;  1K0C A;  1F2E A;  4LMW A;  4BVX A;  4PNG A;  1NSW A;  4N11 A;  1O73 A;  2FA4 A;  2EIQ A;  5ECO B;  2OBI A;  2TRX A;  4ZBA A;  3D6I A;  3C1R A;  5KOX A;  4HZ4 A;  4RI6 A;  16GS A;  1A0R P;  3ZIT A;  2CV4 A;  6GSW A;  1THX A;  1FHE A;  4QQ7 A;  3I6A A;  3I43 A;  3HYP A;  4XRA A;  2CZ3 A;  5IOW A;  1V2A A;  3F6D A;  3VFI A;  2KP1 A;  3HY2 A;  5EVO A;  1AC1 A;  4EIP A;  4L5L A;  3TKQ A;  1TXX A;  2YP6 A;  3LXT A;  1EZK A;  22GS A;  3TUE A;  4BVX B;  5CRG A;  3LJR A;  4AJ7 A;  1EEM A;  2XPE A;  1XPV A;  3BCI A;  2YPM A;  1AQW A;  4V2L A;  4OCF A;  3TKS E;  2WS2 A;  4MPF A;  4LL4 B;  2HRN A;  1OE8 A;  2NPB A;  3G9B A;  3WYW A;  2DJK A;  3GYK A;  3P90 A;  4I5Q A;  3GX0 A;  2NBS A;  1RK4 A;  2VM1 A;  3ZYW A;  1HNC A;  1ZMA A;  1EP7 A;  3MAK A;  5AN1 A;  4F82 A;  1BG5 A;  2L4C A;  3ISO A;  4GST A;  2L57 A;  3VPT A;  4IJ3 A;  1NHO A;  3GL3 A;  4YQV A;  1E2Y A;  2OKA A;  3UBL A;  1M2D A;  1E6B A;  2VCT A;  4F2I A;  3W8J A;  1CQH A;  3TJK A;  3ERF A;  2B5X A;  1XFL A;  2H0G A;  3L9U A;  3RPN A;  5HQP A;  2N5B A;  3F4R A;  3RDW A;  2IWT A;  2CVK A;  3IDV A;  3WT2 A;  4MJE A;  3ZMK A;  1M0U A;  4NHZ A;  1WP0 A;  1X5C A;  2R0C A;  4FIW A;  4HI7 A;  3QAW A;  3L78 A;  4GQF A;  1T7P B;  4N0Z A;  2IJY A;  1N8J A;  3D5J A;  3MDK A;  2HLS A;  2V41 A;  2LQQ A;  3UAP A;  3GSS A;  2RUF A;  1TDI A;  5IO0 A;  2OAC A;  4ML1 A;  2QSI A;  1S3C A;  3TRX A;  3HJM A;  4Q5N A;  3GL5 A;  1SYX A;  2X49 A;  1Z7R A;  2F51 A;  2GSR A;  5ELA A;  1T1V A;  2JL4 A;  4NHW A;  4NMU A;  1DBY A;  4YKG A;  2GT5 A;  2MYG A;  2F3M A;  3FRC A;  4TKY A;  2H71 A;  3M8N A;  1PKW A;  2B3S A;  5JCG A;  3F4S A;  1SKS B;  5GAP D;  3E0U A;  5CRE A;  3FR3 A;  3LSZ A;  4K2X A;  3UIW A;  5JWQ B;  3APQ A;  2CZ2 A;  3IAS 2;  4HEA 2;  3CMI A;  1ERV A;  4OFM A;  5DAL A;  1A2J A;  3P7X A;  3KIJ A;  5F05 A;  4POK A;  4ECC A;  1MDJ A;  2O7K A;  3EE2 A;  3DRN A;  1PRX A;  4TXV A;  5LD0 A;  1LJR A;  3WT1 A;  2A2R A;  3G7J A;  2DML A;  3FYG A;  2FCH A;  2J23 A;  1HD2 A;  2YOI A;  5J5N A;  3MSZ A;  