1XVWA

Crystal structure of ahpe from mycobacterium tuberculosis, a 1-cys peroxiredoxin
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
158
structure length
157
Chain Sequence
PRGSHMLNVGATAPDFTLRDQNQQLVTLRGYRGAKNVLLVFFPLAFTGIQGELDQLRDHLPEFENDDSAALAISVGPPPTHKIWATQSGFTFPLLSDFWPHGAVSQAYGVFNEQAGIANRGTFVVDRSGIIRFAEMKQPGEVRDQRLWTDALAALTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Hypothetical protein Rv2238c/MT2298
publication title Crystal Structure of AhpE from Mycobacterium tuberculosis, a 1-Cys Peroxiredoxin
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 47
structure length 157
sequence length 158
chains with identical sequence B
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2004-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1xvwA00
5AN1A 3P2AA 5B8AA 1B9XC 4MZWA 5AIXA 1PD21 1VF4A 3EYTA 4J56E 4TXVA 1FVKA 3WGXA 2ZCTA 1TW9A 3TJBA 3HJOA 4IN0A 1ERWA 3ZMKA 3QDNA 3ERFA 5B6NA 3EINA 2HRNA 3ED3A 1B8XA 3GV1A 4TR1B 4O7HA 4GWRA 2O87A 5GSTA 5J9CA 3F6DA 2HNLA 1PL2A 1USBA 2HRFA 1EGRA 1XPVA 1O73A 4G10A 5IPGA 4LMWA 5IMZA 5D93A 1GSQA 5LD0A 1O8XA 4GTUA 1TK8B 1GLQA 1FAAA 2XBIA 5B6MA 5JWOB 3VWUA 2FY6A 11GSA 2VCVA 3W8JA 1ZL9A 2AB6A 3KEBA 1WE0A 3MNGA 2OACA 1FOVA 3K8NA 3FR6A 1Z5YE 2GVPA 3IPZA 4WBJA 5JWRB 2OA7A 2VOCA 3DWVA 6GSYA 1ERUA 1KEBA 3IOSA 4PGTA 3RAZA 5HR1A 3C1SA 2P5QA 2DJ3A 2K9FA 3EC3A 4AGSA 1QGVA 4PX1A 1WP0A 2YJHA 1NHYA 1TKDB 4D73A 2DJKA 2H73A 1XCCA 1YKAA 3C7MA 3UBKA 3O76A 2FGXA 6GSWA 3P90A 1XWAA 1ACVA 2KP1A 3ERGA 1TU8A 5H5QA 3HVVA 1KBNA 1OC3A 4N11A 2IWTA 1Z9HA 2PGTA 1QQ2A 2GS3A 4MJCA 2AJQB 3L9VA 2YNXA 4LMVA 4F2IA 2YWOA 3ZFLA 3MAKA 1MDIA 3ZVJA 2B7JA 3RPPA 3IXRA 4KDYA 2EIRA 1HNBA 1A2MA 1SD9A 1YQ1A 2L5OA 4K1FA 2I81A 2IJYA 1THXA 2VO4A 1BEDA 3KP8A 1FW1A 2C0EA 5FWGA 4YAPA 5F8BA 1PMTA 4MJBA 1GTUA 1KTEA 2O89A 3RPNA 2Z9SA 3D5JA 2RUEA 1NW2A 1SJ6A 3TJGA 1ABAA 4PUAA 3M1GA 2F8FA 2I3YA 3DVWA 4EF0A 1Q98A 2CZ3A 1YEXA 1GNWA 3WGDA 4LL1B 4TR1A 4JE1A 1I9DA 4GF0A 3QAWA 3GNJA 1X0RA 5G1KA 2H6YA 2DJ0A 5DJLA 4ID0A 2H30A 3TKPA 3M3MA 1BG5A 3IC4A 2MBSA 3L4NA 3RHBA 1GUMA 1TDIA 4DSRA 1SJZA 1GSUA 1W89A 1GSFA 5ECPB 4HOJA 4K9ZA 2MMAA 4WEYA 3D6IA 2PU9C 4MZCA 3EVIA 2R6KA 3H1NA 4N10A 2H0IA 2H01A 4GSSA 2CVDA 5IMAA 5DCGA 2F9SA 1T8EB 2A2SA 1BJXA 2A2RA 1Z6MA 1AIUA 2H70A 1X5DA 4TR3A 2AHEA 2XPDA 4XRAA 2H0HA 3IAS2 1AUCA 4EUYA 2LRTA 3HJMA 1EP7A 4L0UA 3ZMLA 2LJAA 3C73A 2NBSA 3WT2A 1TRUA 1XVWA 2HXKA 1EEJA 3LJRA 2X8HA 2NDOA 3EMXA 4GSNA 1M9AA 4WF5A 5CYYA 3SBCA 2DC5A 1EP8A 3F0IA 2C0FA 3DD3A 3ME8A 2E0QA 1XOBA 3WD6A 1OC8A 4BVXA 18GSA 2WB9A 4NHWA 5GZZB 2N5AA 2CV4A 3H79A 3GRXA 2AAWA 4H86A 3QAGA 2GQKA 1FB6A 2VUPA 1XVQA 4ECCA 3DYRA 2DJ1A 2R37A 3GL3A 1GRXA 5D9TA 4YAVA 1B9YC 2GQLA 4WKWA 2VL2C 5HFGA 2YV7A 5ECRB 2O8VB 2WRTA 2G0FA 1NSWA 1GTBA 5HR0A 3HYPA 2C0DA 1M9BA 2K8SA 2LRCA 4QQ7A 4EVMA 5DBQA 1GLPA 1ZOFA 2R3XA 3CRUA 4KX4A 3TKSA 5KEJA 4CDOA 5ECMB 5ELGA 1HYUA 3APSA 4RI7A 2CVBA 3KD0A 1F3AA 3GSSA 5G5EA 4TOPA 2P31A 3TKRA 3HVSA 1URMA 2IMKA 2MMNA 3UBLA 4O5RA 5ID2B 3KGKA 4L5LA 1IYIA 1OKTA 3M0FA 4JRRA 1PRXA 4BWQA 3NOFA 3HKRA 3ZVJD 1OC9B 2HSHA 4K8MA 1K0BA 1QXHA 2OKAA 4ZILA 4L5OA 4G19A 1SK2A 2B5YA 3FZ4A 1CQGA 3UVTA 2C3NA 2PUKC 3LWAA 5HFIA 1M0UA 4MABA 3I6AA 3HDCA 5A4VA 5JCGA 4CHSA 2VLUA 4POBA 2OE3A 5AIVA 1EV9A 2QC7A 2PBJA 1Z3EA 2QSIA 4AJ6A 3VFIA 2PERA 3TB2A 1R5PA 2CAIA 1X5EA 2P0GA 3CYNA 3ZREA 5ENUA 1TTZA 4MF5A 1M2DA 1V2AA 2LRNA 4X43A 1BQ7A 4GLTA 1FG4A 2XPEA 1A23A 4FYUA 1HD2A 5AISA 3LXTA 2FUG2 3L0HA 3BBYA 4F9ZA 1ZZYA 4NV5A 2V1MA 5J4UA 1YY7A 4N30A 2HI7A 4Q5RA 4EL1A 2GT5A 1ML6A 5IMFA 1HNAA 2PN8A 2R4VA 1PX7A 3BJ5A 3PGTA 1HNCA 1EV4A 3BOAA 2FA4A 1SYXA 1GWCA 2B3SA 3BCIA 4I6XA 3IV4A 5EVOA 5JCUA 3ZYWA 5JCWA 1BAYA 2CZ2A 5CREA 2H8LA 4AJ7A 2H75A 4BL7A 2LJRA 3S9FA 5C04A 4ZBDA 4LLRA 3KP9A 2H0GA 1K0CA 5KN0A 1GH2A 3ZZXA 5ECOB 3VK9A 5J41A 4K7NA 4O32A 1DBYA 1SKSB 5ECIB 3GKMA 3RDWA 2B5XA 3D4MA 2KUCA 3H93A 3NIVA 1F3BA 1R26A 4KH7A 3LQ7A 1TP9A 5CRWA 1MD4A 3UMAA 3JCML 5LNKe 13GSA 4ECBA 3L9SA 1O6JA 1ERTA 4JR4A 2TIRA 1SD8A 4Q5QA 1UA5A 2REMA 3A2WA 1V57A 3FZAA 3F63A 2JL4A 5DJMA 4HJ2A 3MDKA 1OC9A 2VD0A 5D9XA 3A2VA 1FB0A 5GAPD 2KOKA 2HLSA 4FYCA 2OBIA 3VI7A 5KN2A 2LEGA 3TUEA 1YZXA 3J7Yb 2YZHA 1X5CA 4KB3A 1X9SB 16GSA 1WWJA 2X8GA 3APQA 3E3EA 1MTCA 3DXBA 1DSBA 1SJIA 1XWKA 2PVQA 4PUFC 4IP1A 1K0OA 5DALB 2DJJA 3I43A 3O6TA 6GSXA 2A4VA 4KAEA 1M99A 4F0BA 1A2JA 2ON7A 1AC1A 3IK7A 4QL7A 2PVOC 1A8LA 3PH9A 1SK1A 1H75A 3LYKA 5HQPA 1GNEA 3L78A 2C0GA 2VCQA 3QD9A 4PNFA 2LSTA 4HI7A 2FNOA 2QGVA 1MEKA 3CSHA 4KSMA 5EY6A 1SK0A 1V98A 1SL2B 2K18A 6GSSA 5J5NA 1U3AA 4KCAA 2IMDA 3TRPA 4I2TA 2B6MA 4MF6A 3TOUA 1M2BA 2YWMA 4WETA 5A4WA 1IYHA 4RQXA 1EOGA 1GP1A 3F9UA 2I4AA 1GL8A 3HA9A 2DJ2A 5DAKB 2BMXA 3M9JA 3GSTA 1ZGNA 5H5SA 3FK8A 4TRXA 4HEA2 4MH2A 1J08A 3QPMA 4JBBA 3ZFBA 2MMOA 2O7KA 3DIEA 3FW2A 3C8EA 4ZIJA 5ECNB 2CT6A 3GA4A 3LYPA 2GQMA 2XHFA 3W6GA 3ZRDA 2RM6A 3QOUA 4I8BA 3KTLA 3P7XA 4K2DA 1XZOA 4YH2A 4E8EA 1QFNA 5ECLB 4JEDA 5G5FA 3UVHA 4ACSA 4DVCA 1JZWA 1QMVA 5CO3A 1SKRB 1EZKA 2E2MA 3KIJA 3UEMA 5CRGA 4QL9A 3HD5A 2OADA 1QK8A 1T1VA 2EIQA 3EU4A 5ECSA 3BD2A 4IJ3A 2N5BA 3LXZA 2IFQB 1ILOA 4GCIA 4XS6A 1PGTA 3KMOA 4L8EA 2IMEA 1CQHA 3HVXA 1XOAA 4PQHA 2CX3A 1R4WA 4V1Ag 3ME7A 5COHA 1TRVA 1NM3A 4EO3A 3DVXA 4N0ZA 1AQWA 4KW6A 4XTSA 3R2QA 3TOTA 5J9BA 3VWWA 1GUHA 1YKCA 3TKQA 1TXXA 4NWYA 4KSOA 4EKZA 3CTGA 5IO2A 3ZLPA 2L59A 4CW9A 3FKFA 5F05A 1G6YA 2VAFA 3FRCA 2ZNMA 5DALA 1FHEA 4ISDA 2OE0A 5DDLA 3HY2A 3F6FA 2YV9A 1F2EA 1Y25A 4HU9A 1LU4A 1JHBA 5DQYA 2GSTA 1OAZA 4TKYA 2PPTA 3TRXA 1AXDA 3C71A 4TXOB 1DE1A 4FIWA 2ZUPA 4FYBA 3TCOA 4V2MA 1G7EA 2VM2A 3F3QA 4K6XA 1Q4JA 2CA8A 3GKKA 4JR6A 4NXIA 3TGZA 2JACA 4OFNA 1XXUA 5CRHA 1EOHA 4J2FA 5DAKA 5CNWA 3APOA 1SL0B 1VF2A 1K0DA 3G7IA 3KMNA 1WIKA 1F9MA 1K0MA 2F51A 4I2UA 5DCHA 5DQSA 5E59A 1OVNA 4K7OA 2JADA 4IP6A 3SWLA 1V58A 1UN2A 2H1BA 5LCZA 4KDXA 1TI3A 1R7HA 3GYKA 4GXZA 19GSA 3HZ8A 1Z7PA 1X9WB 4NAXA 1O85A 1PN9A 1B4QA 2V32A 1H4OA 4MF7A 3U5RE 1T3BA 4MJAA 2LJKA 4HQZA 2FHEA 1PKZA 2NVLA 3Q74A 3CMIA 2WGRA 4BWSA 2C80A 1EGOA 3IDVA 1PL1A 1U3IA 1T4YA 2DBCA 4MP4A 1G0TA 4TVEA 3G7JA 3KH9A 4OCFA 5HR2A 1V40A 2OJLA 4RUVA 3HHVA 3GHAA 1A0FA 1TK5B 1VF3A 3BCKA 2PMTA 1OE8A 2IFQA 2LKUA 4ZL9A 1Z7RA 3DMLA 2QKEA 3Q6OA 4OMVA 2IL3A 2WJUA 2L4QA 3MSZA 3CBUA 3TDGA 2H19A 5ECKB 2LV3A 5IIZA 2X8CA 4ECIA 6GSVA 1VGLA 1A8YA 5F0GA 2H74A 2YN1A 4MA9A 2P5RA 1TRSA 2GSQA 2NTOA 4OFTA 1TOFA 4PQIA 1J9BA 2JZRA 3D22A 4WR4A 3KH7A 5E4WA 3ERWA 7GSSA 4LL4B 5IM9A 2WULA 1WMJA 2YANA 3EURA 2IPAA 4HQSA 4DSQA 5IMVA 4WF4A 2JZSA 4OCEA 1TK0B 4TXOA 4ILFA 4L0WA 4E8HA 4V1Ap 2GZYA 3GTUB 2VLTA 1M2AA 2IMFA 4BVYA 1YDKA 2VIMA 3A3TA 3UIWA 2LNTA 2D2ZA 1JZDA 3CRTA 5A4UA 1GULA 4OWYA 4ML1A 1RW1A 2E7PA 3A5WA 3IBHA 4ZXGA 3FZ5A 2L4CA 3TKSC 3GL5A 5D9VA 2LTKA 4GQCA 2GZZA 3KJYA 4NPBA 4JZQA 1FO5A 3ZL5A 1PA3A 3P8WA 1XW5A 5IO0A 1T00A 2TRCP 2H66A 3GMFA 5INYA 1LBKA 1YJ6A 3GN3A 4KDUA 2YWNA 3H8QA 4GRFA 2MBTA 4IGJA 4O92A 3O3TA 2EC4A 3I69A 4WBRD 4K7IA 5EPFA 2H1GA 2GDRA 1XFLA 2VCZA 4I5QA 2X64A 1VF1A 2B1KA 4IHUA 3GKNA 2F8AA 2FWEA 1YF0A 1S3CA 2GLRA 5IMDA 2H6ZA 1YF1A 12GSA 2DMMA 2AYTA 2HSYA 4TR0A 2YJ7A 8GSSA 1WJKA 1GSEA 2X99A 3DEXA 4XS4B 2JSZA 3KCMA 3LEFA 5IOWA 4BPYA 3L9UA 2HZEB 1O8WA 5ID2A 2YWIA 1E2YA 3RBTA 4MZBA 3GH9A 2L6DA 4MLYA 3LORA 1RK4A 4NMUA 2MZCA 1XW9A 4ECJA 4BA7A 4HS1A 2OBKA 5FT3A 4IQ1A 2L5LA 3GX8A 2I1UA 3KZQA 2HZFA 1BX9A 2N5FA 3G7YA 2YZUA 3F4SA 1A0RP 2BTOT 2ALBA 4G2EA 3IAM2 2GSRA 2I9HA 4GSTA 4V2NA 2C3QA 3GH6A 1M7TA 2ON5A 3FEUA 2CVKA 2H1DA 4MMMA 5G30A 4RI6A 1YEPA 4MCUA 1O7UA 3VPQA 1TI1A 1JZRA 3WGEA 1WOUA 3GTUA 3KTBA 4V2LA 2B5EA 1THOA 1XWBA 9GSSA 2LQQA 1EWXA 4YQVA 2KHPA 5GAND 5G1LA 2B7KA 4EDYA 3US3A 1FVJA 3DRNA 4J57E 1ON4A 4WXTA 1K3OA 3F8UA 3VURA 2VL3A 2DSAA 4X1UA 1ZCPA 2MMZA 1S3DA 4IELA 4ZB6A 4IVFA 3QMXA 4KA0A 2WS2A 1K0AA 3QFBC 1B4PA 2WCIA 5D9WA 3IA1A 2J23A 2RLIA 4ZBAA 2RM5A 3GKXA 2OE1A 3QAVA 3HXSA 2ES7A 4TW5A 3IR4A 1DUGA 2GZPA 2VD1A 1B48A 3LFLA 3CSJA 3LGCA 1SU9A 2V41A 2JZTA 1SENA 4K0NA 3TJKA 4DEJA 4WR5A 3IRAA 4ZBBA 4HU7A 5B7CA 4Q5FA 3M8NA 3VPTA 4POLA 2E2GA 3IK9A 2VCWA 2YP6A 3GFKA 1EEMA 2XBQA 1WRYA 2HE3A 4XS4A 2HFDA 5G31A 4ZB9A 2HZEA 1UC7A 4HDEA 3VI5A 2XC2A 1XWCA 2M46A 2JU5A 5HFKA 3ZTLA 5ECQB 3A2XA 1Z6NA 4MH3A 3W8SA 1U87A 2C8UA 2GSSA 1X9MB 2IN3A 1XIYA 4XCSA 2L57A 5IOXA 1TRWA 3IHQA 1GSSA 10GSA 3QCPA 3WYWA 4PNGA 2KP2A 4PQ1A 2LNSA 6GSTA 4NV2A 3NZNA 2H71A 2FA8A 4F0CA 4AJ8A 2DIYA 4IBPA 1WPIA 2CAQA 2H72A 4OFMA 4HJMA 1SKWB 5DVBA 2FWGA 1K0NA 1O81A 1AW9A 1F37A 1NHOA 2LS5A 2VL9A 1ERVA 3FR3A 1PSQA 1S3AA 3AY8A 5C00A 2CX4A 1DE2A 4EXJA 4XIHA 2VL2A 1ST9A 2MYGA 4KE3A 4POMA 4Q5NA 2PWJA 5ECHB 5HR3A 2VCXA 3ISOA 5JWQB 2IMIA 3EU3A 2B1LA 1JLVA 1XWGA 2BJXA 4LA1A 3EWLA 4KNDA 3QR6A 5D96A 1OE7A 2DIZA 2R5GA 2RUFA 2YCDA 3UAPA 4RQRA 2L6CA 3F4RA 4DSSB 2V6KA 5J3RA 4PURA 2LQOA 1U88A 3FHKA 4IQAA 1OYJA 2WDUA 2JSYA 3Q19A 4OD7A 2EIOA 3N9JA 3U6VA 5D73A 1A24A 3F4TA 2R2JA 3PR8A 5ELAA 2GTUA 3D4TA 1TJDA 2AUVA 1ZYQB 2C1YA 5KN3A 1GSDA 4Z7XA 4FH8A 4AF2A 2FLSA 3QFAC 1W4VA 1UVZA 4HZ2A 3ZIJA 2WZ9A 2FWHA 3M9KA 4ZL7A 3ZITA 1N2AA 1E6BA 3E0UA 4MJEA 1PQNA 1ZYEA 1XBSA 1MDJA 14GSA 6GSUA 3HZ4A 5CAXA 4PXOA 3PINA 5CRDA 1GTIA 1T4ZA 2M72A 3C1RA 2LUSA 4YQMA 2F3MA 3VLNA 3DGQA 5F07A 4F03A 1PX6A 4NHZA 17GSA 4XRDA 4TN8A 1JZOA 3E9JB 4XS1A 3H4KA 2TRXA 3FZ9A 2C3TA 1K3YA 2V2GA 1KNGA 3HJPA 1SL1B 5FHIA 1GTAA 3GIXA 3LG6A 5D8IA 1GUKA 1LJRA 3GUSA 3WT1A 3D21A 2GGTA 5A5KA 2H76A 2V6OA 2CQ9A 4KGIA 3D0ZA 1A2LA 4MDCA 3J7Yk 5CP1A 4F82A 4ZL8A 4TR4A 1BYEA 5GSSA 5EL8A 2GT6A 3CSIA 1G6WA 1C72A 3ZIVA 1N8JA 4K0GA 3FY7A 1JFUA 1GSYA 1ZMAA 3MWHA 1SYRA 1G7OA 3GX0A 4JU5A 3TKSE 3KXOA 2C4JA 3VWXA 2VCTA 4KCEA 4KUNA 3TJFA 2VM1A 3KM6A 5ABRA 3GURA 3RHCA 4IKHA 2AV4A 2M80A 3EE2A 4HZ4A 1R5AA 3CXGA 4XHMA 1JLWA 1QUWA 4MPGA 4ZB8A 5B8BA 4MPFA 4GQFA 4DSSA 3IE3A 1RQMA 5IPHA 1HQOA 1AQXA 3F3RA 4ULXA 2H1AA 3V1WA 2WFCA 1V9WA 1AQVA 1K3LA 3UOMA 3N5OA 4ML6A 3UJ1A 1TU7A 22GSA 1F6MC 2DMLA 3UL3A 1Y6EA 4OO4A 2J9HA 1AAZA 3G9BA 5H5RA 4HUAA 5KN1A 5G2ZA 2FCHA 1MD3A 4IJIA 2G2QA 4D73B 2HT9A 2FD3A 5IMCA 2VLVA 3LSZA 2FWFA 1OKDA 1PKWA 5F06A 5L71A 4I97A 2O85A 2K8VA 4IS0A 2YPMA 2RIIA 5AGYA 2IIYA 3CTFA 4P3YB 1VRSD 4EC0A 4EDZA 3FR9A 2YOIA 1T7PB 3Q18A 2DLXA 2KLXA 3TRQA 4YQUA 3TJJA 4EE0A 5IQYA 4POKA 3OR5A 2H6XA 4N0VA 3DKSA 1J0FA 3VWVA 4IW9A 2HYXA 4X0XA 1U6TA 4FO5A 1MDKA 3EMPA 20GSA 2K6VA 3UARA 3FYGA 4OO5A 2NPBA 1I5GA 3I9V2 1XW6A 4G9HA 3HCZA 4MK3A
