2FWHA

Atomic resolution crystal structure of the c-terminal domain of the electron transfer catalyst dsbd (reduced form at ph7)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
117
structure length
117
Chain Sequence
HLNFTQIKTVDELNQALVEAKGKPVMLDLYADWCVACKEFEKYTFSDPQVQKALADTVLLQANVTANDAQDVALLKHLNVLGLPTILFFDGQGQEHPQARVTGFMDAETFSAHLRDR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Thiol:disulfide interchange protein dsbD
publication title High-resolution structures of Escherichia coli cDsbD in different redox states: A combined crystallographic, biochemical and computational study
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 42
structure length 117
sequence length 117
ec nomenclature ec 1.8.1.8: Protein-disulfide reductase.
pdb deposition date 2006-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13899 Thioredoxin_7 Thioredoxin-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2fwhA00
4PNGA 5CRWA 4EDYA 4RI6A 3CXGA 3TRXA 1AUCA 1F9MA 2DMLA 4L8EA 3P90A 1TXXA 3CSHA 2BMXA 3MAKA 1TDIA 2ON5A 3I9V2 1WP0A 3KCMA 4K7IA 2NBSA 4KSMA 4RQXA 1W4VA 1YY7A 1K0AA 3NZNA 2H8LA 4ECBA 3F63A 5GZZB 2LJKA 4EDZA 3ZL5A 3L9VA 3ME7A 3KH7A 1HQOA 3GV1A 3E0UA 5KN1A 3GH9A 1SD9A 2GSQA 4KDXA 2G0FA 1K0NA 1W89A 2V6OA 3D22A 4GXZA 4MJAA 2GT6A 1SJIA 3EMPA 2WDUA 2ZCTA 2VCVA 1GTAA 4ZB6A 1XW9A 3I69A 2AB6A 3P7XA 1DUGA 3GSTA 4TR4A 1PKZA 4Z7XA 4KA0A 5CRDA 4DEJA 3TKSE 4AJ7A 5J9BA 2IN3A 5FWGA 1UVZA 6GSUA 1SKSB 2LEGA 2GZPA 1ABAA 2H19A 5C04A 1YDKA 1MTCA 3D21A 5IMCA 4ID0A 1GH2A 2OE0A 4F2IA 2OBIA 6GSVA 3ME8A 3FK8A 4YQVA 1VF2A 2XHFA 4Q5QA 5AIVA 5IMVA 4PUAA 4X1UA 1MD4A 1ILOA 2DJ0A 3TKSC 2YP6A 4IVFA 5F06A 2GQLA 3C8EA 4MH3A 1WJKA 3M8NA 1QFNA 3WGDA 1UN2A 1YEPA 3D4MA 1OAZA 2H1BA 3FKFA 1XVWA 2CT6A 1B48A 5DCHA 2E2GA 2H75A 3V1WA 3C73A 1OC9A 1O8XA 4HJ2A 4OCFA 2PERA 4IHUA 3TKSA 3ZVJA 4BA7A 2CQ9A 5B8AA 5ECRB 3TRPA 3UMAA 3EU3A 1Z9HA 4FYUA 4LMWA 2OBKA 2C4JA 2HZFA 3C1RA 2VLUA 4RI7A 3TDGA 3US3A 2TIRA 2HLSA 3A2XA 2YCDA 7GSSA 2HRFA 2VAFA 1ON4A 2XBIA 2EC4A 2GDRA 2YPMA 1TTZA 1GULA 1XVQA 2C8UA 1GSUA 2F8AA 3F3RA 4HDEA 4BL7A 5D9TA 5CAXA 1T7PB 3DVXA 3P8WA 2H6ZA 3N9JA 4ECIA 4HZ2A 4HUAA 3ZREA 3A2WA 5JWOB 4JE1A 3KMNA 2D2ZA 4TR1B 1FW1A 1PL1A 1QK8A 2F3MA 3AY8A 4Q5NA 2FWHA 1Z6MA 4ZXGA 2V1MA 5DBQA 4ZB8A 2B1LA 2VD0A 1J08A 2V6KA 3KJYA 3IK7A 3L9SA 3TJKA 3WGEA 3VWWA 3O6TA 1FG4A 2KP2A 3KEBA 2J23A 1K0DA 3TKPA 1OE8A 2HT9A 1YF1A 4MZWA 3HY2A 1EP8A 4WBJA 4XRAA 2P0GA 2ZUPA 2CX3A 3RPNA 3HA9A 2H30A 20GSA 1FAAA 1EWXA 2YV9A 4FYBA 1JHBA 1WRYA 4OFTA 4FH8A 2H71A 1HNCA 4V2NA 5AN1A 2YWMA 3PGTA 4QL9A 1G7EA 1PRXA 3TGZA 4MCUA 2NDOA 2VM1A 3HJMA 1SYRA 2H6XA 4MABA 5INYA 1GSSA 1EGRA 2LJAA 5IIZA 1UC7A 5ECSA 1MEKA 3DKSA 2L6DA 2DMMA 2I4AA 3BBYA 4MH2A 3VFIA 2L5LA 3L4NA 4WBRD 1U3AA 3IV4A 3IOSA 4EL1A 2FCHA 1EOGA 4TR3A 4PX1A 1VGLA 2O8VB 5JCUA 3BD2A 4FIWA 2FGXA 4ZBBA 3VLNA 4MF6A 5AIXA 5IQYA 4EO3A 4LLRA 1KBNA 2H66A 3J7Yk 1AQVA 1S3DA 1ZZYA 1O7UA 3UBKA 1AIUA 3IK9A 5D9XA 4KUNA 3TOTA 4DSSA 3F3QA 3HZ4A 4HU7A 3UOMA 9GSSA 4ZBDA 2FWGA 1VF1A 1ZL9A 3DYRA 4L5OA 3F4SA 3Q18A 5HR1A 4NXIA 3LG6A 1C72A 4MPFA 1VRSD 1R4WA 5ECHB 3I6AA 3UAPA 3KMOA 3S9FA 1SYXA 4FYCA 3TKRA 4PNFA 4DSQA 2YN1A 5EY6A 2WZ9A 2MMAA 1OC3A 4GRFA 3O3TA 1WE0A 3GKNA 4IN0A 2XPEA 5J3RA 5J9CA 2PU9C 1ERVA 3CRUA 1M99A 5B8BA 3GKKA 3DGQA 5HFIA 5KN3A 3QDNA 1M7TA 3KGKA 4HS1A 2M80A 4F9ZA 1SL2B 2K9FA 1X0RA 5IM9A 3TRQA 5FT3A 2YOIA 2IMFA 1EEJA 2EIRA 1TKDB 3ZZXA 1XW5A 4OO5A 2GVPA 2O85A 1TK8B 4X43A 5C00A 5HR2A 2DJ3A 5FHIA 2R37A 2LTKA 2YZUA 3QR6A 4K0GA 3FRCA 1GTIA 3EU4A 5IO2A 3IAS2 2H0IA 2N5AA 4GF0A 1OVNA 1OC9B 3ZIVA 4N10A 2MMNA 2GLRA 5COHA 2H72A 4POKA 5JCWA 2WRTA 3HVXA 5IPGA 2CVKA 5HFGA 1LJRA 5G1LA 4WR4A 6GSTA 3FZAA 3QAGA 3GURA 1YZXA 2CZ2A 2HSHA 2IMKA 1F6MC 5DQYA 2HE3A 1OE7A 4HJMA 2WB9A 1SENA 3BCIA 2B5EA 4O32A 1XCCA 4G19A 4D73A 2B7JA 2LQQA 1FB6A 3QPMA 5D73A 2PN8A 2PMTA 3TJGA 3RDWA 1XXUA 2QGVA 2FLSA 1V58A 3E9JB 3ZFBA 4POMA 1JFUA 2WULA 5DVBA 1B4QA 2M46A 5GAPD 1A0FA 1B9YC 4V2LA 2LV3A 2OJLA 5A5KA 4K8MA 2MMZA 2Z9SA 3ZTLA 2IWTA 1WIKA 1TW9A 1T4ZA 5EPFA 5ECOB 4POLA 4TRXA 1Z7RA 2H6YA 6GSWA 3HVSA 1XWGA 2QSIA 1SKRB 2JSYA 2V41A 4E8HA 4J2FA 2MBSA 2JZTA 1TU8A 2C0GA 2X64A 3HHVA 3DEXA 1I5GA 1PGTA 2L6CA 5IMDA 3TJBA 3LFLA 2V2GA 2YJHA 3GYKA 5EL8A 2O87A 3HJPA 4L5LA 1PMTA 2H1AA 1PX6A 3TJJA 3F6DA 4JR6A 4MMMA 1XFLA 4NAXA 1I9DA 1ZCPA 2YZHA 1Q4JA 2K6VA 3GX8A 4I97A 2P31A 2KP1A 3GSSA 4ZL9A 3APSA 2REMA 1Z3EA 2MZCA 2AUVA 5L71A 4OWYA 1M0UA 4KDYA 4KNDA 1TK0B 13GSA 2FWEA 4X0XA 2CV4A 4NV5A 2GSSA 1QMVA 1GNWA 1J9BA 3KZQA 3HCZA 5B6NA 4ACSA 3LQ7A 2GTUA 4K2DA 4LA1A 4ECJA 3A3TA 3U5RE 5ELGA 2B5YA 2CX4A 3WYWA 2PVOC 2C1YA 1T8EB 4YH2A 5DCGA 1AXDA 4F82A 1SL1B 1H75A 3KP8A 2B6MA 2K8SA 5E59A 1SKWB 2FNOA 4G2EA 2L4CA 3N5OA 2BJXA 5AISA 2XC2A 4NPBA 5CNWA 2HRNA 5JCGA 4LMVA 4ML1A 4TW5A 2LJRA 1PSQA 1AC1A 1F3AA 4ZB9A 2H73A 4J57E 1XOBA 3GX0A 4ECCA 4LL4B 1V9WA 4NMUA 2B5XA 4ML6A 4MP4A 4YQMA 4F0BA 1V98A 2K8VA 4KDUA 3TJFA 3DMLA 1GRXA 3EYTA 4OMVA 3LJRA 2I81A 4EF0A 3F6FA 1JZWA 3F9UA 4ILFA 4MJBA 3FEUA 1SL0B 2OADA 1ERTA 1OKDA 2LQOA 3WGXA 5H5QA 3LXZA 5GSTA 3EVIA 5G31A 1MDJA 3KP9A 5CYYA 3RHCA 3IRAA 3ZIJA 4PXOA 1G6YA 1IYHA 2EIOA 1R7HA 2NTOA 3QD9A 4GCIA 4AGSA 4TXOA 4I6XA 1X5DA 1RW1A 2CAQA 1ZOFA 3IA1A 1M2BA 1F2EA 1Y6EA 1A23A 4ULXA 1EV4A 2VM2A 11GSA 2DBCA 4HEA2 1F3BA 5ABRA 4D73B 4WKWA 4MF5A 4WR5A 3HJOA 3FR3A 2X99A 1TOFA 4TXVA 5IMFA 1KEBA 4HQZA 4Q5RA 4J56E 5GAND 2YV7A 3QAVA 1FVJA 3IAM2 2LNSA 4KW6A 1VF4A 5IOWA 2H74A 4N30A 1RQMA 3IHQA 2PVQA 2NPBA 2H70A 3FZ9A 4ZBAA 4MPGA 2CVDA 5B7CA 1FO5A 2M72A 1WWJA 3R2QA 2OKAA 2PGTA 2YANA 1B9XC 3NIVA 2IMEA 2FY6A 2L4QA 3CSIA 3ERFA 4KCAA 4K0NA 2AHEA 3SWLA 1O81A 1YKAA 3GKXA 4FO5A 4OD7A 4KSOA 1S3AA 1XPVA 2P5QA 4N0VA 2CA8A 5CP1A 1X9WB 4P3YB 1S3CA 2GT5A 2DSAA 3DRNA 1O8WA 5ID2A 2YNXA 3GL3A 2ZNMA 2XPDA 1TP9A 3U6VA 1THXA 3FZ5A 5E4WA 5IOXA 1E6BA 1FHEA 2IMDA 1N8JA 3C1SA 4EC0A 1XZOA 3EMXA 1M9AA 1GLPA 3KTLA 4PQ1A 4IQ1A 2B3SA 2QC7A 3CBUA 1EV9A 1F37A 2OE1A 2P5RA 4OO4A 4WF5A 4K9ZA 4I2TA 3WT1A 4IP6A 3ZITA 4GWRA 4IGJA 2R4VA 1BAYA 2LUSA 5ECLB 4AJ6A 3G9BA 2WFCA 1NM3A 5A4VA 1EP7A 4IW9A 2PUKC 3PR8A 1AQWA 3GRXA 4NV2A 4JBBA 1CQGA 1ERUA 4I5QA 2PWJA 2ALBA 5IMZA 1A2JA 2HZEA 2FHEA 2OA7A 4YAPA 5IPHA 3IXRA 2GS3A 1GSYA 1QXHA 3ISOA 5B6MA 17GSA 3J7Yb 1KNGA 4EXJA 2H0HA 4XS4A 3Q74A 3TOUA 2R5GA 1TI3A 1XWCA 2JSZA 1U6TA 2H01A 2VD1A 4F03A 5ECKB 2A2SA 2E2MA 3NOFA 2C0DA 2L57A 3HVVA 1PKWA 4IKHA 1G7OA 1ST9A 1E2YA 3TCOA 3RHBA 3GFKA 2OACA 1Q98A 3RAZA 5D93A 1MDIA 3MSZA 2TRCP 3UJ1A 5DAKA 1XBSA 2LS5A 3GN3A 1A24A 4ZL8A 2HNLA 3DWVA 4BVXA 1SK2A 4TVEA 1AQXA 1K3OA 2C3NA 5IO0A 1A2MA 3EURA 2GQKA 1EOHA 1HD2A 3D0ZA 4V1Ap 4BWSA 1UA5A 2O89A 4MK3A 1K0CA 3LYKA 3GUSA 1T4YA 4POBA 4K6XA 1XWBA 4NHZA 1RK4A 5DQSA 2VCWA 1TJDA 1G6WA 4NWYA 4V1Ag 4TXOB 3UVTA 3VPTA 3GMFA 5GSSA 3KH9A 4PURA 3ZLPA 2JACA 2F51A 4GTUA 5ECMB 4ISDA 2FWFA 5F07A 1V2AA 1PQNA 1ZMAA 5ECIB 1GTBA 5DALA 19GSA 3DD3A 3UBLA 1PL2A 1BQ7A 1PN9A 1GSQA 1SK1A 5J5NA 4MZCA 1X5CA 4ZILA 4XS6A 4MJCA 2IMIA 2X8CA 2VUPA 2RUEA 1LBKA 3KTBA 1DBYA 5IMAA 5KN0A 1X9MB 1XW6A 4GLTA 3HKRA 1XWAA 4GQCA 4TOPA 3F4TA 3APOA 3PINA 2RLIA 1GUKA 5DJMA 3CYNA 1EZKA 3H8QA 2F9SA 1M2AA 4MLYA 1WOUA 4GQFA 3RBTA 1TU7A 4WF4A 2X8HA 3GH6A 3FR6A 1YJ6A 2B1KA 3WD6A 2JU5A 3W6GA 3I43A 3LXTA 1V40A 3ZMLA 3VURA 2RIIA 1B4PA 4L0WA 4AF2A 1ML6A 4WEYA 1YKCA 1DSBA 3A2VA 1NHOA 4HI7A 1A2LA 1NW2A 3VPQA 1GP1A 4OFMA 1HNAA 1U3IA 3TUEA 6GSSA 4MZBA 3VI7A 1MD3A 4GSTA 5ID2B 3ZRDA 1KTEA 3BOAA 1R26A 2AYTA 4Q5FA 2DIZA 2VCQA 4I2UA 3DXBA 3VWVA 2A4VA 4O5RA 3DIEA 2I3YA 2RM5A 3IPZA 1K0MA 3SBCA 4CDOA 3WT2A 3VWXA 4DSSB 4OFNA 2VLTA 3F4RA 2HYXA 2FD3A 4XRDA 4IJIA 3GTUA 1OC8A 2WCIA 5HR3A 2IL3A 3FHKA 2ON7A 1GWCA 5J4UA 4XTSA 1PD21 3TB2A 4PUFC 1R5AA 3LGCA 2XBQA 2CAIA 3K8NA 3PH9A 2DJ1A 1K3LA 2GGTA 1TRSA 3QFAC 2C3TA 3EINA 3CMIA 3QFBC 5G1KA 3RPPA 3L0HA 3IC4A 2L5OA 1FB0A 1NHYA 1QQ2A 3UVHA 4E8EA 2HZEB 2JZRA 2VL3A 4IQAA 3IR4A 4GSSA 2MYGA 2VCXA 1X5EA 4XS4B 5G5EA 3UEMA 2IJYA 4CW9A 3LSZA 4JU5A 4O92A 3E3EA 3H4KA 4KCEA 3CRTA 5LCZA 3APQA 2C80A 4DSRA 1HYUA 22GSA 5HQPA 4BWQA 1K0BA 2GSTA 2R6KA 1OKTA 4AJ8A 3GIXA 1GL8A 4DVCA 4ZIJA 2DJJA 4OCEA 5A4UA 4TN8A 5DAKB 2IFQA 3L9UA 1BX9A 4RUVA 3M3MA 2OE3A 3P2AA 3CSJA 3L78A 2NVLA 1Z5YE 2DLXA 4KB3A 3KIJA 2VL2C 2H1DA 3QCPA 4N0ZA 1JLVA 2GQMA 3VK9A 4XCSA 1XIYA 1IYIA 3W8JA 4EE0A 8GSSA 2LNTA 3GHAA 2H1GA 4HQSA 1A8YA 2YJ7A 3ZVJD 1NSWA 1DE2A 3ED3A 2LRCA 4JRRA 1O85A 1GUHA 4K7NA 2J9HA 3F8UA 2ES7A 2VL2A 1M2DA 2N5BA 1EEMA 2I1UA 1YQ1A 1TRWA 1PA3A 2RUFA 2DIYA 5F05A 2C3QA 3H79A 5DALB 4HZ4A 4XHMA 4KH7A 1LU4A 5CO3A 3HZ8A 6GSXA 2VLVA 2YWOA 4EKZA 5ELAA 2WS2A 4PQHA 2YWNA 1SJZA 3KXOA 4L0UA 3DVWA 1VF3A 2DJKA 1TK5B 2WJUA 4KX4A 3ZMKA 5KEJA 2VCZA 4CHSA 2A2RA 1K0OA 1CQHA 1JZRA 2HXKA 3FZ4A 4YAVA 4JEDA 1BJXA 5HR0A 5J41A 3D6IA 1YF0A 2CZ3A 12GSA 1U88A 1ZYQB 3G7IA 2X8GA 3C7MA 3EC3A 1QGVA 4H86A 1AAZA 5EVOA 1PX7A 5DJLA 3EE2A 5G5FA 2DJ2A 3IDVA 3QAWA 1TRVA 2IPAA 3UARA 4IBPA 1GSEA 1BYEA 6GSYA 2H0GA 4WXTA 1JZDA 2HSYA 3MDKA 1JLWA 2FA4A 5ENUA 3IE3A 3LORA 1T3BA 5D9VA 2GSRA 1T1VA 4MDCA 2RM6A 1A8LA 1WPIA 1ACVA 3UL3A 2PBJA 2R3XA 3Q6OA 10GSA 2E7PA 5CREA 3GNJA 3IBHA 4BVYA 5D9WA 1GUMA 3HD5A 4TKYA 1A0RP 1WMJA 4HOJA 1GTUA 2QKEA 5D8IA 2R2JA 2G2QA 4LL1B 2AJQB 4EVMA 3GTUB 1ZGNA 2WGRA 3O76A 2C0EA 2F8FA 1FOVA 1G0TA 1GNEA 3Q19A 1R5PA 2CVBA 2V32A 3VI5A 3LYPA 4MJEA 5F0GA 3ERGA 5HFKA 4QQ7A 3KD0A 2JL4A 1AW9A 4N11A 2AV4A 3D4TA 5CRGA 4GSNA 3LEFA 3M9KA 3MNGA 2LRTA 1U87A 5F8BA 2JZSA 1GSDA 4K7OA 1K3YA 2BTOT 4JR4A 3UIWA 3A5WA 1Y25A 1GSFA 3M1GA 2KLXA 1EGOA 4G10A 3ERWA 2TRXA 4YQUA 2HI7A 4PQIA 1SU9A 2HFDA 18GSA 5JWQB 3G7JA 1Z7PA 2MMOA 2FA8A 4TR0A 4IJ3A 1BEDA 5KN2A 2LSTA 3VWUA 2JADA 4NHWA 2KOKA 1B8XA 5ECQB 3ZYWA 5H5RA 4JZQA 2DC5A 5A4WA 3FYGA 3H1NA 1Z6NA 4EUYA 2K18A 2VO4A 2IFQB 1XOAA 2C0FA 5AGYA 3W8SA 2VCTA 1GLQA 1HNBA 1TI1A 4G9HA 4IS0A 3F0IA 4XIHA 1YEXA 2KUCA 4KE3A 2IIYA 4V2MA 4F0CA 4K1FA 3BCKA 1N2AA 2N5FA 2E0QA 2GZZA 2O7KA 5ECNB 1DE1A 3G7YA 4XS1A 1J0FA 2EIQA 1ZYEA 3EWLA 3TKQA 2LKUA 1FVKA 3M0FA 14GSA 3BJ5A 4KAEA 1OYJA 3ZFLA 4WETA 1MDKA 5LD0A 1THOA 5G2ZA 3CTFA 1BG5A 2VOCA 3M9JA 1T00A 16GSA 3HYPA 3GL5A 3QOUA 4HU9A 3D5JA 2I9HA 3OR5A 5CRHA 3QMXA 3HXSA 4O7HA 2VIMA 3JCML 1O6JA 2AAWA 1X9SB 4BPYA 5JWRB 3CTGA 4TR1A 3FY7A 2L59A 3H93A 1USBA 4MA9A 2GZYA 4PGTA 1SD8A 5LNKe 2VL9A 5DDLA 1V57A 1O73A 1ERWA 3C71A 2MBTA 4IP1A 5ECPB 4I8BA 2H76A 5H5SA 1TRUA 4IELA 3LWAA 4MF7A 5G30A 5D96A 3HDCA 3KM6A 1SK0A 2PPTA 4RQRA 2LRNA 4QL7A 3MWHA 1URMA 1M9BA 4KGIA 3GA4A 1QUWA 1JZOA 1XWKA 3FR9A 1H4OA 2B7KA 1SJ6A 3FW2A 4ZL7A 3GKMA 2FUG2 2YWIA 2KHPA
