3EMXA

Crystal structure of thioredoxin from aeropyrum pernix
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
124
structure length
124
Chain Sequence
SLSYVKEGLAVLEDGRLIYITPEEFRQLLQGDAILAVYSKTCPHCHRDWPQLIQASKEVDVPIVMFIWGSLIGERELSAARLEMNKAGVEGTPTLVFYKEGRIVDKLVGATPWSLKVEKAREIY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords Thioredoxin
publication title Crystal structure of thioredoxin from Aeropyrum pernix
rcsb
source organism Aeropyrum pernix
total genus 42
structure length 124
sequence length 124
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3emxA00
5G2ZA 2VD1A 2HRFA 2JL4A 2YZHA 1EV4A 5CAXA 4GSSA 3ERWA 3UARA 3IV4A 3IAM2 3EC3A 1YEXA 4K0GA 1M2DA 4LA1A 1IYIA 2KP1A 2RM5A 1FOVA 2EIOA 3J7Yb 1F6MC 3VWVA 3LXTA 3BD2A 4ECBA 2NBSA 2J23A 5AISA 3D22A 4MMMA 3UJ1A 3CYNA 4G19A 2QKEA 1Z7PA 1B4PA 2H6ZA 1FB0A 5KN1A 5J3RA 1PA3A 3ZVJD 2RIIA 1AXDA 4TXOA 5FHIA 4O7HA 3M9JA 4V2LA 3VPQA 2CAQA 2VLUA 3LXZA 3H79A 5HFKA 1T4YA 5GSTA 2K18A 1E6BA 1GTIA 3VI5A 1ZCPA 3P7XA 3GV1A 5CRWA 5DQSA 1ZYEA 2REMA 1DE2A 3M8NA 4G9HA 2FY6A 3EE2A 4POKA 2WFCA 2WDUA 1G6YA 5AN1A 3BJ5A 1Z6NA 4N10A 3QCPA 4WKWA 4K7NA 1K3YA 3GKKA 3A3TA 4NV2A 2LNSA 2YV7A 3KZQA 3L9VA 1VF4A 1X5DA 4OWYA 4OCEA 5A5KA 4HOJA 2LJRA 3WT1A 4YAPA 3GNJA 1WP0A 1PRXA 2LRTA 17GSA 1TU7A 3I6AA 4TOPA 1EGOA 4O5RA 4Q5FA 3FZ5A 2CVBA 2YCDA 3TRQA 5JWRB 3QAWA 4XTSA 3C8EA 2P5RA 3ZREA 2PMTA 2CZ3A 2ALBA 2N5BA 2PUKC 2R2JA 1ST9A 3KMNA 5G5EA 5FT3A 3TRXA 4HUAA 1M7TA 2CA8A 4IJIA 5ECIB 2VCWA 1R4WA 1FAAA 3IE3A 2H0GA 2GSRA 2IN3A 3HJPA 3VWUA 5IMZA 5DVBA 2C0DA 3O6TA 1AW9A 5IPHA 1EEMA 3W8JA 5ABRA 3GIXA 1QUWA 2X64A 4L0WA 4ULXA 4Z7XA 3CSJA 3Q19A 4XRDA 3FW2A 3IOSA 2ZCTA 1FG4A 4TRXA 1WIKA 4V1Ap 5J9BA 4QL7A 1MDIA 1V9WA 4O92A 5DJMA 1SL0B 1GULA 3PINA 3I9V2 5IMFA 4XIHA 1YKAA 2CT6A 3F6FA 4MPGA 4D73B 2PWJA 3KIJA 3ERGA 3HZ8A 3TKRA 3D5JA 2P31A 3J7Yk 4MJCA 1GSDA 4BPYA 1B4QA 4KAEA 2QGVA 3SBCA 3TKQA 4MK3A 2L4CA 4JEDA 4IP6A 3LEFA 5IOXA 3TJKA 1EP8A 4PUAA 1TRVA 3S9FA 3KEBA 5ECRB 3U5RE 2VCXA 1QXHA 4ZB8A 4ZL8A 4MZCA 1Z5YE 4YAVA 2DC5A 1RQMA 2XBQA 4IKHA 5DBQA 