1AIUA

Human thioredoxin (d60n mutant, reduced form)
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
105
structure length
105
Chain Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords THIOREDOXIN
publication title Human thioredoxin homodimers: regulation by pH, role of aspartate 60, and crystal structure of the aspartate 60 --> asparagine mutant.
pubmed doi rcsb
source organism Homo sapiens
total genus 34
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 1997-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1aiuA00
2YV9A 3D4TA 1BJXA 2L59A 5G31A 1XXUA 4NPBA 1EZKA 2C8UA 5D9TA 4GQFA 4JR4A 1N2AA 2V41A 1NHOA 5IOWA 1O7UA 4KSOA 4AJ8A 3PH9A 4J56E 1S3CA 2V6KA 4AJ6A 2NPBA 2GSRA 4K7OA 3DYRA 3QPMA 1X5DA 4G10A 1GUKA 4WBRD 4N0VA 2A2RA 1J9BA 2IN3A 1BYEA 2VD1A 3APQA 1C72A 5ECMB 1OKDA 4XS1A 2L6CA 2FNOA 4N11A 4MABA 2TRXA 3C8EA 1LBKA 2LUSA 2YPMA 2ON7A 1GTUA 2IFQB 4K6XA 5HFKA 8GSSA 4Q5FA 4G19A 3EMPA 2G0FA 2P5RA 1MTCA 2YWOA 3FZ4A 2I1UA 1FB0A 2PPTA 2N5AA 4HEA2 4XHMA 2R6KA 4I5QA 2YZHA 1Q4JA 1J0FA 1GLPA 2REMA 2DIYA 3ZITA 1ST9A 5G5EA 4HJMA 1HYUA 2B7KA 1T8EB 3S9FA 3QCPA 1E6BA 1SKRB 2CQ9A 1B48A 2C1YA 2NBSA 2GQKA 2DC5A 2C0GA 1EOGA 4MPFA 4E8EA 1TXXA 2JZTA 1THXA 1TK0B 2AB6A 3CMIA 4HQZA 3UVTA 1T1VA 2CVBA 4QL7A 1SENA 3VPQA 2QC7A 4OD7A 1QGVA 2N5BA 3TJJA 4JE1A 5IO0A 4RQRA 2O7KA 5LCZA 4TXVA 19GSA 2GZZA 5ID2B 2ON5A 3ZFBA 4DSSA 2YN1A 1Z6NA 5D9VA 2H76A 2HT9A 2WFCA 1GSYA 4BWSA 1MEKA 1WIKA 5D9WA 4ZXGA 3UAPA 2EC4A 2WULA 2YZUA 3APSA 4KUNA 1SL0B 2E2MA 1QK8A 3IDVA 1I9DA 2IMIA 5FT3A 1PRXA 3TKSC 2E0QA 1TK8B 1YKAA 4AJ7A 1DE2A 2PVOC 5CO3A 3IV4A 4MZWA 2O87A 2AAWA 2PMTA 4DVCA 2HRNA 22GSA 4F0BA 2VLUA 3IK9A 4IKHA 2NDOA 4HI7A 5C04A 1FAAA 3V1WA 3GFKA 2VM1A 4HQSA 1EGOA 2VLVA 1OC9A 2JADA 2FCHA 2B3SA 1A2LA 2JSYA 4O7HA 3M1GA 4I2UA 3EWLA 1JFUA 1GSUA 1V98A 4K9ZA 4RQXA 2VCTA 4ZB8A 2DBCA 5AIXA 2GVPA 2L6DA 4WEYA 4IP1A 1GSDA 1MD4A 3TUEA 3ME7A 3KP9A 4MK3A 4IW9A 3MSZA 1K3YA 1ACVA 4L5LA 3A2VA 1V57A 1M9BA 4EE0A 3H8QA 2IMDA 1TRSA 14GSA 1X5EA 3VPTA 2H66A 3HHVA 3ED3A 5IM9A 3BJ5A 5EVOA 3HVXA 3EYTA 3G9BA 3ERWA 3VI7A 4LMWA 4NMUA 1T3BA 2FWFA 3DEXA 3ZIVA 3ZMLA 5DAKB 4V2LA 5CRWA 4F82A 1GL8A 3VWXA 3HVSA 4WXTA 3D4MA 5B8BA 3D6IA 1A8LA 5ECOB 2QGVA 5ENUA 4LLRA 2X8GA 1MDIA 3LGCA 2AJQB 4KNDA 3FRCA 1WPIA 5L71A 1YZXA 6GSUA 2WB9A 2D2ZA 1DUGA 4OCEA 5KN0A 2F9SA 4PUFC 4D73B 1XWAA 2EIOA 4F0CA 1VF4A 2XBIA 2WGRA 4BA7A 3H79A 3GN3A 4LA1A 3GA4A 1G6WA 2E7PA 1RW1A 5KN1A 2PN8A 2EIQA 2VOCA 1V58A 2H72A 2YNXA 2KHPA 2LQOA 4K7NA 3WD6A 3IR4A 4N0ZA 1PL2A 1PKZA 2FD3A 3M9JA 2P5QA 4ZL9A 3APOA 6GSYA 3C1RA 2PBJA 3KGKA 1PL1A 1FW1A 2C0EA 4MH3A 4MZBA 2OE3A 3DVWA 3I9V2 3CXGA 1Y25A 4MPGA 4ZBBA 3DIEA 3TKSA 2B1LA 2F8AA 5HR3A 16GSA 3BD2A 1JZOA 3GH6A 4MMMA 2DLXA 3DGQA 1XWGA 3FZ5A 4EKZA 1ZOFA 5ELGA 2HNLA 1J08A 1U88A 2GT5A 4JRRA 4ECBA 3C73A 2WRTA 4PUAA 1GSFA 4RUVA 2XPEA 4IP6A 1A23A 3L4NA 1T7PB 1PQNA 3CSJA 5B6MA 1X9SB 1SD8A 3BCKA 2FA8A 4MJEA 3GRXA 3TDGA 2DIZA 3DVXA 3P8WA 2GSQA 2I3YA 5DQSA 5FHIA 1JZWA 3EC3A 1ZGNA 3DXBA 1VF3A 4Q5RA 4XS6A 3GKMA 3QAGA 2N5FA 3GUSA 3KIJA 3KEBA 2C3QA 1GLQA 4TR1A 6GSVA 3F6DA 4KDUA 2B5EA 1XCCA 3FR3A 2CZ3A 4ZB6A 4L8EA 4GRFA 1SU9A 1TJDA 3MNGA 3VK9A 3DKSA 4DEJA 3O76A 3F0IA 5CRDA 3WGDA 3KMOA 2HFDA 2VL9A 1SD9A 4MDCA 1UVZA 1U3AA 1GRXA 1GNEA 4POBA 3HD5A 3QAWA 2H6XA 1NHYA 1R7HA 4ECJA 3G7YA 1EOHA 5J4UA 1AAZA 2WJUA 4FYUA 2V2GA 2PWJA 4GTUA 3IHQA 2CVKA 5EY6A 1ILOA 5COHA 4GXZA 2IJYA 3L9UA 3VURA 1JZDA 3O6TA 2FA4A 1EP8A 3GX0A 1O8XA 4EC0A 1YEPA 5IMCA 2LNSA 4HUAA 4DSSB 1HNAA 3LEFA 1O81A 1GUMA 2H6YA 2IL3A 2KP1A 2V32A 20GSA 2MZCA 2BTOT 4RI7A 4N30A 3TRQA 5E4WA 2LRCA 3RDWA 3EVIA 1H4OA 4KB3A 1AC1A 2DJ1A 4ZIJA 4AGSA 3U6VA 2VCQA 3QD9A 2DJKA 4JBBA 3HYPA 1K0NA 1ERVA 4EDZA 4DSRA 3TRXA 2EIRA 2B5XA 1XZOA 3EURA 1W4VA 3A2WA 3IK7A 2CAIA 4WR4A 1YF1A 4ID0A 1EP7A 1S3DA 2L57A 4ECIA 5D8IA 1M2DA 4Q5NA 2X99A 5LNKe 3WT1A 3HVVA 3GL3A 3QDNA 1GTAA 3UVHA 3IC4A 2R3XA 2H1BA 1OC9B 2L5OA 1YF0A 1Z9HA 4IN0A 1B4PA 2H19A 5KN3A 2IMKA 1B9XC 4XCSA 2MBTA 4L0UA 1SKWB 4YQVA 5IPHA 1Z6MA 2FWEA 3GIXA 2H1DA 1EGRA 4HOJA 4N10A 2QKEA 1ABAA 5CYYA 1LU4A 4PURA 2GZPA 5CREA 1O73A 3GSTA 3ERFA 1OE8A 4HJ2A 2OKAA 3M8NA 1NSWA 1EEJA 3UL3A 3L78A 1PKWA 3C1SA 2OBKA 5B6NA 3QFAC 4CW9A 1FB6A 2TRCP 3FZAA 1QQ2A 2LKUA 3KJYA 4OCFA 3A3TA 1T4YA 2K9FA 4TXOA 2A2SA 3FYGA 4YH2A 2ZUPA 3ZTLA 2F3MA 4OWYA 4EXJA 1PX7A 3PINA 3H93A 3GNJA 2RLIA 1SJ6A 2FGXA 4KDXA 1F37A 5CAXA 3UMAA 3A2XA 1GSQA 3IXRA 2PGTA 2ES7A 3TKQA 1Z7PA 1G7OA 2I4AA 4IVFA 5GAPD 3SWLA 4IELA 1BAYA 4ZILA 4LL1B 5GSTA 3GX8A 1XW9A 2A4VA 4O5RA 1TOFA 4MF6A 4EUYA 1XWBA 4FO5A 1ZMAA 1GP1A 3CTFA 3LFLA 2GSSA 5GAND 4XIHA 1KEBA 4BPYA 3ME8A 3DD3A 1F2EA 2O89A 1WMJA 5H5SA 3GURA 1I5GA 3KH7A 3J7Yk 1OE7A 3D5JA 1XW6A 1ERTA 1AW9A 3WGEA 1W89A 4OMVA 4ZBDA 3EINA 2I9HA 3N9JA 2Z9SA 3E9JB 2KLXA 1AQVA 3BBYA 3CSHA 3G7JA 1TW9A 3UOMA 2VAFA 3VWVA 3LYPA 1G6YA 2VCXA 3C7MA 4PNGA 2B6MA 4PXOA 2B5YA 1V9WA 1NM3A 1A0FA 3HJPA 4KGIA 2YP6A 3CBUA 1CQHA 1O6JA 2YWMA 3LORA 4J2FA 1FVKA 2YJ7A 1S3AA 4TR4A 5J41A 2AV4A 3PGTA 3ZVJA 3RHCA 2GTUA 5DALA 1AIUA 5AN1A 11GSA 4ISDA 3TJFA 3IA1A 5GZZB 3NOFA 1LJRA 4V2NA 1Z7RA 1B9YC 5IMFA 1TRWA 2RM6A 5AIVA 3IAM2 3ERGA 1MDJA 1T00A 2R2JA 1XWCA 5J9BA 5J5NA 5DBQA 3DMLA 4KSMA 4JR6A 5B7CA 1HQOA 4MP4A 2DJ3A 5IIZA 1GWCA 3M3MA 1TI1A 2H1GA 5D73A 3BCIA 3EU3A 4IGJA 10GSA 2K18A 2YV7A 1Q98A 2VL3A 3LXZA 5B8AA 1EEMA 3M0FA 1BQ7A 1TRVA 1UC7A 2C0FA 2FHEA 3ZYWA 2LSTA 1SL1B 3GKKA 3ZMKA 4PGTA 1WWJA 2RUFA 4L5OA 3TOUA 4TR1B 12GSA 3IE3A 3M9KA 2YOIA 3GL5A 3ZZXA 1XVQA 3LJRA 1PD21 4P3YB 1XIYA 5JWQB 1GSEA 5JCUA 3SBCA 4H86A 2L4CA 2VUPA 2RUEA 4MF5A 1UA5A 3F3RA 5IMAA 1TDIA 4IQAA 1FVJA 4ML6A 2GQLA 2F51A 5CRGA 3CSIA 1WP0A 3HKRA 5IOXA 4GSNA 7GSSA 2FLSA 1SYXA 1H75A 1WE0A 2GZYA 4BVYA 5ECIB 5G1KA 4PQHA 3TKRA 4XS4A 1RK4A 5D96A 1AXDA 3FHKA 3ISOA 3HZ4A 5C00A 3VWUA 4ZBAA 5LD0A 2LNTA 3MDKA 1E2YA 3Q74A 2FUG2 2KUCA 1JLVA 2H73A 3RHBA 4GCIA 2CT6A 5HFIA 1VF2A 1X0RA 4WETA 17GSA 4BWQA 2J9HA 4ILFA 5HR2A 4EDYA 2VCZA 5JWRB 1F3BA 4KW6A 1SL2B 3VLNA 4K0NA 1MDKA 4QQ7A 1BEDA 2B1KA 4F03A 1G0TA 2VIMA 5JCWA 5A4WA 3IBHA 2HZEA 2VL2C 3KZQA 3F6FA 1R5PA 1TRUA 3EMXA 2LJKA 3I69A 5D93A 3KTLA 2MMZA 2AYTA 1WRYA 1YKCA 3U5RE 2HLSA 1SK0A 1XPVA 5IMZA 2LS5A 2HE3A 4Q5QA 3K8NA 1UN2A 1OC8A 2MMNA 1G7EA 4POMA 4HZ2A 3HY2A 4EO3A 1K0DA 2VCWA 1A24A 5IPGA 4WKWA 4BVXA 2DMLA 2OADA 5F07A 2RM5A 2C4JA 1CQGA 2M72A 1X5CA 3KH9A 4MJBA 1R5AA 2R4VA 2NVLA 1F3AA 1XOAA 3AY8A 4NV5A 2XC2A 1RQMA 4FIWA 4KDYA 3KTBA 2V6OA 2GS3A 3GSSA 4ULXA 2H0HA 5G2ZA 3A5WA 4PQIA 4FYBA 1U3IA 3TB2A 2VLTA 3EE2A 4G9HA 4ZL7A 2IPAA 4TXOB 1V40A 1Z5YE 4IBPA 2K6VA 4IQ1A 4KCEA 4KCAA 4HDEA 2GQMA 2C80A 3HXSA 1TKDB 3NZNA 3RAZA 1U6TA 3TOTA 3VI5A 1TTZA 2C3TA 2H70A 4I97A 3KMNA 3LG6A 2CV4A 2HRFA 1VF1A 1QMVA 4OO4A 2ZNMA 2HSHA 5DJMA 2HYXA 1MD3A 3L0HA 1XVWA 6GSWA 5A4UA 2H0GA 3F3QA 2OACA 1KBNA 1M9AA 4V2MA 2LJAA 2O85A 4X43A 2K8SA 2JACA 1PA3A 4HU9A 3UBLA 1GSSA 1FG4A 4I6XA 2KP2A 3GHAA 1F6MC 2VD0A 4IJ3A 4XRDA 1QUWA 1GTIA 1BG5A 3FW2A 4MH2A 2GGTA 4NHWA 5J3RA 3QFBC 2OBIA 5HR1A 1K3LA 1TU7A 3WYWA 1OKTA 1PX6A 3GYKA 6GSTA 1VRSD 1VGLA 1K0AA 2VL2A 1EV4A 3KXOA 4MF7A 4TW5A 1A2JA 4ZL8A 4PQ1A 4TN8A 3MWHA 1YQ1A 4TR0A 2FWGA 3W8JA 1JHBA 1USBA 3IRAA 4YAPA 3D22A 2J23A 1WJKA 1V2AA 3F63A 4IS0A 3TJKA 1X9WB 4GF0A 5DALB 1DSBA 4FH8A 4K7IA 3QAVA 2VCVA 5CP1A 3W6GA 3GTUA 2YWIA 3R2QA 4YQMA 2JZSA 1OC3A 2CX4A 1SK1A 5HQPA 3QMXA 3H4KA 4PX1A 3IPZA 4QL9A 2X64A 2GT6A 4KE3A 5ELAA 3LYKA 1DE1A 6GSSA 4GQCA 2TIRA 2DJ0A 5G30A 2H01A 4WBJA 2GLRA 1THOA 2XHFA 1IYHA 1ZZYA 1R26A 2IMFA 3VWWA 1M2BA 1GULA 4NAXA 1Y6EA 2MBSA 3WGXA 4NWYA 1JZRA 1FOVA 5INYA 3ZLPA 4ECCA 2CZ2A 2IWTA 3KP8A 3LQ7A 2VO4A 2CVDA 1TK5B 4HU7A 3FEUA 3TCOA 1XW5A 5DVBA 1ZYQB 4YAVA 4OFTA 5ECPB 2CX3A 4X0XA 1XWKA 5DCHA 2H8LA 2WS2A 4TKYA 4BL7A 2ALBA 4G2EA 3FK8A 5E59A 1QXHA 4GWRA 5FWGA 2LTKA 4O92A 1BX9A 4X1UA 9GSSA 4J57E 1DBYA 1T4ZA 5ABRA 1N8JA 3TJGA 3ZRDA 4POKA 2ZCTA 2HXKA 5IQYA 3ZL5A 1IYIA 3F9UA 2PUKC 1AQXA 4TVEA 3ZVJD 3F4TA 4XS4B 1O85A 4K0GA 3TKSE 5EPFA 3KM6A 2IFQA 3FR9A 3DRNA 2YCDA 4XRAA 4WF4A 4GSSA 3L9SA 1K0BA 2H6ZA 3HDCA 2B7JA 5HR0A 5DQYA 2XBQA 3P2AA 1URMA 1KNGA 3Q6OA 4K8MA 1ML6A 2H0IA 1M2AA 5HFGA 1YY7A 3GV1A 3FKFA 2RIIA 5DDLA 3UEMA 1OAZA 2BMXA 4ZB9A 4PNFA 5DCGA 5ECQB 2YANA 2HZEB 5F8BA 3UIWA 2LRNA 2WDUA 1YDKA 2HZFA 3LXTA 4Z7XA 4I2TA 2GDRA 5ECSA 4EL1A 5IMDA 2PVQA 3KD0A 3HCZA 2GSTA 3HZ8A 1YJ6A 2DJ2A 5IMVA 4MCUA 1A8YA 3RBTA 3F4RA 4RI6A 1AQWA 5ID2A 1XOBA 5ECLB 2V1MA 5IO2A 2JZRA 2NTOA 5CNWA 4O32A 5ECNB 3GH9A 3TRPA 1GTBA 4NHZA 4ACSA 4EF0A 3TGZA 4KAEA 3Q18A 2M80A 5H5RA 1KTEA 1R4WA 4DSQA 2M46A 4NV2A 4KA0A 3TJBA 2LJRA 1M0UA 2R5GA 13GSA 3ZIJA 5F0GA 1B4QA 2X8CA 4ML1A 3W8SA 1JLWA 1GUHA 3CTGA 3J7Yb 1NW2A 2H75A 3CRUA 1HNBA 2AHEA 1FO5A 1M7TA 2I81A 1TU8A 4EVMA 4MZCA 5F05A 3GMFA 2P0GA 2KOKA 3FR6A 1ERWA 3CYNA 1TI3A 3NIVA 3UBKA 3F8UA 1M99A 3HJOA 3FY7A 4I8BA 3N5OA 2OE1A 4GLTA 3CRTA 3F4SA 3ZFLA 3H1NA 1WOUA 1HNCA 5AISA 4HS1A 6GSXA 4JZQA 5AGYA 3UJ1A 4F9ZA 3IOSA 2BJXA 4MJCA 1AUCA 4JU5A 5GSSA 2FY6A 2C0DA 4TOPA 3I43A 3D21A 3D0ZA 1U87A 1F9MA 4E8HA 2MYGA 1K0OA 2OA7A 3QR6A 1SJIA 4MA9A 1FHEA 4NXIA 3TKPA 1GNWA 4LMVA 1ON4A 2H74A 1YEXA 3P7XA 5G1LA 5H5QA 5ECKB 4KH7A 1K0MA 4OO5A 1SKSB 3IAS2 2WCIA 2CAQA 3C71A 1ZYEA 1QFNA 2JU5A 3WT2A 3L9VA 2WZ9A 2YJHA 1OVNA 2DSAA 3G7IA 3ZREA 1K0CA 2E2GA 5DAKA 2XPDA 3BOAA 5ECRB 2MMAA 2H30A 4IJIA 2DMMA 4AF2A 5A5KA 3HA9A 2HSYA 4K1FA 2YWNA 4XTSA 4L0WA 3E0UA 2LQQA 4IHUA 1ZL9A 1XFLA 2P31A 1SJZA 3RPNA 1ERUA 5KN2A 2K8VA 2O8VB 5JCGA 3PR8A 4CDOA 3DWVA 3UARA 2CA8A 5KEJA 4D73A 1OYJA 2LEGA 1K3OA 1PN9A 2AUVA 3VFIA 1HD2A 1SK2A 4TR3A 4LL4B 2H1AA 4HZ4A 2IMEA 1A0RP 1TP9A 2L4QA 1PMTA 2LV3A 4K2DA 1PSQA 4V1Ag 3RPPA 1ZCPA 5F06A 5CRHA 1Z3EA 4MJAA 1A2MA 2FWHA 4KX4A 4POLA 1EV9A 2L5LA 4CHSA 3LWAA 4V1Ap 3GTUB 3I6AA 3QOUA 1GH2A 3Q19A 1X9MB 2G2QA 4YQUA 5A4VA 2C3NA 2LRTA 3GKNA 3EU4A 5D9XA 2QSIA 1B8XA 2IIYA 5DJLA 5ECHB 2PU9C 18GSA 4TRXA 3P90A 4WF5A 1O8WA 3HJMA 4MLYA 3FZ9A 3US3A 3JCML 2OJLA 4GSTA 2HI7A 3KCMA 1PGTA 1EWXA 5G5FA 4OFNA 3OR5A 1XBSA 4FYCA 2DJJA 5JWOB 2PERA 3E3EA 4OFMA 2MMOA 4JEDA 4F2IA 3O3TA 4WR5A 2H71A 2R37A 2JL4A 3GKXA 2VM2A 3MAKA 3LSZA 2JSZA 2OE0A 2X8HA 1SYRA 5J9CA 2F8FA 5EL8A