chains in the Genus database with same CATH superfamily
4PNGA 5CRWA 4EDYA 4RI6A 3CXGA 3TRXA 1AUCA 1F9MA 2DMLA 4L8EA 3P90A 2HRAA 1TXXA 3CSHA 2BMXA 3MAKA 1TDIA 2ON5A 3I9V2 4PTSA 1WP0A 3KCMA 4K7IA 2NBSA 4KSMA 4RQXA 1W4VA 1YY7A 1K0AA 3NZNA 2H8LA 4ECBA 3F63A 5GZZB 2LJKA 4EDZA 3ZL5A 3L9VA 4BVYB 3ME7A 3KH7A 1HQOA 3GV1A 3E0UA 5KN1A 3GH9A 1SD9A 2GSQA 4KDXA 2G0FA 4YKFA 1K0NA 1W89A 2V6OA 3D22A 4GXZA 4MJAA 2GT6A 1SJIA 3EMPA 2WDUA 2ZCTA 2VCVA 1GTAA 4ZB6A 1XW9A 3I69A 2AB6A 3P7XA 1DUGA 3GSTA 4TR4A 1PKZA 4Z7XA 4KA0A 5CRDA 4DEJA 3TKSE 4AJ7A 5J9BA 2IN3A 5FWGA 1UVZA 6GSUA 1SKSB 2LEGA 2GZPA 1ABAA 4A5PA 2H19A 5C04A 1YDKA 1MTCA 3D21A 5IMCA 4ID0A 1GH2A 2OE0A 4F2IA 2OBIA 6GSVA 3ME8A 3FK8A 4YQVA 1VF2A 2XHFA 4Q5QA 5AIVA 5IMVA 4PUAA 4X1UA 1MD4A 1ILOA 2DJ0A 3TKSC 2YP6A 4IVFA 5F06A 2GQLA 3C8EA 4MH3A 1WJKA 3M8NA 1QFNA 3WGDA 1UN2A 1YEPA 3D4MA 1OAZA 2H1BA 3FKFA 1XVWA 3EPTA 2CT6A 1B48A 5DCHA 2E2GA 2H75A 3V1WA 3C73A 1OC9A 1O8XA 4HJ2A 4BVXB 4OCFA 2PERA 4IHUA 3TKSA 3ZVJA 4BA7A 2CQ9A 5B8AA 5ECRB 3TRPA 3UMAA 3EU3A 1Z9HA 4FYUA 4LMWA 2OBKA 2C4JA 1XG8A 2HZFA 3C1RA 2VLUA 4RI7A 3TDGA 3US3A 4Z2RA 2TIRA 2HLSA 4Z2TA 3A2XA 2YCDA 7GSSA 2HRFA 2VAFA 1ON4A 2XBIA 2EC4A 2GDRA 2YPMA 1TTZA 1GULA 1XVQA 2C8UA 1GSUA 2F8AA 3F3RA 4HDEA 4BL7A 5D9TA 5CAXA 1T7PB 3DVXA 3P8WA 2H6ZA 3N9JA 4ECIA 4HZ2A 4HUAA 3ZREA 3A2WA 5JWOB 4JE1A 3KMNA 2D2ZA 4USSA 4TR1B 1FW1A 1PL1A 1QK8A 2F3MA 3AY8A 4Q5NA 2FWHA 1Z6MA 4ZXGA 2V1MA 5DBQA 4ZB8A 2B1LA 2VD0A 1J08A 2V6KA 3KJYA 3IK7A 3L9SA 3TJKA 3WGEA 3VWWA 3O6TA 1FG4A 2KP2A 3KEBA 2J23A 1K0DA 3TKPA 1OE8A 2HT9A 1YF1A 4MZWA 3HY2A 1EP8A 4WBJA 4XRAA 2P0GA 2ZUPA 2CX3A 3RPNA 3HA9A 2H30A 20GSA 1FAAA 1EWXA 2YV9A 4FYBA 1JHBA 1WRYA 4OFTA 4FH8A 2H71A 1HNCA 4V2NA 5AN1A 2YWMA 3PGTA 4QL9A 1G7EA 1PRXA 3TGZA 4MCUA 2NDOA 2VM1A 3HJMA 4K5RA 1SYRA 2H6XA 4MABA 5INYA 1GSSA 1EGRA 2LJAA 5IIZA 1UC7A 1MEKA 3DKSA 5ECSA 2L6DA 2DMMA 2I4AA 3BBYA 4MH2A 3VFIA 2L5LA 3L4NA 4WBRD 1U3AA 3IV4A 3IOSA 4EL1A 2FCHA 1EOGA 4TR3A 4PX1A 1VGLA 2O8VB 5JCUA 3BD2A 4FIWA 2FGXA 4ZBBA 3VLNA 4MF6A 5AIXA 5IQYA 4EO3A 4LLRA 1KBNA 2H66A 3J7Yk 1AQVA 1S3DA 1ZZYA 1O7UA 3UBKA 1AIUA 3IK9A 5D9XA 4KUNA 3TOTA 4DSSA 3F3QA 5KOXA 3HZ4A 4HU7A 3UOMA 9GSSA 4ZBDA 2FWGA 1VF1A 1ZL9A 3DYRA 4L5OA 3F4SA 3Q18A 5HR1A 4NXIA 3LG6A 1C72A 4MPFA 1VRSD 1R4WA 5ECHB 3I6AA 3UAPA 3KMOA 3S9FA 1SYXA 4FYCA 3TKRA 4PNFA 4DSQA 2YN1A 5EY6A 2WZ9A 2MMAA 1OC3A 4GRFA 3O3TA 1WE0A 3GKNA 3MIXA 4IN0A 2XPEA 5J3RA 5J9CA 2PU9C 1ERVA 3CRUA 1M99A 5B8BA 3GKKA 3DGQA 5HFIA 3FMWA 5KN3A 3QDNA 1M7TA 3KGKA 4HS1A 2M80A 4F9ZA 1SL2B 2K9FA 1X0RA 5IM9A 3TRQA 5FT3A 2YOIA 2IMFA 1EEJA 2EIRA 1TKDB 3ZZXA 1XW5A 4OO5A 2GVPA 2O85A 1TK8B 4X43A 5C00A 5HR2A 2DJ3A 5FHIA 2R37A 2LTKA 3MYDA 2YZUA 3QR6A 4K0GA 3FRCA 1GTIA 3EU4A 5IO2A 1FOHA 3IAS2 2H0IA 2N5AA 4GF0A 1OVNA 1OC9B 3ZIVA 4N10A 2MMNA 2GLRA 5COHA 1PN0A 2H72A 4POKA 5JCWA 2WRTA 3HVXA 5IPGA 2CVKA 4X4JA 5HFGA 1LJRA 5G1LA 4WR4A 4G0KA 6GSTA 3FZAA 3QAGA 3GURA 1YZXA 2CZ2A 2HSHA 2IMKA 1F6MC 5DQYA 2HE3A 1OE7A 4HJMA 2WB9A 1SENA 3BCIA 2B5EA 4O32A 1XCCA 4G19A 4D73A 2B7JA 2LQQA 1FB6A 3QPMA 4MNNA 4FQUA 5D73A 2PN8A 2PMTA 3TJGA 3RDWA 1XXUA 2QGVA 2FLSA 1V58A 3E9JB 3ZFBA 4POMA 1JFUA 2WULA 5DVBA 1B4QA 2M46A 5GAPD 1A0FA 1B9YC 4V2LA 2LV3A 2OJLA 5A5KA 4K8MA 2MMZA 2Z9SA 3ZTLA 2IWTA 1WIKA 1TW9A 1T4ZA 5EPFA 5ECOB 4POLA 4TRXA 1Z7RA 2H6YA 3PPUA 3HVSA 6GSWA 1XWGA 2QSIA 1SKRB 2JSYA 2V41A 4E8HA 4J2FA 2MBSA 2QA1A 2JZTA 1TU8A 2C0GA 2X64A 3HHVA 3DEXA 1I5GA 1PGTA 2L6CA 5IMDA 3TJBA 3CQFA 3LFLA 2V2GA 2YJHA 3GYKA 5EL8A 2O87A 3HJPA 4L5LA 1PMTA 2H1AA 1PX6A 3TJJA 3F6DA 4JR6A 4MMMA 1XFLA 4G0IA 4NAXA 1I9DA 1ZCPA 2YZHA 1Q4JA 2K6VA 3GX8A 4I97A 2P31A 2KP1A 3GSSA 4ZL9A 3APSA 2REMA 1Z3EA 2MZCA 2AUVA 5L71A 1M3IA 4OWYA 1M0UA 4KDYA 4KNDA 1TK0B 13GSA 2FWEA 4X0XA 2CV4A 4NV5A 2GSSA 1QMVA 1GNWA 1J9BA 3KZQA 3HCZA 5B6NA 4ACSA 3LQ7A 2GTUA 4K2DA 4LA1A 4ECJA 3A3TA 3U5RE 5ELGA 2B5YA 2CX4A 3WYWA 2PVOC 2C1YA 1T8EB 4YH2A 5DCGA 1AXDA 4F82A 1SL1B 1H75A 3KP8A 2B6MA 2K8SA 5E59A 1SKWB 2FNOA 4G2EA 2L4CA 3N5OA 2BJXA 5AISA 2XC2A 4NPBA 5CNWA 2HRNA 5JCGA 4LMVA 4ML1A 4TW5A 2LJRA 1PSQA 1AC1A 1F3AA 4ZB9A 2H73A 4J57E 1XOBA 3GX0A 4ECCA 4LL4B 1V9WA 4NMUA 2B5XA 4ML6A 4MP4A 4YQMA 4F0BA 1V98A 2K8VA 4KDUA 2QA2A 3TJFA 3DMLA 1GRXA 3EYTA 4OMVA 3LJRA 2UZ8A 2I81A 4EF0A 3F6FA 1JZWA 3F9UA 4ILFA 4MJBA 3FEUA 1SL0B 2OADA 1ERTA 1OKDA 2LQOA 3WGXA 5H5QA 3LXZA 5GSTA 3EVIA 5G31A 1MDJA 3KP9A 5CYYA 3RHCA 3IRAA 3ZIJA 4PXOA 1G6YA 1IYHA 2EIOA 1R7HA 2NTOA 3QD9A 4GCIA 4AGSA 4TXOA 4I6XA 1X5DA 1RW1A 2CAQA 1ZOFA 3IA1A 1M2BA 1F2EA 1Y6EA 1A23A 4ULXA 1EV4A 2VM2A 11GSA 2DBCA 4HEA2 1F3BA 5ABRA 4D73B 4WKWA 4MF5A 4WR5A 3HJOA 2HSMA 2X4AA 3FR3A 2X99A 1TOFA 4TXVA 5IMFA 1KEBA 4HQZA 4Q5RA 4J56E 5GAND 2YV7A 3QAVA 1FVJA 3IAM2 2LNSA 4KW6A 1VF4A 5IOWA 2H74A 4N30A 1RQMA 3IHQA 2PVQA 2NPBA 2H70A 3FZ9A 4ZBAA 4MPGA 2CVDA 5B7CA 1FO5A 2M72A 1WWJA 3R2QA 2OKAA 2PGTA 2YANA 1B9XC 3NIVA 2IMEA 2FY6A 2L4QA 3CSIA 1M3JA 3ERFA 4KCAA 4K0NA 2AHEA 3A5IA 3SWLA 1O81A 1YKAA 3GKXA 4FO5A 4OD7A 4KSOA 3IC8A 1S3AA 1XPVA 2P5QA 4N0VA 2CA8A 5CP1A 1X9WB 4P3YB 1S3CA 2GT5A 2DSAA 3DRNA 1O8WA 5ID2A 3HVNA 2YNXA 3GL3A 2ZNMA 2XPDA 1TP9A 3U6VA 1THXA 3FZ5A 5E4WA 5IOXA 1E6BA 1FHEA 2IMDA 1N8JA 3C1SA 4EC0A 1XZOA 4EIQA 3EMXA 1M9AA 1GLPA 3KTLA 4PQ1A 4IQ1A 2B3SA 2QC7A 3CBUA 1EV9A 1F37A 2OE1A 2P5RA 4OO4A 4WF5A 4K9ZA 4I2TA 3WT1A 4IP6A 3ZITA 4GWRA 4IGJA 2R4VA 1BAYA 4EIPA 2LUSA 5ECLB 4AJ6A 3G9BA 4Z2UA 2WFCA 1NM3A 5A4VA 1EP7A 4IW9A 2PUKC 3PR8A 1AQWA 3GRXA 4NV2A 4JBBA 1CQGA 1ERUA 4I5QA 2PWJA 2ALBA 5IMZA 1A2JA 2HZEA 2FHEA 2OA7A 4YAPA 4YKGA 5IPHA 3IXRA 2GS3A 1GSYA 1QXHA 3ISOA 5B6MA 17GSA 3J7Yb 1KNGA 4EXJA 2H0HA 4XS4A 3Q74A 3TOUA 2R5GA 1TI3A 1XWCA 2JSZA 1U6TA 2H01A 2VD1A 4F03A 5ECKB 2A2SA 2E2MA 3NOFA 2C0DA 2L57A 3HVVA 1PKWA 4IKHA 1G7OA 1ST9A 1E2YA 3TCOA 3RHBA 3GFKA 2OACA 1Q98A 3RAZA 5D93A 1MDIA 3MSZA 3R3EA 2TRCP 3UJ1A 5DAKA 1XBSA 2LS5A 3GN3A 1A24A 4ZL8A 2HNLA 3DWVA 4KF9A 4BVXA 1SK2A 4TVEA 1AQXA 1K3OA 2C3NA 5IO0A 1A2MA 3EURA 2GQKA 1EOHA 1HD2A 3D0ZA 4V1Ap 4BWSA 1UA5A 2O89A 4MK3A 1K0CA 3LYKA 5BRTA 3GUSA 1T4YA 4POBA 4K6XA 1XWBA 4NHZA 1RK4A 5DQSA 2VCWA 1TJDA 1G6WA 4NWYA 4V1Ag 4O5UA 4TXOB 3UVTA 3VPTA 3GMFA 5GSSA 3KH9A 4PURA 3ZLPA 2JACA 2F51A 4GTUA 5ECMB 4ISDA 2FWFA 5F07A 1V2AA 1PQNA 1ZMAA 5ECIB 1GTBA 5DALA 19GSA 3DD3A 3UBLA 1PL2A 1BQ7A 1PN9A 4BL7B 1GSQA 1SK1A 5J5NA 4MZCA 1X5CA 4ZILA 4XS6A 4MJCA 2IMIA 2X8CA 2VUPA 2RUEA 1LBKA 3KTBA 4CY8A 1DBYA 5IMAA 5KN0A 1X9MB 1XW6A 4GLTA 3HKRA 1XWAA 4GQCA 4TOPA 3F4TA 3APOA 3PINA 2RLIA 1GUKA 5DJMA 3CYNA 1EZKA 3H8QA 2F9SA 1M2AA 4MLYA 1WOUA 4GQFA 3RBTA 1TU7A 4WF4A 2X8HA 3GH6A 3FR6A 1YJ6A 2B1KA 3WD6A 2JU5A 3W6GA 3I43A 3LXTA 1V40A 3ZMLA 3VURA 2RIIA 1B4PA 4L0WA 4AF2A 1ML6A 4WEYA 1YKCA 1DSBA 3A2VA 1NHOA 4HI7A 1A2LA 1NW2A 3VPQA 1GP1A 3IHGA 4OFMA 1HNAA 1U3IA 3TUEA 6GSSA 2X49A 4MZBA 3VI7A 1MD3A 4GSTA 5ID2B 3ZRDA 1KTEA 3BOAA 1R26A 2AYTA 4Q5FA 2DIZA 2VCQA 4I2UA 3DXBA 3VWVA 2A4VA 4O5RA 3DIEA 2I3YA 2RM5A 3IPZA 1K0MA 3SBCA 4CDOA 3WT2A 3VWXA 4DSSB 4OFNA 2VLTA 3F4RA 2HYXA 2FD3A 4XRDA 4IJIA 3GTUA 1OC8A 2WCIA 5HR3A 2IL3A 3FHKA 2ON7A 1GWCA 5J4UA 4XTSA 1PD21 3TB2A 4PUFC 1R5AA 3LGCA 2XBQA 2CAIA 3K8NA 3PH9A 2DJ1A 1K3LA 2GGTA 1TRSA 3QFAC 2C3TA 3EINA 3CMIA 3QFBC 2DKHA 5G1KA 3RPPA 3L0HA 3IC4A 2L5OA 1FB0A 1NHYA 1QQ2A 3UVHA 4E8EA 2HZEB 2JZRA 2VL3A 4IQAA 3IR4A 4GSSA 4ICYA 2MYGA 2VCXA 1X5EA 4XS4B 5G5EA 3UEMA 2IJYA 4CW9A 3LSZA 4JU5A 4O92A 1ZYNA 3E3EA 3H4KA 4KCEA 3CRTA 5LCZA 2A2PA 3APQA 2C80A 4DSRA 1HYUA 22GSA 5HQPA 4BWQA 1K0BA 2GSTA 2R6KA 1OKTA 4AJ8A 3GIXA 1GL8A 4DVCA 4ZIJA 2DJJA 4OCEA 5A4UA 4TN8A 5DAKB 2IFQA 3L9UA 1BX9A 4RUVA 3M3MA 2OE3A 3P2AA 3CSJA 3L78A 2NVLA 1Z5YE 2A4HA 2DLXA 4KB3A 3KIJA 2VL2C 5BMUA 2H1DA 3QCPA 4N0ZA 1JLVA 2GQMA 4BIKA 3VK9A 4XCSA 1XIYA 1IYIA 3W8JA 4EE0A 8GSSA 2LNTA 3GHAA 2H1GA 4HQSA 4K2XA 1A8YA 2YJ7A 3ZVJD 1NSWA 1DE2A 3ED3A 2LRCA 4JRRA 1O85A 1GUHA 4K7NA 2J9HA 3F8UA 2ES7A 2VL2A 1M2DA 2N5BA 1EEMA 2I1UA 1YQ1A 1TRWA 2R0CA 1PA3A 2RUFA 2DIYA 5F05A 2C3QA 3H79A 5DALB 4HZ4A 4XHMA 4KH7A 1LU4A 5CO3A 3HZ8A 6GSXA 2VLVA 2YWOA 4EKZA 5ELAA 2WS2A 4PQHA 2YWNA 1SJZA 3KXOA 4L0UA 3DVWA 1VF3A 2DJKA 1TK5B 2WJUA 4KX4A 3ZMKA 5KEJA 2VCZA 4CHSA 2A2RA 1K0OA 1CQHA 1JZRA 2HXKA 3FZ4A 4YAVA 4JEDA 1BJXA 4HSCX 5HR0A 5J41A 3D6IA 1YF0A 2CZ3A 12GSA 4K5SA 1U88A 