2FWHA

Atomic resolution crystal structure of the c-terminal domain of the electron transfer catalyst dsbd (reduced form at ph7)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
117
structure length
117
Chain Sequence
HLNFTQIKTVDELNQALVEAKGKPVMLDLYADWCVACKEFEKYTFSDPQVQKALADTVLLQANVTANDAQDVALLKHLNVLGLPTILFFDGQGQEHPQARVTGFMDAETFSAHLRDR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords Thiol:disulfide interchange protein dsbD
publication title High-resolution structures of Escherichia coli cDsbD in different redox states: A combined crystallographic, biochemical and computational study
pubmed doi rcsb
source organism Escherichia coli
total genus 42
structure length 117
sequence length 117
ec nomenclature ec 1.8.1.8: Protein-disulfide reductase.
pdb deposition date 2006-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13899 Thioredoxin_7 Thioredoxin-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2fwhA00
3NIVA 4MJEA 1X9SB 2LRCA 1M9AA 3FK8A 4I8BA 3EU3A 1B8XA 5FHIA 4TXOA 2RUEA 4NV2A 1R5PA 5LNKe 4K7OA 5ID2A 3E3EA 4MDCA 2H1DA 1ZMAA 4I6XA 3UBLA 9GSSA 1X5EA 3QOUA 3UL3A 3F6DA 4HJMA 4MK3A 1JLWA 1K3YA 3TRQA 4ZL8A 3FZ5A 3IE3A 4PGTA 4NAXA 1AQWA 5JWOB 1GLPA 2E7PA 3HJPA 2YCDA 2YNXA 3IAM2 2ON7A 2LNSA 1XWBA 4XCSA 1JHBA 3HHVA 1XPVA 2VLVA 1A2LA 3H4KA 1XIYA 5D96A 1ERVA 1GNWA 3GKXA 4YQVA 4FIWA 8GSSA 2DMMA 4EDZA 1VF4A 2IL3A 5IMDA 2YOIA 3TJJA 2B1KA 1K0CA 2GDRA 5DQSA 4N0VA 1ILOA 3LG6A 2JL4A 4PURA 3D4TA 2XBIA 4TN8A 3ISOA 4MABA 2IMFA 5DJMA 1V40A 3HKRA 3GTUB 2WULA 4TR1B 3KXOA 3EINA 2C0EA 3GSSA 2C1YA 2LSTA 4MF5A 1PMTA 3HZ8A 3EMPA 2YN1A 3U6VA 1V2AA 3W6GA 3A5WA 2H1AA 2IFQB 2XPDA 5DVBA 1XOBA 2DMLA 4XS6A 6GSTA 1KEBA 2HZEB 1M2AA 2IN3A 4AJ6A 3M9KA 3H1NA 4KCEA 2R37A 22GSA 1IYIA 2VLUA 2V41A 1YDKA 1TOFA 1TTZA 2LJRA 5B6NA 4F2IA 4ZILA 2L4QA 3G7IA 5B6MA 1A23A 1NSWA 12GSA 4QQ7A 1XVQA 3D4MA 2B5YA 2DJKA 3ZMKA 3DYRA 4YAPA 2PMTA 2H75A 3L9SA 2X99A 1OYJA 2DIYA 4XTSA 2LJAA 4CW9A 3WT1A 2DJ3A 3QAWA 2ES7A 5GAPD 4F0BA 5CAXA 2FNOA 5DCGA 1K3OA 2NDOA 5IO0A 1FG4A 4MJAA 2KOKA 2AHEA 3P7XA 1VF3A 1J9BA 3HXSA 3IAS2 2YV9A 1HQOA 1OAZA 3ZFBA 2HLSA 1R7HA 2VIMA 2VCQA 3D6IA 1SYXA 4DSSB 4MF7A 1GWCA 5IO2A 1VGLA 1EGOA 5G30A 1ML6A 1SL0B 1ZYQB 2RIIA 2FCHA 1DE2A 3SBCA 4NPBA 1RQMA 1Z3EA 1EEJA 2GSTA 4N11A 3IK7A 1OVNA 2H01A 1UC7A 3F4RA 1SKSB 1M7TA 3KMNA 2JADA 2H30A 2FY6A 1M2BA 3I9V2 2K18A 4CDOA 4K7IA 4GWRA 3F3RA 5FWGA 5IMVA 5KN0A 5DBQA 17GSA 4ACSA 5G31A 4ECCA 5G2ZA 2DLXA 3UVTA 1PKZA 4ULXA 4JE1A 1EV4A 1GSSA 2DJ0A 3IOSA 1S3AA 3BCKA 5ECLB 3IRAA 4LMVA 2IMIA 1CQHA 2H71A 3VLNA 3LQ7A 4JR4A 5DAKA 3ZMLA 4ZL9A 4WKWA 4Q5FA 1TW9A 2GZZA 1USBA 1A2JA 1K0AA 1F3AA 2CV4A 4E8HA 1GUKA 1GSYA 19GSA 2HI7A 2AAWA 1THOA 1TRSA 3HD5A 4HOJA 1U3IA 3GURA 1XVWA 2MMNA 5D8IA 2AYTA 3ZL5A 1M0UA 3ZRDA 4V2MA 2AV4A 3E0UA 1E2YA 2N5FA 3MNGA 1T00A 3VI7A 3HCZA 4X1UA 2A2RA 1TKDB 2JZSA 4XRDA 3WGDA 4PNGA 2IMDA 4LL4B 3TRXA 2B5XA 2MMAA 2JZRA 3KZQA 1GUMA 2HSHA 2NTOA 4GLTA 2L59A 1SENA 3O76A 3W8SA 2CAQA 1HYUA 2ZCTA 2OADA 3EWLA 2CAIA 4IJ3A 1F2EA 3KIJA 5ELGA 5KN3A 1X0RA 2WZ9A 1GUHA 1B9YC 1FB6A 3I69A 2I4AA 4XRAA 5IOWA 1QQ2A 3DXBA 4V1Ap 3ZIVA 1G6YA 2V1MA 2TIRA 2N5AA 1BQ7A 1A24A 2LRTA 2F9SA 2K9FA 3H8QA 1K0OA 1N8JA 1WP0A 1V57A 1AUCA 4F0CA 3WT2A 3C7MA 4Q5NA 3VI5A 3EE2A 2IMKA 3LXTA 5JCGA 4PQ1A 1AAZA 2MYGA 5CYYA 4YAVA 4WF4A 1VF2A 2FWEA 5F06A 2H0HA 2ZUPA 3LYKA 1O8XA 4Q5RA 4PX1A 2J23A 3M0FA 2AUVA 3F8UA 4CHSA 4Q5QA 2OE0A 1TP9A 3KP9A 2DIZA 5GAND 3FZ9A 5D9TA 5H5QA 3KEBA 1GTUA 3FY7A 1ACVA 4WXTA 2MBTA 1N2AA 5HR3A 3UOMA 1J08A 2GT5A 1QFNA 5B8BA 5F05A 2B6MA 1FW1A 14GSA 4HDEA 4WBJA 3IXRA 2WGRA 2IIYA 2N5BA 4MCUA 1URMA 1QMVA 1AQXA 1AQVA 2PVQA 1NHYA 5H5SA 3RHBA 1B4QA 3K8NA 1Z5YE 5HR2A 4MPFA 2LEGA 3APQA 1WE0A 1A8LA 4KB3A 5DALA 4L0UA 1BYEA 2R3XA 4ZXGA 3NZNA 3LFLA 2FWHA 3WGXA 4POLA 4J57E 4JU5A 2FWFA 1A8YA 2R6KA 2HE3A 1G7EA 4X0XA 4WBRD 2CVDA 3J7Yk 5ECIB 4GSSA 1O81A 4O5RA 3I6AA 1X9WB 2G2QA 5JCWA 1Y25A 2B1LA 5IMFA 10GSA 3UIWA 2IWTA 2BTOT 4OFNA 2KLXA 3IV4A 4IELA 4N30A 2CQ9A 2PPTA 1GSUA 4G19A 1R4WA 1Z9HA 3VWXA 4GQFA 3TJKA 2AB6A 3GN3A 2O7KA 5ECSA 2MZCA 4IQ1A 3C1RA 3TGZA 4V1Ag 1SK0A 3TCOA 1YEPA 3GH9A 3ED3A 4POMA 3R2QA 1JZRA 4IN0A 2H74A 3M1GA 1X5DA 2FWGA 1X9MB 1SKWB 2YZHA 3H79A 1DE1A 3CYNA 3L4NA 6GSXA 2VCZA 1UN2A 4MP4A 5J5NA 4NV5A 1KBNA 4JEDA 5DJLA 1JFUA 3OR5A 3J7Yb 2WB9A 3FR3A 5COHA 3GX8A 4OWYA 5A4WA 3ERGA 3RHCA 4HU7A 4NHWA 1NW2A 1ON4A 2MMOA 2B5EA 2IJYA 4DSQA 2RUFA 1TDIA 2L6CA 1NM3A 3G7YA 1PL2A 3HJOA 4KE3A 4ZB6A 3UARA 1GRXA 1QXHA 4EKZA 1I9DA 2WCIA 1MD4A 2E0QA 3TJGA 3IPZA 2H1GA 2PERA 2C3NA 4MZCA 2DJJA 3L9UA 2YV7A 2VL2A 4FYUA 1V98A 3VFIA 1Z7PA 5ECOB 2L5OA 4ECJA 4IVFA 3G7JA 4DVCA 4GQCA 4GSNA 1K0DA 2HSYA 1TRWA 4RQRA 3S9FA 2GZPA 1ZYEA 2KHPA 4D73A 16GSA 2LQOA 1O6JA 2DBCA 1BEDA 3EURA 2CZ2A 3AY8A 4FYCA 2YJHA 1YF1A 1AXDA 2WJUA 2TRXA 4NMUA 5G5EA 4TXVA 2H8LA 3KMOA 4BWSA 1FB0A 4EO3A 1MDJA 1OKDA 2EIOA 3E9JB 3LXZA 1I5GA 2B7KA 3QR6A 3O6TA 6GSVA 1LJRA 5F0GA 3LEFA 4MPGA 2YP6A 3FZAA 1WIKA 4TKYA 4XHMA 4L8EA 3GUSA 1SJIA 4MA9A 4EVMA 2VL3A 3TUEA 2HRNA 1KTEA 1O7UA 5HQPA 1B9XC 3A3TA 3BCIA 4JZQA 2BMXA 5IIZA 2C3QA 4TR3A 1SD8A 2YWOA 1OC9A 3IC4A 3KH7A 4TRXA 3UMAA 5J3RA 4AJ7A 1XW6A 1ERUA 5INYA 2WFCA 5JWRB 2LJKA 1XWKA 2OE3A 4MF6A 4EUYA 2GSQA 1THXA 4KSOA 5EY6A 3KP8A 3C1SA 1QK8A 4XS4A 4BA7A 1F9MA 2E2MA 4KCAA 5EPFA 1PN9A 1GP1A 4TR4A 1PD21 2KP1A 4V2LA 1MTCA 4K7NA 3IHQA 4H86A 4LA1A 1GSQA 3TB2A 1XCCA 4HZ4A 1Z6NA 3TKSC 4POBA 2LRNA 3HVSA 3HDCA 3DKSA 4L0WA 3DGQA 4GF0A 1SYRA 2DJ1A 4KAEA 4QL9A 1G0TA 2REMA 5ABRA 5CRDA 1Z7RA 4I97A 2GGTA 3FW2A 2VCXA 1YEXA 2I3YA 1DUGA 2PBJA 3GYKA 3PH9A 2C0GA 2YZUA 4ML6A 3GX0A 2VCWA 3MDKA 4WEYA 5B8AA 1MDIA 4KDYA 4IS0A 6GSYA 1K3LA 2YWMA 1C72A 4IQAA 3KM6A 1MDKA 3ZYWA 3TKRA 4TXOB 2LKUA 3MAKA 3ZTLA 4DEJA 4HU9A 5ID2B 3C8EA 2GS3A 4JR6A 5EL8A 5E59A 4PUFC 1SK1A 2RLIA 2PN8A 2H66A 1EOGA 5DCHA 1WRYA 1SD9A 3LJRA 3L9VA 2C80A 3FYGA 4ZBAA 1DBYA 2QGVA 3EMXA 1JZDA 3HJMA 4G9HA 3TKPA 1OE7A 2Z9SA 2A4VA 2PVOC 3D0ZA 1YQ1A 4BVYA 4TR0A 1MD3A 4GCIA 4YH2A 1OC8A 5D93A 3C73A 3GKKA 1SK2A 2C8UA 2H72A 1R5AA 4HQSA 5IQYA 4EC0A 1ERWA 1T4ZA 2EC4A 5ECMB 3VURA 3F63A 4IP1A 4ZIJA 3F4TA 3BD2A 1SKRB 4KUNA 3I43A 4IP6A 3BJ5A 5G1LA 1XWCA 2CVKA 3GHAA 3TOUA 5ECKB 1YKCA 4HI7A 2F51A 4PQHA 1GL8A 2M46A 2H19A 2H76A 3RDWA 1XXUA 2PWJA 4KDXA 1Q4JA 3A2XA 2M80A 2F8AA 3F6FA 2EIRA 3HVXA 3PINA 4ECIA 2OKAA 1RK4A 2X64A 4OO4A 3GTUA 5D9WA 5IM9A 1GSEA 4TR1A 1YY7A 3HY2A 2YANA 4GXZA 3DD3A 3N5OA 2HFDA 3FEUA 2IPAA 4QL7A 2IFQA 2GT6A 4ECBA 2P5QA 4DSRA 4G10A 2HZEA 3FR9A 4ZB8A 3F3QA 1QGVA 5C00A 4PUAA 1VRSD 4JRRA 1A0FA 5ECHB 3V1WA 2CX3A 2K8VA 2GVPA 2FA8A 3DWVA 4MZWA 4N0ZA 2LTKA 3EVIA 1ABAA 3CXGA 5FT3A 3HYPA 4EXJA 1TI1A 4L5OA 4HJ2A 1Z6MA 2GQLA 4MJCA 2KUCA 1A0RP 1AIUA 3IA1A 3FZ4A 1TRVA 1SL2B 4BPYA 2HYXA 1TI3A 3ZFLA 1S3DA 3NOFA 3TDGA 1XWGA 4MH2A 2JSZA 3LGCA 3GKMA 1F3BA 5D73A 3KCMA 2IMEA 3IDVA 4YQUA 3F4SA 3TJBA 4ZL7A 4O32A 4TVEA 1JLVA 1K0MA 2GQKA 2H0IA 2HZFA 4GSTA 2XBQA 2X8HA 2H1BA 4ISDA 1EP7A 2O89A 4TW5A 5EVOA 4DSSA 2RM5A 3APSA 1UVZA 3CSJA 1V9WA 2VM1A 3ZITA 5DDLA 5D9XA 1YKAA 1OKTA 4OCFA 5GSSA 3QFBC 5B7CA 1ST9A 3EC3A 2NBSA 4MH3A 1A2MA 1WJKA 4L5LA 1HNBA 4RI6A 4KX4A 4PNFA 1M99A 4JBBA 4PQIA 1XWAA 1PX7A 1O85A 1OC3A 4ZBDA 3GRXA 5ENUA 3MWHA 5DAKB 2ALBA 1S3CA 2B3SA 3ZZXA 2L57A 1XW9A 3CSHA 4RI7A 2V2GA 5A4UA 1Y6EA 3ME8A 4K6XA 2LQQA 2I1UA 1W4VA 1PQNA 1ERTA 3W8JA 5AIXA 4KSMA 5CP1A 5AGYA 2F8FA 4EF0A 2HRFA 4TOPA 2XPEA 3M9JA 2J9HA 5KEJA 2FA4A 2K8SA 1ZGNA 5G5FA 2C3TA 1U6TA 3LORA 3F9UA 2V6KA 1GNEA 3VPQA 1UA5A 2QKEA 1AW9A 3ME7A 2ON5A 3MSZA 4KW6A 5J9CA 3QFAC 2O8VB 1T8EB 1RW1A 3WGEA 1F6MC 1GTAA 1U3AA 2D2ZA 3VWVA 2H70A 2DSAA 5ECRB 2L6DA 3ERFA 5F8BA 5HR0A 2VM2A 1FO5A 2K6VA 2VO4A 3QCPA 1O8WA 1EZKA 1GSDA 2EIQA 5CREA 1EEMA 2P31A 3DMLA 4ZBBA 3GMFA 5HFIA 2B7JA 1R26A 1SU9A 1PL1A 4EE0A 5GSTA 2FLSA 3ZVJA 1T1VA 1GH2A 2JACA 1SJ6A 1EGRA 3L78A 4IKHA 1XFLA 1T4YA 2QSIA 3EYTA 1WOUA 3P2AA 4PXOA 3LSZA 5ECNB 3QDNA 4O92A 1AC1A 5D9VA 13GSA 4XIHA 1WPIA 5AISA 2VOCA 5IPGA 1HNCA 3ZLPA 3Q19A 4X43A 2O87A 2OE1A 1TU7A 2V32A 3CTFA 3TRPA 3KTBA 1LU4A 2R4VA 5ECPB 4WR5A 4E8EA 1SJZA 3CBUA 3TOTA 2PUKC 2GSRA 4MZBA 1WMJA 2XC2A 4ILFA 4XS1A 4ID0A 3ZIJA 2X8GA 2P0GA 1CQGA 4WF5A 4LMWA 2OBKA 1TK0B 3UEMA 3QMXA 4KDUA 1O73A 4MMMA 1BG5A 1QUWA 1NHOA 2L4CA 3FR6A 1V58A 2YWNA 2FGXA 1FVKA 20GSA 2MBSA 2TRCP 2BJXA 2FD3A 1FVJA 2ZNMA 4K0NA 3Q74A 5ECQB 2XHFA 1BAYA 4J56E 4NHZA 2GQMA 2OJLA 1K0NA 3FKFA 3ERWA 1X5CA 5F07A 3DVWA 5DQYA 5H5RA 4MJBA 5A4VA 3TKQA 4BL7A 3QPMA 6GSUA 4G2EA 3UBKA 3FRCA 1PA3A 1ZCPA 3DIEA 5DALB 3SWLA 1J0FA 4HUAA 5HFKA 2DC5A 11GSA 1PX6A 1OE8A 4OMVA 2GTUA 2CX4A 2HXKA 2VD0A 2C0FA 6GSWA 3VPTA 3GL5A 5JCUA 2X8CA 3M8NA 3HZ4A 2GZYA 3GA4A 1G7OA 2L5LA 4IW9A 4KGIA 2GSSA 4GRFA 4OFMA 3A2VA 2YWIA 5HR1A 3G9BA 5KN1A 2WS2A 2CVBA 2JU5A 4K8MA 3APOA 4EDYA 3KJYA 4POKA 3UJ1A 4EL1A 5IMCA 1TJDA 4KNDA 3CSIA 5CRHA 3GNJA 2RM6A 3A2WA 2JSYA 4WETA 2WDUA 4I2UA 6GSSA 1EV9A 3TJFA 3D22A 3CTGA 4KA0A 3QAVA 4HZ2A 1JZWA 2H0GA 1TK8B 1JZOA 4AGSA 2M72A 3GSTA 1BX9A 1SL1B 1GLQA 2VUPA 2C0DA 1FHEA 4K1FA 3JCML 5G1KA 1PSQA 4K2DA 5C04A 3QAGA 3GH6A 1XOAA 5GZZB 5J4UA 4I2TA 4FO5A 2JZTA 2OA7A 4K9ZA 3GFKA 1HNAA 4YQMA 4IGJA 1T3BA 2F3MA 1VF1A 3D5JA 2FUG2 2DJ2A 1H4OA 2FHEA 2HT9A 1XZOA 3VWUA 2NPBA 4IJIA 1PGTA 2LUSA 3KD0A 1XW5A 2H6XA 2LV3A 2MMZA 4AJ8A 2YPMA 2E2GA 3GKNA 5IMZA 2OACA 1GTIA 3VK9A 3HVVA 3GL3A 5A5KA 2QC7A 5LD0A 1PRXA 5CRWA 2LNTA 5JWQB 1XBSA 3DRNA 4HS1A 1W89A 2G0FA 4D73B 3HA9A 2R5GA 4O7HA 3F0IA 2CA8A 3US3A 3UVHA 2V6OA 1FOVA 4BVXA 1MEKA 3LYPA 3EU4A 3CMIA 3Q6OA 2VCVA 3IBHA 1B48A 3KTLA 3FHKA 1ZZYA 1U88A 2CZ3A 1EOHA 3P90A 3U5RE 1TU8A 4LLRA 3KGKA 2A2SA 1B4PA 5IMAA 3PR8A 4LL1B 4V2NA 2GLRA 4HQZA 2CT6A 3TKSA 4OO5A 1BJXA 2C4JA 2I9HA 3H93A 3UAPA 4P3YB 1EWXA 2H6ZA 3WYWA 3KH9A 1TRUA 1H75A 1YJ6A 1ZOFA 4NXIA 1YZXA 2KP2A 4OFTA 1OC9B 3CRUA 4RQXA 3ZREA 1K0BA 3BBYA 1TXXA 1F37A 5J9BA 4I5QA 2VLTA 1FAAA 5AN1A 1GSFA 5IPHA 4HEA2 4N10A 4RUVA 3ZVJD 3QD9A 5L71A 4J2FA 1Q98A 2VL2C 5HFGA 1DSBA 5E4WA 2PGTA 2P5RA 4IHUA 3TKSE 1WWJA 4XS4B 4FYBA 2H6YA 3GV1A 2LS5A 5LCZA 5CO3A 2VCTA 2I81A 1KNGA 3DEXA 3WD6A 4OD7A 3PGTA 4AF2A 2R2JA 1T7PB 3VWWA 2VL9A 3N9JA 2VAFA 4GTUA 1YF0A 1E6BA 4OCEA 3RPNA 4F03A 5AIVA 2PU9C 4Z7XA 3GIXA 1G6WA 3LWAA 3P8WA 4F9ZA 2H73A 3RPPA 1ZL9A 1PKWA 4ML1A 1TK5B 1U87A 4FH8A 3RBTA 1M2DA 3C71A 1HD2A 3CRTA 3RAZA 5J41A 1GULA 1IYHA 2OBIA 3D21A 2HNLA 4K0GA 5KN2A 3M3MA 1LBKA 5CRGA 4MLYA 3IK9A 3O3TA 2O85A 5IOXA 1M9BA 1EP8A 3Q18A 2NVLA 4IBPA 4WR4A 4F82A 4NWYA 5CNWA 1GTBA 3L0HA 5ELAA 3BOAA 2VD1A 7GSSA 3IR4A 18GSA 2YJ7A 2AJQB 4KH7A 3DVXA 4BWQA 2WRTA 4ZB9A