chains in the Genus database with same CATH superfamily
5AN1A 3P2AA 5B8AA 1B9XC 4MZWA 5AIXA 1PD21 1VF4A 3EYTA 4J56E 5KOWA 4TXVA 1FVKA 3WGXA 2ZCTA 1TW9A 3TJBA 3HJOA 4IN0A 1ERWA 3ZMKA 3QDNA 3ERFA 5B6NA 3EINA 2HRNA 3ED3A 1B8XA 3GV1A 4TR1B 4O7HA 4GWRA 2O87A 5GSTA 5J9CA 3F6DA 2HNLA 1PL2A 1USBA 2HRFA 1EGRA 1XPVA 2A2PA 1O73A 4G10A 5IPGA 4LMWA 5IMZA 5D93A 1GSQA 5LD0A 1O8XA 4GTUA 1TK8B 1GLQA 1FAAA 2XBIA 5B6MA 5JWOB 3VWUA 2FY6A 11GSA 2VCVA 3W8JA 1ZL9A 2AB6A 3KEBA 1WE0A 3MNGA 2OACA 1FOVA 3K8NA 3FR6A 1Z5YE 2GVPA 3IPZA 4WBJA 5JWRB 2OA7A 2VOCA 3DWVA 6GSYA 1ERUA 1KEBA 3IOSA 4PGTA 3RAZA 5HR1A 3C1SA 2P5QA 2DJ3A 2K9FA 3EC3A 4MNNA 4AGSA 1QGVA 4PX1A 1WP0A 2YJHA 1NHYA 1TKDB 2A4HA 4D73A 2DJKA 2H73A 1XCCA 1YKAA 3C7MA 3UBKA 3O76A 2FGXA 6GSWA 3P90A 1XWAA 1ACVA 2KP1A 3ERGA 1TU8A 5H5QA 4EIPA 3HVVA 1KBNA 4BVXB 1OC3A 4N11A 2IWTA 1Z9HA 2PGTA 1QQ2A 2GS3A 4MJCA 1ZYPA 2AJQB 3L9VA 2YNXA 4LMVA 4F2IA 2YWOA 3ZFLA 3MAKA 1MDIA 3ZVJA 2B7JA 3RPPA 3IXRA 4KDYA 2EIRA 1HNBA 1A2MA 1SD9A 1YQ1A 3EPTA 2L5OA 4K1FA 2I81A 2IJYA 1THXA 2VO4A 1BEDA 4G0KA 3KP8A 1FW1A 2C0EA 5FWGA 4YAPA 5F8BA 1PMTA 4MJBA 1GTUA 1KTEA 2O89A 3RPNA 2Z9SA 3D5JA 2RUEA 1NW2A 1SJ6A 3TJGA 1ABAA 4PUAA 2HSMA 3M1GA 2F8FA 2I3YA 3DVWA 4EF0A 1Q98A 2CZ3A 1YEXA 1GNWA 3WGDA 4LL1B 4TR1A 4JE1A 1I9DA 4GF0A 3QAWA 3GNJA 1X0RA 5G1KA 2H6YA 2DJ0A 5DJLA 4ID0A 2H30A 3TKPA 3M3MA 1BG5A 3IC4A 2MBSA 3L4NA 3RHBA 1GUMA 1TDIA 4DSRA 1SJZA 1GSUA 1W89A 1GSFA 5ECPB 4HOJA 4K9ZA 2MMAA 4WEYA 3D6IA 2PU9C 4MZCA 3EVIA 2R6KA 3H1NA 4N10A 2H0IA 2H01A 4GSSA 2CVDA 5IMAA 5KOXA 5DCGA 2F9SA 1T8EB 2A2SA 1BJXA 2A2RA 1Z6MA 1AIUA 2H70A 1X5DA 4TR3A 2AHEA 2XPDA 4XRAA 2H0HA 3IAS2 1AUCA 4EUYA 2LRTA 3HJMA 1EP7A 4L0UA 3ZMLA 2LJAA 3C73A 2NBSA 3WT2A 1TRUA 1XVWA 2HXKA 1EEJA 3LJRA 2X8HA 2NDOA 3EMXA 4GSNA 1M9AA 4WF5A 5CYYA 3SBCA 2DC5A 1EP8A 3F0IA 2C0FA 3DD3A 3ME8A 2E0QA 1XOBA 3WD6A 1OC8A 4BVXA 18GSA 2WB9A 4A5PA 4NHWA 5GZZB 2N5AA 2CV4A 3H79A 3GRXA 2AAWA 4H86A 3QAGA 2GQKA 1FB6A 2VUPA 1XVQA 4ECCA 3DYRA 2DJ1A 2R37A 3GL3A 1GRXA 5D9TA 4YAVA 1B9YC 2GQLA 4WKWA 2VL2C 4BL7B 5HFGA 2YV7A 5ECRB 2O8VB 2WRTA 2G0FA 1NSWA 1GTBA 5HR0A 3HYPA 2C0DA 1M9BA 2K8SA 2LRCA 4QQ7A 4EVMA 5DBQA 1GLPA 3FMWA 1ZOFA 2R3XA 3CRUA 4KX4A 3TKSA 5KEJA 4CDOA 5ECMB 5ELGA 1HYUA 3APSA 4RI7A 2CVBA 3KD0A 1F3AA 3GSSA 5G5EA 4TOPA 2P31A 3TKRA 3HVSA 1URMA 2IMKA 2MMNA 3UBLA 4O5RA 5ID2B 3KGKA 4L5LA 1IYIA 1OKTA 3M0FA 4JRRA 1PRXA 4BWQA 3NOFA 3HKRA 3ZVJD 1OC9B 2HSHA 4K8MA 1K0BA 1QXHA 2OKAA 3LW9A 4ZILA 4L5OA 4G19A 1SK2A 2R0PA 2B5YA 3FZ4A 1CQGA 3UVTA 2C3NA 2PUKC 4PTSA 3LWAA 5HFIA 1M0UA 4MABA 3I6AA 3HDCA 5A4VA 5JCGA 4CHSA 2VLUA 4POBA 2OE3A 5AIVA 2R0CA 1PN0A 1EV9A 2QC7A 2PBJA 1Z3EA 2QSIA 4AJ6A 3VFIA 2PERA 3TB2A 1R5PA 2CAIA 1X5EA 2P0GA 3CYNA 3ZREA 5ENUA 1TTZA 4MF5A 1M2DA 1V2AA 2LRNA 4X43A 1BQ7A 4GLTA 1FG4A 2XPEA 1A23A 4FYUA 1HD2A 5AISA 3LXTA 2FUG2 3L0HA 3BBYA 4F9ZA 1ZZYA 4NV5A 4Z2TA 2V1MA 5J4UA 1YY7A 4N30A 2HI7A 4Q5RA 4EL1A 2GT5A 1ML6A 2DKIA 5IMFA 1HNAA 2PN8A 2R4VA 1PX7A 3BJ5A 3PGTA 1HNCA 1EV4A 3BOAA 2FA4A 1SYXA 1GWCA 2B3SA 3BCIA 4I6XA 3IV4A 5EVOA 5JCUA 3ZYWA 5JCWA 1BAYA 2CZ2A 5CREA 4O5UA 2H8LA 4AJ7A 2H75A 4BL7A 2LJRA 3S9FA 2HRAA 5C04A 4ZBDA 4LLRA 3KP9A 2H0GA 1K0CA 5KN0A 1GH2A 3ZZXA 5ECOB 3VK9A 5J41A 4K7NA 4O32A 1DBYA 1SKSB 5ECIB 3GKMA 3RDWA 1ZYNA 2B5XA 3D4MA 2KUCA 3H93A 4FQUA 3NIVA 1F3BA 1R26A 4KH7A 3LQ7A 1TP9A 5CRWA 1MD4A 3UMAA 3JCML 5LNKe 13GSA 4ECBA 3L9SA 4USSA 1O6JA 1ERTA 4JR4A 2TIRA 1SD8A 4Q5QA 1UA5A 2REMA 3A2WA 1V57A 3FZAA 3F63A 2JL4A 5DJMA 4HJ2A 3MDKA 1OC9A 2VD0A 5D9XA 3A2VA 1FB0A 5GAPD 2KOKA 2HLSA 4FYCA 2OBIA 3VI7A 5KN2A 2LEGA 3TUEA 1YZXA 3J7Yb 2YZHA 1X5CA 4KB3A 1X9SB 16GSA 1WWJA 2X8GA 3APQA 3E3EA 1MTCA 3DXBA 1DSBA 1SJIA 1XWKA 2PVQA 4PUFC 1XG8A 4IP1A 1K0OA 5DALB 2DJJA 3I43A 3O6TA 6GSXA 2A4VA 4KAEA 1M99A 4F0BA 1A2JA 2ON7A 1AC1A 3IK7A 4QL7A 2PVOC 1A8LA 3PH9A 1SK1A 1H75A 3LYKA 5HQPA 1GNEA 3L78A 2C0GA 2VCQA 3QD9A 4PNFA 2LSTA 4HI7A 2FNOA 2QGVA 1MEKA 3CSHA 5BMUA 4KSMA 5EY6A 4CY6A 1SK0A 1V98A 1SL2B 2K18A 6GSSA 3A5IA 4YKGA 5J5NA 1U3AA 4KCAA 2IMDA 3TRPA 4I2TA 2B6MA 4MF6A 3TOUA 1M2BA 2YWMA 4WETA 5A4WA 1IYHA 4RQXA 1EOGA 2DKHA 1GP1A 3F9UA 2I4AA 1GL8A 3HA9A 2DJ2A 5DAKB 2BMXA 3M9JA 3GSTA 1ZGNA 5H5SA 3FK8A 4TRXA 4HEA2 4MH2A 1J08A 3QPMA 4JBBA 3ZFBA 2MMOA 2O7KA 3DIEA 3FW2A 3C8EA 4ZIJA 5ECNB 2CT6A 3GA4A 3LYPA 4X4JA 2GQMA 2XHFA 3W6GA 3ZRDA 2RM6A 3QOUA 4I8BA 3KTLA 3P7XA 4K2DA 1XZOA 4YH2A 4E8EA 1QFNA 5ECLB 4JEDA 5G5FA 4K2XA 3UVHA 4ACSA 4DVCA 1JZWA 1QMVA 5CO3A 1SKRB 1EZKA 2E2MA 3KIJA 3UEMA 5CRGA 4QL9A 3HD5A 4CY8A 2OADA 1QK8A 1T1VA 2EIQA 3EU4A 5ECSA 3BD2A 4K5SA 4IJ3A 2N5BA 3LXZA 2IFQB 1ILOA 4GCIA 4XS6A 1PGTA 3KMOA 4L8EA 2IMEA 1CQHA 3HVXA 1XOAA 4PQHA 2CX3A 1R4WA 4V1Ag 3ME7A 5COHA 1TRVA 1NM3A 3MIXA 4EO3A 3DVXA 4N0ZA 1AQWA 4KW6A 4XTSA 3R2QA 3TOTA 5J9BA 3VWWA 1GUHA 1YKCA 3TKQA 1TXXA 4NWYA 4KSOA 4EKZA 3CTGA 5IO2A 3ZLPA 2L59A 4CW9A 3FKFA 5F05A 1G6YA 4G0LA 2VAFA 3FRCA 2ZNMA 5DALA 1FHEA 4ISDA 2OE0A 5DDLA 3HY2A 3IC8A 3F6FA 2YV9A 1F2EA 1Y25A 4HU9A 1LU4A 1JHBA 5DQYA 2GSTA 1OAZA 4TKYA 2PPTA 3TRXA 1AXDA 3C71A 4TXOB 1DE1A 4FIWA 2ZUPA 4FYBA 3TCOA 4V2MA 1G7EA 2VM2A 3CQFA 3F3QA 2QA1A 4K6XA 4BVYB 1Q4JA 2CA8A 3GKKA 4JR6A 4NXIA 3TGZA 2JACA 4OFNA 1XXUA 5CRHA 1EOHA 4J2FA 5DAKA 5CNWA 3APOA 1SL0B 1VF2A 1K0DA 3G7IA 3KMNA 1WIKA 1F9MA 1K0MA 2F51A 4I2UA 5DCHA 5DQSA 5E59A 1OVNA 4K7OA 2JADA 4IP6A 3HVNA 3SWLA 1V58A 1UN2A 2H1BA 5LCZA 4KDXA 1TI3A 1R7HA 3GYKA 4GXZA 19GSA 3HZ8A 1Z7PA 1X9WB 4NAXA 1O85A 1PN9A 1B4QA 1FOHA 2V32A 1H4OA 4MF7A 3U5RE 1T3BA 4MJAA 2LJKA 4HQZA 4O5QA 2FHEA 1PKZA 2NVLA 3Q74A 3CMIA 2WGRA 4BWSA 2C80A 1EGOA 3IDVA 1PL1A 1U3IA 1T4YA 2DBCA 4MP4A 1G0TA 4TVEA 3G7JA 3KH9A 4OCFA 5HR2A 3R3EA 1V40A 2OJLA 4RUVA 3HHVA 3GHAA 1A0FA 1TK5B 1VF3A 3BCKA 2PMTA 1OE8A 2IFQA 2LKUA 4ZL9A 1Z7RA 3DMLA 2QKEA 3Q6OA 4OMVA 2IL3A 2WJUA 2L4QA 3MSZA 3CBUA 3TDGA 2H19A 5ECKB 2LV3A 5IIZA 2X8CA 4ECIA 6GSVA 1VGLA 1A8YA 5F0GA 2H74A 2YN1A 4MA9A 2P5RA 1TRSA 2GSQA 2NTOA 4OFTA 1TOFA 2UZ8A 4PQIA 1J9BA 2JZRA 3D22A 4WR4A 3KH7A 4HSCX 4Z2RA 5E4WA 3ERWA 7GSSA 4LL4B 5IM9A 2WULA 1WMJA 2YANA 3EURA 2IPAA 4HQSA 4DSQA 5IMVA 4WF4A 2JZSA 4OCEA 1TK0B 4TXOA 4ILFA 4L0WA 4E8HA 4V1Ap 2GZYA 3GTUB 2VLTA 4BIKA 1M2AA 2IMFA 4BVYA 1YDKA 2VIMA 3A3TA 2X49A 3UIWA 2LNTA 2D2ZA 1PFOA 1JZDA 3CRTA 5A4UA 1GULA 4OWYA 4ML1A 1RW1A 2E7PA 3A5WA 3IBHA 2X4AA 4ZXGA 3FZ5A 2L4CA 3TKSC 3GL5A 5D9VA 2LTKA 4GQCA 2GZZA 3KJYA 4NPBA 4JZQA 1FO5A 3ZL5A 1PA3A 3P8WA 1XW5A 5IO0A 1T00A 2TRCP 2H66A 3GMFA 5INYA 1LBKA 1YJ6A 3GN3A 4KDUA 2YWNA 3H8QA 4GRFA 2MBTA 4IGJA 4O92A 3O3TA 2EC4A 3I69A 4WBRD 4K7IA 5EPFA 2H1GA 2GDRA 1XFLA 2VCZA 4I5QA 2X64A 1VF1A 2B1KA 4IHUA 3GKNA 2F8AA 2FWEA 1YF0A 1S3CA 2GLRA 5IMDA 2H6ZA 1YF1A 12GSA 2DMMA 2AYTA 2HSYA 4TR0A 2YJ7A 8GSSA 1WJKA 1GSEA 2X99A 3DEXA 4XS4B 2JSZA 3KCMA 3LEFA 5IOWA 4BPYA 3L9UA 2HZEB 1O8WA 5ID2A 2YWIA 5BRTA 1E2YA 3RBTA 4MZBA 3GH9A 2L6DA 4MLYA 3LORA 1RK4A 4NMUA 4K5RA 2MZCA 1XW9A 4ECJA 4BA7A 4HS1A 2OBKA 5FT3A 4IQ1A 2L5LA 3GX8A 2I1UA 3KZQA 2HZFA 1BX9A 2N5FA 3G7YA 2YZUA 2HRKA 1A0RP 3F4SA 2BTOT 2ALBA 4G2EA 3IAM2 2GSRA 2I9HA 4GSTA 4V2NA 2C3QA 3GH6A 1M7TA 2ON5A 3FEUA 2CVKA 2H1DA 4MMMA 5G30A 4RI6A 1YEPA 4MCUA 1O7UA 3VPQA 1TI1A 1JZRA 3WGEA 1WOUA 3GTUA 3KTBA 4V2LA 2B5EA 1THOA 1XWBA 9GSSA 2LQQA 1EWXA 4YQVA 2KHPA 5GAND 5G1LA 2B7KA 4EDYA 3US3A 1FVJA 3DRNA 4J57E 1ON4A 4WXTA 1K3OA 3F8UA 3VURA 2VL3A 2DSAA 4X1UA 1ZCPA 2MMZA 1S3DA 4IELA 4ZB6A 4IVFA 3QMXA 4KA0A 2WS2A 1K0AA 3QFBC 1B4PA 2WCIA 5D9WA 3IA1A 2J23A 2RLIA 3PPUA 4ZBAA 2RM5A 3GKXA 2OE1A 3QAVA 3HXSA 2ES7A 4TW5A 3IR4A 1DUGA 2GZPA 2VD1A 1B48A 3LFLA 3CSJA 3LGCA 1SU9A 2V41A 2JZTA 1SENA 4K0NA 3TJKA 4DEJA 4WR5A 3IRAA 4ZBBA 4HU7A 1M3JA 5B7CA 4Q5FA 3M8NA 3VPTA 4POLA 2E2GA 3IK9A 2VCWA 2YP6A 3GFKA 1EEMA 2XBQA 1WRYA 2HE3A 4XS4A 2HFDA 5G31A 4ZB9A 2HZEA 1UC7A 4HDEA 3VI5A 2XC2A 1XWCA 2M46A 2JU5A 5HFKA 3ZTLA 5ECQB 3A2XA 1Z6NA 4MH3A 3W8SA 1U87A 2C8UA 2GSSA 1X9MB 2IN3A 1XIYA 4XCSA 2L57A 5IOXA 1TRWA 3IHQA 1GSSA 10GSA 3QCPA 3WYWA 4PNGA 2KP2A 4PQ1A 2LNSA 6GSTA 4NV2A 3NZNA 1S3RA 2H71A 2FA8A 4F0CA 4AJ8A 2DIYA 4IBPA 1WPIA 2CAQA 2H72A 4OFMA 4HJMA 1SKWB 5DVBA 2FWGA 1K0NA 1O81A 1AW9A 1F37A 1NHOA 2LS5A 2VL9A 1ERVA 3FR3A 1PSQA 1S3AA 3AY8A 5C00A 2CX4A 1DE2A 4EXJA 4XIHA 2VL2A 1ST9A 2MYGA 4KE3A 4POMA 4Q5NA 2PWJA 5ECHB 5HR3A 2VCXA 3ISOA 5JWQB 2IMIA 3EU3A 2B1LA 1JLVA 1XWGA 2BJXA 4LA1A 3EWLA 4KNDA 3QR6A 5D96A 1OE7A 2DIZA 2R5GA 2RUFA 2YCDA 