5FT3 A;  4KW6 A;  2V6O A;  1QFN A;  1X5E A;  3PH9 A;  2LST A;  1T4Z A;  3IXR A;  3F3Q A;  1T3B A;  2I81 A;  4Z2U A;  5B8A A;  3P2A A;  2JZT A;  2GT6 A;  1PX7 A;  5G2Z A;  1QUW A;  2DJ1 A;  4RQX A;  3ZLP A;  1GUM A;  3CTF A;  3PPU A;  1YF0 A;  3QDN A;  5JCW A;  4FQU A;  3IOS A;  1K3O A;  4PQH A;  1K0O A;  3EVI A;  3D21 A;  4ECJ A;  2C0E A;  3KH9 A;  1GTI A;  5DAL B;  2K6V A;  1V98 A;  2VAF A;  1J0F A;  1TK5 B;  3GKN A;  1RQM A;  2FWF A;  1TRW A;  3ZFL A;  2GDR A;  3GMF A;  4G0K A;  5IPH A;  1GUK A;  2LKU A;  2VL2 A;  2DBC A;  1TK0 B;  1Y6E A;  2GZZ A;  3GKX A;  2LJA A;  5J4U A;  3KMN A;  1MEK A;  2V32 A;  2CX3 A;  4ZBB A;  2H6Z A;  6GSV A;  3GKM A;  5EY6 A;  1PL1 A;  2R4V A;  2O87 A;  3QFA C;  4FYU A;  1GL8 A;  2J9H A;  1PX6 A;  5LNK e;  3UBK A;  1BAY A;  3UAR A;  2YAN A;  6GSS A;  5ECS A;  1UVZ A;  3RHC A;  4ACS A;  2C3Q A;  1TTZ A;  2CX4 A;  3D4M A;  2EIO A;  4HQS A;  2QA2 A;  4X0X A;  5E4W A;  5AIV A;  1XWC A;  4DVC A;  2A2S A;  5KN1 A;  2HSY A;  3UEM A;  3KD0 A;  3QAV A;  1Z6N A;  3J7Y b;  1EGR A;  1YKC A;  1HYU A;  1XCC A;  1YJ6 A;  1B4P A;  3DKS A;  2JAC A;  5CRH A;  4HU7 A;  4ZB8 A;  4DSR A;  2L5O A;  4GXZ A;  1BYE A;  1VF1 A;  5BRT A;  1BQ7 A;  4IJI A;  2G2Q A;  3DD3 A;  1EV4 A;  4EDY A;  2HNL A;  4CW9 A;  1ZYP A;  2WJU A;  4EKZ A;  3ZTL A;  2MBS A;  2DSA A;  4TR1 A;  4XRD A;  2GVP A;  2YJH A;  4ZIL A;  3H93 A;  1G7E A;  2CAI A;  5D8I A;  2RM5 A;  2C0F A;  3TJF A;  2NDO A;  4HOJ A;  2GST A;  4RI7 A;  1ILO A;  2EC4 A;  3DYR A;  1Q98 A;  1GSD A;  1O8W A;  2WRT A;  2HT9 A;  1SK2 A;  5J9B A;  2R37 A;  4HUA A;  1QXH A;  2DC5 A;  4GWR A;  2H76 A;  1EWX A;  4X43 A;  3TRP A;  3TCO A;  20GS A;  2O89 A;  3DIE A;  4TR4 A;  1JHB A;  5EL8 A;  3KTL A;  2RLI A;  1Y25 A;  1ZYE A;  2QA1 A;  4BWS A;  1F9M A;  3M9J A;  1GUL A;  1UA5 A;  1SYR A;  2MZC A;  3CSH A;  1VRS D;  4V2N A;  3ZVJ A;  3US3 A;  1A23 A;  5A5K A;  1K3Y A;  3G7Y A;  3FZA A;  1IYI A;  3CSI A;  3FZ4 A;  2LJR A;  2VUP A;  3RHB A;  5HR2 A;  2I9H A;  1EGO A;  4K5S A;  3KJY A;  5DJM A;  