chains in the Genus database with same CATH superfamily
3NIVA 4MJEA 1X9SB 2LRCA 1M9AA 3FK8A 4I8BA 4MNNA 3EU3A 1B8XA 5FHIA 4TXOA 2RUEA 4O5UA 3EPTA 4NV2A 1R5PA 5LNKe 4K7OA 5ID2A 3E3EA 4MDCA 2H1DA 1ZMAA 4I6XA 3UBLA 9GSSA 1X5EA 3QOUA 3UL3A 3F6DA 4HJMA 4MK3A 4BVYB 1JLWA 1K3YA 3TRQA 2X4AA 4ZL8A 3FZ5A 3IE3A 4PGTA 4NAXA 1AQWA 5JWOB 1GLPA 2E7PA 3HJPA 2YCDA 2YNXA 3IAM2 2ON7A 2LNSA 1XWBA 4XCSA 1JHBA 3HHVA 1XPVA 2VLVA 1A2LA 3H4KA 1XIYA 5D96A 1ERVA 1GNWA 4Z2UA 3GKXA 4YQVA 4FIWA 8GSSA 2DMMA 4EDZA 1VF4A 2IL3A 5IMDA 2DKHA 2YOIA 3TJJA 2B1KA 1K0CA 2GDRA 5DQSA 4N0VA 1ILOA 3LG6A 3A5IA 2JL4A 4PURA 3D4TA 2XBIA 4TN8A 3ISOA 4MABA 2IMFA 5DJMA 1V40A 3HKRA 3GTUB 2WULA 4TR1B 3KXOA 3EINA 2C0EA 3GSSA 2C1YA 2LSTA 4MF5A 1PMTA 3HZ8A 3EMPA 2YN1A 3U6VA 1V2AA 3W6GA 3A5WA 2H1AA 2IFQB 2XPDA 5DVBA 1XOBA 2DMLA 4XS6A 6GSTA 1KEBA 2HZEB 1M2AA 2IN3A 4AJ6A 3M9KA 3H1NA 4KCEA 2R37A 22GSA 1IYIA 2VLUA 2V41A 1YDKA 1TOFA 1TTZA 2LJRA 5B6NA 4F2IA 4ZILA 2L4QA 4PTSA 3G7IA 5B6MA 1A23A 1NSWA 12GSA 4QQ7A 1XVQA 3D4MA 2B5YA 2DJKA 3ZMKA 3DYRA 4YAPA 2PMTA 2H75A 3L9SA 2X99A 1OYJA 2DIYA 4XTSA 2LJAA 4CW9A 3WT1A 2DJ3A 2DKIA 3PPUA 2ES7A 3QAWA 5GAPD 4G0IA 4F0BA 5CAXA 2FNOA 5DCGA 1K3OA 2NDOA 5IO0A 1FG4A 4HSCX 4MJAA 2KOKA 2AHEA 3P7XA 1VF3A 1J9BA 3HXSA 3IAS2 2YV9A 1HQOA 1OAZA 3ZFBA 2HLSA 1R7HA 1PN0A 2R0GA 1S3RA 2VIMA 2VCQA 3D6IA 1SYXA 4DSSB 4MF7A 1XG8A 1GWCA 5IO2A 1VGLA 1EGOA 5G30A 1ML6A 1SL0B 1ZYQB 2RIIA 2FCHA 1DE2A 3SBCA 4NPBA 1RQMA 1Z3EA 1EEJA 2GSTA 4N11A 3IK7A 1OVNA 2H01A 1UC7A 3F4RA 1SKSB 1M7TA 3KMNA 2JADA 2H30A 2FY6A 1M2BA 3I9V2 2K18A 4CDOA 4K7IA 4GWRA 3F3RA 5FWGA 5IMVA 5KN0A 5DBQA 17GSA 4ACSA 5G31A 4ECCA 5G2ZA 2DLXA 3UVTA 1PKZA 4ULXA 4JE1A 1EV4A 1GSSA 2DJ0A 3IOSA 1S3AA 3BCKA 5ECLB 3IRAA 4LMVA 2IMIA 1CQHA 2H71A 3VLNA 3LQ7A 4JR4A 5DAKA 3ZMLA 4ZL9A 4WKWA 4Q5FA 1TW9A 2GZZA 1USBA 1A2JA 1K0AA 1F3AA 2CV4A 4E8HA 1GUKA 1GSYA 19GSA 2HI7A 2AAWA 1THOA 1TRSA 3HD5A 4HOJA 1U3IA 2A2PA 3GURA 1XVWA 2MMNA 5D8IA 2AYTA 3ZL5A 1M0UA 3ZRDA 4V2MA 2AV4A 3E0UA 1E2YA 2N5FA 3MNGA 1T00A 3VI7A 3HCZA 4X1UA 2A2RA 1TKDB 2JZSA 4XRDA 3WGDA 4PNGA 2IMDA 4LL4B 3TRXA 4ICYA 2B5XA 2MMAA 2JZRA 3KZQA 1GUMA 2HSHA 2NTOA 4GLTA 2L59A 1SENA 3O76A 3W8SA 2CAQA 1HYUA 2ZCTA 3MYDA 2OADA 3EWLA 2CAIA 4IJ3A 4EIQA 1F2EA 3KIJA 5ELGA 5KN3A 1X0RA 2WZ9A 1GUHA 1B9YC 1FB6A 3I69A 2I4AA 4XRAA 5IOWA 1QQ2A 3DXBA 4V1Ap 3ZIVA 1G6YA 2V1MA 2TIRA 2N5AA 1BQ7A 1A24A 2LRTA 2F9SA 2K9FA 3H8QA 1K0OA 1N8JA 1WP0A 1V57A 1AUCA 4F0CA 3WT2A 3C7MA 4Q5NA 3VI5A 3EE2A 2IMKA 3LXTA 5JCGA 4PQ1A 1AAZA 2MYGA 5CYYA 4WF4A 1VF2A 4YAVA 2FWEA 5F06A 2H0HA 2ZUPA 3LYKA 1O8XA 4Q5RA 4PX1A 4KF9A 2J23A 3M0FA 2AUVA 3F8UA 4CHSA 4Q5QA 2OE0A 1TP9A 3KP9A 2DIZA 5GAND 3FZ9A 5D9TA 5H5QA 3KEBA 1GTUA 3FY7A 1ACVA 2HRKA 4WXTA 2MBTA 1N2AA 4BL7B 5HR3A 3UOMA 1J08A 2GT5A 1QFNA 5B8BA 5F05A 2B6MA 1FW1A 14GSA 4HDEA 4WBJA 3IXRA 2WGRA 2IIYA 2N5BA 4MCUA 1URMA 1QMVA 1AQXA 1AQVA 2PVQA 1NHYA 5H5SA 3RHBA 1B4QA 3K8NA 1Z5YE 5HR2A 4MPFA 2LEGA 3APQA 1WE0A 1A8LA 4KB3A 5DALA 4L0UA 1BYEA 2R3XA 4ZXGA 3NZNA 3LFLA 2FWHA 3WGXA 4POLA 4J57E 5BRTA 4JU5A 2FWFA 1A8YA 2R6KA 2HE3A 1G7EA 4X0XA 4WBRD 2CVDA 3J7Yk 5ECIB 4GSSA 1O81A 4O5RA 3I6AA 1X9WB 1ZYNA 2G2QA 5JCWA 1Y25A 2B1LA 5IMFA 10GSA 3UIWA 2IWTA 2BTOT 4OFNA 2KLXA 3IV4A 4IELA 4N30A 2CQ9A 2PPTA 1GSUA 4G19A 1R4WA 1Z9HA 3VWXA 4GQFA 3TJKA 2AB6A 3GN3A 2O7KA 5ECSA 2MZCA 4IQ1A 3C1RA 3TGZA 4V1Ag 1SK0A 3TCOA 1YEPA 3GH9A 3ED3A 4POMA 3R2QA 1JZRA 4IN0A 3IHGA 2H74A 3M1GA 1X5DA 2FWGA 1X9MB 1SKWB 2YZHA 3H79A 1DE1A 3CYNA 3L4NA 6GSXA 2VCZA 1UN2A 5BMUA 4MP4A 5J5NA 4NV5A 1KBNA 4JEDA 3OR5A 1JFUA 5DJLA 3J7Yb 2WB9A 4X4JA 3FR3A 5COHA 3GX8A 4OWYA 5A4WA 3ERGA 3RHCA 4HU7A 4NHWA 1NW2A 1ON4A 2MMOA 2B5EA 2IJYA 4DSQA 2RUFA 2R0PA 1TDIA 2UZ8A 2L6CA 1NM3A 3G7YA 1PL2A 3HJOA 4KE3A 4ZB6A 3UARA 1GRXA 1QXHA 4EKZA 1M3JA 1I9DA 2WCIA 1MD4A 2E0QA 3TJGA 3IPZA 2H1GA 2PERA 2C3NA 4MZCA 2DJJA 3L9UA 2YV7A 2VL2A 4FYUA 1V98A 3VFIA 1Z7PA 5ECOB 2L5OA 4ECJA 4IVFA 3G7JA 4BVXB 4GQCA 4DVCA 4GSNA 1K0DA 2HSYA 1TRWA 4RQRA 3S9FA 2GZPA 1ZYEA 2KHPA 4D73A 16GSA 2LQOA 1O6JA 2DBCA 1BEDA 3EURA 2CZ2A 3AY8A 4FYCA 2YJHA 1YF1A 1AXDA 2WJUA 2TRXA 4NMUA 5G5EA 4TXVA 2H8LA 3KMOA 4BWSA 1FB0A 4EO3A 1MDJA 1OKDA 2EIOA 3E9JB 3LXZA 1I5GA 2B7KA 3QR6A 3O6TA 6GSVA 1LJRA 5F0GA 3LEFA 4Z2RA 4MPGA 2YP6A 3FZAA 1WIKA 4TKYA 4XHMA 4L8EA 3GUSA 1SJIA 4MA9A 4EVMA 2VL3A 3TUEA 2HRNA 1KTEA 1O7UA 5HQPA 1B9XC 3A3TA 3BCIA 4JZQA 2BMXA 5IIZA 2C3QA 4TR3A 1SD8A 2YWOA 1OC9A 3IC4A 3KH7A 4TRXA 3UMAA 4A5PA 5J3RA 4AJ7A 1XW6A 4O5QA 1ERUA 5INYA 2WFCA 5JWRB 2LJKA 1XWKA 2OE3A 4MF6A 4EUYA 2GSQA 1THXA 4KSOA 5EY6A 3KP8A 3C1SA 1QK8A 4XS4A 4BA7A 1F9MA 2E2MA 4KCAA 5EPFA 1PN9A 1GP1A 4TR4A 1PD21 2KP1A 4V2LA 1MTCA 4K7NA 3IHQA 4H86A 4LA1A 1GSQA 3TB2A 1XCCA 4HZ4A 1Z6NA 3TKSC 4POBA 2LRNA 3HVSA 3HDCA 3DKSA 4L0WA 3DGQA 4GF0A 1SYRA 2DJ1A 4KAEA 4QL9A 1G0TA 2REMA 5ABRA 5CRDA 1Z7RA 4I97A 2GGTA 3FW2A 2VCXA 1YEXA 2I3YA 1DUGA 2PBJA 3GYKA 3PH9A 2C0GA 2YZUA 4ML6A 3GX0A 2VCWA 3MDKA 4WEYA 5B8AA 1MDIA 4KDYA 4IS0A 6GSYA 1K3LA 2YWMA 1C72A 4IQAA 3KM6A 1MDKA 3ZYWA 3TKRA 4TXOB 2LKUA 3MAKA 3ZTLA 4DEJA 4HU9A 5ID2B 3C8EA 2GS3A 4JR6A 5EL8A 5E59A 4PUFC 1SK1A 2RLIA 2PN8A 2H66A 2X49A 1EOGA 5DCHA 1WRYA 1SD9A 3LJRA 3L9VA 2C80A 4K2XA 3FYGA 4ZBAA 1DBYA 2QGVA 3EMXA 1JZDA 3HJMA 4G9HA 3TKPA 4EIPA 1OE7A 2Z9SA 2A4VA 2PVOC 3D0ZA 1YQ1A 4BVYA 4TR0A 1MD3A 4GCIA 4YH2A 3FMWA 1OC8A 5D93A 3C73A 3GKKA 1SK2A 4USSA 2C8UA 2H72A 1R5AA 4HQSA 5IQYA 4EC0A 1PFOA 1ERWA 1T4ZA 2EC4A 5ECMB 3IC8A 3VURA 3F63A 4IP1A 4ZIJA 3F4TA 3BD2A 1SKRB 4KUNA 3I43A 4IP6A 3BJ5A 5G1LA 1XWCA 2CVKA 3GHAA 3TOUA 5ECKB 1YKCA 4HI7A 2F51A 4PQHA 1GL8A 2M46A 2H19A 4K5SA 2H76A 3RDWA 1XXUA 2PWJA 4KDXA 1Q4JA 3A2XA 2M80A 2F8AA 3F6FA 2EIRA 3HVXA 3PINA 4ECIA 2OKAA 1RK4A 2X64A 4OO4A 3GTUA 5D9WA 5IM9A 1GSEA 4TR1A 1YY7A 3HY2A 2YANA 4GXZA 5KOXA 3DD3A 3N5OA 2HFDA 3FEUA 2IPAA 4QL7A 2IFQA 2GT6A 4ECBA 2P5QA 4DSRA 4YKFA 4G10A 2HZEA 3FR9A 2QA1A 4ZB8A 3F3QA 1QGVA 5C00A 4PUAA 1VRSD 4JRRA 1M3IA 1A0FA 5ECHB 3V1WA 2CX3A 2K8VA 2GVPA 2FA8A 3DWVA 4MZWA 4N0ZA 2LTKA 3EVIA 1ABAA 3CXGA 5FT3A 3HYPA 4EXJA 1TI1A 4L5OA 4HJ2A 1Z6MA 2GQLA 4MJCA 2KUCA 1A0RP 1AIUA 3IA1A 3FZ4A 1TRVA 1SL2B 4BPYA 2HYXA 1TI3A 3ZFLA 1S3DA 3NOFA 3TDGA 1XWGA 4MH2A 2JSZA 3LGCA 3GKMA 1F3BA 5D73A 3KCMA 2IMEA 3IDVA 4YQUA 3F4SA 3TJBA 4ZL7A 4O32A 4TVEA 1JLVA 1K0MA 2GQKA 2H0IA 2HZFA 4GSTA 2XBQA 2X8HA 2H1BA 4ISDA 1EP7A 2O89A 4TW5A 5EVOA 4DSSA 4K5RA 2RM5A 3APSA 1UVZA 3CSJA 1V9WA 2VM1A 3ZITA 5DDLA 5D9XA 4CY6A 1YKAA 1OKTA 4OCFA 5GSSA 3QFBC 5B7CA 1ST9A 3EC3A 2NBSA 4MH3A 1A2MA 1WJKA 4L5LA 1HNBA 4RI6A 2HRAA 4KX4A 4PNFA 1M99A 4JBBA 4PQIA 1XWAA 1PX7A 1O85A 1OC3A 4ZBDA 3GRXA 5ENUA 3MWHA 5DAKB 2ALBA 1S3CA 2B3SA 3ZZXA 2L57A 1XW9A 3CSHA 2R0CA 4RI7A 2V2GA 5A4UA 1Y6EA 3ME8A 4K6XA 2LQQA 2I1UA 1W4VA 1PQNA 1ERTA 3W8JA 5AIXA 4KSMA 5CP1A 5AGYA 2F8FA 4EF0A 2HRFA 4TOPA 2XPEA 3M9JA 4G0LA 2J9HA 5KEJA 2FA4A 2K8SA 1ZGNA 5G5FA 3CQFA 2C3TA 1U6TA 3LORA 3F9UA 2V6KA 1GNEA 3VPQA 1UA5A 2QKEA 1AW9A 3ME7A 2ON5A 3MSZA 4KW6A 5J9CA 3QFAC 2O8VB 1T8EB 1RW1A 3WGEA 1F6MC 1GTAA 1U3AA 2D2ZA 3VWVA 2H70A 2DSAA 5ECRB 2L6DA 3ERFA 5F8BA 5HR0A 2VM2A 1FO5A 2K6VA 2VO4A 3QCPA 1O8WA 1EZKA 1GSDA 2EIQA 5CREA 1EEMA 2P31A 3DMLA 4ZBBA 3GMFA 5HFIA 2B7JA 1R26A 1SU9A 1PL1A 4EE0A 5GSTA 2FLSA 3ZVJA 1T1VA 1GH2A 2JACA 1SJ6A 1EGRA 3L78A 4IKHA 1XFLA 1T4YA 2QSIA 3EYTA 1WOUA 3P2AA 4PXOA 3LSZA 5ECNB 3QDNA 4O92A 1AC1A 5D9VA 13GSA 4XIHA 1WPIA 5AISA 2VOCA 5IPGA 1HNCA 3ZLPA 3Q19A 4X43A 2O87A 2OE1A 1TU7A 4Z2TA 2V32A 3CTFA 3TRPA 3KTBA 1LU4A 2R4VA 5ECPB 4WR5A 4E8EA 1SJZA 3CBUA 3TOTA 2PUKC 2GSRA 4MZBA 1WMJA 2XC2A 4ILFA 4XS1A 4FQUA 4ID0A 3ZIJA 2X8GA 2P0GA 1CQGA 4WF5A 4LMWA 2OBKA 1TK0B 3UEMA 3QMXA 4KDUA 1O73A 4MMMA 1BG5A 1QUWA 1NHOA 2L4CA 3FR6A 1V58A 2YWNA 2FGXA 1FVKA 20GSA 2MBSA 2TRCP 2BJXA 2FD3A 1FVJA 2ZNMA 4K0NA 3Q74A 5ECQB 2XHFA 1BAYA 4J56E 4NHZA 2GQMA 2OJLA 1K0NA 3FKFA 3ERWA 1X5CA 5F07A 3DVWA 5DQYA 5H5RA 4MJBA 5A4VA 3TKQA 4BL7A 3QPMA 6GSUA 4G2EA 3UBKA 3FRCA 1PA3A 1ZCPA 3DIEA 5DALB 3SWLA 1J0FA 4HUAA 5HFKA 2DC5A 11GSA 1PX6A 1OE8A 4OMVA 2GTUA 2CX4A 2HXKA 2VD0A 2C0FA 6GSWA 3VPTA 3GL5A 2A4HA 5JCUA 2X8CA 3M8NA 3HZ4A 2GZYA 3GA4A 1G7OA 2L5LA 4IW9A 4KGIA 2GSSA 4GRFA 4OFMA 3A2VA 2YWIA 3HVNA 5HR1A 3G9BA 5KN1A 2WS2A 2CVBA 2JU5A 4K8MA 3APOA 4EDYA 3KJYA 4POKA 