3UAPA 4RQRA 2L6CA 3F4RA 4DSSB 2V6KA 5J3RA 4PURA 2LQOA 1U88A 3FHKA 4IQAA 1OYJA 2WDUA 2JSYA 3Q19A 4OD7A 2EIOA 3N9JA 4Z2UA 3U6VA 5D73A 1A24A 3F4TA 2R2JA 3PR8A 5ELAA 2GTUA 3D4TA 1TJDA 2AUVA 1ZYQB 2C1YA 5KN3A 1GSDA 4Z7XA 4FH8A 4AF2A 2QA2A 2FLSA 3QFAC 1W4VA 1UVZA 4HZ2A 3ZIJA 2WZ9A 2FWHA 3M9KA 4ZL7A 3ZITA 1N2AA 1E6BA 3E0UA 4MJEA 1PQNA 1ZYEA 1XBSA 1MDJA 14GSA 6GSUA 3HZ4A 3IHGA 5CAXA 4PXOA 3PINA 5CRDA 1GTIA 1T4ZA 2M72A 3C1RA 2LUSA 4YQMA 2F3MA 3VLNA 3DGQA 5F07A 4F03A 1PX6A 4NHZA 17GSA 4XRDA 4TN8A 1JZOA 3MYDA 3E9JB 4XS1A 3H4KA 2TRXA 3FZ9A 2C3TA 1K3YA 2V2GA 1KNGA 3HJPA 1SL1B 1M3IA 5FHIA 1GTAA 3GIXA 3LG6A 5D8IA 1GUKA 1LJRA 3GUSA 4G0IA 3WT1A 3D21A 2GGTA 5A5KA 2H76A 2V6OA 2CQ9A 4KGIA 3D0ZA 1A2LA 4MDCA 3J7Yk 5CP1A 4F82A 4ZL8A 4TR4A 2R0GA 1BYEA 5GSSA 5EL8A 2GT6A 3CSIA 1G6WA 1C72A 3ZIVA 1N8JA 4K0GA 3FY7A 1JFUA 1GSYA 1ZMAA 3MWHA 1SYRA 1G7OA 3GX0A 4JU5A 3TKSE 3KXOA 2C4JA 3VWXA 2VCTA 4KCEA 4KUNA 3TJFA 2VM1A 3KM6A 5ABRA 3GURA 3RHCA 4IKHA 2AV4A 2M80A 3EE2A 4HZ4A 1R5AA 3CXGA 4XHMA 1JLWA 1QUWA 4MPGA 4ZB8A 5B8BA 4MPFA 4GQFA 4DSSA 3IE3A 1RQMA 5IPHA 1HQOA 1AQXA 3F3RA 4ULXA 2H1AA 3V1WA 2WFCA 1V9WA 1AQVA 1K3LA 3UOMA 3N5OA 4ML6A 3UJ1A 1TU7A 22GSA 1F6MC 2DMLA 3UL3A 1Y6EA 4OO4A 2J9HA 1AAZA 4EIQA 3G9BA 5H5RA 4HUAA 5KN1A 5G2ZA 2FCHA 1MD3A 4IJIA 2G2QA 4D73B 2HT9A 2FD3A 5IMCA 2VLVA 3LSZA 2FWFA 1OKDA 1PKWA 5F06A 5L71A 4I97A 2O85A 4KF9A 2K8VA 4IS0A 2YPMA 2RIIA 5AGYA 2IIYA 3CTFA 4P3YB 1VRSD 4YKFA 4EC0A 4EDZA 3FR9A 2YOIA 1T7PB 3Q18A 2DLXA 2KLXA 3TRQA 4YQUA 4ICYA 3TJJA 4EE0A 5IQYA 4POKA 3OR5A 2H6XA 4N0VA 3DKSA 1J0FA 3VWVA 4IW9A 2HYXA 4X0XA 1U6TA 4FO5A 1MDKA 3EMPA 20GSA 2K6VA 3UARA 3FYGA 4OO5A 2NPBA 1I5GA 3I9V2 1XW6A 4G9HA 3HCZA 4MK3A
chains in the Genus database with same CATH topology
5AN1A 3P2AA 5B8AA 1B9XC 4MZWA 5AIXA 1PD21 1VF4A 3EYTA 4J56E 5KOWA 4TXVA 1FVKA 3WGXA 2ZCTA 1TW9A 3TJBA 3HJOA 4IN0A 1ERWA 3ZMKA 3QDNA 3ERFA 5B6NA 3EINA 2HRNA 3ED3A 1B8XA 3GV1A 4TR1B 4O7HA 4GWRA 2O87A 5GSTA 5J9CA 3F6DA 2HNLA 1PL2A 1USBA 2HRFA 1EGRA 1XPVA 2A2PA 1O73A 4G10A 5IPGA 4LMWA 5IMZA 5D93A 1GSQA 5LD0A 1O8XA 4GTUA 1TK8B 1GLQA 1FAAA 2XBIA 5B6MA 5JWOB 3VWUA 2FY6A 11GSA 2VCVA 3W8JA 1ZL9A 2AB6A 3KEBA 1WE0A 3MNGA 2OACA 1FOVA 3K8NA 3FR6A 1Z5YE 2GVPA 3IPZA 4WBJA 5JWRB 2OA7A 2VOCA 3DWVA 6GSYA 1ERUA 1KEBA 3IOSA 4PGTA 3RAZA 5HR1A 3C1SA 2P5QA 2DJ3A 2K9FA 3EC3A 4MNNA 4AGSA 1QGVA 4PX1A 1WP0A 2YJHA 1NHYA 1TKDB 2A4HA 4D73A 2DJKA 2H73A 1XCCA 1YKAA 3C7MA 3UBKA 3O76A 2FGXA 6GSWA 3P90A 1XWAA 1ACVA 2KP1A 3ERGA 1TU8A 5H5QA 4EIPA 3HVVA 1KBNA 4BVXB 1OC3A 4N11A 2IWTA 1Z9HA 2PGTA 1QQ2A 2GS3A 4MJCA 1ZYPA 2AJQB 3L9VA 2YNXA 4LMVA 4F2IA 2YWOA 3ZFLA 3MAKA 1MDIA 3ZVJA 2B7JA 3RPPA 3IXRA 4KDYA 2EIRA 1HNBA 1A2MA 1SD9A 1YQ1A 3EPTA 2L5OA 4K1FA 2I81A 2IJYA 1THXA 2VO4A 1BEDA 4G0KA 3KP8A 1FW1A 2C0EA 5FWGA 4YAPA 5F8BA 1PMTA 4MJBA 1GTUA 1KTEA 2O89A 3RPNA 2Z9SA 3D5JA 2RUEA 1NW2A 1SJ6A 3TJGA 1ABAA 4PUAA 2HSMA 3M1GA 2F8FA 2I3YA 3DVWA 4EF0A 1Q98A 2CZ3A 1YEXA 1GNWA 3WGDA 4LL1B 4TR1A 4JE1A 1I9DA 4GF0A 3QAWA 3GNJA 1X0RA 5G1KA 2H6YA 2DJ0A 5DJLA 4ID0A 2H30A 3TKPA 3M3MA 1BG5A 3IC4A 2MBSA 3L4NA 3RHBA 1GUMA 1TDIA 4DSRA 1SJZA 1GSUA 1W89A 1GSFA 5ECPB 4HOJA 4K9ZA 2MMAA 4WEYA 3D6IA 2PU9C 4MZCA 3EVIA 2R6KA 3H1NA 4N10A 2H0IA 2H01A 4GSSA 2CVDA 5IMAA 5KOXA 5DCGA 2F9SA 1T8EB 2A2SA 1BJXA 2A2RA 1Z6MA 1AIUA 2H70A 1X5DA 4TR3A 2AHEA 2XPDA 4XRAA 2H0HA 3IAS2 1AUCA 4EUYA 2LRTA 3HJMA 1EP7A 4L0UA 3ZMLA 2LJAA 3C73A 2NBSA 3WT2A 1TRUA 1XVWA 2HXKA 1EEJA 3LJRA 2X8HA 2NDOA 3EMXA 4GSNA 1M9AA 4WF5A 5CYYA 3SBCA 2DC5A 1EP8A 3F0IA 2C0FA 3DD3A 3ME8A 2E0QA 1XOBA 3WD6A 1OC8A 4BVXA 18GSA 2WB9A 4A5PA 4NHWA 5GZZB 2N5AA 2CV4A 3H79A 3GRXA 2AAWA 4H86A 3QAGA 2GQKA 1FB6A 2VUPA 1XVQA 4ECCA 3DYRA 2DJ1A 2R37A 3GL3A 1GRXA 5D9TA 4YAVA 1B9YC 2GQLA 4WKWA 2VL2C 4BL7B 5HFGA 2YV7A 5ECRB 2O8VB 2WRTA 2G0FA 1NSWA 1GTBA 5HR0A 3HYPA 2C0DA 1M9BA 2K8SA 2LRCA 4QQ7A 4EVMA 5DBQA 1GLPA 3FMWA 1ZOFA 2R3XA 3CRUA 4KX4A 3TKSA 5KEJA 4CDOA 5ECMB 5ELGA 1HYUA 3APSA 4RI7A 2CVBA 3KD0A 1F3AA 3GSSA 5G5EA 4TOPA 2P31A 3TKRA 3HVSA 1URMA 2IMKA 2MMNA 3UBLA 4O5RA 5ID2B 3KGKA 4L5LA 1IYIA 1OKTA 3M0FA 4JRRA 1PRXA 4BWQA 3NOFA 3HKRA 3ZVJD 1OC9B 2HSHA 4K8MA 1K0BA 1QXHA 2OKAA 3LW9A 4ZILA 4L5OA 4G19A 1SK2A 2R0PA 2B5YA 3FZ4A 1CQGA 3UVTA 2C3NA 2PUKC 4PTSA 3LWAA 5HFIA 1M0UA 4MABA 3I6AA 3HDCA 5A4VA 5JCGA 4CHSA 2VLUA 4POBA 2OE3A 5AIVA 2R0CA 1PN0A 1EV9A 2QC7A 2PBJA 1Z3EA 2QSIA 4AJ6A 3VFIA 2PERA 3TB2A 1R5PA 2CAIA 1X5EA 2P0GA 3CYNA 3ZREA 5ENUA 1TTZA 4MF5A 1M2DA 1V2AA 2LRNA 4X43A 1BQ7A 4GLTA 1FG4A 2XPEA 1A23A 4FYUA 1HD2A 5AISA 3LXTA 2FUG2 3L0HA 3BBYA 4F9ZA 1ZZYA 4NV5A 4Z2TA 2V1MA 5J4UA 1YY7A 4N30A 2HI7A 4Q5RA 4EL1A 2GT5A 1ML6A 2DKIA 5IMFA 1HNAA 2PN8A 2R4VA 1PX7A 3BJ5A 3PGTA 1HNCA 1EV4A 3BOAA 2FA4A 1SYXA 1GWCA 2B3SA 3BCIA 4I6XA 3IV4A 5EVOA 5JCUA 3ZYWA 5JCWA 1BAYA 2CZ2A 5CREA 4O5UA 2H8LA 4AJ7A 2H75A 4BL7A 2LJRA 3S9FA 2HRAA 5C04A 4ZBDA 4LLRA 3KP9A 2H0GA 1K0CA 5KN0A 1GH2A 3ZZXA 5ECOB 3VK9A 5J41A 4K7NA 4O32A 1DBYA 1SKSB 5ECIB 3GKMA 3RDWA 1ZYNA 2B5XA 3D4MA 2KUCA 3H93A 4FQUA 3NIVA 1F3BA 1R26A 4KH7A 3LQ7A 1TP9A 5CRWA 1MD4A 3UMAA 3JCML 5LNKe 13GSA 4ECBA 3L9SA 4USSA 1O6JA 1ERTA 4JR4A 2TIRA 1SD8A 4Q5QA 1UA5A 2REMA 3A2WA 1V57A 3FZAA 3F63A 2JL4A 5DJMA 4HJ2A 3MDKA 1OC9A 2VD0A 5D9XA 3A2VA 1FB0A 5GAPD 2KOKA 2HLSA 4FYCA 2OBIA 3VI7A 5KN2A 2LEGA 3TUEA 1YZXA 3J7Yb 2YZHA 1X5CA 4KB3A 1X9SB 16GSA 1WWJA 2X8GA 3APQA 3E3EA 1MTCA 3DXBA 1DSBA 1SJIA 1XWKA 2PVQA 4PUFC 4IP1A 1K0OA 5DALB 2DJJA 3I43A 3O6TA 6GSXA 2A4VA 4KAEA 1M99A 4F0BA 1A2JA 2ON7A 1AC1A 3IK7A 4QL7A 2PVOC 1A8LA 3PH9A 1SK1A 1H75A 3LYKA 5HQPA 1GNEA 3L78A 2C0GA 2VCQA 3QD9A 4PNFA 2LSTA 4HI7A 2FNOA 2QGVA 1MEKA 3CSHA 5BMUA 4KSMA 5EY6A 4CY6A 1SK0A 1V98A 1SL2B 2K18A 6GSSA 3A5IA 4YKGA 5J5NA 1U3AA 4KCAA 2IMDA 3TRPA 4I2TA 2B6MA 4MF6A 3TOUA 1M2BA 2YWMA 4WETA 5A4WA 1IYHA 4RQXA 1EOGA 2DKHA 1GP1A 3F9UA 2I4AA 1GL8A 3HA9A 2DJ2A 5DAKB 2BMXA 3M9JA 3GSTA 1ZGNA 5H5SA 3FK8A 4TRXA 4HEA2 4MH2A 1J08A 3QPMA 4JBBA 3ZFBA 2MMOA 2O7KA 3DIEA 3FW2A 3C8EA 4ZIJA 5ECNB 2CT6A 3GA4A 3LYPA 4X4JA 2GQMA 2XHFA 3W6GA 3ZRDA 2RM6A 3QOUA 4I8BA 3KTLA 3P7XA 4K2DA 1XZOA 4YH2A 4E8EA 1QFNA 5ECLB 4JEDA 5G5FA 4K2XA 3UVHA 4ACSA 4DVCA 1JZWA 1QMVA 5CO3A 1SKRB 1EZKA 2E2MA 3KIJA 3UEMA 5CRGA 4QL9A 3HD5A 4CY8A 2OADA 1QK8A 1T1VA 2EIQA 3EU4A 5ECSA 3BD2A 4K5SA 4IJ3A 2N5BA 3LXZA 2IFQB 1ILOA 4GCIA 4XS6A 1PGTA 3KMOA 4L8EA 2IMEA 1CQHA 3HVXA 1XOAA 4PQHA 2CX3A 1R4WA 4V1Ag 3ME7A 5COHA 1TRVA 1NM3A 3MIXA 4EO3A 3DVXA 4N0ZA 1AQWA 4KW6A 4XTSA 3R2QA 3TOTA 5J9BA 3VWWA 1GUHA 1YKCA 3TKQA 1TXXA 4NWYA 4KSOA 4EKZA 3CTGA 5IO2A 3ZLPA 2L59A 4CW9A 3FKFA 5F05A 1G6YA 4G0LA 2VAFA 3FRCA 2ZNMA 5DALA 1FHEA 4ISDA 2OE0A 5DDLA 3HY2A 3IC8A 3F6FA 2YV9A 1F2EA 1Y25A 4HU9A 1LU4A 1JHBA 5DQYA 2GSTA 1OAZA 4TKYA 2PPTA 3TRXA 1AXDA 3C71A 4TXOB 1DE1A 4FIWA 2ZUPA 4FYBA 3TCOA 4V2MA 1G7EA 2VM2A 3F3QA 2QA1A 4K6XA 4BVYB 1Q4JA 2CA8A 3GKKA 4JR6A 4NXIA 3TGZA 2JACA 4OFNA 1XXUA 5CRHA 1EOHA 4J2FA 5DAKA 5CNWA 3APOA 1SL0B 1VF2A 1K0DA 3G7IA 3KMNA 1WIKA 1F9MA 1K0MA 2F51A 4I2UA 5DCHA 5DQSA 5E59A 1OVNA 4K7OA 2JADA 4IP6A 3SWLA 1V58A 1UN2A 2H1BA 5LCZA 4KDXA 1TI3A 1R7HA 3GYKA 4GXZA 19GSA 3HZ8A 1Z7PA 1X9WB 4NAXA 1O85A 1PN9A 1B4QA 1FOHA 2V32A 1H4OA 4MF7A 3U5RE 1T3BA 4MJAA 2LJKA 4HQZA 4O5QA 2FHEA 1PKZA 2NVLA 3Q74A 3CMIA 2WGRA 4BWSA 2C80A 1EGOA 3IDVA 1PL1A 1U3IA 1T4YA 2DBCA 4MP4A 1G0TA 4TVEA 3G7JA 3KH9A 4OCFA 5HR2A 3R3EA 1V40A 2OJLA 4RUVA 3HHVA 3GHAA 1A0FA 1TK5B 1VF3A 3BCKA 2PMTA 1OE8A 2IFQA 2LKUA 4ZL9A 1Z7RA 3DMLA 2QKEA 3Q6OA 4OMVA 2IL3A 2WJUA 2L4QA 3MSZA 3CBUA 3TDGA 2H19A 5ECKB 2LV3A 5IIZA 2X8CA 4ECIA 6GSVA 1VGLA 1A8YA 5F0GA 2H74A 2YN1A 4MA9A 2P5RA 1TRSA 2GSQA 2NTOA 4OFTA 1TOFA 2UZ8A 4PQIA 1J9BA 2JZRA 3D22A 4WR4A 3KH7A 4Z2RA 5E4WA 3ERWA 7GSSA 4LL4B 5IM9A 2WULA 1WMJA 2YANA 3EURA 2IPAA 4HQSA 4DSQA 5IMVA 4WF4A 2JZSA 4OCEA 1TK0B 4TXOA 4ILFA 4L0WA 4E8HA 4V1Ap 2GZYA 3GTUB 2VLTA 1M2AA 2IMFA 4BVYA 1YDKA 2VIMA 3A3TA 2X49A 3UIWA 2LNTA 2D2ZA 1JZDA 3CRTA 5A4UA 1GULA 4OWYA 4ML1A 1RW1A 2E7PA 3A5WA 3IBHA 2X4AA 4ZXGA 3FZ5A 2L4CA 3TKSC 3GL5A 5D9VA 2LTKA 4GQCA 2GZZA 3KJYA 4NPBA 4JZQA 1FO5A 3ZL5A 1PA3A 3P8WA 1XW5A 5IO0A 1T00A 2TRCP 2H66A 3GMFA 5INYA 1LBKA 1YJ6A 3GN3A 4KDUA 2YWNA 3H8QA 4GRFA 2MBTA 4IGJA 4O92A 3O3TA 2EC4A 3I69A 4WBRD 4K7IA 5EPFA 2H1GA 2GDRA 1XFLA 2VCZA 4I5QA 2X64A 1VF1A 2B1KA 4IHUA 3GKNA 2F8AA 2FWEA 1YF0A 1S3CA 2GLRA 5IMDA 2H6ZA 1YF1A 12GSA 2DMMA 2AYTA 2HSYA 4TR0A 2YJ7A 8GSSA 1WJKA 1GSEA 2X99A 3DEXA 4XS4B 2JSZA 3KCMA 3LEFA 5IOWA 4BPYA 3L9UA 2HZEB 1O8WA 5ID2A 2YWIA 5BRTA 1E2YA 3RBTA 4MZBA 3GH9A 2L6DA 4MLYA 3LORA 1RK4A 4NMUA 4K5RA 2MZCA 1XW9A 4ECJA 4BA7A 4HS1A 2OBKA 5FT3A 4IQ1A 2L5LA 3GX8A 2I1UA 3KZQA 2HZFA 1BX9A 2N5FA 3G7YA 2YZUA 2HRKA 1A0RP 3F4SA 2BTOT 2ALBA 4G2EA 3IAM2 2GSRA 2I9HA 4GSTA 4V2NA 2C3QA 3GH6A 1M7TA 2ON5A 3FEUA 2CVKA 2H1DA 4MMMA 5G30A 4RI6A 1YEPA 4MCUA 1O7UA 3VPQA 1TI1A 1JZRA 3WGEA 1WOUA 3GTUA 3KTBA 4V2LA 2B5EA 1THOA 1XWBA 9GSSA 2LQQA 1EWXA 4YQVA 2KHPA 5GAND 5G1LA 2B7KA 4EDYA 3US3A 1FVJA 3DRNA 4J57E 1ON4A 4WXTA 1K3OA 3F8UA 3VURA 2VL3A 2DSAA 4X1UA 1ZCPA 2MMZA 1S3DA 4IELA 4ZB6A 4IVFA 3QMXA 4KA0A 2WS2A 1K0AA 3QFBC 1B4PA 2WCIA 5D9WA 3IA1A 2J23A 2RLIA 3PPUA 4ZBAA 2RM5A 3GKXA 2OE1A 3QAVA 3HXSA 2ES7A 4TW5A 3IR4A 1DUGA 2GZPA 2VD1A 1B48A 3LFLA 3CSJA 3LGCA 1SU9A 2V41A 2JZTA 1SENA 4K0NA 3TJKA 4DEJA 4WR5A 3IRAA 4ZBBA 4HU7A 5B7CA 4Q5FA 3M8NA 3VPTA 4POLA 2E2GA 3IK9A 2VCWA 2YP6A 3GFKA 1EEMA 2XBQA 1WRYA 