1X9M B;  2AJQ B;  2UZ8 A;  1FOH A;  4AJ8 A;  3HZ8 A;  5A4W A;  1URM A;  5L71 A;  1R26 A;  2BMX A;  2K9F A;  2PWJ A;  5A4U A;  5IOX A;  5DAK A;  17GS A;  1SK0 A;  1THO A;  4L0W A;  4F03 A;  4ZB6 A;  3OR5 A;  4MZC A;  1B48 A;  3D22 A;  5CO3 A;  2F8A A;  2FLS A;  2IL3 A;  1X9S B;  3TJJ A;  3ME8 A;  1H4O A;  3EYT A;  1F3B A;  4L0U A;  1VF3 A;  1XWB A;  1S3A A;  5IMD A;  1ERU A;  2FA8 A;  2M46 A;  3IHG A;  1A2L A;  4K6X A;  3NIV A;  3GHA A;  2YWO A;  4IKH A;  2YV9 A;  1O85 A;  2OJL A;  4EO3 A;  1X5D A;  5G30 A;  2A4V A;  4MDC A;  3H79 A;  4POB A;  11GS A;  4J2F A;  4TR3 A;  2PMT A;  1PN0 A;  5IMC A;  2BJX A;  4IP6 A;  4O5U A;  5E59 A;  4PGT A;  5JCU A;  4IEL A;  4BL7 B;  2H8L A;  2AHE A;  4FH8 A;  1KTE A;  3ZIV A;  4MMM A;  3Q19 A;  1FOV A;  3F4T A;  3NZN A;  2YNX A;  1U87 A;  3U5R E;  1Q4J A;  2LTK A;  1TKD B;  4FYC A;  4KCA A;  4CY8 A;  1TRV A;  2YZH A;  5ECQ B;  4KUN A;  4I97 A;  4NV5 A;  5ELG A;  2CA8 A;  14GS A;  1M2B A;  5H5Q A;  4GQC A;  6GSU A;  4G10 A;  3EMX A;  6GSX A;  1GSQ A;  1B4Q A;  2YWM A;  3IK9 A;  3KXO A;  4ECB A;  2R5G A;  2GQM A;  2FY6 A;  3HVX A;  1IYH A;  2YV7 A;  4AGS A;  1WRY A;  4Q5F A;  1RW1 A;  2C4J A;  2H70 A;  5ECI B;  2C3N A;  2TRC P;  4PXO A;  2KP2 A;  4AF2 A;  19GS A;  2WZ9 A;  2GZP A;  2PPT A;  3EU3 A;  1ON4 A;  4IN0 A;  3MYD A;  4JR4 A;  1XZO A;  1K0B A;  2MMA A;  1XW9 A;  3ZML A;  3EPT A;  2AUV A;  3HVV A;  4BPY A;  2H01 A;  2HSH A;  3ZRD A;  5GSS A;  4EIQ A;  4K8M A;  1SKR B;  2H30 A;  1VF4 A;  3KH7 A;  5D93 A;  3GA4 A;  4G9H A;  2WFC A;  1TRU A;  3WGD A;  1DUG A;  3LOR A;  2V6K A;  1N2A A;  3TOU A;  4KAE A;  4EXJ A;  5J41 A;  5B7C A;  1ZYQ B;  2A4H A;  6GSY A;  1R7H A;  2B7J A;  2L4Q A;  4G2E A;  2IPA A;  2REM A;  4Z2R A;  2LJK A;  4YAV A;  3EWL A;  1Z9H A;  5DQY A;  5IO2 A;  3IAM 2;  2R3X A;  1XOB A;  1SD9 A;  2ZNM A;  1A8Y A;  2C0D A;  3EU4 A;  2VCW A;  3ME7 A;  4F9Z A;  5F07 A;  4OWY A;  1Z3E A;  1GTU A;  1KBN A;  3D0Z A;  4GLT A;  1FB0 A;  3H1N A;  1AW9 A;  1M9A A;  2PU9 C;  4XCS A;  1FVK A;  1QQ2 