1T7PB

T7 dna polymerase complexed to dna primer/template,a nucleoside triphosphate, and its processivity factor thioredoxin
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
105
structure length
105
Chain Sequence
KIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords DNA (5'-D(P*GP*CP*CP*AP*GP*TP*GP*CP*CP*AP*2DA)-3')
publication title Crystal structure of a bacteriophage T7 DNA replication complex at 2.2 A resolution.
pubmed doi rcsb
source organism Enterobacteria phage t7
total genus 24
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 1997-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1t7pB00
3EVIA 4MH2A 1FVJA 3M9KA 4BPYA 2B6MA 2H19A 5IOXA 3K8NA 5CRHA 3BD2A 3P90A 4QL7A 4GLTA 1FAAA 2AB6A 5D96A 2RUFA 1PRXA 4GF0A 2GLRA 4AJ7A 2N5AA 4MJAA 4OFMA 1SL0B 3DEXA 3IAM2 1F3AA 2PWJA 2J9HA 4TR0A 5F05A 3VURA 3IOSA 1BG5A 5EPFA 1YJ6A 3KJYA 4JRRA 4QL9A 3M3MA 1K3LA 3HKRA 1TW9A 2PERA 3F0IA 1GRXA 5F07A 3ZTLA 1SYRA 1URMA 4MJBA 2K18A 4MZCA 3UVHA 1MD4A 5A4UA 3UOMA 1TJDA 2C1YA 2YOIA 4O92A 2V2GA 1T8EB 1U88A 4IGJA 3A2XA 4ML1A 4QQ7A 3GTUA 3QD9A 19GSA 3HJOA 5IQYA 4F0BA 1THXA 3CRTA 3ZFLA 2HT9A 1B9XC 1M2BA 1T4YA 4XRAA 1AUCA 3I6AA 10GSA 2GT6A 3TJKA 3QCPA 4ISDA 5IMCA 2VCTA 3H8QA 3V1WA 4Q5QA 4DSQA 2O89A 3CBUA 3EWLA 3DD3A 2B5EA 2VCZA 4TXOA 1GSFA 2V6KA 4O32A 4YAPA 2H6ZA 5ECRB 5CREA 5LD0A 4CW9A 3ERFA 1H4OA 2IFQB 2FA8A 1UC7A 1V57A 1XW5A 3E9JB 2ZNMA 1A0FA 1THOA 4OCFA 2HZFA 3HVSA 2WZ9A 2H73A 2NPBA 1XCCA 4K0NA 3KH9A 3D4TA 5ECHB 3GURA 1W4VA 1SJ6A 2LJKA 1QFNA 3HJPA 1JLWA 1T7PB 1KNGA 2YJ7A 3G7YA 1Y25A 1OC9B 1F9MA 5H5RA 5JCWA 1YZXA 4IKHA 2P31A 3RAZA 2OKAA 4PQIA 2HLSA 1TTZA 1WWJA 1NHOA 3PINA 4NWYA 4V2LA 1LU4A 3J7Yk 3C73A 4I6XA 4TXVA 4KDXA 4KE3A 4AJ6A 4IN0A 2RIIA 5C00A 1BQ7A 1X9SB 4TOPA 4K7IA 1TU7A 5IMDA 2VLUA 2GTUA 3ZITA 1JZWA 3FZAA 1TRWA 5LCZA 5ID2B 5IPHA 3TOTA 4ML6A 1I5GA 3FYGA 3GKNA 3GX8A 1YKCA 2GZZA 1T1VA 3HHVA 2FWEA 4J57E 3RHBA 1O6JA 5G5FA 3EYTA 3MNGA 2YCDA 2CT6A 2PN8A 5IO0A 4ACSA 4RUVA 4MABA 4OFNA 1GNWA 5HFGA 4F03A 2H1DA 2HXKA 3CMIA 3MSZA 9GSSA 3QDNA 2WCIA 2VOCA 4CDOA 2FLSA 5ECKB 2IFQA 2LKUA 3DVWA 3FW2A 3W8SA 5ECNB 5ECQB 2R37A 2WRTA 3PH9A 3VWXA 3M8NA 5HR0A 4IBPA 5DCHA 3EE2A 3HXSA 2N5FA 1KEBA 2ZUPA 4KCAA 2HSYA 3LFLA 1BYEA 2DMLA 4N0ZA 1MTCA 3GKMA 3DRNA 1G0TA 2FGXA 5HQPA 3F8UA 2ALBA 1GSYA 2FUG2 1OC9A 3E0UA 3P7XA 3ZIJA 2KP1A 2MBSA 1AAZA 1XW9A 4G19A 5H5QA 5FWGA 4I97A 3H79A 2KLXA 1SU9A 3DIEA 1VF3A 5ECMB 4YQUA 3DGQA 3UARA 3L9SA 4BVYA 4K8MA 5ID2A 4KGIA 4MK3A 4JR4A 4F9ZA 1PD21 4NXIA 4EDYA 2R4VA 3HVVA 1HQOA 3UBLA 3L9UA 1GP1A 5CP1A 2LTKA 3ZLPA 1XBSA 4JR6A 4JU5A 4K6XA 4PQ1A 3U6VA 3WGDA 2I1UA 2HZEB 3F3RA 3H4KA 2G2QA 4GTUA 4ZL8A 3TRXA 4ZILA 1CQGA 5F06A 3VWUA 2O8VB 1X5DA 3PR8A 1A8LA 4GSNA 2V6OA 3UAPA 1ST9A 1MEKA 3TUEA 4G10A 3HYPA 4MCUA 2LRCA 4BL7A 1EGRA 5KEJA 3FEUA 4KCEA 3U5RE 1V98A 2IMDA 4IJ3A 4EF0A 1E2YA 2MBTA 1GTUA 5A4WA 4WF4A 4NV5A 5J9BA 3MDKA 4RQRA 5DJLA 1GTAA 2F8FA 1Z6NA 2DMMA 4ZB8A 2B3SA 5AISA 2QSIA 2EC4A 3VLNA 2AAWA 3HA9A 3VI5A 5DCGA 1K3YA 2L5LA 2MMNA 4GCIA 1XOAA 1C72A 4K9ZA 1TRSA 4P3YB 5JWRB 2CAIA 3FY7A 4TN8A 5G1LA 2L6DA 2EIRA 1AC1A 3ZL5A 5G5EA 3IE3A 5ECPB 3ISOA 3DVXA 1R5AA 4FYUA 1VF1A 3P2AA 2PUKC 1GSEA 4GRFA 4RQXA 4PGTA 3BBYA 3EURA 2K9FA 2DJJA 2XHFA 2VL2C 2H0IA 3S9FA 5IM9A 3HZ8A 1G7OA 2WJUA 3F4TA 1AW9A 4BWQA 3TB2A 3GHAA 2LQOA 4MPGA 3GA4A 1KTEA 2L57A 1G6WA 3MWHA 1EOGA 2MMZA 4MJCA 2VD1A 1VGLA 2VO4A 1ERUA 2D2ZA 4ZBBA 3CYNA 3F6DA 2GQMA 4WXTA 2EIQA 2PU9C 1DE2A 5G30A 1JFUA 3KXOA 2DC5A 2I9HA 4EKZA 4MF5A 4OCEA 2NTOA 4MH3A 4GSTA 3H93A 4HUAA 3Q18A 5CYYA 2QKEA 4IJIA 3GMFA 1XWGA 3WD6A 2NDOA 2K8SA 1K0BA 2YP6A 4RI6A 5J41A 1K0MA 4YH2A 3Q19A 2I4AA 3I9V2 5EY6A 3F4RA 3D5JA 2MMOA 6GSYA 3KGKA 3A2WA 4N0VA 4V2MA 4JBBA 2E2GA 3L78A 4AGSA 2GZYA 4F2IA 5D93A 4KSOA 4G9HA 1TU8A 2OE0A 1N8JA 3KZQA 3WGEA 4HZ2A 1XPVA 1ZZYA 2YWOA 4E8HA 3NOFA 4NAXA 1GNEA 1HNCA 2R5GA 3I43A 4LL1B 2IMEA 4ID0A 4FH8A 1HNBA 1VF2A 3D4MA 5ECOB 1ACVA 5D8IA 4KA0A 2L4CA 2ON7A 5A4VA 1EP8A 2H76A 1ML6A 2VLTA 1WP0A 1MDJA 3HVXA 1PL1A 5EVOA 4XS4A 1RW1A 5J3RA 4WR4A 1M9BA 3TOUA 4POLA 2LSTA 5HFKA 4IP1A 3LG6A 3KTBA 2JACA 5CRWA 2FWGA 4GWRA 1SD9A 2H1AA 4OWYA 3HZ4A 1R7HA 2LUSA 4PNFA 1WMJA 1ZYEA 1NHYA 2GT5A 5G31A 1TP9A 3UIWA 4XHMA 1OKDA 2AHEA 4EO3A 2OACA 4JE1A 2OADA 4PUAA 3TKSC 2CQ9A 2P0GA 3EMXA 3DWVA 2VUPA 2B1LA 3APSA 2NVLA 1UA5A 3ERWA 1TRVA 2MYGA 4X0XA 2CV4A 2GQKA 1Z9HA 2CZ2A 1QK8A 3QAWA 5GAND 3UVTA 6GSVA 1BJXA 1F2EA 5J9CA 1GH2A 2MMAA 2QGVA 1PX7A 1ABAA 4CHSA 1NSWA 3PGTA 3TKQA 3OR5A 2JADA 4KB3A 1SK1A 1A23A 3QFAC 2YNXA 2IMKA 1FW1A 4HI7A 3CXGA 4MZWA 1X5EA 4IQAA 3APOA 4LMWA 3GSTA 3N9JA 1G6YA 1UVZA 5KN0A 1GUMA 1AQVA 3CTFA 3RPNA 1YF1A 4KX4A 5DQSA 3O6TA 3RBTA 2CVBA 1XW6A 1XIYA 1O8XA 5JCUA 1EOHA 3L4NA 3ZYWA 2HFDA 2BJXA 2FHEA 3UMAA 2P5RA 3KD0A 1X9WB 4KSMA 1B8XA 3IXRA 2DJ2A 2VD0A 3EINA 1IYHA 4POKA 1WE0A 4POBA 4EVMA 5L71A 2C0EA 4YQVA 2RLIA 1FB0A 2H6XA 4Q5RA 2KHPA 3RHCA 4K0GA 5IPGA 1HD2A 1O73A 1XWAA 2DBCA 2ON5A 1PQNA 5ECIB 4NPBA 5IMFA 4ZB9A 4MLYA 4FIWA 3GN3A 3A2VA 3W8JA 2GZPA 3QFBC 1SD8A 5HR2A 4IW9A 3TJJA 3EU3A 3DYRA 3QR6A 1GTIA 4N30A 5GAPD 3GL3A 1LBKA 2JSZA 3WYWA 4JZQA 5HR1A 3G7IA 1J08A 2TRXA 4PX1A 3GH6A 1EGOA 1XXUA 4IVFA 2CX3A 3TKRA 2OBIA 3ZFBA 1GL8A 1USBA 4LLRA 2LJAA 3GSSA 5KN2A 2YPMA 5J4UA 1T4ZA 4F0CA 3SBCA 2PVQA 3LGCA 1TI1A 4O7HA 4IP6A 4ULXA 3QPMA 2VLVA 5CAXA 3C71A 1V9WA 2B5XA 3ME8A 4HQZA 5GZZB 1YDKA 2B7KA 2V41A 2X64A 4HQSA 5DAKB 2XBQA 2LNTA 5ECLB 4D73B 3QAVA 3AY8A 4IS0A 5ELGA 2A2RA 2I3YA 2IJYA 4MF7A 5B8AA 1JLVA 1SKRB 1JHBA 12GSA 3IR4A 3LJRA 1R5PA 4TR4A 1TKDB 1F37A 5KN3A 2LEGA 3TRQA 1OE8A 2GGTA 1TK8B 1GUHA 4K1FA 1RQMA 2C0GA 3N5OA 1PN9A 4N10A 1QMVA 1A8YA 5IOWA 3VPTA 1YY7A 2PBJA 2GSTA 3D0ZA 3ERGA 2C3NA 3F4SA 1LJRA 5AIVA 1SYXA 2H74A 2VAFA 1K0OA 4ECJA 1Z7PA 1S3AA 3TJFA 2IN3A 2VL2A 2WDUA 3WT1A 3KP9A 3C1RA 3G9BA 3BCIA 3HD5A 2AV4A 4BA7A 3O76A 1X0RA 4OFTA 1IYIA 4NV2A 2P5QA 13GSA 1EV9A 4X43A 5B8BA 3UJ1A 1N2AA 1K0CA 1V40A 5H5SA 3C1SA 4HOJA 1ZYQB 4NMUA 4K7OA 1ERWA 3GH9A 4HS1A 1DBYA 1SKWB 2J23A 3ME7A 3ED3A 3KM6A 4NHWA 4LL4B 2IL3A 3VWWA 5DJMA 1B4QA 2VM1A 4HDEA 4ECCA 4MPFA 2FA4A 3ZVJA 4D73A 4K2DA 1TK5B 4XS1A 2RUEA 3A3TA 2YJHA 4TR1B 2DIYA 3ZREA 1XVQA 4XRDA 3TRPA 1FHEA 1X5CA 2R3XA 5DVBA 2R6KA 1AIUA 4L5LA 5ABRA 1PX6A 3WGXA 3O3TA 2E0QA 3FHKA 1SK2A 2HZEA 3J7Yb 3G7JA 3ZRDA 1A2MA 4ZIJA 2H72A 1KBNA 4I5QA 2WS2A 4I2UA 2KP2A 1ERTA 2B7JA 2YV7A 1EP7A 1YEPA 2A2SA 2ZCTA 2H8LA 4YAVA 1F6MC 3DXBA 2YN1A 3TJBA 3ZMKA 1U3IA 3IK7A 3IC4A 1XVWA 1OC8A 1TK0B 2FY6A 5ECSA 2VM2A 1S3DA 5GSSA 1WIKA 2YV9A 3KH7A 3D21A 4KDUA 3EC3A 3RDWA 4I8BA 4JEDA 5J5NA 4OD7A 6GSSA 3IK9A 3Q6OA 5D9XA 1SJIA 3IPZA 1Z3EA 4KNDA 1ZCPA 2H6YA 4DSSB 2TIRA 4G2EA 1R4WA 5F8BA 3FR6A 1EZKA 1I9DA 3US3A 4J2FA 3TGZA 2OBKA 2WB9A 5DALB 3UEMA 3KMNA 4PQHA 3H1NA 4BWSA 4TRXA 5D9WA 2YZUA 3TKSA 4TR1A 2Z9SA 4KW6A 2C4JA 2XPDA 1MD3A 2E7PA 2PMTA 2DJ3A 1ZOFA 4E8EA 2GSSA 2OJLA 1TOFA 4MZBA 2PPTA 1K0NA 1F3BA 1TRUA 4L8EA 2XPEA 2X8HA 2L6CA 2HE3A 3GL5A 2LJRA 2BMXA 4RI7A 1YKAA 3QOUA 3FR9A 4WETA 1FG4A 3FR3A 1CQHA 4MJEA 4WBRD 2GS3A 4HJ2A 5D9VA 4HJMA 2C0DA 2X8CA 2M80A 2M46A 1M99A 2VCXA 4MDCA 4Q5FA 1BEDA 4MF6A 2VIMA 1RK4A 7GSSA 4XCSA 3GX0A 1T3BA 2ES7A 1HNAA 2K6VA 3TDGA 1QUWA 2HRFA 4EE0A 1M7TA 3HDCA 3LEFA 1GSDA 4L0UA 1PSQA 3GV1A 5IIZA 2JZSA 1GSQA 3JCML 3BCKA 2IWTA 3UL3A 1BX9A 3APQA 3ZMLA 3Q74A 1Q4JA 4KUNA 2H0GA 1SL2B 2JL4A 4IQ1A 1J0FA 4GSSA 1SENA 1OKTA 1M2DA 2QC7A 3KP8A 4DSSA 4WEYA 4XIHA 1O8WA 2RM6A 4HZ4A 4KH7A 2XC2A 3CSHA 2FNOA 1B4PA 4J56E 1Q98A 4V2NA 4YQMA 5DALA 4OMVA 1GLPA 2AJQB 3FZ5A 5D73A 3NZNA 1SKSB 5B7CA 2LQQA 5D9TA 4ILFA 2FD3A 3ZZXA 3IBHA 3C8EA 5HR3A 4PURA 3CTGA 3A5WA 1Y6EA 1FOVA 2YWMA 1XOBA 5B6MA 1FB6A 4Z7XA 1SK0A 5AGYA 1PGTA 1U6TA 1ERVA 4MA9A 2F3MA 2DJ1A 5DBQA 3LXTA 1V2AA 1T00A 2VCVA 3F3QA 1K0DA 4NHZA 3HY2A 3IHQA 6GSUA 1PA3A 1U87A 1PMTA 4V1Ag 2HSHA 2C8UA 2VL3A 2C0FA 2JZRA 1DUGA 4IHUA 4ZBAA 5E4WA 4KAEA 2AUVA 3NIVA 2H75A 2DJKA 5IMVA 1MDIA 2LV3A 2NBSA 1XWCA 2K8VA 4BVXA 3FZ9A 2CAQA 2LNSA 3GIXA 1Z5YE 2F9SA 1A2JA 2YZHA 4LMVA 1PL2A 2H71A 18GSA 1ZMAA 5E59A 3KEBA 1S3CA 5B6NA 4ZL9A 2EIOA 2H1GA 5LNKe 2M72A 2CVDA 1FVKA 2OE1A 5AN1A 2O87A 4MP4A 2X8GA 2V1MA 3QMXA 1B48A 2I81A 4AJ8A 2GQLA 5IO2A 1GWCA 4TKYA 1ILOA 1QQ2A 17GSA 2LS5A 1E6BA 1GULA 2LRTA 5HFIA 3GNJA 2L59A 3R2QA 3SWLA 1MDKA 2IPAA 3I69A 4ZBDA 3KCMA 1TDIA 5G2ZA 3GKXA 2IIYA 4HU9A 4HEA2 2VCWA 4GQFA 1FO5A 5KN1A 2C3TA 2BTOT 3QAGA 1YF0A 3RPPA 4L0WA 2H66A 3UBKA 1XFLA 1A2LA 1WPIA 1QXHA 1OAZA 2O7KA 3FZ4A 1JZOA 3GUSA 3M0FA 1NW2A 2CZ3A 1PKWA 5COHA 2AYTA 3VPQA 1AQWA 3GFKA 5DDLA 5GSTA 5INYA 1TI3A 3IDVA 2VL9A 2KUCA 3F63A 8GSSA 1EEMA 1QGVA 2REMA 5ELAA 1DSBA 4ECIA 3KIJA 5AIXA 3VFIA 4XS6A 2H1BA 3LSZA 4N11A 1XWBA 5CRGA 4EC0A 2KOKA 5JCGA 4F82A 4H86A 2HYXA 1GSSA 3IRAA 5JWOB 2TRCP 11GSA 1OVNA 1VF4A 2B5YA 6GSTA 2FCHA 2WFCA 3L9VA 1M9AA 3LYPA 3VI7A 5DQYA 1U3AA 4OO5A 3TKSE 4AF2A 20GSA 1XZOA 4PXOA 2CA8A 5ENUA 3C7MA 1OC3A 2CVKA 3MAKA 1Z6MA 3EU4A 3DKSA 1ON4A 4HU7A 3BOAA 3E3EA 4IELA 1AXDA 3FKFA 1TXXA 4EXJA 4OO4A 2OE3A 1YQ1A 6GSWA 3CSIA 1WRYA 2N5BA 4X1UA 5CRDA 1GSUA 2GDRA 1A24A 4DSRA 14GSA 2B1KA 1GLQA 1XWKA 3KMOA 2H70A 3WT2A 1G7EA 4GXZA 2FWHA 2OA7A 5CNWA 1EV4A 4DVCA 4V1Ap 4L5OA 3VK9A 3LXZA 4LA1A 3IA1A 3GYKA 2H0HA 3VWVA 5FHIA 2WULA 3TKPA 3IV4A 3LWAA 2GVPA 3LORA 2GSQA 2JU5A 1GUKA 2X99A 1SJZA 6GSXA 3HCZA 1ZL9A 2DIZA 1R26A 2YWIA 1SL1B 2MZCA 22GSA 1WOUA 3FK8A 4EL1A 3F9UA 5DAKA 1GTBA 1YEXA 5A5KA 1O7UA 1JZDA 4WKWA 3DMLA 5JWQB 1A0RP 5IMZA 1O85A 4PNGA 2YANA 4O5RA 2IMFA 4ECBA 1OE7A 4K7NA 3CRUA 4KDYA 3P8WA 5FT3A 1H75A 2HI7A 2DLXA 2F51A 1EEJA 1M2AA 1Z7RA 3GRXA 4PUFC 1EWXA 4I2TA 5C04A 3D6IA 3M1GA 2A4VA 3TJGA 4EDZA 3L0HA 4POMA 1K3OA 1NM3A 4MMMA 2DSAA 4WR5A 2JSYA 3D22A 2C80A 4WBJA 4ZXGA 2DJ0A 2PVOC 2L5OA 3CSJA 16GSA 3W6GA 4WF5A 1J9BA 4GQCA 3TCOA 2G0FA 3ZVJD 1HYUA 2H01A 4TVEA 2JZTA 3F6FA 2GSRA 2HNLA 5CO3A 4DEJA 1O81A 1PKZA 2R2JA 2C3QA 3FRCA 4XS4B 1V58A 1OYJA 3GKKA 2PGTA 2CX4A 2H30A 2YWNA 4EUYA 3M9JA 4TW5A 1AQXA 3ZIVA 4XTSA 4ZL7A 4TR3A 1DE1A 2LRNA 3LQ7A 2F8AA 3GTUB 2XBIA 3KTLA 3BJ5A 1BAYA 4FO5A 2WGRA 2HRNA 4Q5NA 1WJKA 4FYBA 2E2MA 1K0AA 3LYKA 4ZB6A 1B9YC 4FYCA 1W89A 3EMPA 5F0GA 1VRSD 2IMIA 1UN2A 2VCQA 2O85A 3IAS2 1JZRA 1ZGNA 2V32A 1M0UA 5G1KA 4TXOB 3HJMA 5EL8A 5IMAA 1X9MB 2L4QA 2RM5A 2FWFA