4G0KA 3UJ1A 4EL1A 5IMCA 1TJDA 4KNDA 3CSIA 5CRHA 3GNJA 2RM6A 3A2WA 2JSYA 4WETA 2WDUA 4I2UA 6GSSA 1EV9A 3TJFA 3D22A 3CTGA 4KA0A 3QAVA 4HZ2A 1JZWA 2H0GA 1TK8B 1JZOA 4AGSA 2M72A 3GSTA 1BX9A 1SL1B 1GLQA 2VUPA 2C0DA 1FHEA 4K1FA 3JCML 5G1KA 1PSQA 4K2DA 5C04A 3QAGA 3GH6A 1XOAA 5GZZB 5J4UA 4I2TA 4FO5A 2JZTA 2OA7A 4K9ZA 3GFKA 1HNAA 4YQMA 4IGJA 1T3BA 2F3MA 1VF1A 3D5JA 2FUG2 2DJ2A 2HSMA 1H4OA 3LW9A 2FHEA 2HT9A 1XZOA 3VWUA 2NPBA 4IJIA 1PGTA 2LUSA 3KD0A 1XW5A 2H6XA 2LV3A 2MMZA 4AJ8A 2YPMA 2E2GA 3GKNA 5IMZA 2OACA 2QA2A 1GTIA 3VK9A 3HVVA 3GL3A 5A5KA 2QC7A 5LD0A 1PRXA 5CRWA 2LNTA 5JWQB 1XBSA 3DRNA 4HS1A 1W89A 2G0FA 4D73B 3HA9A 2R5GA 4O7HA 4YKGA 3F0IA 2CA8A 3US3A 3UVHA 2V6OA 1FOVA 4BVXA 1MEKA 3LYPA 3EU4A 3CMIA 3Q6OA 2VCVA 3IBHA 1B48A 3MIXA 3KTLA 3FHKA 1ZZYA 1U88A 2CZ3A 1EOHA 3P90A 3U5RE 1TU8A 4LLRA 3KGKA 2A2SA 1B4PA 5IMAA 3PR8A 4LL1B 4V2NA 2GLRA 4HQZA 2CT6A 3TKSA 4OO5A 3R3EA 1BJXA 2C4JA 2I9HA 3H93A 3UAPA 4P3YB 1EWXA 1FOHA 2H6ZA 3WYWA 3KH9A 1TRUA 1H75A 1YJ6A 1ZOFA 4NXIA 1YZXA 2KP2A 4OFTA 1OC9B 3CRUA 4RQXA 3ZREA 1K0BA 3BBYA 1TXXA 1F37A 5J9BA 4I5QA 2VLTA 1FAAA 5AN1A 1GSFA 5IPHA 4HEA2 4N10A 4RUVA 3ZVJD 3QD9A 5L71A 4J2FA 1Q98A 2VL2C 5HFGA 1DSBA 5E4WA 2PGTA 2P5RA 4IHUA 3TKSE 1WWJA 4XS4B 4FYBA 2H6YA 3GV1A 2LS5A 5LCZA 5CO3A 2VCTA 2I81A 1KNGA 3DEXA 3WD6A 4OD7A 3PGTA 4AF2A 2R2JA 1T7PB 3VWWA 2VL9A 3N9JA 2VAFA 4GTUA 1YF0A 1E6BA 4OCEA 3RPNA 4F03A 5AIVA 2PU9C 4Z7XA 3GIXA 1G6WA 3LWAA 3P8WA 4F9ZA 2H73A 5KOWA 3RPPA 1ZL9A 1PKWA 4ML1A 1TK5B 1U87A 4FH8A 3RBTA 1M2DA 3C71A 1HD2A 3CRTA 3RAZA 5J41A 1GULA 1IYHA 2OBIA 3D21A 2HNLA 4K0GA 5KN2A 3M3MA 1LBKA 5CRGA 4MLYA 3IK9A 1ZYPA 3O3TA 2O85A 5IOXA 1M9BA 1EP8A 3Q18A 2NVLA 4IBPA 4WR4A 4F82A 4BIKA 4NWYA 5CNWA 1GTBA 3L0HA 5ELAA 3BOAA 2VD1A 7GSSA 3IR4A 4CY8A 18GSA 2YJ7A 2AJQB 4KH7A 3DVXA 4BWQA 2WRTA 4ZB9A
chains in the Genus database with same CATH topology
3NIVA 4MJEA 1X9SB 2LRCA 1M9AA 3FK8A 4I8BA 4MNNA 3EU3A 1B8XA 5FHIA 4TXOA 2RUEA 4O5UA 3EPTA 4NV2A 1R5PA 5LNKe 4K7OA 5ID2A 3E3EA 4MDCA 2H1DA 1ZMAA 4I6XA 3UBLA 9GSSA 1X5EA 3QOUA 3UL3A 3F6DA 4HJMA 4MK3A 4BVYB 1JLWA 1K3YA 3TRQA 2X4AA 4ZL8A 3FZ5A 3IE3A 4PGTA 4NAXA 1AQWA 5JWOB 1GLPA 2E7PA 3HJPA 2YCDA 2YNXA 3IAM2 2ON7A 2LNSA 1XWBA 4XCSA 1JHBA 3HHVA 1XPVA 2VLVA 1A2LA 3H4KA 1XIYA 5D96A 1ERVA 1GNWA 4Z2UA 3GKXA 4YQVA 4FIWA 8GSSA 2DMMA 4EDZA 1VF4A 2IL3A 5IMDA 2DKHA 2YOIA 3TJJA 2B1KA 1K0CA 2GDRA 5DQSA 4N0VA 1ILOA 3LG6A 3A5IA 2JL4A 4PURA 3D4TA 2XBIA 4TN8A 3ISOA 4MABA 2IMFA 5DJMA 1V40A 3HKRA 3GTUB 2WULA 4TR1B 3KXOA 3EINA 2C0EA 3GSSA 2C1YA 2LSTA 4MF5A 1PMTA 3HZ8A 3EMPA 2YN1A 3U6VA 1V2AA 3W6GA 3A5WA 2H1AA 2IFQB 2XPDA 5DVBA 1XOBA 2DMLA 4XS6A 6GSTA 1KEBA 2HZEB 1M2AA 2IN3A 4AJ6A 3M9KA 3H1NA 4KCEA 2R37A 22GSA 1IYIA 2VLUA 2V41A 1YDKA 1TOFA 1TTZA 2LJRA 5B6NA 4F2IA 4ZILA 2L4QA 4PTSA 3G7IA 5B6MA 1A23A 1NSWA 12GSA 4QQ7A 1XVQA 3D4MA 2B5YA 2DJKA 3ZMKA 3DYRA 4YAPA 2PMTA 2H75A 3L9SA 2X99A 1OYJA 2DIYA 4XTSA 2LJAA 4CW9A 3WT1A 2DJ3A 2DKIA 3PPUA 2ES7A 3QAWA 5GAPD 4G0IA 4F0BA 5CAXA 2FNOA 5DCGA 1K3OA 2NDOA 5IO0A 1FG4A 4MJAA 2KOKA 2AHEA 3P7XA 1VF3A 1J9BA 3HXSA 3IAS2 2YV9A 1HQOA 1OAZA 3ZFBA 2HLSA 1R7HA 1PN0A 2R0GA 2VIMA 2VCQA 3D6IA 1SYXA 4DSSB 4MF7A 1GWCA 5IO2A 1VGLA 1EGOA 5G30A 1ML6A 1SL0B 1ZYQB 2RIIA 2FCHA 1DE2A 3SBCA 4NPBA 1RQMA 1Z3EA 1EEJA 2GSTA 4N11A 3IK7A 1OVNA 2H01A 1UC7A 3F4RA 1SKSB 1M7TA 3KMNA 2JADA 2H30A 2FY6A 1M2BA 3I9V2 2K18A 4CDOA 4K7IA 4GWRA 3F3RA 5FWGA 5IMVA 5KN0A 5DBQA 17GSA 4ACSA 5G31A 4ECCA 5G2ZA 2DLXA 3UVTA 1PKZA 4ULXA 4JE1A 1EV4A 1GSSA 2DJ0A 3IOSA 1S3AA 3BCKA 5ECLB 3IRAA 4LMVA 2IMIA 1CQHA 2H71A 3VLNA 3LQ7A 4JR4A 5DAKA 3ZMLA 4ZL9A 4WKWA 4Q5FA 1TW9A 2GZZA 1USBA 1A2JA 1K0AA 1F3AA 2CV4A 4E8HA 1GUKA 1GSYA 19GSA 2HI7A 2AAWA 1THOA 1TRSA 3HD5A 4HOJA 1U3IA 2A2PA 3GURA 1XVWA 2MMNA 5D8IA 2AYTA 3ZL5A 1M0UA 3ZRDA 4V2MA 2AV4A 3E0UA 1E2YA 2N5FA 3MNGA 1T00A 3VI7A 3HCZA 4X1UA 2A2RA 1TKDB 2JZSA 4XRDA 3WGDA 4PNGA 2IMDA 4LL4B 3TRXA 4ICYA 2B5XA 2MMAA 2JZRA 3KZQA 1GUMA 2HSHA 2NTOA 4GLTA 2L59A 1SENA 3O76A 3W8SA 2CAQA 1HYUA 2ZCTA 3MYDA 2OADA 3EWLA 2CAIA 4IJ3A 4EIQA 1F2EA 3KIJA 5ELGA 5KN3A 1X0RA 2WZ9A 1GUHA 1B9YC 1FB6A 3I69A 2I4AA 4XRAA 5IOWA 1QQ2A 3DXBA 4V1Ap 3ZIVA 1G6YA 2V1MA 2TIRA 2N5AA 1BQ7A 1A24A 2LRTA 2F9SA 2K9FA 3H8QA 1K0OA 1N8JA 1WP0A 1V57A 1AUCA 4F0CA 3WT2A 3C7MA 4Q5NA 3VI5A 3EE2A 2IMKA 3LXTA 5JCGA 4PQ1A 1AAZA 2MYGA 5CYYA 4YAVA 4WF4A 1VF2A 2FWEA 5F06A 2H0HA 2ZUPA 3LYKA 1O8XA 4Q5RA 4PX1A 4KF9A 2J23A 3M0FA 2AUVA 3F8UA 4CHSA 4Q5QA 2OE0A 1TP9A 3KP9A 2DIZA 5GAND 3FZ9A 5D9TA 5H5QA 3KEBA 1GTUA 3FY7A 1ACVA 2HRKA 4WXTA 2MBTA 1N2AA 4BL7B 5HR3A 3UOMA 1J08A 2GT5A 1QFNA 5B8BA 5F05A 2B6MA 1FW1A 14GSA 4HDEA 4WBJA 3IXRA 2WGRA 2IIYA 2N5BA 4MCUA 1URMA 1QMVA 1AQXA 1AQVA 2PVQA 1NHYA 5H5SA 3RHBA 1B4QA 3K8NA 1Z5YE 5HR2A 4MPFA 2LEGA 3APQA 1WE0A 1A8LA 4KB3A 5DALA 4L0UA 1BYEA 2R3XA 4ZXGA 3NZNA 3LFLA 2FWHA 3WGXA 4POLA 4J57E 5BRTA 4JU5A 2FWFA 1A8YA 2R6KA 2HE3A 1G7EA 4X0XA 4WBRD 2CVDA 3J7Yk 5ECIB 4GSSA 1O81A 4O5RA 3I6AA 1X9WB 1ZYNA 2G2QA 5JCWA 1Y25A 2B1LA 5IMFA 10GSA 3UIWA 2IWTA 2BTOT 4OFNA 2KLXA 3IV4A 4IELA 4N30A 2CQ9A 2PPTA 1GSUA 4G19A 1R4WA 1Z9HA 3VWXA 4GQFA 3TJKA 2AB6A 3GN3A 2O7KA 5ECSA 2MZCA 4IQ1A 3C1RA 3TGZA 4V1Ag 1SK0A 3TCOA 1YEPA 3GH9A 3ED3A 4POMA 3R2QA 1JZRA 4IN0A 3IHGA 2H74A 3M1GA 1X5DA 2FWGA 1X9MB 1SKWB 2YZHA 3H79A 1DE1A 3CYNA 3L4NA 6GSXA 2VCZA 1UN2A 5BMUA 4MP4A 5J5NA 4NV5A 1KBNA 4JEDA 3OR5A 1JFUA 5DJLA 3J7Yb 2WB9A 4X4JA 3FR3A 5COHA 3GX8A 4OWYA 5A4WA 3ERGA 3RHCA 4HU7A 4NHWA 1NW2A 1ON4A 2MMOA 2B5EA 2IJYA 4DSQA 2RUFA 2R0PA 1TDIA 2UZ8A 2L6CA 1NM3A 3G7YA 1PL2A 3HJOA 4KE3A 4ZB6A 3UARA 1GRXA 1QXHA 4EKZA 1I9DA 2WCIA 1MD4A 2E0QA 3TJGA 3IPZA 2H1GA 2PERA 2C3NA 4MZCA 2DJJA 3L9UA 2YV7A 2VL2A 4FYUA 1V98A 3VFIA 1Z7PA 5ECOB 2L5OA 4ECJA 4IVFA 3G7JA 4BVXB 4GQCA 4DVCA 4GSNA 1K0DA 2HSYA 1TRWA 4RQRA 3S9FA 2GZPA 1ZYEA 2KHPA 4D73A 16GSA 2LQOA 1O6JA 2DBCA 1BEDA 3EURA 2CZ2A 3AY8A 4FYCA 2YJHA 1YF1A 1AXDA 2WJUA 2TRXA 4NMUA 5G5EA 4TXVA 2H8LA 3KMOA 4BWSA 1FB0A 4EO3A 1MDJA 1OKDA 2EIOA 3E9JB 3LXZA 1I5GA 2B7KA 3QR6A 3O6TA 6GSVA 1LJRA 5F0GA 3LEFA 4Z2RA 4MPGA 2YP6A 3FZAA 1WIKA 4TKYA 4XHMA 4L8EA 3GUSA 1SJIA 4MA9A 4EVMA 2VL3A 3TUEA 2HRNA 1KTEA 1O7UA 5HQPA 1B9XC 3A3TA 3BCIA 4JZQA 2BMXA 5IIZA 2C3QA 4TR3A 1SD8A 2YWOA 1OC9A 3IC4A 3KH7A 4TRXA 3UMAA 4A5PA 5J3RA 4AJ7A 1XW6A 4O5QA 1ERUA 5INYA 2WFCA 5JWRB 2LJKA 1XWKA 2OE3A 4MF6A 4EUYA 2GSQA 1THXA 4KSOA 5EY6A 3KP8A 3C1SA 1QK8A 4XS4A 4BA7A 1F9MA 2E2MA 4KCAA 5EPFA 1PN9A 1GP1A 4TR4A 1PD21 2KP1A 4V2LA 1MTCA 4K7NA 3IHQA 4H86A 4LA1A 1GSQA 3TB2A 1XCCA 4HZ4A 1Z6NA 3TKSC 4POBA 2LRNA 3HVSA 3HDCA 3DKSA 4L0WA 3DGQA 4GF0A 1SYRA 2DJ1A 4KAEA 4QL9A 1G0TA 2REMA 5ABRA 5CRDA 1Z7RA 4I97A 2GGTA 3FW2A 2VCXA 1YEXA 2I3YA 1DUGA 2PBJA 3GYKA 3PH9A 2C0GA 2YZUA 4ML6A 3GX0A 2VCWA 3MDKA 4WEYA 5B8AA 1MDIA 4KDYA 4IS0A 6GSYA 1K3LA 2YWMA 1C72A 4IQAA 3KM6A 1MDKA 3ZYWA 3TKRA 4TXOB 2LKUA 3MAKA 3ZTLA 4DEJA 4HU9A 5ID2B 3C8EA 2GS3A 4JR6A 5EL8A 5E59A 4PUFC 1SK1A 2RLIA 2PN8A 2H66A 2X49A 1EOGA 5DCHA 1WRYA 1SD9A 3LJRA 3L9VA 2C80A 4K2XA 3FYGA 4ZBAA 1DBYA 2QGVA 3EMXA 1JZDA 3HJMA 4G9HA 3TKPA 4EIPA 1OE7A 2Z9SA 2A4VA 2PVOC 3D0ZA 1YQ1A 4BVYA 4TR0A 1MD3A 4GCIA 4YH2A 3FMWA 1OC8A 5D93A 3C73A 3GKKA 1SK2A 4USSA 2C8UA 2H72A 1R5AA 4HQSA 5IQYA 4EC0A 1ERWA 1T4ZA 2EC4A 5ECMB 3IC8A 3VURA 3F63A 4IP1A 4ZIJA 3F4TA 3BD2A 1SKRB 4KUNA 3I43A 4IP6A 3BJ5A 5G1LA 1XWCA 2CVKA 3GHAA 3TOUA 5ECKB 1YKCA 4HI7A 2F51A 4PQHA 1GL8A 2M46A 2H19A 4K5SA 2H76A 3RDWA 1XXUA 2PWJA 4KDXA 1Q4JA 3A2XA 2M80A 2F8AA 3F6FA 2EIRA 3HVXA 3PINA 4ECIA 2OKAA 1RK4A 2X64A 4OO4A 3GTUA 5D9WA 5IM9A 1GSEA 4TR1A 1YY7A 3HY2A 2YANA 4GXZA 5KOXA 3DD3A 3N5OA 2HFDA 3FEUA 2IPAA 4QL7A 2IFQA 2GT6A 4ECBA 2P5QA 4DSRA 4YKFA 4G10A 2HZEA 3FR9A 2QA1A 4ZB8A 3F3QA 1QGVA 5C00A 4PUAA 1VRSD 4JRRA 1A0FA 5ECHB 3V1WA 2CX3A 2K8VA 2GVPA 2FA8A 3DWVA 4MZWA 4N0ZA 2LTKA 3EVIA 1ABAA 3CXGA 5FT3A 3HYPA 4EXJA 1TI1A 4L5OA 4HJ2A 1Z6MA 2GQLA 4MJCA 2KUCA 1A0RP 1AIUA 3IA1A 3FZ4A 1TRVA 1SL2B 4BPYA 2HYXA 1TI3A 3ZFLA 1S3DA 3NOFA 3TDGA 1XWGA 4MH2A 2JSZA 3LGCA 3GKMA 1F3BA 5D73A 3KCMA 2IMEA 3IDVA 4YQUA 3F4SA 3TJBA 4ZL7A 4O32A 4TVEA 1JLVA 1K0MA 2GQKA 2H0IA 2HZFA 4GSTA 2XBQA 2X8HA 2H1BA 4ISDA 1EP7A 2O89A 4TW5A 5EVOA 4DSSA 4K5RA 2RM5A 3APSA 1UVZA 3CSJA 1V9WA 2VM1A 3ZITA 5DDLA 5D9XA 4CY6A 1YKAA 1OKTA 4OCFA 5GSSA 3QFBC 5B7CA 1ST9A 3EC3A 2NBSA 4MH3A 1A2MA 1WJKA 4L5LA 1HNBA 4RI6A 2HRAA 4KX4A 4PNFA 1M99A 4JBBA 4PQIA 1XWAA 1PX7A 1O85A 1OC3A 4ZBDA 3GRXA 5ENUA 3MWHA 5DAKB 2ALBA 1S3CA 2B3SA 3ZZXA 2L57A 1XW9A 3CSHA 2R0CA 4RI7A 2V2GA 5A4UA 1Y6EA 3ME8A 4K6XA 2LQQA 2I1UA 1W4VA 1PQNA 1ERTA 3W8JA 5AIXA 4KSMA 5CP1A 5AGYA 2F8FA 4EF0A 2HRFA 4TOPA 2XPEA 3M9JA 4G0LA 2J9HA 5KEJA 2FA4A 2K8SA 1ZGNA 5G5FA 2C3TA 1U6TA 3LORA 3F9UA 2V6KA 1GNEA 3VPQA 1UA5A 2QKEA 1AW9A 3ME7A 2ON5A 3MSZA 4KW6A 5J9CA 3QFAC 2O8VB 1T8EB 1RW1A 3WGEA 1F6MC 1GTAA 1U3AA 2D2ZA 3VWVA 2H70A 2DSAA 5ECRB 2L6DA 3ERFA 5F8BA 5HR0A 2VM2A 1FO5A 2K6VA 2VO4A 3QCPA 1O8WA 1EZKA 1GSDA 2EIQA 5CREA 1EEMA 2P31A 3DMLA 4ZBBA 3GMFA 5HFIA 2B7JA 1R26A 1SU9A 1PL1A 4EE0A 5GSTA 2FLSA 3ZVJA 1T1VA 1GH2A 2JACA 1SJ6A 1EGRA 3L78A 4IKHA 1XFLA 1T4YA 2QSIA 3EYTA 1WOUA 3P2AA 4PXOA 3LSZA 5ECNB 3QDNA 4O92A 1AC1A 5D9VA 13GSA 4XIHA 1WPIA 5AISA 2VOCA 5IPGA 1HNCA 3ZLPA 3Q19A 4X43A 2O87A 2OE1A 1TU7A 4Z2TA 2V32A 3CTFA 3TRPA 3KTBA 1LU4A 2R4VA 5ECPB 4WR5A 4E8EA 1SJZA 3CBUA 3TOTA 2PUKC 2GSRA 4MZBA 1WMJA 2XC2A 4ILFA 4XS1A 4FQUA 4ID0A 3ZIJA 2X8GA 2P0GA 1CQGA 4WF5A 