2HE3A 4XS4A 2HFDA 5G31A 4ZB9A 2HZEA 1UC7A 4HDEA 3VI5A 2XC2A 1XWCA 2M46A 2JU5A 5HFKA 3ZTLA 5ECQB 3A2XA 1Z6NA 4MH3A 3W8SA 1U87A 2C8UA 2GSSA 1X9MB 2IN3A 1XIYA 4XCSA 2L57A 5IOXA 1TRWA 3IHQA 1GSSA 10GSA 3QCPA 3WYWA 4PNGA 2KP2A 4PQ1A 2LNSA 6GSTA 4NV2A 3NZNA 2H71A 2FA8A 4F0CA 4AJ8A 2DIYA 4IBPA 1WPIA 2CAQA 2H72A 4OFMA 4HJMA 1SKWB 5DVBA 2FWGA 1K0NA 1O81A 1AW9A 1F37A 1NHOA 2LS5A 2VL9A 1ERVA 3FR3A 1PSQA 1S3AA 3AY8A 5C00A 2CX4A 1DE2A 4EXJA 4XIHA 2VL2A 1ST9A 2MYGA 4KE3A 4POMA 4Q5NA 2PWJA 5ECHB 5HR3A 2VCXA 3ISOA 5JWQB 2IMIA 3EU3A 2B1LA 1JLVA 1XWGA 2BJXA 4LA1A 3EWLA 4KNDA 3QR6A 5D96A 1OE7A 2DIZA 2R5GA 2RUFA 2YCDA 3UAPA 4RQRA 2L6CA 3F4RA 4DSSB 2V6KA 5J3RA 4PURA 2LQOA 1U88A 3FHKA 4IQAA 1OYJA 2WDUA 2JSYA 3Q19A 4OD7A 2EIOA 3N9JA 4Z2UA 3U6VA 5D73A 1A24A 3F4TA 2R2JA 3PR8A 5ELAA 2GTUA 3D4TA 1TJDA 2AUVA 1ZYQB 2C1YA 5KN3A 1GSDA 4Z7XA 4FH8A 4AF2A 2QA2A 2FLSA 3QFAC 1W4VA 1UVZA 4HZ2A 3ZIJA 2WZ9A 2FWHA 3M9KA 4ZL7A 3ZITA 1N2AA 1E6BA 3E0UA 4MJEA 1PQNA 1ZYEA 1XBSA 1MDJA 14GSA 6GSUA 3HZ4A 3IHGA 5CAXA 4PXOA 3PINA 5CRDA 1GTIA 1T4ZA 2M72A 3C1RA 2LUSA 4YQMA 2F3MA 3VLNA 3DGQA 5F07A 4F03A 1PX6A 4NHZA 17GSA 4XRDA 4TN8A 1JZOA 3MYDA 3E9JB 4XS1A 3H4KA 2TRXA 3FZ9A 2C3TA 1K3YA 2V2GA 1KNGA 3HJPA 1SL1B 5FHIA 1GTAA 3GIXA 3LG6A 5D8IA 1GUKA 1LJRA 3GUSA 4G0IA 3WT1A 3D21A 2GGTA 5A5KA 2H76A 2V6OA 2CQ9A 4KGIA 3D0ZA 1A2LA 4MDCA 3J7Yk 5CP1A 4F82A 4ZL8A 4TR4A 2R0GA 1BYEA 5GSSA 5EL8A 2GT6A 3CSIA 1G6WA 1C72A 3ZIVA 1N8JA 4K0GA 3FY7A 1JFUA 1GSYA 1ZMAA 3MWHA 1SYRA 1G7OA 3GX0A 4JU5A 3TKSE 3KXOA 2C4JA 3VWXA 2VCTA 4KCEA 4KUNA 3TJFA 2VM1A 3KM6A 5ABRA 3GURA 3RHCA 4IKHA 2AV4A 2M80A 3EE2A 4HZ4A 1R5AA 3CXGA 4XHMA 1JLWA 1QUWA 4MPGA 4ZB8A 5B8BA 4MPFA 4GQFA 4DSSA 3IE3A 1RQMA 5IPHA 1HQOA 1AQXA 3F3RA 4ULXA 2H1AA 3V1WA 2WFCA 1V9WA 1AQVA 1K3LA 3UOMA 3N5OA 4ML6A 3UJ1A 1TU7A 22GSA 1F6MC 2DMLA 3UL3A 1Y6EA 4OO4A 2J9HA 1AAZA 4EIQA 3G9BA 5H5RA 4HUAA 5KN1A 5G2ZA 2FCHA 1MD3A 4IJIA 2G2QA 4D73B 2HT9A 2FD3A 5IMCA 2VLVA 3LSZA 2FWFA 1OKDA 1PKWA 5F06A 5L71A 4I97A 2O85A 4KF9A 2K8VA 4IS0A 2YPMA 2RIIA 5AGYA 2IIYA 3CTFA 4P3YB 1VRSD 4YKFA 4EC0A 4EDZA 3FR9A 2YOIA 1T7PB 3Q18A 2DLXA 2KLXA 3TRQA 4YQUA 4ICYA 3TJJA 4EE0A 5IQYA 4POKA 3OR5A 2H6XA 4N0VA 3DKSA 1J0FA 3VWVA 4IW9A 2HYXA 4X0XA 1U6TA 4FO5A 1MDKA 3EMPA 20GSA 2K6VA 3UARA 3FYGA 4OO5A 2NPBA 1I5GA 3I9V2 1XW6A 4G9HA 3HCZA 4MK3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AN1 A;  3P2A A;  5B8A A;  1B9X C;  4MZW A;  5AIX A;  1PD2 1;  1VF4 A;  3EYT A;  4J56 E;  4TXV A;  1FVK A;  3WGX A;  2ZCT A;  1TW9 A;  3TJB A;  3HJO A;  4IN0 A;  1ERW A;  3ZMK A;  3QDN A;  3ERF A;  5B6N A;  3EIN A;  2HRN A;  3ED3 A;  1B8X A;  3GV1 A;  4TR1 B;  4O7H A;  4GWR A;  2O87 A;  5GST A;  5J9C A;  3F6D A;  2HNL A;  1PL2 A;  1USB A;  2HRF A;  1EGR A;  1XPV A;  1O73 A;  4G10 A;  5IPG A;  4LMW A;  5IMZ A;  5D93 A;  1GSQ A;  5LD0 A;  1O8X A;  4GTU A;  1TK8 B;  1GLQ A;  1FAA A;  2XBI A;  5B6M A;  5JWO B;  3VWU A;  2FY6 A;  11GS A;  2VCV A;  3W8J A;  1ZL9 A;  2AB6 A;  3KEB A;  1WE0 A;  3MNG A;  2OAC A;  1FOV A;  3K8N A;  3FR6 A;  1Z5Y E;  2GVP A;  3IPZ A;  4WBJ A;  5JWR B;  2OA7 A;  2VOC A;  3DWV A;  6GSY A;  1ERU A;  1KEB A;  3IOS A;  4PGT A;  3RAZ A;  5HR1 A;  3C1S A;  2P5Q A;  2DJ3 A;  2K9F A;  3EC3 A;  4AGS A;  1QGV A;  4PX1 A;  1WP0 A;  2YJH A;  1NHY A;  1TKD B;  4D73 A;  2DJK A;  2H73 A;  1XCC A;  1YKA A;  3C7M A;  3UBK A;  3O76 A;  2FGX A;  6GSW A;  3P90 A;  1XWA A;  1ACV A;  2KP1 A;  3ERG A;  1TU8 A;  5H5Q A;  3HVV A;  1KBN A;  1OC3 A;  4N11 A;  2IWT A;  1Z9H A;  2PGT A;  1QQ2 A;  2GS3 A;  4MJC A;  2AJQ B;  3L9V A;  2YNX A;  4LMV A;  4F2I A;  2YWO A;  3ZFL A;  3MAK A;  1MDI A;  3ZVJ A;  2B7J A;  3RPP A;  3IXR A;  4KDY A;  2EIR A;  1HNB A;  1A2M A;  1SD9 A;  1YQ1 A;  2L5O A;  4K1F A;  2I81 A;  2IJY A;  1THX A;  2VO4 A;  1BED A;  3KP8 A;  1FW1 A;  2C0E A;  5FWG A;  4YAP A;  5F8B A;  1PMT A;  4MJB A;  1GTU A;  1KTE A;  2O89 A;  3RPN A;  2Z9S A;  3D5J A;  2RUE A;  1NW2 A;  1SJ6 A;  3TJG A;  1ABA A;  4PUA A;  3M1G A;  2F8F A;  2I3Y A;  3DVW A;  4EF0 A;  1Q98 A;  2CZ3 A;  1YEX A;  1GNW A;  3WGD A;  4LL1 B;  4TR1 A;  4JE1 A;  1I9D A;  4GF0 A;  3QAW A;  3GNJ A;  1X0R A;  5G1K A;  2H6Y A;  2DJ0 A;  5DJL A;  4ID0 A;  2H30 A;  3TKP A;  3M3M A;  1BG5 A;  3IC4 A;  2MBS A;  3L4N A;  3RHB A;  1GUM A;  1TDI A;  4DSR A;  1SJZ A;  1GSU A;  1W89 A;  1GSF A;  5ECP B;  4HOJ A;  4K9Z A;  2MMA A;  4WEY A;  3D6I A;  2PU9 C;  4MZC A;  3EVI A;  2R6K A;  3H1N A;  4N10 A;  2H0I A;  2H01 A;  4GSS A;  2CVD A;  5IMA A;  5DCG A;  2F9S A;  1T8E B;  2A2S A;  1BJX A;  2A2R A;  1Z6M A;  1AIU A;  2H70 A;  1X5D A;  4TR3 A;  2AHE A;  2XPD A;  4XRA A;  2H0H A;  3IAS 2;  1AUC A;  4EUY A;  2LRT A;  3HJM A;  1EP7 A;  4L0U A;  3ZML A;  2LJA A;  3C73 A;  2NBS A;  3WT2 A;  1TRU A;  1XVW A;  2HXK A;  1EEJ A;  3LJR A;  2X8H A;  2NDO A;  3EMX A;  4GSN A;  1M9A A;  4WF5 A;  5CYY A;  3SBC A;  2DC5 A;  1EP8 A;  3F0I A;  2C0F A;  3DD3 A;  3ME8 A;  2E0Q A;  1XOB A;  3WD6 A;  1OC8 A;  4BVX A;  18GS A;  2WB9 A;  4NHW A;  5GZZ B;  2N5A A;  2CV4 A;  3H79 A;  3GRX A;  2AAW A;  4H86 A;  3QAG A;  2GQK A;  1FB6 A;  2VUP A;  1XVQ A;  4ECC A;  3DYR A;  2DJ1 A;  2R37 A;  3GL3 A;  1GRX A;  5D9T A;  4YAV A;  1B9Y C;  2GQL A;  4WKW A;  2VL2 C;  5HFG A;  2YV7 A;  5ECR B;  2O8V B;  2WRT A;  2G0F A;  1NSW A;  1GTB A;  5HR0 A;  3HYP A;  2C0D A;  1M9B A;  2K8S A;  2LRC A;  4QQ7 A;  4EVM A;  5DBQ A;  1GLP A;  1ZOF A;  2R3X A;  3CRU A;  4KX4 A;  3TKS A;  5KEJ A;  4CDO A;  5ECM B;  5ELG A;  1HYU A;  3APS A;  4RI7 A;  2CVB A;  3KD0 A;  1F3A A;  3GSS A;  5G5E A;  4TOP A;  2P31 A;  3TKR A;  3HVS A;  1URM A;  2IMK A;  2MMN A;  3UBL A;  4O5R A;  5ID2 B;  3KGK A;  4L5L A;  1IYI A;  1OKT A;  3M0F A;  4JRR A;  1PRX A;  4BWQ A;  3NOF A;  3HKR A;  3ZVJ D;  1OC9 B;  2HSH A;  4K8M A;  1K0B A;  1QXH A;  2OKA A;  4ZIL A;  4L5O A;  4G19 A;  1SK2 A;  2B5Y A;  3FZ4 A;  1CQG A;  3UVT A;  2C3N A;  2PUK C;  3LWA A;  5HFI A;  1M0U A;  4MAB A;  3I6A A;  3HDC A;  5A4V A;  5JCG A;  4CHS A;  2VLU A;  4POB A;  2OE3 A;  5AIV A;  1EV9 A;  2QC7 A;  2PBJ A;  1Z3E A;  2QSI A;  4AJ6 A;  3VFI A;  2PER A;  3TB2 A;  1R5P A;  2CAI A;  1X5E A;  2P0G A;  3CYN A;  3ZRE A;  5ENU A;  1TTZ A;  4MF5 A;  1M2D A;  1V2A A;  2LRN A;  4X43 A;  1BQ7 A;  4GLT A;  1FG4 A;  2XPE A;  1A23 A;  4FYU A;  1HD2 A;  5AIS A;  3LXT A;  2FUG 2;  3L0H A;  3BBY A;  4F9Z A;  1ZZY A;  4NV5 A;  2V1M A;  5J4U A;  1YY7 A;  4N30 A;  2HI7 A;  4Q5R A;  4EL1 A;  2GT5 A;  1ML6 A;  5IMF A;  1HNA A;  2PN8 A;  2R4V A;  1PX7 A;  3BJ5 A;  3PGT A;  1HNC A;  1EV4 A;  3BOA A;  2FA4 A;  1SYX A;  1GWC A;  2B3S A;  3BCI A;  4I6X A;  3IV4 A;  5EVO A;  5JCU A;  3ZYW A;  5JCW A;  1BAY A;  2CZ2 A;  5CRE A;  2H8L A;  4AJ7 A;  2H75 A;  4BL7 A;  2LJR A;  3S9F A;  5C04 A;  4ZBD A;  4LLR A;  3KP9 A;  2H0G A;  1K0C A;  5KN0 A;  1GH2 A;  3ZZX A;  5ECO B;  3VK9 A;  5J41 A;  4K7N A;  4O32 A;  1DBY A;  1SKS B;  5ECI B;  3GKM A;  3RDW A;  2B5X A;  3D4M A;  2KUC A;  3H93 A;  3NIV A;  1F3B A;  1R26 A;  4KH7 A;  3LQ7 A;  1TP9 A;  5CRW A;  1MD4 A;  3UMA A;  3JCM L;  5LNK e;  13GS A;  4ECB A;  3L9S A;  1O6J A;  1ERT A;  4JR4 A;  2TIR A;  1SD8 A;  4Q5Q A;  1UA5 A;  2REM A;  3A2W A;  1V57 A;  3FZA A;  3F63 A;  2JL4 A;  5DJM A;  4HJ2 A;  3MDK A;  1OC9 A;  2VD0 A;  5D9X A;  3A2V A;  1FB0 A;  5GAP D;  2KOK A;  2HLS A;  4FYC A;  2OBI A;  3VI7 A;  5KN2 A;  2LEG A;  3TUE A;  1YZX A;  3J7Y b;  2YZH A;  1X5C A;  4KB3 A;  1X9S B;  16GS A;  1WWJ A;  2X8G A;  3APQ A;  3E3E A;  1MTC A;  3DXB A;  1DSB A;  1SJI A;  1XWK A;  2PVQ A;  4PUF C;  4IP1 A;  1K0O A;  5DAL B;  2DJJ A;  3I43 A;  3O6T A;  6GSX A;  2A4V A;  4KAE A;  1M99 A;  4F0B A;  1A2J A;  2ON7 A;  1AC1 A;  3IK7 A;  4QL7 A;  2PVO C;  1A8L A;  3PH9 A;  1SK1 A;  1H75 A;  3LYK A;  5HQP A;  1GNE A;  3L78 A;  2C0G A;  2VCQ A;  3QD9 A;  4PNF A;  2LST A;  4HI7 A;  2FNO A;  2QGV A;  1MEK A;  3CSH A;  4KSM A;  5EY6 A;  1SK0 A;  1V98 A;  1SL2 B;  2K18 A;  6GSS A;  5J5N A;  1U3A A;  4KCA A;  2IMD A;  3TRP A;  4I2T A;  2B6M A;  4MF6 A;  3TOU A;  1M2B A;  2YWM A;  4WET A;  5A4W A;  1IYH A;  4RQX A;  1EOG A;  1GP1 A;  3F9U A;  2I4A A;  1GL8 A;  3HA9 A;  2DJ2 A;  5DAK B;  2BMX A;  3M9J A;  3GST A;  1ZGN A;  5H5S A;  3FK8 A;  4TRX A;  4HEA 2;  4MH2 A;  1J08 A;  3QPM A;  4JBB A;  3ZFB A;  2MMO A;  2O7K A;  3DIE A;  3FW2 A;  3C8E A;  4ZIJ A;  5ECN B;  2CT6 A;  3GA4 A;  3LYP A;  2GQM A;  2XHF A;  3W6G A;  3ZRD A;  2RM6 A;  3QOU A;  4I8B A;  3KTL A;  3P7X A;  4K2D A;  1XZO A;  4YH2 A;  4E8E A;  1QFN A;  5ECL B;  4JED A;  5G5F A;  3UVH A;  4ACS A;  4DVC A;  1JZW A;  1QMV A;  5CO3 A;  1SKR B;  1EZK A;  2E2M A;  3KIJ A;  3UEM A;  5CRG A;  4QL9 A;  3HD5 A;  2OAD A;  1QK8 A;  1T1V A;  2EIQ A;  3EU4 A;  5ECS A;  3BD2 A;  4IJ3 A;  2N5B A;  3LXZ A;  2IFQ B;  1ILO A;  4GCI A;  4XS6 A;  1PGT A;  3KMO A;  4L8E A;  2IME A;  1CQH A;  3HVX A;  1XOA A;  4PQH A;  2CX3 A;  1R4W A;  4V1A g;  3ME7 A;  5COH A;  1TRV A;  1NM3 A;  4EO3 A;  3DVX A;  4N0Z A;  1AQW A;  4KW6 A;  4XTS A;  3R2Q A;  3TOT A;  5J9B A;  3VWW A;  1GUH A;  1YKC A;  3TKQ A;  1TXX A;  4NWY A;  4KSO A;  4EKZ A;  3CTG A;  5IO2 A;  3ZLP A;  2L59 A;  4CW9 A;  3FKF A;  5F05 A;  1G6Y A;  2VAF A;  3FRC A;  2ZNM A;  5DAL A;  1FHE A;  4ISD A;  2OE0 A;  5DDL A;  3HY2 A;  3F6F A;  