chains in the Genus database with same CATH superfamily
3EVIA 4MH2A 1FVJA 3M9KA 4BPYA 2B6MA 2H19A 5IOXA 3K8NA 5CRHA 3BD2A 3P90A 4QL7A 4GLTA 1FAAA 2AB6A 5D96A 2RUFA 1PRXA 4GF0A 2GLRA 4AJ7A 2N5AA 4MJAA 4OFMA 1SL0B 3DEXA 3IAM2 1F3AA 2PWJA 2J9HA 4TR0A 5F05A 3VURA 3IOSA 1BG5A 4YKFA 5EPFA 1YJ6A 3KJYA 4JRRA 4QL9A 3M3MA 1K3LA 3HKRA 1TW9A 2PERA 3F0IA 1GRXA 4FQUA 5F07A 3ZTLA 1SYRA 1URMA 4MJBA 2K18A 4MZCA 3UVHA 1MD4A 5A4UA 3UOMA 1TJDA 2C1YA 2YOIA 4O92A 2V2GA 1T8EB 1U88A 4IGJA 3A2XA 4ML1A 4QQ7A 3GTUA 3QD9A 19GSA 3HJOA 5IQYA 4F0BA 1THXA 3CRTA 3ZFLA 2HT9A 1B9XC 1M2BA 2HRAA 1T4YA 4XRAA 1AUCA 3I6AA 10GSA 2GT6A 3TJKA 3QCPA 4ISDA 5IMCA 2VCTA 3H8QA 3V1WA 4Q5QA 4DSQA 2O89A 3CBUA 3EWLA 3DD3A 2B5EA 2VCZA 4TXOA 1GSFA 2V6KA 4O32A 4YAPA 2H6ZA 5ECRB 5CREA 5LD0A 5BRTA 4CW9A 3ERFA 1H4OA 2IFQB 2FA8A 1UC7A 1V57A 1XW5A 3E9JB 2ZNMA 1A0FA 1THOA 4OCFA 2HZFA 3HVSA 2WZ9A 2H73A 2NPBA 1XCCA 4K0NA 3KH9A 3D4TA 5ECHB 3GURA 1W4VA 1SJ6A 2LJKA 1QFNA 3HJPA 1JLWA 1T7PB 1KNGA 2YJ7A 3G7YA 1Y25A 1OC9B 1F9MA 5H5RA 5JCWA 1YZXA 4IKHA 2P31A 3RAZA 2OKAA 4PQIA 2HLSA 1TTZA 1WWJA 1NHOA 3PINA 4NWYA 4V2LA 1LU4A 3J7Yk 3C73A 4I6XA 4TXVA 4KDXA 4KE3A 4AJ6A 4IN0A 2RIIA 5C00A 1BQ7A 1X9SB 4TOPA 4K7IA 1TU7A 5IMDA 2VLUA 2GTUA 3ZITA 1JZWA 3FZAA 1TRWA 5LCZA 4BVYB 5ID2B 5IPHA 3TOTA 4ML6A 1I5GA 3FYGA 3GKNA 3GX8A 1YKCA 2GZZA 1T1VA 3HHVA 2FWEA 4J57E 3RHBA 1O6JA 5G5FA 3EYTA 3MNGA 2YCDA 2CT6A 2PN8A 5IO0A 4ACSA 4RUVA 4MABA 4OFNA 1GNWA 5HFGA 4F03A 2H1DA 2HXKA 3CMIA 2X49A 3MSZA 9GSSA 3QDNA 2WCIA 2VOCA 4CDOA 2FLSA 5ECKB 2IFQA 2LKUA 3MIXA 3DVWA 3FW2A 3W8SA 5ECNB 5ECQB 2R37A 2WRTA 3PH9A 3VWXA 3M8NA 4BL7B 5HR0A 4IBPA 5DCHA 3EE2A 3HXSA 2N5FA 1KEBA 2ZUPA 4KCAA 2HSYA 3LFLA 1BYEA 2DMLA 4N0ZA 1MTCA 3GKMA 3DRNA 1G0TA 2FGXA 5HQPA 3F8UA 2ALBA 1GSYA 2FUG2 4G0IA 1OC9A 3E0UA 3P7XA 4K2XA 3ZIJA 2KP1A 2MBSA 1AAZA 1XW9A 4G19A 5H5QA 5FWGA 4I97A 3H79A 2KLXA 1SU9A 3DIEA 1VF3A 5ECMB 4YQUA 3DGQA 3UARA 3L9SA 4BVYA 4K8MA 5ID2A 4KGIA 4MK3A 4JR4A 4F9ZA 1PD21 4NXIA 4EDYA 2R4VA 3HVVA 1HQOA 3UBLA 3L9UA 1GP1A 5CP1A 2LTKA 3ZLPA 1XBSA 4JR6A 4JU5A 4K5SA 4K6XA 4PQ1A 3U6VA 3WGDA 2I1UA 2HZEB 3F3RA 3H4KA 2G2QA 4GTUA 4ZL8A 3TRXA 4ZILA 1CQGA 5F06A 3VWUA 2O8VB 1X5DA 3PR8A 1A8LA 4GSNA 2V6OA 3UAPA 1ST9A 1MEKA 3TUEA 4G10A 3HYPA 4MCUA 2LRCA 1S3RA 4BL7A 1EGRA 5KEJA 3FEUA 4KCEA 3U5RE 1V98A 2IMDA 4IJ3A 4EF0A 1E2YA 2MBTA 1GTUA 5A4WA 4WF4A 4NV5A 5J9BA 3MDKA 4ICYA 4RQRA 5DJLA 1GTAA 2F8FA 1Z6NA 2DMMA 4ZB8A 2B3SA 5AISA 2QSIA 2EC4A 3VLNA 2AAWA 3HA9A 3VI5A 5DCGA 1K3YA 2L5LA 2MMNA 4GCIA 1XOAA 1C72A 1PN0A 4K9ZA 1TRSA 4P3YB 2QA1A 5JWRB 2CAIA 3FY7A 4TN8A 5G1LA 2L6DA 2EIRA 1AC1A 3ZL5A 5G5EA 3IE3A 5ECPB 3ISOA 3DVXA 1R5AA 4FYUA 1VF1A 3P2AA 2PUKC 1GSEA 4GRFA 4RQXA 4PGTA 3BBYA 3EURA 2K9FA 2DJJA 2XHFA 2VL2C 2H0IA 3S9FA 5IM9A 3HZ8A 1G7OA 2WJUA 3F4TA 1AW9A 4BWQA 3TB2A 3GHAA 2LQOA 4MPGA 4O5UA 3GA4A 1KTEA 2L57A 1G6WA 3MWHA 1EOGA 2MMZA 4MJCA 2VD1A 1VGLA 2VO4A 1ERUA 2D2ZA 4ZBBA 3CYNA 3F6DA 2GQMA 4WXTA 2EIQA 2PU9C 1DE2A 1M3IA 5G30A 1JFUA 3KXOA 2DC5A 2I9HA 4EKZA 4MF5A 4OCEA 2NTOA 4USSA 4MH3A 4GSTA 3H93A 4HUAA 3Q18A 5CYYA 2QKEA 4IJIA 3GMFA 1XWGA 3WD6A 2NDOA 2K8SA 1K0BA 2YP6A 4RI6A 5J41A 1K0MA 4YH2A 2A4HA 3Q19A 2I4AA 3I9V2 5EY6A 3F4RA 3D5JA 2MMOA 6GSYA 3KGKA 3A2WA 3PPUA 4N0VA 4V2MA 4JBBA 2E2GA 3L78A 4AGSA 2GZYA 4F2IA 5D93A 4KSOA 4G9HA 1TU8A 2OE0A 1N8JA 3KZQA 3WGEA 4HZ2A 1XPVA 1ZZYA 2YWOA 4E8HA 3NOFA 4NAXA 1GNEA 1HNCA 2R5GA 3I43A 4LL1B 2IMEA 4ID0A 4FH8A 1HNBA 1VF2A 3D4MA 5ECOB 1ACVA 5D8IA 4KA0A 2L4CA 2ON7A 5A4VA 1EP8A 2H76A 1ML6A 2VLTA 1WP0A 1MDJA 3HVXA 1PL1A 5EVOA 4XS4A 1RW1A 5J3RA 4WR4A 1M9BA 3TOUA 4POLA 2LSTA 5HFKA 3IC8A 4IP1A 3LG6A 3KTBA 2JACA 5CRWA 2FWGA 4GWRA 1SD9A 2H1AA 4OWYA 3HZ4A 1R7HA 2LUSA 4PNFA 1WMJA 1ZYEA 1NHYA 2GT5A 5G31A 1TP9A 3UIWA 4XHMA 1OKDA 2AHEA 4EO3A 2OACA 4JE1A 2OADA 4PUAA 3TKSC 2CQ9A 2P0GA 3EMXA 3DWVA 2VUPA 2B1LA 3APSA 2NVLA 1UA5A 3ERWA 1TRVA 2MYGA 4X0XA 2CV4A 2GQKA 1Z9HA 2CZ2A 1QK8A 3QAWA 5GAND 3UVTA 6GSVA 1BJXA 1F2EA 5J9CA 1GH2A 2MMAA 2QGVA 1PX7A 1ABAA 4CHSA 1NSWA 3PGTA 3TKQA 3OR5A 2JADA 4KB3A 1SK1A 1A23A 3QFAC 2UZ8A 2YNXA 4EIPA 2IMKA 1FW1A 4HI7A 3CXGA 4MZWA 1X5EA 4IQAA 3APOA 4LMWA 3GSTA 3N9JA 1G6YA 1UVZA 5KN0A 1GUMA 1AQVA 3CTFA 3RPNA 1YF1A 4KX4A 5DQSA 3O6TA 3RBTA 2CVBA 1XW6A 1XIYA 1O8XA 5JCUA 1EOHA 3L4NA 1PFOA 3ZYWA 2HFDA 2BJXA 2FHEA 3UMAA 2P5RA 3KD0A 1X9WB 4KSMA 1B8XA 3R3EA 3IXRA 2DJ2A 2VD0A 3EINA 1IYHA 4POKA 1WE0A 4POBA 4EVMA 5L71A 2C0EA 4YQVA 2RLIA 1FB0A 2H6XA 4Q5RA 2KHPA 3RHCA 4K0GA 5IPGA 1HD2A 1O73A 1XWAA 2DBCA 2ON5A 1PQNA 5ECIB 4NPBA 5IMFA 4ZB9A 4MLYA 4X4JA 4FIWA 3A5IA 3GN3A 3A2VA 3W8JA 2GZPA 3QFBC 1SD8A 5HR2A 4IW9A 3TJJA 3EU3A 3DYRA 3QR6A 1GTIA 4N30A 5GAPD 3GL3A 1LBKA 2JSZA 3WYWA 2QA2A 4JZQA 4EIQA 5HR1A 3G7IA 4MNNA 1J08A 2TRXA 4PX1A 3GH6A 1EGOA 1XXUA 4IVFA 2CX3A 3TKRA 2OBIA 3ZFBA 1GL8A 1USBA 4LLRA 2LJAA 3GSSA 5KN2A 2YPMA 5J4UA 1T4ZA 4F0CA 3SBCA 2PVQA 3LGCA 1TI1A 4O7HA 4IP6A 4ULXA 3QPMA 2VLVA 5CAXA 3C71A 1V9WA 2B5XA 3ME8A 4HQZA 5GZZB 1YDKA 2B7KA 2V41A 2X64A 4HQSA 5DAKB 2XBQA 2LNTA 5ECLB 4D73B 3QAVA 3AY8A 4IS0A 2R0GA 5ELGA 2A2RA 2I3YA 2IJYA 1FOHA 4MF7A 5B8AA 1JLVA 1SKRB 1JHBA 12GSA 3IR4A 3MYDA 3LJRA 1R5PA 4TR4A 1TKDB 1F37A 5KN3A 2LEGA 3TRQA 1OE8A 2GGTA 1TK8B 1GUHA 4K1FA 1RQMA 2C0GA 5BMUA 3N5OA 1PN9A 4N10A 1QMVA 1A8YA 5IOWA 3VPTA 1YY7A 2PBJA 1XG8A 2GSTA 3D0ZA 3ERGA 2C3NA 3F4SA 1LJRA 5AIVA 1SYXA 2H74A 2VAFA 1K0OA 4ECJA 1Z7PA 1S3AA 3TJFA 2IN3A 2VL2A 2WDUA 3WT1A 3KP9A 3C1RA 3G9BA 3BCIA 3HD5A 2AV4A 4BA7A 3O76A 1X0RA 4OFTA 1IYIA 3HVNA 4NV2A 2P5QA 13GSA 1EV9A 4X43A 5B8BA 3UJ1A 1N2AA 1K0CA 1V40A 5H5SA 3C1SA 4HOJA 1ZYQB 4NMUA 4K7OA 1ERWA 3GH9A 4HS1A 1DBYA 1SKWB 2J23A 3ME7A 3ED3A 3KM6A 4NHWA 4LL4B 2IL3A 3VWWA 5DJMA 1B4QA 2VM1A 4HDEA 4ECCA 4MPFA 2FA4A 3ZVJA 4D73A 2R0PA 4K2DA 1TK5B 4XS1A 5KOWA 2RUEA 3A3TA 2YJHA 4TR1B 2DIYA 3ZREA 1XVQA 4XRDA 3TRPA 1FHEA 2DKHA 1X5CA 2R3XA 5DVBA 2R6KA 1AIUA 4L5LA 5ABRA 1PX6A 5KOXA 3WGXA 3O3TA 2E0QA 3FHKA 1SK2A 2HZEA 3J7Yb 3G7JA 3ZRDA 1A2MA 4ZIJA 2H72A 1KBNA 4K5RA 4I5QA 2WS2A 4I2UA 2HRKA 2KP2A 1ERTA 2B7JA 1ZYPA 2YV7A 1EP7A 4Z2UA 1YEPA 2A2SA 2ZCTA 2H8LA 4YAVA 1F6MC 3DXBA 2YN1A 3TJBA 3ZMKA 1U3IA 3IK7A 3IC4A 1XVWA 1OC8A 1TK0B 2FY6A 5ECSA 2VM2A 1S3DA 5GSSA 1WIKA 2YV9A 3KH7A 3D21A 4KDUA 3EC3A 3RDWA 4I8BA 4JEDA 5J5NA 4OD7A 6GSSA 3IK9A 3Q6OA 5D9XA 1SJIA 3IPZA 1Z3EA 4KNDA 1ZCPA 2H6YA 4DSSB 2TIRA 4G2EA 1R4WA 5F8BA 3FR6A 1EZKA 1I9DA 3US3A 4J2FA 3TGZA 2OBKA 2WB9A 5DALB 3UEMA 3KMNA 4PQHA 3H1NA 4BWSA 2DKIA 4TRXA 5D9WA 2YZUA 3TKSA 4TR1A 2Z9SA 4KW6A 2C4JA 2XPDA 1MD3A 2E7PA 2PMTA 2DJ3A 1ZOFA 4E8EA 2GSSA 2OJLA 1TOFA 4MZBA 2PPTA 1K0NA 1F3BA 1TRUA 4L8EA 2XPEA 2X8HA 2L6CA 2HE3A 3GL5A 2LJRA 2BMXA 4Z2TA 4Z2RA 4RI7A 1YKAA 3QOUA 3FR9A 4WETA 1FG4A 3FR3A 1CQHA 4MJEA 4WBRD 2GS3A 4HJ2A 5D9VA 4HJMA 2C0DA 2X8CA 2M80A 2M46A 1M99A 2VCXA 4MDCA 4Q5FA 1BEDA 4MF6A 2VIMA 1RK4A 7GSSA 4XCSA 3GX0A 1T3BA 2ES7A 1HNAA 2K6VA 3FMWA 3TDGA 1QUWA 2HRFA 4EE0A 1M7TA 4YKGA 3HDCA 3LEFA 1GSDA 4L0UA 1PSQA 3GV1A 4BVXB 5IIZA 2JZSA 1GSQA 3JCML 3BCKA 2IWTA 3UL3A 1BX9A 3APQA 3ZMLA 3Q74A 1Q4JA 4KUNA 2H0GA 1SL2B 2JL4A 4IQ1A 1J0FA 4GSSA 1SENA 1OKTA 1M2DA 2QC7A 3KP8A 4DSSA 4WEYA 4XIHA 1O8WA 2RM6A 4HZ4A 4KH7A 2XC2A 3CSHA 2FNOA 1B4PA 4J56E 1Q98A 4V2NA 4YQMA 5DALA 4OMVA 1GLPA 4CY6A 2AJQB 3FZ5A 5D73A 3NZNA 1SKSB 5B7CA 2LQQA 5D9TA 4ILFA 2FD3A 3ZZXA 3IBHA 3C8EA 5HR3A 4PURA 3CTGA 3A5WA 1Y6EA 1FOVA 2YWMA 1XOBA 5B6MA 1FB6A 4Z7XA 1SK0A 5AGYA 1PGTA 1U6TA 4BIKA 1ERVA 4MA9A 2F3MA 2DJ1A 5DBQA 3LXTA 1V2AA 1T00A 2VCVA 3F3QA 1K0DA 4NHZA 3HY2A 3IHQA 6GSUA 1PA3A 1U87A 1PMTA 4V1Ag 2HSHA 2C8UA 2VL3A 2C0FA 2JZRA 1DUGA 4IHUA 4ZBAA 5E4WA 4KAEA 2AUVA 3NIVA 2H75A 2DJKA 5IMVA 1MDIA 2LV3A 4PTSA 2NBSA 1XWCA 2K8VA 4BVXA 3FZ9A 2CAQA 2LNSA 3GIXA 1Z5YE 2F9SA 1A2JA 2YZHA 4LMVA 1PL2A 2H71A 18GSA 1ZMAA 5E59A 3KEBA 1S3CA 5B6NA 4ZL9A 2EIOA 2H1GA 5LNKe 2M72A 2CVDA 1FVKA 2OE1A 5AN1A 2O87A 4MP4A 2X8GA 2V1MA 3QMXA 1M3JA 1B48A 2I81A 4AJ8A 2GQLA 5IO2A 1GWCA 4TKYA 1ILOA 1QQ2A 17GSA 2LS5A 1E6BA 1GULA 2LRTA 5HFIA 3GNJA 2L59A 3R2QA 3SWLA 1MDKA 2IPAA 3I69A 4ZBDA 3KCMA 1TDIA 1ZYNA 5G2ZA 3GKXA 2IIYA 4HU9A 4HEA2 2VCWA 4GQFA 1FO5A 5KN1A 2C3TA 2BTOT 3QAGA 1YF0A 3RPPA 4L0WA 2H66A 3UBKA 1XFLA 1A2LA 1WPIA 1QXHA 1OAZA 2O7KA 3FZ4A 1JZOA 3GUSA 3M0FA 1NW2A 2CZ3A 3EPTA 1PKWA 5COHA 2AYTA 3VPQA 1AQWA 3GFKA 5DDLA 4G0LA 5GSTA 5INYA 2A2PA 1TI3A 3IDVA 2VL9A 2KUCA 3F63A 8GSSA 1EEMA 1QGVA 2REMA 5ELAA 1DSBA 4ECIA 4KF9A 3KIJA 5AIXA 3VFIA 4XS6A 2H1BA 3LSZA 4N11A 1XWBA 5CRGA 4EC0A 3LW9A 2KOKA 5JCGA 4F82A 