1ZYQB 3G7IA 2X8GA 3C7MA 3EC3A 1QGVA 4H86A 1AAZA 5EVOA 1PX7A 5DJLA 3EE2A 5G5FA 2DJ2A 3IDVA 3QAWA 1TRVA 2IPAA 3UARA 4IBPA 1GSEA 1BYEA 6GSYA 2H0GA 4WXTA 1JZDA 2HSYA 3MDKA 1JLWA 2FA4A 5ENUA 3IE3A 4CY6A 3LORA 1T3BA 5D9VA 2R0GA 2GSRA 1T1VA 4MDCA 2RM6A 1A8LA 1WPIA 1ACVA 3UL3A 2PBJA 2R3XA 3Q6OA 10GSA 2E7PA 5CREA 3GNJA 3IBHA 4BVYA 5D9WA 1GUMA 3HD5A 4TKYA 1A0RP 1WMJA 4HOJA 1GTUA 2QKEA 5D8IA 2R2JA 2G2QA 4LL1B 2AJQB 4EVMA 3GTUB 1ZGNA 2WGRA 3O76A 2C0EA 2F8FA 1FOVA 1G0TA 1GNEA 3Q19A 2HRKA 1R5PA 2CVBA 2V32A 3VI5A 3LYPA 4MJEA 5F0GA 3ERGA 5HFKA 4QQ7A 3KD0A 2JL4A 1AW9A 4N11A 2AV4A 3D4TA 5CRGA 4GSNA 3LEFA 3M9KA 3MNGA 2LRTA 1U87A 5F8BA 2JZSA 1GSDA 4K7OA 1K3YA 2BTOT 4JR4A 3UIWA 3A5WA 1Y25A 1GSFA 3M1GA 2KLXA 1EGOA 4G10A 3ERWA 2TRXA 4YQUA 2HI7A 4PQIA 1SU9A 2HFDA 18GSA 5JWQB 3G7JA 1Z7PA 2MMOA 2FA8A 4TR0A 4IJ3A 1BEDA 5KN2A 2LSTA 3VWUA 2JADA 4NHWA 2KOKA 1B8XA 5ECQB 3ZYWA 5H5RA 4JZQA 2DC5A 5A4WA 3FYGA 3H1NA 1Z6NA 4EUYA 2K18A 3LW9A 2VO4A 2IFQB 1XOAA 2C0FA 5AGYA 3W8SA 2VCTA 1GLQA 1HNBA 1TI1A 4G9HA 4G0LA 4IS0A 3F0IA 4XIHA 1YEXA 2KUCA 4KE3A 2IIYA 4V2MA 4F0CA 4K1FA 3BCKA 1N2AA 2N5FA 2E0QA 2GZZA 2O7KA 5ECNB 1DE1A 3G7YA 4XS1A 1J0FA 1PFOA 2DKIA 2EIQA 1ZYEA 3EWLA 3TKQA 2LKUA 1FVKA 3M0FA 14GSA 3BJ5A 4KAEA 1OYJA 3ZFLA 4WETA 4O5QA 1MDKA 5LD0A 1THOA 5G2ZA 3CTFA 1BG5A 2VOCA 3M9JA 1T00A 16GSA 3HYPA 3GL5A 3QOUA 4HU9A 3D5JA 2I9HA 3OR5A 5CRHA 3QMXA 3HXSA 4O7HA 2VIMA 3JCML 1O6JA 2AAWA 1X9SB 4BPYA 5JWRB 1S3RA 3CTGA 4TR1A 3FY7A 2L59A 3H93A 1USBA 4MA9A 2GZYA 4PGTA 1ZYPA 1SD8A 2R0PA 5LNKe 2VL9A 5DDLA 1V57A 1O73A 1ERWA 5KOWA 3C71A 2MBTA 4IP1A 5ECPB 4I8BA 2H76A 5H5SA 1TRUA 4IELA 3LWAA 4MF7A 5G30A 5D96A 3HDCA 3KM6A 1SK0A 2PPTA 4RQRA 2LRNA 4QL7A 3MWHA 1URMA 1M9BA 4KGIA 3GA4A 1QUWA 1JZOA 1XWKA 3FR9A 1H4OA 2B7KA 1SJ6A 3FW2A 4ZL7A 3GKMA 2FUG2 2YWIA 2KHPA
chains in the Genus database with same CATH topology
4PNGA 5CRWA 4EDYA 4RI6A 3CXGA 3TRXA 1AUCA 1F9MA 2DMLA 4L8EA 3P90A 2HRAA 1TXXA 3CSHA 2BMXA 3MAKA 1TDIA 2ON5A 3I9V2 4PTSA 1WP0A 3KCMA 4K7IA 2NBSA 4KSMA 4RQXA 1W4VA 1YY7A 1K0AA 3NZNA 2H8LA 4ECBA 3F63A 5GZZB 2LJKA 4EDZA 3ZL5A 3L9VA 4BVYB 3ME7A 3KH7A 1HQOA 3GV1A 3E0UA 5KN1A 3GH9A 1SD9A 2GSQA 4KDXA 2G0FA 4YKFA 1K0NA 1W89A 2V6OA 3D22A 4GXZA 4MJAA 2GT6A 1SJIA 3EMPA 2WDUA 2ZCTA 2VCVA 1GTAA 4ZB6A 1XW9A 3I69A 2AB6A 3P7XA 1DUGA 3GSTA 4TR4A 1PKZA 4Z7XA 4KA0A 5CRDA 4DEJA 3TKSE 4AJ7A 5J9BA 2IN3A 5FWGA 1UVZA 6GSUA 1SKSB 2LEGA 2GZPA 1ABAA 4A5PA 2H19A 5C04A 1YDKA 1MTCA 3D21A 5IMCA 4ID0A 1GH2A 2OE0A 4F2IA 2OBIA 6GSVA 3ME8A 3FK8A 4YQVA 1VF2A 2XHFA 4Q5QA 5AIVA 5IMVA 4PUAA 4X1UA 1MD4A 1ILOA 2DJ0A 3TKSC 2YP6A 4IVFA 5F06A 2GQLA 3C8EA 4MH3A 1WJKA 3M8NA 1QFNA 3WGDA 1UN2A 1YEPA 3D4MA 1OAZA 2H1BA 3FKFA 1XVWA 3EPTA 2CT6A 1B48A 5DCHA 2E2GA 2H75A 3V1WA 3C73A 1OC9A 1O8XA 4HJ2A 4BVXB 4OCFA 2PERA 4IHUA 3TKSA 3ZVJA 4BA7A 2CQ9A 5B8AA 5ECRB 3TRPA 3UMAA 3EU3A 1Z9HA 4FYUA 4LMWA 2OBKA 2C4JA 2HZFA 3C1RA 2VLUA 4RI7A 3TDGA 3US3A 4Z2RA 2TIRA 2HLSA 4Z2TA 3A2XA 2YCDA 7GSSA 2HRFA 2VAFA 1ON4A 2XBIA 2EC4A 2GDRA 2YPMA 1TTZA 1GULA 1XVQA 2C8UA 1GSUA 2F8AA 3F3RA 4HDEA 4BL7A 5D9TA 5CAXA 1T7PB 3DVXA 3P8WA 2H6ZA 3N9JA 4ECIA 4HZ2A 4HUAA 3ZREA 3A2WA 5JWOB 4JE1A 3KMNA 2D2ZA 4USSA 4TR1B 1FW1A 1PL1A 1QK8A 2F3MA 3AY8A 4Q5NA 2FWHA 1Z6MA 4ZXGA 2V1MA 5DBQA 4ZB8A 2B1LA 2VD0A 1J08A 2V6KA 3KJYA 3IK7A 3L9SA 3TJKA 3WGEA 3VWWA 3O6TA 1FG4A 2KP2A 3KEBA 2J23A 1K0DA 3TKPA 1OE8A 2HT9A 1YF1A 4MZWA 3HY2A 1EP8A 4WBJA 4XRAA 2P0GA 2ZUPA 2CX3A 3RPNA 3HA9A 2H30A 20GSA 1FAAA 1EWXA 2YV9A 4FYBA 1JHBA 1WRYA 4OFTA 4FH8A 2H71A 1HNCA 4V2NA 5AN1A 2YWMA 3PGTA 4QL9A 1G7EA 1PRXA 3TGZA 4MCUA 2NDOA 2VM1A 3HJMA 4K5RA 1SYRA 2H6XA 4MABA 5INYA 1GSSA 1EGRA 2LJAA 5IIZA 1UC7A 1MEKA 3DKSA 5ECSA 2L6DA 2DMMA 2I4AA 3BBYA 4MH2A 3VFIA 2L5LA 3L4NA 4WBRD 1U3AA 3IV4A 3IOSA 4EL1A 2FCHA 1EOGA 4TR3A 4PX1A 1VGLA 2O8VB 5JCUA 3BD2A 4FIWA 2FGXA 4ZBBA 3VLNA 4MF6A 5AIXA 5IQYA 4EO3A 4LLRA 1KBNA 2H66A 3J7Yk 1AQVA 1S3DA 1ZZYA 1O7UA 3UBKA 1AIUA 3IK9A 5D9XA 4KUNA 3TOTA 4DSSA 3F3QA 5KOXA 3HZ4A 4HU7A 3UOMA 9GSSA 4ZBDA 2FWGA 1VF1A 1ZL9A 3DYRA 4L5OA 3F4SA 3Q18A 5HR1A 4NXIA 3LG6A 1C72A 4MPFA 1VRSD 1R4WA 5ECHB 3I6AA 3UAPA 3KMOA 3S9FA 1SYXA 4FYCA 3TKRA 4PNFA 4DSQA 2YN1A 5EY6A 2WZ9A 2MMAA 1OC3A 4GRFA 3O3TA 1WE0A 3GKNA 3MIXA 4IN0A 2XPEA 5J3RA 5J9CA 2PU9C 1ERVA 3CRUA 1M99A 5B8BA 3GKKA 3DGQA 5HFIA 3FMWA 5KN3A 3QDNA 1M7TA 3KGKA 4HS1A 2M80A 4F9ZA 1SL2B 2K9FA 1X0RA 5IM9A 3TRQA 5FT3A 2YOIA 2IMFA 1EEJA 2EIRA 1TKDB 3ZZXA 1XW5A 4OO5A 2GVPA 2O85A 1TK8B 4X43A 5C00A 5HR2A 2DJ3A 5FHIA 2R37A 2LTKA 3MYDA 2YZUA 3QR6A 4K0GA 3FRCA 1GTIA 3EU4A 5IO2A 1FOHA 3IAS2 2H0IA 2N5AA 4GF0A 1OVNA 1OC9B 3ZIVA 4N10A 2MMNA 2GLRA 5COHA 1PN0A 2H72A 4POKA 5JCWA 2WRTA 3HVXA 5IPGA 2CVKA 4X4JA 5HFGA 1LJRA 5G1LA 4WR4A 4G0KA 6GSTA 3FZAA 3QAGA 3GURA 1YZXA 2CZ2A 2HSHA 2IMKA 1F6MC 5DQYA 2HE3A 1OE7A 4HJMA 2WB9A 1SENA 3BCIA 2B5EA 4O32A 1XCCA 4G19A 4D73A 2B7JA 2LQQA 1FB6A 3QPMA 4MNNA 4FQUA 5D73A 2PN8A 2PMTA 3TJGA 3RDWA 1XXUA 2QGVA 2FLSA 1V58A 3E9JB 3ZFBA 4POMA 1JFUA 2WULA 5DVBA 1B4QA 2M46A 5GAPD 1A0FA 1B9YC 4V2LA 2LV3A 2OJLA 5A5KA 4K8MA 2MMZA 2Z9SA 3ZTLA 2IWTA 1WIKA 1TW9A 1T4ZA 5EPFA 5ECOB 4POLA 4TRXA 1Z7RA 2H6YA 3PPUA 3HVSA 6GSWA 1XWGA 2QSIA 1SKRB 2JSYA 2V41A 4E8HA 4J2FA 2MBSA 2QA1A 2JZTA 1TU8A 2C0GA 2X64A 3HHVA 3DEXA 1I5GA 1PGTA 2L6CA 5IMDA 3TJBA 3LFLA 2V2GA 2YJHA 3GYKA 5EL8A 2O87A 3HJPA 4L5LA 1PMTA 2H1AA 1PX6A 3TJJA 3F6DA 4JR6A 4MMMA 1XFLA 4G0IA 4NAXA 1I9DA 1ZCPA 2YZHA 1Q4JA 2K6VA 3GX8A 4I97A 2P31A 2KP1A 3GSSA 4ZL9A 3APSA 2REMA 1Z3EA 2MZCA 2AUVA 5L71A 4OWYA 1M0UA 4KDYA 4KNDA 1TK0B 13GSA 2FWEA 4X0XA 2CV4A 4NV5A 2GSSA 1QMVA 1GNWA 1J9BA 3KZQA 3HCZA 5B6NA 4ACSA 3LQ7A 2GTUA 4K2DA 4LA1A 4ECJA 3A3TA 3U5RE 5ELGA 2B5YA 2CX4A 3WYWA 2PVOC 2C1YA 1T8EB 4YH2A 5DCGA 1AXDA 4F82A 1SL1B 1H75A 3KP8A 2B6MA 2K8SA 5E59A 1SKWB 2FNOA 4G2EA 2L4CA 3N5OA 2BJXA 5AISA 2XC2A 4NPBA 5CNWA 2HRNA 5JCGA 4LMVA 4ML1A 4TW5A 2LJRA 1PSQA 1AC1A 1F3AA 4ZB9A 2H73A 4J57E 1XOBA 3GX0A 4ECCA 4LL4B 1V9WA 4NMUA 2B5XA 4ML6A 4MP4A 4YQMA 4F0BA 1V98A 2K8VA 4KDUA 2QA2A 3TJFA 3DMLA 1GRXA 3EYTA 4OMVA 3LJRA 2UZ8A 2I81A 4EF0A 3F6FA 1JZWA 3F9UA 4ILFA 4MJBA 3FEUA 1SL0B 2OADA 1ERTA 1OKDA 2LQOA 3WGXA 5H5QA 3LXZA 5GSTA 3EVIA 5G31A 1MDJA 3KP9A 5CYYA 3RHCA 3IRAA 3ZIJA 4PXOA 1G6YA 1IYHA 2EIOA 1R7HA 2NTOA 3QD9A 4GCIA 4AGSA 4TXOA 4I6XA 1X5DA 1RW1A 2CAQA 1ZOFA 3IA1A 1M2BA 1F2EA 1Y6EA 1A23A 4ULXA 1EV4A 2VM2A 11GSA 2DBCA 4HEA2 1F3BA 5ABRA 4D73B 4WKWA 4MF5A 4WR5A 3HJOA 2HSMA 2X4AA 3FR3A 2X99A 1TOFA 4TXVA 5IMFA 1KEBA 4HQZA 4Q5RA 4J56E 5GAND 2YV7A 3QAVA 1FVJA 3IAM2 2LNSA 4KW6A 1VF4A 5IOWA 2H74A 4N30A 1RQMA 3IHQA 2PVQA 2NPBA 2H70A 3FZ9A 4ZBAA 4MPGA 2CVDA 5B7CA 1FO5A 2M72A 1WWJA 3R2QA 2OKAA 2PGTA 2YANA 1B9XC 3NIVA 2IMEA 2FY6A 2L4QA 3CSIA 3ERFA 4KCAA 4K0NA 2AHEA 3A5IA 3SWLA 1O81A 1YKAA 3GKXA 4FO5A 4OD7A 4KSOA 3IC8A 1S3AA 1XPVA 2P5QA 4N0VA 2CA8A 5CP1A 1X9WB 4P3YB 1S3CA 2GT5A 2DSAA 3DRNA 1O8WA 5ID2A 2YNXA 3GL3A 2ZNMA 2XPDA 1TP9A 3U6VA 1THXA 3FZ5A 5E4WA 5IOXA 1E6BA 1FHEA 2IMDA 1N8JA 3C1SA 4EC0A 1XZOA 4EIQA 3EMXA 1M9AA 1GLPA 3KTLA 4PQ1A 4IQ1A 2B3SA 2QC7A 3CBUA 1EV9A 1F37A 2OE1A 2P5RA 4OO4A 4WF5A 4K9ZA 4I2TA 3WT1A 4IP6A 3ZITA 4GWRA 4IGJA 2R4VA 1BAYA 4EIPA 2LUSA 5ECLB 4AJ6A 3G9BA 4Z2UA 2WFCA 1NM3A 5A4VA 1EP7A 4IW9A 2PUKC 3PR8A 1AQWA 3GRXA 4NV2A 4JBBA 1CQGA 1ERUA 4I5QA 2PWJA 2ALBA 5IMZA 1A2JA 2HZEA 2FHEA 2OA7A 4YAPA 4YKGA 5IPHA 3IXRA 2GS3A 1GSYA 1QXHA 3ISOA 5B6MA 17GSA 3J7Yb 1KNGA 4EXJA 2H0HA 4XS4A 3Q74A 3TOUA 2R5GA 1TI3A 1XWCA 2JSZA 1U6TA 2H01A 2VD1A 4F03A 5ECKB 2A2SA 2E2MA 3NOFA 2C0DA 2L57A 3HVVA 1PKWA 4IKHA 1G7OA 1ST9A 1E2YA 3TCOA 3RHBA 3GFKA 2OACA 1Q98A 3RAZA 5D93A 1MDIA 3MSZA 3R3EA 2TRCP 3UJ1A 5DAKA 1XBSA 2LS5A 3GN3A 1A24A 4ZL8A 2HNLA 3DWVA 4KF9A 4BVXA 1SK2A 4TVEA 1AQXA 1K3OA 2C3NA 5IO0A 1A2MA 3EURA 2GQKA 1EOHA 1HD2A 3D0ZA 4V1Ap 4BWSA 1UA5A 2O89A 4MK3A 1K0CA 3LYKA 5BRTA 3GUSA 1T4YA 4POBA 4K6XA 1XWBA 4NHZA 1RK4A 5DQSA 2VCWA 1TJDA 1G6WA 4NWYA 4V1Ag 4O5UA 4TXOB 3UVTA 3VPTA 3GMFA 5GSSA 3KH9A 4PURA 3ZLPA 2JACA 2F51A 4GTUA 5ECMB 4ISDA 2FWFA 5F07A 1V2AA 1PQNA 1ZMAA 5ECIB 1GTBA 5DALA 19GSA 3DD3A 3UBLA 1PL2A 1BQ7A 1PN9A 4BL7B 1GSQA 1SK1A 5J5NA 4MZCA 1X5CA 4ZILA 4XS6A 4MJCA 2IMIA 2X8CA 2VUPA 2RUEA 1LBKA 3KTBA 4CY8A 1DBYA 5IMAA 5KN0A 1X9MB 1XW6A 4GLTA 3HKRA 1XWAA 4GQCA 4TOPA 3F4TA 3APOA 3PINA 2RLIA 1GUKA 5DJMA 3CYNA 1EZKA 3H8QA 2F9SA 1M2AA 4MLYA 1WOUA 4GQFA 3RBTA 1TU7A 4WF4A 2X8HA 3GH6A 3FR6A 1YJ6A 2B1KA 3WD6A 2JU5A 3W6GA 3I43A 3LXTA 1V40A 3ZMLA 3VURA 2RIIA 1B4PA 4L0WA 4AF2A 1ML6A 4WEYA 1YKCA 1DSBA 3A2VA 1NHOA 4HI7A 1A2LA 1NW2A 3VPQA 1GP1A 3IHGA 4OFMA 1HNAA 1U3IA 3TUEA 6GSSA 2X49A 4MZBA 3VI7A 1MD3A 4GSTA 5ID2B 3ZRDA 1KTEA 3BOAA 1R26A 2AYTA 4Q5FA 2DIZA 2VCQA 4I2UA 3DXBA 3VWVA 2A4VA 4O5RA 3DIEA 2I3YA 2RM5A 3IPZA 1K0MA 3SBCA 4CDOA 3WT2A 3VWXA 4DSSB 4OFNA 2VLTA 3F4RA 2HYXA 2FD3A 4XRDA 4IJIA 3GTUA 1OC8A 2WCIA 5HR3A 2IL3A 3FHKA 2ON7A 1GWCA 5J4UA 4XTSA 1PD21 3TB2A 4PUFC 1R5AA 3LGCA 2XBQA 2CAIA 3K8NA 3PH9A 2DJ1A 1K3LA 2GGTA 1TRSA 3QFAC 2C3TA 3EINA 3CMIA 3QFBC 2DKHA 5G1KA 3RPPA 3L0HA 3IC4A 2L5OA 1FB0A 1NHYA 1QQ2A 3UVHA 4E8EA 2HZEB 2JZRA 2VL3A 4IQAA 3IR4A 4GSSA 4ICYA 2MYGA 2VCXA 1X5EA 4XS4B 5G5EA 3UEMA 2IJYA 4CW9A 3LSZA 4JU5A 4O92A 1ZYNA 3E3EA 3H4KA 4KCEA 3CRTA 5LCZA 2A2PA 3APQA 2C80A 4DSRA 1HYUA 22GSA 5HQPA 4BWQA 1K0BA 2GSTA 2R6KA 1OKTA 4AJ8A 3GIXA 1GL8A 4DVCA 4ZIJA 2DJJA 4OCEA 5A4UA 4TN8A 5DAKB 2IFQA 3L9UA 1BX9A 4RUVA 3M3MA 2OE3A 3P2AA 3CSJA 