1SK0A 4K7OA 2R5GA 1LBKA 3FEUA 4RI7A 2LTKA 1XOBA 2HNLA 1K0CA 5HFIA 3EINA 5B8AA 1F3AA 3DVXA 3AY8A 4PNGA 5LCZA 2M46A 1JZDA 1K0DA 2FD3A 2CX4A 4EO3A 2IMKA 1VF2A 3CSHA 4IQAA 4EDYA 4POMA 3M9KA 4Q5NA 3HKRA 1MDJA 4NHZA 3IBHA 3GA4A 2L57A 3KXOA 5E59A 1B9YC 3D4MA 5ECPB 1QFNA 3F0IA 1ABAA 2YJ7A 3KH9A 3HVXA 2C8UA 4HZ4A 2GSQA 5KEJA 1EZKA 3TOUA 3A2WA 2R6KA 2DMMA 5L71A 1YF0A 2OACA 3FYGA 2H1AA 4ML6A 2B7JA 2LQOA 3RPNA 3ISOA 1N2AA 5B7CA 5IMDA 5J9CA 1OKTA 4RI6A 1WPIA 1T1VA 1TK0B 1O81A 4HJMA 2KP2A 4ILFA 1M2BA 1JZWA 5HR2A 4JBBA 5F05A 1OC3A 5D73A 2YWMA 2G0FA 3ZIJA 3VLNA 1VGLA 2VCTA 4D73A 2PU9C 3FZAA 1X9WB 2L5OA 4MH2A 5G1KA 4CDOA 1A24A 1FW1A 2RUEA 2HZFA 1I5GA 5G31A 3TKSE 1TP9A 1R5AA 4L8EA 1DE1A 4WR5A 1ON4A 2IL3A 6GSXA 2IMFA 2AJQB 2B1LA 4GQFA 3KCMA 2LNTA 3KH7A 1EP7A 1V58A 3G7JA 3GFKA 1SKSB 3GKNA 4EE0A 4HS1A 3L4NA 2VL3A 2HFDA 2VL2C 3N9JA 5D9WA 4YQMA 2GS3A 3M0FA 5A4UA 3ZFBA 3LWAA 2XPEA 4N0VA 2JZSA 5ECQB 3M3MA 19GSA 1UN2A 1PX6A 4AJ7A 5CYYA 5IMCA 3IPZA 1GWCA 2DJKA 3FR9A 1MD4A 6GSUA 1A2JA 3BCIA 1JLVA 2GT6A 3WYWA 1KEBA 3TKSA 1WJKA 3TUEA 3ME8A 3IHQA 1A2MA 3TJJA 1IYHA 3P90A 1BYEA 4J2FA 3RHBA 1U3IA 3G7YA 2FUG2 2Z9SA 2ZUPA 5H5SA 5GAPD 1WE0A 1XOAA 3QAGA 1SK1A 4PNFA 3QMXA 1TRUA 1FO5A 4ID0A 4KCAA 2LUSA 1SD8A 1EV9A 1R5PA 2CZ2A 3I43A 1GNWA 2OA7A 2WGRA 5B8BA 1QGVA 3EURA 4JR6A 2LQQA 4MJBA 1MEKA 4EVMA 2TRXA 4G10A 1AQVA 2H66A 4I2TA 1NHYA 2YP6A 1XIYA 3GMFA 2H6YA 1XXUA 1AQWA 6GSTA 5GSSA 4TN8A 1XW6A 6GSSA 1XWBA 5B6MA 3PH9A 1GLQA 2XC2A 4OO5A 2H30A 1WWJA 4IQ1A 4NAXA 5A4WA 5J5NA 2C3TA 4EC0A 1USBA 2NTOA 3ZTLA 2HLSA 4WXTA 5ELAA 4H86A 2FA8A 3VK9A 3KJYA 4OD7A 1PQNA 4YQUA 13GSA 4ZL9A 4JRRA 6GSWA 1VF3A 3HJOA 5LD0A 2H74A 1PN9A 5J41A 22GSA 4JZQA 1HQOA 4OO4A 2O87A 1XVQA 5JWQB 4ISDA 2WCIA 1U3AA 4GF0A 5C00A 1ERTA 3FKFA 3P2AA 1HNBA 2AHEA 3LYPA 5IMVA 1YJ6A 2YANA 4WF4A 3RPPA 2V32A 4DVCA 1B8XA 3F3QA 4XS6A 1DSBA 14GSA 4POBA 3NZNA 3ME7A 2DIZA 4K7IA 4TR4A 5IM9A 2YWNA 4TKYA 2HRNA 4TR1B 3VWWA 4ACSA 5DDLA 1QMVA 5IQYA 3C71A 4G2EA 1PD21 2VCVA 3ZZXA 2BTOT 1R7HA 5CRDA 2BJXA 5IO0A 3K8NA 1N8JA 3NOFA 3CRUA 3ZLPA 2MYGA 1O73A 