4H86A 2HYXA 1GSSA 3IRAA 2X4AA 5JWOB 2TRCP 11GSA 1OVNA 1VF4A 2B5YA 6GSTA 2FCHA 2WFCA 3L9VA 1M9AA 3LYPA 3VI7A 5DQYA 1U3AA 4OO5A 3TKSE 4AF2A 20GSA 1XZOA 4PXOA 2CA8A 5ENUA 3C7MA 1OC3A 2CVKA 3MAKA 1Z6MA 3EU4A 3DKSA 1ON4A 4HU7A 3BOAA 3E3EA 4IELA 4A5PA 1AXDA 3FKFA 1TXXA 4EXJA 4OO4A 2OE3A 1YQ1A 6GSWA 3CSIA 1WRYA 2N5BA 4X1UA 5CRDA 1GSUA 2GDRA 1A24A 4DSRA 14GSA 2B1KA 1GLQA 1XWKA 3KMOA 2H70A 3WT2A 1G7EA 4GXZA 2FWHA 2OA7A 5CNWA 1EV4A 4DVCA 4V1Ap 4L5OA 3VK9A 3LXZA 4LA1A 3IA1A 3GYKA 2H0HA 3VWVA 5FHIA 2WULA 3TKPA 3IV4A 3LWAA 2GVPA 3LORA 2GSQA 2JU5A 1GUKA 2X99A 1SJZA 6GSXA 3HCZA 1ZL9A 2DIZA 1R26A 2YWIA 1SL1B 2MZCA 22GSA 1WOUA 3FK8A 4EL1A 3F9UA 5DAKA 3CQFA 1GTBA 4HSCX 1YEXA 5A5KA 1O7UA 1JZDA 4WKWA 3DMLA 5JWQB 1A0RP 5IMZA 1O85A 4PNGA 2YANA 4O5RA 2IMFA 4ECBA 1OE7A 4K7NA 3CRUA 4KDYA 3P8WA 5FT3A 1H75A 2HI7A 2DLXA 2F51A 1EEJA 1M2AA 1Z7RA 3GRXA 4PUFC 1EWXA 4I2TA 4O5QA 5C04A 3IHGA 3D6IA 2R0CA 3M1GA 2A4VA 3TJGA 4EDZA 3L0HA 4POMA 1K3OA 1NM3A 4MMMA 2DSAA 4WR5A 2JSYA 3D22A 2C80A 4WBJA 4ZXGA 2DJ0A 2PVOC 2L5OA 2HSMA 3CSJA 16GSA 3W6GA 4WF5A 1J9BA 4GQCA 3TCOA 2G0FA 3ZVJD 1HYUA 2H01A 4TVEA 2JZTA 3F6FA 2GSRA 2HNLA 5CO3A 4DEJA 1O81A 1PKZA 2R2JA 2C3QA 3FRCA 4XS4B 1V58A 1OYJA 3GKKA 2PGTA 2CX4A 2H30A 2YWNA 4EUYA 3M9JA 4TW5A 1AQXA 3ZIVA 4XTSA 4ZL7A 4TR3A 1DE1A 2LRNA 3LQ7A 2F8AA 3GTUB 2XBIA 3KTLA 3BJ5A 1BAYA 4FO5A 2WGRA 2HRNA 4Q5NA 1WJKA 4FYBA 2E2MA 1K0AA 3LYKA 4ZB6A 1B9YC 4FYCA 1W89A 3EMPA 5F0GA 1VRSD 2IMIA 1UN2A 4G0KA 2VCQA 2O85A 3IAS2 1JZRA 1ZGNA 2V32A 4CY8A 1M0UA 5G1KA 4TXOB 3HJMA 5EL8A 5IMAA 1X9MB 2L4QA 2RM5A 2FWFA
chains in the Genus database with same CATH topology
3EVIA 4MH2A 1FVJA 3M9KA 4BPYA 2B6MA 2H19A 5IOXA 3K8NA 5CRHA 3BD2A 3P90A 4QL7A 4GLTA 1FAAA 2AB6A 5D96A 2RUFA 1PRXA 4GF0A 2GLRA 4AJ7A 2N5AA 4MJAA 4OFMA 1SL0B 3DEXA 3IAM2 1F3AA 2PWJA 2J9HA 4TR0A 5F05A 3VURA 3IOSA 1BG5A 4YKFA 5EPFA 1YJ6A 3KJYA 4JRRA 4QL9A 3M3MA 1K3LA 3HKRA 1TW9A 2PERA 3F0IA 1GRXA 4FQUA 5F07A 3ZTLA 1SYRA 1URMA 4MJBA 2K18A 4MZCA 3UVHA 1MD4A 5A4UA 3UOMA 1TJDA 2C1YA 2YOIA 4O92A 2V2GA 1T8EB 1U88A 4IGJA 3A2XA 4ML1A 4QQ7A 3GTUA 3QD9A 19GSA 3HJOA 5IQYA 4F0BA 1THXA 3CRTA 3ZFLA 2HT9A 1B9XC 1M2BA 2HRAA 1T4YA 4XRAA 1AUCA 3I6AA 10GSA 2GT6A 3TJKA 3QCPA 4ISDA 5IMCA 2VCTA 3H8QA 3V1WA 4Q5QA 4DSQA 2O89A 3CBUA 3EWLA 3DD3A 2B5EA 2VCZA 4TXOA 1GSFA 2V6KA 4O32A 4YAPA 2H6ZA 5ECRB 5CREA 5LD0A 5BRTA 4CW9A 3ERFA 1H4OA 2IFQB 2FA8A 1UC7A 1V57A 1XW5A 3E9JB 2ZNMA 1A0FA 1THOA 4OCFA 2HZFA 3HVSA 2WZ9A 2H73A 2NPBA 1XCCA 4K0NA 3KH9A 3D4TA 5ECHB 3GURA 1W4VA 1SJ6A 2LJKA 1QFNA 3HJPA 1JLWA 1T7PB 1KNGA 2YJ7A 3G7YA 1Y25A 1OC9B 1F9MA 5H5RA 5JCWA 1YZXA 4IKHA 2P31A 3RAZA 2OKAA 4PQIA 2HLSA 1TTZA 1WWJA 1NHOA 3PINA 4NWYA 4V2LA 1LU4A 3J7Yk 3C73A 4I6XA 4TXVA 4KDXA 4KE3A 4AJ6A 4IN0A 2RIIA 5C00A 1BQ7A 1X9SB 4TOPA 4K7IA 1TU7A 5IMDA 2VLUA 2GTUA 3ZITA 1JZWA 3FZAA 1TRWA 5LCZA 4BVYB 5ID2B 5IPHA 3TOTA 4ML6A 1I5GA 3FYGA 3GKNA 3GX8A 1YKCA 2GZZA 1T1VA 3HHVA 2FWEA 4J57E 3RHBA 1O6JA 5G5FA 3EYTA 3MNGA 2YCDA 2CT6A 2PN8A 5IO0A 4ACSA 4RUVA 4MABA 4OFNA 1GNWA 5HFGA 4F03A 2H1DA 2HXKA 3CMIA 2X49A 3MSZA 9GSSA 3QDNA 2WCIA 2VOCA 4CDOA 2FLSA 5ECKB 2IFQA 2LKUA 3MIXA 3DVWA 3FW2A 3W8SA 5ECNB 5ECQB 2R37A 2WRTA 3PH9A 3VWXA 3M8NA 4BL7B 5HR0A 4IBPA 5DCHA 3EE2A 3HXSA 2N5FA 1KEBA 2ZUPA 4KCAA 2HSYA 3LFLA 1BYEA 2DMLA 4N0ZA 1MTCA 3GKMA 3DRNA 1G0TA 2FGXA 5HQPA 3F8UA 2ALBA 1GSYA 2FUG2 4G0IA 1OC9A 3E0UA 3P7XA 4K2XA 3ZIJA 2KP1A 2MBSA 1AAZA 1XW9A 4G19A 5H5QA 5FWGA 4I97A 3H79A 2KLXA 1SU9A 3DIEA 1VF3A 5ECMB 4YQUA 3DGQA 3UARA 3L9SA 4BVYA 4K8MA 5ID2A 4KGIA 4MK3A 4JR4A 4F9ZA 1PD21 4NXIA 4EDYA 2R4VA 3HVVA 1HQOA 3UBLA 3L9UA 1GP1A 5CP1A 2LTKA 3ZLPA 1XBSA 4JR6A 4JU5A 4K5SA 4K6XA 4PQ1A 3U6VA 3WGDA 2I1UA 2HZEB 3F3RA 3H4KA 2G2QA 4GTUA 4ZL8A 3TRXA 4ZILA 1CQGA 5F06A 3VWUA 2O8VB 1X5DA 3PR8A 1A8LA 4GSNA 2V6OA 3UAPA 1ST9A 1MEKA 3TUEA 4G10A 3HYPA 4MCUA 2LRCA 4BL7A 1EGRA 5KEJA 3FEUA 4KCEA 3U5RE 1V98A 2IMDA 4IJ3A 4EF0A 1E2YA 2MBTA 1GTUA 5A4WA 4WF4A 4NV5A 5J9BA 3MDKA 4ICYA 4RQRA 5DJLA 1GTAA 2F8FA 1Z6NA 2DMMA 4ZB8A 2B3SA 5AISA 2QSIA 2EC4A 3VLNA 2AAWA 3HA9A 3VI5A 5DCGA 1K3YA 2L5LA 2MMNA 4GCIA 1XOAA 1C72A 1PN0A 4K9ZA 1TRSA 4P3YB 2QA1A 5JWRB 2CAIA 3FY7A 4TN8A 5G1LA 2L6DA 2EIRA 1AC1A 3ZL5A 5G5EA 3IE3A 5ECPB 3ISOA 3DVXA 1R5AA 4FYUA 1VF1A 3P2AA 2PUKC 1GSEA 4GRFA 4RQXA 4PGTA 3BBYA 3EURA 2K9FA 2DJJA 2XHFA 2VL2C 2H0IA 3S9FA 5IM9A 3HZ8A 1G7OA 2WJUA 3F4TA 1AW9A 4BWQA 3TB2A 3GHAA 2LQOA 4MPGA 4O5UA 3GA4A 1KTEA 2L57A 1G6WA 3MWHA 1EOGA 2MMZA 4MJCA 2VD1A 1VGLA 2VO4A 1ERUA 2D2ZA 4ZBBA 3CYNA 3F6DA 2GQMA 4WXTA 2EIQA 2PU9C 1DE2A 5G30A 1JFUA 3KXOA 2DC5A 2I9HA 4EKZA 4MF5A 4OCEA 2NTOA 4USSA 4MH3A 4GSTA 3H93A 4HUAA 3Q18A 5CYYA 2QKEA 4IJIA 3GMFA 1XWGA 3WD6A 2NDOA 2K8SA 1K0BA 2YP6A 4RI6A 5J41A 1K0MA 4YH2A 2A4HA 3Q19A 2I4AA 3I9V2 5EY6A 3F4RA 3D5JA 2MMOA 6GSYA 3KGKA 3A2WA 3PPUA 4N0VA 4V2MA 4JBBA 2E2GA 3L78A 4AGSA 2GZYA 4F2IA 5D93A 4KSOA 4G9HA 1TU8A 2OE0A 1N8JA 3KZQA 3WGEA 4HZ2A 1XPVA 1ZZYA 2YWOA 4E8HA 3NOFA 4NAXA 1GNEA 1HNCA 2R5GA 3I43A 4LL1B 2IMEA 4ID0A 4FH8A 1HNBA 1VF2A 3D4MA 5ECOB 1ACVA 5D8IA 4KA0A 2L4CA 2ON7A 5A4VA 1EP8A 2H76A 1ML6A 2VLTA 1WP0A 1MDJA 3HVXA 1PL1A 5EVOA 4XS4A 1RW1A 5J3RA 4WR4A 1M9BA 3TOUA 4POLA 2LSTA 5HFKA 3IC8A 4IP1A 3LG6A 3KTBA 2JACA 5CRWA 2FWGA 4GWRA 1SD9A 2H1AA 4OWYA 3HZ4A 1R7HA 2LUSA 4PNFA 1WMJA 1ZYEA 1NHYA 2GT5A 5G31A 1TP9A 3UIWA 4XHMA 1OKDA 2AHEA 4EO3A 2OACA 4JE1A 2OADA 4PUAA 3TKSC 2CQ9A 2P0GA 3EMXA 3DWVA 2VUPA 2B1LA 3APSA 2NVLA 1UA5A 3ERWA 1TRVA 2MYGA 4X0XA 2CV4A 2GQKA 1Z9HA 2CZ2A 1QK8A 3QAWA 5GAND 3UVTA 6GSVA 1BJXA 1F2EA 5J9CA 1GH2A 2MMAA 2QGVA 1PX7A 1ABAA 4CHSA 1NSWA 3PGTA 3TKQA 3OR5A 2JADA 4KB3A 1SK1A 1A23A 3QFAC 2UZ8A 2YNXA 4EIPA 2IMKA 1FW1A 4HI7A 3CXGA 4MZWA 1X5EA 4IQAA 3APOA 4LMWA 3GSTA 3N9JA 1G6YA 1UVZA 5KN0A 1GUMA 1AQVA 3CTFA 3RPNA 1YF1A 4KX4A 5DQSA 3O6TA 3RBTA 2CVBA 1XW6A 1XIYA 1O8XA 5JCUA 1EOHA 3L4NA 3ZYWA 2HFDA 2BJXA 2FHEA 3UMAA 2P5RA 3KD0A 1X9WB 4KSMA 1B8XA 3R3EA 3IXRA 2DJ2A 2VD0A 3EINA 1IYHA 4POKA 1WE0A 4POBA 4EVMA 5L71A 2C0EA 4YQVA 2RLIA 1FB0A 2H6XA 4Q5RA 2KHPA 3RHCA 4K0GA 5IPGA 1HD2A 1O73A 1XWAA 2DBCA 2ON5A 1PQNA 5ECIB 4NPBA 5IMFA 4ZB9A 4MLYA 4X4JA 4FIWA 3A5IA 3GN3A 3A2VA 3W8JA 2GZPA 3QFBC 1SD8A 5HR2A 4IW9A 3TJJA 3EU3A 3DYRA 3QR6A 1GTIA 4N30A 5GAPD 3GL3A 1LBKA 2JSZA 3WYWA 2QA2A 4JZQA 4EIQA 5HR1A 3G7IA 4MNNA 1J08A 2TRXA 4PX1A 3GH6A 1EGOA 1XXUA 4IVFA 2CX3A 3TKRA 2OBIA 3ZFBA 1GL8A 1USBA 4LLRA 2LJAA 3GSSA 5KN2A 2YPMA 5J4UA 1T4ZA 4F0CA 3SBCA 2PVQA 3LGCA 1TI1A 4O7HA 4IP6A 4ULXA 3QPMA 2VLVA 5CAXA 3C71A 1V9WA 2B5XA 3ME8A 4HQZA 5GZZB 1YDKA 2B7KA 2V41A 2X64A 4HQSA 5DAKB 2XBQA 2LNTA 5ECLB 4D73B 3QAVA 3AY8A 4IS0A 2R0GA 5ELGA 2A2RA 2I3YA 2IJYA 1FOHA 4MF7A 5B8AA 1JLVA 1SKRB 1JHBA 12GSA 3IR4A 3MYDA 3LJRA 1R5PA 4TR4A 1TKDB 1F37A 5KN3A 2LEGA 3TRQA 1OE8A 2GGTA 1TK8B 1GUHA 4K1FA 1RQMA 2C0GA 5BMUA 3N5OA 1PN9A 4N10A 1QMVA 1A8YA 5IOWA 3VPTA 1YY7A 2PBJA 2GSTA 3D0ZA 3ERGA 2C3NA 3F4SA 1LJRA 5AIVA 1SYXA 2H74A 2VAFA 1K0OA 4ECJA 1Z7PA 1S3AA 3TJFA 2IN3A 2VL2A 2WDUA 3WT1A 3KP9A 3C1RA 3G9BA 3BCIA 3HD5A 2AV4A 4BA7A 3O76A 1X0RA 4OFTA 1IYIA 4NV2A 2P5QA 13GSA 1EV9A 4X43A 5B8BA 3UJ1A 1N2AA 1K0CA 1V40A 5H5SA 3C1SA 4HOJA 1ZYQB 4NMUA 4K7OA 1ERWA 3GH9A 4HS1A 1DBYA 1SKWB 2J23A 3ME7A 3ED3A 3KM6A 4NHWA 4LL4B 2IL3A 3VWWA 5DJMA 1B4QA 2VM1A 4HDEA 4ECCA 4MPFA 2FA4A 3ZVJA 4D73A 2R0PA 4K2DA 1TK5B 4XS1A 5KOWA 2RUEA 3A3TA 2YJHA 4TR1B 2DIYA 3ZREA 1XVQA 4XRDA 3TRPA 1FHEA 2DKHA 1X5CA 2R3XA 5DVBA 2R6KA 1AIUA 4L5LA 5ABRA 1PX6A 5KOXA 3WGXA 3O3TA 2E0QA 3FHKA 1SK2A 2HZEA 3J7Yb 3G7JA 3ZRDA 1A2MA 4ZIJA 2H72A 1KBNA 4K5RA 4I5QA 2WS2A 4I2UA 2HRKA 2KP2A 1ERTA 2B7JA 1ZYPA 2YV7A 1EP7A 4Z2UA 1YEPA 2A2SA 2ZCTA 2H8LA 4YAVA 1F6MC 3DXBA 2YN1A 3TJBA 3ZMKA 1U3IA 3IK7A 3IC4A 1XVWA 1OC8A 1TK0B 2FY6A 5ECSA 2VM2A 1S3DA 5GSSA 1WIKA 2YV9A 3KH7A 3D21A 4KDUA 3EC3A 3RDWA 4I8BA 4JEDA 5J5NA 4OD7A 6GSSA 3IK9A 3Q6OA 5D9XA 1SJIA 3IPZA 1Z3EA 4KNDA 1ZCPA 2H6YA 4DSSB 2TIRA 4G2EA 1R4WA 5F8BA 3FR6A 1EZKA 1I9DA 3US3A 4J2FA 3TGZA 2OBKA 2WB9A 5DALB 3UEMA 3KMNA 4PQHA 3H1NA 4BWSA 2DKIA 4TRXA 5D9WA 2YZUA 3TKSA 4TR1A 2Z9SA 4KW6A 2C4JA 2XPDA 1MD3A 2E7PA 2PMTA 2DJ3A 1ZOFA 4E8EA 2GSSA 2OJLA 1TOFA 4MZBA 2PPTA 1K0NA 1F3BA 1TRUA 4L8EA 2XPEA 2X8HA 2L6CA 2HE3A 3GL5A 2LJRA 2BMXA 4Z2TA 4Z2RA 4RI7A 1YKAA 3QOUA 3FR9A 4WETA 1FG4A 3FR3A 1CQHA 4MJEA 4WBRD 2GS3A 4HJ2A 5D9VA 4HJMA 2C0DA 2X8CA 2M80A 2M46A 1M99A 2VCXA 4MDCA 4Q5FA 1BEDA 4MF6A 2VIMA 1RK4A 7GSSA 4XCSA 3GX0A 1T3BA 2ES7A 1HNAA 2K6VA 3FMWA 3TDGA 1QUWA 2HRFA 4EE0A 1M7TA 4YKGA 3HDCA 3LEFA 1GSDA 4L0UA 1PSQA 3GV1A 4BVXB 5IIZA 2JZSA 1GSQA 3JCML 3BCKA 2IWTA 3UL3A 1BX9A 3APQA 3ZMLA 3Q74A 1Q4JA 4KUNA 2H0GA 1SL2B 2JL4A 4IQ1A 1J0FA 4GSSA 1SENA 1OKTA 1M2DA 2QC7A 3KP8A 4DSSA 4WEYA 4XIHA 1O8WA 2RM6A 4HZ4A 4KH7A 2XC2A 3CSHA 2FNOA 1B4PA 4J56E 1Q98A 4V2NA 4YQMA 5DALA 4OMVA 1GLPA 4CY6A 2AJQB 3FZ5A 5D73A 3NZNA 1SKSB 5B7CA 2LQQA 5D9TA 4ILFA 2FD3A 3ZZXA 3IBHA 3C8EA 5HR3A 4PURA 3CTGA 3A5WA 1Y6EA 1FOVA 2YWMA 1XOBA 5B6MA 1FB6A 4Z7XA 1SK0A 5AGYA 1PGTA 1U6TA 1ERVA 4MA9A 2F3MA 2DJ1A 5DBQA 3LXTA 1V2AA 1T00A 2VCVA 3F3QA 1K0DA 4NHZA 3HY2A 3IHQA 6GSUA 1PA3A 1U87A 1PMTA 4V1Ag 2HSHA 2C8UA 2VL3A 2C0FA 2JZRA 1DUGA 4IHUA 4ZBAA 5E4WA 4KAEA 2AUVA 3NIVA 2H75A 2DJKA 5IMVA 1MDIA 2LV3A 4PTSA 2NBSA 1XWCA 2K8VA 4BVXA 3FZ9A 2CAQA 2LNSA 3GIXA 1Z5YE 2F9SA 1A2JA 2YZHA 4LMVA 1PL2A 2H71A 18GSA 1ZMAA 5E59A 3KEBA 1S3CA 5B6NA 4ZL9A 2EIOA 2H1GA 