chains in the Genus database with same CATH superfamily
2YV9A 3D4TA 1BJXA 2L59A 5G31A 1XXUA 4NPBA 1EZKA 2C8UA 5D9TA 4GQFA 4JR4A 1N2AA 2V41A 1NHOA 5IOWA 1O7UA 4KSOA 4AJ8A 3PH9A 4J56E 1S3CA 2V6KA 4MNNA 4BL7B 4AJ6A 2NPBA 2GSRA 4K7OA 3DYRA 3QPMA 1X5DA 4G10A 1GUKA 4WBRD 4N0VA 2A2RA 1J9BA 2IN3A 1BYEA 2VD1A 3APQA 1C72A 5ECMB 1OKDA 4XS1A 2L6CA 2FNOA 4N11A 4MABA 2TRXA 3C8EA 1LBKA 2LUSA 2YPMA 2ON7A 1GTUA 2IFQB 4K6XA 5HFKA 8GSSA 4Q5FA 4G19A 3EMPA 2G0FA 2P5RA 1MTCA 2YWOA 3FZ4A 2I1UA 1FB0A 2PPTA 2N5AA 4HEA2 4XHMA 2R6KA 4I5QA 2YZHA 1Q4JA 1J0FA 1GLPA 2REMA 2DIYA 3ZITA 1ST9A 5G5EA 4HJMA 1HYUA 2B7KA 1T8EB 3S9FA 3QCPA 1E6BA 1SKRB 2CQ9A 1B48A 2C1YA 2NBSA 2GQKA 2DC5A 4Z2UA 2C0GA 1EOGA 4MPFA 4E8EA 1TXXA 2JZTA 1THXA 1TK0B 2AB6A 3CMIA 4HQZA 3UVTA 1T1VA 2CVBA 4QL7A 1SENA 3VPQA 2QC7A 4OD7A 1QGVA 2N5BA 3TJJA 4JE1A 5IO0A 4RQRA 2O7KA 5LCZA 4TXVA 19GSA 2GZZA 5ID2B 2ON5A 3ZFBA 4DSSA 2YN1A 1Z6NA 5D9VA 2H76A 4CY8A 2HT9A 2WFCA 1GSYA 4BWSA 1MEKA 1WIKA 5D9WA 4ZXGA 3UAPA 2EC4A 2WULA 2YZUA 3APSA 4KUNA 1SL0B 2E2MA 1PFOA 1QK8A 3IDVA 1I9DA 2IMIA 5FT3A 1PRXA 3TKSC 2E0QA 1TK8B 1YKAA 4AJ7A 1DE2A 2PVOC 5CO3A 3IV4A 4MZWA 2O87A 2AAWA 2PMTA 4DVCA 2HRNA 22GSA 4F0BA 2VLUA 3IK9A 4IKHA 2NDOA 4HI7A 5C04A 1FAAA 3V1WA 3EPTA 3GFKA 2VM1A 4HQSA 1EGOA 2VLVA 1OC9A 2JADA 2FCHA 2B3SA 1A2LA 2JSYA 4O7HA 3M1GA 4I2UA 3EWLA 1JFUA 1GSUA 1V98A 4K9ZA 4RQXA 2VCTA 4ZB8A 2DBCA 5AIXA 2GVPA 2L6DA 4WEYA 4IP1A 1GSDA 1MD4A 3TUEA 3ME7A 3KP9A 4MK3A 4IW9A 3MSZA 1K3YA 1ACVA 4L5LA 3A2VA 1V57A 1M9BA 4EE0A 3H8QA 2IMDA 1TRSA 14GSA 1X5EA 3VPTA 2H66A 3HHVA 3ED3A 5IM9A 3BJ5A 5EVOA 3HVXA 3EYTA 3G9BA 3ERWA 3VI7A 4LMWA 4NMUA 1T3BA 2FWFA 3DEXA 3ZIVA 3ZMLA 5DAKB 4V2LA 5CRWA 4F82A 1GL8A 3VWXA 2DKHA 3HVSA 4WXTA 3D4MA 5B8BA 3D6IA 1A8LA 5ECOB 2QGVA 5ENUA 4LLRA 2X8GA 1MDIA 3LGCA 2AJQB 4KNDA 3FRCA 1WPIA 5L71A 1YZXA 6GSUA 2A2PA 2WB9A 2D2ZA 1DUGA 4OCEA 5KN0A 2F9SA 4PUFC 4D73B 1XWAA 2EIOA 4F0CA 1VF4A 2XBIA 2WGRA 4BA7A 3H79A 3GN3A 3MYDA 1FOHA 4LA1A 3GA4A 1G6WA 2E7PA 1RW1A 5KN1A 2PN8A 2EIQA 2VOCA 1V58A 2H72A 2YNXA 2KHPA 2LQOA 4K7NA 3WD6A 3IR4A 4N0ZA 1PL2A 1PKZA 2FD3A 3M9JA 2P5QA 4ZL9A 3APOA 6GSYA 3C1RA 2PBJA 3KGKA 1PL1A 1FW1A 2C0EA 4MH3A 4MZBA 2OE3A 3DVWA 3I9V2 3CXGA 1Y25A 4MPGA 4ZBBA 3DIEA 3TKSA 2B1LA 2F8AA 5HR3A 16GSA 3BD2A 1JZOA 3GH6A 4MMMA 2DLXA 3DGQA 1XWGA 3FZ5A 4EKZA 1M3IA 1ZOFA 5ELGA 2HNLA 1J08A 4X4JA 1U88A 2GT5A 4JRRA 4ECBA 3C73A 2WRTA 4PUAA 1GSFA 4RUVA 2XPEA 4IP6A 1A23A 3L4NA 1T7PB 1PQNA 3CSJA 5B6MA 1X9SB 1SD8A 3BCKA 2FA8A 4MJEA 3GRXA 3TDGA 2DIZA 3DVXA 3P8WA 2GSQA 2I3YA 5DQSA 5FHIA 1JZWA 1PN0A 4YKFA 3EC3A 1ZGNA 3DXBA 1VF3A 4Q5RA 4XS6A 3GKMA 3QAGA 2N5FA 4K5RA 3GUSA 3KIJA 3KEBA 2C3QA 1GLQA 4TR1A 6GSVA 3F6DA 4KDUA 2B5EA 1XCCA 3FR3A 2CZ3A 4ZB6A 4L8EA 4GRFA 1SU9A 1TJDA 3MNGA 3VK9A 3DKSA 4DEJA 3O76A 3F0IA 5CRDA 3WGDA 5BRTA 3KMOA 2HFDA 2VL9A 1SD9A 4MDCA 1UVZA 1U3AA 1GRXA 1GNEA 4POBA 3HD5A 3QAWA 2H6XA 1ZYPA 1NHYA 1R7HA 4ECJA 3G7YA 4A5PA 1EOHA 5J4UA 1AAZA 2WJUA 4FYUA 2V2GA 2PWJA 4GTUA 3IHQA 2CVKA 5EY6A 1ILOA 5COHA 4GXZA 2IJYA 3L9UA 3VURA 1JZDA 3O6TA 2FA4A 1EP8A 3GX0A 1O8XA 4EC0A 1YEPA 5IMCA 2LNSA 4HUAA 4DSSB 1HNAA 3LEFA 1O81A 1GUMA 2H6YA 2IL3A 2KP1A 2V32A 20GSA 2MZCA 2BTOT 4RI7A 4N30A 2HSMA 3TRQA 5E4WA 2LRCA 3RDWA 2UZ8A 3EVIA 1H4OA 4KB3A 1AC1A 2DJ1A 4ZIJA 4AGSA 3U6VA 2VCQA 3QD9A 2DJKA 4JBBA 3HYPA 1K0NA 1ERVA 4EDZA 4DSRA 3TRXA 2EIRA 2B5XA 1XZOA 3EURA 1W4VA 3A2WA 3IK7A 2CAIA 4WR4A 1YF1A 4ID0A 1EP7A 1S3DA 2L57A 4ECIA 5D8IA 1M2DA 4Q5NA 2X99A 2DKIA 5LNKe 3WT1A 3HVVA 3GL3A 3QDNA 1GTAA 3UVHA 3IC4A 2R3XA 2H1BA 1OC9B 2HRAA 2L5OA 1YF0A 1Z9HA 4IN0A 1B4PA 2H19A 5KN3A 2IMKA 1B9XC 4XCSA 2MBTA 4L0UA 1SKWB 4YQVA 5IPHA 1Z6MA 2FWEA 3GIXA 2H1DA 1EGRA 4HOJA 4N10A 2QKEA 1ABAA 5CYYA 1LU4A 4PURA 2GZPA 5CREA 1O73A 3GSTA 3ERFA 1OE8A 4HJ2A 2OKAA 3M8NA 1NSWA 1EEJA 3UL3A 3L78A 1PKWA 3C1SA 5BMUA 2OBKA 5B6NA 3QFAC 4CW9A 1FB6A 2TRCP 3FZAA 1QQ2A 2LKUA 3KJYA 4OCFA 3A3TA 1T4YA 2K9FA 4TXOA 2A2SA 3FYGA 4YH2A 2ZUPA 3ZTLA 2F3MA 4OWYA 4EXJA 1PX7A 3PINA 3H93A 3GNJA 2RLIA 1SJ6A 2FGXA 4KDXA 1F37A 5CAXA 3UMAA 3A2XA 1GSQA 3IXRA 2PGTA 2ES7A 3TKQA 1Z7PA 1G7OA 2I4AA 4IVFA 5GAPD 3SWLA 4IELA 1BAYA 4ZILA 4LL1B 5GSTA 3GX8A 1XW9A 2A4VA 4O5RA 1TOFA 4MF6A 4EUYA 1XWBA 4FO5A 1ZMAA 1GP1A 3CTFA 3LFLA 2GSSA 5GAND 4XIHA 1KEBA 4BPYA 3ME8A 3DD3A 1F2EA 2O89A 1WMJA 5H5SA 3GURA 1I5GA 3KH7A 3J7Yk 1OE7A 3D5JA 1XW6A 1ERTA 1AW9A 3WGEA 1W89A 4OMVA 4ZBDA 3EINA 2I9HA 3N9JA 2Z9SA 3E9JB 2KLXA 1AQVA 3BBYA 3CSHA 3G7JA 1TW9A 3UOMA 2VAFA 3VWVA 3LYPA 1G6YA 2VCXA 3C7MA 4PNGA 2B6MA 4PXOA 2B5YA 1V9WA 2QA1A 4KF9A 1NM3A 1A0FA 3HJPA 4KGIA 2YP6A 3CBUA 1CQHA 1ZYNA 1O6JA 2YWMA 3LORA 4J2FA 1FVKA 2YJ7A 1S3AA 4TR4A 5J41A 2AV4A 3PGTA 3ZVJA 3RHCA 2GTUA 5DALA 1AIUA 5AN1A 11GSA 4ISDA 3TJFA 3IA1A 5GZZB 3NOFA 5KOWA 1LJRA 4V2NA 1Z7RA 1B9YC 5IMFA 1TRWA 2RM6A 5AIVA 3IAM2 3ERGA 1MDJA 1T00A 2R2JA 1XWCA 5J9BA 5J5NA 5DBQA 3DMLA 4KSMA 4FQUA 4JR6A 5B7CA 1HQOA 4MP4A 2DJ3A 5IIZA 1GWCA 3M3MA 1TI1A 2H1GA 5D73A 3BCIA 3EU3A 4IGJA 10GSA 2K18A 2YV7A 1Q98A 2VL3A 3LXZA 5B8AA 1EEMA 3M0FA 1BQ7A 1TRVA 1UC7A 2C0FA 2FHEA 3ZYWA 2LSTA 1SL1B 3GKKA 3ZMKA 4PGTA 1WWJA 2RUFA 4L5OA 3TOUA 4TR1B 12GSA 3IE3A 3M9KA 2YOIA 3GL5A 3ZZXA 1XVQA 3LJRA 1PD21 4P3YB 1XIYA 5JWQB 1GSEA 5JCUA 3SBCA 4H86A 2L4CA 2VUPA 3A5IA 2RUEA 4MF5A 1UA5A 3F3RA 5IMAA 1TDIA 3R3EA 4IQAA 1FVJA 4ML6A 2GQLA 2F51A 5CRGA 3CSIA 1WP0A 3HKRA 5IOXA 4GSNA 7GSSA 2FLSA 1SYXA 1H75A 1WE0A 2GZYA 4BVYA 5ECIB 5G1KA 4PQHA 3TKRA 4XS4A 1RK4A 5D96A 1AXDA 3FHKA 3ISOA 3HZ4A 5C00A 3VWUA 3LW9A 4ZBAA 5LD0A 2LNTA 3MDKA 1E2YA 3Q74A 2FUG2 2KUCA 1JLVA 2H73A 3RHBA 4GCIA 2CT6A 5HFIA 1VF2A 1X0RA 4WETA 17GSA 4BWQA 2J9HA 4ILFA 5HR2A 4EDYA 2VCZA 5JWRB 1F3BA 4KW6A 1SL2B 3VLNA 4K0NA 1MDKA 4QQ7A 1BEDA 5KOXA 2B1KA 4F03A 1G0TA 2VIMA 5JCWA 5A4WA 3IBHA 2HZEA 2VL2C 3KZQA 3F6FA 1R5PA 1TRUA 3EMXA 2LJKA 3I69A 5D93A 3KTLA 2MMZA 2AYTA 1WRYA 1YKCA 3U5RE 4CY6A 2HLSA 1SK0A 1XPVA 5IMZA 2LS5A 2HE3A 4Q5QA 3K8NA 1UN2A 2HRKA 1OC8A 2MMNA 1G7EA 4POMA 4HZ2A 3HY2A 4EO3A 1K0DA 2VCWA 1A24A 5IPGA 4WKWA 4BVXA 4Z2RA 4G0KA 2DMLA 2OADA 5F07A 2RM5A 2C4JA 1CQGA 2M72A 1X5CA 3KH9A 4MJBA 1R5AA 2R4VA 2NVLA 1XG8A 1F3AA 1XOAA 3AY8A 4NV5A 2XC2A 1RQMA 4FIWA 4BIKA 4KDYA 3KTBA 2V6OA 3MIXA 2GS3A 3GSSA 4ULXA 2H0HA 5G2ZA 3A5WA 4PQIA 4FYBA 1U3IA 3TB2A 2VLTA 3EE2A 4G9HA 4ZL7A 2IPAA 2QA2A 4TXOB 2X49A 1V40A 1Z5YE 4IBPA 2K6VA 4IQ1A 4KCEA 4KCAA 4HDEA 2GQMA 2C80A 3HXSA 1TKDB 3NZNA 3RAZA 1U6TA 3TOTA 3VI5A 1TTZA 2C3TA 2H70A 4I97A 3KMNA 3LG6A 2CV4A 2HRFA 1VF1A 1QMVA 4OO4A 2ZNMA 2HSHA 5DJMA 2HYXA 1MD3A 3L0HA 1XVWA 6GSWA 5A4UA 2H0GA 3F3QA 3HVNA 2OACA 2R0PA 1KBNA 1M9AA 4V2MA 2LJAA 2O85A 4X43A 2K8SA 2JACA 1PA3A 4HU9A 3UBLA 1GSSA 1FG4A 4I6XA 2KP2A 3GHAA 1F6MC 2VD0A 4IJ3A 4XRDA 1QUWA 1GTIA 1BG5A 3FW2A 4MH2A 2GGTA 4NHWA 5J3RA 3QFBC 2OBIA 5HR1A 1K3LA 1TU7A 3WYWA 1OKTA 1PX6A 3GYKA 6GSTA 1VRSD 1VGLA 1K0AA 2VL2A 1EV4A 3KXOA 4MF7A 4TW5A 1A2JA 4ZL8A 4PQ1A 4TN8A 3MWHA 1YQ1A 4TR0A 2FWGA 3W8JA 1JHBA 1USBA 3IRAA 4YAPA 3D22A 2J23A 1WJKA 1V2AA 3F63A 4IS0A 3TJKA 1X9WB 4GF0A 5DALB 1DSBA 4FH8A 4K7IA 3QAVA 2VCVA 5CP1A 3W6GA 3GTUA 2YWIA 3R2QA 4YQMA 2JZSA 1OC3A 2CX4A 1SK1A 5HQPA 4K2XA 3QMXA 3H4KA 4PX1A 3IPZA 4QL9A 4EIQA 2X64A 4O5QA 2GT6A 4KE3A 5ELAA 3FMWA 3LYKA 1DE1A 6GSSA 4GQCA 2TIRA 2DJ0A 5G30A 2A4HA 2H01A 4WBJA 2GLRA 1THOA 2XHFA 1IYHA 3PPUA 1ZZYA 1R26A 2IMFA 3VWWA 1M2BA 1GULA 4NAXA 1Y6EA 2MBSA 3WGXA 4NWYA 1JZRA 1FOVA 5INYA 3ZLPA 4ECCA 2CZ2A 2IWTA 3KP8A 3LQ7A 2VO4A 2CVDA 1TK5B 4HU7A 3FEUA 3TCOA 1XW5A 5DVBA 1ZYQB 4YAVA 4OFTA 5ECPB 2CX3A 2R0GA 4X0XA 1XWKA 5DCHA 4USSA 2H8LA 2WS2A 4TKYA 4BL7A 2ALBA 4G2EA 3FK8A 5E59A 1QXHA 4GWRA 5FWGA 2LTKA 4O92A 1BX9A 4X1UA 9GSSA 4J57E 1DBYA 1T4ZA 5ABRA 1N8JA 3TJGA 3ZRDA 4POKA 2ZCTA 2HXKA 5IQYA 3ZL5A 1IYIA 3F9UA 4BVYB 2PUKC 1AQXA 4TVEA 3ZVJD 3F4TA 4XS4B 1O85A 4K0GA 3TKSE 5EPFA 3KM6A 2IFQA 3FR9A 3DRNA 2YCDA 4XRAA 4WF4A 4GSSA 3L9SA 1K0BA 2H6ZA 3HDCA 2B7JA 5HR0A 5DQYA 2XBQA 3P2AA 1URMA 1KNGA 3Q6OA 4O5UA 4K8MA 1ML6A 2H0IA 1M2AA 5HFGA 1YY7A 3GV1A 3FKFA 2RIIA 5DDLA 3UEMA 1OAZA 2BMXA 4ZB9A 4PNFA 5DCGA 5ECQB 2R0CA 2YANA 2HZEB 5F8BA 3UIWA 2LRNA 2WDUA 1YDKA 2HZFA 3LXTA 4Z7XA 4I2TA 2GDRA 5ECSA 4EL1A 5IMDA 2PVQA 3KD0A 3HCZA 2GSTA 3HZ8A 1YJ6A 2DJ2A 5IMVA 4MCUA 1A8YA 3RBTA 3F4RA 4RI6A 1AQWA 5ID2A 1XOBA 5ECLB 2V1MA 5IO2A 2JZRA 2NTOA 5CNWA 4O32A 5ECNB 3GH9A 3TRPA 1GTBA 4NHZA 4ACSA 4EF0A 3TGZA 4KAEA 3Q18A 2M80A 4BVXB 5H5RA 1KTEA 1R4WA 4DSQA 2M46A 4NV2A 4KA0A 3TJBA 2LJRA 1M0UA 2R5GA 13GSA 3ZIJA 5F0GA 1B4QA 2X8CA 4ML1A 3W8SA 1JLWA 1GUHA 4HSCX 3CTGA 3J7Yb 1NW2A 2H75A 3CRUA 1HNBA 2AHEA 1FO5A 1M7TA 