A;  2HI7 A;  4BA7 A;  2NVL A;  3UJ1 A;  3PIN A;  2VO4 A;  3CSJ A;  4HDE A;  1WWJ A;  4TXO A;  4WBJ A;  4TOP A;  2HSM A;  2GTU A;  2GZY A;  3PR8 A;  2DMM A;  3A2W A;  2E2M A;  3F8U A;  5HFI A;  3Q6O A;  3VUR A;  3HDC A;  5D9X A;  4MCU A;  2VM2 A;  3DVX A;  5KEJ A;  4GF0 A;  1GRX A;  1O6J A;  2B5E A;  1W4V A;  1ZCP A;  3BD2 A;  1WOU A;  1PD2 1;  1VF2 A;  1OAZ A;  1WIK A;  4MA9 A;  3IV4 A;  4V1A g;  3U6V A;  1AIU A;  2H72 A;  2LV3 A;  2P5Q A;  3GUR A;  4HJM A;  3KZQ A;  4KCE A;  4TXO B;  1OVN A;  1W89 A;  4MZB A;  1K0D A;  2YWN A;  2X64 A;  4K5R A;  5IIZ A;  2C80 A;  1OE7 A;  3O6T A;  3J7Y k;  2DKH A;  3IBH A;  2CT6 A;  1B8X A;  2K8V A;  2DIZ A;  3L9V A;  4JED A;  4JU5 A;  5ENU A;  4FYB A;  1ZL9 A;  3M1G A;  1PA3 A;  1PL2 A;  4IP1 A;  3E3E A;  1AAZ A;  4MP4 A;  2RII A;  3WD6 A;  5KN2 A;  4IQA A;  1SD8 A;  2OBK A;  5FHI A;  4OMV A;  5ABR A;  4J56 E;  5CRD A;  1JLV A;  3LW9 A;  5IMF A;  1GSF A;  5G5F A;  4GRF A;  2FWG A;  1CQG A;  5H5S A;  1YZX A;  1O81 A;  2B1K A;  4G0L A;  1GNE A;  4HU9 A;  5D73 A;  3FR9 A;  1SU9 A;  4K7O A;  3L4N A;  5H5R A;  2LNT A;  2YN1 A;  1LU4 A;  4KDY A;  3M3M A;  2QGV A;  3GX8 A;  4TR0 A;  2HRK A;  1HQO A;  4G19 A;  1HNB A;  5J9C A;  2C0G A;  4ILF A;  1XIY A;  2MBT A;  4MH2 A;  3Q18 A;  2HFD A;  4F0C A;  2JAD A;  2N5A A;  3LXZ A;  4MZW A;  4XS4 A;  2O8V B;  4EC0 A;  1H75 A;  2IIY A;  1TI1 A;  4KX4 A;  4GSN A;  5GAN D;  2E0Q A;  1Z7P A;  3NOF A;  3H8Q A;  4K0N A;  3G7I A;  2IME A;  1T00 A;  3FK8 A;  4K7N A;  3VI7 A;  1GLP A;  2H19 A;  3N5O A;  4TN8 A;  1ERT A;  5HR0 A;  1A0F A;  3ZZX A;  5D9T A;  4ICY A;  3FKF A;  3QOU A;  1TP9 A;  1AQV A;  2C8U A;  3LYP A;  2VL9 A;  5D96 A;  2V2G A;  5C04 A;  2L6C A;  4YAP A;  4ISD A;  3TGZ A;  4LL1 B;  4NXI A;  1U3I A;  3KTB A;  12GS A;  1MD3 A;  2VD0 A;  4F0B A;  2H0H A;  5CNW A;  5B8B A;  3HJP A;  1TU8 A;  1AXD A;  4G0I A;  3HXS A;  3ERG A;  2GSQ A;  4XS4 B;  5B6M A;  2XPD A;  2H75 A;  4O5R A;  5HR3 A;  3ZRE A;  1BED A;  1A8L A;  3IPZ A;  1Z5Y E;  3FHK A;  1UN2 A;  3CXG A;  