5LNKe 2M72A 2CVDA 1FVKA 2OE1A 5AN1A 2O87A 4MP4A 2X8GA 2V1MA 3QMXA 1B48A 2I81A 4AJ8A 2GQLA 5IO2A 1GWCA 4TKYA 1ILOA 1QQ2A 17GSA 2LS5A 1E6BA 1GULA 2LRTA 5HFIA 3GNJA 2L59A 3R2QA 3SWLA 1MDKA 2IPAA 3I69A 4ZBDA 3KCMA 1TDIA 1ZYNA 5G2ZA 3GKXA 2IIYA 4HU9A 4HEA2 2VCWA 4GQFA 1FO5A 5KN1A 2C3TA 2BTOT 3QAGA 1YF0A 3RPPA 4L0WA 2H66A 3UBKA 1XFLA 1A2LA 1WPIA 1QXHA 1OAZA 2O7KA 3FZ4A 1JZOA 3GUSA 3M0FA 1NW2A 2CZ3A 3EPTA 1PKWA 5COHA 2AYTA 3VPQA 1AQWA 3GFKA 5DDLA 4G0LA 5GSTA 5INYA 2A2PA 1TI3A 3IDVA 2VL9A 2KUCA 3F63A 8GSSA 1EEMA 1QGVA 2REMA 5ELAA 1DSBA 4ECIA 4KF9A 3KIJA 5AIXA 3VFIA 4XS6A 2H1BA 3LSZA 4N11A 1XWBA 5CRGA 4EC0A 3LW9A 2KOKA 5JCGA 4F82A 4H86A 2HYXA 1GSSA 3IRAA 2X4AA 5JWOB 2TRCP 11GSA 1OVNA 1VF4A 2B5YA 6GSTA 2FCHA 2WFCA 3L9VA 1M9AA 3LYPA 3VI7A 5DQYA 1U3AA 4OO5A 3TKSE 4AF2A 20GSA 1XZOA 4PXOA 2CA8A 5ENUA 3C7MA 1OC3A 2CVKA 3MAKA 1Z6MA 3EU4A 3DKSA 1ON4A 4HU7A 3BOAA 3E3EA 4IELA 4A5PA 1AXDA 3FKFA 1TXXA 4EXJA 4OO4A 2OE3A 1YQ1A 6GSWA 3CSIA 1WRYA 2N5BA 4X1UA 5CRDA 1GSUA 2GDRA 1A24A 4DSRA 14GSA 2B1KA 1GLQA 1XWKA 3KMOA 2H70A 3WT2A 1G7EA 4GXZA 2FWHA 2OA7A 5CNWA 1EV4A 4DVCA 4V1Ap 4L5OA 3VK9A 3LXZA 4LA1A 3IA1A 3GYKA 2H0HA 3VWVA 5FHIA 2WULA 3TKPA 3IV4A 3LWAA 2GVPA 3LORA 2GSQA 2JU5A 1GUKA 2X99A 1SJZA 6GSXA 3HCZA 1ZL9A 2DIZA 1R26A 2YWIA 1SL1B 2MZCA 22GSA 1WOUA 3FK8A 4EL1A 3F9UA 5DAKA 1GTBA 1YEXA 5A5KA 1O7UA 1JZDA 4WKWA 3DMLA 5JWQB 1A0RP 5IMZA 1O85A 4PNGA 2YANA 4O5RA 2IMFA 4ECBA 1OE7A 4K7NA 3CRUA 4KDYA 3P8WA 5FT3A 1H75A 2HI7A 2DLXA 2F51A 1EEJA 1M2AA 1Z7RA 3GRXA 4PUFC 1EWXA 4I2TA 4O5QA 5C04A 3IHGA 3D6IA 2R0CA 3M1GA 2A4VA 3TJGA 4EDZA 3L0HA 4POMA 1K3OA 1NM3A 4MMMA 2DSAA 4WR5A 2JSYA 3D22A 2C80A 4WBJA 4ZXGA 2DJ0A 2PVOC 2L5OA 2HSMA 3CSJA 16GSA 3W6GA 4WF5A 1J9BA 4GQCA 3TCOA 2G0FA 3ZVJD 1HYUA 2H01A 4TVEA 2JZTA 3F6FA 2GSRA 2HNLA 5CO3A 4DEJA 1O81A 1PKZA 2R2JA 2C3QA 3FRCA 4XS4B 1V58A 1OYJA 3GKKA 2PGTA 2CX4A 2H30A 2YWNA 4EUYA 3M9JA 4TW5A 1AQXA 3ZIVA 4XTSA 4ZL7A 4TR3A 1DE1A 2LRNA 3LQ7A 2F8AA 3GTUB 2XBIA 3KTLA 3BJ5A 1BAYA 4FO5A 2WGRA 2HRNA 4Q5NA 1WJKA 4FYBA 2E2MA 1K0AA 3LYKA 4ZB6A 1B9YC 4FYCA 1W89A 3EMPA 5F0GA 1VRSD 2IMIA 1UN2A 4G0KA 2VCQA 2O85A 3IAS2 1JZRA 1ZGNA 2V32A 4CY8A 1M0UA 5G1KA 4TXOB 3HJMA 5EL8A 5IMAA 1X9MB 2L4QA 2RM5A 2FWFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EVI A;  4MH2 A;  1FVJ A;  3M9K A;  4BPY A;  2B6M A;  2H19 A;  5IOX A;  3K8N A;  5CRH A;  3BD2 A;  3P90 A;  4QL7 A;  4GLT A;  1FAA A;  2AB6 A;  5D96 A;  2RUF A;  1PRX A;  4GF0 A;  2GLR A;  4AJ7 A;  2N5A A;  4MJA A;  4OFM A;  1SL0 B;  3DEX A;  3IAM 2;  1F3A A;  2PWJ A;  2J9H A;  4TR0 A;  5F05 A;  3VUR A;  3IOS A;  1BG5 A;  5EPF A;  1YJ6 A;  3KJY A;  4JRR A;  4QL9 A;  3M3M A;  1K3L A;  3HKR A;  1TW9 A;  2PER A;  3F0I A;  1GRX A;  5F07 A;  3ZTL A;  1SYR A;  1URM A;  4MJB A;  2K18 A;  4MZC A;  3UVH A;  1MD4 A;  5A4U A;  3UOM A;  1TJD A;  2C1Y A;  2YOI A;  4O92 A;  2V2G A;  1T8E B;  1U88 A;  4IGJ A;  3A2X A;  4ML1 A;  4QQ7 A;  3GTU A;  3QD9 A;  19GS A;  3HJO A;  5IQY A;  4F0B A;  1THX A;  3CRT A;  3ZFL A;  2HT9 A;  1B9X C;  1M2B A;  1T4Y A;  4XRA A;  1AUC A;  3I6A A;  10GS A;  2GT6 A;  3TJK A;  3QCP A;  4ISD A;  5IMC A;  2VCT A;  3H8Q A;  3V1W A;  4Q5Q A;  4DSQ A;  2O89 A;  3CBU A;  3EWL A;  3DD3 A;  2B5E A;  2VCZ A;  4TXO A;  1GSF A;  2V6K A;  4O32 A;  4YAP A;  2H6Z A;  5ECR B;  5CRE A;  5LD0 A;  4CW9 A;  3ERF A;  1H4O A;  2IFQ B;  2FA8 A;  1UC7 A;  1V57 A;  1XW5 A;  3E9J B;  2ZNM A;  1A0F A;  1THO A;  4OCF A;  2HZF A;  3HVS A;  2WZ9 A;  2H73 A;  2NPB A;  1XCC A;  4K0N A;  3KH9 A;  3D4T A;  5ECH B;  3GUR A;  1W4V A;  1SJ6 A;  2LJK A;  1QFN A;  3HJP A;  1JLW A;  1T7P B;  1KNG A;  2YJ7 A;  3G7Y A;  1Y25 A;  1OC9 B;  1F9M A;  5H5R A;  5JCW A;  1YZX A;  4IKH A;  2P31 A;  3RAZ A;  2OKA A;  4PQI A;  2HLS A;  1TTZ A;  1WWJ A;  1NHO A;  3PIN A;  4NWY A;  4V2L A;  1LU4 A;  3J7Y k;  3C73 A;  4I6X A;  4TXV A;  4KDX A;  4KE3 A;  4AJ6 A;  4IN0 A;  2RII A;  5C00 A;  1BQ7 A;  1X9S B;  4TOP A;  4K7I A;  1TU7 A;  5IMD A;  2VLU A;  2GTU A;  3ZIT A;  1JZW A;  3FZA A;  1TRW A;  5LCZ A;  5ID2 B;  5IPH A;  3TOT A;  4ML6 A;  1I5G A;  3FYG A;  3GKN A;  3GX8 A;  1YKC A;  2GZZ A;  1T1V A;  3HHV A;  2FWE A;  4J57 E;  3RHB A;  1O6J A;  5G5F A;  3EYT A;  3MNG A;  2YCD A;  2CT6 A;  2PN8 A;  5IO0 A;  4ACS A;  4RUV A;  4MAB A;  4OFN A;  1GNW A;  5HFG A;  4F03 A;  2H1D A;  2HXK A;  3CMI A;  3MSZ A;  9GSS A;  3QDN A;  2WCI A;  2VOC A;  4CDO A;  2FLS A;  5ECK B;  2IFQ A;  2LKU A;  3DVW A;  3FW2 A;  3W8S A;  5ECN B;  5ECQ B;  2R37 A;  2WRT A;  3PH9 A;  3VWX A;  3M8N A;  5HR0 A;  4IBP A;  5DCH A;  3EE2 A;  3HXS A;  2N5F A;  1KEB A;  2ZUP A;  4KCA A;  2HSY A;  3LFL A;  1BYE A;  2DML A;  4N0Z A;  1MTC A;  3GKM A;  3DRN A;  1G0T A;  2FGX A;  5HQP A;  3F8U A;  2ALB A;  1GSY A;  2FUG 2;  1OC9 A;  3E0U A;  3P7X A;  3ZIJ A;  2KP1 A;  2MBS A;  1AAZ A;  1XW9 A;  4G19 A;  5H5Q A;  5FWG A;  4I97 A;  3H79 A;  2KLX A;  1SU9 A;  3DIE A;  1VF3 A;  5ECM B;  4YQU A;  3DGQ A;  3UAR A;  3L9S A;  4BVY A;  4K8M A;  5ID2 A;  4KGI A;  4MK3 A;  4JR4 A;  4F9Z A;  1PD2 1;  4NXI A;  4EDY A;  2R4V A;  3HVV A;  1HQO A;  3UBL A;  3L9U A;  1GP1 A;  5CP1 A;  2LTK A;  3ZLP A;  1XBS A;  4JR6 A;  4JU5 A;  4K6X A;  4PQ1 A;  3U6V A;  3WGD A;  2I1U A;  2HZE B;  3F3R A;  3H4K A;  2G2Q A;  4GTU A;  4ZL8 A;  3TRX A;  4ZIL A;  1CQG A;  5F06 A;  3VWU A;  2O8V B;  1X5D A;  3PR8 A;  1A8L A;  4GSN A;  2V6O A;  3UAP A;  1ST9 A;  1MEK A;  3TUE A;  4G10 A;  3HYP A;  4MCU A;  2LRC A;  4BL7 A;  1EGR A;  5KEJ A;  3FEU A;  4KCE A;  3U5R E;  1V98 A;  2IMD A;  4IJ3 A;  4EF0 A;  1E2Y A;  2MBT A;  1GTU A;  5A4W A;  4WF4 A;  4NV5 A;  5J9B A;  3MDK A;  4RQR A;  5DJL A;  1GTA A;  2F8F A;  1Z6N A;  2DMM A;  4ZB8 A;  2B3S A;  5AIS A;  2QSI A;  2EC4 A;  3VLN A;  2AAW A;  3HA9 A;  3VI5 A;  5DCG A;  1K3Y A;  2L5L A;  2MMN A;  4GCI A;  1XOA A;  1C72 A;  4K9Z A;  1TRS A;  4P3Y B;  5JWR B;  2CAI A;  3FY7 A;  4TN8 A;  5G1L A;  2L6D A;  2EIR A;  1AC1 A;  3ZL5 A;  5G5E A;  3IE3 A;  5ECP B;  3ISO A;  3DVX A;  1R5A A;  4FYU A;  1VF1 A;  3P2A A;  2PUK C;  1GSE A;  4GRF A;  4RQX A;  4PGT A;  3BBY A;  3EUR A;  2K9F A;  2DJJ A;  2XHF A;  2VL2 C;  2H0I A;  3S9F A;  5IM9 A;  3HZ8 A;  1G7O A;  2WJU A;  3F4T A;  1AW9 A;  4BWQ A;  3TB2 A;  3GHA A;  2LQO A;  4MPG A;  3GA4 A;  1KTE A;  2L57 A;  1G6W A;  3MWH A;  1EOG A;  2MMZ A;  4MJC A;  2VD1 A;  1VGL A;  2VO4 A;  1ERU A;  2D2Z A;  4ZBB A;  3CYN A;  3F6D A;  2GQM A;  4WXT A;  2EIQ A;  2PU9 C;  1DE2 A;  5G30 A;  1JFU A;  3KXO A;  2DC5 A;  2I9H A;  4EKZ A;  4MF5 A;  4OCE A;  2NTO A;  4MH3 A;  4GST A;  3H93 A;  4HUA A;  3Q18 A;  5CYY A;  2QKE A;  4IJI A;  3GMF A;  1XWG A;  3WD6 A;  2NDO A;  2K8S A;  1K0B A;  2YP6 A;  4RI6 A;  5J41 A;  1K0M A;  4YH2 A;  3Q19 A;  2I4A A;  3I9V 2;  5EY6 A;  3F4R A;  3D5J A;  2MMO A;  6GSY A;  3KGK A;  3A2W A;  4N0V A;  4V2M A;  4JBB A;  2E2G A;  3L78 A;  4AGS A;  2GZY A;  4F2I A;  5D93 A;  4KSO A;  4G9H A;  1TU8 A;  2OE0 A;  1N8J A;  3KZQ A;  3WGE A;  4HZ2 A;  1XPV A;  1ZZY A;  2YWO A;  4E8H A;  3NOF A;  4NAX A;  1GNE A;  1HNC A;  2R5G A;  3I43 A;  4LL1 B;  2IME A;  4ID0 A;  4FH8 A;  1HNB A;  1VF2 A;  3D4M A;  5ECO B;  1ACV A;  5D8I A;  4KA0 A;  2L4C A;  2ON7 A;  5A4V A;  1EP8 A;  2H76 A;  1ML6 A;  2VLT A;  1WP0 A;  1MDJ A;  3HVX A;  1PL1 A;  5EVO A;  4XS4 A;  1RW1 A;  5J3R A;  4WR4 A;  1M9B A;  3TOU A;  4POL A;  2LST A;  5HFK A;  4IP1 A;  3LG6 A;  3KTB A;  2JAC A;  5CRW A;  2FWG A;  4GWR A;  1SD9 A;  2H1A A;  4OWY A;  3HZ4 A;  1R7H A;  2LUS A;  4PNF A;  1WMJ A;  1ZYE A;  1NHY A;  2GT5 A;  5G31 A;  1TP9 A;  3UIW A;  4XHM A;  1OKD A;  2AHE A;  4EO3 A;  2OAC A;  4JE1 A;  2OAD A;  4PUA A;  3TKS C;  2CQ9 A;  2P0G A;  3EMX A;  3DWV A;  2VUP A;  2B1L A;  3APS A;  2NVL A;  1UA5 A;  3ERW A;  1TRV A;  2MYG A;  4X0X A;  2CV4 A;  2GQK A;  1Z9H A;  2CZ2 A;  1QK8 A;  3QAW A;  5GAN D;  3UVT A;  6GSV A;  1BJX A;  1F2E A;  5J9C A;  1GH2 A;  2MMA A;  2QGV A;  1PX7 A;  1ABA A;  4CHS A;  1NSW A;  3PGT A;  3TKQ A;  3OR5 A;  2JAD A;  4KB3 A;  1SK1 A;  1A23 A;  3QFA C;  2YNX A;  2IMK A;  1FW1 A;  4HI7 A;  3CXG A;  4MZW A;  1X5E A;  4IQA A;  3APO A;  4LMW A;  3GST A;  3N9J A;  1G6Y A;  1UVZ A;  5KN0 A;  1GUM A;  1AQV A;  3CTF A;  3RPN A;  1YF1 A;  4KX4 A;  5DQS A;  3O6T A;  3RBT A;  2CVB A;  1XW6 A;  1XIY A;  1O8X A;  5JCU A;  1EOH A;  3L4N A;  3ZYW A;  2HFD A;  2BJX A;  2FHE A;  3UMA A;  2P5R A;  3KD0 A;  1X9W B;  4KSM A;  1B8X A;  3IXR A;  2DJ2 A;  2VD0 A;  3EIN A;  1IYH A;  4POK A;  1WE0 A;  4POB A;  4EVM A;  5L71 A;  2C0E A;  4YQV A;  2RLI A;  1FB0 A;  2H6X A;  4Q5R A;  2KHP A;  3RHC A;  4K0G A;  5IPG A;  1HD2 A;  1O73 A;  1XWA A;  2DBC A;  2ON5 A;  1PQN A;  5ECI B;  4NPB A;  5IMF A;  4ZB9 A;  4MLY A;  4FIW A;  3GN3 A;  3A2V A;  3W8J A;  2GZP A;  3QFB C;  1SD8 A;  5HR2 A;  4IW9 A;  3TJJ A;  3EU3 A;  3DYR A;  3QR6 A;  1GTI A;  4N30 A;  5GAP D;  3GL3 A;  1LBK A;  2JSZ A;  3WYW A;  4JZQ A;  5HR1 A;  3G7I A;  1J08 A;  2TRX A;  4PX1 A;  3GH6 A;  1EGO A;  1XXU A;  4IVF A;  2CX3 A;  3TKR A;  2OBI A;  3ZFB A;  1GL8 A;  1USB A;  4LLR A;  2LJA A;  3GSS A;  5KN2 A;  2YPM A;  5J4U A;  1T4Z A;  4F0C A;  3SBC A;  2PVQ A;  3LGC A;  1TI1 A;  4O7H A;  4IP6 A;  4ULX A;  3QPM A;  2VLV A;  5CAX A;  3C71 A;  1V9W A;  2B5X A;  