3L78A 2NVLA 1Z5YE 2A4HA 2DLXA 4KB3A 3KIJA 2VL2C 5BMUA 2H1DA 3QCPA 4N0ZA 1JLVA 2GQMA 3VK9A 4XCSA 1XIYA 1IYIA 3W8JA 4EE0A 8GSSA 2LNTA 3GHAA 2H1GA 4HQSA 4K2XA 1A8YA 2YJ7A 3ZVJD 1NSWA 1DE2A 3ED3A 2LRCA 4JRRA 1O85A 1GUHA 4K7NA 2J9HA 3F8UA 2ES7A 2VL2A 1M2DA 2N5BA 1EEMA 2I1UA 1YQ1A 1TRWA 2R0CA 1PA3A 2RUFA 2DIYA 5F05A 2C3QA 3H79A 5DALB 4HZ4A 4XHMA 4KH7A 1LU4A 5CO3A 3HZ8A 6GSXA 2VLVA 2YWOA 4EKZA 5ELAA 2WS2A 4PQHA 2YWNA 1SJZA 3KXOA 4L0UA 3DVWA 1VF3A 2DJKA 1TK5B 2WJUA 4KX4A 3ZMKA 5KEJA 2VCZA 4CHSA 2A2RA 1K0OA 1CQHA 1JZRA 2HXKA 3FZ4A 4YAVA 4JEDA 1BJXA 5HR0A 5J41A 3D6IA 1YF0A 2CZ3A 12GSA 4K5SA 1U88A 1ZYQB 3G7IA 2X8GA 3C7MA 3EC3A 1QGVA 4H86A 1AAZA 5EVOA 1PX7A 5DJLA 3EE2A 5G5FA 2DJ2A 3IDVA 3QAWA 1TRVA 2IPAA 3UARA 4IBPA 1GSEA 1BYEA 6GSYA 2H0GA 4WXTA 1JZDA 2HSYA 3MDKA 1JLWA 2FA4A 5ENUA 3IE3A 4CY6A 3LORA 1T3BA 5D9VA 2R0GA 2GSRA 1T1VA 4MDCA 2RM6A 1A8LA 1WPIA 1ACVA 3UL3A 2PBJA 2R3XA 3Q6OA 10GSA 2E7PA 5CREA 3GNJA 3IBHA 4BVYA 5D9WA 1GUMA 3HD5A 4TKYA 1A0RP 1WMJA 4HOJA 1GTUA 2QKEA 5D8IA 2R2JA 2G2QA 4LL1B 2AJQB 4EVMA 3GTUB 1ZGNA 2WGRA 3O76A 2C0EA 2F8FA 1FOVA 1G0TA 1GNEA 3Q19A 2HRKA 1R5PA 2CVBA 2V32A 3VI5A 3LYPA 4MJEA 5F0GA 3ERGA 5HFKA 4QQ7A 3KD0A 2JL4A 1AW9A 4N11A 2AV4A 3D4TA 5CRGA 4GSNA 3LEFA 3M9KA 3MNGA 2LRTA 1U87A 5F8BA 2JZSA 1GSDA 4K7OA 1K3YA 2BTOT 4JR4A 3UIWA 3A5WA 1Y25A 1GSFA 3M1GA 2KLXA 1EGOA 4G10A 3ERWA 2TRXA 4YQUA 2HI7A 4PQIA 1SU9A 2HFDA 18GSA 5JWQB 3G7JA 1Z7PA 2MMOA 2FA8A 4TR0A 4IJ3A 1BEDA 5KN2A 2LSTA 3VWUA 2JADA 4NHWA 2KOKA 1B8XA 5ECQB 3ZYWA 5H5RA 4JZQA 2DC5A 5A4WA 3FYGA 3H1NA 1Z6NA 4EUYA 2K18A 3LW9A 2VO4A 2IFQB 1XOAA 2C0FA 5AGYA 3W8SA 2VCTA 1GLQA 1HNBA 1TI1A 4G9HA 4G0LA 4IS0A 3F0IA 4XIHA 1YEXA 2KUCA 4KE3A 2IIYA 4V2MA 4F0CA 4K1FA 3BCKA 1N2AA 2N5FA 2E0QA 2GZZA 2O7KA 5ECNB 1DE1A 3G7YA 4XS1A 1J0FA 2DKIA 2EIQA 1ZYEA 3EWLA 3TKQA 2LKUA 1FVKA 3M0FA 14GSA 3BJ5A 4KAEA 1OYJA 3ZFLA 4WETA 4O5QA 1MDKA 5LD0A 1THOA 5G2ZA 3CTFA 1BG5A 2VOCA 3M9JA 1T00A 16GSA 3HYPA 3GL5A 3QOUA 4HU9A 3D5JA 2I9HA 3OR5A 5CRHA 3QMXA 3HXSA 4O7HA 2VIMA 3JCML 1O6JA 2AAWA 1X9SB 4BPYA 5JWRB 3CTGA 4TR1A 3FY7A 2L59A 3H93A 1USBA 4MA9A 2GZYA 4PGTA 1ZYPA 1SD8A 2R0PA 5LNKe 2VL9A 5DDLA 1V57A 1O73A 1ERWA 5KOWA 3C71A 2MBTA 4IP1A 5ECPB 4I8BA 2H76A 5H5SA 1TRUA 4IELA 3LWAA 4MF7A 5G30A 5D96A 3HDCA 3KM6A 1SK0A 2PPTA 4RQRA 2LRNA 4QL7A 3MWHA 1URMA 1M9BA 4KGIA 3GA4A 1QUWA 1JZOA 1XWKA 3FR9A 1H4OA 2B7KA 1SJ6A 3FW2A 4ZL7A 3GKMA 2FUG2 2YWIA 2KHPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PNG A;  5CRW A;  4EDY A;  4RI6 A;  3CXG A;  3TRX A;  1AUC A;  1F9M A;  2DML A;  4L8E A;  3P90 A;  1TXX A;  3CSH A;  2BMX A;  3MAK A;  1TDI A;  2ON5 A;  3I9V 2;  1WP0 A;  3KCM A;  4K7I A;  2NBS A;  4KSM A;  4RQX A;  1W4V A;  1YY7 A;  1K0A A;  3NZN A;  2H8L A;  4ECB A;  3F63 A;  5GZZ B;  2LJK A;  4EDZ A;  3ZL5 A;  3L9V A;  3ME7 A;  3KH7 A;  1HQO A;  3GV1 A;  3E0U A;  5KN1 A;  3GH9 A;  1SD9 A;  2GSQ A;  4KDX A;  2G0F A;  1K0N A;  1W89 A;  2V6O A;  3D22 A;  4GXZ A;  4MJA A;  2GT6 A;  1SJI A;  3EMP A;  2WDU A;  2ZCT A;  2VCV A;  1GTA A;  4ZB6 A;  1XW9 A;  3I69 A;  2AB6 A;  3P7X A;  1DUG A;  3GST A;  4TR4 A;  1PKZ A;  4Z7X A;  4KA0 A;  5CRD A;  4DEJ A;  3TKS E;  4AJ7 A;  5J9B A;  2IN3 A;  5FWG A;  1UVZ A;  6GSU A;  1SKS B;  2LEG A;  2GZP A;  1ABA A;  2H19 A;  5C04 A;  1YDK A;  1MTC A;  3D21 A;  5IMC A;  4ID0 A;  1GH2 A;  2OE0 A;  4F2I A;  2OBI A;  6GSV A;  3ME8 A;  3FK8 A;  4YQV A;  1VF2 A;  2XHF A;  4Q5Q A;  5AIV A;  5IMV A;  4PUA A;  4X1U A;  1MD4 A;  1ILO A;  2DJ0 A;  3TKS C;  2YP6 A;  4IVF A;  5F06 A;  2GQL A;  3C8E A;  4MH3 A;  1WJK A;  3M8N A;  1QFN A;  3WGD A;  1UN2 A;  1YEP A;  3D4M A;  1OAZ A;  2H1B A;  3FKF A;  1XVW A;  2CT6 A;  1B48 A;  5DCH A;  2E2G A;  2H75 A;  3V1W A;  3C73 A;  1OC9 A;  1O8X A;  4HJ2 A;  4OCF A;  2PER A;  4IHU A;  3TKS A;  3ZVJ A;  4BA7 A;  2CQ9 A;  5B8A A;  5ECR B;  3TRP A;  3UMA A;  3EU3 A;  1Z9H A;  4FYU A;  4LMW A;  2OBK A;  2C4J A;  2HZF A;  3C1R A;  2VLU A;  4RI7 A;  3TDG A;  3US3 A;  2TIR A;  2HLS A;  3A2X A;  2YCD A;  7GSS A;  2HRF A;  2VAF A;  1ON4 A;  2XBI A;  2EC4 A;  2GDR A;  2YPM A;  1TTZ A;  1GUL A;  1XVQ A;  2C8U A;  1GSU A;  2F8A A;  3F3R A;  4HDE A;  4BL7 A;  5D9T A;  5CAX A;  1T7P B;  3DVX A;  3P8W A;  2H6Z A;  3N9J A;  4ECI A;  4HZ2 A;  4HUA A;  3ZRE A;  3A2W A;  5JWO B;  4JE1 A;  3KMN A;  2D2Z A;  4TR1 B;  1FW1 A;  1PL1 A;  1QK8 A;  2F3M A;  3AY8 A;  4Q5N A;  2FWH A;  1Z6M A;  4ZXG A;  2V1M A;  5DBQ A;  4ZB8 A;  2B1L A;  2VD0 A;  1J08 A;  2V6K A;  3KJY A;  3IK7 A;  3L9S A;  3TJK A;  3WGE A;  3VWW A;  3O6T A;  1FG4 A;  2KP2 A;  3KEB A;  2J23 A;  1K0D A;  3TKP A;  1OE8 A;  2HT9 A;  1YF1 A;  4MZW A;  3HY2 A;  1EP8 A;  4WBJ A;  4XRA A;  2P0G A;  2ZUP A;  2CX3 A;  3RPN A;  3HA9 A;  2H30 A;  20GS A;  1FAA A;  1EWX A;  2YV9 A;  4FYB A;  1JHB A;  1WRY A;  4OFT A;  4FH8 A;  2H71 A;  1HNC A;  4V2N A;  5AN1 A;  2YWM A;  3PGT A;  4QL9 A;  1G7E A;  1PRX A;  3TGZ A;  4MCU A;  2NDO A;  2VM1 A;  3HJM A;  1SYR A;  2H6X A;  4MAB A;  5INY A;  1GSS A;  1EGR A;  2LJA A;  5IIZ A;  1UC7 A;  5ECS A;  1MEK A;  3DKS A;  2L6D A;  2DMM A;  2I4A A;  3BBY A;  4MH2 A;  3VFI A;  2L5L A;  3L4N A;  4WBR D;  1U3A A;  3IV4 A;  3IOS A;  4EL1 A;  2FCH A;  1EOG A;  4TR3 A;  4PX1 A;  1VGL A;  2O8V B;  5JCU A;  3BD2 A;  4FIW A;  2FGX A;  4ZBB A;  3VLN A;  4MF6 A;  5AIX A;  5IQY A;  4EO3 A;  4LLR A;  1KBN A;  2H66 A;  3J7Y k;  1AQV A;  1S3D A;  1ZZY A;  1O7U A;  3UBK A;  1AIU A;  3IK9 A;  5D9X A;  4KUN A;  3TOT A;  4DSS A;  3F3Q A;  3HZ4 A;  4HU7 A;  3UOM A;  9GSS A;  4ZBD A;  2FWG A;  1VF1 A;  1ZL9 A;  3DYR A;  4L5O A;  3F4S A;  3Q18 A;  5HR1 A;  4NXI A;  3LG6 A;  1C72 A;  4MPF A;  1VRS D;  1R4W A;  5ECH B;  3I6A A;  3UAP A;  3KMO A;  3S9F A;  1SYX A;  4FYC A;  3TKR A;  4PNF A;  4DSQ A;  2YN1 A;  5EY6 A;  2WZ9 A;  2MMA A;  1OC3 A;  4GRF A;  3O3T A;  1WE0 A;  3GKN A;  4IN0 A;  2XPE A;  5J3R A;  5J9C A;  2PU9 C;  1ERV A;  3CRU A;  1M99 A;  5B8B A;  3GKK A;  3DGQ A;  5HFI A;  5KN3 A;  3QDN A;  1M7T A;  3KGK A;  4HS1 A;  2M80 A;  4F9Z A;  1SL2 B;  2K9F A;  1X0R A;  5IM9 A;  3TRQ A;  5FT3 A;  2YOI A;  2IMF A;  1EEJ A;  2EIR A;  1TKD B;  3ZZX A;  1XW5 A;  4OO5 A;  2GVP A;  2O85 A;  1TK8 B;  4X43 A;  5C00 A;  5HR2 A;  2DJ3 A;  5FHI A;  2R37 A;  2LTK A;  2YZU A;  3QR6 A;  4K0G A;  3FRC A;  1GTI A;  3EU4 A;  5IO2 A;  3IAS 2;  2H0I A;  2N5A A;  4GF0 A;  1OVN A;  1OC9 B;  3ZIV A;  4N10 A;  2MMN A;  2GLR A;  5COH A;  2H72 A;  4POK A;  5JCW A;  2WRT A;  3HVX A;  5IPG A;  2CVK A;  5HFG A;  1LJR A;  5G1L A;  4WR4 A;  6GST A;  3FZA A;  3QAG A;  3GUR A;  1YZX A;  2CZ2 A;  2HSH A;  2IMK A;  1F6M C;  5DQY A;  2HE3 A;  1OE7 A;  4HJM A;  2WB9 A;  1SEN A;  3BCI A;  2B5E A;  4O32 A;  1XCC A;  4G19 A;  4D73 A;  2B7J A;  2LQQ A;  1FB6 A;  3QPM A;  5D73 A;  2PN8 A;  2PMT A;  3TJG A;  3RDW A;  1XXU A;  2QGV A;  2FLS A;  1V58 A;  3E9J B;  3ZFB A;  4POM A;  1JFU A;  2WUL A;  5DVB A;  1B4Q A;  2M46 A;  5GAP D;  1A0F A;  1B9Y C;  4V2L A;  2LV3 A;  2OJL A;  5A5K A;  4K8M A;  2MMZ A;  2Z9S A;  3ZTL A;  2IWT A;  1WIK A;  1TW9 A;  1T4Z A;  5EPF A;  5ECO B;  4POL A;  4TRX A;  1Z7R A;  2H6Y A;  6GSW A;  3HVS A;  1XWG A;  2QSI A;  1SKR B;  2JSY A;  2V41 A;  4E8H A;  4J2F A;  2MBS A;  2JZT A;  1TU8 A;  2C0G A;  2X64 A;  3HHV A;  3DEX A;  1I5G A;  1PGT A;  2L6C A;  5IMD A;  3TJB A;  3LFL A;  2V2G A;  2YJH A;  3GYK A;  5EL8 A;  2O87 A;  3HJP A;  4L5L A;  1PMT A;  2H1A A;  1PX6 A;  3TJJ A;  3F6D A;  4JR6 A;  4MMM A;  1XFL A;  4NAX A;  1I9D A;  1ZCP A;  2YZH A;  1Q4J A;  2K6V A;  3GX8 A;  4I97 A;  2P31 A;  2KP1 A;  3GSS A;  4ZL9 A;  3APS A;  2REM A;  1Z3E A;  2MZC A;  2AUV A;  5L71 A;  4OWY A;  1M0U A;  4KDY A;  4KND A;  1TK0 B;  13GS A;  2FWE A;  4X0X A;  2CV4 A;  4NV5 A;  2GSS A;  1QMV A;  1GNW A;  1J9B A;  3KZQ A;  3HCZ A;  5B6N A;  4ACS A;  3LQ7 A;  2GTU A;  4K2D A;  4LA1 A;  4ECJ A;  3A3T A;  3U5R E;  5ELG A;  2B5Y A;  2CX4 A;  3WYW A;  2PVO C;  2C1Y A;  1T8E B;  4YH2 A;  5DCG A;  1AXD A;  4F82 A;  1SL1 B;  1H75 A;  3KP8 A;  2B6M A;  2K8S A;  5E59 A;  1SKW B;  2FNO A;  4G2E A;  2L4C A;  3N5O A;  2BJX A;  5AIS A;  2XC2 A;  4NPB A;  5CNW A;  2HRN A;  5JCG A;  4LMV A;  4ML1 A;  4TW5 A;  2LJR A;  1PSQ A;  1AC1 A;  1F3A A;  4ZB9 A;  2H73 A;  4J57 E;  1XOB A;  3GX0 A;  4ECC A;  4LL4 B;  1V9W A;  4NMU A;  2B5X A;  4ML6 A;  4MP4 A;  4YQM A;  4F0B A;  1V98 A;  2K8V A;  4KDU A;  3TJF A;  3DML A;  1GRX A;  3EYT A;  4OMV A;  3LJR A;  2I81 A;  4EF0 A;  3F6F A;  1JZW A;  3F9U A;  4ILF A;  4MJB A;  3FEU A;  1SL0 B;  2OAD A;  1ERT A;  1OKD A;  2LQO A;  3WGX A;  5H5Q A;  3LXZ A;  5GST A;  3EVI A;  5G31 A;  1MDJ A;  3KP9 A;  5CYY A;  3RHC A;  3IRA A;  3ZIJ A;  4PXO A;  1G6Y A;  1IYH A;  2EIO A;  1R7H A;  2NTO A;  3QD9 A;  4GCI A;  4AGS A;  4TXO A;  4I6X A;  1X5D A;  1RW1 A;  2CAQ A;  1ZOF A;  3IA1 A;  1M2B A;  1F2E A;  1Y6E A;  1A23 A;  4ULX A;  1EV4 A;  2VM2 A;  11GS A;  2DBC A;  4HEA 2;  1F3B A;  5ABR A;  4D73 B;  4WKW A;  4MF5 A;  4WR5 A;  3HJO A;  3FR3 A;  2X99 A;  1TOF A;  4TXV A;  5IMF A;  1KEB A;  4HQZ A;  4Q5R A;  4J56 E;  5GAN D;  2YV7 A;  3QAV A;  1FVJ A;  3IAM 2;  2LNS A;  4KW6 A;  1VF4 A;  5IOW A;  2H74 A;  4N30 A;  1RQM A;  3IHQ A;  2PVQ A;  2NPB A;  2H70 A;  3FZ9 A;  4ZBA A;  4MPG A;  2CVD A;  5B7C A;  1FO5 A;  2M72 A;  1WWJ A;  3R2Q