2I81A 1TU8A 4EVMA 4MZCA 5F05A 3GMFA 2P0GA 2KOKA 3FR6A 1ERWA 3CYNA 1TI3A 3NIVA 3UBKA 3F8UA 1M99A 3HJOA 3FY7A 4I8BA 3N5OA 3IC8A 2OE1A 4GLTA 3CRTA 3F4SA 3ZFLA 3H1NA 1WOUA 1HNCA 5AISA 4HS1A 6GSXA 4JZQA 5AGYA 3UJ1A 4F9ZA 3IOSA 2BJXA 4MJCA 1AUCA 4JU5A 5GSSA 2FY6A 2C0DA 4ICYA 4TOPA 3I43A 3D21A 3D0ZA 4Z2TA 1U87A 1F9MA 4K5SA 4E8HA 2MYGA 1K0OA 2OA7A 3QR6A 1SJIA 4MA9A 1FHEA 4NXIA 3TKPA 1GNWA 4LMVA 1ON4A 2H74A 1YEXA 3CQFA 3P7XA 5G1LA 5H5QA 4YKGA 5ECKB 4KH7A 1K0MA 4OO5A 1SKSB 3IAS2 2WCIA 4EIPA 2CAQA 3C71A 1ZYEA 1QFNA 2JU5A 3WT2A 3L9VA 2WZ9A 2YJHA 1OVNA 2DSAA 3G7IA 3ZREA 1K0CA 2E2GA 5DAKA 2XPDA 3BOAA 5ECRB 2MMAA 2H30A 2X4AA 4IJIA 2DMMA 4AF2A 5A5KA 3HA9A 2HSYA 4K1FA 2YWNA 4G0IA 4XTSA 4L0WA 3E0UA 2LQQA 4IHUA 1ZL9A 1XFLA 2P31A 1SJZA 3RPNA 1ERUA 5KN2A 2K8VA 2O8VB 5JCGA 3PR8A 4CDOA 3DWVA 3UARA 2CA8A 5KEJA 4D73A 1OYJA 2LEGA 1K3OA 1PN9A 2AUVA 3VFIA 1HD2A 1S3RA 1SK2A 4LL4B 4TR3A 2H1AA 4HZ4A 2IMEA 1A0RP 1TP9A 2L4QA 1PMTA 2LV3A 4K2DA 1PSQA 4V1Ag 3RPPA 1ZCPA 5F06A 5CRHA 1Z3EA 4MJAA 1M3JA 1A2MA 2FWHA 4KX4A 4POLA 1EV9A 2L5LA 4CHSA 3LWAA 4V1Ap 3GTUB 3I6AA 3QOUA 1GH2A 3Q19A 1X9MB 2G2QA 4YQUA 5A4VA 2C3NA 2LRTA 3IHGA 3GKNA 3EU4A 5D9XA 2QSIA 1B8XA 2IIYA 5DJLA 5ECHB 2PU9C 18GSA 4TRXA 3P90A 4WF5A 1O8WA 3HJMA 4MLYA 3FZ9A 4G0LA 3US3A 3JCML 2OJLA 4PTSA 4GSTA 2HI7A 3KCMA 1PGTA 1EWXA 5G5FA 4OFNA 3OR5A 1XBSA 4FYCA 2DJJA 5JWOB 2PERA 3E3EA 4OFMA 2MMOA 4JEDA 4F2IA 3O3TA 4WR5A 2H71A 2R37A 2JL4A 3GKXA 2VM2A 3MAKA 3LSZA 2JSZA 2OE0A 2X8HA 1SYRA 5J9CA 2F8FA 5EL8A
chains in the Genus database with same CATH topology
2YV9A 3D4TA 1BJXA 2L59A 5G31A 1XXUA 4NPBA 1EZKA 2C8UA 5D9TA 4GQFA 4JR4A 1N2AA 2V41A 1NHOA 5IOWA 1O7UA 4KSOA 4AJ8A 3PH9A 4J56E 1S3CA 2V6KA 4MNNA 4BL7B 4AJ6A 2NPBA 2GSRA 4K7OA 3DYRA 3QPMA 1X5DA 4G10A 1GUKA 4WBRD 4N0VA 2A2RA 1J9BA 2IN3A 1BYEA 2VD1A 3APQA 1C72A 5ECMB 1OKDA 4XS1A 2L6CA 2FNOA 4N11A 4MABA 2TRXA 3C8EA 1LBKA 2LUSA 2YPMA 2ON7A 1GTUA 2IFQB 4K6XA 5HFKA 8GSSA 4Q5FA 4G19A 3EMPA 2G0FA 2P5RA 1MTCA 2YWOA 3FZ4A 2I1UA 1FB0A 2PPTA 2N5AA 4HEA2 4XHMA 2R6KA 4I5QA 2YZHA 1Q4JA 1J0FA 1GLPA 2REMA 2DIYA 3ZITA 1ST9A 5G5EA 4HJMA 1HYUA 2B7KA 1T8EB 3S9FA 3QCPA 1E6BA 1SKRB 2CQ9A 1B48A 2C1YA 2NBSA 2GQKA 2DC5A 4Z2UA 2C0GA 1EOGA 4MPFA 4E8EA 1TXXA 2JZTA 1THXA 1TK0B 2AB6A 3CMIA 4HQZA 3UVTA 1T1VA 2CVBA 4QL7A 1SENA 3VPQA 2QC7A 4OD7A 1QGVA 2N5BA 3TJJA 4JE1A 5IO0A 4RQRA 2O7KA 5LCZA 4TXVA 19GSA 2GZZA 5ID2B 2ON5A 3ZFBA 4DSSA 2YN1A 1Z6NA 5D9VA 2H76A 4CY8A 2HT9A 2WFCA 1GSYA 4BWSA 1MEKA 1WIKA 5D9WA 4ZXGA 3UAPA 2EC4A 2WULA 2YZUA 3APSA 4KUNA 1SL0B 2E2MA 1QK8A 3IDVA 1I9DA 2IMIA 5FT3A 1PRXA 3TKSC 2E0QA 1TK8B 1YKAA 4AJ7A 1DE2A 2PVOC 5CO3A 3IV4A 4MZWA 2O87A 2AAWA 2PMTA 4DVCA 2HRNA 22GSA 4F0BA 2VLUA 3IK9A 4IKHA 2NDOA 4HI7A 5C04A 1FAAA 3V1WA 3EPTA 3GFKA 2VM1A 4HQSA 1EGOA 2VLVA 1OC9A 2JADA 2FCHA 2B3SA 1A2LA 2JSYA 4O7HA 3M1GA 4I2UA 3EWLA 1JFUA 1GSUA 1V98A 4K9ZA 4RQXA 2VCTA 4ZB8A 2DBCA 5AIXA 2GVPA 2L6DA 4WEYA 4IP1A 1GSDA 1MD4A 3TUEA 3ME7A 3KP9A 4MK3A 4IW9A 3MSZA 1K3YA 1ACVA 4L5LA 3A2VA 1V57A 1M9BA 4EE0A 3H8QA 2IMDA 1TRSA 14GSA 1X5EA 3VPTA 2H66A 3HHVA 3ED3A 5IM9A 3BJ5A 5EVOA 3HVXA 3EYTA 3G9BA 3ERWA 3VI7A 4LMWA 4NMUA 1T3BA 2FWFA 3DEXA 3ZIVA 3ZMLA 5DAKB 4V2LA 5CRWA 4F82A 1GL8A 3VWXA 2DKHA 3HVSA 4WXTA 3D4MA 5B8BA 3D6IA 1A8LA 5ECOB 2QGVA 5ENUA 4LLRA 2X8GA 1MDIA 3LGCA 2AJQB 4KNDA 3FRCA 1WPIA 5L71A 1YZXA 6GSUA 2A2PA 2WB9A 2D2ZA 1DUGA 4OCEA 5KN0A 2F9SA 4PUFC 4D73B 1XWAA 2EIOA 4F0CA 1VF4A 2XBIA 2WGRA 4BA7A 3H79A 3GN3A 3MYDA 1FOHA 4LA1A 3GA4A 1G6WA 2E7PA 1RW1A 5KN1A 2PN8A 2EIQA 2VOCA 1V58A 2H72A 2YNXA 2KHPA 2LQOA 4K7NA 3WD6A 3IR4A 4N0ZA 1PL2A 1PKZA 2FD3A 3M9JA 2P5QA 4ZL9A 3APOA 6GSYA 3C1RA 2PBJA 3KGKA 1PL1A 1FW1A 2C0EA 4MH3A 4MZBA 2OE3A 3DVWA 3I9V2 3CXGA 1Y25A 4MPGA 4ZBBA 3DIEA 3TKSA 2B1LA 2F8AA 5HR3A 16GSA 3BD2A 1JZOA 3GH6A 4MMMA 2DLXA 3DGQA 1XWGA 3FZ5A 4EKZA 1ZOFA 5ELGA 2HNLA 1J08A 4X4JA 1U88A 2GT5A 4JRRA 4ECBA 3C73A 2WRTA 4PUAA 1GSFA 4RUVA 2XPEA 4IP6A 1A23A 3L4NA 1T7PB 1PQNA 3CSJA 5B6MA 1X9SB 1SD8A 3BCKA 2FA8A 4MJEA 3GRXA 3TDGA 2DIZA 3DVXA 3P8WA 2GSQA 2I3YA 5DQSA 5FHIA 1JZWA 1PN0A 4YKFA 3EC3A 1ZGNA 3DXBA 1VF3A 4Q5RA 4XS6A 3GKMA 3QAGA 2N5FA 4K5RA 3GUSA 3KIJA 3KEBA 2C3QA 1GLQA 4TR1A 6GSVA 3F6DA 4KDUA 2B5EA 1XCCA 3FR3A 2CZ3A 4ZB6A 4L8EA 4GRFA 1SU9A 1TJDA 3MNGA 3VK9A 3DKSA 4DEJA 3O76A 3F0IA 5CRDA 3WGDA 5BRTA 3KMOA 2HFDA 2VL9A 1SD9A 4MDCA 1UVZA 1U3AA 1GRXA 1GNEA 4POBA 3HD5A 3QAWA 2H6XA 1ZYPA 1NHYA 1R7HA 4ECJA 3G7YA 4A5PA 1EOHA 5J4UA 1AAZA 2WJUA 4FYUA 2V2GA 2PWJA 4GTUA 3IHQA 2CVKA 5EY6A 1ILOA 5COHA 4GXZA 2IJYA 3L9UA 3VURA 1JZDA 3O6TA 2FA4A 1EP8A 3GX0A 1O8XA 4EC0A 1YEPA 5IMCA 2LNSA 4HUAA 4DSSB 1HNAA 3LEFA 1O81A 1GUMA 2H6YA 2IL3A 2KP1A 2V32A 20GSA 2MZCA 2BTOT 4RI7A 4N30A 2HSMA 3TRQA 5E4WA 2LRCA 3RDWA 2UZ8A 3EVIA 1H4OA 4KB3A 1AC1A 2DJ1A 4ZIJA 4AGSA 3U6VA 2VCQA 3QD9A 2DJKA 4JBBA 3HYPA 1K0NA 1ERVA 4EDZA 4DSRA 3TRXA 2EIRA 2B5XA 1XZOA 3EURA 1W4VA 3A2WA 3IK7A 2CAIA 4WR4A 1YF1A 4ID0A 1EP7A 1S3DA 2L57A 4ECIA 5D8IA 1M2DA 4Q5NA 2X99A 2DKIA 5LNKe 3WT1A 3HVVA 3GL3A 3QDNA 1GTAA 3UVHA 3IC4A 2R3XA 2H1BA 1OC9B 2HRAA 2L5OA 1YF0A 1Z9HA 4IN0A 1B4PA 2H19A 5KN3A 2IMKA 1B9XC 4XCSA 2MBTA 4L0UA 1SKWB 4YQVA 5IPHA 1Z6MA 2FWEA 3GIXA 2H1DA 1EGRA 4HOJA 4N10A 2QKEA 1ABAA 5CYYA 1LU4A 4PURA 2GZPA 5CREA 1O73A 3GSTA 3ERFA 1OE8A 4HJ2A 2OKAA 3M8NA 1NSWA 1EEJA 3UL3A 3L78A 1PKWA 3C1SA 5BMUA 2OBKA 5B6NA 3QFAC 4CW9A 1FB6A 2TRCP 3FZAA 1QQ2A 2LKUA 3KJYA 4OCFA 3A3TA 1T4YA 2K9FA 4TXOA 2A2SA 3FYGA 4YH2A 2ZUPA 3ZTLA 2F3MA 4OWYA 4EXJA 1PX7A 3PINA 3H93A 3GNJA 2RLIA 1SJ6A 2FGXA 4KDXA 1F37A 5CAXA 3UMAA 3A2XA 1GSQA 3IXRA 2PGTA 2ES7A 3TKQA 1Z7PA 1G7OA 2I4AA 4IVFA 5GAPD 3SWLA 4IELA 1BAYA 4ZILA 4LL1B 5GSTA 3GX8A 1XW9A 2A4VA 4O5RA 1TOFA 4MF6A 4EUYA 1XWBA 4FO5A 1ZMAA 1GP1A 3CTFA 3LFLA 2GSSA 5GAND 4XIHA 1KEBA 4BPYA 3ME8A 3DD3A 1F2EA 2O89A 1WMJA 5H5SA 3GURA 1I5GA 3KH7A 3J7Yk 1OE7A 3D5JA 1XW6A 1ERTA 1AW9A 3WGEA 1W89A 4OMVA 4ZBDA 3EINA 2I9HA 3N9JA 2Z9SA 3E9JB 2KLXA 1AQVA 3BBYA 3CSHA 3G7JA 1TW9A 3UOMA 2VAFA 3VWVA 3LYPA 1G6YA 2VCXA 3C7MA 4PNGA 2B6MA 4PXOA 2B5YA 1V9WA 2QA1A 4KF9A 1NM3A 1A0FA 3HJPA 4KGIA 2YP6A 3CBUA 1CQHA 1ZYNA 1O6JA 2YWMA 3LORA 4J2FA 1FVKA 2YJ7A 1S3AA 4TR4A 5J41A 2AV4A 3PGTA 3ZVJA 3RHCA 2GTUA 5DALA 1AIUA 5AN1A 11GSA 4ISDA 3TJFA 3IA1A 5GZZB 3NOFA 5KOWA 1LJRA 4V2NA 1Z7RA 1B9YC 5IMFA 1TRWA 2RM6A 5AIVA 3IAM2 3ERGA 1MDJA 1T00A 2R2JA 1XWCA 5J9BA 5J5NA 5DBQA 3DMLA 4KSMA 4FQUA 4JR6A 5B7CA 1HQOA 4MP4A 2DJ3A 5IIZA 1GWCA 3M3MA 1TI1A 2H1GA 5D73A 3BCIA 3EU3A 4IGJA 10GSA 2K18A 2YV7A 1Q98A 2VL3A 3LXZA 5B8AA 1EEMA 3M0FA 1BQ7A 1TRVA 1UC7A 2C0FA 2FHEA 3ZYWA 2LSTA 1SL1B 3GKKA 3ZMKA 4PGTA 1WWJA 2RUFA 4L5OA 3TOUA 4TR1B 12GSA 3IE3A 3M9KA 2YOIA 3GL5A 3ZZXA 1XVQA 3LJRA 1PD21 4P3YB 1XIYA 5JWQB 1GSEA 5JCUA 3SBCA 4H86A 2L4CA 2VUPA 3A5IA 2RUEA 4MF5A 1UA5A 3F3RA 5IMAA 1TDIA 3R3EA 4IQAA 1FVJA 4ML6A 2GQLA 2F51A 5CRGA 3CSIA 1WP0A 3HKRA 5IOXA 4GSNA 7GSSA 2FLSA 1SYXA 1H75A 1WE0A 2GZYA 4BVYA 5ECIB 5G1KA 4PQHA 3TKRA 4XS4A 1RK4A 5D96A 1AXDA 3FHKA 3ISOA 3HZ4A 5C00A 3VWUA 3LW9A 4ZBAA 5LD0A 2LNTA 3MDKA 1E2YA 3Q74A 2FUG2 2KUCA 1JLVA 2H73A 3RHBA 4GCIA 2CT6A 5HFIA 1VF2A 1X0RA 4WETA 17GSA 4BWQA 2J9HA 4ILFA 5HR2A 4EDYA 2VCZA 5JWRB 1F3BA 4KW6A 1SL2B 3VLNA 4K0NA 1MDKA 4QQ7A 1BEDA 5KOXA 2B1KA 4F03A 1G0TA 2VIMA 5JCWA 5A4WA 3IBHA 2HZEA 2VL2C 3KZQA 3F6FA 1R5PA 1TRUA 3EMXA 2LJKA 3I69A 5D93A 3KTLA 2MMZA 2AYTA 1WRYA 1YKCA 3U5RE 4CY6A 2HLSA 1SK0A 1XPVA 5IMZA 2LS5A 2HE3A 4Q5QA 3K8NA 1UN2A 2HRKA 1OC8A 2MMNA 1G7EA 4POMA 4HZ2A 3HY2A 4EO3A 1K0DA 2VCWA 1A24A 5IPGA 4WKWA 4BVXA 4Z2RA 4G0KA 2DMLA 2OADA 5F07A 2RM5A 2C4JA 1CQGA 2M72A 1X5CA 3KH9A 4MJBA 1R5AA 2R4VA 2NVLA 1F3AA 1XOAA 3AY8A 4NV5A 2XC2A 1RQMA 4FIWA 4KDYA 3KTBA 2V6OA 3MIXA 2GS3A 3GSSA 4ULXA 2H0HA 5G2ZA 3A5WA 4PQIA 4FYBA 1U3IA 3TB2A 2VLTA 3EE2A 4G9HA 4ZL7A 2IPAA 2QA2A 4TXOB 2X49A 1V40A 1Z5YE 4IBPA 2K6VA 4IQ1A 4KCEA 4KCAA 4HDEA 2GQMA 2C80A 3HXSA 1TKDB 3NZNA 3RAZA 1U6TA 3TOTA 3VI5A 1TTZA 2C3TA 2H70A 4I97A 3KMNA 3LG6A 2CV4A 2HRFA 1VF1A 1QMVA 4OO4A 2ZNMA 2HSHA 5DJMA 2HYXA 1MD3A 3L0HA 1XVWA 6GSWA 5A4UA 2H0GA 3F3QA 2OACA 2R0PA 1KBNA 1M9AA 4V2MA 2LJAA 2O85A 4X43A 2K8SA 2JACA 1PA3A 4HU9A 3UBLA 1GSSA 1FG4A 4I6XA 2KP2A 3GHAA 1F6MC 2VD0A 4IJ3A 4XRDA 1QUWA 1GTIA 1BG5A 3FW2A 4MH2A 2GGTA 4NHWA 5J3RA 3QFBC 2OBIA 5HR1A 1K3LA 1TU7A 3WYWA 1OKTA 1PX6A 3GYKA 6GSTA 1VRSD 1VGLA 1K0AA 2VL2A 1EV4A 3KXOA 4MF7A 4TW5A 1A2JA 4ZL8A 4PQ1A 4TN8A 3MWHA 1YQ1A 4TR0A 2FWGA 3W8JA 1JHBA 1USBA 3IRAA 4YAPA 3D22A 2J23A 1WJKA 1V2AA 3F63A 4IS0A 3TJKA 1X9WB 4GF0A 5DALB 1DSBA 4FH8A 4K7IA 3QAVA 2VCVA 5CP1A 3W6GA 3GTUA 2YWIA 3R2QA 4YQMA 2JZSA 1OC3A 2CX4A 1SK1A 5HQPA 4K2XA 3QMXA 3H4KA 4PX1A 3IPZA 4QL9A 4EIQA 2X64A 4O5QA 2GT6A 4KE3A 5ELAA 3FMWA 3LYKA 1DE1A 6GSSA 4GQCA 2TIRA 2DJ0A 5G30A 2A4HA 2H01A 4WBJA 2GLRA 1THOA 2XHFA 1IYHA 3PPUA 1ZZYA 1R26A 2IMFA 3VWWA 1M2BA 1GULA 4NAXA 1Y6EA 2MBSA 3WGXA 4NWYA 1JZRA 1FOVA 5INYA 3ZLPA 4ECCA 2CZ2A 2IWTA 3KP8A 3LQ7A 2VO4A 2CVDA 1TK5B 4HU7A 3FEUA 3TCOA 1XW5A 5DVBA 1ZYQB 4YAVA 4OFTA 5ECPB 2CX3A 2R0GA 4X0XA 1XWKA 5DCHA 4USSA 2H8LA 2WS2A 4TKYA 4BL7A 2ALBA 4G2EA 3FK8A 5E59A 1QXHA 4GWRA 5FWGA 2LTKA 4O92A 1BX9A 4X1UA 9GSSA 4J57E 1DBYA 1T4ZA 5ABRA 1N8JA 3TJGA 3ZRDA 4POKA 2ZCTA 2HXKA 5IQYA 3ZL5A 1IYIA 3F9UA 4BVYB 2PUKC 1AQXA 4TVEA 3ZVJD 3F4TA 4XS4B 1O85A 4K0GA 3TKSE 5EPFA 3KM6A 2IFQA 3FR9A 3DRNA 2YCDA 4XRAA 4WF4A 4GSSA 3L9SA 1K0BA 