2YV9 A;  1F2E A;  1Y25 A;  4HU9 A;  1LU4 A;  1JHB A;  5DQY A;  2GST A;  1OAZ A;  4TKY A;  2PPT A;  3TRX A;  1AXD A;  3C71 A;  4TXO B;  1DE1 A;  4FIW A;  2ZUP A;  4FYB A;  3TCO A;  4V2M A;  1G7E A;  2VM2 A;  3F3Q A;  4K6X A;  1Q4J A;  2CA8 A;  3GKK A;  4JR6 A;  4NXI A;  3TGZ A;  2JAC A;  4OFN A;  1XXU A;  5CRH A;  1EOH A;  4J2F A;  5DAK A;  5CNW A;  3APO A;  1SL0 B;  1VF2 A;  1K0D A;  3G7I A;  3KMN A;  1WIK A;  1F9M A;  1K0M A;  2F51 A;  4I2U A;  5DCH A;  5DQS A;  5E59 A;  1OVN A;  4K7O A;  2JAD A;  4IP6 A;  3SWL A;  1V58 A;  1UN2 A;  2H1B A;  5LCZ A;  4KDX A;  1TI3 A;  1R7H A;  3GYK A;  4GXZ A;  19GS A;  3HZ8 A;  1Z7P A;  1X9W B;  4NAX A;  1O85 A;  1PN9 A;  1B4Q A;  2V32 A;  1H4O A;  4MF7 A;  3U5R E;  1T3B A;  4MJA A;  2LJK A;  4HQZ A;  2FHE A;  1PKZ A;  2NVL A;  3Q74 A;  3CMI A;  2WGR A;  4BWS A;  2C80 A;  1EGO A;  3IDV A;  1PL1 A;  1U3I A;  1T4Y A;  2DBC A;  4MP4 A;  1G0T A;  4TVE A;  3G7J A;  3KH9 A;  4OCF A;  5HR2 A;  1V40 A;  2OJL A;  4RUV A;  3HHV A;  3GHA A;  1A0F A;  1TK5 B;  1VF3 A;  3BCK A;  2PMT A;  1OE8 A;  2IFQ A;  2LKU A;  4ZL9 A;  1Z7R A;  3DML A;  2QKE A;  3Q6O A;  4OMV A;  2IL3 A;  2WJU A;  2L4Q A;  3MSZ A;  3CBU A;  3TDG A;  2H19 A;  5ECK B;  2LV3 A;  5IIZ A;  2X8C A;  4ECI A;  6GSV A;  1VGL A;  1A8Y A;  5F0G A;  2H74 A;  2YN1 A;  4MA9 A;  2P5R A;  1TRS A;  2GSQ A;  2NTO A;  4OFT A;  1TOF A;  4PQI A;  1J9B A;  2JZR A;  3D22 A;  4WR4 A;  3KH7 A;  5E4W A;  3ERW A;  7GSS A;  4LL4 B;  5IM9 A;  2WUL A;  1WMJ A;  2YAN A;  3EUR A;  2IPA A;  4HQS A;  4DSQ A;  5IMV A;  4WF4 A;  2JZS A;  4OCE A;  1TK0 B;  4TXO A;  4ILF A;  4L0W A;  4E8H A;  4V1A p;  2GZY A;  3GTU B;  2VLT A;  1M2A A;  2IMF A;  4BVY A;  1YDK A;  2VIM A;  3A3T A;  3UIW A;  2LNT A;  2D2Z A;  1JZD A;  3CRT A;  5A4U A;  1GUL A;  4OWY A;  4ML1 A;  1RW1 A;  2E7P A;  3A5W A;  3IBH A;  4ZXG A;  3FZ5 A;  2L4C A;  3TKS C;  3GL5 A;  5D9V A;  2LTK A;  4GQC A;  2GZZ A;  3KJY A;  4NPB A;  4JZQ A;  1FO5 A;  3ZL5 A;  1PA3 A;  3P8W A;  1XW5 A;  5IO0 A;  1T00 A;  2TRC P;  2H66 A;  3GMF A;  5INY A;  1LBK A;  1YJ6 A;  3GN3 A;  4KDU A;  2YWN A;  3H8Q A;  4GRF A;  2MBT A;  4IGJ A;  4O92 A;  3O3T A;  2EC4 A;  3I69 A;  4WBR D;  4K7I A;  5EPF A;  2H1G A;  2GDR A;  1XFL A;  2VCZ A;  4I5Q A;  2X64 A;  1VF1 A;  2B1K A;  4IHU A;  3GKN A;  2F8A A;  2FWE A;  1YF0 A;  1S3C A;  2GLR A;  5IMD A;  2H6Z A;  1YF1 A;  12GS A;  2DMM A;  2AYT A;  2HSY A;  4TR0 A;  2YJ7 A;  8GSS A;  1WJK A;  1GSE A;  2X99 A;  3DEX A;  4XS4 B;  2JSZ A;  3KCM A;  3LEF A;  5IOW A;  4BPY A;  3L9U A;  2HZE B;  1O8W A;  5ID2 A;  2YWI A;  1E2Y A;  3RBT A;  4MZB A;  3GH9 A;  2L6D A;  4MLY A;  3LOR A;  1RK4 A;  4NMU A;  2MZC A;  1XW9 A;  4ECJ A;  4BA7 A;  4HS1 A;  2OBK A;  5FT3 A;  4IQ1 A;  2L5L A;  3GX8 A;  2I1U A;  3KZQ A;  2HZF A;  1BX9 A;  2N5F A;  3G7Y A;  2YZU A;  3F4S A;  1A0R P;  2BTO T;  2ALB A;  4G2E A;  3IAM 2;  2GSR A;  2I9H A;  4GST A;  4V2N A;  2C3Q A;  3GH6 A;  1M7T A;  2ON5 A;  3FEU A;  2CVK A;  2H1D A;  4MMM A;  5G30 A;  4RI6 A;  1YEP A;  4MCU A;  1O7U A;  3VPQ A;  1TI1 A;  1JZR A;  3WGE A;  1WOU A;  3GTU A;  3KTB A;  4V2L A;  2B5E A;  1THO A;  1XWB A;  9GSS A;  2LQQ A;  1EWX A;  4YQV A;  2KHP A;  5GAN D;  5G1L A;  2B7K A;  4EDY A;  3US3 A;  1FVJ A;  3DRN A;  4J57 E;  1ON4 A;  4WXT A;  1K3O A;  3F8U A;  3VUR A;  2VL3 A;  2DSA A;  4X1U A;  1ZCP A;  2MMZ A;  1S3D A;  4IEL A;  4ZB6 A;  4IVF A;  3QMX A;  4KA0 A;  2WS2 A;  1K0A A;  3QFB C;  1B4P A;  2WCI A;  5D9W A;  3IA1 A;  2J23 A;  2RLI A;  4ZBA A;  2RM5 A;  3GKX A;  2OE1 A;  3QAV A;  3HXS A;  2ES7 A;  4TW5 A;  3IR4 A;  1DUG A;  2GZP A;  2VD1 A;  1B48 A;  3LFL A;  3CSJ A;  3LGC A;  1SU9 A;  2V41 A;  2JZT A;  1SEN A;  4K0N A;  3TJK A;  4DEJ A;  4WR5 A;  3IRA A;  4ZBB A;  4HU7 A;  5B7C A;  4Q5F A;  3M8N A;  3VPT A;  4POL A;  2E2G A;  3IK9 A;  2VCW A;  2YP6 A;  3GFK A;  1EEM A;  2XBQ A;  1WRY A;  2HE3 A;  4XS4 A;  2HFD A;  5G31 A;  4ZB9 A;  2HZE A;  1UC7 A;  4HDE A;  3VI5 A;  2XC2 A;  1XWC A;  2M46 A;  2JU5 A;  5HFK A;  3ZTL A;  5ECQ B;  3A2X A;  1Z6N A;  4MH3 A;  3W8S A;  1U87 A;  2C8U A;  2GSS A;  1X9M B;  2IN3 A;  1XIY A;  4XCS A;  2L57 A;  5IOX A;  1TRW A;  3IHQ A;  1GSS A;  10GS A;  3QCP A;  3WYW A;  4PNG A;  2KP2 A;  4PQ1 A;  2LNS A;  6GST A;  4NV2 A;  3NZN A;  2H71 A;  2FA8 A;  4F0C A;  4AJ8 A;  2DIY A;  4IBP A;  1WPI A;  2CAQ A;  2H72 A;  4OFM A;  4HJM A;  1SKW B;  5DVB A;  2FWG A;  1K0N A;  1O81 A;  1AW9 A;  1F37 A;  1NHO A;  2LS5 A;  2VL9 A;  1ERV A;  3FR3 A;  1PSQ A;  1S3A A;  3AY8 A;  5C00 A;  2CX4 A;  1DE2 A;  4EXJ A;  4XIH A;  2VL2 A;  1ST9 A;  2MYG A;  4KE3 A;  4POM A;  4Q5N A;  2PWJ A;  5ECH B;  5HR3 A;  2VCX A;  3ISO A;  5JWQ B;  2IMI A;  3EU3 A;  2B1L A;  1JLV A;  1XWG A;  2BJX A;  4LA1 A;  3EWL A;  4KND A;  3QR6 A;  5D96 A;  1OE7 A;  2DIZ A;  2R5G A;  2RUF A;  2YCD A;  3UAP A;  4RQR A;  2L6C A;  3F4R A;  4DSS B;  2V6K A;  5J3R A;  4PUR A;  2LQO A;  1U88 A;  3FHK A;  4IQA A;  1OYJ A;  2WDU A;  2JSY A;  3Q19 A;  4OD7 A;  2EIO A;  3N9J A;  3U6V A;  5D73 A;  1A24 A;  3F4T A;  2R2J A;  3PR8 A;  5ELA A;  2GTU A;  3D4T A;  1TJD A;  2AUV A;  1ZYQ B;  2C1Y A;  5KN3 A;  1GSD A;  4Z7X A;  4FH8 A;  4AF2 A;  2FLS A;  3QFA C;  1W4V A;  1UVZ A;  4HZ2 A;  3ZIJ A;  2WZ9 A;  2FWH A;  3M9K A;  4ZL7 A;  3ZIT A;  1N2A A;  1E6B A;  3E0U A;  4MJE A;  1PQN A;  1ZYE A;  1XBS A;  1MDJ A;  14GS A;  6GSU A;  3HZ4 A;  5CAX A;  4PXO A;  3PIN A;  5CRD A;  1GTI A;  1T4Z A;  2M72 A;  3C1R A;  2LUS A;  4YQM A;  2F3M A;  3VLN A;  3DGQ A;  5F07 A;  4F03 A;  1PX6 A;  4NHZ A;  17GS A;  4XRD A;  4TN8 A;  1JZO A;  3E9J B;  4XS1 A;  3H4K A;  2TRX A;  3FZ9 A;  2C3T A;  1K3Y A;  2V2G A;  1KNG A;  3HJP A;  1SL1 B;  5FHI A;  1GTA A;  3GIX A;  3LG6 A;  5D8I A;  1GUK A;  1LJR A;  3GUS A;  3WT1 A;  3D21 A;  2GGT A;  5A5K A;  2H76 A;  2V6O A;  2CQ9 A;  4KGI A;  3D0Z A;  1A2L A;  4MDC A;  3J7Y k;  5CP1 A;  4F82 A;  4ZL8 A;  4TR4 A;  1BYE A;  5GSS A;  5EL8 A;  2GT6 A;  3CSI A;  1G6W A;  1C72 A;  3ZIV A;  1N8J A;  4K0G A;  3FY7 A;  1JFU A;  1GSY A;  1ZMA A;  3MWH A;  1SYR A;  1G7O A;  3GX0 A;  4JU5 A;  3TKS E;  3KXO A;  2C4J A;  3VWX A;  2VCT A;  4KCE A;  4KUN A;  3TJF A;  2VM1 A;  3KM6 A;  5ABR A;  3GUR A;  3RHC A;  4IKH A;  2AV4 A;  2M80 A;  3EE2 A;  4HZ4 A;  1R5A A;  3CXG A;  4XHM A;  1JLW A;  1QUW A;  4MPG A;  4ZB8 A;  5B8B A;  4MPF A;  4GQF A;  4DSS A;  3IE3 A;  1RQM A;  5IPH A;  1HQO A;  1AQX A;  3F3R A;  4ULX A;  2H1A A;  3V1W A;  2WFC A;  1V9W A;  1AQV A;  1K3L A;  3UOM A;  3N5O A;  4ML6 A;  3UJ1 A;  1TU7 A;  22GS A;  1F6M C;  2DML A;  3UL3 A;  1Y6E A;  4OO4 A;  2J9H A;  1AAZ A;  3G9B A;  5H5R A;  4HUA A;  5KN1 A;  5G2Z A;  2FCH A;  1MD3 A;  4IJI A;  2G2Q A;  4D73 B;  2HT9 A;  2FD3 A;  5IMC A;  2VLV A;  3LSZ A;  2FWF A;  1OKD A;  1PKW A;  5F06 A;  5L71 A;  4I97 A;  2O85 A;  2K8V A;  4IS0 A;  2YPM A;  2RII A;  5AGY A;  2IIY A;  3CTF A;  4P3Y B;  1VRS D;  4EC0 A;  4EDZ A;  3FR9 A;  2YOI A;  1T7P B;  3Q18 A;  2DLX A;  2KLX A;  3TRQ A;  4YQU A;  3TJJ A;  4EE0 A;  5IQY A;  4POK A;  3OR5 A;  2H6X A;  4N0V A;  3DKS A;  1J0F A;  3VWV A;  4IW9 A;  2HYX A;  4X0X A;  1U6T A;  4FO5 A;  1MDK A;  3EMP A;  20GS A;  2K6V A;  3UAR A;  3FYG A;  4OO5 A;  2NPB A;  1I5G A;  3I9V 2;  1XW6 A;  4G9H A;  3HCZ A;  4MK3 A; 
#chains in the Genus database with same CATH topology
 5AN1 A;  3P2A A;  5B8A A;  1B9X C;  4MZW A;  5AIX A;  1PD2 1;  1VF4 A;  3EYT A;  4J56 E;  5KOW A;  4TXV A;  1FVK A;  3WGX A;  2ZCT A;  1TW9 A;  3TJB A;  3HJO A;  4IN0 A;  1ERW A;  3ZMK A;  3QDN A;  3ERF A;  5B6N A;  3EIN A;  2HRN A;  3ED3 A;  1B8X A;  3GV1 A;  4TR1 B;  4O7H A;  4GWR A;  2O87 A;  5GST A;  5J9C A;  3F6D A;  2HNL A;  1PL2 A;  1USB A;  2HRF A;  1EGR A;  1XPV A;  2A2P A;  1O73 A;  4G10 A;  5IPG A;  4LMW A;  5IMZ A;  5D93 A;  1GSQ A;  5LD0 A;  1O8X A;  4GTU A;  1TK8 B;  1GLQ A;  1FAA A;  2XBI A;  5B6M A;  5JWO B;  3VWU A;  2FY6 A;  11GS A;  2VCV A;  3W8J A;  1ZL9 A;  2AB6 A;  3KEB A;  1WE0 A;  3MNG A;  2OAC A;  1FOV A;  3K8N A;  3FR6 A;  1Z5Y E;  2GVP A;  3IPZ A;  4WBJ A;  5JWR B;  2OA7 A;  2VOC A;  3DWV A;  6GSY A;  1ERU A;  1KEB A;  3IOS A;  4PGT A;  3RAZ A;  5HR1 A;  3C1S A;  2P5Q A;  2DJ3 A;  2K9F A;  3EC3 A;  4MNN A;  4AGS A;  1QGV A;  4PX1 A;  1WP0 A;  2YJH A;  1NHY A;  1TKD B;  2A4H A;  4D73 A;  2DJK A;  2H73 A;  1XCC A;  1YKA A;  3C7M A;  3UBK A;  3O76 A;  2FGX A;  6GSW A;  3P90 A;  1XWA A;  1ACV A;  2KP1 A;  3ERG A;  1TU8 A;  5H5Q A;  4EIP A;  3HVV A;  1KBN A;  4BVX B;  1OC3 A;  4N11 A;  2IWT A;  1Z9H A;  2PGT A;  1QQ2 A;  2GS3 A;  4MJC A;  1ZYP A;  2AJQ B;  3L9V A;  2YNX A;  4LMV A;  4F2I A;  2YWO A;  3ZFL A;  3MAK A;  1MDI A;  3ZVJ A;  2B7J A;  3RPP A;  3IXR A;  4KDY A;  2EIR A;  1HNB A;  1A2M A;  1SD9 A;  1YQ1 A;  3EPT A;  2L5O A;  4K1F A;  2I81 A;  2IJY A;  1THX A;  2VO4 A;  1BED A;  4G0K A;  3KP8 A;  1FW1 A;  2C0E A;  5FWG A;  4YAP A;  5F8B A;  1PMT A;  4MJB A;  1GTU A;  1KTE A;  2O89 A;  3RPN A;  2Z9S A;  3D5J A;  2RUE A;  1NW2 A;  1SJ6 A;  3TJG A;  1ABA A;  4PUA A;  2HSM A;  3M1G A;  2F8F A;  2I3Y A;  3DVW A;  4EF0 A;  1Q98 A;  2CZ3 A;  1YEX A;  1GNW A;  3WGD A;  4LL1 B;  4TR1 A;  4JE1 A;  1I9D A;  4GF0 A;  3QAW A;  3GNJ A;  1X0R A;  5G1K A;  2H6Y A;  2DJ0 A;  5DJL A;  4ID0 