4LMWA 2OBKA 1TK0B 3UEMA 3QMXA 4KDUA 1O73A 4MMMA 1BG5A 1QUWA 1NHOA 2L4CA 3FR6A 1V58A 2YWNA 2FGXA 1FVKA 20GSA 2MBSA 2TRCP 2BJXA 2FD3A 1FVJA 2ZNMA 4K0NA 3Q74A 5ECQB 2XHFA 1BAYA 4J56E 4NHZA 2GQMA 2OJLA 1K0NA 3FKFA 3ERWA 1X5CA 5F07A 3DVWA 5DQYA 5H5RA 4MJBA 5A4VA 3TKQA 4BL7A 3QPMA 6GSUA 4G2EA 3UBKA 3FRCA 1PA3A 1ZCPA 3DIEA 5DALB 3SWLA 1J0FA 4HUAA 5HFKA 2DC5A 11GSA 1PX6A 1OE8A 4OMVA 2GTUA 2CX4A 2HXKA 2VD0A 2C0FA 6GSWA 3VPTA 3GL5A 2A4HA 5JCUA 2X8CA 3M8NA 3HZ4A 2GZYA 3GA4A 1G7OA 2L5LA 4IW9A 4KGIA 2GSSA 4GRFA 4OFMA 3A2VA 2YWIA 5HR1A 3G9BA 5KN1A 2WS2A 2CVBA 2JU5A 4K8MA 3APOA 4EDYA 3KJYA 4POKA 4G0KA 3UJ1A 4EL1A 5IMCA 1TJDA 4KNDA 3CSIA 5CRHA 3GNJA 2RM6A 3A2WA 2JSYA 4WETA 2WDUA 4I2UA 6GSSA 1EV9A 3TJFA 3D22A 3CTGA 4KA0A 3QAVA 4HZ2A 1JZWA 2H0GA 1TK8B 1JZOA 4AGSA 2M72A 3GSTA 1BX9A 1SL1B 1GLQA 2VUPA 2C0DA 1FHEA 4K1FA 3JCML 5G1KA 1PSQA 4K2DA 5C04A 3QAGA 3GH6A 1XOAA 5GZZB 5J4UA 4I2TA 4FO5A 2JZTA 2OA7A 4K9ZA 3GFKA 1HNAA 4YQMA 4IGJA 1T3BA 2F3MA 1VF1A 3D5JA 2FUG2 2DJ2A 2HSMA 1H4OA 3LW9A 2FHEA 2HT9A 1XZOA 3VWUA 2NPBA 4IJIA 1PGTA 2LUSA 3KD0A 1XW5A 2H6XA 2LV3A 2MMZA 4AJ8A 2YPMA 2E2GA 3GKNA 5IMZA 2OACA 2QA2A 1GTIA 3VK9A 3HVVA 3GL3A 5A5KA 2QC7A 5LD0A 1PRXA 5CRWA 2LNTA 5JWQB 1XBSA 3DRNA 4HS1A 1W89A 2G0FA 4D73B 3HA9A 2R5GA 4O7HA 4YKGA 3F0IA 2CA8A 3US3A 3UVHA 2V6OA 1FOVA 4BVXA 1MEKA 3LYPA 3EU4A 3CMIA 3Q6OA 2VCVA 3IBHA 1B48A 3MIXA 3KTLA 3FHKA 1ZZYA 1U88A 2CZ3A 1EOHA 3P90A 3U5RE 1TU8A 4LLRA 3KGKA 2A2SA 1B4PA 5IMAA 3PR8A 4LL1B 4V2NA 2GLRA 4HQZA 2CT6A 3TKSA 4OO5A 3R3EA 1BJXA 2C4JA 2I9HA 3H93A 3UAPA 4P3YB 1EWXA 1FOHA 2H6ZA 3WYWA 3KH9A 1TRUA 1H75A 1YJ6A 1ZOFA 4NXIA 1YZXA 2KP2A 4OFTA 1OC9B 3CRUA 4RQXA 3ZREA 1K0BA 3BBYA 1TXXA 1F37A 5J9BA 4I5QA 2VLTA 1FAAA 5AN1A 1GSFA 5IPHA 4HEA2 4N10A 4RUVA 3ZVJD 3QD9A 5L71A 4J2FA 1Q98A 2VL2C 5HFGA 1DSBA 5E4WA 2PGTA 2P5RA 4IHUA 3TKSE 1WWJA 4XS4B 4FYBA 2H6YA 3GV1A 2LS5A 5LCZA 5CO3A 2VCTA 2I81A 1KNGA 3DEXA 3WD6A 4OD7A 3PGTA 4AF2A 2R2JA 1T7PB 3VWWA 2VL9A 3N9JA 2VAFA 4GTUA 1YF0A 1E6BA 4OCEA 3RPNA 4F03A 5AIVA 2PU9C 4Z7XA 3GIXA 1G6WA 3LWAA 3P8WA 4F9ZA 2H73A 5KOWA 3RPPA 1ZL9A 1PKWA 4ML1A 1TK5B 1U87A 4FH8A 3RBTA 1M2DA 3C71A 1HD2A 3CRTA 3RAZA 5J41A 1GULA 1IYHA 2OBIA 3D21A 2HNLA 4K0GA 5KN2A 3M3MA 1LBKA 5CRGA 4MLYA 3IK9A 1ZYPA 3O3TA 2O85A 5IOXA 1M9BA 1EP8A 3Q18A 2NVLA 4IBPA 4WR4A 4F82A 4NWYA 5CNWA 1GTBA 3L0HA 5ELAA 3BOAA 2VD1A 7GSSA 3IR4A 4CY8A 18GSA 2YJ7A 2AJQB 4KH7A 3DVXA 4BWQA 2WRTA 4ZB9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NIV A;  4MJE A;  1X9S B;  2LRC A;  1M9A A;  3FK8 A;  4I8B A;  3EU3 A;  1B8X A;  5FHI A;  4TXO A;  2RUE A;  4NV2 A;  1R5P A;  5LNK e;  4K7O A;  5ID2 A;  3E3E A;  4MDC A;  2H1D A;  1ZMA A;  4I6X A;  3UBL A;  9GSS A;  1X5E A;  3QOU A;  3UL3 A;  3F6D A;  4HJM A;  4MK3 A;  1JLW A;  1K3Y A;  3TRQ A;  4ZL8 A;  3FZ5 A;  3IE3 A;  4PGT A;  4NAX A;  1AQW A;  5JWO B;  1GLP A;  2E7P A;  3HJP A;  2YCD A;  2YNX A;  3IAM 2;  2ON7 A;  2LNS A;  1XWB A;  4XCS A;  1JHB A;  3HHV A;  1XPV A;  2VLV A;  1A2L A;  3H4K A;  1XIY A;  5D96 A;  1ERV A;  1GNW A;  3GKX A;  4YQV A;  4FIW A;  8GSS A;  2DMM A;  4EDZ A;  1VF4 A;  2IL3 A;  5IMD A;  2YOI A;  3TJJ A;  2B1K A;  1K0C A;  2GDR A;  5DQS A;  4N0V A;  1ILO A;  3LG6 A;  2JL4 A;  4PUR A;  3D4T A;  2XBI A;  4TN8 A;  3ISO A;  4MAB A;  2IMF A;  5DJM A;  1V40 A;  3HKR A;  3GTU B;  2WUL A;  4TR1 B;  3KXO A;  3EIN A;  2C0E A;  3GSS A;  2C1Y A;  2LST A;  4MF5 A;  1PMT A;  3HZ8 A;  3EMP A;  2YN1 A;  3U6V A;  1V2A A;  3W6G A;  3A5W A;  2H1A A;  2IFQ B;  2XPD A;  5DVB A;  1XOB A;  2DML A;  4XS6 A;  6GST A;  1KEB A;  2HZE B;  1M2A A;  2IN3 A;  4AJ6 A;  3M9K A;  3H1N A;  4KCE A;  2R37 A;  22GS A;  1IYI A;  2VLU A;  2V41 A;  1YDK A;  1TOF A;  1TTZ A;  2LJR A;  5B6N A;  4F2I A;  4ZIL A;  2L4Q A;  3G7I A;  5B6M A;  1A23 A;  1NSW A;  12GS A;  4QQ7 A;  1XVQ A;  3D4M A;  2B5Y A;  2DJK A;  3ZMK A;  3DYR A;  4YAP A;  2PMT A;  2H75 A;  3L9S A;  2X99 A;  1OYJ A;  2DIY A;  4XTS A;  2LJA A;  4CW9 A;  3WT1 A;  2DJ3 A;  3QAW A;  2ES7 A;  5GAP D;  4F0B A;  5CAX A;  2FNO A;  5DCG A;  1K3O A;  2NDO A;  5IO0 A;  1FG4 A;  4MJA A;  2KOK A;  2AHE A;  3P7X A;  1VF3 A;  1J9B A;  3HXS A;  3IAS 2;  2YV9 A;  1HQO A;  1OAZ A;  3ZFB A;  2HLS A;  1R7H A;  2VIM A;  2VCQ A;  3D6I A;  1SYX A;  4DSS B;  4MF7 A;  1GWC A;  5IO2 A;  1VGL A;  1EGO A;  5G30 A;  1ML6 A;  1SL0 B;  1ZYQ B;  2RII A;  2FCH A;  1DE2 A;  3SBC A;  4NPB A;  1RQM A;  1Z3E A;  1EEJ A;  2GST A;  4N11 A;  3IK7 A;  1OVN A;  2H01 A;  1UC7 A;  3F4R A;  1SKS B;  1M7T A;  3KMN A;  2JAD A;  2H30 A;  2FY6 A;  1M2B A;  3I9V 2;  2K18 A;  4CDO A;  4K7I A;  4GWR A;  3F3R A;  5FWG A;  5IMV A;  5KN0 A;  5DBQ A;  17GS A;  4ACS A;  5G31 A;  4ECC A;  5G2Z A;  2DLX A;  3UVT A;  1PKZ A;  4ULX A;  4JE1 A;  1EV4 A;  1GSS A;  2DJ0 A;  3IOS A;  1S3A A;  3BCK A;  5ECL B;  3IRA A;  4LMV A;  2IMI A;  1CQH A;  2H71 A;  3VLN A;  3LQ7 A;  4JR4 A;  5DAK A;  3ZML A;  4ZL9 A;  4WKW A;  4Q5F A;  1TW9 A;  2GZZ A;  1USB A;  1A2J A;  1K0A A;  1F3A A;  2CV4 A;  4E8H A;  1GUK A;  1GSY A;  19GS A;  2HI7 A;  2AAW A;  1THO A;  1TRS A;  3HD5 A;  4HOJ A;  1U3I A;  3GUR A;  1XVW A;  2MMN A;  5D8I A;  2AYT A;  3ZL5 A;  1M0U A;  3ZRD A;  4V2M A;  2AV4 A;  3E0U A;  1E2Y A;  2N5F A;  3MNG A;  1T00 A;  3VI7 A;  3HCZ A;  4X1U A;  2A2R A;  1TKD B;  2JZS A;  4XRD A;  3WGD A;  4PNG A;  2IMD A;  4LL4 B;  3TRX A;  2B5X A;  2MMA A;  2JZR A;  3KZQ A;  1GUM A;  2HSH A;  2NTO A;  4GLT A;  2L59 A;  1SEN A;  3O76 A;  3W8S A;  2CAQ A;  1HYU A;  2ZCT A;  2OAD A;  3EWL A;  2CAI A;  4IJ3 A;  1F2E A;  3KIJ A;  5ELG A;  5KN3 A;  1X0R A;  2WZ9 A;  1GUH A;  1B9Y C;  1FB6 A;  3I69 A;  2I4A A;  4XRA A;  5IOW A;  1QQ2 A;  3DXB A;  4V1A p;  3ZIV A;  1G6Y A;  2V1M A;  2TIR A;  2N5A A;  1BQ7 A;  1A24 A;  2LRT A;  2F9S A;  2K9F A;  3H8Q A;  1K0O A;  1N8J A;  1WP0 A;  1V57 A;  1AUC A;  4F0C A;  3WT2 A;  3C7M A;  4Q5N A;  3VI5 A;  3EE2 A;  2IMK A;  3LXT A;  5JCG A;  4PQ1 A;  1AAZ A;  2MYG A;  5CYY A;  4YAV A;  4WF4 A;  1VF2 A;  2FWE A;  5F06 A;  2H0H A;  2ZUP A;  3LYK A;  1O8X A;  4Q5R A;  4PX1 A;  2J23 A;  3M0F A;  2AUV A;  3F8U A;  4CHS A;  4Q5Q A;  2OE0 A;  1TP9 A;  3KP9 A;  2DIZ A;  5GAN D;  3FZ9 A;  5D9T A;  5H5Q A;  3KEB A;  1GTU A;  3FY7 A;  1ACV A;  4WXT A;  2MBT A;  1N2A A;  5HR3 A;  3UOM A;  1J08 A;  2GT5 A;  1QFN A;  5B8B A;  5F05 A;  2B6M A;  1FW1 A;  14GS A;  4HDE A;  4WBJ A;  3IXR A;  2WGR A;  2IIY A;  2N5B A;  4MCU A;  1URM A;  1QMV A;  1AQX A;  1AQV A;  2PVQ A;  1NHY A;  5H5S A;  3RHB A;  1B4Q A;  3K8N A;  1Z5Y E;  5HR2 A;  4MPF A;  2LEG A;  3APQ A;  1WE0 A;  1A8L A;  4KB3 A;  5DAL A;  4L0U A;  1BYE A;  2R3X A;  4ZXG A;  3NZN A;  3LFL A;  2FWH A;  3WGX A;  4POL A;  4J57 E;  4JU5 A;  2FWF A;  1A8Y A;  2R6K A;  2HE3 A;  1G7E A;  4X0X A;  4WBR D;  2CVD A;  3J7Y k;  5ECI B;  4GSS A;  1O81 A;  4O5R A;  3I6A A;  1X9W B;  2G2Q A;  5JCW A;  1Y25 A;  2B1L A;  5IMF A;  10GS A;  3UIW A;  2IWT A;  2BTO T;  4OFN A;  2KLX A;  3IV4 A;  4IEL A;  4N30 A;  2CQ9 A;  2PPT A;  1GSU A;  4G19 A;  1R4W A;  1Z9H A;  3VWX A;  4GQF A;  3TJK A;  2AB6 A;  3GN3 A;  2O7K A;  5ECS A;  2MZC A;  4IQ1 A;  3C1R A;  3TGZ A;  4V1A g;  1SK0 A;  3TCO A;  1YEP A;  3GH9 A;  3ED3 A;  4POM A;  3R2Q A;  1JZR A;  4IN0 A;  2H74 A;  3M1G A;  1X5D A;  2FWG A;  1X9M B;  1SKW B;  2YZH A;  3H79 A;  1DE1 A;  3CYN A;  3L4N A;  6GSX A;  2VCZ A;  1UN2 A;  4MP4 A;  5J5N A;  4NV5 A;  1KBN A;  4JED A;  5DJL A;  1JFU A;  3OR5 A;  3J7Y b;  2WB9 A;  3FR3 A;  5COH A;  3GX8 A;  4OWY A;  5A4W A;  3ERG A;  3RHC A;  4HU7 A;  4NHW A;  1NW2 A;  1ON4 A;  2MMO A;  2B5E A;  2IJY A;  4DSQ A;  2RUF A;  1TDI A;  2L6C A;  1NM3 A;  3G7Y A;  1PL2 A;  3HJO A;  4KE3 A;  4ZB6 A;  3UAR A;  1GRX A;  1QXH A;  4EKZ A;  1I9D A;  2WCI A;  1MD4 A;  2E0Q A;  3TJG A;  3IPZ A;  2H1G A;  2PER A;  2C3N A;  4MZC A;  2DJJ A;  3L9U A;  2YV7 A;  2VL2 A;  4FYU A;  1V98 A;  3VFI A;  1Z7P A;  5ECO B;  2L5O A;  4ECJ A;  4IVF A;  3G7J A;  4DVC A;  4GQC A;  4GSN A;  1K0D A;  2HSY A;  1TRW A;  4RQR A;  3S9F A;  2GZP A;  1ZYE A;  2KHP A;  4D73 A;  16GS A;  2LQO A;  1O6J A;  2DBC A;  1BED A;  3EUR A;  2CZ2 A;  3AY8 A;  4FYC A;  2YJH A;  1YF1 A;  1AXD A;  2WJU A;  2TRX A;  4NMU A;  5G5E A;  4TXV A;  2H8L A;  3KMO A;  4BWS A;  1FB0 A;  4EO3 A;  1MDJ A;  1OKD A;  2EIO A;  3E9J B;  3LXZ A;  1I5G A;  2B7K A;  3QR6 A;  3O6T A;  6GSV A;  1LJR A;  5F0G A;  3LEF A;  4MPG A;  2YP6 A;  3FZA A;  1WIK A;  4TKY A;  4XHM A;  4L8E A;  3GUS A;  1SJI A;  4MA9 A;  4EVM A;  2VL3 A;  3TUE A;  2HRN A;  1KTE A;  1O7U A;  5HQP A;  1B9X C;  3A3T A;  3BCI A;  4JZQ A;  2BMX A;  5IIZ A;  2C3Q A;  4TR3 A;  1SD8 A;  2YWO A;  1OC9 A;  3IC4 A;  3KH7 A;  4TRX A;  3UMA A;  5J3R A;  4AJ7 A;  1XW6 A;  1ERU A;  5INY A;  2WFC A;  5JWR B;  2LJK A;  1XWK A;  2OE3 A;  4MF6 A;  4EUY A;  2GSQ A;  1THX A;  4KSO A;  5EY6 A;  3KP8 A;  3C1S A;  1QK8 A;  4XS4 A;  4BA7 A;  1F9M A;  2E2M A;  4KCA A;  5EPF A;  1PN9 A;  1GP1 A;  4TR4 A;  1PD2 1;  2KP1 A;  4V2L A;  1MTC A;  4K7N A;  3IHQ A;  4H86 A;  4LA1 A;  1GSQ A;  3TB2 A;  1XCC A;  4HZ4 A;  1Z6N A;  3TKS C;  4POB A;  2LRN A;  3HVS A;  3HDC A;  3DKS A;  4L0W A;  3DGQ A;  4GF0 A;  1SYR A;  2DJ1 A;  4KAE A;  4QL9 A;  1G0T A;  2REM A;  5ABR A;  5CRD A;  1Z7R A;  4I97 A;  2GGT A;  3FW2 A;  2VCX A;  1YEX A;  2I3Y A;  