3ME8 A;  4HQZ A;  5GZZ B;  1YDK A;  2B7K A;  2V41 A;  2X64 A;  4HQS A;  5DAK B;  2XBQ A;  2LNT A;  5ECL B;  4D73 B;  3QAV A;  3AY8 A;  4IS0 A;  5ELG A;  2A2R A;  2I3Y A;  2IJY A;  4MF7 A;  5B8A A;  1JLV A;  1SKR B;  1JHB A;  12GS A;  3IR4 A;  3LJR A;  1R5P A;  4TR4 A;  1TKD B;  1F37 A;  5KN3 A;  2LEG A;  3TRQ A;  1OE8 A;  2GGT A;  1TK8 B;  1GUH A;  4K1F A;  1RQM A;  2C0G A;  3N5O A;  1PN9 A;  4N10 A;  1QMV A;  1A8Y A;  5IOW A;  3VPT A;  1YY7 A;  2PBJ A;  2GST A;  3D0Z A;  3ERG A;  2C3N A;  3F4S A;  1LJR A;  5AIV A;  1SYX A;  2H74 A;  2VAF A;  1K0O A;  4ECJ A;  1Z7P A;  1S3A A;  3TJF A;  2IN3 A;  2VL2 A;  2WDU A;  3WT1 A;  3KP9 A;  3C1R A;  3G9B A;  3BCI A;  3HD5 A;  2AV4 A;  4BA7 A;  3O76 A;  1X0R A;  4OFT A;  1IYI A;  4NV2 A;  2P5Q A;  13GS A;  1EV9 A;  4X43 A;  5B8B A;  3UJ1 A;  1N2A A;  1K0C A;  1V40 A;  5H5S A;  3C1S A;  4HOJ A;  1ZYQ B;  4NMU A;  4K7O A;  1ERW A;  3GH9 A;  4HS1 A;  1DBY A;  1SKW B;  2J23 A;  3ME7 A;  3ED3 A;  3KM6 A;  4NHW A;  4LL4 B;  2IL3 A;  3VWW A;  5DJM A;  1B4Q A;  2VM1 A;  4HDE A;  4ECC A;  4MPF A;  2FA4 A;  3ZVJ A;  4D73 A;  4K2D A;  1TK5 B;  4XS1 A;  2RUE A;  3A3T A;  2YJH A;  4TR1 B;  2DIY A;  3ZRE A;  1XVQ A;  4XRD A;  3TRP A;  1FHE A;  1X5C A;  2R3X A;  5DVB A;  2R6K A;  1AIU A;  4L5L A;  5ABR A;  1PX6 A;  3WGX A;  3O3T A;  2E0Q A;  3FHK A;  1SK2 A;  2HZE A;  3J7Y b;  3G7J A;  3ZRD A;  1A2M A;  4ZIJ A;  2H72 A;  1KBN A;  4I5Q A;  2WS2 A;  4I2U A;  2KP2 A;  1ERT A;  2B7J A;  2YV7 A;  1EP7 A;  1YEP A;  2A2S A;  2ZCT A;  2H8L A;  4YAV A;  1F6M C;  3DXB A;  2YN1 A;  3TJB A;  3ZMK A;  1U3I A;  3IK7 A;  3IC4 A;  1XVW A;  1OC8 A;  1TK0 B;  2FY6 A;  5ECS A;  2VM2 A;  1S3D A;  5GSS A;  1WIK A;  2YV9 A;  3KH7 A;  3D21 A;  4KDU A;  3EC3 A;  3RDW A;  4I8B A;  4JED A;  5J5N A;  4OD7 A;  6GSS A;  3IK9 A;  3Q6O A;  5D9X A;  1SJI A;  3IPZ A;  1Z3E A;  4KND A;  1ZCP A;  2H6Y A;  4DSS B;  2TIR A;  4G2E A;  1R4W A;  5F8B A;  3FR6 A;  1EZK A;  1I9D A;  3US3 A;  4J2F A;  3TGZ A;  2OBK A;  2WB9 A;  5DAL B;  3UEM A;  3KMN A;  4PQH A;  3H1N A;  4BWS A;  4TRX A;  5D9W A;  2YZU A;  3TKS A;  4TR1 A;  2Z9S A;  4KW6 A;  2C4J A;  2XPD A;  1MD3 A;  2E7P A;  2PMT A;  2DJ3 A;  1ZOF A;  4E8E A;  2GSS A;  2OJL A;  1TOF A;  4MZB A;  2PPT A;  1K0N A;  1F3B A;  1TRU A;  4L8E A;  2XPE A;  2X8H A;  2L6C A;  2HE3 A;  3GL5 A;  2LJR A;  2BMX A;  4RI7 A;  1YKA A;  3QOU A;  3FR9 A;  4WET A;  1FG4 A;  3FR3 A;  1CQH A;  4MJE A;  4WBR D;  2GS3 A;  4HJ2 A;  5D9V A;  4HJM A;  2C0D A;  2X8C A;  2M80 A;  2M46 A;  1M99 A;  2VCX A;  4MDC A;  4Q5F A;  1BED A;  4MF6 A;  2VIM A;  1RK4 A;  7GSS A;  4XCS A;  3GX0 A;  1T3B A;  2ES7 A;  1HNA A;  2K6V A;  3TDG A;  1QUW A;  2HRF A;  4EE0 A;  1M7T A;  3HDC A;  3LEF A;  1GSD A;  4L0U A;  1PSQ A;  3GV1 A;  5IIZ A;  2JZS A;  1GSQ A;  3JCM L;  3BCK A;  2IWT A;  3UL3 A;  1BX9 A;  3APQ A;  3ZML A;  3Q74 A;  1Q4J A;  4KUN A;  2H0G A;  1SL2 B;  2JL4 A;  4IQ1 A;  1J0F A;  4GSS A;  1SEN A;  1OKT A;  1M2D A;  2QC7 A;  3KP8 A;  4DSS A;  4WEY A;  4XIH A;  1O8W A;  2RM6 A;  4HZ4 A;  4KH7 A;  2XC2 A;  3CSH A;  2FNO A;  1B4P A;  4J56 E;  1Q98 A;  4V2N A;  4YQM A;  5DAL A;  4OMV A;  1GLP A;  2AJQ B;  3FZ5 A;  5D73 A;  3NZN A;  1SKS B;  5B7C A;  2LQQ A;  5D9T A;  4ILF A;  2FD3 A;  3ZZX A;  3IBH A;  3C8E A;  5HR3 A;  4PUR A;  3CTG A;  3A5W A;  1Y6E A;  1FOV A;  2YWM A;  1XOB A;  5B6M A;  1FB6 A;  4Z7X A;  1SK0 A;  5AGY A;  1PGT A;  1U6T A;  1ERV A;  4MA9 A;  2F3M A;  2DJ1 A;  5DBQ A;  3LXT A;  1V2A A;  1T00 A;  2VCV A;  3F3Q A;  1K0D A;  4NHZ A;  3HY2 A;  3IHQ A;  6GSU A;  1PA3 A;  1U87 A;  1PMT A;  4V1A g;  2HSH A;  2C8U A;  2VL3 A;  2C0F A;  2JZR A;  1DUG A;  4IHU A;  4ZBA A;  5E4W A;  4KAE A;  2AUV A;  3NIV A;  2H75 A;  2DJK A;  5IMV A;  1MDI A;  2LV3 A;  2NBS A;  1XWC A;  2K8V A;  4BVX A;  3FZ9 A;  2CAQ A;  2LNS A;  3GIX A;  1Z5Y E;  2F9S A;  1A2J A;  2YZH A;  4LMV A;  1PL2 A;  2H71 A;  18GS A;  1ZMA A;  5E59 A;  3KEB A;  1S3C A;  5B6N A;  4ZL9 A;  2EIO A;  2H1G A;  5LNK e;  2M72 A;  2CVD A;  1FVK A;  2OE1 A;  5AN1 A;  2O87 A;  4MP4 A;  2X8G A;  2V1M A;  3QMX A;  1B48 A;  2I81 A;  4AJ8 A;  2GQL A;  5IO2 A;  1GWC A;  4TKY A;  1ILO A;  1QQ2 A;  17GS A;  2LS5 A;  1E6B A;  1GUL A;  2LRT A;  5HFI A;  3GNJ A;  2L59 A;  3R2Q A;  3SWL A;  1MDK A;  2IPA A;  3I69 A;  4ZBD A;  3KCM A;  1TDI A;  5G2Z A;  3GKX A;  2IIY A;  4HU9 A;  4HEA 2;  2VCW A;  4GQF A;  1FO5 A;  5KN1 A;  2C3T A;  2BTO T;  3QAG A;  1YF0 A;  3RPP A;  4L0W A;  2H66 A;  3UBK A;  1XFL A;  1A2L A;  1WPI A;  1QXH A;  1OAZ A;  2O7K A;  3FZ4 A;  1JZO A;  3GUS A;  3M0F A;  1NW2 A;  2CZ3 A;  1PKW A;  5COH A;  2AYT A;  3VPQ A;  1AQW A;  3GFK A;  5DDL A;  5GST A;  5INY A;  1TI3 A;  3IDV A;  2VL9 A;  2KUC A;  3F63 A;  8GSS A;  1EEM A;  1QGV A;  2REM A;  5ELA A;  1DSB A;  4ECI A;  3KIJ A;  5AIX A;  3VFI A;  4XS6 A;  2H1B A;  3LSZ A;  4N11 A;  1XWB A;  5CRG A;  4EC0 A;  2KOK A;  5JCG A;  4F82 A;  4H86 A;  2HYX A;  1GSS A;  3IRA A;  5JWO B;  2TRC P;  11GS A;  1OVN A;  1VF4 A;  2B5Y A;  6GST A;  2FCH A;  2WFC A;  3L9V A;  1M9A A;  3LYP A;  3VI7 A;  5DQY A;  1U3A A;  4OO5 A;  3TKS E;  4AF2 A;  20GS A;  1XZO A;  4PXO A;  2CA8 A;  5ENU A;  3C7M A;  1OC3 A;  2CVK A;  3MAK A;  1Z6M A;  3EU4 A;  3DKS A;  1ON4 A;  4HU7 A;  3BOA A;  3E3E A;  4IEL A;  1AXD A;  3FKF A;  1TXX A;  4EXJ A;  4OO4 A;  2OE3 A;  1YQ1 A;  6GSW A;  3CSI A;  1WRY A;  2N5B A;  4X1U A;  5CRD A;  1GSU A;  2GDR A;  1A24 A;  4DSR A;  14GS A;  2B1K A;  1GLQ A;  1XWK A;  3KMO A;  2H70 A;  3WT2 A;  1G7E A;  4GXZ A;  2FWH A;  2OA7 A;  5CNW A;  1EV4 A;  4DVC A;  4V1A p;  4L5O A;  3VK9 A;  3LXZ A;  4LA1 A;  3IA1 A;  3GYK A;  2H0H A;  3VWV A;  5FHI A;  2WUL A;  3TKP A;  3IV4 A;  3LWA A;  2GVP A;  3LOR A;  2GSQ A;  2JU5 A;  1GUK A;  2X99 A;  1SJZ A;  6GSX A;  3HCZ A;  1ZL9 A;  2DIZ A;  1R26 A;  2YWI A;  1SL1 B;  2MZC A;  22GS A;  1WOU A;  3FK8 A;  4EL1 A;  3F9U A;  5DAK A;  1GTB A;  1YEX A;  5A5K A;  1O7U A;  1JZD A;  4WKW A;  3DML A;  5JWQ B;  1A0R P;  5IMZ A;  1O85 A;  4PNG A;  2YAN A;  4O5R A;  2IMF A;  4ECB A;  1OE7 A;  4K7N A;  3CRU A;  4KDY A;  3P8W A;  5FT3 A;  1H75 A;  2HI7 A;  2DLX A;  2F51 A;  1EEJ A;  1M2A A;  1Z7R A;  3GRX A;  4PUF C;  1EWX A;  4I2T A;  5C04 A;  3D6I A;  3M1G A;  2A4V A;  3TJG A;  4EDZ A;  3L0H A;  4POM A;  1K3O A;  1NM3 A;  4MMM A;  2DSA A;  4WR5 A;  2JSY A;  3D22 A;  2C80 A;  4WBJ A;  4ZXG A;  2DJ0 A;  2PVO C;  2L5O A;  3CSJ A;  16GS A;  3W6G A;  4WF5 A;  1J9B A;  4GQC A;  3TCO A;  2G0F A;  3ZVJ D;  1HYU A;  2H01 A;  4TVE A;  2JZT A;  3F6F A;  2GSR A;  2HNL A;  5CO3 A;  4DEJ A;  1O81 A;  1PKZ A;  2R2J A;  2C3Q A;  3FRC A;  4XS4 B;  1V58 A;  1OYJ A;  3GKK A;  2PGT A;  2CX4 A;  2H30 A;  2YWN A;  4EUY A;  3M9J A;  4TW5 A;  1AQX A;  3ZIV A;  4XTS A;  4ZL7 A;  4TR3 A;  1DE1 A;  2LRN A;  3LQ7 A;  2F8A A;  3GTU B;  2XBI A;  3KTL A;  3BJ5 A;  1BAY A;  4FO5 A;  2WGR A;  2HRN A;  4Q5N A;  1WJK A;  4FYB A;  2E2M A;  1K0A A;  3LYK A;  4ZB6 A;  1B9Y C;  4FYC A;  1W89 A;  3EMP A;  5F0G A;  1VRS D;  2IMI A;  1UN2 A;  2VCQ A;  2O85 A;  3IAS 2;  1JZR A;  1ZGN A;  2V32 A;  1M0U A;  5G1K A;  4TXO B;  3HJM A;  5EL8 A;  5IMA A;  1X9M B;  2L4Q A;  2RM5 A;  2FWF A; 
#chains in the Genus database with same CATH topology
 3EVI A;  4MH2 A;  1FVJ A;  3M9K A;  4BPY A;  2B6M A;  2H19 A;  5IOX A;  3K8N A;  5CRH A;  3BD2 A;  3P90 A;  4QL7 A;  4GLT A;  1FAA A;  2AB6 A;  5D96 A;  2RUF A;  1PRX A;  4GF0 A;  2GLR A;  4AJ7 A;  2N5A A;  4MJA A;  4OFM A;  1SL0 B;  3DEX A;  3IAM 2;  1F3A A;  2PWJ A;  2J9H A;  4TR0 A;  5F05 A;  3VUR A;  3IOS A;  1BG5 A;  4YKF A;  5EPF A;  1YJ6 A;  3KJY A;  4JRR A;  4QL9 A;  3M3M A;  1K3L A;  3HKR A;  1TW9 A;  2PER A;  3F0I A;  1GRX A;  4FQU A;  5F07 A;  3ZTL A;  1SYR A;  1URM A;  4MJB A;  2K18 A;  4MZC A;  3UVH A;  1MD4 A;  5A4U A;  3UOM A;  1TJD A;  2C1Y A;  2YOI A;  4O92 A;  2V2G A;  1T8E B;  1U88 A;  4IGJ A;  3A2X A;  4ML1 A;  4QQ7 A;  3GTU A;  3QD9 A;  19GS A;  3HJO A;  5IQY A;  4F0B A;  1THX A;  3CRT A;  3ZFL A;  2HT9 A;  1B9X C;  1M2B A;  2HRA A;  1T4Y A;  4XRA A;  1AUC A;  3I6A A;  10GS A;  2GT6 A;  3TJK A;  3QCP A;  4ISD A;  5IMC A;  2VCT A;  3H8Q A;  3V1W A;  4Q5Q A;  4DSQ A;  2O89 A;  3CBU A;  3EWL A;  3DD3 A;  2B5E A;  2VCZ A;  4TXO A;  1GSF A;  2V6K A;  4O32 A;  4YAP A;  2H6Z A;  5ECR B;  5CRE A;  5LD0 A;  5BRT A;  4CW9 A;  3ERF A;  1H4O A;  2IFQ B;  2FA8 A;  1UC7 A;  1V57 A;  1XW5 A;  3E9J B;  2ZNM A;  1A0F A;  1THO A;  4OCF A;  2HZF A;  3HVS A;  2WZ9 A;  2H73 A;  2NPB A;  1XCC A;  4K0N A;  3KH9 A;  3D4T A;  5ECH B;  3GUR A;  1W4V A;  1SJ6 A;  2LJK A;  1QFN A;  3HJP A;  1JLW A;  1T7P B;  1KNG A;  2YJ7 A;  3G7Y A;  1Y25 A;  1OC9 B;  1F9M A;  5H5R A;  5JCW A;  1YZX A;  4IKH A;  2P31 A;  3RAZ A;  2OKA A;  4PQI A;  2HLS A;  1TTZ A;  1WWJ A;  1NHO A;  3PIN A;  4NWY A;  4V2L A;  1LU4 A;  3J7Y k;  3C73 A;  4I6X A;  4TXV A;  4KDX A;  4KE3 A;  4AJ6 A;  4IN0 A;  2RII A;  5C00 A;  1BQ7 A;  1X9S B;  4TOP A;  4K7I A;  1TU7 A;  5IMD A;  2VLU A;  2GTU A;  3ZIT A;  1JZW A;  3FZA A;  1TRW A;  5LCZ A;  4BVY B;  5ID2 B;  5IPH A;  3TOT A;  4ML6 A;  1I5G A;  3FYG A;  3GKN A;  3GX8 A;  1YKC A;  2GZZ A;  1T1V A;  3HHV A;  2FWE A;  4J57 E;  3RHB A;  1O6J A;  5G5F A;  