2H6ZA 3HDCA 2B7JA 5HR0A 5DQYA 2XBQA 3P2AA 1URMA 1KNGA 3Q6OA 4O5UA 4K8MA 1ML6A 2H0IA 1M2AA 5HFGA 1YY7A 3GV1A 3FKFA 2RIIA 5DDLA 3UEMA 1OAZA 2BMXA 4ZB9A 4PNFA 5DCGA 5ECQB 2R0CA 2YANA 2HZEB 5F8BA 3UIWA 2LRNA 2WDUA 1YDKA 2HZFA 3LXTA 4Z7XA 4I2TA 2GDRA 5ECSA 4EL1A 5IMDA 2PVQA 3KD0A 3HCZA 2GSTA 3HZ8A 1YJ6A 2DJ2A 5IMVA 4MCUA 1A8YA 3RBTA 3F4RA 4RI6A 1AQWA 5ID2A 1XOBA 5ECLB 2V1MA 5IO2A 2JZRA 2NTOA 5CNWA 4O32A 5ECNB 3GH9A 3TRPA 1GTBA 4NHZA 4ACSA 4EF0A 3TGZA 4KAEA 3Q18A 2M80A 4BVXB 5H5RA 1KTEA 1R4WA 4DSQA 2M46A 4NV2A 4KA0A 3TJBA 2LJRA 1M0UA 2R5GA 13GSA 3ZIJA 5F0GA 1B4QA 2X8CA 4ML1A 3W8SA 1JLWA 1GUHA 3CTGA 3J7Yb 1NW2A 2H75A 3CRUA 1HNBA 2AHEA 1FO5A 1M7TA 2I81A 1TU8A 4EVMA 4MZCA 5F05A 3GMFA 2P0GA 2KOKA 3FR6A 1ERWA 3CYNA 1TI3A 3NIVA 3UBKA 3F8UA 1M99A 3HJOA 3FY7A 4I8BA 3N5OA 3IC8A 2OE1A 4GLTA 3CRTA 3F4SA 3ZFLA 3H1NA 1WOUA 1HNCA 5AISA 4HS1A 6GSXA 4JZQA 5AGYA 3UJ1A 4F9ZA 3IOSA 2BJXA 4MJCA 1AUCA 4JU5A 5GSSA 2FY6A 2C0DA 4ICYA 4TOPA 3I43A 3D21A 3D0ZA 4Z2TA 1U87A 1F9MA 4K5SA 4E8HA 2MYGA 1K0OA 2OA7A 3QR6A 1SJIA 4MA9A 1FHEA 4NXIA 3TKPA 1GNWA 4LMVA 1ON4A 2H74A 1YEXA 3P7XA 5G1LA 5H5QA 4YKGA 5ECKB 4KH7A 1K0MA 4OO5A 1SKSB 3IAS2 2WCIA 4EIPA 2CAQA 3C71A 1ZYEA 1QFNA 2JU5A 3WT2A 3L9VA 2WZ9A 2YJHA 1OVNA 2DSAA 3G7IA 3ZREA 1K0CA 2E2GA 5DAKA 2XPDA 3BOAA 5ECRB 2MMAA 2H30A 2X4AA 4IJIA 2DMMA 4AF2A 5A5KA 3HA9A 2HSYA 4K1FA 2YWNA 4G0IA 4XTSA 4L0WA 3E0UA 2LQQA 4IHUA 1ZL9A 1XFLA 2P31A 1SJZA 3RPNA 1ERUA 5KN2A 2K8VA 2O8VB 5JCGA 3PR8A 4CDOA 3DWVA 3UARA 2CA8A 5KEJA 4D73A 1OYJA 2LEGA 1K3OA 1PN9A 2AUVA 3VFIA 1HD2A 1SK2A 4TR3A 4LL4B 2H1AA 4HZ4A 2IMEA 1A0RP 1TP9A 2L4QA 1PMTA 2LV3A 4K2DA 1PSQA 4V1Ag 3RPPA 1ZCPA 5F06A 5CRHA 1Z3EA 4MJAA 1A2MA 2FWHA 4KX4A 4POLA 1EV9A 2L5LA 4CHSA 3LWAA 4V1Ap 3GTUB 3I6AA 3QOUA 1GH2A 3Q19A 1X9MB 2G2QA 4YQUA 5A4VA 2C3NA 2LRTA 3IHGA 3GKNA 3EU4A 5D9XA 2QSIA 1B8XA 2IIYA 5DJLA 5ECHB 2PU9C 18GSA 4TRXA 3P90A 4WF5A 1O8WA 3HJMA 4MLYA 3FZ9A 4G0LA 3US3A 3JCML 2OJLA 4PTSA 4GSTA 2HI7A 3KCMA 1PGTA 1EWXA 5G5FA 4OFNA 3OR5A 1XBSA 4FYCA 2DJJA 5JWOB 2PERA 3E3EA 4OFMA 2MMOA 4JEDA 4F2IA 3O3TA 4WR5A 2H71A 2R37A 2JL4A 3GKXA 2VM2A 3MAKA 3LSZA 2JSZA 2OE0A 2X8HA 1SYRA 5J9CA 2F8FA 5EL8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YV9 A;  3D4T A;  1BJX A;  2L59 A;  5G31 A;  1XXU A;  4NPB A;  1EZK A;  2C8U A;  5D9T A;  4GQF A;  4JR4 A;  1N2A A;  2V41 A;  1NHO A;  5IOW A;  1O7U A;  4KSO A;  4AJ8 A;  3PH9 A;  4J56 E;  1S3C A;  2V6K A;  4AJ6 A;  2NPB A;  2GSR A;  4K7O A;  3DYR A;  3QPM A;  1X5D A;  4G10 A;  1GUK A;  4WBR D;  4N0V A;  2A2R A;  1J9B A;  2IN3 A;  1BYE A;  2VD1 A;  3APQ A;  1C72 A;  5ECM B;  1OKD A;  4XS1 A;  2L6C A;  2FNO A;  4N11 A;  4MAB A;  2TRX A;  3C8E A;  1LBK A;  2LUS A;  2YPM A;  2ON7 A;  1GTU A;  2IFQ B;  4K6X A;  5HFK A;  8GSS A;  4Q5F A;  4G19 A;  3EMP A;  2G0F A;  2P5R A;  1MTC A;  2YWO A;  3FZ4 A;  2I1U A;  1FB0 A;  2PPT A;  2N5A A;  4HEA 2;  4XHM A;  2R6K A;  4I5Q A;  2YZH A;  1Q4J A;  1J0F A;  1GLP A;  2REM A;  2DIY A;  3ZIT A;  1ST9 A;  5G5E A;  4HJM A;  1HYU A;  2B7K A;  1T8E B;  3S9F A;  3QCP A;  1E6B A;  1SKR B;  2CQ9 A;  1B48 A;  2C1Y A;  2NBS A;  2GQK A;  2DC5 A;  2C0G A;  1EOG A;  4MPF A;  4E8E A;  1TXX A;  2JZT A;  1THX A;  1TK0 B;  2AB6 A;  3CMI A;  4HQZ A;  3UVT A;  1T1V A;  2CVB A;  4QL7 A;  1SEN A;  3VPQ A;  2QC7 A;  4OD7 A;  1QGV A;  2N5B A;  3TJJ A;  4JE1 A;  5IO0 A;  4RQR A;  2O7K A;  5LCZ A;  4TXV A;  19GS A;  2GZZ A;  5ID2 B;  2ON5 A;  3ZFB A;  4DSS A;  2YN1 A;  1Z6N A;  5D9V A;  2H76 A;  2HT9 A;  2WFC A;  1GSY A;  4BWS A;  1MEK A;  1WIK A;  5D9W A;  4ZXG A;  3UAP A;  2EC4 A;  2WUL A;  2YZU A;  3APS A;  4KUN A;  1SL0 B;  2E2M A;  1QK8 A;  3IDV A;  1I9D A;  2IMI A;  5FT3 A;  1PRX A;  3TKS C;  2E0Q A;  1TK8 B;  1YKA A;  4AJ7 A;  1DE2 A;  2PVO C;  5CO3 A;  3IV4 A;  4MZW A;  2O87 A;  2AAW A;  2PMT A;  4DVC A;  2HRN A;  22GS A;  4F0B A;  2VLU A;  3IK9 A;  4IKH A;  2NDO A;  4HI7 A;  5C04 A;  1FAA A;  3V1W A;  3GFK A;  2VM1 A;  4HQS A;  1EGO A;  2VLV A;  1OC9 A;  2JAD A;  2FCH A;  2B3S A;  1A2L A;  2JSY A;  4O7H A;  3M1G A;  4I2U A;  3EWL A;  1JFU A;  1GSU A;  1V98 A;  4K9Z A;  4RQX A;  2VCT A;  4ZB8 A;  2DBC A;  5AIX A;  2GVP A;  2L6D A;  4WEY A;  4IP1 A;  1GSD A;  1MD4 A;  3TUE A;  3ME7 A;  3KP9 A;  4MK3 A;  4IW9 A;  3MSZ A;  1K3Y A;  1ACV A;  4L5L A;  3A2V A;  1V57 A;  1M9B A;  4EE0 A;  3H8Q A;  2IMD A;  1TRS A;  14GS A;  1X5E A;  3VPT A;  2H66 A;  3HHV A;  3ED3 A;  5IM9 A;  3BJ5 A;  5EVO A;  3HVX A;  3EYT A;  3G9B A;  3ERW A;  3VI7 A;  4LMW A;  4NMU A;  1T3B A;  2FWF A;  3DEX A;  3ZIV A;  3ZML A;  5DAK B;  4V2L A;  5CRW A;  4F82 A;  1GL8 A;  3VWX A;  3HVS A;  4WXT A;  3D4M A;  5B8B A;  3D6I A;  1A8L A;  5ECO B;  2QGV A;  5ENU A;  4LLR A;  2X8G A;  1MDI A;  3LGC A;  2AJQ B;  4KND A;  3FRC A;  1WPI A;  5L71 A;  1YZX A;  6GSU A;  2WB9 A;  2D2Z A;  1DUG A;  4OCE A;  5KN0 A;  2F9S A;  4PUF C;  4D73 B;  1XWA A;  2EIO A;  4F0C A;  1VF4 A;  2XBI A;  2WGR A;  4BA7 A;  3H79 A;  3GN3 A;  4LA1 A;  3GA4 A;  1G6W A;  2E7P A;  1RW1 A;  5KN1 A;  2PN8 A;  2EIQ A;  2VOC A;  1V58 A;  2H72 A;  2YNX A;  2KHP A;  2LQO A;  4K7N A;  3WD6 A;  3IR4 A;  4N0Z A;  1PL2 A;  1PKZ A;  2FD3 A;  3M9J A;  2P5Q A;  4ZL9 A;  3APO A;  6GSY A;  3C1R A;  2PBJ A;  3KGK A;  1PL1 A;  1FW1 A;  2C0E A;  4MH3 A;  4MZB A;  2OE3 A;  3DVW A;  3I9V 2;  3CXG A;  1Y25 A;  4MPG A;  4ZBB A;  3DIE A;  3TKS A;  2B1L A;  2F8A A;  5HR3 A;  16GS A;  3BD2 A;  1JZO A;  3GH6 A;  4MMM A;  2DLX A;  3DGQ A;  1XWG A;  3FZ5 A;  4EKZ A;  1ZOF A;  5ELG A;  2HNL A;  1J08 A;  1U88 A;  2GT5 A;  4JRR A;  4ECB A;  3C73 A;  2WRT A;  4PUA A;  1GSF A;  4RUV A;  2XPE A;  4IP6 A;  1A23 A;  3L4N A;  1T7P B;  1PQN A;  3CSJ A;  5B6M A;  1X9S B;  1SD8 A;  3BCK A;  2FA8 A;  4MJE A;  3GRX A;  3TDG A;  2DIZ A;  3DVX A;  3P8W A;  2GSQ A;  2I3Y A;  5DQS A;  5FHI A;  1JZW A;  3EC3 A;  1ZGN A;  3DXB A;  1VF3 A;  4Q5R A;  4XS6 A;  3GKM A;  3QAG A;  2N5F A;  3GUS A;  3KIJ A;  3KEB A;  2C3Q A;  1GLQ A;  4TR1 A;  6GSV A;  3F6D A;  4KDU A;  2B5E A;  1XCC A;  3FR3 A;  2CZ3 A;  4ZB6 A;  4L8E A;  4GRF A;  1SU9 A;  1TJD A;  3MNG A;  3VK9 A;  3DKS A;  4DEJ A;  3O76 A;  3F0I A;  5CRD A;  3WGD A;  3KMO A;  2HFD A;  2VL9 A;  1SD9 A;  4MDC A;  1UVZ A;  1U3A A;  1GRX A;  1GNE A;  4POB A;  3HD5 A;  3QAW A;  2H6X A;  1NHY A;  1R7H A;  4ECJ A;  3G7Y A;  1EOH A;  5J4U A;  1AAZ A;  2WJU A;  4FYU A;  2V2G A;  2PWJ A;  4GTU A;  3IHQ A;  2CVK A;  5EY6 A;  1ILO A;  5COH A;  4GXZ A;  2IJY A;  3L9U A;  3VUR A;  1JZD A;  3O6T A;  2FA4 A;  1EP8 A;  3GX0 A;  1O8X A;  4EC0 A;  1YEP A;  5IMC A;  2LNS A;  4HUA A;  4DSS B;  1HNA A;  3LEF A;  1O81 A;  1GUM A;  2H6Y A;  2IL3 A;  2KP1 A;  2V32 A;  20GS A;  2MZC A;  2BTO T;  4RI7 A;  4N30 A;  3TRQ A;  5E4W A;  2LRC A;  3RDW A;  3EVI A;  1H4O A;  4KB3 A;  1AC1 A;  2DJ1 A;  4ZIJ A;  4AGS A;  3U6V A;  2VCQ A;  3QD9 A;  2DJK A;  4JBB A;  3HYP A;  1K0N A;  1ERV A;  4EDZ A;  4DSR A;  3TRX A;  2EIR A;  2B5X A;  1XZO A;  3EUR A;  1W4V A;  3A2W A;  3IK7 A;  2CAI A;  4WR4 A;  1YF1 A;  4ID0 A;  1EP7 A;  1S3D A;  2L57 A;  4ECI A;  5D8I A;  1M2D A;  4Q5N A;  2X99 A;  5LNK e;  3WT1 A;  3HVV A;  3GL3 A;  3QDN A;  1GTA A;  3UVH A;  3IC4 A;  2R3X A;  2H1B A;  1OC9 B;  2L5O A;  1YF0 A;  1Z9H A;  4IN0 A;  1B4P A;  2H19 A;  5KN3 A;  2IMK A;  1B9X C;  4XCS A;  2MBT A;  4L0U A;  1SKW B;  4YQV A;  5IPH A;  1Z6M A;  2FWE A;  3GIX A;  2H1D A;  1EGR A;  4HOJ A;  4N10 A;  2QKE A;  1ABA A;  5CYY A;  1LU4 A;  4PUR A;  2GZP A;  5CRE A;  1O73 A;  3GST A;  3ERF A;  1OE8 A;  4HJ2 A;  2OKA A;  3M8N A;  1NSW A;  1EEJ A;  3UL3 A;  3L78 A;  1PKW A;  3C1S A;  2OBK A;  5B6N A;  3QFA C;  4CW9 A;  1FB6 A;  2TRC P;  3FZA A;  1QQ2 A;  2LKU A;  3KJY A;  4OCF A;  3A3T A;  1T4Y A;  2K9F A;  4TXO A;  2A2S A;  3FYG A;  4YH2 A;  2ZUP A;  3ZTL A;  2F3M A;  4OWY A;  4EXJ A;  1PX7 A;  3PIN A;  3H93 A;  3GNJ A;  2RLI A;  1SJ6 A;  2FGX A;  4KDX A;  1F37 A;  5CAX A;  3UMA A;  3A2X A;  1GSQ A;  3IXR A;  2PGT A;  2ES7 A;  3TKQ A;  1Z7P A;  1G7O A;  2I4A A;  4IVF A;  5GAP D;  3SWL A;  4IEL A;  1BAY A;  4ZIL A;  4LL1 B;  5GST A;  3GX8 A;  1XW9 A;  2A4V A;  4O5R A;  1TOF A;  4MF6 A;  4EUY A;  1XWB A;  4FO5 A;  1ZMA A;  1GP1 A;  3CTF A;  3LFL A;  2GSS A;  5GAN D;  4XIH A;  1KEB A;  4BPY A;  3ME8 A;  3DD3 A;  1F2E A;  2O89 A;  1WMJ A;  5H5S A;  3GUR A;  1I5G A;  3KH7 A;  3J7Y k;  1OE7 A;  3D5J A;  1XW6 A;  1ERT A;  1AW9 A;  3WGE A;  1W89 A;  4OMV A;  4ZBD A;  3EIN A;  2I9H A;  3N9J A;  2Z9S A;  3E9J B;  2KLX A;  1AQV A;  3BBY A;  3CSH A;  3G7J A;  1TW9 A;  3UOM A;  2VAF A;  3VWV A;  3LYP A;  1G6Y A;  2VCX A;  3C7M A;  4PNG A;  2B6M A;  4PXO A;  2B5Y A;  1V9W A;  1NM3 A;  1A0F A;  3HJP A;  4KGI A;  2YP6 A;  3CBU A;  1CQH A;  1O6J A;  2YWM A;  3LOR A;  4J2F A;  1FVK A;  2YJ7 A;  1S3A A;  4TR4 A;  5J41 A;  2AV4 A;  3PGT A;  3ZVJ A;  3RHC A;  2GTU A;  5DAL A;  1AIU A;  5AN1 A;  11GS A;  4ISD A;  3TJF A;  3IA1 A;  5GZZ B;  3NOF A;  1LJR A;  4V2N A;  1Z7R A;  1B9Y C;  5IMF A;  1TRW A;  2RM6 A;  5AIV A;  3IAM 2;  3ERG A;  1MDJ A;  1T00 A;  2R2J A;  1XWC A;  5J9B A;  5J5N A;  5DBQ A;  3DML A;  4KSM A;  4JR6 A;  5B7C A;  1HQO A;  4MP4 A;  2DJ3 A;  5IIZ A;  1GWC A;  3M3M A;  1TI1 A;  2H1G A;  5D73 A;  3BCI A;  3EU3 A;  