1DUG A;  2PBJ A;  3GYK A;  3PH9 A;  2C0G A;  2YZU A;  4ML6 A;  3GX0 A;  2VCW A;  3MDK A;  4WEY A;  5B8A A;  1MDI A;  4KDY A;  4IS0 A;  6GSY A;  1K3L A;  2YWM A;  1C72 A;  4IQA A;  3KM6 A;  1MDK A;  3ZYW A;  3TKR A;  4TXO B;  2LKU A;  3MAK A;  3ZTL A;  4DEJ A;  4HU9 A;  5ID2 B;  3C8E A;  2GS3 A;  4JR6 A;  5EL8 A;  5E59 A;  4PUF C;  1SK1 A;  2RLI A;  2PN8 A;  2H66 A;  1EOG A;  5DCH A;  1WRY A;  1SD9 A;  3LJR A;  3L9V A;  2C80 A;  3FYG A;  4ZBA A;  1DBY A;  2QGV A;  3EMX A;  1JZD A;  3HJM A;  4G9H A;  3TKP A;  1OE7 A;  2Z9S A;  2A4V A;  2PVO C;  3D0Z A;  1YQ1 A;  4BVY A;  4TR0 A;  1MD3 A;  4GCI A;  4YH2 A;  1OC8 A;  5D93 A;  3C73 A;  3GKK A;  1SK2 A;  2C8U A;  2H72 A;  1R5A A;  4HQS A;  5IQY A;  4EC0 A;  1ERW A;  1T4Z A;  2EC4 A;  5ECM B;  3VUR A;  3F63 A;  4IP1 A;  4ZIJ A;  3F4T A;  3BD2 A;  1SKR B;  4KUN A;  3I43 A;  4IP6 A;  3BJ5 A;  5G1L A;  1XWC A;  2CVK A;  3GHA A;  3TOU A;  5ECK B;  1YKC A;  4HI7 A;  2F51 A;  4PQH A;  1GL8 A;  2M46 A;  2H19 A;  2H76 A;  3RDW A;  1XXU A;  2PWJ A;  4KDX A;  1Q4J A;  3A2X A;  2M80 A;  2F8A A;  3F6F A;  2EIR A;  3HVX A;  3PIN A;  4ECI A;  2OKA A;  1RK4 A;  2X64 A;  4OO4 A;  3GTU A;  5D9W A;  5IM9 A;  1GSE A;  4TR1 A;  1YY7 A;  3HY2 A;  2YAN A;  4GXZ A;  3DD3 A;  3N5O A;  2HFD A;  3FEU A;  2IPA A;  4QL7 A;  2IFQ A;  2GT6 A;  4ECB A;  2P5Q A;  4DSR A;  4G10 A;  2HZE A;  3FR9 A;  4ZB8 A;  3F3Q A;  1QGV A;  5C00 A;  4PUA A;  1VRS D;  4JRR A;  1A0F A;  5ECH B;  3V1W A;  2CX3 A;  2K8V A;  2GVP A;  2FA8 A;  3DWV A;  4MZW A;  4N0Z A;  2LTK A;  3EVI A;  1ABA A;  3CXG A;  5FT3 A;  3HYP A;  4EXJ A;  1TI1 A;  4L5O A;  4HJ2 A;  1Z6M A;  2GQL A;  4MJC A;  2KUC A;  1A0R P;  1AIU A;  3IA1 A;  3FZ4 A;  1TRV A;  1SL2 B;  4BPY A;  2HYX A;  1TI3 A;  3ZFL A;  1S3D A;  3NOF A;  3TDG A;  1XWG A;  4MH2 A;  2JSZ A;  3LGC A;  3GKM A;  1F3B A;  5D73 A;  3KCM A;  2IME A;  3IDV A;  4YQU A;  3F4S A;  3TJB A;  4ZL7 A;  4O32 A;  4TVE A;  1JLV A;  1K0M A;  2GQK A;  2H0I A;  2HZF A;  4GST A;  2XBQ A;  2X8H A;  2H1B A;  4ISD A;  1EP7 A;  2O89 A;  4TW5 A;  5EVO A;  4DSS A;  2RM5 A;  3APS A;  1UVZ A;  3CSJ A;  1V9W A;  2VM1 A;  3ZIT A;  5DDL A;  5D9X A;  1YKA A;  1OKT A;  4OCF A;  5GSS A;  3QFB C;  5B7C A;  1ST9 A;  3EC3 A;  2NBS A;  4MH3 A;  1A2M A;  1WJK A;  4L5L A;  1HNB A;  4RI6 A;  4KX4 A;  4PNF A;  1M99 A;  4JBB A;  4PQI A;  1XWA A;  1PX7 A;  1O85 A;  1OC3 A;  4ZBD A;  3GRX A;  5ENU A;  3MWH A;  5DAK B;  2ALB A;  1S3C A;  2B3S A;  3ZZX A;  2L57 A;  1XW9 A;  3CSH A;  4RI7 A;  2V2G A;  5A4U A;  1Y6E A;  3ME8 A;  4K6X A;  2LQQ A;  2I1U A;  1W4V A;  1PQN A;  1ERT A;  3W8J A;  5AIX A;  4KSM A;  5CP1 A;  5AGY A;  2F8F A;  4EF0 A;  2HRF A;  4TOP A;  2XPE A;  3M9J A;  2J9H A;  5KEJ A;  2FA4 A;  2K8S A;  1ZGN A;  5G5F A;  2C3T A;  1U6T A;  3LOR A;  3F9U A;  2V6K A;  1GNE A;  3VPQ A;  1UA5 A;  2QKE A;  1AW9 A;  3ME7 A;  2ON5 A;  3MSZ A;  4KW6 A;  5J9C A;  3QFA C;  2O8V B;  1T8E B;  1RW1 A;  3WGE A;  1F6M C;  1GTA A;  1U3A A;  2D2Z A;  3VWV A;  2H70 A;  2DSA A;  5ECR B;  2L6D A;  3ERF A;  5F8B A;  5HR0 A;  2VM2 A;  1FO5 A;  2K6V A;  2VO4 A;  3QCP A;  1O8W A;  1EZK A;  1GSD A;  2EIQ A;  5CRE A;  1EEM A;  2P31 A;  3DML A;  4ZBB A;  3GMF A;  5HFI A;  2B7J A;  1R26 A;  1SU9 A;  1PL1 A;  4EE0 A;  5GST A;  2FLS A;  3ZVJ A;  1T1V A;  1GH2 A;  2JAC A;  1SJ6 A;  1EGR A;  3L78 A;  4IKH A;  1XFL A;  1T4Y A;  2QSI A;  3EYT A;  1WOU A;  3P2A A;  4PXO A;  3LSZ A;  5ECN B;  3QDN A;  4O92 A;  1AC1 A;  5D9V A;  13GS A;  4XIH A;  1WPI A;  5AIS A;  2VOC A;  5IPG A;  1HNC A;  3ZLP A;  3Q19 A;  4X43 A;  2O87 A;  2OE1 A;  1TU7 A;  2V32 A;  3CTF A;  3TRP A;  3KTB A;  1LU4 A;  2R4V A;  5ECP B;  4WR5 A;  4E8E A;  1SJZ A;  3CBU A;  3TOT A;  2PUK C;  2GSR A;  4MZB A;  1WMJ A;  2XC2 A;  4ILF A;  4XS1 A;  4ID0 A;  3ZIJ A;  2X8G A;  2P0G A;  1CQG A;  4WF5 A;  4LMW A;  2OBK A;  1TK0 B;  3UEM A;  3QMX A;  4KDU A;  1O73 A;  4MMM A;  1BG5 A;  1QUW A;  1NHO A;  2L4C A;  3FR6 A;  1V58 A;  2YWN A;  2FGX A;  1FVK A;  20GS A;  2MBS A;  2TRC P;  2BJX A;  2FD3 A;  1FVJ A;  2ZNM A;  4K0N A;  3Q74 A;  5ECQ B;  2XHF A;  1BAY A;  4J56 E;  4NHZ A;  2GQM A;  2OJL A;  1K0N A;  3FKF A;  3ERW A;  1X5C A;  5F07 A;  3DVW A;  5DQY A;  5H5R A;  4MJB A;  5A4V A;  3TKQ A;  4BL7 A;  3QPM A;  6GSU A;  4G2E A;  3UBK A;  3FRC A;  1PA3 A;  1ZCP A;  3DIE A;  5DAL B;  3SWL A;  1J0F A;  4HUA A;  5HFK A;  2DC5 A;  11GS A;  1PX6 A;  1OE8 A;  4OMV A;  2GTU A;  2CX4 A;  2HXK A;  2VD0 A;  2C0F A;  6GSW A;  3VPT A;  3GL5 A;  5JCU A;  2X8C A;  3M8N A;  3HZ4 A;  2GZY A;  3GA4 A;  1G7O A;  2L5L A;  4IW9 A;  4KGI A;  2GSS A;  4GRF A;  4OFM A;  3A2V A;  2YWI A;  5HR1 A;  3G9B A;  5KN1 A;  2WS2 A;  2CVB A;  2JU5 A;  4K8M A;  3APO A;  4EDY A;  3KJY A;  4POK A;  3UJ1 A;  4EL1 A;  5IMC A;  1TJD A;  4KND A;  3CSI A;  5CRH A;  3GNJ A;  2RM6 A;  3A2W A;  2JSY A;  4WET A;  2WDU A;  4I2U A;  6GSS A;  1EV9 A;  3TJF A;  3D22 A;  3CTG A;  4KA0 A;  3QAV A;  4HZ2 A;  1JZW A;  2H0G A;  1TK8 B;  1JZO A;  4AGS A;  2M72 A;  3GST A;  1BX9 A;  1SL1 B;  1GLQ A;  2VUP A;  2C0D A;  1FHE A;  4K1F A;  3JCM L;  5G1K A;  1PSQ A;  4K2D A;  5C04 A;  3QAG A;  3GH6 A;  1XOA A;  5GZZ B;  5J4U A;  4I2T A;  4FO5 A;  2JZT A;  2OA7 A;  4K9Z A;  3GFK A;  1HNA A;  4YQM A;  4IGJ A;  1T3B A;  2F3M A;  1VF1 A;  3D5J A;  2FUG 2;  2DJ2 A;  1H4O A;  2FHE A;  2HT9 A;  1XZO A;  3VWU A;  2NPB A;  4IJI A;  1PGT A;  2LUS A;  3KD0 A;  1XW5 A;  2H6X A;  2LV3 A;  2MMZ A;  4AJ8 A;  2YPM A;  2E2G A;  3GKN A;  5IMZ A;  2OAC A;  1GTI A;  3VK9 A;  3HVV A;  3GL3 A;  5A5K A;  2QC7 A;  5LD0 A;  1PRX A;  5CRW A;  2LNT A;  5JWQ B;  1XBS A;  3DRN A;  4HS1 A;  1W89 A;  2G0F A;  4D73 B;  3HA9 A;  2R5G A;  4O7H A;  3F0I A;  2CA8 A;  3US3 A;  3UVH A;  2V6O A;  1FOV A;  4BVX A;  1MEK A;  3LYP A;  3EU4 A;  3CMI A;  3Q6O A;  2VCV A;  3IBH A;  1B48 A;  3KTL A;  3FHK A;  1ZZY A;  1U88 A;  2CZ3 A;  1EOH A;  3P90 A;  3U5R E;  1TU8 A;  4LLR A;  3KGK A;  2A2S A;  1B4P A;  5IMA A;  3PR8 A;  4LL1 B;  4V2N A;  2GLR A;  4HQZ A;  2CT6 A;  3TKS A;  4OO5 A;  1BJX A;  2C4J A;  2I9H A;  3H93 A;  3UAP A;  4P3Y B;  1EWX A;  2H6Z A;  3WYW A;  3KH9 A;  1TRU A;  1H75 A;  1YJ6 A;  1ZOF A;  4NXI A;  1YZX A;  2KP2 A;  4OFT A;  1OC9 B;  3CRU A;  4RQX A;  3ZRE A;  1K0B A;  3BBY A;  1TXX A;  1F37 A;  5J9B A;  4I5Q A;  2VLT A;  1FAA A;  5AN1 A;  1GSF A;  5IPH A;  4HEA 2;  4N10 A;  4RUV A;  3ZVJ D;  3QD9 A;  5L71 A;  4J2F A;  1Q98 A;  2VL2 C;  5HFG A;  1DSB A;  5E4W A;  2PGT A;  2P5R A;  4IHU A;  3TKS E;  1WWJ A;  4XS4 B;  4FYB A;  2H6Y A;  3GV1 A;  2LS5 A;  5LCZ A;  5CO3 A;  2VCT A;  2I81 A;  1KNG A;  3DEX A;  3WD6 A;  4OD7 A;  3PGT A;  4AF2 A;  2R2J A;  1T7P B;  3VWW A;  2VL9 A;  3N9J A;  2VAF A;  4GTU A;  1YF0 A;  1E6B A;  4OCE A;  3RPN A;  4F03 A;  5AIV A;  2PU9 C;  4Z7X A;  3GIX A;  1G6W A;  3LWA A;  3P8W A;  4F9Z A;  2H73 A;  3RPP A;  1ZL9 A;  1PKW A;  4ML1 A;  1TK5 B;  1U87 A;  4FH8 A;  3RBT A;  1M2D A;  3C71 A;  1HD2 A;  3CRT A;  3RAZ A;  5J41 A;  1GUL A;  1IYH A;  2OBI A;  3D21 A;  2HNL A;  4K0G A;  5KN2 A;  3M3M A;  1LBK A;  5CRG A;  4MLY A;  3IK9 A;  3O3T A;  2O85 A;  5IOX A;  1M9B A;  1EP8 A;  3Q18 A;  2NVL A;  4IBP A;  4WR4 A;  4F82 A;  4NWY A;  5CNW A;  1GTB A;  3L0H A;  5ELA A;  3BOA A;  2VD1 A;  7GSS A;  3IR4 A;  18GS A;  2YJ7 A;  2AJQ B;  4KH7 A;  3DVX A;  4BWQ A;  2WRT A;  4ZB9 A; 
#chains in the Genus database with same CATH topology
 3NIV A;  4MJE A;  1X9S B;  2LRC A;  1M9A A;  3FK8 A;  4I8B A;  4MNN A;  3EU3 A;  1B8X A;  5FHI A;  4TXO A;  2RUE A;  4O5U A;  3EPT A;  4NV2 A;  1R5P A;  5LNK e;  4K7O A;  5ID2 A;  3E3E A;  4MDC A;  2H1D A;  1ZMA A;  4I6X A;  3UBL A;  9GSS A;  1X5E A;  3QOU A;  3UL3 A;  3F6D A;  4HJM A;  4MK3 A;  4BVY B;  1JLW A;  1K3Y A;  3TRQ A;  2X4A A;  4ZL8 A;  3FZ5 A;  3IE3 A;  4PGT A;  4NAX A;  1AQW A;  5JWO B;  1GLP A;  2E7P A;  3HJP A;  2YCD A;  2YNX A;  3IAM 2;  2ON7 A;  2LNS A;  1XWB A;  4XCS A;  1JHB A;  3HHV A;  1XPV A;  2VLV A;  1A2L A;  3H4K A;  1XIY A;  5D96 A;  1ERV A;  1GNW A;  4Z2U A;  3GKX A;  4YQV A;  4FIW A;  8GSS A;  2DMM A;  4EDZ A;  1VF4 A;  2IL3 A;  5IMD A;  2DKH A;  2YOI A;  3TJJ A;  2B1K A;  1K0C A;  2GDR A;  5DQS A;  4N0V A;  1ILO A;  3LG6 A;  3A5I A;  2JL4 A;  4PUR A;  3D4T A;  2XBI A;  4TN8 A;  3ISO A;  4MAB A;  2IMF A;  5DJM A;  1V40 A;  3HKR A;  3GTU B;  2WUL A;  4TR1 B;  3KXO A;  3EIN A;  2C0E A;  3GSS A;  2C1Y A;  2LST A;  4MF5 A;  1PMT A;  3HZ8 A;  3EMP A;  2YN1 A;  3U6V A;  1V2A A;  3W6G A;  3A5W A;  2H1A A;  2IFQ B;  2XPD A;  5DVB A;  1XOB A;  2DML A;  4XS6 A;  6GST A;  1KEB A;  2HZE B;  1M2A A;  2IN3 A;  4AJ6 A;  3M9K A;  3H1N A;  4KCE A;  2R37 A;  22GS A;  1IYI A;  2VLU A;  2V41 A;  1YDK A;  1TOF A;  1TTZ A;  2LJR A;  5B6N A;  4F2I A;  4ZIL A;  2L4Q A;  4PTS A;  3G7I A;  5B6M A;  1A23 A;  1NSW A;  12GS A;  4QQ7 A;  1XVQ A;  3D4M A;  2B5Y A;  2DJK A;  3ZMK A;  3DYR A;  4YAP A;  2PMT A;  2H75 A;  3L9S A;  2X99 A;  1OYJ A;  2DIY A;  4XTS A;  2LJA A;  4CW9 A;  3WT1 A;  2DJ3 A;  2DKI A;  3PPU A;  2ES7 A;  3QAW A;  5GAP D;  4G0I A;  4F0B A;  5CAX A;  2FNO A;  5DCG A;  1K3O A;  2NDO A;  5IO0 A;  1FG4 A;  4HSC X;  4MJA A;  2KOK A;  2AHE A;  3P7X A;  1VF3 A;  1J9B A;  3HXS A;  3IAS 2;  2YV9 A;  1HQO A;  1OAZ A;  3ZFB A;  2HLS A;  