3EYT A;  3MNG A;  2YCD A;  2CT6 A;  2PN8 A;  5IO0 A;  4ACS A;  4RUV A;  4MAB A;  4OFN A;  1GNW A;  5HFG A;  4F03 A;  2H1D A;  2HXK A;  3CMI A;  2X49 A;  3MSZ A;  9GSS A;  3QDN A;  2WCI A;  2VOC A;  4CDO A;  2FLS A;  5ECK B;  2IFQ A;  2LKU A;  3MIX A;  3DVW A;  3FW2 A;  3W8S A;  5ECN B;  5ECQ B;  2R37 A;  2WRT A;  3PH9 A;  3VWX A;  3M8N A;  4BL7 B;  5HR0 A;  4IBP A;  5DCH A;  3EE2 A;  3HXS A;  2N5F A;  1KEB A;  2ZUP A;  4KCA A;  2HSY A;  3LFL A;  1BYE A;  2DML A;  4N0Z A;  1MTC A;  3GKM A;  3DRN A;  1G0T A;  2FGX A;  5HQP A;  3F8U A;  2ALB A;  1GSY A;  2FUG 2;  4G0I A;  1OC9 A;  3E0U A;  3P7X A;  4K2X A;  3ZIJ A;  2KP1 A;  2MBS A;  1AAZ A;  1XW9 A;  4G19 A;  5H5Q A;  5FWG A;  4I97 A;  3H79 A;  2KLX A;  1SU9 A;  3DIE A;  1VF3 A;  5ECM B;  4YQU A;  3DGQ A;  3UAR A;  3L9S A;  4BVY A;  4K8M A;  5ID2 A;  4KGI A;  4MK3 A;  4JR4 A;  4F9Z A;  1PD2 1;  4NXI A;  4EDY A;  2R4V A;  3HVV A;  1HQO A;  3UBL A;  3L9U A;  1GP1 A;  5CP1 A;  2LTK A;  3ZLP A;  1XBS A;  4JR6 A;  4JU5 A;  4K5S A;  4K6X A;  4PQ1 A;  3U6V A;  3WGD A;  2I1U A;  2HZE B;  3F3R A;  3H4K A;  2G2Q A;  4GTU A;  4ZL8 A;  3TRX A;  4ZIL A;  1CQG A;  5F06 A;  3VWU A;  2O8V B;  1X5D A;  3PR8 A;  1A8L A;  4GSN A;  2V6O A;  3UAP A;  1ST9 A;  1MEK A;  3TUE A;  4G10 A;  3HYP A;  4MCU A;  2LRC A;  1S3R A;  4BL7 A;  1EGR A;  5KEJ A;  3FEU A;  4KCE A;  3U5R E;  1V98 A;  2IMD A;  4IJ3 A;  4EF0 A;  1E2Y A;  2MBT A;  1GTU A;  5A4W A;  4WF4 A;  4NV5 A;  5J9B A;  3MDK A;  4ICY A;  4RQR A;  5DJL A;  1GTA A;  2F8F A;  1Z6N A;  2DMM A;  4ZB8 A;  2B3S A;  5AIS A;  2QSI A;  2EC4 A;  3VLN A;  2AAW A;  3HA9 A;  3VI5 A;  5DCG A;  1K3Y A;  2L5L A;  2MMN A;  4GCI A;  1XOA A;  1C72 A;  1PN0 A;  4K9Z A;  1TRS A;  4P3Y B;  2QA1 A;  5JWR B;  2CAI A;  3FY7 A;  4TN8 A;  5G1L A;  2L6D A;  2EIR A;  1AC1 A;  3ZL5 A;  5G5E A;  3IE3 A;  5ECP B;  3ISO A;  3DVX A;  1R5A A;  4FYU A;  1VF1 A;  3P2A A;  2PUK C;  1GSE A;  4GRF A;  4RQX A;  4PGT A;  3BBY A;  3EUR A;  2K9F A;  2DJJ A;  2XHF A;  2VL2 C;  2H0I A;  3S9F A;  5IM9 A;  3HZ8 A;  1G7O A;  2WJU A;  3F4T A;  1AW9 A;  4BWQ A;  3TB2 A;  3GHA A;  2LQO A;  4MPG A;  4O5U A;  3GA4 A;  1KTE A;  2L57 A;  1G6W A;  3MWH A;  1EOG A;  2MMZ A;  4MJC A;  2VD1 A;  1VGL A;  2VO4 A;  1ERU A;  2D2Z A;  4ZBB A;  3CYN A;  3F6D A;  2GQM A;  4WXT A;  2EIQ A;  2PU9 C;  1DE2 A;  1M3I A;  5G30 A;  1JFU A;  3KXO A;  2DC5 A;  2I9H A;  4EKZ A;  4MF5 A;  4OCE A;  2NTO A;  4USS A;  4MH3 A;  4GST A;  3H93 A;  4HUA A;  3Q18 A;  5CYY A;  2QKE A;  4IJI A;  3GMF A;  1XWG A;  3WD6 A;  2NDO A;  2K8S A;  1K0B A;  2YP6 A;  4RI6 A;  5J41 A;  1K0M A;  4YH2 A;  2A4H A;  3Q19 A;  2I4A A;  3I9V 2;  5EY6 A;  3F4R A;  3D5J A;  2MMO A;  6GSY A;  3KGK A;  3A2W A;  3PPU A;  4N0V A;  4V2M A;  4JBB A;  2E2G A;  3L78 A;  4AGS A;  2GZY A;  4F2I A;  5D93 A;  4KSO A;  4G9H A;  1TU8 A;  2OE0 A;  1N8J A;  3KZQ A;  3WGE A;  4HZ2 A;  1XPV A;  1ZZY A;  2YWO A;  4E8H A;  3NOF A;  4NAX A;  1GNE A;  1HNC A;  2R5G A;  3I43 A;  4LL1 B;  2IME A;  4ID0 A;  4FH8 A;  1HNB A;  1VF2 A;  3D4M A;  5ECO B;  1ACV A;  5D8I A;  4KA0 A;  2L4C A;  2ON7 A;  5A4V A;  1EP8 A;  2H76 A;  1ML6 A;  2VLT A;  1WP0 A;  1MDJ A;  3HVX A;  1PL1 A;  5EVO A;  4XS4 A;  1RW1 A;  5J3R A;  4WR4 A;  1M9B A;  3TOU A;  4POL A;  2LST A;  5HFK A;  3IC8 A;  4IP1 A;  3LG6 A;  3KTB A;  2JAC A;  5CRW A;  2FWG A;  4GWR A;  1SD9 A;  2H1A A;  4OWY A;  3HZ4 A;  1R7H A;  2LUS A;  4PNF A;  1WMJ A;  1ZYE A;  1NHY A;  2GT5 A;  5G31 A;  1TP9 A;  3UIW A;  4XHM A;  1OKD A;  2AHE A;  4EO3 A;  2OAC A;  4JE1 A;  2OAD A;  4PUA A;  3TKS C;  2CQ9 A;  2P0G A;  3EMX A;  3DWV A;  2VUP A;  2B1L A;  3APS A;  2NVL A;  1UA5 A;  3ERW A;  1TRV A;  2MYG A;  4X0X A;  2CV4 A;  2GQK A;  1Z9H A;  2CZ2 A;  1QK8 A;  3QAW A;  5GAN D;  3UVT A;  6GSV A;  1BJX A;  1F2E A;  5J9C A;  1GH2 A;  2MMA A;  2QGV A;  1PX7 A;  1ABA A;  4CHS A;  1NSW A;  3PGT A;  3TKQ A;  3OR5 A;  2JAD A;  4KB3 A;  1SK1 A;  1A23 A;  3QFA C;  2UZ8 A;  2YNX A;  4EIP A;  2IMK A;  1FW1 A;  4HI7 A;  3CXG A;  4MZW A;  1X5E A;  4IQA A;  3APO A;  4LMW A;  3GST A;  3N9J A;  1G6Y A;  1UVZ A;  5KN0 A;  1GUM A;  1AQV A;  3CTF A;  3RPN A;  1YF1 A;  4KX4 A;  5DQS A;  3O6T A;  3RBT A;  2CVB A;  1XW6 A;  1XIY A;  1O8X A;  5JCU A;  1EOH A;  3L4N A;  1PFO A;  3ZYW A;  2HFD A;  2BJX A;  2FHE A;  3UMA A;  2P5R A;  3KD0 A;  1X9W B;  4KSM A;  1B8X A;  3R3E A;  3IXR A;  2DJ2 A;  2VD0 A;  3EIN A;  1IYH A;  4POK A;  1WE0 A;  4POB A;  4EVM A;  5L71 A;  2C0E A;  4YQV A;  2RLI A;  1FB0 A;  2H6X A;  4Q5R A;  2KHP A;  3RHC A;  4K0G A;  5IPG A;  1HD2 A;  1O73 A;  1XWA A;  2DBC A;  2ON5 A;  1PQN A;  5ECI B;  4NPB A;  5IMF A;  4ZB9 A;  4MLY A;  4X4J A;  4FIW A;  3A5I A;  3GN3 A;  3A2V A;  3W8J A;  2GZP A;  3QFB C;  1SD8 A;  5HR2 A;  4IW9 A;  3TJJ A;  3EU3 A;  3DYR A;  3QR6 A;  1GTI A;  4N30 A;  5GAP D;  3GL3 A;  1LBK A;  2JSZ A;  3WYW A;  2QA2 A;  4JZQ A;  4EIQ A;  5HR1 A;  3G7I A;  4MNN A;  1J08 A;  2TRX A;  4PX1 A;  3GH6 A;  1EGO A;  1XXU A;  4IVF A;  2CX3 A;  3TKR A;  2OBI A;  3ZFB A;  1GL8 A;  1USB A;  4LLR A;  2LJA A;  3GSS A;  5KN2 A;  2YPM A;  5J4U A;  1T4Z A;  4F0C A;  3SBC A;  2PVQ A;  3LGC A;  1TI1 A;  4O7H A;  4IP6 A;  4ULX A;  3QPM A;  2VLV A;  5CAX A;  3C71 A;  1V9W A;  2B5X A;  3ME8 A;  4HQZ A;  5GZZ B;  1YDK A;  2B7K A;  2V41 A;  2X64 A;  4HQS A;  5DAK B;  2XBQ A;  2LNT A;  5ECL B;  4D73 B;  3QAV A;  3AY8 A;  4IS0 A;  2R0G A;  5ELG A;  2A2R A;  2I3Y A;  2IJY A;  1FOH A;  4MF7 A;  5B8A A;  1JLV A;  1SKR B;  1JHB A;  12GS A;  3IR4 A;  3MYD A;  3LJR A;  1R5P A;  4TR4 A;  1TKD B;  1F37 A;  5KN3 A;  2LEG A;  3TRQ A;  1OE8 A;  2GGT A;  1TK8 B;  1GUH A;  4K1F A;  1RQM A;  2C0G A;  5BMU A;  3N5O A;  1PN9 A;  4N10 A;  1QMV A;  1A8Y A;  5IOW A;  3VPT A;  1YY7 A;  2PBJ A;  1XG8 A;  2GST A;  3D0Z A;  3ERG A;  2C3N A;  3F4S A;  1LJR A;  5AIV A;  1SYX A;  2H74 A;  2VAF A;  1K0O A;  4ECJ A;  1Z7P A;  1S3A A;  3TJF A;  2IN3 A;  2VL2 A;  2WDU A;  3WT1 A;  3KP9 A;  3C1R A;  3G9B A;  3BCI A;  3HD5 A;  2AV4 A;  4BA7 A;  3O76 A;  1X0R A;  4OFT A;  1IYI A;  3HVN A;  4NV2 A;  2P5Q A;  13GS A;  1EV9 A;  4X43 A;  5B8B A;  3UJ1 A;  1N2A A;  1K0C A;  1V40 A;  5H5S A;  3C1S A;  4HOJ A;  1ZYQ B;  4NMU A;  4K7O A;  1ERW A;  3GH9 A;  4HS1 A;  1DBY A;  1SKW B;  2J23 A;  3ME7 A;  3ED3 A;  3KM6 A;  4NHW A;  4LL4 B;  2IL3 A;  3VWW A;  5DJM A;  1B4Q A;  2VM1 A;  4HDE A;  4ECC A;  4MPF A;  2FA4 A;  3ZVJ A;  4D73 A;  2R0P A;  4K2D A;  1TK5 B;  4XS1 A;  5KOW A;  2RUE A;  3A3T A;  2YJH A;  4TR1 B;  2DIY A;  3ZRE A;  1XVQ A;  4XRD A;  3TRP A;  1FHE A;  2DKH A;  1X5C A;  2R3X A;  5DVB A;  2R6K A;  1AIU A;  4L5L A;  5ABR A;  1PX6 A;  5KOX A;  3WGX A;  3O3T A;  2E0Q A;  3FHK A;  1SK2 A;  2HZE A;  3J7Y b;  3G7J A;  3ZRD A;  1A2M A;  4ZIJ A;  2H72 A;  1KBN A;  4K5R A;  4I5Q A;  2WS2 A;  4I2U A;  2HRK A;  2KP2 A;  1ERT A;  2B7J A;  1ZYP A;  2YV7 A;  1EP7 A;  4Z2U A;  1YEP A;  2A2S A;  2ZCT A;  2H8L A;  4YAV A;  1F6M C;  3DXB A;  2YN1 A;  3TJB A;  3ZMK A;  1U3I A;  3IK7 A;  3IC4 A;  1XVW A;  1OC8 A;  1TK0 B;  2FY6 A;  5ECS A;  2VM2 A;  1S3D A;  5GSS A;  1WIK A;  2YV9 A;  3KH7 A;  3D21 A;  4KDU A;  3EC3 A;  3RDW A;  4I8B A;  4JED A;  5J5N A;  4OD7 A;  6GSS A;  3IK9 A;  3Q6O A;  5D9X A;  1SJI A;  3IPZ A;  1Z3E A;  4KND A;  1ZCP A;  2H6Y A;  4DSS B;  2TIR A;  4G2E A;  1R4W A;  5F8B A;  3FR6 A;  1EZK A;  1I9D A;  3US3 A;  4J2F A;  3TGZ A;  2OBK A;  2WB9 A;  5DAL B;  3UEM A;  3KMN A;  4PQH A;  3H1N A;  4BWS A;  2DKI A;  4TRX A;  5D9W A;  2YZU A;  3TKS A;  4TR1 A;  2Z9S A;  4KW6 A;  2C4J A;  2XPD A;  1MD3 A;  2E7P A;  2PMT A;  2DJ3 A;  1ZOF A;  4E8E A;  2GSS A;  2OJL A;  1TOF A;  4MZB A;  2PPT A;  1K0N A;  1F3B A;  1TRU A;  4L8E A;  2XPE A;  2X8H A;  2L6C A;  2HE3 A;  3GL5 A;  2LJR A;  2BMX A;  4Z2T A;  4Z2R A;  4RI7 A;  1YKA A;  3QOU A;  3FR9 A;  4WET A;  1FG4 A;  3FR3 A;  1CQH A;  4MJE A;  4WBR D;  2GS3 A;  4HJ2 A;  5D9V A;  4HJM A;  2C0D A;  2X8C A;  2M80 A;  2M46 A;  1M99 A;  2VCX A;  4MDC A;  4Q5F A;  1BED A;  4MF6 A;  2VIM A;  1RK4 A;  7GSS A;  4XCS A;  3GX0 A;  1T3B A;  2ES7 A;  1HNA A;  2K6V A;  3FMW A;  3TDG A;  1QUW A;  2HRF A;  4EE0 A;  1M7T A;  4YKG A;  3HDC A;  3LEF A;  1GSD A;  4L0U A;  1PSQ A;  3GV1 A;  4BVX B;  5IIZ A;  2JZS A;  1GSQ A;  3JCM L;  3BCK A;  2IWT A;  3UL3 A;  1BX9 A;  3APQ A;  3ZML A;  3Q74 A;  1Q4J A;  4KUN A;  2H0G A;  1SL2 B;  2JL4 A;  4IQ1 A;  1J0F A;  4GSS A;  1SEN A;  1OKT A;  1M2D A;  2QC7 A;  3KP8 A;  4DSS A;  4WEY A;  4XIH A;  1O8W A;  2RM6 A;  4HZ4 A;  4KH7 A;  2XC2 A;  3CSH A;  2FNO A;  1B4P A;  4J56 E;  1Q98 A;  4V2N A;  4YQM A;  5DAL A;  4OMV A;  1GLP A;  4CY6 A;  2AJQ B;  3FZ5 A;  5D73 A;  3NZN A;  1SKS B;  5B7C A;  2LQQ A;  5D9T A;  4ILF A;  2FD3 A;  3ZZX A;  3IBH A;  3C8E A;  5HR3 A;  4PUR A;  3CTG A;  3A5W A;  1Y6E A;  1FOV A;  2YWM A;  1XOB A;  5B6M A;  1FB6 A;  4Z7X A;  1SK0 A;  5AGY A;  1PGT A;  1U6T A;  4BIK A;  1ERV A;  4MA9 A;  2F3M A;  2DJ1 A;  5DBQ A;  3LXT A;  1V2A A;  1T00 A;  2VCV A;  3F3Q A;  1K0D A;  4NHZ A;  3HY2 A;  3IHQ A;  6GSU A;  1PA3 A;  1U87 A;  1PMT A;  4V1A g;  2HSH A;  2C8U A;  2VL3 A;  2C0F A;  2JZR A;  1DUG A;  4IHU A;  4ZBA A;  5E4W A;  4KAE A;  2AUV A;  3NIV A;  2H75 A;  2DJK A;  