4IGJ A;  10GS A;  2K18 A;  2YV7 A;  1Q98 A;  2VL3 A;  3LXZ A;  5B8A A;  1EEM A;  3M0F A;  1BQ7 A;  1TRV A;  1UC7 A;  2C0F A;  2FHE A;  3ZYW A;  2LST A;  1SL1 B;  3GKK A;  3ZMK A;  4PGT A;  1WWJ A;  2RUF A;  4L5O A;  3TOU A;  4TR1 B;  12GS A;  3IE3 A;  3M9K A;  2YOI A;  3GL5 A;  3ZZX A;  1XVQ A;  3LJR A;  1PD2 1;  4P3Y B;  1XIY A;  5JWQ B;  1GSE A;  5JCU A;  3SBC A;  4H86 A;  2L4C A;  2VUP A;  2RUE A;  4MF5 A;  1UA5 A;  3F3R A;  5IMA A;  1TDI A;  4IQA A;  1FVJ A;  4ML6 A;  2GQL A;  2F51 A;  5CRG A;  3CSI A;  1WP0 A;  3HKR A;  5IOX A;  4GSN A;  7GSS A;  2FLS A;  1SYX A;  1H75 A;  1WE0 A;  2GZY A;  4BVY A;  5ECI B;  5G1K A;  4PQH A;  3TKR A;  4XS4 A;  1RK4 A;  5D96 A;  1AXD A;  3FHK A;  3ISO A;  3HZ4 A;  5C00 A;  3VWU A;  4ZBA A;  5LD0 A;  2LNT A;  3MDK A;  1E2Y A;  3Q74 A;  2FUG 2;  2KUC A;  1JLV A;  2H73 A;  3RHB A;  4GCI A;  2CT6 A;  5HFI A;  1VF2 A;  1X0R A;  4WET A;  17GS A;  4BWQ A;  2J9H A;  4ILF A;  5HR2 A;  4EDY A;  2VCZ A;  5JWR B;  1F3B A;  4KW6 A;  1SL2 B;  3VLN A;  4K0N A;  1MDK A;  4QQ7 A;  1BED A;  2B1K A;  4F03 A;  1G0T A;  2VIM A;  5JCW A;  5A4W A;  3IBH A;  2HZE A;  2VL2 C;  3KZQ A;  3F6F A;  1R5P A;  1TRU A;  3EMX A;  2LJK A;  3I69 A;  5D93 A;  3KTL A;  2MMZ A;  2AYT A;  1WRY A;  1YKC A;  3U5R E;  2HLS A;  1SK0 A;  1XPV A;  5IMZ A;  2LS5 A;  2HE3 A;  4Q5Q A;  3K8N A;  1UN2 A;  1OC8 A;  2MMN A;  1G7E A;  4POM A;  4HZ2 A;  3HY2 A;  4EO3 A;  1K0D A;  2VCW A;  1A24 A;  5IPG A;  4WKW A;  4BVX A;  2DML A;  2OAD A;  5F07 A;  2RM5 A;  2C4J A;  1CQG A;  2M72 A;  1X5C A;  3KH9 A;  4MJB A;  1R5A A;  2R4V A;  2NVL A;  1F3A A;  1XOA A;  3AY8 A;  4NV5 A;  2XC2 A;  1RQM A;  4FIW A;  4KDY A;  3KTB A;  2V6O A;  2GS3 A;  3GSS A;  4ULX A;  2H0H A;  5G2Z A;  3A5W A;  4PQI A;  4FYB A;  1U3I A;  3TB2 A;  2VLT A;  3EE2 A;  4G9H A;  4ZL7 A;  2IPA A;  4TXO B;  1V40 A;  1Z5Y E;  4IBP A;  2K6V A;  4IQ1 A;  4KCE A;  4KCA A;  4HDE A;  2GQM A;  2C80 A;  3HXS A;  1TKD B;  3NZN A;  3RAZ A;  1U6T A;  3TOT A;  3VI5 A;  1TTZ A;  2C3T A;  2H70 A;  4I97 A;  3KMN A;  3LG6 A;  2CV4 A;  2HRF A;  1VF1 A;  1QMV A;  4OO4 A;  2ZNM A;  2HSH A;  5DJM A;  2HYX A;  1MD3 A;  3L0H A;  1XVW A;  6GSW A;  5A4U A;  2H0G A;  3F3Q A;  2OAC A;  1KBN A;  1M9A A;  4V2M A;  2LJA A;  2O85 A;  4X43 A;  2K8S A;  2JAC A;  1PA3 A;  4HU9 A;  3UBL A;  1GSS A;  1FG4 A;  4I6X A;  2KP2 A;  3GHA A;  1F6M C;  2VD0 A;  4IJ3 A;  4XRD A;  1QUW A;  1GTI A;  1BG5 A;  3FW2 A;  4MH2 A;  2GGT A;  4NHW A;  5J3R A;  3QFB C;  2OBI A;  5HR1 A;  1K3L A;  1TU7 A;  3WYW A;  1OKT A;  1PX6 A;  3GYK A;  6GST A;  1VRS D;  1VGL A;  1K0A A;  2VL2 A;  1EV4 A;  3KXO A;  4MF7 A;  4TW5 A;  1A2J A;  4ZL8 A;  4PQ1 A;  4TN8 A;  3MWH A;  1YQ1 A;  4TR0 A;  2FWG A;  3W8J A;  1JHB A;  1USB A;  3IRA A;  4YAP A;  3D22 A;  2J23 A;  1WJK A;  1V2A A;  3F63 A;  4IS0 A;  3TJK A;  1X9W B;  4GF0 A;  5DAL B;  1DSB A;  4FH8 A;  4K7I A;  3QAV A;  2VCV A;  5CP1 A;  3W6G A;  3GTU A;  2YWI A;  3R2Q A;  4YQM A;  2JZS A;  1OC3 A;  2CX4 A;  1SK1 A;  5HQP A;  3QMX A;  3H4K A;  4PX1 A;  3IPZ A;  4QL9 A;  2X64 A;  2GT6 A;  4KE3 A;  5ELA A;  3LYK A;  1DE1 A;  6GSS A;  4GQC A;  2TIR A;  2DJ0 A;  5G30 A;  2H01 A;  4WBJ A;  2GLR A;  1THO A;  2XHF A;  1IYH A;  1ZZY A;  1R26 A;  2IMF A;  3VWW A;  1M2B A;  1GUL A;  4NAX A;  1Y6E A;  2MBS A;  3WGX A;  4NWY A;  1JZR A;  1FOV A;  5INY A;  3ZLP A;  4ECC A;  2CZ2 A;  2IWT A;  3KP8 A;  3LQ7 A;  2VO4 A;  2CVD A;  1TK5 B;  4HU7 A;  3FEU A;  3TCO A;  1XW5 A;  5DVB A;  1ZYQ B;  4YAV A;  4OFT A;  5ECP B;  2CX3 A;  4X0X A;  1XWK A;  5DCH A;  2H8L A;  2WS2 A;  4TKY A;  4BL7 A;  2ALB A;  4G2E A;  3FK8 A;  5E59 A;  1QXH A;  4GWR A;  5FWG A;  2LTK A;  4O92 A;  1BX9 A;  4X1U A;  9GSS A;  4J57 E;  1DBY A;  1T4Z A;  5ABR A;  1N8J A;  3TJG A;  3ZRD A;  4POK A;  2ZCT A;  2HXK A;  5IQY A;  3ZL5 A;  1IYI A;  3F9U A;  2PUK C;  1AQX A;  4TVE A;  3ZVJ D;  3F4T A;  4XS4 B;  1O85 A;  4K0G A;  3TKS E;  5EPF A;  3KM6 A;  2IFQ A;  3FR9 A;  3DRN A;  2YCD A;  4XRA A;  4WF4 A;  4GSS A;  3L9S A;  1K0B A;  2H6Z A;  3HDC A;  2B7J A;  5HR0 A;  5DQY A;  2XBQ A;  3P2A A;  1URM A;  1KNG A;  3Q6O A;  4K8M A;  1ML6 A;  2H0I A;  1M2A A;  5HFG A;  1YY7 A;  3GV1 A;  3FKF A;  2RII A;  5DDL A;  3UEM A;  1OAZ A;  2BMX A;  4ZB9 A;  4PNF A;  5DCG A;  5ECQ B;  2YAN A;  2HZE B;  5F8B A;  3UIW A;  2LRN A;  2WDU A;  1YDK A;  2HZF A;  3LXT A;  4Z7X A;  4I2T A;  2GDR A;  5ECS A;  4EL1 A;  5IMD A;  2PVQ A;  3KD0 A;  3HCZ A;  2GST A;  3HZ8 A;  1YJ6 A;  2DJ2 A;  5IMV A;  4MCU A;  1A8Y A;  3RBT A;  3F4R A;  4RI6 A;  1AQW A;  5ID2 A;  1XOB A;  5ECL B;  2V1M A;  5IO2 A;  2JZR A;  2NTO A;  5CNW A;  4O32 A;  5ECN B;  3GH9 A;  3TRP A;  1GTB A;  4NHZ A;  4ACS A;  4EF0 A;  3TGZ A;  4KAE A;  3Q18 A;  2M80 A;  5H5R A;  1KTE A;  1R4W A;  4DSQ A;  2M46 A;  4NV2 A;  4KA0 A;  3TJB A;  2LJR A;  1M0U A;  2R5G A;  13GS A;  3ZIJ A;  5F0G A;  1B4Q A;  2X8C A;  4ML1 A;  3W8S A;  1JLW A;  1GUH A;  3CTG A;  3J7Y b;  1NW2 A;  2H75 A;  3CRU A;  1HNB A;  2AHE A;  1FO5 A;  1M7T A;  2I81 A;  1TU8 A;  4EVM A;  4MZC A;  5F05 A;  3GMF A;  2P0G A;  2KOK A;  3FR6 A;  1ERW A;  3CYN A;  1TI3 A;  3NIV A;  3UBK A;  3F8U A;  1M99 A;  3HJO A;  3FY7 A;  4I8B A;  3N5O A;  2OE1 A;  4GLT A;  3CRT A;  3F4S A;  3ZFL A;  3H1N A;  1WOU A;  1HNC A;  5AIS A;  4HS1 A;  6GSX A;  4JZQ A;  5AGY A;  3UJ1 A;  4F9Z A;  3IOS A;  2BJX A;  4MJC A;  1AUC A;  4JU5 A;  5GSS A;  2FY6 A;  2C0D A;  4TOP A;  3I43 A;  3D21 A;  3D0Z A;  1U87 A;  1F9M A;  4E8H A;  2MYG A;  1K0O A;  2OA7 A;  3QR6 A;  1SJI A;  4MA9 A;  1FHE A;  4NXI A;  3TKP A;  1GNW A;  4LMV A;  1ON4 A;  2H74 A;  1YEX A;  3P7X A;  5G1L A;  5H5Q A;  5ECK B;  4KH7 A;  1K0M A;  4OO5 A;  1SKS B;  3IAS 2;  2WCI A;  2CAQ A;  3C71 A;  1ZYE A;  1QFN A;  2JU5 A;  3WT2 A;  3L9V A;  2WZ9 A;  2YJH A;  1OVN A;  2DSA A;  3G7I A;  3ZRE A;  1K0C A;  2E2G A;  5DAK A;  2XPD A;  3BOA A;  5ECR B;  2MMA A;  2H30 A;  4IJI A;  2DMM A;  4AF2 A;  5A5K A;  3HA9 A;  2HSY A;  4K1F A;  2YWN A;  4XTS A;  4L0W A;  3E0U A;  2LQQ A;  4IHU A;  1ZL9 A;  1XFL A;  2P31 A;  1SJZ A;  3RPN A;  1ERU A;  5KN2 A;  2K8V A;  2O8V B;  5JCG A;  3PR8 A;  4CDO A;  3DWV A;  3UAR A;  2CA8 A;  5KEJ A;  4D73 A;  1OYJ A;  2LEG A;  1K3O A;  1PN9 A;  2AUV A;  3VFI A;  1HD2 A;  1SK2 A;  4TR3 A;  4LL4 B;  2H1A A;  4HZ4 A;  2IME A;  1A0R P;  1TP9 A;  2L4Q A;  1PMT A;  2LV3 A;  4K2D A;  1PSQ A;  4V1A g;  3RPP A;  1ZCP A;  5F06 A;  5CRH A;  1Z3E A;  4MJA A;  1A2M A;  2FWH A;  4KX4 A;  4POL A;  1EV9 A;  2L5L A;  4CHS A;  3LWA A;  4V1A p;  3GTU B;  3I6A A;  3QOU A;  1GH2 A;  3Q19 A;  1X9M B;  2G2Q A;  4YQU A;  5A4V A;  2C3N A;  2LRT A;  3GKN A;  3EU4 A;  5D9X A;  2QSI A;  1B8X A;  2IIY A;  5DJL A;  5ECH B;  2PU9 C;  18GS A;  4TRX A;  3P90 A;  4WF5 A;  1O8W A;  3HJM A;  4MLY A;  3FZ9 A;  3US3 A;  3JCM L;  2OJL A;  4GST A;  2HI7 A;  3KCM A;  1PGT A;  1EWX A;  5G5F A;  4OFN A;  3OR5 A;  1XBS A;  4FYC A;  2DJJ A;  5JWO B;  2PER A;  3E3E A;  4OFM A;  2MMO A;  4JED A;  4F2I A;  3O3T A;  4WR5 A;  2H71 A;  2R37 A;  2JL4 A;  3GKX A;  2VM2 A;  3MAK A;  3LSZ A;  2JSZ A;  2OE0 A;  2X8H A;  1SYR A;  5J9C A;  2F8F A;  5EL8 A; 
#chains in the Genus database with same CATH topology
 2YV9 A;  3D4T A;  1BJX A;  2L59 A;  5G31 A;  1XXU A;  4NPB A;  1EZK A;  2C8U A;  5D9T A;  4GQF A;  4JR4 A;  1N2A A;  2V41 A;  1NHO A;  5IOW A;  1O7U A;  4KSO A;  4AJ8 A;  3PH9 A;  4J56 E;  1S3C A;  2V6K A;  4MNN A;  4BL7 B;  4AJ6 A;  2NPB A;  2GSR A;  4K7O A;  3DYR A;  3QPM A;  1X5D A;  4G10 A;  1GUK A;  4WBR D;  4N0V A;  2A2R A;  1J9B A;  2IN3 A;  1BYE A;  2VD1 A;  3APQ A;  1C72 A;  5ECM B;  1OKD A;  4XS1 A;  2L6C A;  2FNO A;  4N11 A;  4MAB A;  2TRX A;  3C8E A;  1LBK A;  2LUS A;  2YPM A;  2ON7 A;  1GTU A;  2IFQ B;  4K6X A;  5HFK A;  8GSS A;  4Q5F A;  4G19 A;  3EMP A;  2G0F A;  2P5R A;  1MTC A;  2YWO A;  3FZ4 A;  2I1U A;  1FB0 A;  2PPT A;  2N5A A;  4HEA 2;  4XHM A;  2R6K A;  4I5Q A;  2YZH A;  1Q4J A;  1J0F A;  1GLP A;  2REM A;  2DIY A;  3ZIT A;  1ST9 A;  5G5E A;  4HJM A;  1HYU A;  2B7K A;  1T8E B;  3S9F A;  3QCP A;  1E6B A;  1SKR B;  2CQ9 A;  1B48 A;  2C1Y A;  2NBS A;  2GQK A;  2DC5 A;  4Z2U A;  2C0G A;  1EOG A;  4MPF A;  4E8E A;  1TXX A;  2JZT A;  1THX A;  1TK0 B;  2AB6 A;  3CMI A;  4HQZ A;  3UVT A;  1T1V A;  2CVB A;  4QL7 A;  1SEN A;  3VPQ A;  2QC7 A;  4OD7 A;  1QGV A;  2N5B A;  3TJJ A;  4JE1 A;  5IO0 A;  4RQR A;  2O7K A;  5LCZ A;  4TXV A;  19GS A;  2GZZ A;  5ID2 B;  2ON5 A;  3ZFB A;  4DSS A;  2YN1 A;  1Z6N A;  5D9V A;  2H76 A;  4CY8 A;  2HT9 A;  2WFC A;  1GSY A;  4BWS A;  1MEK A;  1WIK A;  5D9W A;  4ZXG A;  3UAP A;  2EC4 A;  2WUL A;  2YZU A;  3APS A;  4KUN A;  1SL0 B;  2E2M A;  1PFO A;  1QK8 A;  3IDV A;  1I9D A;  2IMI A;  5FT3 A;  1PRX A;  3TKS C;  2E0Q A;  1TK8 B;  1YKA A;  4AJ7 A;  1DE2 A;  2PVO C;  5CO3 A;  3IV4 A;  4MZW A;  2O87 A;  2AAW A;  2PMT A;  4DVC A;  2HRN A;  22GS A;  4F0B A;  2VLU A;  3IK9 A;  4IKH A;  2NDO A;  4HI7 A;  5C04 A;  1FAA A;  3V1W A;  3EPT A;  3GFK A;  2VM1 A;  4HQS A;  1EGO A;  2VLV A;  1OC9 A;  2JAD A;  2FCH A;  2B3S A;  1A2L A;  2JSY A;  4O7H A;  3M1G A;  4I2U A;  3EWL A;  1JFU A;  1GSU A;  1V98 A;  4K9Z A;  4RQX A;  2VCT A;  4ZB8 A;  2DBC A;  5AIX A;  2GVP