1T4Y A;  2XC2 A;  2AYT A;  2M80 A;  3A5W A;  4KE3 A;  2R6K A;  2PVQ A;  3N9J A;  1F6M C;  3O3T A;  1PKZ A;  2KUC A;  3RBT A;  2G0F A;  2JSZ A;  2PVO C;  4TR1 B;  5CP1 A;  5AGY A;  1MDI A;  1UC7 A;  3GFK A;  4HQZ A;  2H6Y A;  5A4V A;  4WF5 A;  1PGT A;  1TW9 A;  1V40 A;  3VWX A;  1PSQ A;  3UOM A;  1GSS A;  5LCZ A;  4DEJ A;  4QL7 A;  3UL3 A;  2RUE A;  2YZU A;  2DIY A;  2ON7 A;  2HRA A;  4PUA A;  4ZBD A;  3ZVJ D;  1G0T A;  2PER A;  2LQO A;  4K0G A;  4MF5 A;  4RQR A;  5IM9 A;  2VLU A;  1SJI A;  2OE0 A;  1SKW B;  3FEU A;  1K0N A;  2IFQ A;  3TOT A;  1GUH A;  5AIX A;  4MK3 A;  4KSO A;  1XWA A;  4ZIJ A;  4N10 A;  4USS A;  5D9W A;  1R5P A;  1X9W B;  2DJ2 A;  4O32 A;  2CQ9 A;  4X1U A;  3V1W A;  2X8G A;  2HZF A;  4IQ1 A;  4KSM A;  2P0G A;  1TI3 A;  3WGE A;  3IK7 A;  2R2J A;  5ECP B;  1FVJ A;  1QGV A;  4AJ6 A;  2ON5 A;  2PN8 A;  3GTU A;  4OFN A;  3IR4 A;  3HZ4 A;  1SEN A;  2HZE A;  1I5G A;  2FWE A;  4GSS A;  2B1L A;  4DSQ A;  4IHU A;  3A2X A;  3I69 A;  1FO5 A;  3E9J B;  2DKI A;  1F3A A;  4X4J A;  1FG4 A;  3C7M A;  1MD4 A;  2QC7 A;  3GNJ A;  5HR1 A;  3BOA A;  18GS A;  1XVQ A;  2IFQ B;  1G6Y A;  2F8F A;  3BJ5 A;  3KEB A;  4MF7 A;  2AV4 A;  5DAK B;  3F6F A;  4OO4 A;  1R5A A;  2R0G A;  3WGX A;  2QKE A;  4HJ2 A;  3TDG A;  1MTC A;  2AB6 A;  2FD3 A;  2H74 A;  4ULX A;  4MLY A;  1TJD A;  2K18 A;  1EP8 A;  3QR6 A;  1XBS A;  2X8C A;  4EL1 A;  1AUC A;  1TK8 B;  8GSS A;  4QL9 A;  5DJL A;  3DGQ A;  1YDK A;  1OYJ A;  2DJ3 A;  3KM6 A;  2I1U A;  4LA1 A;  1BJX A;  2FHE A;  2VCQ A;  4JR6 A;  5D9V A;  2GQL A;  1R4W A;  2V1M A;  3L9S A;  4IS0 A;  5IMA A;  4V2M A;  2XBI A;  3DEX A;  3IHQ A;  4YH2 A;  2GGT A;  4POL A;  4HS1 A;  4ZL7 A;  4HZ2 A;  1B9Y C;  2PBJ A;  1I9D A;  3EMP A;  4POM A;  2OAD A;  2GLR A;  4MJC A;  3HJO A;  3FR6 A;  4TVE A;  3QAG A;  9GSS A;  4KA0 A;  4KDU A;  1ST9 A;  3H4K A;  2LRC A;  3W8S A;  3A2V A;  1K3L A;  2F9S A;  5JWO B;  3KGK A;  4I2U A;  5J3R A;  1T8E B;  5IMZ A;  1GH2 A;  5GST A;  3TJG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...