5IMV A;  1MDI A;  2LV3 A;  4PTS A;  2NBS A;  1XWC A;  2K8V A;  4BVX A;  3FZ9 A;  2CAQ A;  2LNS A;  3GIX A;  1Z5Y E;  2F9S A;  1A2J A;  2YZH A;  4LMV A;  1PL2 A;  2H71 A;  18GS A;  1ZMA A;  5E59 A;  3KEB A;  1S3C A;  5B6N A;  4ZL9 A;  2EIO A;  2H1G A;  5LNK e;  2M72 A;  2CVD A;  1FVK A;  2OE1 A;  5AN1 A;  2O87 A;  4MP4 A;  2X8G A;  2V1M A;  3QMX A;  1M3J A;  1B48 A;  2I81 A;  4AJ8 A;  2GQL A;  5IO2 A;  1GWC A;  4TKY A;  1ILO A;  1QQ2 A;  17GS A;  2LS5 A;  1E6B A;  1GUL A;  2LRT A;  5HFI A;  3GNJ A;  2L59 A;  3R2Q A;  3SWL A;  1MDK A;  2IPA A;  3I69 A;  4ZBD A;  3KCM A;  1TDI A;  1ZYN A;  5G2Z A;  3GKX A;  2IIY A;  4HU9 A;  4HEA 2;  2VCW A;  4GQF A;  1FO5 A;  5KN1 A;  2C3T A;  2BTO T;  3QAG A;  1YF0 A;  3RPP A;  4L0W A;  2H66 A;  3UBK A;  1XFL A;  1A2L A;  1WPI A;  1QXH A;  1OAZ A;  2O7K A;  3FZ4 A;  1JZO A;  3GUS A;  3M0F A;  1NW2 A;  2CZ3 A;  3EPT A;  1PKW A;  5COH A;  2AYT A;  3VPQ A;  1AQW A;  3GFK A;  5DDL A;  4G0L A;  5GST A;  5INY A;  2A2P A;  1TI3 A;  3IDV A;  2VL9 A;  2KUC A;  3F63 A;  8GSS A;  1EEM A;  1QGV A;  2REM A;  5ELA A;  1DSB A;  4ECI A;  4KF9 A;  3KIJ A;  5AIX A;  3VFI A;  4XS6 A;  2H1B A;  3LSZ A;  4N11 A;  1XWB A;  5CRG A;  4EC0 A;  3LW9 A;  2KOK A;  5JCG A;  4F82 A;  4H86 A;  2HYX A;  1GSS A;  3IRA A;  2X4A A;  5JWO B;  2TRC P;  11GS A;  1OVN A;  1VF4 A;  2B5Y A;  6GST A;  2FCH A;  2WFC A;  3L9V A;  1M9A A;  3LYP A;  3VI7 A;  5DQY A;  1U3A A;  4OO5 A;  3TKS E;  4AF2 A;  20GS A;  1XZO A;  4PXO A;  2CA8 A;  5ENU A;  3C7M A;  1OC3 A;  2CVK A;  3MAK A;  1Z6M A;  3EU4 A;  3DKS A;  1ON4 A;  4HU7 A;  3BOA A;  3E3E A;  4IEL A;  4A5P A;  1AXD A;  3FKF A;  1TXX A;  4EXJ A;  4OO4 A;  2OE3 A;  1YQ1 A;  6GSW A;  3CSI A;  1WRY A;  2N5B A;  4X1U A;  5CRD A;  1GSU A;  2GDR A;  1A24 A;  4DSR A;  14GS A;  2B1K A;  1GLQ A;  1XWK A;  3KMO A;  2H70 A;  3WT2 A;  1G7E A;  4GXZ A;  2FWH A;  2OA7 A;  5CNW A;  1EV4 A;  4DVC A;  4V1A p;  4L5O A;  3VK9 A;  3LXZ A;  4LA1 A;  3IA1 A;  3GYK A;  2H0H A;  3VWV A;  5FHI A;  2WUL A;  3TKP A;  3IV4 A;  3LWA A;  2GVP A;  3LOR A;  2GSQ A;  2JU5 A;  1GUK A;  2X99 A;  1SJZ A;  6GSX A;  3HCZ A;  1ZL9 A;  2DIZ A;  1R26 A;  2YWI A;  1SL1 B;  2MZC A;  22GS A;  1WOU A;  3FK8 A;  4EL1 A;  3F9U A;  5DAK A;  3CQF A;  1GTB A;  4HSC X;  1YEX A;  5A5K A;  1O7U A;  1JZD A;  4WKW A;  3DML A;  5JWQ B;  1A0R P;  5IMZ A;  1O85 A;  4PNG A;  2YAN A;  4O5R A;  2IMF A;  4ECB A;  1OE7 A;  4K7N A;  3CRU A;  4KDY A;  3P8W A;  5FT3 A;  1H75 A;  2HI7 A;  2DLX A;  2F51 A;  1EEJ A;  1M2A A;  1Z7R A;  3GRX A;  4PUF C;  1EWX A;  4I2T A;  4O5Q A;  5C04 A;  3IHG A;  3D6I A;  2R0C A;  3M1G A;  2A4V A;  3TJG A;  4EDZ A;  3L0H A;  4POM A;  1K3O A;  1NM3 A;  4MMM A;  2DSA A;  4WR5 A;  2JSY A;  3D22 A;  2C80 A;  4WBJ A;  4ZXG A;  2DJ0 A;  2PVO C;  2L5O A;  2HSM A;  3CSJ A;  16GS A;  3W6G A;  4WF5 A;  1J9B A;  4GQC A;  3TCO A;  2G0F A;  3ZVJ D;  1HYU A;  2H01 A;  4TVE A;  2JZT A;  3F6F A;  2GSR A;  2HNL A;  5CO3 A;  4DEJ A;  1O81 A;  1PKZ A;  2R2J A;  2C3Q A;  3FRC A;  4XS4 B;  1V58 A;  1OYJ A;  3GKK A;  2PGT A;  2CX4 A;  2H30 A;  2YWN A;  4EUY A;  3M9J A;  4TW5 A;  1AQX A;  3ZIV A;  4XTS A;  4ZL7 A;  4TR3 A;  1DE1 A;  2LRN A;  3LQ7 A;  2F8A A;  3GTU B;  2XBI A;  3KTL A;  3BJ5 A;  1BAY A;  4FO5 A;  2WGR A;  2HRN A;  4Q5N A;  1WJK A;  4FYB A;  2E2M A;  1K0A A;  3LYK A;  4ZB6 A;  1B9Y C;  4FYC A;  1W89 A;  3EMP A;  5F0G A;  1VRS D;  2IMI A;  1UN2 A;  4G0K A;  2VCQ A;  2O85 A;  3IAS 2;  1JZR A;  1ZGN A;  2V32 A;  4CY8 A;  1M0U A;  5G1K A;  4TXO B;  3HJM A;  5EL8 A;  5IMA A;  1X9M B;  2L4Q A;  2RM5 A;  2FWF A; 
#chains in the Genus database with same CATH homology
 3EVI A;  4MH2 A;  1FVJ A;  3M9K A;  4BPY A;  2B6M A;  2H19 A;  5IOX A;  3K8N A;  5CRH A;  3BD2 A;  3P90 A;  4QL7 A;  4GLT A;  1FAA A;  2AB6 A;  5D96 A;  2RUF A;  1PRX A;  4GF0 A;  2GLR A;  4AJ7 A;  2N5A A;  4MJA A;  4OFM A;  1SL0 B;  3DEX A;  3IAM 2;  1F3A A;  2PWJ A;  2J9H A;  4TR0 A;  5F05 A;  3VUR A;  3IOS A;  1BG5 A;  4YKF A;  5EPF A;  1YJ6 A;  3KJY A;  4JRR A;  4QL9 A;  3M3M A;  1K3L A;  3HKR A;  1TW9 A;  2PER A;  3F0I A;  1GRX A;  4FQU A;  5F07 A;  3ZTL A;  1SYR A;  1URM A;  4MJB A;  2K18 A;  4MZC A;  3UVH A;  1MD4 A;  5A4U A;  3UOM A;  1TJD A;  2C1Y A;  2YOI A;  4O92 A;  2V2G A;  1T8E B;  1U88 A;  4IGJ A;  3A2X A;  4ML1 A;  4QQ7 A;  3GTU A;  3QD9 A;  19GS A;  3HJO A;  5IQY A;  4F0B A;  1THX A;  3CRT A;  3ZFL A;  2HT9 A;  1B9X C;  1M2B A;  2HRA A;  1T4Y A;  4XRA A;  1AUC A;  3I6A A;  10GS A;  2GT6 A;  3TJK A;  3QCP A;  4ISD A;  5IMC A;  2VCT A;  3H8Q A;  3V1W A;  4Q5Q A;  4DSQ A;  2O89 A;  3CBU A;  3EWL A;  3DD3 A;  2B5E A;  2VCZ A;  4TXO A;  1GSF A;  2V6K A;  4O32 A;  4YAP A;  2H6Z A;  5ECR B;  5CRE A;  5LD0 A;  5BRT A;  4CW9 A;  3ERF A;  1H4O A;  2IFQ B;  2FA8 A;  1UC7 A;  1V57 A;  1XW5 A;  3E9J B;  2ZNM A;  1A0F A;  1THO A;  4OCF A;  2HZF A;  3HVS A;  2WZ9 A;  2H73 A;  2NPB A;  1XCC A;  4K0N A;  3KH9 A;  3D4T A;  5ECH B;  3GUR A;  1W4V A;  1SJ6 A;  2LJK A;  1QFN A;  3HJP A;  1JLW A;  1T7P B;  1KNG A;  2YJ7 A;  3G7Y A;  1Y25 A;  1OC9 B;  1F9M A;  5H5R A;  5JCW A;  1YZX A;  4IKH A;  2P31 A;  3RAZ A;  2OKA A;  4PQI A;  2HLS A;  1TTZ A;  1WWJ A;  1NHO A;  3PIN A;  4NWY A;  4V2L A;  1LU4 A;  3J7Y k;  3C73 A;  4I6X A;  4TXV A;  4KDX A;  4KE3 A;  4AJ6 A;  4IN0 A;  2RII A;  5C00 A;  1BQ7 A;  1X9S B;  4TOP A;  4K7I A;  1TU7 A;  5IMD A;  2VLU A;  2GTU A;  3ZIT A;  1JZW A;  3FZA A;  1TRW A;  5LCZ A;  4BVY B;  5ID2 B;  5IPH A;  3TOT A;  4ML6 A;  1I5G A;  3FYG A;  3GKN A;  3GX8 A;  1YKC A;  2GZZ A;  1T1V A;  3HHV A;  2FWE A;  4J57 E;  3RHB A;  1O6J A;  5G5F A;  3EYT A;  3MNG A;  2YCD A;  2CT6 A;  2PN8 A;  5IO0 A;  4ACS A;  4RUV A;  4MAB A;  4OFN A;  1GNW A;  5HFG A;  4F03 A;  2H1D A;  2HXK A;  3CMI A;  2X49 A;  3MSZ A;  9GSS A;  3QDN A;  2WCI A;  2VOC A;  4CDO A;  2FLS A;  5ECK B;  2IFQ A;  2LKU A;  3MIX A;  3DVW A;  3FW2 A;  3W8S A;  5ECN B;  5ECQ B;  2R37 A;  2WRT A;  3PH9 A;  3VWX A;  3M8N A;  4BL7 B;  5HR0 A;  4IBP A;  5DCH A;  3EE2 A;  3HXS A;  2N5F A;  1KEB A;  2ZUP A;  4KCA A;  2HSY A;  3LFL A;  1BYE A;  2DML A;  4N0Z A;  1MTC A;  3GKM A;  3DRN A;  1G0T A;  2FGX A;  5HQP A;  3F8U A;  2ALB A;  1GSY A;  2FUG 2;  4G0I A;  1OC9 A;  3E0U A;  3P7X A;  4K2X A;  3ZIJ A;  2KP1 A;  2MBS A;  1AAZ A;  1XW9 A;  4G19 A;  5H5Q A;  5FWG A;  4I97 A;  3H79 A;  2KLX A;  1SU9 A;  3DIE A;  1VF3 A;  5ECM B;  4YQU A;  3DGQ A;  3UAR A;  3L9S A;  4BVY A;  4K8M A;  5ID2 A;  4KGI A;  4MK3 A;  4JR4 A;  4F9Z A;  1PD2 1;  4NXI A;  4EDY A;  2R4V A;  3HVV A;  1HQO A;  3UBL A;  3L9U A;  1GP1 A;  5CP1 A;  2LTK A;  3ZLP A;  1XBS A;  4JR6 A;  4JU5 A;  4K5S A;  4K6X A;  4PQ1 A;  3U6V A;  3WGD A;  2I1U A;  2HZE B;  3F3R A;  3H4K A;  2G2Q A;  4GTU A;  4ZL8 A;  3TRX A;  4ZIL A;  1CQG A;  5F06 A;  3VWU A;  2O8V B;  1X5D A;  3PR8 A;  1A8L A;  4GSN A;  2V6O A;  3UAP A;  1ST9 A;  1MEK A;  3TUE A;  4G10 A;  3HYP A;  4MCU A;  2LRC A;  4BL7 A;  1EGR A;  5KEJ A;  3FEU A;  4KCE A;  3U5R E;  1V98 A;  2IMD A;  4IJ3 A;  4EF0 A;  1E2Y A;  2MBT A;  1GTU A;  5A4W A;  4WF4 A;  4NV5 A;  5J9B A;  3MDK A;  4ICY A;  4RQR A;  5DJL A;  1GTA A;  2F8F A;  1Z6N A;  2DMM A;  4ZB8 A;  2B3S A;  5AIS A;  2QSI A;  2EC4 A;  3VLN A;  2AAW A;  3HA9 A;  3VI5 A;  5DCG A;  1K3Y A;  2L5L A;  2MMN A;  4GCI A;  1XOA A;  1C72 A;  1PN0 A;  4K9Z A;  1TRS A;  4P3Y B;  2QA1 A;  5JWR B;  2CAI A;  3FY7 A;  4TN8 A;  5G1L A;  2L6D A;  2EIR A;  1AC1 A;  3ZL5 A;  5G5E A;  3IE3 A;  5ECP B;  3ISO A;  3DVX A;  1R5A A;  4FYU A;  1VF1 A;  3P2A A;  2PUK C;  1GSE A;  4GRF A;  4RQX A;  4PGT A;  3BBY A;  3EUR A;  2K9F A;  2DJJ A;  2XHF A;  2VL2 C;  2H0I A;  3S9F A;  5IM9 A;  3HZ8 A;  1G7O A;  2WJU A;  3F4T A;  1AW9 A;  4BWQ A;  3TB2 A;  3GHA A;  2LQO A;  4MPG A;  4O5U A;  3GA4 A;  1KTE A;  2L57 A;  1G6W A;  3MWH A;  1EOG A;  2MMZ A;  4MJC A;  2VD1 A;  1VGL A;  2VO4 A;  1ERU A;  2D2Z A;  4ZBB A;  3CYN A;  3F6D A;  2GQM A;  4WXT A;  2EIQ A;  2PU9 C;  1DE2 A;  5G30 A;  1JFU A;  3KXO A;  2DC5 A;  2I9H A;  4EKZ A;  4MF5 A;  4OCE A;  2NTO A;  4USS A;  4MH3 A;  4GST A;  3H93 A;  4HUA A;  3Q18 A;  5CYY A;  2QKE A;  4IJI A;  3GMF A;  1XWG A;  3WD6 A;  2NDO A;  2K8S A;  1K0B A;  2YP6 A;  4RI6 A;  5J41 A;  1K0M A;  4YH2 A;  2A4H A;  3Q19 A;  2I4A A;  3I9V 2;  5EY6 A;  3F4R A;  3D5J A;  2MMO A;  6GSY A;  3KGK A;  3A2W A;  3PPU A;  4N0V A;  4V2M A;  4JBB A;  2E2G A;  3L78 A;  4AGS A;  2GZY A;  4F2I A;  5D93 A;  4KSO A;  4G9H A;  1TU8 A;  2OE0 A;  1N8J A;  3KZQ A;  3WGE A;  4HZ2 A;  1XPV A;  1ZZY A;  2YWO A;  4E8H A;  3NOF A;  4NAX A;  1GNE A;  1HNC A;  2R5G A;  3I43 A;  4LL1 B;  2IME A;  4ID0 A;  4FH8 A;  1HNB A;  1VF2 A;  3D4M A;  5ECO B;  1ACV A;  5D8I A;  4KA0 A;  2L4C A;  2ON7 A;  5A4V A;  1EP8 A;  2H76 A;  1ML6 A;  2VLT A;  1WP0 A;  1MDJ A;  3HVX A;  1PL1 A;  5EVO A;  4XS4 A;  1RW1 A;  5J3R A;  4WR4 A;  1M9B A;  3TOU A;  4POL A;  2LST A;  5HFK A;  3IC8 A;  4IP1 A;  3LG6 A;  3KTB A;  2JAC A;  5CRW A;  2FWG A;  4GWR A;  1SD9 A;  2H1A A;  4OWY A;  3HZ4 A;  1R7H A;  2LUS A;  4PNF A;  1WMJ A;  1ZYE A;  1NHY A;  2GT5 A;  5G31 A;  1TP9 A;  3UIW A;  4XHM A;  1OKD A;  2AHE A;  4EO3 A;  2OAC A;  4JE1 A;  2OAD A;  4PUA A;  3TKS C;  2CQ9 