A;  2L6D A;  4WEY A;  4IP1 A;  1GSD A;  1MD4 A;  3TUE A;  3ME7 A;  3KP9 A;  4MK3 A;  4IW9 A;  3MSZ A;  1K3Y A;  1ACV A;  4L5L A;  3A2V A;  1V57 A;  1M9B A;  4EE0 A;  3H8Q A;  2IMD A;  1TRS A;  14GS A;  1X5E A;  3VPT A;  2H66 A;  3HHV A;  3ED3 A;  5IM9 A;  3BJ5 A;  5EVO A;  3HVX A;  3EYT A;  3G9B A;  3ERW A;  3VI7 A;  4LMW A;  4NMU A;  1T3B A;  2FWF A;  3DEX A;  3ZIV A;  3ZML A;  5DAK B;  4V2L A;  5CRW A;  4F82 A;  1GL8 A;  3VWX A;  2DKH A;  3HVS A;  4WXT A;  3D4M A;  5B8B A;  3D6I A;  1A8L A;  5ECO B;  2QGV A;  5ENU A;  4LLR A;  2X8G A;  1MDI A;  3LGC A;  2AJQ B;  4KND A;  3FRC A;  1WPI A;  5L71 A;  1YZX A;  6GSU A;  2A2P A;  2WB9 A;  2D2Z A;  1DUG A;  4OCE A;  5KN0 A;  2F9S A;  4PUF C;  4D73 B;  1XWA A;  2EIO A;  4F0C A;  1VF4 A;  2XBI A;  2WGR A;  4BA7 A;  3H79 A;  3GN3 A;  3MYD A;  1FOH A;  4LA1 A;  3GA4 A;  1G6W A;  2E7P A;  1RW1 A;  5KN1 A;  2PN8 A;  2EIQ A;  2VOC A;  1V58 A;  2H72 A;  2YNX A;  2KHP A;  2LQO A;  4K7N A;  3WD6 A;  3IR4 A;  4N0Z A;  1PL2 A;  1PKZ A;  2FD3 A;  3M9J A;  2P5Q A;  4ZL9 A;  3APO A;  6GSY A;  3C1R A;  2PBJ A;  3KGK A;  1PL1 A;  1FW1 A;  2C0E A;  4MH3 A;  4MZB A;  2OE3 A;  3DVW A;  3I9V 2;  3CXG A;  1Y25 A;  4MPG A;  4ZBB A;  3DIE A;  3TKS A;  2B1L A;  2F8A A;  5HR3 A;  16GS A;  3BD2 A;  1JZO A;  3GH6 A;  4MMM A;  2DLX A;  3DGQ A;  1XWG A;  3FZ5 A;  4EKZ A;  1M3I A;  1ZOF A;  5ELG A;  2HNL A;  1J08 A;  4X4J A;  1U88 A;  2GT5 A;  4JRR A;  4ECB A;  3C73 A;  2WRT A;  4PUA A;  1GSF A;  4RUV A;  2XPE A;  4IP6 A;  1A23 A;  3L4N A;  1T7P B;  1PQN A;  3CSJ A;  5B6M A;  1X9S B;  1SD8 A;  3BCK A;  2FA8 A;  4MJE A;  3GRX A;  3TDG A;  2DIZ A;  3DVX A;  3P8W A;  2GSQ A;  2I3Y A;  5DQS A;  5FHI A;  1JZW A;  1PN0 A;  4YKF A;  3EC3 A;  1ZGN A;  3DXB A;  1VF3 A;  4Q5R A;  4XS6 A;  3GKM A;  3QAG A;  2N5F A;  4K5R A;  3GUS A;  3KIJ A;  3KEB A;  2C3Q A;  1GLQ A;  4TR1 A;  6GSV A;  3F6D A;  4KDU A;  2B5E A;  1XCC A;  3FR3 A;  2CZ3 A;  4ZB6 A;  4L8E A;  4GRF A;  1SU9 A;  1TJD A;  3MNG A;  3VK9 A;  3DKS A;  4DEJ A;  3O76 A;  3F0I A;  5CRD A;  3WGD A;  5BRT A;  3KMO A;  2HFD A;  2VL9 A;  1SD9 A;  4MDC A;  1UVZ A;  1U3A A;  1GRX A;  1GNE A;  4POB A;  3HD5 A;  3QAW A;  2H6X A;  1ZYP A;  1NHY A;  1R7H A;  4ECJ A;  3G7Y A;  4A5P A;  1EOH A;  5J4U A;  1AAZ A;  2WJU A;  4FYU A;  2V2G A;  2PWJ A;  4GTU A;  3IHQ A;  2CVK A;  5EY6 A;  1ILO A;  5COH A;  4GXZ A;  2IJY A;  3L9U A;  3VUR A;  1JZD A;  3O6T A;  2FA4 A;  1EP8 A;  3GX0 A;  1O8X A;  4EC0 A;  1YEP A;  5IMC A;  2LNS A;  4HUA A;  4DSS B;  1HNA A;  3LEF A;  1O81 A;  1GUM A;  2H6Y A;  2IL3 A;  2KP1 A;  2V32 A;  20GS A;  2MZC A;  2BTO T;  4RI7 A;  4N30 A;  2HSM A;  3TRQ A;  5E4W A;  2LRC A;  3RDW A;  2UZ8 A;  3EVI A;  1H4O A;  4KB3 A;  1AC1 A;  2DJ1 A;  4ZIJ A;  4AGS A;  3U6V A;  2VCQ A;  3QD9 A;  2DJK A;  4JBB A;  3HYP A;  1K0N A;  1ERV A;  4EDZ A;  4DSR A;  3TRX A;  2EIR A;  2B5X A;  1XZO A;  3EUR A;  1W4V A;  3A2W A;  3IK7 A;  2CAI A;  4WR4 A;  1YF1 A;  4ID0 A;  1EP7 A;  1S3D A;  2L57 A;  4ECI A;  5D8I A;  1M2D A;  4Q5N A;  2X99 A;  2DKI A;  5LNK e;  3WT1 A;  3HVV A;  3GL3 A;  3QDN A;  1GTA A;  3UVH A;  3IC4 A;  2R3X A;  2H1B A;  1OC9 B;  2HRA A;  2L5O A;  1YF0 A;  1Z9H A;  4IN0 A;  1B4P A;  2H19 A;  5KN3 A;  2IMK A;  1B9X C;  4XCS A;  2MBT A;  4L0U A;  1SKW B;  4YQV A;  5IPH A;  1Z6M A;  2FWE A;  3GIX A;  2H1D A;  1EGR A;  4HOJ A;  4N10 A;  2QKE A;  1ABA A;  5CYY A;  1LU4 A;  4PUR A;  2GZP A;  5CRE A;  1O73 A;  3GST A;  3ERF A;  1OE8 A;  4HJ2 A;  2OKA A;  3M8N A;  1NSW A;  1EEJ A;  3UL3 A;  3L78 A;  1PKW A;  3C1S A;  5BMU A;  2OBK A;  5B6N A;  3QFA C;  4CW9 A;  1FB6 A;  2TRC P;  3FZA A;  1QQ2 A;  2LKU A;  3KJY A;  4OCF A;  3A3T A;  1T4Y A;  2K9F A;  4TXO A;  2A2S A;  3FYG A;  4YH2 A;  2ZUP A;  3ZTL A;  2F3M A;  4OWY A;  4EXJ A;  1PX7 A;  3PIN A;  3H93 A;  3GNJ A;  2RLI A;  1SJ6 A;  2FGX A;  4KDX A;  1F37 A;  5CAX A;  3UMA A;  3A2X A;  1GSQ A;  3IXR A;  2PGT A;  2ES7 A;  3TKQ A;  1Z7P A;  1G7O A;  2I4A A;  4IVF A;  5GAP D;  3SWL A;  4IEL A;  1BAY A;  4ZIL A;  4LL1 B;  5GST A;  3GX8 A;  1XW9 A;  2A4V A;  4O5R A;  1TOF A;  4MF6 A;  4EUY A;  1XWB A;  4FO5 A;  1ZMA A;  1GP1 A;  3CTF A;  3LFL A;  2GSS A;  5GAN D;  4XIH A;  1KEB A;  4BPY A;  3ME8 A;  3DD3 A;  1F2E A;  2O89 A;  1WMJ A;  5H5S A;  3GUR A;  1I5G A;  3KH7 A;  3J7Y k;  1OE7 A;  3D5J A;  1XW6 A;  1ERT A;  1AW9 A;  3WGE A;  1W89 A;  4OMV A;  4ZBD A;  3EIN A;  2I9H A;  3N9J A;  2Z9S A;  3E9J B;  2KLX A;  1AQV A;  3BBY A;  3CSH A;  3G7J A;  1TW9 A;  3UOM A;  2VAF A;  3VWV A;  3LYP A;  1G6Y A;  2VCX A;  3C7M A;  4PNG A;  2B6M A;  4PXO A;  2B5Y A;  1V9W A;  2QA1 A;  4KF9 A;  1NM3 A;  1A0F A;  3HJP A;  4KGI A;  2YP6 A;  3CBU A;  1CQH A;  1ZYN A;  1O6J A;  2YWM A;  3LOR A;  4J2F A;  1FVK A;  2YJ7 A;  1S3A A;  4TR4 A;  5J41 A;  2AV4 A;  3PGT A;  3ZVJ A;  3RHC A;  2GTU A;  5DAL A;  1AIU A;  5AN1 A;  11GS A;  4ISD A;  3TJF A;  3IA1 A;  5GZZ B;  3NOF A;  5KOW A;  1LJR A;  4V2N A;  1Z7R A;  1B9Y C;  5IMF A;  1TRW A;  2RM6 A;  5AIV A;  3IAM 2;  3ERG A;  1MDJ A;  1T00 A;  2R2J A;  1XWC A;  5J9B A;  5J5N A;  5DBQ A;  3DML A;  4KSM A;  4FQU A;  4JR6 A;  5B7C A;  1HQO A;  4MP4 A;  2DJ3 A;  5IIZ A;  1GWC A;  3M3M A;  1TI1 A;  2H1G A;  5D73 A;  3BCI A;  3EU3 A;  4IGJ A;  10GS A;  2K18 A;  2YV7 A;  1Q98 A;  2VL3 A;  3LXZ A;  5B8A A;  1EEM A;  3M0F A;  1BQ7 A;  1TRV A;  1UC7 A;  2C0F A;  2FHE A;  3ZYW A;  2LST A;  1SL1 B;  3GKK A;  3ZMK A;  4PGT A;  1WWJ A;  2RUF A;  4L5O A;  3TOU A;  4TR1 B;  12GS A;  3IE3 A;  3M9K A;  2YOI A;  3GL5 A;  3ZZX A;  1XVQ A;  3LJR A;  1PD2 1;  4P3Y B;  1XIY A;  5JWQ B;  1GSE A;  5JCU A;  3SBC A;  4H86 A;  2L4C A;  2VUP A;  3A5I A;  2RUE A;  4MF5 A;  1UA5 A;  3F3R A;  5IMA A;  1TDI A;  3R3E A;  4IQA A;  1FVJ A;  4ML6 A;  2GQL A;  2F51 A;  5CRG A;  3CSI A;  1WP0 A;  3HKR A;  5IOX A;  4GSN A;  7GSS A;  2FLS A;  1SYX A;  1H75 A;  1WE0 A;  2GZY A;  4BVY A;  5ECI B;  5G1K A;  4PQH A;  3TKR A;  4XS4 A;  1RK4 A;  5D96 A;  1AXD A;  3FHK A;  3ISO A;  3HZ4 A;  5C00 A;  3VWU A;  3LW9 A;  4ZBA A;  5LD0 A;  2LNT A;  3MDK A;  1E2Y A;  3Q74 A;  2FUG 2;  2KUC A;  1JLV A;  2H73 A;  3RHB A;  4GCI A;  2CT6 A;  5HFI A;  1VF2 A;  1X0R A;  4WET A;  17GS A;  4BWQ A;  2J9H A;  4ILF A;  5HR2 A;  4EDY A;  2VCZ A;  5JWR B;  1F3B A;  4KW6 A;  1SL2 B;  3VLN A;  4K0N A;  1MDK A;  4QQ7 A;  1BED A;  5KOX A;  2B1K A;  4F03 A;  1G0T A;  2VIM A;  5JCW A;  5A4W A;  3IBH A;  2HZE A;  2VL2 C;  3KZQ A;  3F6F A;  1R5P A;  1TRU A;  3EMX A;  2LJK A;  3I69 A;  5D93 A;  3KTL A;  2MMZ A;  2AYT A;  1WRY A;  1YKC A;  3U5R E;  4CY6 A;  2HLS A;  1SK0 A;  1XPV A;  5IMZ A;  2LS5 A;  2HE3 A;  4Q5Q A;  3K8N A;  1UN2 A;  2HRK A;  1OC8 A;  2MMN A;  1G7E A;  4POM A;  4HZ2 A;  3HY2 A;  4EO3 A;  1K0D A;  2VCW A;  1A24 A;  5IPG A;  4WKW A;  4BVX A;  4Z2R A;  4G0K A;  2DML A;  2OAD A;  5F07 A;  2RM5 A;  2C4J A;  1CQG A;  2M72 A;  1X5C A;  3KH9 A;  4MJB A;  1R5A A;  2R4V A;  2NVL A;  1XG8 A;  1F3A A;  1XOA A;  3AY8 A;  4NV5 A;  2XC2 A;  1RQM A;  4FIW A;  4BIK A;  4KDY A;  3KTB A;  2V6O A;  3MIX A;  2GS3 A;  3GSS A;  4ULX A;  2H0H A;  5G2Z A;  3A5W A;  4PQI A;  4FYB A;  1U3I A;  3TB2 A;  2VLT A;  3EE2 A;  4G9H A;  4ZL7 A;  2IPA A;  2QA2 A;  4TXO B;  2X49 A;  1V40 A;  1Z5Y E;  4IBP A;  2K6V A;  4IQ1 A;  4KCE A;  4KCA A;  4HDE A;  2GQM A;  2C80 A;  3HXS A;  1TKD B;  3NZN A;  3RAZ A;  1U6T A;  3TOT A;  3VI5 A;  1TTZ A;  2C3T A;  2H70 A;  4I97 A;  3KMN A;  3LG6 A;  2CV4 A;  2HRF A;  1VF1 A;  1QMV A;  4OO4 A;  2ZNM A;  2HSH A;  5DJM A;  2HYX A;  1MD3 A;  3L0H A;  1XVW A;  6GSW A;  5A4U A;  2H0G A;  3F3Q A;  3HVN A;  2OAC A;  2R0P A;  1KBN A;  1M9A A;  4V2M A;  2LJA A;  2O85 A;  4X43 A;  2K8S A;  2JAC A;  1PA3 A;  4HU9 A;  3UBL A;  1GSS A;  1FG4 A;  4I6X A;  2KP2 A;  3GHA A;  1F6M C;  2VD0 A;  4IJ3 A;  4XRD A;  1QUW A;  1GTI A;  1BG5 A;  3FW2 A;  4MH2 A;  2GGT A;  4NHW A;  5J3R A;  3QFB C;  2OBI A;  5HR1 A;  1K3L A;  1TU7 A;  3WYW A;  1OKT A;  1PX6 A;  3GYK A;  6GST A;  1VRS D;  1VGL A;  1K0A A;  2VL2 A;  1EV4 A;  3KXO A;  4MF7 A;  4TW5 A;  1A2J A;  4ZL8 A;  4PQ1 A;  4TN8 A;  3MWH A;  1YQ1 A;  4TR0 A;  2FWG A;  3W8J A;  1JHB A;  1USB A;  3IRA A;  4YAP A;  3D22 A;  2J23 A;  1WJK A;  1V2A A;  3F63 A;  4IS0 A;  3TJK A;  1X9W B;  4GF0 A;  5DAL B;  1DSB A;  4FH8 A;  4K7I A;  3QAV A;  2VCV A;  5CP1 A;  3W6G A;  3GTU A;  2YWI A;  3R2Q A;  4YQM A;  2JZS A;  1OC3 A;  2CX4 A;  1SK1 A;  5HQP A;  4K2X A;  3QMX A;  3H4K A;  4PX1 A;  3IPZ A;  4QL9 A;  4EIQ A;  2X64 A;  4O5Q A;  2GT6 A;  4KE3 A;  5ELA A;  3FMW A;  3LYK A;  1DE1 A;  6GSS A;  4GQC A;  2TIR A;  2DJ0 A;  5G30 A;  2A4H A;  2H01 A;  4WBJ A;  2GLR A;  1THO A;  2XHF A;  1IYH A;  3PPU A;  1ZZY A;  1R26 A;  2IMF A;  3VWW A;  1M2B A;  1GUL A;  4NAX A;  1Y6E A;  2MBS A;  3WGX A;  4NWY A;  1JZR A;  1FOV A;  5INY A;  3ZLP A;  4ECC A;  2CZ2 A;  2IWT A;  3KP8 A;  3LQ7 A;  2VO4 A;  2CVD A;  1TK5 B;  4HU7 A;  3FEU A;  3TCO A;  1XW5 A;  5DVB A;  1ZYQ B;  4YAV A;  4OFT A;  5ECP B;  2CX3 A;  2R0G A;  4X0X A;  1XWK A;  5DCH A;  4USS A;  2H8L A;  2WS2 A;  4TKY A;  4BL7 A;  2ALB A;  4G2E A;  3FK8 A;  5E59 A;  1QXH A;  4GWR A;  5FWG A;  2LTK A;  4O92 A;  1BX9 A;  4X1U A;  9GSS A;  4J57 E;  1DBY