1R7H A;  1PN0 A;  2R0G A;  1S3R A;  2VIM A;  2VCQ A;  3D6I A;  1SYX A;  4DSS B;  4MF7 A;  1XG8 A;  1GWC A;  5IO2 A;  1VGL A;  1EGO A;  5G30 A;  1ML6 A;  1SL0 B;  1ZYQ B;  2RII A;  2FCH A;  1DE2 A;  3SBC A;  4NPB A;  1RQM A;  1Z3E A;  1EEJ A;  2GST A;  4N11 A;  3IK7 A;  1OVN A;  2H01 A;  1UC7 A;  3F4R A;  1SKS B;  1M7T A;  3KMN A;  2JAD A;  2H30 A;  2FY6 A;  1M2B A;  3I9V 2;  2K18 A;  4CDO A;  4K7I A;  4GWR A;  3F3R A;  5FWG A;  5IMV A;  5KN0 A;  5DBQ A;  17GS A;  4ACS A;  5G31 A;  4ECC A;  5G2Z A;  2DLX A;  3UVT A;  1PKZ A;  4ULX A;  4JE1 A;  1EV4 A;  1GSS A;  2DJ0 A;  3IOS A;  1S3A A;  3BCK A;  5ECL B;  3IRA A;  4LMV A;  2IMI A;  1CQH A;  2H71 A;  3VLN A;  3LQ7 A;  4JR4 A;  5DAK A;  3ZML A;  4ZL9 A;  4WKW A;  4Q5F A;  1TW9 A;  2GZZ A;  1USB A;  1A2J A;  1K0A A;  1F3A A;  2CV4 A;  4E8H A;  1GUK A;  1GSY A;  19GS A;  2HI7 A;  2AAW A;  1THO A;  1TRS A;  3HD5 A;  4HOJ A;  1U3I A;  2A2P A;  3GUR A;  1XVW A;  2MMN A;  5D8I A;  2AYT A;  3ZL5 A;  1M0U A;  3ZRD A;  4V2M A;  2AV4 A;  3E0U A;  1E2Y A;  2N5F A;  3MNG A;  1T00 A;  3VI7 A;  3HCZ A;  4X1U A;  2A2R A;  1TKD B;  2JZS A;  4XRD A;  3WGD A;  4PNG A;  2IMD A;  4LL4 B;  3TRX A;  4ICY A;  2B5X A;  2MMA A;  2JZR A;  3KZQ A;  1GUM A;  2HSH A;  2NTO A;  4GLT A;  2L59 A;  1SEN A;  3O76 A;  3W8S A;  2CAQ A;  1HYU A;  2ZCT A;  3MYD A;  2OAD A;  3EWL A;  2CAI A;  4IJ3 A;  4EIQ A;  1F2E A;  3KIJ A;  5ELG A;  5KN3 A;  1X0R A;  2WZ9 A;  1GUH A;  1B9Y C;  1FB6 A;  3I69 A;  2I4A A;  4XRA A;  5IOW A;  1QQ2 A;  3DXB A;  4V1A p;  3ZIV A;  1G6Y A;  2V1M A;  2TIR A;  2N5A A;  1BQ7 A;  1A24 A;  2LRT A;  2F9S A;  2K9F A;  3H8Q A;  1K0O A;  1N8J A;  1WP0 A;  1V57 A;  1AUC A;  4F0C A;  3WT2 A;  3C7M A;  4Q5N A;  3VI5 A;  3EE2 A;  2IMK A;  3LXT A;  5JCG A;  4PQ1 A;  1AAZ A;  2MYG A;  5CYY A;  4WF4 A;  1VF2 A;  4YAV A;  2FWE A;  5F06 A;  2H0H A;  2ZUP A;  3LYK A;  1O8X A;  4Q5R A;  4PX1 A;  4KF9 A;  2J23 A;  3M0F A;  2AUV A;  3F8U A;  4CHS A;  4Q5Q A;  2OE0 A;  1TP9 A;  3KP9 A;  2DIZ A;  5GAN D;  3FZ9 A;  5D9T A;  5H5Q A;  3KEB A;  1GTU A;  3FY7 A;  1ACV A;  2HRK A;  4WXT A;  2MBT A;  1N2A A;  4BL7 B;  5HR3 A;  3UOM A;  1J08 A;  2GT5 A;  1QFN A;  5B8B A;  5F05 A;  2B6M A;  1FW1 A;  14GS A;  4HDE A;  4WBJ A;  3IXR A;  2WGR A;  2IIY A;  2N5B A;  4MCU A;  1URM A;  1QMV A;  1AQX A;  1AQV A;  2PVQ A;  1NHY A;  5H5S A;  3RHB A;  1B4Q A;  3K8N A;  1Z5Y E;  5HR2 A;  4MPF A;  2LEG A;  3APQ A;  1WE0 A;  1A8L A;  4KB3 A;  5DAL A;  4L0U A;  1BYE A;  2R3X A;  4ZXG A;  3NZN A;  3LFL A;  2FWH A;  3WGX A;  4POL A;  4J57 E;  5BRT A;  4JU5 A;  2FWF A;  1A8Y A;  2R6K A;  2HE3 A;  1G7E A;  4X0X A;  4WBR D;  2CVD A;  3J7Y k;  5ECI B;  4GSS A;  1O81 A;  4O5R A;  3I6A A;  1X9W B;  1ZYN A;  2G2Q A;  5JCW A;  1Y25 A;  2B1L A;  5IMF A;  10GS A;  3UIW A;  2IWT A;  2BTO T;  4OFN A;  2KLX A;  3IV4 A;  4IEL A;  4N30 A;  2CQ9 A;  2PPT A;  1GSU A;  4G19 A;  1R4W A;  1Z9H A;  3VWX A;  4GQF A;  3TJK A;  2AB6 A;  3GN3 A;  2O7K A;  5ECS A;  2MZC A;  4IQ1 A;  3C1R A;  3TGZ A;  4V1A g;  1SK0 A;  3TCO A;  1YEP A;  3GH9 A;  3ED3 A;  4POM A;  3R2Q A;  1JZR A;  4IN0 A;  3IHG A;  2H74 A;  3M1G A;  1X5D A;  2FWG A;  1X9M B;  1SKW B;  2YZH A;  3H79 A;  1DE1 A;  3CYN A;  3L4N A;  6GSX A;  2VCZ A;  1UN2 A;  5BMU A;  4MP4 A;  5J5N A;  4NV5 A;  1KBN A;  4JED A;  3OR5 A;  1JFU A;  5DJL A;  3J7Y b;  2WB9 A;  4X4J A;  3FR3 A;  5COH A;  3GX8 A;  4OWY A;  5A4W A;  3ERG A;  3RHC A;  4HU7 A;  4NHW A;  1NW2 A;  1ON4 A;  2MMO A;  2B5E A;  2IJY A;  4DSQ A;  2RUF A;  2R0P A;  1TDI A;  2UZ8 A;  2L6C A;  1NM3 A;  3G7Y A;  1PL2 A;  3HJO A;  4KE3 A;  4ZB6 A;  3UAR A;  1GRX A;  1QXH A;  4EKZ A;  1M3J A;  1I9D A;  2WCI A;  1MD4 A;  2E0Q A;  3TJG A;  3IPZ A;  2H1G A;  2PER A;  2C3N A;  4MZC A;  2DJJ A;  3L9U A;  2YV7 A;  2VL2 A;  4FYU A;  1V98 A;  3VFI A;  1Z7P A;  5ECO B;  2L5O A;  4ECJ A;  4IVF A;  3G7J A;  4BVX B;  4GQC A;  4DVC A;  4GSN A;  1K0D A;  2HSY A;  1TRW A;  4RQR A;  3S9F A;  2GZP A;  1ZYE A;  2KHP A;  4D73 A;  16GS A;  2LQO A;  1O6J A;  2DBC A;  1BED A;  3EUR A;  2CZ2 A;  3AY8 A;  4FYC A;  2YJH A;  1YF1 A;  1AXD A;  2WJU A;  2TRX A;  4NMU A;  5G5E A;  4TXV A;  2H8L A;  3KMO A;  4BWS A;  1FB0 A;  4EO3 A;  1MDJ A;  1OKD A;  2EIO A;  3E9J B;  3LXZ A;  1I5G A;  2B7K A;  3QR6 A;  3O6T A;  6GSV A;  1LJR A;  5F0G A;  3LEF A;  4Z2R A;  4MPG A;  2YP6 A;  3FZA A;  1WIK A;  4TKY A;  4XHM A;  4L8E A;  3GUS A;  1SJI A;  4MA9 A;  4EVM A;  2VL3 A;  3TUE A;  2HRN A;  1KTE A;  1O7U A;  5HQP A;  1B9X C;  3A3T A;  3BCI A;  4JZQ A;  2BMX A;  5IIZ A;  2C3Q A;  4TR3 A;  1SD8 A;  2YWO A;  1OC9 A;  3IC4 A;  3KH7 A;  4TRX A;  3UMA A;  4A5P A;  5J3R A;  4AJ7 A;  1XW6 A;  4O5Q A;  1ERU A;  5INY A;  2WFC A;  5JWR B;  2LJK A;  1XWK A;  2OE3 A;  4MF6 A;  4EUY A;  2GSQ A;  1THX A;  4KSO A;  5EY6 A;  3KP8 A;  3C1S A;  1QK8 A;  4XS4 A;  4BA7 A;  1F9M A;  2E2M A;  4KCA A;  5EPF A;  1PN9 A;  1GP1 A;  4TR4 A;  1PD2 1;  2KP1 A;  4V2L A;  1MTC A;  4K7N A;  3IHQ A;  4H86 A;  4LA1 A;  1GSQ A;  3TB2 A;  1XCC A;  4HZ4 A;  1Z6N A;  3TKS C;  4POB A;  2LRN A;  3HVS A;  3HDC A;  3DKS A;  4L0W A;  3DGQ A;  4GF0 A;  1SYR A;  2DJ1 A;  4KAE A;  4QL9 A;  1G0T A;  2REM A;  5ABR A;  5CRD A;  1Z7R A;  4I97 A;  2GGT A;  3FW2 A;  2VCX A;  1YEX A;  2I3Y A;  1DUG A;  2PBJ A;  3GYK A;  3PH9 A;  2C0G A;  2YZU A;  4ML6 A;  3GX0 A;  2VCW A;  3MDK A;  4WEY A;  5B8A A;  1MDI A;  4KDY A;  4IS0 A;  6GSY A;  1K3L A;  2YWM A;  1C72 A;  4IQA A;  3KM6 A;  1MDK A;  3ZYW A;  3TKR A;  4TXO B;  2LKU A;  3MAK A;  3ZTL A;  4DEJ A;  4HU9 A;  5ID2 B;  3C8E A;  2GS3 A;  4JR6 A;  5EL8 A;  5E59 A;  4PUF C;  1SK1 A;  2RLI A;  2PN8 A;  2H66 A;  2X49 A;  1EOG A;  5DCH A;  1WRY A;  1SD9 A;  3LJR A;  3L9V A;  2C80 A;  4K2X A;  3FYG A;  4ZBA A;  1DBY A;  2QGV A;  3EMX A;  1JZD A;  3HJM A;  4G9H A;  3TKP A;  4EIP A;  1OE7 A;  2Z9S A;  2A4V A;  2PVO C;  3D0Z A;  1YQ1 A;  4BVY A;  4TR0 A;  1MD3 A;  4GCI A;  4YH2 A;  3FMW A;  1OC8 A;  5D93 A;  3C73 A;  3GKK A;  1SK2 A;  4USS A;  2C8U A;  2H72 A;  1R5A A;  4HQS A;  5IQY A;  4EC0 A;  1PFO A;  1ERW A;  1T4Z A;  2EC4 A;  5ECM B;  3IC8 A;  3VUR A;  3F63 A;  4IP1 A;  4ZIJ A;  3F4T A;  3BD2 A;  1SKR B;  4KUN A;  3I43 A;  4IP6 A;  3BJ5 A;  5G1L A;  1XWC A;  2CVK A;  3GHA A;  3TOU A;  5ECK B;  1YKC A;  4HI7 A;  2F51 A;  4PQH A;  1GL8 A;  2M46 A;  2H19 A;  4K5S A;  2H76 A;  3RDW A;  1XXU A;  2PWJ A;  4KDX A;  1Q4J A;  3A2X A;  2M80 A;  2F8A A;  3F6F A;  2EIR A;  3HVX A;  3PIN A;  4ECI A;  2OKA A;  1RK4 A;  2X64 A;  4OO4 A;  3GTU A;  5D9W A;  5IM9 A;  1GSE A;  4TR1 A;  1YY7 A;  3HY2 A;  2YAN A;  4GXZ A;  5KOX A;  3DD3 A;  3N5O A;  2HFD A;  3FEU A;  2IPA A;  4QL7 A;  2IFQ A;  2GT6 A;  4ECB A;  2P5Q A;  4DSR A;  4YKF A;  4G10 A;  2HZE A;  3FR9 A;  2QA1 A;  4ZB8 A;  3F3Q A;  1QGV A;  5C00 A;  4PUA A;  1VRS D;  4JRR A;  1M3I A;  1A0F A;  5ECH B;  3V1W A;  2CX3 A;  2K8V A;  2GVP A;  2FA8 A;  3DWV A;  4MZW A;  4N0Z A;  2LTK A;  3EVI A;  1ABA A;  3CXG A;  5FT3 A;  3HYP A;  4EXJ A;  1TI1 A;  4L5O A;  4HJ2 A;  1Z6M A;  2GQL A;  4MJC A;  2KUC A;  1A0R P;  1AIU A;  3IA1 A;  3FZ4 A;  1TRV A;  1SL2 B;  4BPY A;  2HYX A;  1TI3 A;  3ZFL A;  1S3D A;  3NOF A;  3TDG A;  1XWG A;  4MH2 A;  2JSZ A;  3LGC A;  3GKM A;  1F3B A;  5D73 A;  3KCM A;  2IME A;  3IDV A;  4YQU A;  3F4S A;  3TJB A;  4ZL7 A;  4O32 A;  4TVE A;  1JLV A;  1K0M A;  2GQK A;  2H0I A;  2HZF A;  4GST A;  2XBQ A;  2X8H A;  2H1B A;  4ISD A;  1EP7 A;  2O89 A;  4TW5 A;  5EVO A;  4DSS A;  4K5R A;  2RM5 A;  3APS A;  1UVZ A;  3CSJ A;  1V9W A;  2VM1 A;  3ZIT A;  5DDL A;  5D9X A;  4CY6 A;  1YKA A;  1OKT A;  4OCF A;  5GSS A;  3QFB C;  5B7C A;  1ST9 A;  3EC3 A;  2NBS A;  4MH3 A;  1A2M A;  1WJK A;  4L5L A;  1HNB A;  4RI6 A;  2HRA A;  4KX4 A;  4PNF A;  1M99 A;  4JBB A;  4PQI A;  1XWA A;  1PX7 A;  1O85 A;  1OC3 A;  4ZBD A;  3GRX A;  5ENU A;  3MWH A;  5DAK B;  2ALB A;  1S3C A;  2B3S A;  3ZZX A;  2L57 A;  1XW9 A;  3CSH A;  2R0C A;  4RI7 A;  2V2G A;  5A4U A;  1Y6E A;  3ME8 A;  4K6X A;  2LQQ A;  2I1U A;  1W4V A;  1PQN A;  1ERT A;  3W8J A;  5AIX A;  4KSM A;  5CP1 A;  5AGY A;  2F8F A;  4EF0 A;  2HRF A;  4TOP A;  2XPE A;  3M9J A;  4G0L A;  2J9H A;  5KEJ A;  2FA4 A;  2K8S A;  1ZGN A;  5G5F A;  3CQF A;  2C3T A;  1U6T A;  3LOR A;  3F9U A;  2V6K A;  1GNE A;  3VPQ A;  1UA5 A;  2QKE A;  1AW9 A;  3ME7 A;  2ON5 A;  3MSZ A;  4KW6 A;  5J9C A;  3QFA C;  2O8V B;  1T8E B;  1RW1 A;  3WGE A;  1F6M C;  1GTA A;  1U3A A;  2D2Z A;  3VWV A;  2H70 A;  2DSA A;  5ECR B;  2L6D A;  3ERF A;  5F8B A;  5HR0 A;  2VM2 A;  1FO5 A;  2K6V A;  2VO4 A;  3QCP A;  1O8W A;  1EZK A;  1GSD A;  2EIQ A;  5CRE A;  1EEM A;  2P31 A;  3DML A;  4ZBB A;  3GMF A;  5HFI A;  2B7J A;  1R26 A;  1SU9 A;  1PL1 A;  4EE0 A;  5GST A;  2FLS A;  3ZVJ A;  1T1V A;  1GH2 A;  2JAC A;  1SJ6 A;  1EGR A;  3L78 A;  4IKH A;  1XFL A;  1T4Y A;  2QSI A;  3EYT A;  1WOU A;  3P2A A;  4PXO A;  3LSZ A;  5ECN B;  3QDN A;  4O92 A;  1AC1 A;  5D9V A;  13GS A;  4XIH A;  1WPI A;  5AIS A;  2VOC A;  5IPG A;  1HNC A;  3ZLP A;  3Q19 A;  4X43 A;  2O87 A;  2OE1 A;  1TU7 A;  4Z2T A;  2V32 A;  3CTF A;  3TRP A;  3KTB A;  1LU4 A;  2R4V A;  5ECP B;  4WR5 A;  4E8E A;  1SJZ A;  3CBU A;  3TOT A;  2PUK C;  2GSR A;  4MZB A;  1WMJ A;  2XC2 A;  4ILF A;  4XS1 A;  4FQU A;  4ID0 