A;  2H30 A;  3TKP A;  3M3M A;  1BG5 A;  3IC4 A;  2MBS A;  3L4N A;  3RHB A;  1GUM A;  1TDI A;  4DSR A;  1SJZ A;  1GSU A;  1W89 A;  1GSF A;  5ECP B;  4HOJ A;  4K9Z A;  2MMA A;  4WEY A;  3D6I A;  2PU9 C;  4MZC A;  3EVI A;  2R6K A;  3H1N A;  4N10 A;  2H0I A;  2H01 A;  4GSS A;  2CVD A;  5IMA A;  5KOX A;  5DCG A;  2F9S A;  1T8E B;  2A2S A;  1BJX A;  2A2R A;  1Z6M A;  1AIU A;  2H70 A;  1X5D A;  4TR3 A;  2AHE A;  2XPD A;  4XRA A;  2H0H A;  3IAS 2;  1AUC A;  4EUY A;  2LRT A;  3HJM A;  1EP7 A;  4L0U A;  3ZML A;  2LJA A;  3C73 A;  2NBS A;  3WT2 A;  1TRU A;  1XVW A;  2HXK A;  1EEJ A;  3LJR A;  2X8H A;  2NDO A;  3EMX A;  4GSN A;  1M9A A;  4WF5 A;  5CYY A;  3SBC A;  2DC5 A;  1EP8 A;  3F0I A;  2C0F A;  3DD3 A;  3ME8 A;  2E0Q A;  1XOB A;  3WD6 A;  1OC8 A;  4BVX A;  18GS A;  2WB9 A;  4A5P A;  4NHW A;  5GZZ B;  2N5A A;  2CV4 A;  3H79 A;  3GRX A;  2AAW A;  4H86 A;  3QAG A;  2GQK A;  1FB6 A;  2VUP A;  1XVQ A;  4ECC A;  3DYR A;  2DJ1 A;  2R37 A;  3GL3 A;  1GRX A;  5D9T A;  4YAV A;  1B9Y C;  2GQL A;  4WKW A;  2VL2 C;  4BL7 B;  5HFG A;  2YV7 A;  5ECR B;  2O8V B;  2WRT A;  2G0F A;  1NSW A;  1GTB A;  5HR0 A;  3HYP A;  2C0D A;  1M9B A;  2K8S A;  2LRC A;  4QQ7 A;  4EVM A;  5DBQ A;  1GLP A;  3FMW A;  1ZOF A;  2R3X A;  3CRU A;  4KX4 A;  3TKS A;  5KEJ A;  4CDO A;  5ECM B;  5ELG A;  1HYU A;  3APS A;  4RI7 A;  2CVB A;  3KD0 A;  1F3A A;  3GSS A;  5G5E A;  4TOP A;  2P31 A;  3TKR A;  3HVS A;  1URM A;  2IMK A;  2MMN A;  3UBL A;  4O5R A;  5ID2 B;  3KGK A;  4L5L A;  1IYI A;  1OKT A;  3M0F A;  4JRR A;  1PRX A;  4BWQ A;  3NOF A;  3HKR A;  3ZVJ D;  1OC9 B;  2HSH A;  4K8M A;  1K0B A;  1QXH A;  2OKA A;  3LW9 A;  4ZIL A;  4L5O A;  4G19 A;  1SK2 A;  2R0P A;  2B5Y A;  3FZ4 A;  1CQG A;  3UVT A;  2C3N A;  2PUK C;  4PTS A;  3LWA A;  5HFI A;  1M0U A;  4MAB A;  3I6A A;  3HDC A;  5A4V A;  5JCG A;  4CHS A;  2VLU A;  4POB A;  2OE3 A;  5AIV A;  2R0C A;  1PN0 A;  1EV9 A;  2QC7 A;  2PBJ A;  1Z3E A;  2QSI A;  4AJ6 A;  3VFI A;  2PER A;  3TB2 A;  1R5P A;  2CAI A;  1X5E A;  2P0G A;  3CYN A;  3ZRE A;  5ENU A;  1TTZ A;  4MF5 A;  1M2D A;  1V2A A;  2LRN A;  4X43 A;  1BQ7 A;  4GLT A;  1FG4 A;  2XPE A;  1A23 A;  4FYU A;  1HD2 A;  5AIS A;  3LXT A;  2FUG 2;  3L0H A;  3BBY A;  4F9Z A;  1ZZY A;  4NV5 A;  4Z2T A;  2V1M A;  5J4U A;  1YY7 A;  4N30 A;  2HI7 A;  4Q5R A;  4EL1 A;  2GT5 A;  1ML6 A;  2DKI A;  5IMF A;  1HNA A;  2PN8 A;  2R4V A;  1PX7 A;  3BJ5 A;  3PGT A;  1HNC A;  1EV4 A;  3BOA A;  2FA4 A;  1SYX A;  1GWC A;  2B3S A;  3BCI A;  4I6X A;  3IV4 A;  5EVO A;  5JCU A;  3ZYW A;  5JCW A;  1BAY A;  2CZ2 A;  5CRE A;  4O5U A;  2H8L A;  4AJ7 A;  2H75 A;  4BL7 A;  2LJR A;  3S9F A;  2HRA A;  5C04 A;  4ZBD A;  4LLR A;  3KP9 A;  2H0G A;  1K0C A;  5KN0 A;  1GH2 A;  3ZZX A;  5ECO B;  3VK9 A;  5J41 A;  4K7N A;  4O32 A;  1DBY A;  1SKS B;  5ECI B;  3GKM A;  3RDW A;  1ZYN A;  2B5X A;  3D4M A;  2KUC A;  3H93 A;  4FQU A;  3NIV A;  1F3B A;  1R26 A;  4KH7 A;  3LQ7 A;  1TP9 A;  5CRW A;  1MD4 A;  3UMA A;  3JCM L;  5LNK e;  13GS A;  4ECB A;  3L9S A;  4USS A;  1O6J A;  1ERT A;  4JR4 A;  2TIR A;  1SD8 A;  4Q5Q A;  1UA5 A;  2REM A;  3A2W A;  1V57 A;  3FZA A;  3F63 A;  2JL4 A;  5DJM A;  4HJ2 A;  3MDK A;  1OC9 A;  2VD0 A;  5D9X A;  3A2V A;  1FB0 A;  5GAP D;  2KOK A;  2HLS A;  4FYC A;  2OBI A;  3VI7 A;  5KN2 A;  2LEG A;  3TUE A;  1YZX A;  3J7Y b;  2YZH A;  1X5C A;  4KB3 A;  1X9S B;  16GS A;  1WWJ A;  2X8G A;  3APQ A;  3E3E A;  1MTC A;  3DXB A;  1DSB A;  1SJI A;  1XWK A;  2PVQ A;  4PUF C;  1XG8 A;  4IP1 A;  1K0O A;  5DAL B;  2DJJ A;  3I43 A;  3O6T A;  6GSX A;  2A4V A;  4KAE A;  1M99 A;  4F0B A;  1A2J A;  2ON7 A;  1AC1 A;  3IK7 A;  4QL7 A;  2PVO C;  1A8L A;  3PH9 A;  1SK1 A;  1H75 A;  3LYK A;  5HQP A;  1GNE A;  3L78 A;  2C0G A;  2VCQ A;  3QD9 A;  4PNF A;  2LST A;  4HI7 A;  2FNO A;  2QGV A;  1MEK A;  3CSH A;  5BMU A;  4KSM A;  5EY6 A;  4CY6 A;  1SK0 A;  1V98 A;  1SL2 B;  2K18 A;  6GSS A;  3A5I A;  4YKG A;  5J5N A;  1U3A A;  4KCA A;  2IMD A;  3TRP A;  4I2T A;  2B6M A;  4MF6 A;  3TOU A;  1M2B A;  2YWM A;  4WET A;  5A4W A;  1IYH A;  4RQX A;  1EOG A;  2DKH A;  1GP1 A;  3F9U A;  2I4A A;  1GL8 A;  3HA9 A;  2DJ2 A;  5DAK B;  2BMX A;  3M9J A;  3GST A;  1ZGN A;  5H5S A;  3FK8 A;  4TRX A;  4HEA 2;  4MH2 A;  1J08 A;  3QPM A;  4JBB A;  3ZFB A;  2MMO A;  2O7K A;  3DIE A;  3FW2 A;  3C8E A;  4ZIJ A;  5ECN B;  2CT6 A;  3GA4 A;  3LYP A;  4X4J A;  2GQM A;  2XHF A;  3W6G A;  3ZRD A;  2RM6 A;  3QOU A;  4I8B A;  3KTL A;  3P7X A;  4K2D A;  1XZO A;  4YH2 A;  4E8E A;  1QFN A;  5ECL B;  4JED A;  5G5F A;  4K2X A;  3UVH A;  4ACS A;  4DVC A;  1JZW A;  1QMV A;  5CO3 A;  1SKR B;  1EZK A;  2E2M A;  3KIJ A;  3UEM A;  5CRG A;  4QL9 A;  3HD5 A;  4CY8 A;  2OAD A;  1QK8 A;  1T1V A;  2EIQ A;  3EU4 A;  5ECS A;  3BD2 A;  4K5S A;  4IJ3 A;  2N5B A;  3LXZ A;  2IFQ B;  1ILO A;  4GCI A;  4XS6 A;  1PGT A;  3KMO A;  4L8E A;  2IME A;  1CQH A;  3HVX A;  1XOA A;  4PQH A;  2CX3 A;  1R4W A;  4V1A g;  3ME7 A;  5COH A;  1TRV A;  1NM3 A;  3MIX A;  4EO3 A;  3DVX A;  4N0Z A;  1AQW A;  4KW6 A;  4XTS A;  3R2Q A;  3TOT A;  5J9B A;  3VWW A;  1GUH A;  1YKC A;  3TKQ A;  1TXX A;  4NWY A;  4KSO A;  4EKZ A;  3CTG A;  5IO2 A;  3ZLP A;  2L59 A;  4CW9 A;  3FKF A;  5F05 A;  1G6Y A;  4G0L A;  2VAF A;  3FRC A;  2ZNM A;  5DAL A;  1FHE A;  4ISD A;  2OE0 A;  5DDL A;  3HY2 A;  3IC8 A;  3F6F A;  2YV9 A;  1F2E A;  1Y25 A;  4HU9 A;  1LU4 A;  1JHB A;  5DQY A;  2GST A;  1OAZ A;  4TKY A;  2PPT A;  3TRX A;  1AXD A;  3C71 A;  4TXO B;  1DE1 A;  4FIW A;  2ZUP A;  4FYB A;  3TCO A;  4V2M A;  1G7E A;  2VM2 A;  3CQF A;  3F3Q A;  2QA1 A;  4K6X A;  4BVY B;  1Q4J A;  2CA8 A;  3GKK A;  4JR6 A;  4NXI A;  3TGZ A;  2JAC A;  4OFN A;  1XXU A;  5CRH A;  1EOH A;  4J2F A;  5DAK A;  5CNW A;  3APO A;  1SL0 B;  1VF2 A;  1K0D A;  3G7I A;  3KMN A;  1WIK A;  1F9M A;  1K0M A;  2F51 A;  4I2U A;  5DCH A;  5DQS A;  5E59 A;  1OVN A;  4K7O A;  2JAD A;  4IP6 A;  3HVN A;  3SWL A;  1V58 A;  1UN2 A;  2H1B A;  5LCZ A;  4KDX A;  1TI3 A;  1R7H A;  3GYK A;  4GXZ A;  19GS A;  3HZ8 A;  1Z7P A;  1X9W B;  4NAX A;  1O85 A;  1PN9 A;  1B4Q A;  1FOH A;  2V32 A;  1H4O A;  4MF7 A;  3U5R E;  1T3B A;  4MJA A;  2LJK A;  4HQZ A;  4O5Q A;  2FHE A;  1PKZ A;  2NVL A;  3Q74 A;  3CMI A;  2WGR A;  4BWS A;  2C80 A;  1EGO A;  3IDV A;  1PL1 A;  1U3I A;  1T4Y A;  2DBC A;  4MP4 A;  1G0T A;  4TVE A;  3G7J A;  3KH9 A;  4OCF A;  5HR2 A;  3R3E A;  1V40 A;  2OJL A;  4RUV A;  3HHV A;  3GHA A;  1A0F A;  1TK5 B;  1VF3 A;  3BCK A;  2PMT A;  1OE8 A;  2IFQ A;  2LKU A;  4ZL9 A;  1Z7R A;  3DML A;  2QKE A;  3Q6O A;  4OMV A;  2IL3 A;  2WJU A;  2L4Q A;  3MSZ A;  3CBU A;  3TDG A;  2H19 A;  5ECK B;  2LV3 A;  5IIZ A;  2X8C A;  4ECI A;  6GSV A;  1VGL A;  1A8Y A;  5F0G A;  2H74 A;  2YN1 A;  4MA9 A;  2P5R A;  1TRS A;  2GSQ A;  2NTO A;  4OFT A;  1TOF A;  2UZ8 A;  4PQI A;  1J9B A;  2JZR A;  3D22 A;  4WR4 A;  3KH7 A;  4HSC X;  4Z2R A;  5E4W A;  3ERW A;  7GSS A;  4LL4 B;  5IM9 A;  2WUL A;  1WMJ A;  2YAN A;  3EUR A;  2IPA A;  4HQS A;  4DSQ A;  5IMV A;  4WF4 A;  2JZS A;  4OCE A;  1TK0 B;  4TXO A;  4ILF A;  4L0W A;  4E8H A;  4V1A p;  2GZY A;  3GTU B;  2VLT A;  4BIK A;  1M2A A;  2IMF A;  4BVY A;  1YDK A;  2VIM A;  3A3T A;  2X49 A;  3UIW A;  2LNT A;  2D2Z A;  1PFO A;  1JZD A;  3CRT A;  5A4U A;  1GUL A;  4OWY A;  4ML1 A;  1RW1 A;  2E7P A;  3A5W A;  3IBH A;  2X4A A;  4ZXG A;  3FZ5 A;  2L4C A;  3TKS C;  3GL5 A;  5D9V A;  2LTK A;  4GQC A;  2GZZ A;  3KJY A;  4NPB A;  4JZQ A;  1FO5 A;  3ZL5 A;  1PA3 A;  3P8W A;  1XW5 A;  5IO0 A;  1T00 A;  2TRC P;  2H66 A;  3GMF A;  5INY A;  1LBK A;  1YJ6 A;  3GN3 A;  4KDU A;  2YWN A;  3H8Q A;  4GRF A;  2MBT A;  4IGJ A;  4O92 A;  3O3T A;  2EC4 A;  3I69 A;  4WBR D;  4K7I A;  5EPF A;  2H1G A;  2GDR A;  1XFL A;  2VCZ A;  4I5Q A;  2X64 A;  1VF1 A;  2B1K A;  4IHU A;  3GKN A;  2F8A A;  2FWE A;  1YF0 A;  1S3C A;  2GLR A;  5IMD A;  2H6Z A;  1YF1 A;  12GS A;  2DMM A;  2AYT A;  2HSY A;  4TR0 A;  2YJ7 A;  8GSS A;  1WJK A;  1GSE A;  2X99 A;  3DEX A;  4XS4 B;  2JSZ A;  3KCM A;  3LEF A;  5IOW A;  4BPY A;  3L9U A;  2HZE B;  1O8W A;  5ID2 A;  2YWI A;  5BRT A;  1E2Y A;  3RBT A;  4MZB A;  3GH9 A;  2L6D A;  4MLY A;  3LOR A;  1RK4 A;  4NMU A;  4K5R A;  2MZC A;  1XW9 A;  4ECJ A;  4BA7 A;  4HS1 A;  2OBK A;  5FT3 A;  4IQ1 A;  2L5L A;  3GX8 A;  2I1U A;  3KZQ A;  2HZF A;  1BX9 A;  2N5F A;  3G7Y A;  2YZU A;  2HRK A;  1A0R P;  3F4S A;  2BTO T;  2ALB A;  4G2E A;  3IAM 2;  2GSR A;  2I9H A;  4GST A;  4V2N A;  2C3Q A;  3GH6 A;  1M7T A;  2ON5 A;  3FEU A;  2CVK A;  2H1D A;  4MMM A;  5G30 A;  4RI6 A;  1YEP A;  4MCU A;  1O7U A;  3VPQ A;  1TI1 A;  1JZR A;  3WGE A;  1WOU A;  3GTU A;  3KTB A;  4V2L A;  2B5E A;  1THO A;  1XWB A;  9GSS A;  2LQQ A;  1EWX A;  4YQV A;  2KHP A;  5GAN D;  5G1L A;  2B7K A;  4EDY A;  3US3 A;  1FVJ A;  3DRN A;  4J57 E;  1ON4 A;  4WXT A;  1K3O A;  3F8U A;  3VUR A;  2VL3 A;  2DSA A;  4X1U A;  1ZCP A;  2MMZ A;  1S3D A;  4IEL A;  4ZB6 A;  4IVF A;  3QMX A;  4KA0 A;  2WS2 A;  1K0A A;  3QFB C;  1B4P A;  2WCI A;  5D9W A;  3IA1 A;  2J23 A;  2RLI A;  3PPU A;  4ZBA A;  2RM5 A;  3GKX A;  2OE1 A;  3QAV A;  3HXS A;  2ES7 A;  4TW5 A;  3IR4 A;  1DUG A;  2GZP A;  2VD1 A;  1B48 A;  3LFL A;  3CSJ A;  3LGC A;  1SU9 A;  2V41 A;  2JZT A;  1SEN A;  4K0N A;  3TJK A;  4DEJ A;  4WR5 