A;  2P0G A;  3EMX A;  3DWV A;  2VUP A;  2B1L A;  3APS A;  2NVL A;  1UA5 A;  3ERW A;  1TRV A;  2MYG A;  4X0X A;  2CV4 A;  2GQK A;  1Z9H A;  2CZ2 A;  1QK8 A;  3QAW A;  5GAN D;  3UVT A;  6GSV A;  1BJX A;  1F2E A;  5J9C A;  1GH2 A;  2MMA A;  2QGV A;  1PX7 A;  1ABA A;  4CHS A;  1NSW A;  3PGT A;  3TKQ A;  3OR5 A;  2JAD A;  4KB3 A;  1SK1 A;  1A23 A;  3QFA C;  2UZ8 A;  2YNX A;  4EIP A;  2IMK A;  1FW1 A;  4HI7 A;  3CXG A;  4MZW A;  1X5E A;  4IQA A;  3APO A;  4LMW A;  3GST A;  3N9J A;  1G6Y A;  1UVZ A;  5KN0 A;  1GUM A;  1AQV A;  3CTF A;  3RPN A;  1YF1 A;  4KX4 A;  5DQS A;  3O6T A;  3RBT A;  2CVB A;  1XW6 A;  1XIY A;  1O8X A;  5JCU A;  1EOH A;  3L4N A;  3ZYW A;  2HFD A;  2BJX A;  2FHE A;  3UMA A;  2P5R A;  3KD0 A;  1X9W B;  4KSM A;  1B8X A;  3R3E A;  3IXR A;  2DJ2 A;  2VD0 A;  3EIN A;  1IYH A;  4POK A;  1WE0 A;  4POB A;  4EVM A;  5L71 A;  2C0E A;  4YQV A;  2RLI A;  1FB0 A;  2H6X A;  4Q5R A;  2KHP A;  3RHC A;  4K0G A;  5IPG A;  1HD2 A;  1O73 A;  1XWA A;  2DBC A;  2ON5 A;  1PQN A;  5ECI B;  4NPB A;  5IMF A;  4ZB9 A;  4MLY A;  4X4J A;  4FIW A;  3A5I A;  3GN3 A;  3A2V A;  3W8J A;  2GZP A;  3QFB C;  1SD8 A;  5HR2 A;  4IW9 A;  3TJJ A;  3EU3 A;  3DYR A;  3QR6 A;  1GTI A;  4N30 A;  5GAP D;  3GL3 A;  1LBK A;  2JSZ A;  3WYW A;  2QA2 A;  4JZQ A;  4EIQ A;  5HR1 A;  3G7I A;  4MNN A;  1J08 A;  2TRX A;  4PX1 A;  3GH6 A;  1EGO A;  1XXU A;  4IVF A;  2CX3 A;  3TKR A;  2OBI A;  3ZFB A;  1GL8 A;  1USB A;  4LLR A;  2LJA A;  3GSS A;  5KN2 A;  2YPM A;  5J4U A;  1T4Z A;  4F0C A;  3SBC A;  2PVQ A;  3LGC A;  1TI1 A;  4O7H A;  4IP6 A;  4ULX A;  3QPM A;  2VLV A;  5CAX A;  3C71 A;  1V9W A;  2B5X A;  3ME8 A;  4HQZ A;  5GZZ B;  1YDK A;  2B7K A;  2V41 A;  2X64 A;  4HQS A;  5DAK B;  2XBQ A;  2LNT A;  5ECL B;  4D73 B;  3QAV A;  3AY8 A;  4IS0 A;  2R0G A;  5ELG A;  2A2R A;  2I3Y A;  2IJY A;  1FOH A;  4MF7 A;  5B8A A;  1JLV A;  1SKR B;  1JHB A;  12GS A;  3IR4 A;  3MYD A;  3LJR A;  1R5P A;  4TR4 A;  1TKD B;  1F37 A;  5KN3 A;  2LEG A;  3TRQ A;  1OE8 A;  2GGT A;  1TK8 B;  1GUH A;  4K1F A;  1RQM A;  2C0G A;  5BMU A;  3N5O A;  1PN9 A;  4N10 A;  1QMV A;  1A8Y A;  5IOW A;  3VPT A;  1YY7 A;  2PBJ A;  2GST A;  3D0Z A;  3ERG A;  2C3N A;  3F4S A;  1LJR A;  5AIV A;  1SYX A;  2H74 A;  2VAF A;  1K0O A;  4ECJ A;  1Z7P A;  1S3A A;  3TJF A;  2IN3 A;  2VL2 A;  2WDU A;  3WT1 A;  3KP9 A;  3C1R A;  3G9B A;  3BCI A;  3HD5 A;  2AV4 A;  4BA7 A;  3O76 A;  1X0R A;  4OFT A;  1IYI A;  4NV2 A;  2P5Q A;  13GS A;  1EV9 A;  4X43 A;  5B8B A;  3UJ1 A;  1N2A A;  1K0C A;  1V40 A;  5H5S A;  3C1S A;  4HOJ A;  1ZYQ B;  4NMU A;  4K7O A;  1ERW A;  3GH9 A;  4HS1 A;  1DBY A;  1SKW B;  2J23 A;  3ME7 A;  3ED3 A;  3KM6 A;  4NHW A;  4LL4 B;  2IL3 A;  3VWW A;  5DJM A;  1B4Q A;  2VM1 A;  4HDE A;  4ECC A;  4MPF A;  2FA4 A;  3ZVJ A;  4D73 A;  2R0P A;  4K2D A;  1TK5 B;  4XS1 A;  5KOW A;  2RUE A;  3A3T A;  2YJH A;  4TR1 B;  2DIY A;  3ZRE A;  1XVQ A;  4XRD A;  3TRP A;  1FHE A;  2DKH A;  1X5C A;  2R3X A;  5DVB A;  2R6K A;  1AIU A;  4L5L A;  5ABR A;  1PX6 A;  5KOX A;  3WGX A;  3O3T A;  2E0Q A;  3FHK A;  1SK2 A;  2HZE A;  3J7Y b;  3G7J A;  3ZRD A;  1A2M A;  4ZIJ A;  2H72 A;  1KBN A;  4K5R A;  4I5Q A;  2WS2 A;  4I2U A;  2HRK A;  2KP2 A;  1ERT A;  2B7J A;  1ZYP A;  2YV7 A;  1EP7 A;  4Z2U A;  1YEP A;  2A2S A;  2ZCT A;  2H8L A;  4YAV A;  1F6M C;  3DXB A;  2YN1 A;  3TJB A;  3ZMK A;  1U3I A;  3IK7 A;  3IC4 A;  1XVW A;  1OC8 A;  1TK0 B;  2FY6 A;  5ECS A;  2VM2 A;  1S3D A;  5GSS A;  1WIK A;  2YV9 A;  3KH7 A;  3D21 A;  4KDU A;  3EC3 A;  3RDW A;  4I8B A;  4JED A;  5J5N A;  4OD7 A;  6GSS A;  3IK9 A;  3Q6O A;  5D9X A;  1SJI A;  3IPZ A;  1Z3E A;  4KND A;  1ZCP A;  2H6Y A;  4DSS B;  2TIR A;  4G2E A;  1R4W A;  5F8B A;  3FR6 A;  1EZK A;  1I9D A;  3US3 A;  4J2F A;  3TGZ A;  2OBK A;  2WB9 A;  5DAL B;  3UEM A;  3KMN A;  4PQH A;  3H1N A;  4BWS A;  2DKI A;  4TRX A;  5D9W A;  2YZU A;  3TKS A;  4TR1 A;  2Z9S A;  4KW6 A;  2C4J A;  2XPD A;  1MD3 A;  2E7P A;  2PMT A;  2DJ3 A;  1ZOF A;  4E8E A;  2GSS A;  2OJL A;  1TOF A;  4MZB A;  2PPT A;  1K0N A;  1F3B A;  1TRU A;  4L8E A;  2XPE A;  2X8H A;  2L6C A;  2HE3 A;  3GL5 A;  2LJR A;  2BMX A;  4Z2T A;  4Z2R A;  4RI7 A;  1YKA A;  3QOU A;  3FR9 A;  4WET A;  1FG4 A;  3FR3 A;  1CQH A;  4MJE A;  4WBR D;  2GS3 A;  4HJ2 A;  5D9V A;  4HJM A;  2C0D A;  2X8C A;  2M80 A;  2M46 A;  1M99 A;  2VCX A;  4MDC A;  4Q5F A;  1BED A;  4MF6 A;  2VIM A;  1RK4 A;  7GSS A;  4XCS A;  3GX0 A;  1T3B A;  2ES7 A;  1HNA A;  2K6V A;  3FMW A;  3TDG A;  1QUW A;  2HRF A;  4EE0 A;  1M7T A;  4YKG A;  3HDC A;  3LEF A;  1GSD A;  4L0U A;  1PSQ A;  3GV1 A;  4BVX B;  5IIZ A;  2JZS A;  1GSQ A;  3JCM L;  3BCK A;  2IWT A;  3UL3 A;  1BX9 A;  3APQ A;  3ZML A;  3Q74 A;  1Q4J A;  4KUN A;  2H0G A;  1SL2 B;  2JL4 A;  4IQ1 A;  1J0F A;  4GSS A;  1SEN A;  1OKT A;  1M2D A;  2QC7 A;  3KP8 A;  4DSS A;  4WEY A;  4XIH A;  1O8W A;  2RM6 A;  4HZ4 A;  4KH7 A;  2XC2 A;  3CSH A;  2FNO A;  1B4P A;  4J56 E;  1Q98 A;  4V2N A;  4YQM A;  5DAL A;  4OMV A;  1GLP A;  4CY6 A;  2AJQ B;  3FZ5 A;  5D73 A;  3NZN A;  1SKS B;  5B7C A;  2LQQ A;  5D9T A;  4ILF A;  2FD3 A;  3ZZX A;  3IBH A;  3C8E A;  5HR3 A;  4PUR A;  3CTG A;  3A5W A;  1Y6E A;  1FOV A;  2YWM A;  1XOB A;  5B6M A;  1FB6 A;  4Z7X A;  1SK0 A;  5AGY A;  1PGT A;  1U6T A;  1ERV A;  4MA9 A;  2F3M A;  2DJ1 A;  5DBQ A;  3LXT A;  1V2A A;  1T00 A;  2VCV A;  3F3Q A;  1K0D A;  4NHZ A;  3HY2 A;  3IHQ A;  6GSU A;  1PA3 A;  1U87 A;  1PMT A;  4V1A g;  2HSH A;  2C8U A;  2VL3 A;  2C0F A;  2JZR A;  1DUG A;  4IHU A;  4ZBA A;  5E4W A;  4KAE A;  2AUV A;  3NIV A;  2H75 A;  2DJK A;  5IMV A;  1MDI A;  2LV3 A;  4PTS A;  2NBS A;  1XWC A;  2K8V A;  4BVX A;  3FZ9 A;  2CAQ A;  2LNS A;  3GIX A;  1Z5Y E;  2F9S A;  1A2J A;  2YZH A;  4LMV A;  1PL2 A;  2H71 A;  18GS A;  1ZMA A;  5E59 A;  3KEB A;  1S3C A;  5B6N A;  4ZL9 A;  2EIO A;  2H1G A;  5LNK e;  2M72 A;  2CVD A;  1FVK A;  2OE1 A;  5AN1 A;  2O87 A;  4MP4 A;  2X8G A;  2V1M A;  3QMX A;  1B48 A;  2I81 A;  4AJ8 A;  2GQL A;  5IO2 A;  1GWC A;  4TKY A;  1ILO A;  1QQ2 A;  17GS A;  2LS5 A;  1E6B A;  1GUL A;  2LRT A;  5HFI A;  3GNJ A;  2L59 A;  3R2Q A;  3SWL A;  1MDK A;  2IPA A;  3I69 A;  4ZBD A;  3KCM A;  1TDI A;  1ZYN A;  5G2Z A;  3GKX A;  2IIY A;  4HU9 A;  4HEA 2;  2VCW A;  4GQF A;  1FO5 A;  5KN1 A;  2C3T A;  2BTO T;  3QAG A;  1YF0 A;  3RPP A;  4L0W A;  2H66 A;  3UBK A;  1XFL A;  1A2L A;  1WPI A;  1QXH A;  1OAZ A;  2O7K A;  3FZ4 A;  1JZO A;  3GUS A;  3M0F A;  1NW2 A;  2CZ3 A;  3EPT A;  1PKW A;  5COH A;  2AYT A;  3VPQ A;  1AQW A;  3GFK A;  5DDL A;  4G0L A;  5GST A;  5INY A;  2A2P A;  1TI3 A;  3IDV A;  2VL9 A;  2KUC A;  3F63 A;  8GSS A;  1EEM A;  1QGV A;  2REM A;  5ELA A;  1DSB A;  4ECI A;  4KF9 A;  3KIJ A;  5AIX A;  3VFI A;  4XS6 A;  2H1B A;  3LSZ A;  4N11 A;  1XWB A;  5CRG A;  4EC0 A;  3LW9 A;  2KOK A;  5JCG A;  4F82 A;  4H86 A;  2HYX A;  1GSS A;  3IRA A;  2X4A A;  5JWO B;  2TRC P;  11GS A;  1OVN A;  1VF4 A;  2B5Y A;  6GST A;  2FCH A;  2WFC A;  3L9V A;  1M9A A;  3LYP A;  3VI7 A;  5DQY A;  1U3A A;  4OO5 A;  3TKS E;  4AF2 A;  20GS A;  1XZO A;  4PXO A;  2CA8 A;  5ENU A;  3C7M A;  1OC3 A;  2CVK A;  3MAK A;  1Z6M A;  3EU4 A;  3DKS A;  1ON4 A;  4HU7 A;  3BOA A;  3E3E A;  4IEL A;  4A5P A;  1AXD A;  3FKF A;  1TXX A;  4EXJ A;  4OO4 A;  2OE3 A;  1YQ1 A;  6GSW A;  3CSI A;  1WRY A;  2N5B A;  4X1U A;  5CRD A;  1GSU A;  2GDR A;  1A24 A;  4DSR A;  14GS A;  2B1K A;  1GLQ A;  1XWK A;  3KMO A;  2H70 A;  3WT2 A;  1G7E A;  4GXZ A;  2FWH A;  2OA7 A;  5CNW A;  1EV4 A;  4DVC A;  4V1A p;  4L5O A;  3VK9 A;  3LXZ A;  4LA1 A;  3IA1 A;  3GYK A;  2H0H A;  3VWV A;  5FHI A;  2WUL A;  3TKP A;  3IV4 A;  3LWA A;  2GVP A;  3LOR A;  2GSQ A;  2JU5 A;  1GUK A;  2X99 A;  1SJZ A;  6GSX A;  3HCZ A;  1ZL9 A;  2DIZ A;  1R26 A;  2YWI A;  1SL1 B;  2MZC A;  22GS A;  1WOU A;  3FK8 A;  4EL1 A;  3F9U A;  5DAK A;  1GTB A;  1YEX A;  5A5K A;  1O7U A;  1JZD A;  4WKW A;  3DML A;  5JWQ B;  1A0R P;  5IMZ A;  1O85 A;  4PNG A;  2YAN A;  4O5R A;  2IMF A;  4ECB A;  1OE7 A;  4K7N A;  3CRU A;  4KDY A;  3P8W A;  5FT3 A;  1H75 A;  2HI7 A;  2DLX A;  2F51 A;  1EEJ A;  1M2A A;  1Z7R A;  3GRX A;  4PUF C;  1EWX A;  4I2T A;  4O5Q A;  5C04 A;  3IHG A;  3D6I A;  2R0C A;  3M1G A;  2A4V A;  3TJG A;  4EDZ A;  3L0H A;  4POM A;  1K3O A;  1NM3 A;  4MMM A;  2DSA A;  4WR5 A;  2JSY A;  3D22 A;  2C80 A;  4WBJ A;  4ZXG A;  2DJ0 A;  2PVO C;  2L5O A;  2HSM A;  3CSJ A;  16GS A;  3W6G A;  4WF5 A;  1J9B A;  4GQC A;  3TCO A;  2G0F A;  3ZVJ D;  1HYU A;  2H01 A;  4TVE A;  2JZT A;  3F6F A;  2GSR A;  2HNL A;  5CO3 A;  4DEJ A;  1O81 A;  1PKZ A;  2R2J A;  2C3Q A;  3FRC A;  4XS4 B;  1V58 A;  1OYJ A;  3GKK A;  2PGT A;  2CX4 A;  2H30 A;  2YWN A;  4EUY A;  3M9J A;  4TW5 A;  1AQX A;  3ZIV A;  4XTS A;  4ZL7 A;  4TR3 A;  1DE1 A;  2LRN A;  3LQ7 A;  2F8A A;  3GTU B;  2XBI A;  3KTL A;  3BJ5 A;  1BAY A;  4FO5 A;  2WGR A;  2HRN A;  4Q5N A;  1WJK A;  4FYB A;  2E2M A;  1K0A A;  3LYK A;  4ZB6 A;  1B9Y C;  4FYC A;  1W89 A;  3EMP A;  5F0G A;  1VRS D;  2IMI A;  1UN2 A;  4G0K A;  2VCQ A;  2O85 A;  3IAS 2;  1JZR A;  1ZGN A;  2V32 A;  4CY8 A;  1M0U A;  5G1K A;  4TXO B;  3HJM A;  5EL8 A;  5IMA A;  1X9M B;  2L4Q A;  2RM5 A;  2FWF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...