A;  3ZIJ A;  2X8G A;  2P0G A;  1CQG A;  4WF5 A;  4LMW A;  2OBK A;  1TK0 B;  3UEM A;  3QMX A;  4KDU A;  1O73 A;  4MMM A;  1BG5 A;  1QUW A;  1NHO A;  2L4C A;  3FR6 A;  1V58 A;  2YWN A;  2FGX A;  1FVK A;  20GS A;  2MBS A;  2TRC P;  2BJX A;  2FD3 A;  1FVJ A;  2ZNM A;  4K0N A;  3Q74 A;  5ECQ B;  2XHF A;  1BAY A;  4J56 E;  4NHZ A;  2GQM A;  2OJL A;  1K0N A;  3FKF A;  3ERW A;  1X5C A;  5F07 A;  3DVW A;  5DQY A;  5H5R A;  4MJB A;  5A4V A;  3TKQ A;  4BL7 A;  3QPM A;  6GSU A;  4G2E A;  3UBK A;  3FRC A;  1PA3 A;  1ZCP A;  3DIE A;  5DAL B;  3SWL A;  1J0F A;  4HUA A;  5HFK A;  2DC5 A;  11GS A;  1PX6 A;  1OE8 A;  4OMV A;  2GTU A;  2CX4 A;  2HXK A;  2VD0 A;  2C0F A;  6GSW A;  3VPT A;  3GL5 A;  2A4H A;  5JCU A;  2X8C A;  3M8N A;  3HZ4 A;  2GZY A;  3GA4 A;  1G7O A;  2L5L A;  4IW9 A;  4KGI A;  2GSS A;  4GRF A;  4OFM A;  3A2V A;  2YWI A;  3HVN A;  5HR1 A;  3G9B A;  5KN1 A;  2WS2 A;  2CVB A;  2JU5 A;  4K8M A;  3APO A;  4EDY A;  3KJY A;  4POK A;  4G0K A;  3UJ1 A;  4EL1 A;  5IMC A;  1TJD A;  4KND A;  3CSI A;  5CRH A;  3GNJ A;  2RM6 A;  3A2W A;  2JSY A;  4WET A;  2WDU A;  4I2U A;  6GSS A;  1EV9 A;  3TJF A;  3D22 A;  3CTG A;  4KA0 A;  3QAV A;  4HZ2 A;  1JZW A;  2H0G A;  1TK8 B;  1JZO A;  4AGS A;  2M72 A;  3GST A;  1BX9 A;  1SL1 B;  1GLQ A;  2VUP A;  2C0D A;  1FHE A;  4K1F A;  3JCM L;  5G1K A;  1PSQ A;  4K2D A;  5C04 A;  3QAG A;  3GH6 A;  1XOA A;  5GZZ B;  5J4U A;  4I2T A;  4FO5 A;  2JZT A;  2OA7 A;  4K9Z A;  3GFK A;  1HNA A;  4YQM A;  4IGJ A;  1T3B A;  2F3M A;  1VF1 A;  3D5J A;  2FUG 2;  2DJ2 A;  2HSM A;  1H4O A;  3LW9 A;  2FHE A;  2HT9 A;  1XZO A;  3VWU A;  2NPB A;  4IJI A;  1PGT A;  2LUS A;  3KD0 A;  1XW5 A;  2H6X A;  2LV3 A;  2MMZ A;  4AJ8 A;  2YPM A;  2E2G A;  3GKN A;  5IMZ A;  2OAC A;  2QA2 A;  1GTI A;  3VK9 A;  3HVV A;  3GL3 A;  5A5K A;  2QC7 A;  5LD0 A;  1PRX A;  5CRW A;  2LNT A;  5JWQ B;  1XBS A;  3DRN A;  4HS1 A;  1W89 A;  2G0F A;  4D73 B;  3HA9 A;  2R5G A;  4O7H A;  4YKG A;  3F0I A;  2CA8 A;  3US3 A;  3UVH A;  2V6O A;  1FOV A;  4BVX A;  1MEK A;  3LYP A;  3EU4 A;  3CMI A;  3Q6O A;  2VCV A;  3IBH A;  1B48 A;  3MIX A;  3KTL A;  3FHK A;  1ZZY A;  1U88 A;  2CZ3 A;  1EOH A;  3P90 A;  3U5R E;  1TU8 A;  4LLR A;  3KGK A;  2A2S A;  1B4P A;  5IMA A;  3PR8 A;  4LL1 B;  4V2N A;  2GLR A;  4HQZ A;  2CT6 A;  3TKS A;  4OO5 A;  3R3E A;  1BJX A;  2C4J A;  2I9H A;  3H93 A;  3UAP A;  4P3Y B;  1EWX A;  1FOH A;  2H6Z A;  3WYW A;  3KH9 A;  1TRU A;  1H75 A;  1YJ6 A;  1ZOF A;  4NXI A;  1YZX A;  2KP2 A;  4OFT A;  1OC9 B;  3CRU A;  4RQX A;  3ZRE A;  1K0B A;  3BBY A;  1TXX A;  1F37 A;  5J9B A;  4I5Q A;  2VLT A;  1FAA A;  5AN1 A;  1GSF A;  5IPH A;  4HEA 2;  4N10 A;  4RUV A;  3ZVJ D;  3QD9 A;  5L71 A;  4J2F A;  1Q98 A;  2VL2 C;  5HFG A;  1DSB A;  5E4W A;  2PGT A;  2P5R A;  4IHU A;  3TKS E;  1WWJ A;  4XS4 B;  4FYB A;  2H6Y A;  3GV1 A;  2LS5 A;  5LCZ A;  5CO3 A;  2VCT A;  2I81 A;  1KNG A;  3DEX A;  3WD6 A;  4OD7 A;  3PGT A;  4AF2 A;  2R2J A;  1T7P B;  3VWW A;  2VL9 A;  3N9J A;  2VAF A;  4GTU A;  1YF0 A;  1E6B A;  4OCE A;  3RPN A;  4F03 A;  5AIV A;  2PU9 C;  4Z7X A;  3GIX A;  1G6W A;  3LWA A;  3P8W A;  4F9Z A;  2H73 A;  5KOW A;  3RPP A;  1ZL9 A;  1PKW A;  4ML1 A;  1TK5 B;  1U87 A;  4FH8 A;  3RBT A;  1M2D A;  3C71 A;  1HD2 A;  3CRT A;  3RAZ A;  5J41 A;  1GUL A;  1IYH A;  2OBI A;  3D21 A;  2HNL A;  4K0G A;  5KN2 A;  3M3M A;  1LBK A;  5CRG A;  4MLY A;  3IK9 A;  1ZYP A;  3O3T A;  2O85 A;  5IOX A;  1M9B A;  1EP8 A;  3Q18 A;  2NVL A;  4IBP A;  4WR4 A;  4F82 A;  4BIK A;  4NWY A;  5CNW A;  1GTB A;  3L0H A;  5ELA A;  3BOA A;  2VD1 A;  7GSS A;  3IR4 A;  4CY8 A;  18GS A;  2YJ7 A;  2AJQ B;  4KH7 A;  3DVX A;  4BWQ A;  2WRT A;  4ZB9 A; 
#chains in the Genus database with same CATH homology
 3NIV A;  4MJE A;  1X9S B;  2LRC A;  1M9A A;  3FK8 A;  4I8B A;  4MNN A;  3EU3 A;  1B8X A;  5FHI A;  4TXO A;  2RUE A;  4O5U A;  3EPT A;  4NV2 A;  1R5P A;  5LNK e;  4K7O A;  5ID2 A;  3E3E A;  4MDC A;  2H1D A;  1ZMA A;  4I6X A;  3UBL A;  9GSS A;  1X5E A;  3QOU A;  3UL3 A;  3F6D A;  4HJM A;  4MK3 A;  4BVY B;  1JLW A;  1K3Y A;  3TRQ A;  2X4A A;  4ZL8 A;  3FZ5 A;  3IE3 A;  4PGT A;  4NAX A;  1AQW A;  5JWO B;  1GLP A;  2E7P A;  3HJP A;  2YCD A;  2YNX A;  3IAM 2;  2ON7 A;  2LNS A;  1XWB A;  4XCS A;  1JHB A;  3HHV A;  1XPV A;  2VLV A;  1A2L A;  3H4K A;  1XIY A;  5D96 A;  1ERV A;  1GNW A;  4Z2U A;  3GKX A;  4YQV A;  4FIW A;  8GSS A;  2DMM A;  4EDZ A;  1VF4 A;  2IL3 A;  5IMD A;  2DKH A;  2YOI A;  3TJJ A;  2B1K A;  1K0C A;  2GDR A;  5DQS A;  4N0V A;  1ILO A;  3LG6 A;  3A5I A;  2JL4 A;  4PUR A;  3D4T A;  2XBI A;  4TN8 A;  3ISO A;  4MAB A;  2IMF A;  5DJM A;  1V40 A;  3HKR A;  3GTU B;  2WUL A;  4TR1 B;  3KXO A;  3EIN A;  2C0E A;  3GSS A;  2C1Y A;  2LST A;  4MF5 A;  1PMT A;  3HZ8 A;  3EMP A;  2YN1 A;  3U6V A;  1V2A A;  3W6G A;  3A5W A;  2H1A A;  2IFQ B;  2XPD A;  5DVB A;  1XOB A;  2DML A;  4XS6 A;  6GST A;  1KEB A;  2HZE B;  1M2A A;  2IN3 A;  4AJ6 A;  3M9K A;  3H1N A;  4KCE A;  2R37 A;  22GS A;  1IYI A;  2VLU A;  2V41 A;  1YDK A;  1TOF A;  1TTZ A;  2LJR A;  5B6N A;  4F2I A;  4ZIL A;  2L4Q A;  4PTS A;  3G7I A;  5B6M A;  1A23 A;  1NSW A;  12GS A;  4QQ7 A;  1XVQ A;  3D4M A;  2B5Y A;  2DJK A;  3ZMK A;  3DYR A;  4YAP A;  2PMT A;  2H75 A;  3L9S A;  2X99 A;  1OYJ A;  2DIY A;  4XTS A;  2LJA A;  4CW9 A;  3WT1 A;  2DJ3 A;  2DKI A;  3PPU A;  2ES7 A;  3QAW A;  5GAP D;  4G0I A;  4F0B A;  5CAX A;  2FNO A;  5DCG A;  1K3O A;  2NDO A;  5IO0 A;  1FG4 A;  4MJA A;  2KOK A;  2AHE A;  3P7X A;  1VF3 A;  1J9B A;  3HXS A;  3IAS 2;  2YV9 A;  1HQO A;  1OAZ A;  3ZFB A;  2HLS A;  1R7H A;  1PN0 A;  2R0G A;  2VIM A;  2VCQ A;  3D6I A;  1SYX A;  4DSS B;  4MF7 A;  1GWC A;  5IO2 A;  1VGL A;  1EGO A;  5G30 A;  1ML6 A;  1SL0 B;  1ZYQ B;  2RII A;  2FCH A;  1DE2 A;  3SBC A;  4NPB A;  1RQM A;  1Z3E A;  1EEJ A;  2GST A;  4N11 A;  3IK7 A;  1OVN A;  2H01 A;  1UC7 A;  3F4R A;  1SKS B;  1M7T A;  3KMN A;  2JAD A;  2H30 A;  2FY6 A;  1M2B A;  3I9V 2;  2K18 A;  4CDO A;  4K7I A;  4GWR A;  3F3R A;  5FWG A;  5IMV A;  5KN0 A;  5DBQ A;  17GS A;  4ACS A;  5G31 A;  4ECC A;  5G2Z A;  2DLX A;  3UVT A;  1PKZ A;  4ULX A;  4JE1 A;  1EV4 A;  1GSS A;  2DJ0 A;  3IOS A;  1S3A A;  3BCK A;  5ECL B;  3IRA A;  4LMV A;  2IMI A;  1CQH A;  2H71 A;  3VLN A;  3LQ7 A;  4JR4 A;  5DAK A;  3ZML A;  4ZL9 A;  4WKW A;  4Q5F A;  1TW9 A;  2GZZ A;  1USB A;  1A2J A;  1K0A A;  1F3A A;  2CV4 A;  4E8H A;  1GUK A;  1GSY A;  19GS A;  2HI7 A;  2AAW A;  1THO A;  1TRS A;  3HD5 A;  4HOJ A;  1U3I A;  2A2P A;  3GUR A;  1XVW A;  2MMN A;  5D8I A;  2AYT A;  3ZL5 A;  1M0U A;  3ZRD A;  4V2M A;  2AV4 A;  3E0U A;  1E2Y A;  2N5F A;  3MNG A;  1T00 A;  3VI7 A;  3HCZ A;  4X1U A;  2A2R A;  1TKD B;  2JZS A;  4XRD A;  3WGD A;  4PNG A;  2IMD A;  4LL4 B;  3TRX A;  4ICY A;  2B5X A;  2MMA A;  2JZR A;  3KZQ A;  1GUM A;  2HSH A;  2NTO A;  4GLT A;  2L59 A;  1SEN A;  3O76 A;  3W8S A;  2CAQ A;  1HYU A;  2ZCT A;  3MYD A;  2OAD A;  3EWL A;  2CAI A;  4IJ3 A;  4EIQ A;  1F2E A;  3KIJ A;  5ELG A;  5KN3 A;  1X0R A;  2WZ9 A;  1GUH A;  1B9Y C;  1FB6 A;  3I69 A;  2I4A A;  4XRA A;  5IOW A;  1QQ2 A;  3DXB A;  4V1A p;  3ZIV A;  1G6Y A;  2V1M A;  2TIR A;  2N5A A;  1BQ7 A;  1A24 A;  2LRT A;  2F9S A;  2K9F A;  3H8Q A;  1K0O A;  1N8J A;  1WP0 A;  1V57 A;  1AUC A;  4F0C A;  3WT2 A;  3C7M A;  4Q5N A;  3VI5 A;  3EE2 A;  2IMK A;  3LXT A;  5JCG A;  4PQ1 A;  1AAZ A;  2MYG A;  5CYY A;  4YAV A;  4WF4 A;  1VF2 A;  2FWE A;  5F06 A;  2H0H A;  2ZUP A;  3LYK A;  1O8X A;  4Q5R A;  4PX1 A;  4KF9 A;  2J23 A;  3M0F A;  2AUV A;  3F8U A;  4CHS A;  4Q5Q A;  2OE0 A;  1TP9 A;  3KP9 A;  2DIZ A;  5GAN D;  3FZ9 A;  5D9T A;  5H5Q A;  3KEB A;  1GTU A;  3FY7 A;  1ACV A;  2HRK A;  4WXT A;  2MBT A;  1N2A A;  4BL7 B;  5HR3 A;  3UOM A;  1J08 A;  2GT5 A;  1QFN A;  5B8B A;  5F05 A;  2B6M A;  1FW1 A;  14GS A;  4HDE A;  4WBJ A;  3IXR A;  2WGR A;  2IIY A;  2N5B A;  4MCU A;  1URM A;  1QMV A;  1AQX A;  1AQV A;  2PVQ A;  1NHY A;  5H5S A;  3RHB A;  1B4Q A;  3K8N A;  1Z5Y E;  5HR2 A;  4MPF A;  2LEG A;  3APQ A;  1WE0 A;  1A8L A;  4KB3 A;  5DAL A;  4L0U A;  1BYE A;  2R3X A;  4ZXG A;  3NZN A;  3LFL A;  2FWH A;  3WGX A;  4POL A;  4J57 E;  5BRT A;  4JU5 A;  2FWF A;  1A8Y A;  2R6K A;  2HE3 A;  1G7E A;  4X0X A;  4WBR D;  2CVD A;  3J7Y k;  5ECI B;  4GSS A;  1O81 A;  4O5R A;  3I6A A;  1X9W B;  1ZYN A;  2G2Q A;  5JCW A;  1Y25 A;  2B1L A;  5IMF A;  10GS A;  3UIW A;  2IWT A;  2BTO T;  4OFN A;  2KLX A;  3IV4 A;  4IEL A;  4N30 A;  2CQ9 A;  2PPT A;  1GSU A;  4G19 A;  1R4W A;  1Z9H A;  3VWX A;  4GQF A;  3TJK A;  2AB6 A;  3GN3 A;  2O7K A;  5ECS A;  2MZC A;  4IQ1 A;  3C1R A;  3TGZ A;  4V1A g;  1SK0 A;  3TCO A;  1YEP A;  3GH9 A;  3ED3 A;  4POM A;  3R2Q A;  1JZR A;  4IN0 A;  3IHG A;  2H74 A;  3M1G A;  1X5D A;  2FWG A;  1X9M B;  1SKW B;  2YZH A;  3H79 A;  1DE1 A;  3CYN A;  3L4N A;  6GSX A;  2VCZ A;  1UN2 A;  5BMU A;  4MP4 A;  5J5N A;  4NV5 A;  1KBN A;  4JED A;  3OR5 A;  1JFU A;  5DJL A;  3J7Y b;  2WB9 A;  4X4J A;  3FR3 A;  5COH A;  3GX8 A;  4OWY A;  5A4W A;  3ERG A;  3RHC A;  4HU7 A;  4NHW A;  1NW2 A;  1ON4 A;  2MMO A;  2B5E A;  2IJY A;  4DSQ A;  2RUF A;  2R0P A;  1TDI A;  2UZ8 A;  2L6C A;  1NM3 A;  3G7Y A;  1PL2 A;  3HJO A;  4KE3 A;  4ZB6 A;  3UAR A;  1GRX A;  1QXH A;  4EKZ A;  1I9D A;  2WCI A;  1MD4 