A;  3IRA A;  4ZBB A;  4HU7 A;  1M3J A;  5B7C A;  4Q5F A;  3M8N A;  3VPT A;  4POL A;  2E2G A;  3IK9 A;  2VCW A;  2YP6 A;  3GFK A;  1EEM A;  2XBQ A;  1WRY A;  2HE3 A;  4XS4 A;  2HFD A;  5G31 A;  4ZB9 A;  2HZE A;  1UC7 A;  4HDE A;  3VI5 A;  2XC2 A;  1XWC A;  2M46 A;  2JU5 A;  5HFK A;  3ZTL A;  5ECQ B;  3A2X A;  1Z6N A;  4MH3 A;  3W8S A;  1U87 A;  2C8U A;  2GSS A;  1X9M B;  2IN3 A;  1XIY A;  4XCS A;  2L57 A;  5IOX A;  1TRW A;  3IHQ A;  1GSS A;  10GS A;  3QCP A;  3WYW A;  4PNG A;  2KP2 A;  4PQ1 A;  2LNS A;  6GST A;  4NV2 A;  3NZN A;  1S3R A;  2H71 A;  2FA8 A;  4F0C A;  4AJ8 A;  2DIY A;  4IBP A;  1WPI A;  2CAQ A;  2H72 A;  4OFM A;  4HJM A;  1SKW B;  5DVB A;  2FWG A;  1K0N A;  1O81 A;  1AW9 A;  1F37 A;  1NHO A;  2LS5 A;  2VL9 A;  1ERV A;  3FR3 A;  1PSQ A;  1S3A A;  3AY8 A;  5C00 A;  2CX4 A;  1DE2 A;  4EXJ A;  4XIH A;  2VL2 A;  1ST9 A;  2MYG A;  4KE3 A;  4POM A;  4Q5N A;  2PWJ A;  5ECH B;  5HR3 A;  2VCX A;  3ISO A;  5JWQ B;  2IMI A;  3EU3 A;  2B1L A;  1JLV A;  1XWG A;  2BJX A;  4LA1 A;  3EWL A;  4KND A;  3QR6 A;  5D96 A;  1OE7 A;  2DIZ A;  2R5G A;  2RUF A;  2YCD A;  3UAP A;  4RQR A;  2L6C A;  3F4R A;  4DSS B;  2V6K A;  5J3R A;  4PUR A;  2LQO A;  1U88 A;  3FHK A;  4IQA A;  1OYJ A;  2WDU A;  2JSY A;  3Q19 A;  4OD7 A;  2EIO A;  3N9J A;  4Z2U A;  3U6V A;  5D73 A;  1A24 A;  3F4T A;  2R2J A;  3PR8 A;  5ELA A;  2GTU A;  3D4T A;  1TJD A;  2AUV A;  1ZYQ B;  2C1Y A;  5KN3 A;  1GSD A;  4Z7X A;  4FH8 A;  4AF2 A;  2QA2 A;  2FLS A;  3QFA C;  1W4V A;  1UVZ A;  4HZ2 A;  3ZIJ A;  2WZ9 A;  2FWH A;  3M9K A;  4ZL7 A;  3ZIT A;  1N2A A;  1E6B A;  3E0U A;  4MJE A;  1PQN A;  1ZYE A;  1XBS A;  1MDJ A;  14GS A;  6GSU A;  3HZ4 A;  3IHG A;  5CAX A;  4PXO A;  3PIN A;  5CRD A;  1GTI A;  1T4Z A;  2M72 A;  3C1R A;  2LUS A;  4YQM A;  2F3M A;  3VLN A;  3DGQ A;  5F07 A;  4F03 A;  1PX6 A;  4NHZ A;  17GS A;  4XRD A;  4TN8 A;  1JZO A;  3MYD A;  3E9J B;  4XS1 A;  3H4K A;  2TRX A;  3FZ9 A;  2C3T A;  1K3Y A;  2V2G A;  1KNG A;  3HJP A;  1SL1 B;  1M3I A;  5FHI A;  1GTA A;  3GIX A;  3LG6 A;  5D8I A;  1GUK A;  1LJR A;  3GUS A;  4G0I A;  3WT1 A;  3D21 A;  2GGT A;  5A5K A;  2H76 A;  2V6O A;  2CQ9 A;  4KGI A;  3D0Z A;  1A2L A;  4MDC A;  3J7Y k;  5CP1 A;  4F82 A;  4ZL8 A;  4TR4 A;  2R0G A;  1BYE A;  5GSS A;  5EL8 A;  2GT6 A;  3CSI A;  1G6W A;  1C72 A;  3ZIV A;  1N8J A;  4K0G A;  3FY7 A;  1JFU A;  1GSY A;  1ZMA A;  3MWH A;  1SYR A;  1G7O A;  3GX0 A;  4JU5 A;  3TKS E;  3KXO A;  2C4J A;  3VWX A;  2VCT A;  4KCE A;  4KUN A;  3TJF A;  2VM1 A;  3KM6 A;  5ABR A;  3GUR A;  3RHC A;  4IKH A;  2AV4 A;  2M80 A;  3EE2 A;  4HZ4 A;  1R5A A;  3CXG A;  4XHM A;  1JLW A;  1QUW A;  4MPG A;  4ZB8 A;  5B8B A;  4MPF A;  4GQF A;  4DSS A;  3IE3 A;  1RQM A;  5IPH A;  1HQO A;  1AQX A;  3F3R A;  4ULX A;  2H1A A;  3V1W A;  2WFC A;  1V9W A;  1AQV A;  1K3L A;  3UOM A;  3N5O A;  4ML6 A;  3UJ1 A;  1TU7 A;  22GS A;  1F6M C;  2DML A;  3UL3 A;  1Y6E A;  4OO4 A;  2J9H A;  1AAZ A;  4EIQ A;  3G9B A;  5H5R A;  4HUA A;  5KN1 A;  5G2Z A;  2FCH A;  1MD3 A;  4IJI A;  2G2Q A;  4D73 B;  2HT9 A;  2FD3 A;  5IMC A;  2VLV A;  3LSZ A;  2FWF A;  1OKD A;  1PKW A;  5F06 A;  5L71 A;  4I97 A;  2O85 A;  4KF9 A;  2K8V A;  4IS0 A;  2YPM A;  2RII A;  5AGY A;  2IIY A;  3CTF A;  4P3Y B;  1VRS D;  4YKF A;  4EC0 A;  4EDZ A;  3FR9 A;  2YOI A;  1T7P B;  3Q18 A;  2DLX A;  2KLX A;  3TRQ A;  4YQU A;  4ICY A;  3TJJ A;  4EE0 A;  5IQY A;  4POK A;  3OR5 A;  2H6X A;  4N0V A;  3DKS A;  1J0F A;  3VWV A;  4IW9 A;  2HYX A;  4X0X A;  1U6T A;  4FO5 A;  1MDK A;  3EMP A;  20GS A;  2K6V A;  3UAR A;  3FYG A;  4OO5 A;  2NPB A;  1I5G A;  3I9V 2;  1XW6 A;  4G9H A;  3HCZ A;  4MK3 A; 
#chains in the Genus database with same CATH homology
 5AN1 A;  3P2A A;  5B8A A;  1B9X C;  4MZW A;  5AIX A;  1PD2 1;  1VF4 A;  3EYT A;  4J56 E;  5KOW A;  4TXV A;  1FVK A;  3WGX A;  2ZCT A;  1TW9 A;  3TJB A;  3HJO A;  4IN0 A;  1ERW A;  3ZMK A;  3QDN A;  3ERF A;  5B6N A;  3EIN A;  2HRN A;  3ED3 A;  1B8X A;  3GV1 A;  4TR1 B;  4O7H A;  4GWR A;  2O87 A;  5GST A;  5J9C A;  3F6D A;  2HNL A;  1PL2 A;  1USB A;  2HRF A;  1EGR A;  1XPV A;  2A2P A;  1O73 A;  4G10 A;  5IPG A;  4LMW A;  5IMZ A;  5D93 A;  1GSQ A;  5LD0 A;  1O8X A;  4GTU A;  1TK8 B;  1GLQ A;  1FAA A;  2XBI A;  5B6M A;  5JWO B;  3VWU A;  2FY6 A;  11GS A;  2VCV A;  3W8J A;  1ZL9 A;  2AB6 A;  3KEB A;  1WE0 A;  3MNG A;  2OAC A;  1FOV A;  3K8N A;  3FR6 A;  1Z5Y E;  2GVP A;  3IPZ A;  4WBJ A;  5JWR B;  2OA7 A;  2VOC A;  3DWV A;  6GSY A;  1ERU A;  1KEB A;  3IOS A;  4PGT A;  3RAZ A;  5HR1 A;  3C1S A;  2P5Q A;  2DJ3 A;  2K9F A;  3EC3 A;  4MNN A;  4AGS A;  1QGV A;  4PX1 A;  1WP0 A;  2YJH A;  1NHY A;  1TKD B;  2A4H A;  4D73 A;  2DJK A;  2H73 A;  1XCC A;  1YKA A;  3C7M A;  3UBK A;  3O76 A;  2FGX A;  6GSW A;  3P90 A;  1XWA A;  1ACV A;  2KP1 A;  3ERG A;  1TU8 A;  5H5Q A;  4EIP A;  3HVV A;  1KBN A;  4BVX B;  1OC3 A;  4N11 A;  2IWT A;  1Z9H A;  2PGT A;  1QQ2 A;  2GS3 A;  4MJC A;  1ZYP A;  2AJQ B;  3L9V A;  2YNX A;  4LMV A;  4F2I A;  2YWO A;  3ZFL A;  3MAK A;  1MDI A;  3ZVJ A;  2B7J A;  3RPP A;  3IXR A;  4KDY A;  2EIR A;  1HNB A;  1A2M A;  1SD9 A;  1YQ1 A;  3EPT A;  2L5O A;  4K1F A;  2I81 A;  2IJY A;  1THX A;  2VO4 A;  1BED A;  4G0K A;  3KP8 A;  1FW1 A;  2C0E A;  5FWG A;  4YAP A;  5F8B A;  1PMT A;  4MJB A;  1GTU A;  1KTE A;  2O89 A;  3RPN A;  2Z9S A;  3D5J A;  2RUE A;  1NW2 A;  1SJ6 A;  3TJG A;  1ABA A;  4PUA A;  2HSM A;  3M1G A;  2F8F A;  2I3Y A;  3DVW A;  4EF0 A;  1Q98 A;  2CZ3 A;  1YEX A;  1GNW A;  3WGD A;  4LL1 B;  4TR1 A;  4JE1 A;  1I9D A;  4GF0 A;  3QAW A;  3GNJ A;  1X0R A;  5G1K A;  2H6Y A;  2DJ0 A;  5DJL A;  4ID0 A;  2H30 A;  3TKP A;  3M3M A;  1BG5 A;  3IC4 A;  2MBS A;  3L4N A;  3RHB A;  1GUM A;  1TDI A;  4DSR A;  1SJZ A;  1GSU A;  1W89 A;  1GSF A;  5ECP B;  4HOJ A;  4K9Z A;  2MMA A;  4WEY A;  3D6I A;  2PU9 C;  4MZC A;  3EVI A;  2R6K A;  3H1N A;  4N10 A;  2H0I A;  2H01 A;  4GSS A;  2CVD A;  5IMA A;  5KOX A;  5DCG A;  2F9S A;  1T8E B;  2A2S A;  1BJX A;  2A2R A;  1Z6M A;  1AIU A;  2H70 A;  1X5D A;  4TR3 A;  2AHE A;  2XPD A;  4XRA A;  2H0H A;  3IAS 2;  1AUC A;  4EUY A;  2LRT A;  3HJM A;  1EP7 A;  4L0U A;  3ZML A;  2LJA A;  3C73 A;  2NBS A;  3WT2 A;  1TRU A;  1XVW A;  2HXK A;  1EEJ A;  3LJR A;  2X8H A;  2NDO A;  3EMX A;  4GSN A;  1M9A A;  4WF5 A;  5CYY A;  3SBC A;  2DC5 A;  1EP8 A;  3F0I A;  2C0F A;  3DD3 A;  3ME8 A;  2E0Q A;  1XOB A;  3WD6 A;  1OC8 A;  4BVX A;  18GS A;  2WB9 A;  4A5P A;  4NHW A;  5GZZ B;  2N5A A;  2CV4 A;  3H79 A;  3GRX A;  2AAW A;  4H86 A;  3QAG A;  2GQK A;  1FB6 A;  2VUP A;  1XVQ A;  4ECC A;  3DYR A;  2DJ1 A;  2R37 A;  3GL3 A;  1GRX A;  5D9T A;  4YAV A;  1B9Y C;  2GQL A;  4WKW A;  2VL2 C;  4BL7 B;  5HFG A;  2YV7 A;  5ECR B;  2O8V B;  2WRT A;  2G0F A;  1NSW A;  1GTB A;  5HR0 A;  3HYP A;  2C0D A;  1M9B A;  2K8S A;  2LRC A;  4QQ7 A;  4EVM A;  5DBQ A;  1GLP A;  3FMW A;  1ZOF A;  2R3X A;  3CRU A;  4KX4 A;  3TKS A;  5KEJ A;  4CDO A;  5ECM B;  5ELG A;  1HYU A;  3APS A;  4RI7 A;  2CVB A;  3KD0 A;  1F3A A;  3GSS A;  5G5E A;  4TOP A;  2P31 A;  3TKR A;  3HVS A;  1URM A;  2IMK A;  2MMN A;  3UBL A;  4O5R A;  5ID2 B;  3KGK A;  4L5L A;  1IYI A;  1OKT A;  3M0F A;  4JRR A;  1PRX A;  4BWQ A;  3NOF A;  3HKR A;  3ZVJ D;  1OC9 B;  2HSH A;  4K8M A;  1K0B A;  1QXH A;  2OKA A;  3LW9 A;  4ZIL A;  4L5O A;  4G19 A;  1SK2 A;  2R0P A;  2B5Y A;  3FZ4 A;  1CQG A;  3UVT A;  2C3N A;  2PUK C;  4PTS A;  3LWA A;  5HFI A;  1M0U A;  4MAB A;  3I6A A;  3HDC A;  5A4V A;  5JCG A;  4CHS A;  2VLU A;  4POB A;  2OE3 A;  5AIV A;  2R0C A;  1PN0 A;  1EV9 A;  2QC7 A;  2PBJ A;  1Z3E A;  2QSI A;  4AJ6 A;  3VFI A;  2PER A;  3TB2 A;  1R5P A;  2CAI A;  1X5E A;  2P0G A;  3CYN A;  3ZRE A;  5ENU A;  1TTZ A;  4MF5 A;  1M2D A;  1V2A A;  2LRN A;  4X43 A;  1BQ7 A;  4GLT A;  1FG4 A;  2XPE A;  1A23 A;  4FYU A;  1HD2 A;  5AIS A;  3LXT A;  2FUG 2;  3L0H A;  3BBY A;  4F9Z A;  1ZZY A;  4NV5 A;  4Z2T A;  2V1M A;  5J4U A;  1YY7 A;  4N30 A;  2HI7 A;  4Q5R A;  4EL1 A;  2GT5 A;  1ML6 A;  2DKI A;  5IMF A;  1HNA A;  2PN8 A;  2R4V A;  1PX7 A;  3BJ5 A;  3PGT A;  1HNC A;  1EV4 A;  3BOA A;  2FA4 A;  1SYX A;  1GWC A;  2B3S A;  3BCI A;  4I6X A;  3IV4 A;  5EVO A;  5JCU A;  3ZYW A;  5JCW A;  1BAY A;  2CZ2 A;  5CRE A;  4O5U A;  2H8L A;  4AJ7 A;  2H75 A;  4BL7 A;  2LJR A;  3S9F A;  2HRA A;  5C04 A;  4ZBD A;  4LLR A;  3KP9 A;  2H0G A;  1K0C A;  5KN0 A;  1GH2 A;  3ZZX A;  5ECO B;  3VK9 A;  5J41 A;  4K7N A;  4O32 A;  1DBY A;  1SKS B;  5ECI B;  3GKM A;  3RDW A;  1ZYN A;  2B5X A;  3D4M A;  2KUC A;  3H93 A;  4FQU A;  3NIV A;  1F3B A;  1R26 A;  4KH7 A;  3LQ7 A;  1TP9 A;  5CRW A;  1MD4 A;  3UMA A;  3JCM L;  5LNK e;  13GS A;  4ECB A;  3L9S A;  4USS A;  1O6J A;  1ERT A;  4JR4 A;  2TIR A;  1SD8 A;  4Q5Q A;  1UA5 A;  2REM A;  3A2W A;  1V57 A;  3FZA A;  3F63 A;  2JL4 A;  5DJM A;  4HJ2 A;  3MDK A;  1OC9 A;  2VD0 A;  5D9X A;  3A2V A;  1FB0 A;  5GAP D;  2KOK A;  2HLS A;  4FYC A;  2OBI A;  3VI7 A;  5KN2 A;  2LEG A;  3TUE A;  1YZX A;  3J7Y b;  2YZH A;  1X5C A;  4KB3 A;  1X9S B;  16GS A;  1WWJ A;  2X8G A;  3APQ A;  3E3E A;  1MTC A;  3DXB A;  1DSB A;  1SJI A;  1XWK A;  2PVQ A;  4PUF C;  4IP1 A;  1K0O A;  5DAL B;  2DJJ A;  3I43 A;  3O6T A;  6GSX A;  2A4V A;  4KAE A;  1M99 A;  4F0B A;  1A2J A;  2ON7 A;  1AC1 