A;  1T4Z A;  5ABR A;  1N8J A;  3TJG A;  3ZRD A;  4POK A;  2ZCT A;  2HXK A;  5IQY A;  3ZL5 A;  1IYI A;  3F9U A;  4BVY B;  2PUK C;  1AQX A;  4TVE A;  3ZVJ D;  3F4T A;  4XS4 B;  1O85 A;  4K0G A;  3TKS E;  5EPF A;  3KM6 A;  2IFQ A;  3FR9 A;  3DRN A;  2YCD A;  4XRA A;  4WF4 A;  4GSS A;  3L9S A;  1K0B A;  2H6Z A;  3HDC A;  2B7J A;  5HR0 A;  5DQY A;  2XBQ A;  3P2A A;  1URM A;  1KNG A;  3Q6O A;  4O5U A;  4K8M A;  1ML6 A;  2H0I A;  1M2A A;  5HFG A;  1YY7 A;  3GV1 A;  3FKF A;  2RII A;  5DDL A;  3UEM A;  1OAZ A;  2BMX A;  4ZB9 A;  4PNF A;  5DCG A;  5ECQ B;  2R0C A;  2YAN A;  2HZE B;  5F8B A;  3UIW A;  2LRN A;  2WDU A;  1YDK A;  2HZF A;  3LXT A;  4Z7X A;  4I2T A;  2GDR A;  5ECS A;  4EL1 A;  5IMD A;  2PVQ A;  3KD0 A;  3HCZ A;  2GST A;  3HZ8 A;  1YJ6 A;  2DJ2 A;  5IMV A;  4MCU A;  1A8Y A;  3RBT A;  3F4R A;  4RI6 A;  1AQW A;  5ID2 A;  1XOB A;  5ECL B;  2V1M A;  5IO2 A;  2JZR A;  2NTO A;  5CNW A;  4O32 A;  5ECN B;  3GH9 A;  3TRP A;  1GTB A;  4NHZ A;  4ACS A;  4EF0 A;  3TGZ A;  4KAE A;  3Q18 A;  2M80 A;  4BVX B;  5H5R A;  1KTE A;  1R4W A;  4DSQ A;  2M46 A;  4NV2 A;  4KA0 A;  3TJB A;  2LJR A;  1M0U A;  2R5G A;  13GS A;  3ZIJ A;  5F0G A;  1B4Q A;  2X8C A;  4ML1 A;  3W8S A;  1JLW A;  1GUH A;  4HSC X;  3CTG A;  3J7Y b;  1NW2 A;  2H75 A;  3CRU A;  1HNB A;  2AHE A;  1FO5 A;  1M7T A;  2I81 A;  1TU8 A;  4EVM A;  4MZC A;  5F05 A;  3GMF A;  2P0G A;  2KOK A;  3FR6 A;  1ERW A;  3CYN A;  1TI3 A;  3NIV A;  3UBK A;  3F8U A;  1M99 A;  3HJO A;  3FY7 A;  4I8B A;  3N5O A;  3IC8 A;  2OE1 A;  4GLT A;  3CRT A;  3F4S A;  3ZFL A;  3H1N A;  1WOU A;  1HNC A;  5AIS A;  4HS1 A;  6GSX A;  4JZQ A;  5AGY A;  3UJ1 A;  4F9Z A;  3IOS A;  2BJX A;  4MJC A;  1AUC A;  4JU5 A;  5GSS A;  2FY6 A;  2C0D A;  4ICY A;  4TOP A;  3I43 A;  3D21 A;  3D0Z A;  4Z2T A;  1U87 A;  1F9M A;  4K5S A;  4E8H A;  2MYG A;  1K0O A;  2OA7 A;  3QR6 A;  1SJI A;  4MA9 A;  1FHE A;  4NXI A;  3TKP A;  1GNW A;  4LMV A;  1ON4 A;  2H74 A;  1YEX A;  3CQF A;  3P7X A;  5G1L A;  5H5Q A;  4YKG A;  5ECK B;  4KH7 A;  1K0M A;  4OO5 A;  1SKS B;  3IAS 2;  2WCI A;  4EIP A;  2CAQ A;  3C71 A;  1ZYE A;  1QFN A;  2JU5 A;  3WT2 A;  3L9V A;  2WZ9 A;  2YJH A;  1OVN A;  2DSA A;  3G7I A;  3ZRE A;  1K0C A;  2E2G A;  5DAK A;  2XPD A;  3BOA A;  5ECR B;  2MMA A;  2H30 A;  2X4A A;  4IJI A;  2DMM A;  4AF2 A;  5A5K A;  3HA9 A;  2HSY A;  4K1F A;  2YWN A;  4G0I A;  4XTS A;  4L0W A;  3E0U A;  2LQQ A;  4IHU A;  1ZL9 A;  1XFL A;  2P31 A;  1SJZ A;  3RPN A;  1ERU A;  5KN2 A;  2K8V A;  2O8V B;  5JCG A;  3PR8 A;  4CDO A;  3DWV A;  3UAR A;  2CA8 A;  5KEJ A;  4D73 A;  1OYJ A;  2LEG A;  1K3O A;  1PN9 A;  2AUV A;  3VFI A;  1HD2 A;  1S3R A;  1SK2 A;  4LL4 B;  4TR3 A;  2H1A A;  4HZ4 A;  2IME A;  1A0R P;  1TP9 A;  2L4Q A;  1PMT A;  2LV3 A;  4K2D A;  1PSQ A;  4V1A g;  3RPP A;  1ZCP A;  5F06 A;  5CRH A;  1Z3E A;  4MJA A;  1M3J A;  1A2M A;  2FWH A;  4KX4 A;  4POL A;  1EV9 A;  2L5L A;  4CHS A;  3LWA A;  4V1A p;  3GTU B;  3I6A A;  3QOU A;  1GH2 A;  3Q19 A;  1X9M B;  2G2Q A;  4YQU A;  5A4V A;  2C3N A;  2LRT A;  3IHG A;  3GKN A;  3EU4 A;  5D9X A;  2QSI A;  1B8X A;  2IIY A;  5DJL A;  5ECH B;  2PU9 C;  18GS A;  4TRX A;  3P90 A;  4WF5 A;  1O8W A;  3HJM A;  4MLY A;  3FZ9 A;  4G0L A;  3US3 A;  3JCM L;  2OJL A;  4PTS A;  4GST A;  2HI7 A;  3KCM A;  1PGT A;  1EWX A;  5G5F A;  4OFN A;  3OR5 A;  1XBS A;  4FYC A;  2DJJ A;  5JWO B;  2PER A;  3E3E A;  4OFM A;  2MMO A;  4JED A;  4F2I A;  3O3T A;  4WR5 A;  2H71 A;  2R37 A;  2JL4 A;  3GKX A;  2VM2 A;  3MAK A;  3LSZ A;  2JSZ A;  2OE0 A;  2X8H A;  1SYR A;  5J9C A;  2F8F A;  5EL8 A; 
#chains in the Genus database with same CATH homology
 2YV9 A;  3D4T A;  1BJX A;  2L59 A;  5G31 A;  1XXU A;  4NPB A;  1EZK A;  2C8U A;  5D9T A;  4GQF A;  4JR4 A;  1N2A A;  2V41 A;  1NHO A;  5IOW A;  1O7U A;  4KSO A;  4AJ8 A;  3PH9 A;  4J56 E;  1S3C A;  2V6K A;  4MNN A;  4BL7 B;  4AJ6 A;  2NPB A;  2GSR A;  4K7O A;  3DYR A;  3QPM A;  1X5D A;  4G10 A;  1GUK A;  4WBR D;  4N0V A;  2A2R A;  1J9B A;  2IN3 A;  1BYE A;  2VD1 A;  3APQ A;  1C72 A;  5ECM B;  1OKD A;  4XS1 A;  2L6C A;  2FNO A;  4N11 A;  4MAB A;  2TRX A;  3C8E A;  1LBK A;  2LUS A;  2YPM A;  2ON7 A;  1GTU A;  2IFQ B;  4K6X A;  5HFK A;  8GSS A;  4Q5F A;  4G19 A;  3EMP A;  2G0F A;  2P5R A;  1MTC A;  2YWO A;  3FZ4 A;  2I1U A;  1FB0 A;  2PPT A;  2N5A A;  4HEA 2;  4XHM A;  2R6K A;  4I5Q A;  2YZH A;  1Q4J A;  1J0F A;  1GLP A;  2REM A;  2DIY A;  3ZIT A;  1ST9 A;  5G5E A;  4HJM A;  1HYU A;  2B7K A;  1T8E B;  3S9F A;  3QCP A;  1E6B A;  1SKR B;  2CQ9 A;  1B48 A;  2C1Y A;  2NBS A;  2GQK A;  2DC5 A;  4Z2U A;  2C0G A;  1EOG A;  4MPF A;  4E8E A;  1TXX A;  2JZT A;  1THX A;  1TK0 B;  2AB6 A;  3CMI A;  4HQZ A;  3UVT A;  1T1V A;  2CVB A;  4QL7 A;  1SEN A;  3VPQ A;  2QC7 A;  4OD7 A;  1QGV A;  2N5B A;  3TJJ A;  4JE1 A;  5IO0 A;  4RQR A;  2O7K A;  5LCZ A;  4TXV A;  19GS A;  2GZZ A;  5ID2 B;  2ON5 A;  3ZFB A;  4DSS A;  2YN1 A;  1Z6N A;  5D9V A;  2H76 A;  4CY8 A;  2HT9 A;  2WFC A;  1GSY A;  4BWS A;  1MEK A;  1WIK A;  5D9W A;  4ZXG A;  3UAP A;  2EC4 A;  2WUL A;  2YZU A;  3APS A;  4KUN A;  1SL0 B;  2E2M A;  1QK8 A;  3IDV A;  1I9D A;  2IMI A;  5FT3 A;  1PRX A;  3TKS C;  2E0Q A;  1TK8 B;  1YKA A;  4AJ7 A;  1DE2 A;  2PVO C;  5CO3 A;  3IV4 A;  4MZW A;  2O87 A;  2AAW A;  2PMT A;  4DVC A;  2HRN A;  22GS A;  4F0B A;  2VLU A;  3IK9 A;  4IKH A;  2NDO A;  4HI7 A;  5C04 A;  1FAA A;  3V1W A;  3EPT A;  3GFK A;  2VM1 A;  4HQS A;  1EGO A;  2VLV A;  1OC9 A;  2JAD A;  2FCH A;  2B3S A;  1A2L A;  2JSY A;  4O7H A;  3M1G A;  4I2U A;  3EWL A;  1JFU A;  1GSU A;  1V98 A;  4K9Z A;  4RQX A;  2VCT A;  4ZB8 A;  2DBC A;  5AIX A;  2GVP A;  2L6D A;  4WEY A;  4IP1 A;  1GSD A;  1MD4 A;  3TUE A;  3ME7 A;  3KP9 A;  4MK3 A;  4IW9 A;  3MSZ A;  1K3Y A;  1ACV A;  4L5L A;  3A2V A;  1V57 A;  1M9B A;  4EE0 A;  3H8Q A;  2IMD A;  1TRS A;  14GS A;  1X5E A;  3VPT A;  2H66 A;  3HHV A;  3ED3 A;  5IM9 A;  3BJ5 A;  5EVO A;  3HVX A;  3EYT A;  3G9B A;  3ERW A;  3VI7 A;  4LMW A;  4NMU A;  1T3B A;  2FWF A;  3DEX A;  3ZIV A;  3ZML A;  5DAK B;  4V2L A;  5CRW A;  4F82 A;  1GL8 A;  3VWX A;  2DKH A;  3HVS A;  4WXT A;  3D4M A;  5B8B A;  3D6I A;  1A8L A;  5ECO B;  2QGV A;  5ENU A;  4LLR A;  2X8G A;  1MDI A;  3LGC A;  2AJQ B;  4KND A;  3FRC A;  1WPI A;  5L71 A;  1YZX A;  6GSU A;  2A2P A;  2WB9 A;  2D2Z A;  1DUG A;  4OCE A;  5KN0 A;  2F9S A;  4PUF C;  4D73 B;  1XWA A;  2EIO A;  4F0C A;  1VF4 A;  2XBI A;  2WGR A;  4BA7 A;  3H79 A;  3GN3 A;  3MYD A;  1FOH A;  4LA1 A;  3GA4 A;  1G6W A;  2E7P A;  1RW1 A;  5KN1 A;  2PN8 A;  2EIQ A;  2VOC A;  1V58 A;  2H72 A;  2YNX A;  2KHP A;  2LQO A;  4K7N A;  3WD6 A;  3IR4 A;  4N0Z A;  1PL2 A;  1PKZ A;  2FD3 A;  3M9J A;  2P5Q A;  4ZL9 A;  3APO A;  6GSY A;  3C1R A;  2PBJ A;  3KGK A;  1PL1 A;  1FW1 A;  2C0E A;  4MH3 A;  4MZB A;  2OE3 A;  3DVW A;  3I9V 2;  3CXG A;  1Y25 A;  4MPG A;  4ZBB A;  3DIE A;  3TKS A;  2B1L A;  2F8A A;  5HR3 A;  16GS A;  3BD2 A;  1JZO A;  3GH6 A;  4MMM A;  2DLX A;  3DGQ A;  1XWG A;  3FZ5 A;  4EKZ A;  1ZOF A;  5ELG A;  2HNL A;  1J08 A;  4X4J A;  1U88 A;  2GT5 A;  4JRR A;  4ECB A;  3C73 A;  2WRT A;  4PUA A;  1GSF A;  4RUV A;  2XPE A;  4IP6 A;  1A23 A;  3L4N A;  1T7P B;  1PQN A;  3CSJ A;  5B6M A;  1X9S B;  1SD8 A;  3BCK A;  2FA8 A;  4MJE A;  3GRX A;  3TDG A;  2DIZ A;  3DVX A;  3P8W A;  2GSQ A;  2I3Y A;  5DQS A;  5FHI A;  1JZW A;  1PN0 A;  4YKF A;  3EC3 A;  1ZGN A;  3DXB A;  1VF3 A;  4Q5R A;  4XS6 A;  3GKM A;  3QAG A;  2N5F A;  4K5R A;  3GUS A;  3KIJ A;  3KEB A;  2C3Q A;  1GLQ A;  4TR1 A;  6GSV A;  3F6D A;  4KDU A;  2B5E A;  1XCC A;  3FR3 A;  2CZ3 A;  4ZB6 A;  4L8E A;  4GRF A;  1SU9 A;  1TJD A;  3MNG A;  3VK9 A;  3DKS A;  4DEJ A;  3O76 A;  3F0I A;  5CRD A;  3WGD A;  5BRT A;  3KMO A;  2HFD A;  2VL9 A;  1SD9 A;  4MDC A;  1UVZ A;  1U3A A;  1GRX A;  1GNE A;  4POB A;  3HD5 A;  3QAW A;  2H6X A;  1ZYP A;  1NHY A;  1R7H A;  4ECJ A;  3G7Y A;  4A5P A;  1EOH A;  5J4U A;  1AAZ A;  2WJU A;  4FYU A;  2V2G A;  2PWJ A;  4GTU A;  3IHQ A;  2CVK A;  5EY6 A;  1ILO A;  5COH A;  4GXZ A;  2IJY A;  3L9U A;  3VUR A;  1JZD A;  3O6T A;  2FA4 A;  1EP8 A;  3GX0 A;  1O8X A;  4EC0 A;  1YEP A;  5IMC A;  2LNS A;  4HUA A;  4DSS B;  1HNA A;  3LEF A;  1O81 A;  1GUM A;  2H6Y A;  2IL3 A;  2KP1 A;  2V32 A;  20GS A;  2MZC A;  2BTO T;  4RI7 A;  4N30 A;  2HSM A;  3TRQ A;  5E4W A;  2LRC A;  3RDW A;  2UZ8 A;  3EVI A;  1H4O A;  4KB3 A;  1AC1 A;  2DJ1 A;  4ZIJ A;  4AGS A;  3U6V A;  2VCQ A;  3QD9 A;  2DJK A;  4JBB A;  3HYP A;  1K0N A;  1ERV A;  4EDZ A;  4DSR A;  3TRX A;  2EIR A;  2B5X A;  1XZO A;  3EUR A;  1W4V A;  3A2W A;  3IK7 A;  2CAI A;  4WR4 A;  1YF1 A;  4ID0 A;  1EP7 A;  1S3D A;  2L57 A;  4ECI A;  5D8I A;  1M2D A;  4Q5N A;  2X99 A;  2DKI A;  5LNK e;  3WT1 A;  3HVV A;  3GL3 A;  3QDN A;  1GTA A;  3UVH A;  3IC4 A;  2R3X A;  2H1B A;  1OC9 B;  2HRA A;  2L5O A;  1YF0 A;  1Z9H A;  4IN0 A;  1B4P A;  2H19 A;  5KN3 A;  2IMK A;  1B9X C;  4XCS A;  2MBT A;  4L0U A;  1SKW B;  4YQV A;  5IPH A;  1Z6M A;  2FWE A;  3GIX A;  2H1D A;  1EGR A;  4HOJ A;  4N10 A;  2QKE A;  1ABA A;  5CYY A;  1LU4 A;  4PUR A;  2GZP A;  5CRE A;  1O73 A;  3GST A;  3ERF A;  1OE8 A;  4HJ2 A;  2OKA A;  3M8N A;  1NSW A;  1EEJ A;  3UL3 A;  3L78 A;  1PKW A;  3C1S A;  