A;  2OKA A;  2PGT A;  2YAN A;  1B9X C;  3NIV A;  2IME A;  2FY6 A;  2L4Q A;  3CSI A;  3ERF A;  4KCA A;  4K0N A;  2AHE A;  3SWL A;  1O81 A;  1YKA A;  3GKX A;  4FO5 A;  4OD7 A;  4KSO A;  1S3A A;  1XPV A;  2P5Q A;  4N0V A;  2CA8 A;  5CP1 A;  1X9W B;  4P3Y B;  1S3C A;  2GT5 A;  2DSA A;  3DRN A;  1O8W A;  5ID2 A;  2YNX A;  3GL3 A;  2ZNM A;  2XPD A;  1TP9 A;  3U6V A;  1THX A;  3FZ5 A;  5E4W A;  5IOX A;  1E6B A;  1FHE A;  2IMD A;  1N8J A;  3C1S A;  4EC0 A;  1XZO A;  3EMX A;  1M9A A;  1GLP A;  3KTL A;  4PQ1 A;  4IQ1 A;  2B3S A;  2QC7 A;  3CBU A;  1EV9 A;  1F37 A;  2OE1 A;  2P5R A;  4OO4 A;  4WF5 A;  4K9Z A;  4I2T A;  3WT1 A;  4IP6 A;  3ZIT A;  4GWR A;  4IGJ A;  2R4V A;  1BAY A;  2LUS A;  5ECL B;  4AJ6 A;  3G9B A;  2WFC A;  1NM3 A;  5A4V A;  1EP7 A;  4IW9 A;  2PUK C;  3PR8 A;  1AQW A;  3GRX A;  4NV2 A;  4JBB A;  1CQG A;  1ERU A;  4I5Q A;  2PWJ A;  2ALB A;  5IMZ A;  1A2J A;  2HZE A;  2FHE A;  2OA7 A;  4YAP A;  5IPH A;  3IXR A;  2GS3 A;  1GSY A;  1QXH A;  3ISO A;  5B6M A;  17GS A;  3J7Y b;  1KNG A;  4EXJ A;  2H0H A;  4XS4 A;  3Q74 A;  3TOU A;  2R5G A;  1TI3 A;  1XWC A;  2JSZ A;  1U6T A;  2H01 A;  2VD1 A;  4F03 A;  5ECK B;  2A2S A;  2E2M A;  3NOF A;  2C0D A;  2L57 A;  3HVV A;  1PKW A;  4IKH A;  1G7O A;  1ST9 A;  1E2Y A;  3TCO A;  3RHB A;  3GFK A;  2OAC A;  1Q98 A;  3RAZ A;  5D93 A;  1MDI A;  3MSZ A;  2TRC P;  3UJ1 A;  5DAK A;  1XBS A;  2LS5 A;  3GN3 A;  1A24 A;  4ZL8 A;  2HNL A;  3DWV A;  4BVX A;  1SK2 A;  4TVE A;  1AQX A;  1K3O A;  2C3N A;  5IO0 A;  1A2M A;  3EUR A;  2GQK A;  1EOH A;  1HD2 A;  3D0Z A;  4V1A p;  4BWS A;  1UA5 A;  2O89 A;  4MK3 A;  1K0C A;  3LYK A;  3GUS A;  1T4Y A;  4POB A;  4K6X A;  1XWB A;  4NHZ A;  1RK4 A;  5DQS A;  2VCW A;  1TJD A;  1G6W A;  4NWY A;  4V1A g;  4TXO B;  3UVT A;  3VPT A;  3GMF A;  5GSS A;  3KH9 A;  4PUR A;  3ZLP A;  2JAC A;  2F51 A;  4GTU A;  5ECM B;  4ISD A;  2FWF A;  5F07 A;  1V2A A;  1PQN A;  1ZMA A;  5ECI B;  1GTB A;  5DAL A;  19GS A;  3DD3 A;  3UBL A;  1PL2 A;  1BQ7 A;  1PN9 A;  1GSQ A;  1SK1 A;  5J5N A;  4MZC A;  1X5C A;  4ZIL A;  4XS6 A;  4MJC A;  2IMI A;  2X8C A;  2VUP A;  2RUE A;  1LBK A;  3KTB A;  1DBY A;  5IMA A;  5KN0 A;  1X9M B;  1XW6 A;  4GLT A;  3HKR A;  1XWA A;  4GQC A;  4TOP A;  3F4T A;  3APO A;  3PIN A;  2RLI A;  1GUK A;  5DJM A;  3CYN A;  1EZK A;  3H8Q A;  2F9S A;  1M2A A;  4MLY A;  1WOU A;  4GQF A;  3RBT A;  1TU7 A;  4WF4 A;  2X8H A;  3GH6 A;  3FR6 A;  1YJ6 A;  2B1K A;  3WD6 A;  2JU5 A;  3W6G A;  3I43 A;  3LXT A;  1V40 A;  3ZML A;  3VUR A;  2RII A;  1B4P A;  4L0W A;  4AF2 A;  1ML6 A;  4WEY A;  1YKC A;  1DSB A;  3A2V A;  1NHO A;  4HI7 A;  1A2L A;  1NW2 A;  3VPQ A;  1GP1 A;  4OFM A;  1HNA A;  1U3I A;  3TUE A;  6GSS A;  4MZB A;  3VI7 A;  1MD3 A;  4GST A;  5ID2 B;  3ZRD A;  1KTE A;  3BOA A;  1R26 A;  2AYT A;  4Q5F A;  2DIZ A;  2VCQ A;  4I2U A;  3DXB A;  3VWV A;  2A4V A;  4O5R A;  3DIE A;  2I3Y A;  2RM5 A;  3IPZ A;  1K0M A;  3SBC A;  4CDO A;  3WT2 A;  3VWX A;  4DSS B;  4OFN A;  2VLT A;  3F4R A;  2HYX A;  2FD3 A;  4XRD A;  4IJI A;  3GTU A;  1OC8 A;  2WCI A;  5HR3 A;  2IL3 A;  3FHK A;  2ON7 A;  1GWC A;  5J4U A;  4XTS A;  1PD2 1;  3TB2 A;  4PUF C;  1R5A A;  3LGC A;  2XBQ A;  2CAI A;  3K8N A;  3PH9 A;  2DJ1 A;  1K3L A;  2GGT A;  1TRS A;  3QFA C;  2C3T A;  3EIN A;  3CMI A;  3QFB C;  5G1K A;  3RPP A;  3L0H A;  3IC4 A;  2L5O A;  1FB0 A;  1NHY A;  1QQ2 A;  3UVH A;  4E8E A;  2HZE B;  2JZR A;  2VL3 A;  4IQA A;  3IR4 A;  4GSS A;  2MYG A;  2VCX A;  1X5E A;  4XS4 B;  5G5E A;  3UEM A;  2IJY A;  4CW9 A;  3LSZ A;  4JU5 A;  4O92 A;  3E3E A;  3H4K A;  4KCE A;  3CRT A;  5LCZ A;  3APQ A;  2C80 A;  4DSR A;  1HYU A;  22GS A;  5HQP A;  4BWQ A;  1K0B A;  2GST A;  2R6K A;  1OKT A;  4AJ8 A;  3GIX A;  1GL8 A;  4DVC A;  4ZIJ A;  2DJJ A;  4OCE A;  5A4U A;  4TN8 A;  5DAK B;  2IFQ A;  3L9U A;  1BX9 A;  4RUV A;  3M3M A;  2OE3 A;  3P2A A;  3CSJ A;  3L78 A;  2NVL A;  1Z5Y E;  2DLX A;  4KB3 A;  3KIJ A;  2VL2 C;  2H1D A;  3QCP A;  4N0Z A;  1JLV A;  2GQM A;  3VK9 A;  4XCS A;  1XIY A;  1IYI A;  3W8J A;  4EE0 A;  8GSS A;  2LNT A;  3GHA A;  2H1G A;  4HQS A;  1A8Y A;  2YJ7 A;  3ZVJ D;  1NSW A;  1DE2 A;  3ED3 A;  2LRC A;  4JRR A;  1O85 A;  1GUH A;  4K7N A;  2J9H A;  3F8U A;  2ES7 A;  2VL2 A;  1M2D A;  2N5B A;  1EEM A;  2I1U A;  1YQ1 A;  1TRW A;  1PA3 A;  2RUF A;  2DIY A;  5F05 A;  2C3Q A;  3H79 A;  5DAL B;  4HZ4 A;  4XHM A;  4KH7 A;  1LU4 A;  5CO3 A;  3HZ8 A;  6GSX A;  2VLV A;  2YWO A;  4EKZ A;  5ELA A;  2WS2 A;  4PQH A;  2YWN A;  1SJZ A;  3KXO A;  4L0U A;  3DVW A;  1VF3 A;  2DJK A;  1TK5 B;  2WJU A;  4KX4 A;  3ZMK A;  5KEJ A;  2VCZ A;  4CHS A;  2A2R A;  1K0O A;  1CQH A;  1JZR A;  2HXK A;  3FZ4 A;  4YAV A;  4JED A;  1BJX A;  5HR0 A;  5J41 A;  3D6I A;  1YF0 A;  2CZ3 A;  12GS A;  1U88 A;  1ZYQ B;  3G7I A;  2X8G A;  3C7M A;  3EC3 A;  1QGV A;  4H86 A;  1AAZ A;  5EVO A;  1PX7 A;  5DJL A;  3EE2 A;  5G5F A;  2DJ2 A;  3IDV A;  3QAW A;  1TRV A;  2IPA A;  3UAR A;  4IBP A;  1GSE A;  1BYE A;  6GSY A;  2H0G A;  4WXT A;  1JZD A;  2HSY A;  3MDK A;  1JLW A;  2FA4 A;  5ENU A;  3IE3 A;  3LOR A;  1T3B A;  5D9V A;  2GSR A;  1T1V A;  4MDC A;  2RM6 A;  1A8L A;  1WPI A;  1ACV A;  3UL3 A;  2PBJ A;  2R3X A;  3Q6O A;  10GS A;  2E7P A;  5CRE A;  3GNJ A;  3IBH A;  4BVY A;  5D9W A;  1GUM A;  3HD5 A;  4TKY A;  1A0R P;  1WMJ A;  4HOJ A;  1GTU A;  2QKE A;  5D8I A;  2R2J A;  2G2Q A;  4LL1 B;  2AJQ B;  4EVM A;  3GTU B;  1ZGN A;  2WGR A;  3O76 A;  2C0E A;  2F8F A;  1FOV A;  1G0T A;  1GNE A;  3Q19 A;  1R5P A;  2CVB A;  2V32 A;  3VI5 A;  3LYP A;  4MJE A;  5F0G A;  3ERG A;  5HFK A;  4QQ7 A;  3KD0 A;  2JL4 A;  1AW9 A;  4N11 A;  2AV4 A;  3D4T A;  5CRG A;  4GSN A;  3LEF A;  3M9K A;  3MNG A;  2LRT A;  1U87 A;  5F8B A;  2JZS A;  1GSD A;  4K7O A;  1K3Y A;  2BTO T;  4JR4 A;  3UIW A;  3A5W A;  1Y25 A;  1GSF A;  3M1G A;  2KLX A;  1EGO A;  4G10 A;  3ERW A;  2TRX A;  4YQU A;  2HI7 A;  4PQI A;  1SU9 A;  2HFD A;  18GS A;  5JWQ B;  3G7J A;  1Z7P A;  2MMO A;  2FA8 A;  4TR0 A;  4IJ3 A;  1BED A;  5KN2 A;  2LST A;  3VWU A;  2JAD A;  4NHW A;  2KOK A;  1B8X A;  5ECQ B;  3ZYW A;  5H5R A;  4JZQ A;  2DC5 A;  5A4W A;  3FYG A;  3H1N A;  1Z6N A;  4EUY A;  2K18 A;  2VO4 A;  2IFQ B;  1XOA A;  2C0F A;  5AGY A;  3W8S A;  2VCT A;  1GLQ A;  1HNB A;  1TI1 A;  4G9H A;  4IS0 A;  3F0I A;  4XIH A;  1YEX A;  2KUC A;  4KE3 A;  2IIY A;  4V2M A;  4F0C A;  4K1F A;  3BCK A;  1N2A A;  2N5F A;  2E0Q A;  2GZZ A;  2O7K A;  5ECN B;  1DE1 A;  3G7Y A;  4XS1 A;  1J0F A;  2EIQ A;  1ZYE A;  3EWL A;  3TKQ A;  2LKU A;  1FVK A;  3M0F A;  14GS A;  3BJ5 A;  4KAE A;  1OYJ A;  3ZFL A;  4WET A;  1MDK A;  5LD0 A;  1THO A;  5G2Z A;  3CTF A;  1BG5 A;  2VOC A;  3M9J A;  1T00 A;  16GS A;  3HYP A;  3GL5 A;  3QOU A;  4HU9 A;  3D5J A;  2I9H A;  3OR5 A;  5CRH A;  3QMX A;  3HXS A;  4O7H A;  2VIM A;  3JCM L;  1O6J A;  2AAW A;  1X9S B;  4BPY A;  5JWR B;  3CTG A;  4TR1 A;  3FY7 A;  2L59 A;  3H93 A;  1USB A;  4MA9 A;  2GZY A;  4PGT A;  1SD8 A;  5LNK e;  2VL9 A;  5DDL A;  1V57 A;  1O73 A;  1ERW A;  3C71 A;  2MBT A;  4IP1 A;  5ECP B;  4I8B A;  2H76 A;  5H5S A;  1TRU A;  4IEL A;  3LWA A;  4MF7 A;  5G30 A;  5D96 A;  3HDC A;  3KM6 A;  1SK0 A;  2PPT A;  4RQR A;  2LRN A;  4QL7 A;  3MWH A;  1URM A;  1M9B A;  4KGI A;  3GA4 A;  1QUW A;  1JZO A;  1XWK A;  3FR9 A;  1H4O A;  2B7K A;  1SJ6 A;  3FW2 A;  4ZL7 A;  3GKM A;  2FUG 2;  2YWI A;  2KHP A; 
#chains in the Genus database with same CATH topology
 4PNG A;  5CRW A;  4EDY A;  4RI6 A;  3CXG A;  3TRX A;  1AUC A;  1F9M A;  2DML A;  4L8E A;  3P90 A;  2HRA A;  1TXX A;  3CSH A;  2BMX A;  3MAK A;  1TDI A;  2ON5 A;  3I9V 2;  4PTS A;  1WP0 A;  3KCM A;  4K7I A;  2NBS A;  4KSM A;  4RQX A;  1W4V A;  1YY7 A;  1K0A A;  3NZN A;  2H8L A;  4ECB A;  3F63 A;  5GZZ B;  2LJK A;  4EDZ A;  3ZL5 A;  3L9V A;  4BVY B;  3ME7 A;  3KH7 A;  1HQO A;  3GV1 A;  3E0U A;  5KN1 A;  3GH9 A;  1SD9 A;  2GSQ A;  4KDX A;  2G0F A;  4YKF A;  1K0N A;  1W89 A;  2V6O A;  3D22 A;  4GXZ A;  4MJA A;  2GT6 A;  1SJI A;  3EMP A;  2WDU A;  2ZCT A;  2VCV A;  1GTA A;  4ZB6 A;  1XW9 A;  3I69 A;  2AB6 A;  3P7X A;  1DUG A;  3GST A;  4TR4 A;  1PKZ A;  4Z7X A;  4KA0 A;  5CRD A;  4DEJ A;  3TKS E;  4AJ7 A;  5J9B A;  2IN3 A;  5FWG A;  1UVZ A;  6GSU A;  1SKS B;  2LEG A;  2GZP A;  1ABA A;  4A5P A;  2H19 A;  5C04 A;  1YDK A;  1MTC A;  3D21 A;  5IMC A;  4ID0 A;  1GH2 A;  2OE0 A;  4F2I A;  2OBI A;  6GSV A;  3ME8 A;  3FK8 A;  4YQV A;  1VF2 A;  2XHF A;  4Q5Q A;  5AIV A;  5IMV A;  4PUA A;  4X1U A;  1MD4 A;  1ILO A;  2DJ0 A;  3TKS C;  2YP6 A;  4IVF A;  5F06 A;  2GQL A;  3C8E A;  4MH3 A;  1WJK A;  3M8N A;  1QFN A;  3WGD A;  1UN2 A;  1YEP A;  3D4M A;  1OAZ A;  2H1B A;  3FKF A;  1XVW A;  3EPT A;  2CT6 A;  1B48 A;  5DCH A;  2E2G A;  2H75 A;  3V1W A;  3C73 A;  1OC9 A;  1O8X A;  4HJ2 A;  4BVX B;  4OCF A;  2PER A;  4IHU A;  3TKS A;  3ZVJ A;  4BA7 A;  2CQ9 A;  5B8A A;  5ECR B;  3TRP A;  3UMA A;  3EU3 A;  1Z9H A;  4FYU A;  4LMW A;  2OBK A;  2C4J A;  1XG8 A;  2HZF A;  3C1R A;  2VLU A;  4RI7 A;  3TDG A;  3US3 A;  4Z2R A;  2TIR A;  2HLS A;  4Z2T A;  3A2X A;  2YCD A;  7GSS A;  2HRF A;  2VAF A;  1ON4 A;  2XBI A;  2EC4 A;  2GDR A;  2YPM A;  1TTZ A;  1GUL A;  1XVQ A;  2C8U A;  1GSU A;  2F8A A;  3F3R A;  4HDE A;  4BL7 A;  5D9T A;  5CAX A;  1T7P B;  3DVX A;  3P8W A;  2H6Z A;  3N9J