A;  2E0Q A;  3TJG A;  3IPZ A;  2H1G A;  2PER A;  2C3N A;  4MZC A;  2DJJ A;  3L9U A;  2YV7 A;  2VL2 A;  4FYU A;  1V98 A;  3VFI A;  1Z7P A;  5ECO B;  2L5O A;  4ECJ A;  4IVF A;  3G7J A;  4BVX B;  4GQC A;  4DVC A;  4GSN A;  1K0D A;  2HSY A;  1TRW A;  4RQR A;  3S9F A;  2GZP A;  1ZYE A;  2KHP A;  4D73 A;  16GS A;  2LQO A;  1O6J A;  2DBC A;  1BED A;  3EUR A;  2CZ2 A;  3AY8 A;  4FYC A;  2YJH A;  1YF1 A;  1AXD A;  2WJU A;  2TRX A;  4NMU A;  5G5E A;  4TXV A;  2H8L A;  3KMO A;  4BWS A;  1FB0 A;  4EO3 A;  1MDJ A;  1OKD A;  2EIO A;  3E9J B;  3LXZ A;  1I5G A;  2B7K A;  3QR6 A;  3O6T A;  6GSV A;  1LJR A;  5F0G A;  3LEF A;  4Z2R A;  4MPG A;  2YP6 A;  3FZA A;  1WIK A;  4TKY A;  4XHM A;  4L8E A;  3GUS A;  1SJI A;  4MA9 A;  4EVM A;  2VL3 A;  3TUE A;  2HRN A;  1KTE A;  1O7U A;  5HQP A;  1B9X C;  3A3T A;  3BCI A;  4JZQ A;  2BMX A;  5IIZ A;  2C3Q A;  4TR3 A;  1SD8 A;  2YWO A;  1OC9 A;  3IC4 A;  3KH7 A;  4TRX A;  3UMA A;  4A5P A;  5J3R A;  4AJ7 A;  1XW6 A;  4O5Q A;  1ERU A;  5INY A;  2WFC A;  5JWR B;  2LJK A;  1XWK A;  2OE3 A;  4MF6 A;  4EUY A;  2GSQ A;  1THX A;  4KSO A;  5EY6 A;  3KP8 A;  3C1S A;  1QK8 A;  4XS4 A;  4BA7 A;  1F9M A;  2E2M A;  4KCA A;  5EPF A;  1PN9 A;  1GP1 A;  4TR4 A;  1PD2 1;  2KP1 A;  4V2L A;  1MTC A;  4K7N A;  3IHQ A;  4H86 A;  4LA1 A;  1GSQ A;  3TB2 A;  1XCC A;  4HZ4 A;  1Z6N A;  3TKS C;  4POB A;  2LRN A;  3HVS A;  3HDC A;  3DKS A;  4L0W A;  3DGQ A;  4GF0 A;  1SYR A;  2DJ1 A;  4KAE A;  4QL9 A;  1G0T A;  2REM A;  5ABR A;  5CRD A;  1Z7R A;  4I97 A;  2GGT A;  3FW2 A;  2VCX A;  1YEX A;  2I3Y A;  1DUG A;  2PBJ A;  3GYK A;  3PH9 A;  2C0G A;  2YZU A;  4ML6 A;  3GX0 A;  2VCW A;  3MDK A;  4WEY A;  5B8A A;  1MDI A;  4KDY A;  4IS0 A;  6GSY A;  1K3L A;  2YWM A;  1C72 A;  4IQA A;  3KM6 A;  1MDK A;  3ZYW A;  3TKR A;  4TXO B;  2LKU A;  3MAK A;  3ZTL A;  4DEJ A;  4HU9 A;  5ID2 B;  3C8E A;  2GS3 A;  4JR6 A;  5EL8 A;  5E59 A;  4PUF C;  1SK1 A;  2RLI A;  2PN8 A;  2H66 A;  2X49 A;  1EOG A;  5DCH A;  1WRY A;  1SD9 A;  3LJR A;  3L9V A;  2C80 A;  4K2X A;  3FYG A;  4ZBA A;  1DBY A;  2QGV A;  3EMX A;  1JZD A;  3HJM A;  4G9H A;  3TKP A;  4EIP A;  1OE7 A;  2Z9S A;  2A4V A;  2PVO C;  3D0Z A;  1YQ1 A;  4BVY A;  4TR0 A;  1MD3 A;  4GCI A;  4YH2 A;  3FMW A;  1OC8 A;  5D93 A;  3C73 A;  3GKK A;  1SK2 A;  4USS A;  2C8U A;  2H72 A;  1R5A A;  4HQS A;  5IQY A;  4EC0 A;  1ERW A;  1T4Z A;  2EC4 A;  5ECM B;  3IC8 A;  3VUR A;  3F63 A;  4IP1 A;  4ZIJ A;  3F4T A;  3BD2 A;  1SKR B;  4KUN A;  3I43 A;  4IP6 A;  3BJ5 A;  5G1L A;  1XWC A;  2CVK A;  3GHA A;  3TOU A;  5ECK B;  1YKC A;  4HI7 A;  2F51 A;  4PQH A;  1GL8 A;  2M46 A;  2H19 A;  4K5S A;  2H76 A;  3RDW A;  1XXU A;  2PWJ A;  4KDX A;  1Q4J A;  3A2X A;  2M80 A;  2F8A A;  3F6F A;  2EIR A;  3HVX A;  3PIN A;  4ECI A;  2OKA A;  1RK4 A;  2X64 A;  4OO4 A;  3GTU A;  5D9W A;  5IM9 A;  1GSE A;  4TR1 A;  1YY7 A;  3HY2 A;  2YAN A;  4GXZ A;  5KOX A;  3DD3 A;  3N5O A;  2HFD A;  3FEU A;  2IPA A;  4QL7 A;  2IFQ A;  2GT6 A;  4ECB A;  2P5Q A;  4DSR A;  4YKF A;  4G10 A;  2HZE A;  3FR9 A;  2QA1 A;  4ZB8 A;  3F3Q A;  1QGV A;  5C00 A;  4PUA A;  1VRS D;  4JRR A;  1A0F A;  5ECH B;  3V1W A;  2CX3 A;  2K8V A;  2GVP A;  2FA8 A;  3DWV A;  4MZW A;  4N0Z A;  2LTK A;  3EVI A;  1ABA A;  3CXG A;  5FT3 A;  3HYP A;  4EXJ A;  1TI1 A;  4L5O A;  4HJ2 A;  1Z6M A;  2GQL A;  4MJC A;  2KUC A;  1A0R P;  1AIU A;  3IA1 A;  3FZ4 A;  1TRV A;  1SL2 B;  4BPY A;  2HYX A;  1TI3 A;  3ZFL A;  1S3D A;  3NOF A;  3TDG A;  1XWG A;  4MH2 A;  2JSZ A;  3LGC A;  3GKM A;  1F3B A;  5D73 A;  3KCM A;  2IME A;  3IDV A;  4YQU A;  3F4S A;  3TJB A;  4ZL7 A;  4O32 A;  4TVE A;  1JLV A;  1K0M A;  2GQK A;  2H0I A;  2HZF A;  4GST A;  2XBQ A;  2X8H A;  2H1B A;  4ISD A;  1EP7 A;  2O89 A;  4TW5 A;  5EVO A;  4DSS A;  4K5R A;  2RM5 A;  3APS A;  1UVZ A;  3CSJ A;  1V9W A;  2VM1 A;  3ZIT A;  5DDL A;  5D9X A;  4CY6 A;  1YKA A;  1OKT A;  4OCF A;  5GSS A;  3QFB C;  5B7C A;  1ST9 A;  3EC3 A;  2NBS A;  4MH3 A;  1A2M A;  1WJK A;  4L5L A;  1HNB A;  4RI6 A;  2HRA A;  4KX4 A;  4PNF A;  1M99 A;  4JBB A;  4PQI A;  1XWA A;  1PX7 A;  1O85 A;  1OC3 A;  4ZBD A;  3GRX A;  5ENU A;  3MWH A;  5DAK B;  2ALB A;  1S3C A;  2B3S A;  3ZZX A;  2L57 A;  1XW9 A;  3CSH A;  2R0C A;  4RI7 A;  2V2G A;  5A4U A;  1Y6E A;  3ME8 A;  4K6X A;  2LQQ A;  2I1U A;  1W4V A;  1PQN A;  1ERT A;  3W8J A;  5AIX A;  4KSM A;  5CP1 A;  5AGY A;  2F8F A;  4EF0 A;  2HRF A;  4TOP A;  2XPE A;  3M9J A;  4G0L A;  2J9H A;  5KEJ A;  2FA4 A;  2K8S A;  1ZGN A;  5G5F A;  2C3T A;  1U6T A;  3LOR A;  3F9U A;  2V6K A;  1GNE A;  3VPQ A;  1UA5 A;  2QKE A;  1AW9 A;  3ME7 A;  2ON5 A;  3MSZ A;  4KW6 A;  5J9C A;  3QFA C;  2O8V B;  1T8E B;  1RW1 A;  3WGE A;  1F6M C;  1GTA A;  1U3A A;  2D2Z A;  3VWV A;  2H70 A;  2DSA A;  5ECR B;  2L6D A;  3ERF A;  5F8B A;  5HR0 A;  2VM2 A;  1FO5 A;  2K6V A;  2VO4 A;  3QCP A;  1O8W A;  1EZK A;  1GSD A;  2EIQ A;  5CRE A;  1EEM A;  2P31 A;  3DML A;  4ZBB A;  3GMF A;  5HFI A;  2B7J A;  1R26 A;  1SU9 A;  1PL1 A;  4EE0 A;  5GST A;  2FLS A;  3ZVJ A;  1T1V A;  1GH2 A;  2JAC A;  1SJ6 A;  1EGR A;  3L78 A;  4IKH A;  1XFL A;  1T4Y A;  2QSI A;  3EYT A;  1WOU A;  3P2A A;  4PXO A;  3LSZ A;  5ECN B;  3QDN A;  4O92 A;  1AC1 A;  5D9V A;  13GS A;  4XIH A;  1WPI A;  5AIS A;  2VOC A;  5IPG A;  1HNC A;  3ZLP A;  3Q19 A;  4X43 A;  2O87 A;  2OE1 A;  1TU7 A;  4Z2T A;  2V32 A;  3CTF A;  3TRP A;  3KTB A;  1LU4 A;  2R4V A;  5ECP B;  4WR5 A;  4E8E A;  1SJZ A;  3CBU A;  3TOT A;  2PUK C;  2GSR A;  4MZB A;  1WMJ A;  2XC2 A;  4ILF A;  4XS1 A;  4FQU A;  4ID0 A;  3ZIJ A;  2X8G A;  2P0G A;  1CQG A;  4WF5 A;  4LMW A;  2OBK A;  1TK0 B;  3UEM A;  3QMX A;  4KDU A;  1O73 A;  4MMM A;  1BG5 A;  1QUW A;  1NHO A;  2L4C A;  3FR6 A;  1V58 A;  2YWN A;  2FGX A;  1FVK A;  20GS A;  2MBS A;  2TRC P;  2BJX A;  2FD3 A;  1FVJ A;  2ZNM A;  4K0N A;  3Q74 A;  5ECQ B;  2XHF A;  1BAY A;  4J56 E;  4NHZ A;  2GQM A;  2OJL A;  1K0N A;  3FKF A;  3ERW A;  1X5C A;  5F07 A;  3DVW A;  5DQY A;  5H5R A;  4MJB A;  5A4V A;  3TKQ A;  4BL7 A;  3QPM A;  6GSU A;  4G2E A;  3UBK A;  3FRC A;  1PA3 A;  1ZCP A;  3DIE A;  5DAL B;  3SWL A;  1J0F A;  4HUA A;  5HFK A;  2DC5 A;  11GS A;  1PX6 A;  1OE8 A;  4OMV A;  2GTU A;  2CX4 A;  2HXK A;  2VD0 A;  2C0F A;  6GSW A;  3VPT A;  3GL5 A;  2A4H A;  5JCU A;  2X8C A;  3M8N A;  3HZ4 A;  2GZY A;  3GA4 A;  1G7O A;  2L5L A;  4IW9 A;  4KGI A;  2GSS A;  4GRF A;  4OFM A;  3A2V A;  2YWI A;  5HR1 A;  3G9B A;  5KN1 A;  2WS2 A;  2CVB A;  2JU5 A;  4K8M A;  3APO A;  4EDY A;  3KJY A;  4POK A;  4G0K A;  3UJ1 A;  4EL1 A;  5IMC A;  1TJD A;  4KND A;  3CSI A;  5CRH A;  3GNJ A;  2RM6 A;  3A2W A;  2JSY A;  4WET A;  2WDU A;  4I2U A;  6GSS A;  1EV9 A;  3TJF A;  3D22 A;  3CTG A;  4KA0 A;  3QAV A;  4HZ2 A;  1JZW A;  2H0G A;  1TK8 B;  1JZO A;  4AGS A;  2M72 A;  3GST A;  1BX9 A;  1SL1 B;  1GLQ A;  2VUP A;  2C0D A;  1FHE A;  4K1F A;  3JCM L;  5G1K A;  1PSQ A;  4K2D A;  5C04 A;  3QAG A;  3GH6 A;  1XOA A;  5GZZ B;  5J4U A;  4I2T A;  4FO5 A;  2JZT A;  2OA7 A;  4K9Z A;  3GFK A;  1HNA A;  4YQM A;  4IGJ A;  1T3B A;  2F3M A;  1VF1 A;  3D5J A;  2FUG 2;  2DJ2 A;  2HSM A;  1H4O A;  3LW9 A;  2FHE A;  2HT9 A;  1XZO A;  3VWU A;  2NPB A;  4IJI A;  1PGT A;  2LUS A;  3KD0 A;  1XW5 A;  2H6X A;  2LV3 A;  2MMZ A;  4AJ8 A;  2YPM A;  2E2G A;  3GKN A;  5IMZ A;  2OAC A;  2QA2 A;  1GTI A;  3VK9 A;  3HVV A;  3GL3 A;  5A5K A;  2QC7 A;  5LD0 A;  1PRX A;  5CRW A;  2LNT A;  5JWQ B;  1XBS A;  3DRN A;  4HS1 A;  1W89 A;  2G0F A;  4D73 B;  3HA9 A;  2R5G A;  4O7H A;  4YKG A;  3F0I A;  2CA8 A;  3US3 A;  3UVH A;  2V6O A;  1FOV A;  4BVX A;  1MEK A;  3LYP A;  3EU4 A;  3CMI A;  3Q6O A;  2VCV A;  3IBH A;  1B48 A;  3MIX A;  3KTL A;  3FHK A;  1ZZY A;  1U88 A;  2CZ3 A;  1EOH A;  3P90 A;  3U5R E;  1TU8 A;  4LLR A;  3KGK A;  2A2S A;  1B4P A;  5IMA A;  3PR8 A;  4LL1 B;  4V2N A;  2GLR A;  4HQZ A;  2CT6 A;  3TKS A;  4OO5 A;  3R3E A;  1BJX A;  2C4J A;  2I9H A;  3H93 A;  3UAP A;  4P3Y B;  1EWX A;  1FOH A;  2H6Z A;  3WYW A;  3KH9 A;  1TRU A;  1H75 A;  1YJ6 A;  1ZOF A;  4NXI A;  1YZX A;  2KP2 A;  4OFT A;  1OC9 B;  3CRU A;  4RQX A;  3ZRE A;  1K0B A;  3BBY A;  1TXX A;  1F37 A;  5J9B A;  4I5Q A;  2VLT A;  1FAA A;  5AN1 A;  1GSF A;  5IPH A;  4HEA 2;  4N10 A;  4RUV A;  3ZVJ D;  3QD9 A;  5L71 A;  4J2F A;  1Q98 A;  2VL2 C;  5HFG A;  1DSB A;  5E4W A;  2PGT A;  2P5R A;  4IHU A;  3TKS E;  1WWJ A;  4XS4 B;  4FYB A;  2H6Y A;  3GV1 A;  2LS5 A;  5LCZ A;  5CO3 A;  2VCT A;  2I81 A;  1KNG A;  3DEX A;  3WD6 A;  4OD7 A;  3PGT A;  4AF2 A;  2R2J A;  1T7P B;  3VWW A;  2VL9 A;  3N9J A;  2VAF A;  4GTU A;  1YF0 A;  1E6B A;  4OCE A;  3RPN A;  4F03 A;  5AIV A;  2PU9 C;  4Z7X A;  3GIX A;  1G6W A;  3LWA A;  3P8W A;  4F9Z A;  2H73 A;  5KOW A;  3RPP A;  1ZL9 A;  1PKW A;  4ML1 A;  1TK5 B;  1U87 A;  4FH8 A;  3RBT A;  1M2D A;  3C71 A;  1HD2 A;  3CRT A;  3RAZ A;  5J41 A;  1GUL A;  1IYH A;  2OBI A;  3D21 A;  2HNL A;  4K0G A;  5KN2 A;  3M3M A;  1LBK A;  5CRG A;  4MLY A;  3IK9 A;  1ZYP A;  3O3T A;  2O85 A;  5IOX A;  1M9B A;  1EP8 A;  3Q18 A;  2NVL A;  4IBP A;  4WR4 A;  4F82 A;  4NWY A;  5CNW A;  1GTB A;  3L0H A;  5ELA A;  3BOA A;  2VD1 A;  7GSS A;  3IR4 A;  4CY8 A;  18GS A;  2YJ7 A;  2AJQ B;  4KH7 A;  3DVX A;  4BWQ A;  2WRT A;  4ZB9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...