A;  3IK7 A;  4QL7 A;  2PVO C;  1A8L A;  3PH9 A;  1SK1 A;  1H75 A;  3LYK A;  5HQP A;  1GNE A;  3L78 A;  2C0G A;  2VCQ A;  3QD9 A;  4PNF A;  2LST A;  4HI7 A;  2FNO A;  2QGV A;  1MEK A;  3CSH A;  5BMU A;  4KSM A;  5EY6 A;  4CY6 A;  1SK0 A;  1V98 A;  1SL2 B;  2K18 A;  6GSS A;  3A5I A;  4YKG A;  5J5N A;  1U3A A;  4KCA A;  2IMD A;  3TRP A;  4I2T A;  2B6M A;  4MF6 A;  3TOU A;  1M2B A;  2YWM A;  4WET A;  5A4W A;  1IYH A;  4RQX A;  1EOG A;  2DKH A;  1GP1 A;  3F9U A;  2I4A A;  1GL8 A;  3HA9 A;  2DJ2 A;  5DAK B;  2BMX A;  3M9J A;  3GST A;  1ZGN A;  5H5S A;  3FK8 A;  4TRX A;  4HEA 2;  4MH2 A;  1J08 A;  3QPM A;  4JBB A;  3ZFB A;  2MMO A;  2O7K A;  3DIE A;  3FW2 A;  3C8E A;  4ZIJ A;  5ECN B;  2CT6 A;  3GA4 A;  3LYP A;  4X4J A;  2GQM A;  2XHF A;  3W6G A;  3ZRD A;  2RM6 A;  3QOU A;  4I8B A;  3KTL A;  3P7X A;  4K2D A;  1XZO A;  4YH2 A;  4E8E A;  1QFN A;  5ECL B;  4JED A;  5G5F A;  4K2X A;  3UVH A;  4ACS A;  4DVC A;  1JZW A;  1QMV A;  5CO3 A;  1SKR B;  1EZK A;  2E2M A;  3KIJ A;  3UEM A;  5CRG A;  4QL9 A;  3HD5 A;  4CY8 A;  2OAD A;  1QK8 A;  1T1V A;  2EIQ A;  3EU4 A;  5ECS A;  3BD2 A;  4K5S A;  4IJ3 A;  2N5B A;  3LXZ A;  2IFQ B;  1ILO A;  4GCI A;  4XS6 A;  1PGT A;  3KMO A;  4L8E A;  2IME A;  1CQH A;  3HVX A;  1XOA A;  4PQH A;  2CX3 A;  1R4W A;  4V1A g;  3ME7 A;  5COH A;  1TRV A;  1NM3 A;  3MIX A;  4EO3 A;  3DVX A;  4N0Z A;  1AQW A;  4KW6 A;  4XTS A;  3R2Q A;  3TOT A;  5J9B A;  3VWW A;  1GUH A;  1YKC A;  3TKQ A;  1TXX A;  4NWY A;  4KSO A;  4EKZ A;  3CTG A;  5IO2 A;  3ZLP A;  2L59 A;  4CW9 A;  3FKF A;  5F05 A;  1G6Y A;  4G0L A;  2VAF A;  3FRC A;  2ZNM A;  5DAL A;  1FHE A;  4ISD A;  2OE0 A;  5DDL A;  3HY2 A;  3IC8 A;  3F6F A;  2YV9 A;  1F2E A;  1Y25 A;  4HU9 A;  1LU4 A;  1JHB A;  5DQY A;  2GST A;  1OAZ A;  4TKY A;  2PPT A;  3TRX A;  1AXD A;  3C71 A;  4TXO B;  1DE1 A;  4FIW A;  2ZUP A;  4FYB A;  3TCO A;  4V2M A;  1G7E A;  2VM2 A;  3F3Q A;  2QA1 A;  4K6X A;  4BVY B;  1Q4J A;  2CA8 A;  3GKK A;  4JR6 A;  4NXI A;  3TGZ A;  2JAC A;  4OFN A;  1XXU A;  5CRH A;  1EOH A;  4J2F A;  5DAK A;  5CNW A;  3APO A;  1SL0 B;  1VF2 A;  1K0D A;  3G7I A;  3KMN A;  1WIK A;  1F9M A;  1K0M A;  2F51 A;  4I2U A;  5DCH A;  5DQS A;  5E59 A;  1OVN A;  4K7O A;  2JAD A;  4IP6 A;  3SWL A;  1V58 A;  1UN2 A;  2H1B A;  5LCZ A;  4KDX A;  1TI3 A;  1R7H A;  3GYK A;  4GXZ A;  19GS A;  3HZ8 A;  1Z7P A;  1X9W B;  4NAX A;  1O85 A;  1PN9 A;  1B4Q A;  1FOH A;  2V32 A;  1H4O A;  4MF7 A;  3U5R E;  1T3B A;  4MJA A;  2LJK A;  4HQZ A;  4O5Q A;  2FHE A;  1PKZ A;  2NVL A;  3Q74 A;  3CMI A;  2WGR A;  4BWS A;  2C80 A;  1EGO A;  3IDV A;  1PL1 A;  1U3I A;  1T4Y A;  2DBC A;  4MP4 A;  1G0T A;  4TVE A;  3G7J A;  3KH9 A;  4OCF A;  5HR2 A;  3R3E A;  1V40 A;  2OJL A;  4RUV A;  3HHV A;  3GHA A;  1A0F A;  1TK5 B;  1VF3 A;  3BCK A;  2PMT A;  1OE8 A;  2IFQ A;  2LKU A;  4ZL9 A;  1Z7R A;  3DML A;  2QKE A;  3Q6O A;  4OMV A;  2IL3 A;  2WJU A;  2L4Q A;  3MSZ A;  3CBU A;  3TDG A;  2H19 A;  5ECK B;  2LV3 A;  5IIZ A;  2X8C A;  4ECI A;  6GSV A;  1VGL A;  1A8Y A;  5F0G A;  2H74 A;  2YN1 A;  4MA9 A;  2P5R A;  1TRS A;  2GSQ A;  2NTO A;  4OFT A;  1TOF A;  2UZ8 A;  4PQI A;  1J9B A;  2JZR A;  3D22 A;  4WR4 A;  3KH7 A;  4Z2R A;  5E4W A;  3ERW A;  7GSS A;  4LL4 B;  5IM9 A;  2WUL A;  1WMJ A;  2YAN A;  3EUR A;  2IPA A;  4HQS A;  4DSQ A;  5IMV A;  4WF4 A;  2JZS A;  4OCE A;  1TK0 B;  4TXO A;  4ILF A;  4L0W A;  4E8H A;  4V1A p;  2GZY A;  3GTU B;  2VLT A;  1M2A A;  2IMF A;  4BVY A;  1YDK A;  2VIM A;  3A3T A;  2X49 A;  3UIW A;  2LNT A;  2D2Z A;  1JZD A;  3CRT A;  5A4U A;  1GUL A;  4OWY A;  4ML1 A;  1RW1 A;  2E7P A;  3A5W A;  3IBH A;  2X4A A;  4ZXG A;  3FZ5 A;  2L4C A;  3TKS C;  3GL5 A;  5D9V A;  2LTK A;  4GQC A;  2GZZ A;  3KJY A;  4NPB A;  4JZQ A;  1FO5 A;  3ZL5 A;  1PA3 A;  3P8W A;  1XW5 A;  5IO0 A;  1T00 A;  2TRC P;  2H66 A;  3GMF A;  5INY A;  1LBK A;  1YJ6 A;  3GN3 A;  4KDU A;  2YWN A;  3H8Q A;  4GRF A;  2MBT A;  4IGJ A;  4O92 A;  3O3T A;  2EC4 A;  3I69 A;  4WBR D;  4K7I A;  5EPF A;  2H1G A;  2GDR A;  1XFL A;  2VCZ A;  4I5Q A;  2X64 A;  1VF1 A;  2B1K A;  4IHU A;  3GKN A;  2F8A A;  2FWE A;  1YF0 A;  1S3C A;  2GLR A;  5IMD A;  2H6Z A;  1YF1 A;  12GS A;  2DMM A;  2AYT A;  2HSY A;  4TR0 A;  2YJ7 A;  8GSS A;  1WJK A;  1GSE A;  2X99 A;  3DEX A;  4XS4 B;  2JSZ A;  3KCM A;  3LEF A;  5IOW A;  4BPY A;  3L9U A;  2HZE B;  1O8W A;  5ID2 A;  2YWI A;  5BRT A;  1E2Y A;  3RBT A;  4MZB A;  3GH9 A;  2L6D A;  4MLY A;  3LOR A;  1RK4 A;  4NMU A;  4K5R A;  2MZC A;  1XW9 A;  4ECJ A;  4BA7 A;  4HS1 A;  2OBK A;  5FT3 A;  4IQ1 A;  2L5L A;  3GX8 A;  2I1U A;  3KZQ A;  2HZF A;  1BX9 A;  2N5F A;  3G7Y A;  2YZU A;  2HRK A;  1A0R P;  3F4S A;  2BTO T;  2ALB A;  4G2E A;  3IAM 2;  2GSR A;  2I9H A;  4GST A;  4V2N A;  2C3Q A;  3GH6 A;  1M7T A;  2ON5 A;  3FEU A;  2CVK A;  2H1D A;  4MMM A;  5G30 A;  4RI6 A;  1YEP A;  4MCU A;  1O7U A;  3VPQ A;  1TI1 A;  1JZR A;  3WGE A;  1WOU A;  3GTU A;  3KTB A;  4V2L A;  2B5E A;  1THO A;  1XWB A;  9GSS A;  2LQQ A;  1EWX A;  4YQV A;  2KHP A;  5GAN D;  5G1L A;  2B7K A;  4EDY A;  3US3 A;  1FVJ A;  3DRN A;  4J57 E;  1ON4 A;  4WXT A;  1K3O A;  3F8U A;  3VUR A;  2VL3 A;  2DSA A;  4X1U A;  1ZCP A;  2MMZ A;  1S3D A;  4IEL A;  4ZB6 A;  4IVF A;  3QMX A;  4KA0 A;  2WS2 A;  1K0A A;  3QFB C;  1B4P A;  2WCI A;  5D9W A;  3IA1 A;  2J23 A;  2RLI A;  3PPU A;  4ZBA A;  2RM5 A;  3GKX A;  2OE1 A;  3QAV A;  3HXS A;  2ES7 A;  4TW5 A;  3IR4 A;  1DUG A;  2GZP A;  2VD1 A;  1B48 A;  3LFL A;  3CSJ A;  3LGC A;  1SU9 A;  2V41 A;  2JZT A;  1SEN A;  4K0N A;  3TJK A;  4DEJ A;  4WR5 A;  3IRA A;  4ZBB A;  4HU7 A;  5B7C A;  4Q5F A;  3M8N A;  3VPT A;  4POL A;  2E2G A;  3IK9 A;  2VCW A;  2YP6 A;  3GFK A;  1EEM A;  2XBQ A;  1WRY A;  2HE3 A;  4XS4 A;  2HFD A;  5G31 A;  4ZB9 A;  2HZE A;  1UC7 A;  4HDE A;  3VI5 A;  2XC2 A;  1XWC A;  2M46 A;  2JU5 A;  5HFK A;  3ZTL A;  5ECQ B;  3A2X A;  1Z6N A;  4MH3 A;  3W8S A;  1U87 A;  2C8U A;  2GSS A;  1X9M B;  2IN3 A;  1XIY A;  4XCS A;  2L57 A;  5IOX A;  1TRW A;  3IHQ A;  1GSS A;  10GS A;  3QCP A;  3WYW A;  4PNG A;  2KP2 A;  4PQ1 A;  2LNS A;  6GST A;  4NV2 A;  3NZN A;  2H71 A;  2FA8 A;  4F0C A;  4AJ8 A;  2DIY A;  4IBP A;  1WPI A;  2CAQ A;  2H72 A;  4OFM A;  4HJM A;  1SKW B;  5DVB A;  2FWG A;  1K0N A;  1O81 A;  1AW9 A;  1F37 A;  1NHO A;  2LS5 A;  2VL9 A;  1ERV A;  3FR3 A;  1PSQ A;  1S3A A;  3AY8 A;  5C00 A;  2CX4 A;  1DE2 A;  4EXJ A;  4XIH A;  2VL2 A;  1ST9 A;  2MYG A;  4KE3 A;  4POM A;  4Q5N A;  2PWJ A;  5ECH B;  5HR3 A;  2VCX A;  3ISO A;  5JWQ B;  2IMI A;  3EU3 A;  2B1L A;  1JLV A;  1XWG A;  2BJX A;  4LA1 A;  3EWL A;  4KND A;  3QR6 A;  5D96 A;  1OE7 A;  2DIZ A;  2R5G A;  2RUF A;  2YCD A;  3UAP A;  4RQR A;  2L6C A;  3F4R A;  4DSS B;  2V6K A;  5J3R A;  4PUR A;  2LQO A;  1U88 A;  3FHK A;  4IQA A;  1OYJ A;  2WDU A;  2JSY A;  3Q19 A;  4OD7 A;  2EIO A;  3N9J A;  4Z2U A;  3U6V A;  5D73 A;  1A24 A;  3F4T A;  2R2J A;  3PR8 A;  5ELA A;  2GTU A;  3D4T A;  1TJD A;  2AUV A;  1ZYQ B;  2C1Y A;  5KN3 A;  1GSD A;  4Z7X A;  4FH8 A;  4AF2 A;  2QA2 A;  2FLS A;  3QFA C;  1W4V A;  1UVZ A;  4HZ2 A;  3ZIJ A;  2WZ9 A;  2FWH A;  3M9K A;  4ZL7 A;  3ZIT A;  1N2A A;  1E6B A;  3E0U A;  4MJE A;  1PQN A;  1ZYE A;  1XBS A;  1MDJ A;  14GS A;  6GSU A;  3HZ4 A;  3IHG A;  5CAX A;  4PXO A;  3PIN A;  5CRD A;  1GTI A;  1T4Z A;  2M72 A;  3C1R A;  2LUS A;  4YQM A;  2F3M A;  3VLN A;  3DGQ A;  5F07 A;  4F03 A;  1PX6 A;  4NHZ A;  17GS A;  4XRD A;  4TN8 A;  1JZO A;  3MYD A;  3E9J B;  4XS1 A;  3H4K A;  2TRX A;  3FZ9 A;  2C3T A;  1K3Y A;  2V2G A;  1KNG A;  3HJP A;  1SL1 B;  5FHI A;  1GTA A;  3GIX A;  3LG6 A;  5D8I A;  1GUK A;  1LJR A;  3GUS A;  4G0I A;  3WT1 A;  3D21 A;  2GGT A;  5A5K A;  2H76 A;  2V6O A;  2CQ9 A;  4KGI A;  3D0Z A;  1A2L A;  4MDC A;  3J7Y k;  5CP1 A;  4F82 A;  4ZL8 A;  4TR4 A;  2R0G A;  1BYE A;  5GSS A;  5EL8 A;  2GT6 A;  3CSI A;  1G6W A;  1C72 A;  3ZIV A;  1N8J A;  4K0G A;  3FY7 A;  1JFU A;  1GSY A;  1ZMA A;  3MWH A;  1SYR A;  1G7O A;  3GX0 A;  4JU5 A;  3TKS E;  3KXO A;  2C4J A;  3VWX A;  2VCT A;  4KCE A;  4KUN A;  3TJF A;  2VM1 A;  3KM6 A;  5ABR A;  3GUR A;  3RHC A;  4IKH A;  2AV4 A;  2M80 A;  3EE2 A;  4HZ4 A;  1R5A A;  3CXG A;  4XHM A;  1JLW A;  1QUW A;  4MPG A;  4ZB8 A;  5B8B A;  4MPF A;  4GQF A;  4DSS A;  3IE3 A;  1RQM A;  5IPH A;  1HQO A;  1AQX A;  3F3R A;  4ULX A;  2H1A A;  3V1W A;  2WFC A;  1V9W A;  1AQV A;  1K3L A;  3UOM A;  3N5O A;  4ML6 A;  3UJ1 A;  1TU7 A;  22GS A;  1F6M C;  2DML A;  3UL3 A;  1Y6E A;  4OO4 A;  2J9H A;  1AAZ A;  4EIQ A;  3G9B A;  5H5R A;  4HUA A;  5KN1 A;  5G2Z A;  2FCH A;  1MD3 A;  4IJI A;  2G2Q A;  4D73 B;  2HT9 A;  2FD3 A;  5IMC A;  2VLV A;  3LSZ A;  2FWF A;  1OKD A;  1PKW A;  5F06 A;  5L71 A;  4I97 A;  2O85 A;  4KF9 A;  2K8V A;  4IS0 A;  2YPM A;  2RII A;  5AGY A;  2IIY A;  3CTF A;  4P3Y B;  1VRS D;  4YKF A;  4EC0 A;  4EDZ A;  3FR9 A;  2YOI A;  1T7P B;  3Q18 A;  2DLX A;  2KLX A;  3TRQ A;  4YQU A;  4ICY A;  3TJJ A;  4EE0 A;  5IQY A;  4POK A;  3OR5 A;  2H6X A;  4N0V A;  3DKS A;  1J0F A;  3VWV A;  4IW9 A;  2HYX A;  4X0X A;  1U6T A;  4FO5 A;  1MDK A;  3EMP A;  20GS A;  2K6V A;  3UAR A;  3FYG A;  4OO5 A;  2NPB A;  1I5G A;  3I9V 2;  1XW6 A;  4G9H A;  3HCZ A;  4MK3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...