A;  4ECI A;  4HZ2 A;  4HUA A;  3ZRE A;  3A2W A;  5JWO B;  4JE1 A;  3KMN A;  2D2Z A;  4USS A;  4TR1 B;  1FW1 A;  1PL1 A;  1QK8 A;  2F3M A;  3AY8 A;  4Q5N A;  2FWH A;  1Z6M A;  4ZXG A;  2V1M A;  5DBQ A;  4ZB8 A;  2B1L A;  2VD0 A;  1J08 A;  2V6K A;  3KJY A;  3IK7 A;  3L9S A;  3TJK A;  3WGE A;  3VWW A;  3O6T A;  1FG4 A;  2KP2 A;  3KEB A;  2J23 A;  1K0D A;  3TKP A;  1OE8 A;  2HT9 A;  1YF1 A;  4MZW A;  3HY2 A;  1EP8 A;  4WBJ A;  4XRA A;  2P0G A;  2ZUP A;  2CX3 A;  3RPN A;  3HA9 A;  2H30 A;  20GS A;  1FAA A;  1EWX A;  2YV9 A;  4FYB A;  1JHB A;  1WRY A;  4OFT A;  4FH8 A;  2H71 A;  1HNC A;  4V2N A;  5AN1 A;  2YWM A;  3PGT A;  4QL9 A;  1G7E A;  1PRX A;  3TGZ A;  4MCU A;  2NDO A;  2VM1 A;  3HJM A;  4K5R A;  1SYR A;  2H6X A;  4MAB A;  5INY A;  1GSS A;  1EGR A;  2LJA A;  5IIZ A;  1UC7 A;  1MEK A;  3DKS A;  5ECS A;  2L6D A;  2DMM A;  2I4A A;  3BBY A;  4MH2 A;  3VFI A;  2L5L A;  3L4N A;  4WBR D;  1U3A A;  3IV4 A;  3IOS A;  4EL1 A;  2FCH A;  1EOG A;  4TR3 A;  4PX1 A;  1VGL A;  2O8V B;  5JCU A;  3BD2 A;  4FIW A;  2FGX A;  4ZBB A;  3VLN A;  4MF6 A;  5AIX A;  5IQY A;  4EO3 A;  4LLR A;  1KBN A;  2H66 A;  3J7Y k;  1AQV A;  1S3D A;  1ZZY A;  1O7U A;  3UBK A;  1AIU A;  3IK9 A;  5D9X A;  4KUN A;  3TOT A;  4DSS A;  3F3Q A;  5KOX A;  3HZ4 A;  4HU7 A;  3UOM A;  9GSS A;  4ZBD A;  2FWG A;  1VF1 A;  1ZL9 A;  3DYR A;  4L5O A;  3F4S A;  3Q18 A;  5HR1 A;  4NXI A;  3LG6 A;  1C72 A;  4MPF A;  1VRS D;  1R4W A;  5ECH B;  3I6A A;  3UAP A;  3KMO A;  3S9F A;  1SYX A;  4FYC A;  3TKR A;  4PNF A;  4DSQ A;  2YN1 A;  5EY6 A;  2WZ9 A;  2MMA A;  1OC3 A;  4GRF A;  3O3T A;  1WE0 A;  3GKN A;  3MIX A;  4IN0 A;  2XPE A;  5J3R A;  5J9C A;  2PU9 C;  1ERV A;  3CRU A;  1M99 A;  5B8B A;  3GKK A;  3DGQ A;  5HFI A;  3FMW A;  5KN3 A;  3QDN A;  1M7T A;  3KGK A;  4HS1 A;  2M80 A;  4F9Z A;  1SL2 B;  2K9F A;  1X0R A;  5IM9 A;  3TRQ A;  5FT3 A;  2YOI A;  2IMF A;  1EEJ A;  2EIR A;  1TKD B;  3ZZX A;  1XW5 A;  4OO5 A;  2GVP A;  2O85 A;  1TK8 B;  4X43 A;  5C00 A;  5HR2 A;  2DJ3 A;  5FHI A;  2R37 A;  2LTK A;  3MYD A;  2YZU A;  3QR6 A;  4K0G A;  3FRC A;  1GTI A;  3EU4 A;  5IO2 A;  1FOH A;  3IAS 2;  2H0I A;  2N5A A;  4GF0 A;  1OVN A;  1OC9 B;  3ZIV A;  4N10 A;  2MMN A;  2GLR A;  5COH A;  1PN0 A;  2H72 A;  4POK A;  5JCW A;  2WRT A;  3HVX A;  5IPG A;  2CVK A;  4X4J A;  5HFG A;  1LJR A;  5G1L A;  4WR4 A;  4G0K A;  6GST A;  3FZA A;  3QAG A;  3GUR A;  1YZX A;  2CZ2 A;  2HSH A;  2IMK A;  1F6M C;  5DQY A;  2HE3 A;  1OE7 A;  4HJM A;  2WB9 A;  1SEN A;  3BCI A;  2B5E A;  4O32 A;  1XCC A;  4G19 A;  4D73 A;  2B7J A;  2LQQ A;  1FB6 A;  3QPM A;  4MNN A;  4FQU A;  5D73 A;  2PN8 A;  2PMT A;  3TJG A;  3RDW A;  1XXU A;  2QGV A;  2FLS A;  1V58 A;  3E9J B;  3ZFB A;  4POM A;  1JFU A;  2WUL A;  5DVB A;  1B4Q A;  2M46 A;  5GAP D;  1A0F A;  1B9Y C;  4V2L A;  2LV3 A;  2OJL A;  5A5K A;  4K8M A;  2MMZ A;  2Z9S A;  3ZTL A;  2IWT A;  1WIK A;  1TW9 A;  1T4Z A;  5EPF A;  5ECO B;  4POL A;  4TRX A;  1Z7R A;  2H6Y A;  3PPU A;  3HVS A;  6GSW A;  1XWG A;  2QSI A;  1SKR B;  2JSY A;  2V41 A;  4E8H A;  4J2F A;  2MBS A;  2QA1 A;  2JZT A;  1TU8 A;  2C0G A;  2X64 A;  3HHV A;  3DEX A;  1I5G A;  1PGT A;  2L6C A;  5IMD A;  3TJB A;  3CQF A;  3LFL A;  2V2G A;  2YJH A;  3GYK A;  5EL8 A;  2O87 A;  3HJP A;  4L5L A;  1PMT A;  2H1A A;  1PX6 A;  3TJJ A;  3F6D A;  4JR6 A;  4MMM A;  1XFL A;  4G0I A;  4NAX A;  1I9D A;  1ZCP A;  2YZH A;  1Q4J A;  2K6V A;  3GX8 A;  4I97 A;  2P31 A;  2KP1 A;  3GSS A;  4ZL9 A;  3APS A;  2REM A;  1Z3E A;  2MZC A;  2AUV A;  5L71 A;  1M3I A;  4OWY A;  1M0U A;  4KDY A;  4KND A;  1TK0 B;  13GS A;  2FWE A;  4X0X A;  2CV4 A;  4NV5 A;  2GSS A;  1QMV A;  1GNW A;  1J9B A;  3KZQ A;  3HCZ A;  5B6N A;  4ACS A;  3LQ7 A;  2GTU A;  4K2D A;  4LA1 A;  4ECJ A;  3A3T A;  3U5R E;  5ELG A;  2B5Y A;  2CX4 A;  3WYW A;  2PVO C;  2C1Y A;  1T8E B;  4YH2 A;  5DCG A;  1AXD A;  4F82 A;  1SL1 B;  1H75 A;  3KP8 A;  2B6M A;  2K8S A;  5E59 A;  1SKW B;  2FNO A;  4G2E A;  2L4C A;  3N5O A;  2BJX A;  5AIS A;  2XC2 A;  4NPB A;  5CNW A;  2HRN A;  5JCG A;  4LMV A;  4ML1 A;  4TW5 A;  2LJR A;  1PSQ A;  1AC1 A;  1F3A A;  4ZB9 A;  2H73 A;  4J57 E;  1XOB A;  3GX0 A;  4ECC A;  4LL4 B;  1V9W A;  4NMU A;  2B5X A;  4ML6 A;  4MP4 A;  4YQM A;  4F0B A;  1V98 A;  2K8V A;  4KDU A;  2QA2 A;  3TJF A;  3DML A;  1GRX A;  3EYT A;  4OMV A;  3LJR A;  2UZ8 A;  2I81 A;  4EF0 A;  3F6F A;  1JZW A;  3F9U A;  4ILF A;  4MJB A;  3FEU A;  1SL0 B;  2OAD A;  1ERT A;  1OKD A;  2LQO A;  3WGX A;  5H5Q A;  3LXZ A;  5GST A;  3EVI A;  5G31 A;  1MDJ A;  3KP9 A;  5CYY A;  3RHC A;  3IRA A;  3ZIJ A;  4PXO A;  1G6Y A;  1IYH A;  2EIO A;  1R7H A;  2NTO A;  3QD9 A;  4GCI A;  4AGS A;  4TXO A;  4I6X A;  1X5D A;  1RW1 A;  2CAQ A;  1ZOF A;  3IA1 A;  1M2B A;  1F2E A;  1Y6E A;  1A23 A;  4ULX A;  1EV4 A;  2VM2 A;  11GS A;  2DBC A;  4HEA 2;  1F3B A;  5ABR A;  4D73 B;  4WKW A;  4MF5 A;  4WR5 A;  3HJO A;  2HSM A;  2X4A A;  3FR3 A;  2X99 A;  1TOF A;  4TXV A;  5IMF A;  1KEB A;  4HQZ A;  4Q5R A;  4J56 E;  5GAN D;  2YV7 A;  3QAV A;  1FVJ A;  3IAM 2;  2LNS A;  4KW6 A;  1VF4 A;  5IOW A;  2H74 A;  4N30 A;  1RQM A;  3IHQ A;  2PVQ A;  2NPB A;  2H70 A;  3FZ9 A;  4ZBA A;  4MPG A;  2CVD A;  5B7C A;  1FO5 A;  2M72 A;  1WWJ A;  3R2Q A;  2OKA A;  2PGT A;  2YAN A;  1B9X C;  3NIV A;  2IME A;  2FY6 A;  2L4Q A;  3CSI A;  1M3J A;  3ERF A;  4KCA A;  4K0N A;  2AHE A;  3A5I A;  3SWL A;  1O81 A;  1YKA A;  3GKX A;  4FO5 A;  4OD7 A;  4KSO A;  3IC8 A;  1S3A A;  1XPV A;  2P5Q A;  4N0V A;  2CA8 A;  5CP1 A;  1X9W B;  4P3Y B;  1S3C A;  2GT5 A;  2DSA A;  3DRN A;  1O8W A;  5ID2 A;  3HVN A;  2YNX A;  3GL3 A;  2ZNM A;  2XPD A;  1TP9 A;  3U6V A;  1THX A;  3FZ5 A;  5E4W A;  5IOX A;  1E6B A;  1FHE A;  2IMD A;  1N8J A;  3C1S A;  4EC0 A;  1XZO A;  4EIQ A;  3EMX A;  1M9A A;  1GLP A;  3KTL A;  4PQ1 A;  4IQ1 A;  2B3S A;  2QC7 A;  3CBU A;  1EV9 A;  1F37 A;  2OE1 A;  2P5R A;  4OO4 A;  4WF5 A;  4K9Z A;  4I2T A;  3WT1 A;  4IP6 A;  3ZIT A;  4GWR A;  4IGJ A;  2R4V A;  1BAY A;  4EIP A;  2LUS A;  5ECL B;  4AJ6 A;  3G9B A;  4Z2U A;  2WFC A;  1NM3 A;  5A4V A;  1EP7 A;  4IW9 A;  2PUK C;  3PR8 A;  1AQW A;  3GRX A;  4NV2 A;  4JBB A;  1CQG A;  1ERU A;  4I5Q A;  2PWJ A;  2ALB A;  5IMZ A;  1A2J A;  2HZE A;  2FHE A;  2OA7 A;  4YAP A;  4YKG A;  5IPH A;  3IXR A;  2GS3 A;  1GSY A;  1QXH A;  3ISO A;  5B6M A;  17GS A;  3J7Y b;  1KNG A;  4EXJ A;  2H0H A;  4XS4 A;  3Q74 A;  3TOU A;  2R5G A;  1TI3 A;  1XWC A;  2JSZ A;  1U6T A;  2H01 A;  2VD1 A;  4F03 A;  5ECK B;  2A2S A;  2E2M A;  3NOF A;  2C0D A;  2L57 A;  3HVV A;  1PKW A;  4IKH A;  1G7O A;  1ST9 A;  1E2Y A;  3TCO A;  3RHB A;  3GFK A;  2OAC A;  1Q98 A;  3RAZ A;  5D93 A;  1MDI A;  3MSZ A;  3R3E A;  2TRC P;  3UJ1 A;  5DAK A;  1XBS A;  2LS5 A;  3GN3 A;  1A24 A;  4ZL8 A;  2HNL A;  3DWV A;  4KF9 A;  4BVX A;  1SK2 A;  4TVE A;  1AQX A;  1K3O A;  2C3N A;  5IO0 A;  1A2M A;  3EUR A;  2GQK A;  1EOH A;  1HD2 A;  3D0Z A;  4V1A p;  4BWS A;  1UA5 A;  2O89 A;  4MK3 A;  1K0C A;  3LYK A;  5BRT A;  3GUS A;  1T4Y A;  4POB A;  4K6X A;  1XWB A;  4NHZ A;  1RK4 A;  5DQS A;  2VCW A;  1TJD A;  1G6W A;  4NWY A;  4V1A g;  4O5U A;  4TXO B;  3UVT A;  3VPT A;  3GMF A;  5GSS A;  3KH9 A;  4PUR A;  3ZLP A;  2JAC A;  2F51 A;  4GTU A;  5ECM B;  4ISD A;  2FWF A;  5F07 A;  1V2A A;  1PQN A;  1ZMA A;  5ECI B;  1GTB A;  5DAL A;  19GS A;  3DD3 A;  3UBL A;  1PL2 A;  1BQ7 A;  1PN9 A;  4BL7 B;  1GSQ A;  1SK1 A;  5J5N A;  4MZC A;  1X5C A;  4ZIL A;  4XS6 A;  4MJC A;  2IMI A;  2X8C A;  2VUP A;  2RUE A;  1LBK A;  3KTB A;  4CY8 A;  1DBY A;  5IMA A;  5KN0 A;  1X9M B;  1XW6 A;  4GLT A;  3HKR A;  1XWA A;  4GQC A;  4TOP A;  3F4T A;  3APO A;  3PIN A;  2RLI A;  1GUK A;  5DJM A;  3CYN A;  1EZK A;  3H8Q A;  2F9S A;  1M2A A;  4MLY A;  1WOU A;  4GQF A;  3RBT A;  1TU7 A;  4WF4 A;  2X8H A;  3GH6 A;  3FR6 A;  1YJ6 A;  2B1K A;  3WD6 A;  2JU5 A;  3W6G A;  3I43 A;  3LXT A;  1V40 A;  3ZML A;  3VUR A;  2RII A;  1B4P A;  4L0W A;  4AF2 A;  1ML6 A;  4WEY A;  1YKC A;  1DSB A;  3A2V A;  1NHO A;  4HI7 A;  1A2L A;  1NW2 A;  3VPQ A;  1GP1 A;  3IHG A;  4OFM A;  1HNA A;  1U3I A;  3TUE A;  6GSS A;  2X49 A;  4MZB A;  3VI7 A;  1MD3 A;  4GST A;  5ID2 B;  3ZRD A;  1KTE A;  3BOA A;  1R26 A;  2AYT A;  4Q5F A;  2DIZ A;  2VCQ A;  4I2U A;  3DXB A;  3VWV A;  2A4V A;  4O5R A;  3DIE A;  2I3Y A;  2RM5 A;  3IPZ A;  1K0M A;  3SBC A;  4CDO A;  3WT2 A;  3VWX A;  4DSS B;  4OFN A;  2VLT A;  3F4R A;  2HYX A;  2FD3 A;  4XRD A;  4IJI A;  3GTU A;  1OC8 A;  2WCI A;  5HR3 A;  2IL3 A;  3FHK A;  2ON7 A;  1GWC A;  5J4U A;  4XTS A;  1PD2 1;  3TB2 A;  4PUF C;  1R5A A;  3LGC A;  2XBQ A;  2CAI A;  3K8N A;  3PH9 A;  2DJ1 A;  1K3L A;  2GGT A;  1TRS A;  3QFA C;  2C3T A;  3EIN A;  3CMI A;  3QFB C;  2DKH A;  5G1K A;  3RPP A;  3L0H A;  3IC4 A;  2L5O A;  1FB0 A;  1NHY A;  1QQ2 A;  3UVH A;  4E8E A;  2HZE B;  2JZR A;  2VL3 A;  4IQA A;  3IR4 A;  4GSS A;  4ICY A;  2MYG A;  2VCX A;  1X5E A;  4XS4 B;  5G5E A;  3UEM A;  2IJY A;  4CW9 A;  3LSZ A;  4JU5 A;  4O92 A;  1ZYN A;  3E3E A;  3H4K A;  4KCE A;  3CRT A;  5LCZ A;  2A2P A;  3APQ A;  2C80 A;  4DSR A;  1HYU A;  22GS A;  5HQP A;  4BWQ A;  1K0B A;  2GST A;  2R6K A;  1OKT A;  4AJ8 A;  3GIX A;  1GL8 A;  4DVC A;  4ZIJ A;  2DJJ A;  4OCE A;  5A4U A;  4TN8 A;  5DAK B;  2IFQ A;  3L9U A;  1BX9 A;  4RUV