5BMU A;  2OBK A;  5B6N A;  3QFA C;  4CW9 A;  1FB6 A;  2TRC P;  3FZA A;  1QQ2 A;  2LKU A;  3KJY A;  4OCF A;  3A3T A;  1T4Y A;  2K9F A;  4TXO A;  2A2S A;  3FYG A;  4YH2 A;  2ZUP A;  3ZTL A;  2F3M A;  4OWY A;  4EXJ A;  1PX7 A;  3PIN A;  3H93 A;  3GNJ A;  2RLI A;  1SJ6 A;  2FGX A;  4KDX A;  1F37 A;  5CAX A;  3UMA A;  3A2X A;  1GSQ A;  3IXR A;  2PGT A;  2ES7 A;  3TKQ A;  1Z7P A;  1G7O A;  2I4A A;  4IVF A;  5GAP D;  3SWL A;  4IEL A;  1BAY A;  4ZIL A;  4LL1 B;  5GST A;  3GX8 A;  1XW9 A;  2A4V A;  4O5R A;  1TOF A;  4MF6 A;  4EUY A;  1XWB A;  4FO5 A;  1ZMA A;  1GP1 A;  3CTF A;  3LFL A;  2GSS A;  5GAN D;  4XIH A;  1KEB A;  4BPY A;  3ME8 A;  3DD3 A;  1F2E A;  2O89 A;  1WMJ A;  5H5S A;  3GUR A;  1I5G A;  3KH7 A;  3J7Y k;  1OE7 A;  3D5J A;  1XW6 A;  1ERT A;  1AW9 A;  3WGE A;  1W89 A;  4OMV A;  4ZBD A;  3EIN A;  2I9H A;  3N9J A;  2Z9S A;  3E9J B;  2KLX A;  1AQV A;  3BBY A;  3CSH A;  3G7J A;  1TW9 A;  3UOM A;  2VAF A;  3VWV A;  3LYP A;  1G6Y A;  2VCX A;  3C7M A;  4PNG A;  2B6M A;  4PXO A;  2B5Y A;  1V9W A;  2QA1 A;  4KF9 A;  1NM3 A;  1A0F A;  3HJP A;  4KGI A;  2YP6 A;  3CBU A;  1CQH A;  1ZYN A;  1O6J A;  2YWM A;  3LOR A;  4J2F A;  1FVK A;  2YJ7 A;  1S3A A;  4TR4 A;  5J41 A;  2AV4 A;  3PGT A;  3ZVJ A;  3RHC A;  2GTU A;  5DAL A;  1AIU A;  5AN1 A;  11GS A;  4ISD A;  3TJF A;  3IA1 A;  5GZZ B;  3NOF A;  5KOW A;  1LJR A;  4V2N A;  1Z7R A;  1B9Y C;  5IMF A;  1TRW A;  2RM6 A;  5AIV A;  3IAM 2;  3ERG A;  1MDJ A;  1T00 A;  2R2J A;  1XWC A;  5J9B A;  5J5N A;  5DBQ A;  3DML A;  4KSM A;  4FQU A;  4JR6 A;  5B7C A;  1HQO A;  4MP4 A;  2DJ3 A;  5IIZ A;  1GWC A;  3M3M A;  1TI1 A;  2H1G A;  5D73 A;  3BCI A;  3EU3 A;  4IGJ A;  10GS A;  2K18 A;  2YV7 A;  1Q98 A;  2VL3 A;  3LXZ A;  5B8A A;  1EEM A;  3M0F A;  1BQ7 A;  1TRV A;  1UC7 A;  2C0F A;  2FHE A;  3ZYW A;  2LST A;  1SL1 B;  3GKK A;  3ZMK A;  4PGT A;  1WWJ A;  2RUF A;  4L5O A;  3TOU A;  4TR1 B;  12GS A;  3IE3 A;  3M9K A;  2YOI A;  3GL5 A;  3ZZX A;  1XVQ A;  3LJR A;  1PD2 1;  4P3Y B;  1XIY A;  5JWQ B;  1GSE A;  5JCU A;  3SBC A;  4H86 A;  2L4C A;  2VUP A;  3A5I A;  2RUE A;  4MF5 A;  1UA5 A;  3F3R A;  5IMA A;  1TDI A;  3R3E A;  4IQA A;  1FVJ A;  4ML6 A;  2GQL A;  2F51 A;  5CRG A;  3CSI A;  1WP0 A;  3HKR A;  5IOX A;  4GSN A;  7GSS A;  2FLS A;  1SYX A;  1H75 A;  1WE0 A;  2GZY A;  4BVY A;  5ECI B;  5G1K A;  4PQH A;  3TKR A;  4XS4 A;  1RK4 A;  5D96 A;  1AXD A;  3FHK A;  3ISO A;  3HZ4 A;  5C00 A;  3VWU A;  3LW9 A;  4ZBA A;  5LD0 A;  2LNT A;  3MDK A;  1E2Y A;  3Q74 A;  2FUG 2;  2KUC A;  1JLV A;  2H73 A;  3RHB A;  4GCI A;  2CT6 A;  5HFI A;  1VF2 A;  1X0R A;  4WET A;  17GS A;  4BWQ A;  2J9H A;  4ILF A;  5HR2 A;  4EDY A;  2VCZ A;  5JWR B;  1F3B A;  4KW6 A;  1SL2 B;  3VLN A;  4K0N A;  1MDK A;  4QQ7 A;  1BED A;  5KOX A;  2B1K A;  4F03 A;  1G0T A;  2VIM A;  5JCW A;  5A4W A;  3IBH A;  2HZE A;  2VL2 C;  3KZQ A;  3F6F A;  1R5P A;  1TRU A;  3EMX A;  2LJK A;  3I69 A;  5D93 A;  3KTL A;  2MMZ A;  2AYT A;  1WRY A;  1YKC A;  3U5R E;  4CY6 A;  2HLS A;  1SK0 A;  1XPV A;  5IMZ A;  2LS5 A;  2HE3 A;  4Q5Q A;  3K8N A;  1UN2 A;  2HRK A;  1OC8 A;  2MMN A;  1G7E A;  4POM A;  4HZ2 A;  3HY2 A;  4EO3 A;  1K0D A;  2VCW A;  1A24 A;  5IPG A;  4WKW A;  4BVX A;  4Z2R A;  4G0K A;  2DML A;  2OAD A;  5F07 A;  2RM5 A;  2C4J A;  1CQG A;  2M72 A;  1X5C A;  3KH9 A;  4MJB A;  1R5A A;  2R4V A;  2NVL A;  1F3A A;  1XOA A;  3AY8 A;  4NV5 A;  2XC2 A;  1RQM A;  4FIW A;  4KDY A;  3KTB A;  2V6O A;  3MIX A;  2GS3 A;  3GSS A;  4ULX A;  2H0H A;  5G2Z A;  3A5W A;  4PQI A;  4FYB A;  1U3I A;  3TB2 A;  2VLT A;  3EE2 A;  4G9H A;  4ZL7 A;  2IPA A;  2QA2 A;  4TXO B;  2X49 A;  1V40 A;  1Z5Y E;  4IBP A;  2K6V A;  4IQ1 A;  4KCE A;  4KCA A;  4HDE A;  2GQM A;  2C80 A;  3HXS A;  1TKD B;  3NZN A;  3RAZ A;  1U6T A;  3TOT A;  3VI5 A;  1TTZ A;  2C3T A;  2H70 A;  4I97 A;  3KMN A;  3LG6 A;  2CV4 A;  2HRF A;  1VF1 A;  1QMV A;  4OO4 A;  2ZNM A;  2HSH A;  5DJM A;  2HYX A;  1MD3 A;  3L0H A;  1XVW A;  6GSW A;  5A4U A;  2H0G A;  3F3Q A;  2OAC A;  2R0P A;  1KBN A;  1M9A A;  4V2M A;  2LJA A;  2O85 A;  4X43 A;  2K8S A;  2JAC A;  1PA3 A;  4HU9 A;  3UBL A;  1GSS A;  1FG4 A;  4I6X A;  2KP2 A;  3GHA A;  1F6M C;  2VD0 A;  4IJ3 A;  4XRD A;  1QUW A;  1GTI A;  1BG5 A;  3FW2 A;  4MH2 A;  2GGT A;  4NHW A;  5J3R A;  3QFB C;  2OBI A;  5HR1 A;  1K3L A;  1TU7 A;  3WYW A;  1OKT A;  1PX6 A;  3GYK A;  6GST A;  1VRS D;  1VGL A;  1K0A A;  2VL2 A;  1EV4 A;  3KXO A;  4MF7 A;  4TW5 A;  1A2J A;  4ZL8 A;  4PQ1 A;  4TN8 A;  3MWH A;  1YQ1 A;  4TR0 A;  2FWG A;  3W8J A;  1JHB A;  1USB A;  3IRA A;  4YAP A;  3D22 A;  2J23 A;  1WJK A;  1V2A A;  3F63 A;  4IS0 A;  3TJK A;  1X9W B;  4GF0 A;  5DAL B;  1DSB A;  4FH8 A;  4K7I A;  3QAV A;  2VCV A;  5CP1 A;  3W6G A;  3GTU A;  2YWI A;  3R2Q A;  4YQM A;  2JZS A;  1OC3 A;  2CX4 A;  1SK1 A;  5HQP A;  4K2X A;  3QMX A;  3H4K A;  4PX1 A;  3IPZ A;  4QL9 A;  4EIQ A;  2X64 A;  4O5Q A;  2GT6 A;  4KE3 A;  5ELA A;  3FMW A;  3LYK A;  1DE1 A;  6GSS A;  4GQC A;  2TIR A;  2DJ0 A;  5G30 A;  2A4H A;  2H01 A;  4WBJ A;  2GLR A;  1THO A;  2XHF A;  1IYH A;  3PPU A;  1ZZY A;  1R26 A;  2IMF A;  3VWW A;  1M2B A;  1GUL A;  4NAX A;  1Y6E A;  2MBS A;  3WGX A;  4NWY A;  1JZR A;  1FOV A;  5INY A;  3ZLP A;  4ECC A;  2CZ2 A;  2IWT A;  3KP8 A;  3LQ7 A;  2VO4 A;  2CVD A;  1TK5 B;  4HU7 A;  3FEU A;  3TCO A;  1XW5 A;  5DVB A;  1ZYQ B;  4YAV A;  4OFT A;  5ECP B;  2CX3 A;  2R0G A;  4X0X A;  1XWK A;  5DCH A;  4USS A;  2H8L A;  2WS2 A;  4TKY A;  4BL7 A;  2ALB A;  4G2E A;  3FK8 A;  5E59 A;  1QXH A;  4GWR A;  5FWG A;  2LTK A;  4O92 A;  1BX9 A;  4X1U A;  9GSS A;  4J57 E;  1DBY A;  1T4Z A;  5ABR A;  1N8J A;  3TJG A;  3ZRD A;  4POK A;  2ZCT A;  2HXK A;  5IQY A;  3ZL5 A;  1IYI A;  3F9U A;  4BVY B;  2PUK C;  1AQX A;  4TVE A;  3ZVJ D;  3F4T A;  4XS4 B;  1O85 A;  4K0G A;  3TKS E;  5EPF A;  3KM6 A;  2IFQ A;  3FR9 A;  3DRN A;  2YCD A;  4XRA A;  4WF4 A;  4GSS A;  3L9S A;  1K0B A;  2H6Z A;  3HDC A;  2B7J A;  5HR0 A;  5DQY A;  2XBQ A;  3P2A A;  1URM A;  1KNG A;  3Q6O A;  4O5U A;  4K8M A;  1ML6 A;  2H0I A;  1M2A A;  5HFG A;  1YY7 A;  3GV1 A;  3FKF A;  2RII A;  5DDL A;  3UEM A;  1OAZ A;  2BMX A;  4ZB9 A;  4PNF A;  5DCG A;  5ECQ B;  2R0C A;  2YAN A;  2HZE B;  5F8B A;  3UIW A;  2LRN A;  2WDU A;  1YDK A;  2HZF A;  3LXT A;  4Z7X A;  4I2T A;  2GDR A;  5ECS A;  4EL1 A;  5IMD A;  2PVQ A;  3KD0 A;  3HCZ A;  2GST A;  3HZ8 A;  1YJ6 A;  2DJ2 A;  5IMV A;  4MCU A;  1A8Y A;  3RBT A;  3F4R A;  4RI6 A;  1AQW A;  5ID2 A;  1XOB A;  5ECL B;  2V1M A;  5IO2 A;  2JZR A;  2NTO A;  5CNW A;  4O32 A;  5ECN B;  3GH9 A;  3TRP A;  1GTB A;  4NHZ A;  4ACS A;  4EF0 A;  3TGZ A;  4KAE A;  3Q18 A;  2M80 A;  4BVX B;  5H5R A;  1KTE A;  1R4W A;  4DSQ A;  2M46 A;  4NV2 A;  4KA0 A;  3TJB A;  2LJR A;  1M0U A;  2R5G A;  13GS A;  3ZIJ A;  5F0G A;  1B4Q A;  2X8C A;  4ML1 A;  3W8S A;  1JLW A;  1GUH A;  3CTG A;  3J7Y b;  1NW2 A;  2H75 A;  3CRU A;  1HNB A;  2AHE A;  1FO5 A;  1M7T A;  2I81 A;  1TU8 A;  4EVM A;  4MZC A;  5F05 A;  3GMF A;  2P0G A;  2KOK A;  3FR6 A;  1ERW A;  3CYN A;  1TI3 A;  3NIV A;  3UBK A;  3F8U A;  1M99 A;  3HJO A;  3FY7 A;  4I8B A;  3N5O A;  3IC8 A;  2OE1 A;  4GLT A;  3CRT A;  3F4S A;  3ZFL A;  3H1N A;  1WOU A;  1HNC A;  5AIS A;  4HS1 A;  6GSX A;  4JZQ A;  5AGY A;  3UJ1 A;  4F9Z A;  3IOS A;  2BJX A;  4MJC A;  1AUC A;  4JU5 A;  5GSS A;  2FY6 A;  2C0D A;  4ICY A;  4TOP A;  3I43 A;  3D21 A;  3D0Z A;  4Z2T A;  1U87 A;  1F9M A;  4K5S A;  4E8H A;  2MYG A;  1K0O A;  2OA7 A;  3QR6 A;  1SJI A;  4MA9 A;  1FHE A;  4NXI A;  3TKP A;  1GNW A;  4LMV A;  1ON4 A;  2H74 A;  1YEX A;  3P7X A;  5G1L A;  5H5Q A;  4YKG A;  5ECK B;  4KH7 A;  1K0M A;  4OO5 A;  1SKS B;  3IAS 2;  2WCI A;  4EIP A;  2CAQ A;  3C71 A;  1ZYE A;  1QFN A;  2JU5 A;  3WT2 A;  3L9V A;  2WZ9 A;  2YJH A;  1OVN A;  2DSA A;  3G7I A;  3ZRE A;  1K0C A;  2E2G A;  5DAK A;  2XPD A;  3BOA A;  5ECR B;  2MMA A;  2H30 A;  2X4A A;  4IJI A;  2DMM A;  4AF2 A;  5A5K A;  3HA9 A;  2HSY A;  4K1F A;  2YWN A;  4G0I A;  4XTS A;  4L0W A;  3E0U A;  2LQQ A;  4IHU A;  1ZL9 A;  1XFL A;  2P31 A;  1SJZ A;  3RPN A;  1ERU A;  5KN2 A;  2K8V A;  2O8V B;  5JCG A;  3PR8 A;  4CDO A;  3DWV A;  3UAR A;  2CA8 A;  5KEJ A;  4D73 A;  1OYJ A;  2LEG A;  1K3O A;  1PN9 A;  2AUV A;  3VFI A;  1HD2 A;  1SK2 A;  4TR3 A;  4LL4 B;  2H1A A;  4HZ4 A;  2IME A;  1A0R P;  1TP9 A;  2L4Q A;  1PMT A;  2LV3 A;  4K2D A;  1PSQ A;  4V1A g;  3RPP A;  1ZCP A;  5F06 A;  5CRH A;  1Z3E A;  4MJA A;  1A2M A;  2FWH A;  4KX4 A;  4POL A;  1EV9 A;  2L5L A;  4CHS A;  3LWA A;  4V1A p;  3GTU B;  3I6A A;  3QOU A;  1GH2 A;  3Q19 A;  1X9M B;  2G2Q A;  4YQU A;  5A4V A;  2C3N A;  2LRT A;  3IHG A;  3GKN A;  3EU4 A;  5D9X A;  2QSI A;  1B8X A;  2IIY A;  5DJL A;  5ECH B;  2PU9 C;  18GS A;  4TRX A;  3P90 A;  4WF5 A;  1O8W A;  3HJM A;  4MLY A;  3FZ9 A;  4G0L A;  3US3 A;  3JCM L;  2OJL A;  4PTS A;  4GST A;  2HI7 A;  3KCM A;  1PGT A;  1EWX A;  5G5F A;  4OFN A;  3OR5 A;  1XBS A;  4FYC A;  2DJJ A;  5JWO B;  2PER A;  3E3E A;  4OFM A;  2MMO A;  4JED A;  4F2I A;  3O3T A;  4WR5 A;  2H71 A;  2R37 A;  2JL4 A;  3GKX A;  2VM2 A;  3MAK A;  3LSZ A;  2JSZ A;  2OE0 A;  2X8H A;  1SYR A;  5J9C A;  2F8F A;  5EL8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...