A;  3M3M A;  2OE3 A;  3P2A A;  3CSJ A;  3L78 A;  2NVL A;  1Z5Y E;  2A4H A;  2DLX A;  4KB3 A;  3KIJ A;  2VL2 C;  5BMU A;  2H1D A;  3QCP A;  4N0Z A;  1JLV A;  2GQM A;  4BIK A;  3VK9 A;  4XCS A;  1XIY A;  1IYI A;  3W8J A;  4EE0 A;  8GSS A;  2LNT A;  3GHA A;  2H1G A;  4HQS A;  4K2X A;  1A8Y A;  2YJ7 A;  3ZVJ D;  1NSW A;  1DE2 A;  3ED3 A;  2LRC A;  4JRR A;  1O85 A;  1GUH A;  4K7N A;  2J9H A;  3F8U A;  2ES7 A;  2VL2 A;  1M2D A;  2N5B A;  1EEM A;  2I1U A;  1YQ1 A;  1TRW A;  2R0C A;  1PA3 A;  2RUF A;  2DIY A;  5F05 A;  2C3Q A;  3H79 A;  5DAL B;  4HZ4 A;  4XHM A;  4KH7 A;  1LU4 A;  5CO3 A;  3HZ8 A;  6GSX A;  2VLV A;  2YWO A;  4EKZ A;  5ELA A;  2WS2 A;  4PQH A;  2YWN A;  1SJZ A;  3KXO A;  4L0U A;  3DVW A;  1VF3 A;  2DJK A;  1TK5 B;  2WJU A;  4KX4 A;  3ZMK A;  5KEJ A;  2VCZ A;  4CHS A;  2A2R A;  1K0O A;  1CQH A;  1JZR A;  2HXK A;  3FZ4 A;  4YAV A;  4JED A;  1BJX A;  4HSC X;  5HR0 A;  5J41 A;  3D6I A;  1YF0 A;  2CZ3 A;  12GS A;  4K5S A;  1U88 A;  1ZYQ B;  3G7I A;  2X8G A;  3C7M A;  3EC3 A;  1QGV A;  4H86 A;  1AAZ A;  5EVO A;  1PX7 A;  5DJL A;  3EE2 A;  5G5F A;  2DJ2 A;  3IDV A;  3QAW A;  1TRV A;  2IPA A;  3UAR A;  4IBP A;  1GSE A;  1BYE A;  6GSY A;  2H0G A;  4WXT A;  1JZD A;  2HSY A;  3MDK A;  1JLW A;  2FA4 A;  5ENU A;  3IE3 A;  4CY6 A;  3LOR A;  1T3B A;  5D9V A;  2R0G A;  2GSR A;  1T1V A;  4MDC A;  2RM6 A;  1A8L A;  1WPI A;  1ACV A;  3UL3 A;  2PBJ A;  2R3X A;  3Q6O A;  10GS A;  2E7P A;  5CRE A;  3GNJ A;  3IBH A;  4BVY A;  5D9W A;  1GUM A;  3HD5 A;  4TKY A;  1A0R P;  1WMJ A;  4HOJ A;  1GTU A;  2QKE A;  5D8I A;  2R2J A;  2G2Q A;  4LL1 B;  2AJQ B;  4EVM A;  3GTU B;  1ZGN A;  2WGR A;  3O76 A;  2C0E A;  2F8F A;  1FOV A;  1G0T A;  1GNE A;  3Q19 A;  2HRK A;  1R5P A;  2CVB A;  2V32 A;  3VI5 A;  3LYP A;  4MJE A;  5F0G A;  3ERG A;  5HFK A;  4QQ7 A;  3KD0 A;  2JL4 A;  1AW9 A;  4N11 A;  2AV4 A;  3D4T A;  5CRG A;  4GSN A;  3LEF A;  3M9K A;  3MNG A;  2LRT A;  1U87 A;  5F8B A;  2JZS A;  1GSD A;  4K7O A;  1K3Y A;  2BTO T;  4JR4 A;  3UIW A;  3A5W A;  1Y25 A;  1GSF A;  3M1G A;  2KLX A;  1EGO A;  4G10 A;  3ERW A;  2TRX A;  4YQU A;  2HI7 A;  4PQI A;  1SU9 A;  2HFD A;  18GS A;  5JWQ B;  3G7J A;  1Z7P A;  2MMO A;  2FA8 A;  4TR0 A;  4IJ3 A;  1BED A;  5KN2 A;  2LST A;  3VWU A;  2JAD A;  4NHW A;  2KOK A;  1B8X A;  5ECQ B;  3ZYW A;  5H5R A;  4JZQ A;  2DC5 A;  5A4W A;  3FYG A;  3H1N A;  1Z6N A;  4EUY A;  2K18 A;  3LW9 A;  2VO4 A;  2IFQ B;  1XOA A;  2C0F A;  5AGY A;  3W8S A;  2VCT A;  1GLQ A;  1HNB A;  1TI1 A;  4G9H A;  4G0L A;  4IS0 A;  3F0I A;  4XIH A;  1YEX A;  2KUC A;  4KE3 A;  2IIY A;  4V2M A;  4F0C A;  4K1F A;  3BCK A;  1N2A A;  2N5F A;  2E0Q A;  2GZZ A;  2O7K A;  5ECN B;  1DE1 A;  3G7Y A;  4XS1 A;  1J0F A;  1PFO A;  2DKI A;  2EIQ A;  1ZYE A;  3EWL A;  3TKQ A;  2LKU A;  1FVK A;  3M0F A;  14GS A;  3BJ5 A;  4KAE A;  1OYJ A;  3ZFL A;  4WET A;  4O5Q A;  1MDK A;  5LD0 A;  1THO A;  5G2Z A;  3CTF A;  1BG5 A;  2VOC A;  3M9J A;  1T00 A;  16GS A;  3HYP A;  3GL5 A;  3QOU A;  4HU9 A;  3D5J A;  2I9H A;  3OR5 A;  5CRH A;  3QMX A;  3HXS A;  4O7H A;  2VIM A;  3JCM L;  1O6J A;  2AAW A;  1X9S B;  4BPY A;  5JWR B;  1S3R A;  3CTG A;  4TR1 A;  3FY7 A;  2L59 A;  3H93 A;  1USB A;  4MA9 A;  2GZY A;  4PGT A;  1ZYP A;  1SD8 A;  2R0P A;  5LNK e;  2VL9 A;  5DDL A;  1V57 A;  1O73 A;  1ERW A;  5KOW A;  3C71 A;  2MBT A;  4IP1 A;  5ECP B;  4I8B A;  2H76 A;  5H5S A;  1TRU A;  4IEL A;  3LWA A;  4MF7 A;  5G30 A;  5D96 A;  3HDC A;  3KM6 A;  1SK0 A;  2PPT A;  4RQR A;  2LRN A;  4QL7 A;  3MWH A;  1URM A;  1M9B A;  4KGI A;  3GA4 A;  1QUW A;  1JZO A;  1XWK A;  3FR9 A;  1H4O A;  2B7K A;  1SJ6 A;  3FW2 A;  4ZL7 A;  3GKM A;  2FUG 2;  2YWI A;  2KHP A; 
#chains in the Genus database with same CATH homology
 4PNG A;  5CRW A;  4EDY A;  4RI6 A;  3CXG A;  3TRX A;  1AUC A;  1F9M A;  2DML A;  4L8E A;  3P90 A;  2HRA A;  1TXX A;  3CSH A;  2BMX A;  3MAK A;  1TDI A;  2ON5 A;  3I9V 2;  4PTS A;  1WP0 A;  3KCM A;  4K7I A;  2NBS A;  4KSM A;  4RQX A;  1W4V A;  1YY7 A;  1K0A A;  3NZN A;  2H8L A;  4ECB A;  3F63 A;  5GZZ B;  2LJK A;  4EDZ A;  3ZL5 A;  3L9V A;  4BVY B;  3ME7 A;  3KH7 A;  1HQO A;  3GV1 A;  3E0U A;  5KN1 A;  3GH9 A;  1SD9 A;  2GSQ A;  4KDX A;  2G0F A;  4YKF A;  1K0N A;  1W89 A;  2V6O A;  3D22 A;  4GXZ A;  4MJA A;  2GT6 A;  1SJI A;  3EMP A;  2WDU A;  2ZCT A;  2VCV A;  1GTA A;  4ZB6 A;  1XW9 A;  3I69 A;  2AB6 A;  3P7X A;  1DUG A;  3GST A;  4TR4 A;  1PKZ A;  4Z7X A;  4KA0 A;  5CRD A;  4DEJ A;  3TKS E;  4AJ7 A;  5J9B A;  2IN3 A;  5FWG A;  1UVZ A;  6GSU A;  1SKS B;  2LEG A;  2GZP A;  1ABA A;  4A5P A;  2H19 A;  5C04 A;  1YDK A;  1MTC A;  3D21 A;  5IMC A;  4ID0 A;  1GH2 A;  2OE0 A;  4F2I A;  2OBI A;  6GSV A;  3ME8 A;  3FK8 A;  4YQV A;  1VF2 A;  2XHF A;  4Q5Q A;  5AIV A;  5IMV A;  4PUA A;  4X1U A;  1MD4 A;  1ILO A;  2DJ0 A;  3TKS C;  2YP6 A;  4IVF A;  5F06 A;  2GQL A;  3C8E A;  4MH3 A;  1WJK A;  3M8N A;  1QFN A;  3WGD A;  1UN2 A;  1YEP A;  3D4M A;  1OAZ A;  2H1B A;  3FKF A;  1XVW A;  3EPT A;  2CT6 A;  1B48 A;  5DCH A;  2E2G A;  2H75 A;  3V1W A;  3C73 A;  1OC9 A;  1O8X A;  4HJ2 A;  4BVX B;  4OCF A;  2PER A;  4IHU A;  3TKS A;  3ZVJ A;  4BA7 A;  2CQ9 A;  5B8A A;  5ECR B;  3TRP A;  3UMA A;  3EU3 A;  1Z9H A;  4FYU A;  4LMW A;  2OBK A;  2C4J A;  2HZF A;  3C1R A;  2VLU A;  4RI7 A;  3TDG A;  3US3 A;  4Z2R A;  2TIR A;  2HLS A;  4Z2T A;  3A2X A;  2YCD A;  7GSS A;  2HRF A;  2VAF A;  1ON4 A;  2XBI A;  2EC4 A;  2GDR A;  2YPM A;  1TTZ A;  1GUL A;  1XVQ A;  2C8U A;  1GSU A;  2F8A A;  3F3R A;  4HDE A;  4BL7 A;  5D9T A;  5CAX A;  1T7P B;  3DVX A;  3P8W A;  2H6Z A;  3N9J A;  4ECI A;  4HZ2 A;  4HUA A;  3ZRE A;  3A2W A;  5JWO B;  4JE1 A;  3KMN A;  2D2Z A;  4USS A;  4TR1 B;  1FW1 A;  1PL1 A;  1QK8 A;  2F3M A;  3AY8 A;  4Q5N A;  2FWH A;  1Z6M A;  4ZXG A;  2V1M A;  5DBQ A;  4ZB8 A;  2B1L A;  2VD0 A;  1J08 A;  2V6K A;  3KJY A;  3IK7 A;  3L9S A;  3TJK A;  3WGE A;  3VWW A;  3O6T A;  1FG4 A;  2KP2 A;  3KEB A;  2J23 A;  1K0D A;  3TKP A;  1OE8 A;  2HT9 A;  1YF1 A;  4MZW A;  3HY2 A;  1EP8 A;  4WBJ A;  4XRA A;  2P0G A;  2ZUP A;  2CX3 A;  3RPN A;  3HA9 A;  2H30 A;  20GS A;  1FAA A;  1EWX A;  2YV9 A;  4FYB A;  1JHB A;  1WRY A;  4OFT A;  4FH8 A;  2H71 A;  1HNC A;  4V2N A;  5AN1 A;  2YWM A;  3PGT A;  4QL9 A;  1G7E A;  1PRX A;  3TGZ A;  4MCU A;  2NDO A;  2VM1 A;  3HJM A;  4K5R A;  1SYR A;  2H6X A;  4MAB A;  5INY A;  1GSS A;  1EGR A;  2LJA A;  5IIZ A;  1UC7 A;  1MEK A;  3DKS A;  5ECS A;  2L6D A;  2DMM A;  2I4A A;  3BBY A;  4MH2 A;  3VFI A;  2L5L A;  3L4N A;  4WBR D;  1U3A A;  3IV4 A;  3IOS A;  4EL1 A;  2FCH A;  1EOG A;  4TR3 A;  4PX1 A;  1VGL A;  2O8V B;  5JCU A;  3BD2 A;  4FIW A;  2FGX A;  4ZBB A;  3VLN A;  4MF6 A;  5AIX A;  5IQY A;  4EO3 A;  4LLR A;  1KBN A;  2H66 A;  3J7Y k;  1AQV A;  1S3D A;  1ZZY A;  1O7U A;  3UBK A;  1AIU A;  3IK9 A;  5D9X A;  4KUN A;  3TOT A;  4DSS A;  3F3Q A;  5KOX A;  3HZ4 A;  4HU7 A;  3UOM A;  9GSS A;  4ZBD A;  2FWG A;  1VF1 A;  1ZL9 A;  3DYR A;  4L5O A;  3F4S A;  3Q18 A;  5HR1 A;  4NXI A;  3LG6 A;  1C72 A;  4MPF A;  1VRS D;  1R4W A;  5ECH B;  3I6A A;  3UAP A;  3KMO A;  3S9F A;  1SYX A;  4FYC A;  3TKR A;  4PNF A;  4DSQ A;  2YN1 A;  5EY6 A;  2WZ9 A;  2MMA A;  1OC3 A;  4GRF A;  3O3T A;  1WE0 A;  3GKN A;  3MIX A;  4IN0 A;  2XPE A;  5J3R A;  5J9C A;  2PU9 C;  1ERV A;  3CRU A;  1M99 A;  5B8B A;  3GKK A;  3DGQ A;  5HFI A;  3FMW A;  5KN3 A;  3QDN A;  1M7T A;  3KGK A;  4HS1 A;  2M80 A;  4F9Z A;  1SL2 B;  2K9F A;  1X0R A;  5IM9 A;  3TRQ A;  5FT3 A;  2YOI A;  2IMF A;  1EEJ A;  2EIR A;  1TKD B;  3ZZX A;  1XW5 A;  4OO5 A;  2GVP A;  2O85 A;  1TK8 B;  4X43 A;  5C00 A;  5HR2 A;  2DJ3 A;  5FHI A;  2R37 A;  2LTK A;  3MYD A;  2YZU A;  3QR6 A;  4K0G A;  3FRC A;  1GTI A;  3EU4 A;  5IO2 A;  1FOH A;  3IAS 2;  2H0I A;  2N5A A;  4GF0 A;  1OVN A;  1OC9 B;  3ZIV A;  4N10 A;  2MMN A;  2GLR A;  5COH A;  1PN0 A;  2H72 A;  4POK A;  5JCW A;  2WRT A;  3HVX A;  5IPG A;  2CVK A;  4X4J A;  5HFG A;  1LJR A;  5G1L A;  4WR4 A;  4G0K A;  6GST A;  3FZA A;  3QAG A;  3GUR A;  1YZX A;  2CZ2 A;  2HSH A;  2IMK A;  1F6M C;  5DQY A;  2HE3 A;  1OE7 A;  4HJM A;  2WB9 A;  1SEN A;  3BCI A;  2B5E A;  4O32 A;  1XCC A;  4G19 A;  4D73 A;  2B7J A;  2LQQ A;  1FB6 A;  3QPM A;  4MNN A;  4FQU A;  5D73 A;  2PN8 A;  2PMT A;  3TJG A;  3RDW A;  1XXU A;  2QGV A;  2FLS A;  1V58 A;  3E9J B;  3ZFB A;  4POM A;  1JFU A;  2WUL A;  5DVB A;  1B4Q A;  2M46 A;  5GAP D;  1A0F A;  1B9Y C;  4V2L A;  2LV3 A;  2OJL A;  5A5K A;  4K8M A;  2MMZ A;  2Z9S A;  3ZTL A;  2IWT A;  1WIK A;  1TW9 A;  1T4Z A;  5EPF A;  5ECO B;  4POL A;  4TRX A;  1Z7R A;  2H6Y A;  3PPU A;  3HVS A;  6GSW A;  1XWG A;  2QSI A;  1SKR B;  2JSY A;  2V41 A;  4E8H A;  4J2F A;  2MBS A;  2QA1 A;  2JZT A;  1TU8 A;  2C0G A;  2X64 A;  3HHV A;  3DEX A;  1I5G A;  1PGT A;  2L6C A;  5IMD A;  3TJB A;  3LFL A;  2V2G A;  2YJH A;  3GYK A;  5EL8 A;  2O87 A;  3HJP A;  4L5L A;  1PMT A;  2H1A A;  1PX6 A;  3TJJ A;  3F6D A;  4JR6 A;  4MMM A;  1XFL A;  4G0I A;  4NAX A;  1I9D A;  1ZCP A;  2YZH A;  1Q4J A;  2K6V A;  3GX8 A;  4I97 A;  2P31 A;  2KP1 A;  3GSS A;  4ZL9 A;  3APS A;  2REM A;  1Z3E A;  2MZC A;  2AUV A;  5L71 A;  4OWY A;  1M0U A;  4KDY A;  4KND A;  1TK0 B;  13GS A;  2FWE A;  4X0X A;  2CV4 A;  4NV5 A;  2GSS A;  1QMV A;  1GNW A;  1J9B A;  3KZQ A;  3HCZ A;  5B6N A;  4ACS A;  3LQ7 A;  2GTU A;  4K2D A;  4LA1 A;  4ECJ A;  3A3T A;  3U5R E;  5ELG A;  2B5Y A;  2CX4 A;  3WYW A;  2PVO C;  2C1Y A;  1T8E B;  4YH2 A;  5DCG A;  1AXD A;  4F82 A;  1SL1 B;  1H75 A;  3KP8 A;  2B6M A;  2K8S A;  5E59 A;  1SKW B;  2FNO A;  4G2E A;  2L4C A;  3N5O A;  2BJX A;  5AIS A;  2XC2 A;  4NPB A;  5CNW A;  2HRN A;  5JCG A;  4LMV A;  4ML1 A;  4TW5 A;  2LJR A;  1PSQ A;  1AC1 A;  1F3A A;  4ZB9 A;  2H73 A;  4J57 E;  1XOB A;  3GX0 A;  4ECC A;  4LL4 B;  1V9W A;  4NMU A;  2B5X A;  4ML6 A;  4MP4 A;  4YQM A;  4F0B A;  1V98 A;  2K8V A;  4KDU A;  2QA2 A;  3TJF A;  3DML A;  1GRX A;  3EYT A;  4OMV A;  3LJR A;  2UZ8 A;  2I81 A;  4EF0 A;  3F6F A;  1JZW A;  3F9U A;  4ILF A;  4MJB A;  3FEU A;  1SL0 B;  2OAD A;  1ERT A;  1OKD A;  2LQO A;  3WGX A;  5H5Q A;  3LXZ A;  5GST A;  3EVI A;  5G31 A;  1MDJ A;  3KP9 A;  5CYY A;  3RHC A;  3IRA A;  3ZIJ A;  4PXO A;  1G6Y A;  1IYH A;  2EIO A;  1R7H A;  2NTO A;  3QD9 A;  4GCI A;  4AGS A;  4TXO A;  4I6X A;  1X5D A;  1RW1 A;  2CAQ A;  1ZOF A;  3IA1 A;  1M2B A;  1F2E A;  1Y6E A;  1A23 A;  4ULX A;  1EV4 A;  2VM2 A;  11GS A;  2DBC A;  4HEA 2;  1F3B A;  5ABR A;  4D73 B;  4WKW A;  4MF5 A;  4WR5 A;  3HJO A;  2HSM A;  2X4A A;  3FR3 A;  2X99 A;  1TOF A;  4TXV A;  5IMF A;  1KEB A;  4HQZ A;  4Q5R A;  4J56 E;  5GAN D;  2YV7 A;  3QAV A;  1FVJ A;  3IAM 2;  2LNS A;  4KW6 A;  1VF4 A;  5IOW A;  2H74 A;  4N30 A;  1RQM A;  3IHQ A;  2PVQ A;  2NPB A;  2H70 A;  3FZ9 A;  4ZBA A;  4MPG A;  2CVD A;  5B7C A;  1FO5 A;  2M72 A;  1WWJ A;  3R2Q A;  2OKA A;  2PGT A;  2YAN A;  1B9X C;  3NIV A;  2IME A;  2FY6 A;  2L4Q A;  3CSI A;  3ERF A;  4KCA A;  4K0N A;  2AHE A;  3A5I A;  3SWL A;  1O81 A;  1YKA A;  3GKX A;  4FO5 A;  4OD7 A;  4KSO A;  3IC8 A;  1S3A A;  1XPV A;  2P5Q A;  4N0V A;  2CA8 A;  5CP1 A;  1X9W B;  4P3Y B;  1S3C A;  2GT5 A;  2DSA A;  3DRN A;  1O8W A;  5ID2 A;  2YNX A;  3GL3 A;  2ZNM A;  2XPD A;  1TP9 A;  3U6V A;  1THX A;  3FZ5 A;  5E4W A;  5IOX A;  1E6B A;  1FHE A;  2IMD A;  1N8J A;  3C1S A;  4EC0 A;  1XZO A;  4EIQ A;  3EMX A;  1M9A A;  1GLP A;  3KTL A;  4PQ1 A;  4IQ1 A;  2B3S A;  2QC7 A;  3CBU A;  1EV9 A;  1F37 A;  2OE1 A;  2P5R A;  4OO4 A;  4WF5 A;  4K9Z A;  4I2T A;  3WT1 A;  4IP6 A;  3ZIT A;  4GWR A;  4IGJ A;  2R4V A;  1BAY A;  4EIP A;  2LUS A;  5ECL B;  4AJ6 A;  3G9B A;  4Z2U A;  2WFC A;  1NM3 A;  5A4V A;  1EP7 A;  4IW9 A;  2PUK C;  3PR8 A;  1AQW A;  3GRX A;  4NV2 A;  4JBB A;  1CQG A;  1ERU A;  4I5Q A;  2PWJ A;  2ALB A;  5IMZ A;  1A2J A;  2HZE A;  2FHE A;  2OA7 A;  4YAP A;  4YKG A;  5IPH A;  3IXR A;  2GS3 A;  1GSY A;  1QXH A;  3ISO A;  5B6M A;  17GS A;  3J7Y b;  1KNG A;  4EXJ A;  2H0H A;  4XS4 A;  3Q74 A;  3TOU A;  2R5G A;  1TI3 A;  1XWC A;  2JSZ A;  1U6T A;  2H01 A;  2VD1 A;  4F03 A;  5ECK B;  2A2S A;  2E2M A;  3NOF A;  2C0D A;  2L57 A;  3HVV A;  1PKW A;  4IKH A;  1G7O A;  1ST9 A;  1E2Y A;  3TCO A;  3RHB A;  3GFK A;  2OAC A;  1Q98 A;  3RAZ A;  5D93 A;  1MDI A;  3MSZ A;  3R3E A;  2TRC P;  3UJ1 A;  5DAK A;  1XBS A;  2LS5 A;  3GN3 A;  1A24 A;  4ZL8 A;  2HNL A;  3DWV A;  4KF9 A;  4BVX A;  1SK2 A;  4TVE A;  1AQX A;  1K3O A;  2C3N A;  5IO0 A;  1A2M A;  3EUR A;  2GQK A;  1EOH A;  1HD2 A;  3D0Z A;  4V1A p;  4BWS A;  1UA5 A;  2O89 A;  4MK3 A;  1K0C A;  3LYK A;  5BRT A;  3GUS A;  1T4Y A;  4POB A;  4K6X A;  1XWB A;  4NHZ A;  1RK4 A;  5DQS A;  2VCW A;  1TJD A;  1G6W A;  4NWY A;  4V1A g;  4O5U A;  4TXO B;  3UVT A;  3VPT A;  3GMF A;  5GSS A;  3KH9 A;  4PUR A;  3ZLP A;  2JAC A;  2F51 A;  4GTU A;  5ECM B;  4ISD A;  2FWF A;  5F07 A;  1V2A A;  1PQN A;  1ZMA A;  5ECI B;  1GTB A;  5DAL A;  19GS A;  3DD3 A;  3UBL A;  1PL2 A;  1BQ7 A;  1PN9 A;  4BL7 B;  1GSQ A;  1SK1 A;  5J5N A;  4MZC A;  1X5C A;  4ZIL A;  4XS6 A;  4MJC A;  2IMI A;  2X8C A;  2VUP A;  2RUE A;  1LBK A;  3KTB A;  4CY8 A;  1DBY A;  5IMA A;  5KN0 A;  1X9M B;  1XW6 A;  4GLT A;  3HKR A;  1XWA A;  4GQC A;  4TOP A;  3F4T A;  3APO A;  3PIN A;  2RLI A;  1GUK A;  5DJM A;  3CYN A;  1EZK A;  3H8Q A;  2F9S A;  1M2A A;  4MLY A;  1WOU A;  4GQF A;  3RBT A;  1TU7 A;  4WF4 A;  2X8H A;  3GH6 A;  3FR6 A;  1YJ6 A;  2B1K A;  3WD6 A;  2JU5 A;  3W6G A;  3I43 A;  3LXT A;  1V40 A;  3ZML A;  3VUR A;  2RII A;  1B4P A;  4L0W A;  4AF2 A;  1ML6 A;  4WEY A;  1YKC A;  1DSB A;  3A2V A;  1NHO A;  4HI7 A;  1A2L A;  1NW2 A;  3VPQ A;  1GP1 A;  3IHG A;  4OFM A;  1HNA A;  1U3I A;  3TUE A;  6GSS A;  2X49 A;  4MZB A;  3VI7 A;  1MD3 A;  4GST A;  5ID2 B;  3ZRD A;  1KTE A;  3BOA A;  1R26 A;  2AYT A;  4Q5F A;  2DIZ A;  2VCQ A;  4I2U A;  3DXB A;  3VWV A;  2A4V A;  4O5R A;  3DIE A;  2I3Y A;  2RM5 A;  3IPZ A;  1K0M A;  3SBC A;  4CDO A;  3WT2 A;  3VWX A;  4DSS B;  4OFN A;  2VLT A;  3F4R A;  2HYX A;  2FD3 A;  4XRD A;  4IJI A;  3GTU A;  1OC8 A;  2WCI A;  5HR3 A;  2IL3 A;  3FHK A;  2ON7 A;  1GWC A;  5J4U A;  4XTS A;  1PD2 1;  3TB2 A;  4PUF C;  1R5A A;  3LGC A;  2XBQ A;  2CAI A;  3K8N A;  3PH9 A;  2DJ1 A;  1K3L A;  2GGT A;  1TRS A;  3QFA C;  2C3T A;  3EIN A;  3CMI A;  3QFB C;  2DKH A;  5G1K A;  3RPP A;  3L0H A;  3IC4 A;  2L5O A;  1FB0 A;  1NHY A;  1QQ2 A;  3UVH A;  4E8E A;  2HZE B;  2JZR A;  2VL3 A;  4IQA A;  3IR4 A;  4GSS A;  4ICY A;  2MYG A;  2VCX A;  1X5E A;  4XS4 B;  5G5E A;  3UEM A;  2IJY A;  4CW9 A;  3LSZ A;  4JU5 A;  4O92 A;  1ZYN A;  3E3E A;  3H4K A;  4KCE A;  3CRT A;  5LCZ A;  2A2P A;  3APQ A;  2C80 A;  4DSR A;  1HYU A;  22GS A;  5HQP A;  4BWQ A;  1K0B A;  2GST A;  2R6K A;  1OKT A;  4AJ8 A;  3GIX A;  1GL8 A;  4DVC A;  4ZIJ A;  2DJJ A;  4OCE A;  5A4U A;  4TN8 A;  5DAK B;  2IFQ A;  3L9U A;  1BX9 A;  4RUV A;  3M3M A;  2OE3 A;  3P2A A;  3CSJ A;  3L78 A;  2NVL A;  1Z5Y E;  2A4H A;  2DLX A;  4KB3 A;  3KIJ A;  2VL2 C;  5BMU A;  2H1D A;  3QCP A;  4N0Z A;  1JLV A;  2GQM A;  3VK9 A;  4XCS A;  1XIY A;  1IYI A;  3W8J A;  4EE0 A;  8GSS A;  2LNT A;  3GHA A;  2H1G A;  4HQS A;  4K2X A;  1A8Y A;  2YJ7 A;  3ZVJ D;  1NSW A;  1DE2 A;  3ED3 A;  2LRC A;  4JRR A;  1O85 A;  1GUH A;  4K7N A;  2J9H A;  3F8U A;  2ES7 A;  2VL2 A;  1M2D A;  2N5B A;  1EEM A;  2I1U A;  1YQ1 A;  1TRW A;  2R0C A;  1PA3 A;  2RUF A;  2DIY A;  5F05 A;  2C3Q A;  3H79 A;  5DAL B;  4HZ4 A;  4XHM A;  4KH7 A;  1LU4 A;  5CO3 A;  3HZ8 A;  6GSX A;  2VLV A;  2YWO A;  4EKZ A;  5ELA A;  2WS2 A;  4PQH A;  2YWN A;  1SJZ A;  3KXO A;  4L0U A;  3DVW A;  1VF3 A;  2DJK A;  1TK5 B;  2WJU A;  4KX4 A;  3ZMK A;  5KEJ A;  2VCZ A;  4CHS A;  2A2R A;  1K0O A;  1CQH A;  1JZR A;  2HXK A;  3FZ4 A;  4YAV A;  4JED A;  1BJX A;  5HR0 A;  5J41 A;  3D6I A;  1YF0 A;  2CZ3 A;  12GS A;  4K5S A;  1U88 A;  1ZYQ B;  3G7I A;  2X8G A;  3C7M A;  3EC3 A;  1QGV A;  4H86 A;  1AAZ A;  5EVO A;  1PX7 A;  5DJL A;  3EE2 A;  5G5F A;  2DJ2 A;  3IDV A;  3QAW A;  1TRV A;  2IPA A;  3UAR A;  4IBP A;  1GSE A;  1BYE A;  6GSY A;  2H0G A;  4WXT A;  1JZD A;  2HSY A;  3MDK A;  1JLW A;  2FA4 A;  5ENU A;  3IE3 A;  4CY6 A;  3LOR A;  1T3B A;  5D9V A;  2R0G A;  2GSR A;  1T1V A;  4MDC A;  2RM6 A;  1A8L A;  1WPI A;  1ACV A;  3UL3 A;  2PBJ A;  2R3X A;  3Q6O A;  10GS A;  2E7P A;  5CRE A;  3GNJ A;  3IBH A;  4BVY A;  5D9W A;  1GUM A;  3HD5 A;  4TKY A;  1A0R P;  1WMJ A;  4HOJ A;  1GTU A;  2QKE A;  5D8I A;  2R2J A;  2G2Q A;  4LL1 B;  2AJQ B;  4EVM A;  3GTU B;  1ZGN A;  2WGR A;  3O76 A;  2C0E A;  2F8F A;  1FOV A;  1G0T A;  1GNE A;  3Q19 A;  2HRK A;  1R5P A;  2CVB A;  2V32 A;  3VI5 A;  3LYP A;  4MJE A;  5F0G A;  3ERG A;  5HFK A;  4QQ7 A;  3KD0 A;  2JL4 A;  1AW9 A;  4N11 A;  2AV4 A;  3D4T A;  5CRG A;  4GSN A;  3LEF A;  3M9K A;  3MNG A;  2LRT A;  1U87 A;  5F8B A;  2JZS A;  1GSD A;  4K7O A;  1K3Y A;  2BTO T;  4JR4 A;  3UIW A;  3A5W A;  1Y25 A;  1GSF A;  3M1G A;  2KLX A;  1EGO A;  4G10 A;  3ERW A;  2TRX A;  4YQU A;  2HI7 A;  4PQI A;  1SU9 A;  2HFD A;  18GS A;  5JWQ B;  3G7J A;  1Z7P A;  2MMO A;  2FA8 A;  4TR0 A;  4IJ3 A;  1BED A;  5KN2 A;  2LST A;  3VWU A;  2JAD A;  4NHW A;  2KOK A;  1B8X A;  5ECQ B;  3ZYW A;  5H5R A;  4JZQ A;  2DC5 A;  5A4W A;  3FYG A;  3H1N A;  1Z6N A;  4EUY A;  2K18 A;  3LW9 A;  2VO4 A;  2IFQ B;  1XOA A;  2C0F A;  5AGY A;  3W8S A;  2VCT A;  1GLQ A;  1HNB A;  1TI1 A;  4G9H A;  4G0L A;  4IS0 A;  3F0I A;  4XIH A;  1YEX A;  2KUC A;  4KE3 A;  2IIY A;  4V2M A;  4F0C A;  4K1F A;  3BCK A;  1N2A A;  2N5F A;  2E0Q A;  2GZZ A;  2O7K A;  5ECN B;  1DE1 A;  3G7Y A;  4XS1 A;  1J0F A;  2DKI A;  2EIQ A;  1ZYE A;  3EWL A;  3TKQ A;  2LKU A;  1FVK A;  3M0F A;  14GS A;  3BJ5 A;  4KAE A;  1OYJ A;  3ZFL A;  4WET A;  4O5Q A;  1MDK A;  5LD0 A;  1THO A;  5G2Z A;  3CTF A;  1BG5 A;  2VOC A;  3M9J A;  1T00 A;  16GS A;  3HYP A;  3GL5 A;  3QOU A;  4HU9 A;  3D5J A;  2I9H A;  3OR5 A;  5CRH A;  3QMX A;  3HXS A;  4O7H A;  2VIM A;  3JCM L;  1O6J A;  2AAW A;  1X9S B;  4BPY A;  5JWR B;  3CTG A;  4TR1 A;  3FY7 A;  2L59 A;  3H93 A;  1USB A;  4MA9 A;  2GZY A;  4PGT A;  1ZYP A;  1SD8 A;  2R0P A;  5LNK e;  2VL9 A;  5DDL A;  1V57 A;  1O73 A;  1ERW A;  5KOW A;  3C71 A;  2MBT A;  4IP1 A;  5ECP B;  4I8B A;  2H76 A;  5H5S A;  1TRU A;  4IEL A;  3LWA A;  4MF7 A;  5G30 A;  5D96 A;  3HDC A;  3KM6 A;  1SK0 A;  2PPT A;  4RQR A;  2LRN A;  4QL7 A;  3MWH A;  1URM A;  1M9B A;  4KGI A;  3GA4 A;  1QUW A;  1JZO A;  1XWK A;  3FR9 A;  1H4O A;  2B7K A;  1SJ6 A;  3FW2 A;  4ZL7 A;  3GKM A;  2FUG 2;  2YWI A;  2KHP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...