3HD5A 2WJUA 5IOWA 3TJGA 2WULA 3RHCA 3RDWA 2VOCA 1TK8B 4AF2A 3F3RA 1SL2B 1TU8A 1GUHA 2NPBA 2RUFA 1TW9A 4KSMA 2VLVA 5JCUA 3TJBA 3UIWA 4F82A 1U88A 4ZXGA 2C0FA 8GSSA 2MBSA 1V40A 1JLWA 4BA7A 3LQ7A 1ZOFA 3JCML 1F9MA 3US3A 2E7PA 2A2RA 3F8UA 1U6TA 1NHOA 1SU9A 2JSZA 4X43A 1T00A 3ZVJA 1F37A 1G7OA 1SKRB 4WF5A 2B5YA 4X0XA 2C80A 1LU4A 1AC1A 1M2AA 4GWRA 4MH3A 4JU5A 5C04A 2ON5A 1DUGA 3UBKA 4PQHA 1YQ1A 1XWCA 2L59A 1ZGNA 1TDIA 5CREA 4ZB9A 3CRTA 3UL3A 4POLA 1THOA 1PL2A 1XWAA 3N5OA 4ZB6A 2ON7A 2LKUA 3GX0A 1OC8A 3TJFA 4OFTA 1BQ7A 4HQZA 1TOFA 3TRPA 4MDCA 2E2MA 3HVSA 3FHKA 2B5EA 5KN3A 2DJJA 3QD9A 2O85A 1MDKA 1J9BA 1AQXA 1O8WA 2AUVA 3QPMA 3CBUA 3ZIVA 1OYJA 1A8LA 3VURA 4GRFA 3RBTA 2FLSA 2DJ2A 2JZRA 5EY6A 3UVTA 4FIWA 4Q5RA 1VRSD 2MMAA 2VLTA 4K8MA 5COHA 4MPFA 2CV4A 2FGXA 1XZOA 1AAZA 1MTCA 2CVDA 5ECMB 2LRCA 2GZYA 1RK4A 4PUFC 4DSSB 1VF1A 1W4VA 1EGRA 3VPTA 4PURA 4TR1A 3QOUA 4KDYA 2XPDA 3F4RA 3DRNA 2DJ1A 5CP1A 1XPVA 5H5RA 3W8SA 4IW9A 3NIVA 2GSSA 4AJ6A 4WETA 1ERUA 2H73A 2B6MA 2DLXA 4KB3A 4QL9A 2K8VA 2X8GA 4K2DA 2PPTA 4E8EA 3I69A 2H6XA 4TVEA 2DMLA 1THXA 2AYTA 5ECNB 2X8CA 1V57A 4MJEA 1X0RA 2VM2A 1GTUA 3ZFLA 2JADA 3G9BA 5IMAA 3IK9A 1GTAA 2YJHA 1M99A 5F0GA 1A2LA 1JZOA 2IMIA 2H72A 2IIYA 2R37A 4XHMA 3CXGA 16GSA 3A5WA 1PGTA 2RLIA 4GTUA 3QFBC 1WOUA 4F2IA 4O32A 2TIRA 2HXKA 1ML6A 5ECSA 1JZRA 3GL5A 3F9UA 2O89A 3WD6A 4WEYA 2BMXA 1M9AA 4NHWA 5F06A 3H1NA 3LGCA 2GZZA 1DBYA 2EC4A 3LFLA 3PGTA 4TR0A 5GZZB 4TR3A 3QR6A 2GLRA 4V1Ag 2H0IA 6GSVA 3WGEA 2O7KA 1URMA 4GXZA 2NVLA 1XVWA 3BOAA 3W6GA 3BCKA 3HXSA 4N30A 3F4SA 3HA9A 1GSSA 4L5LA 4OCFA 1Y6EA 2O8VB 2QC7A 2QSIA 4PXOA 4KH7A 3P8WA 4IBPA 2H76A 3WT2A 3IK7A 5LNKe 4Q5QA 3GYKA 5J4UA 3C1RA 3GX8A 4F0CA 2B7KA 2H1GA 3KP8A 4DSSA 2DBCA 3IRAA 2OE0A 3VI7A 4ECIA 4FH8A 1NW2A 1F2EA 1PX7A 4WBRD 4CW9A 2V41A 1R26A 1TI3A 3TKSC 1FHEA 3M1GA 5JWOB 1J08A 3TKPA 4KSOA 3QDNA 5INYA 3Q6OA 1ZMAA 2AB6A 4I8BA 1OVNA 3DWVA 2FNOA 2H0HA 5HR1A 5F8BA 3CTFA 2P0GA 2IFQB 2DIYA 4EDZA 1YF1A 1E2YA 1NSWA 3FR6A 3GHAA 1TKDB 2H70A 1BAYA 4ZBDA 3HYPA 2PBJA 4EF0A 2OBKA 3UBLA 1X5EA 4NWYA 4BL7A 1G7EA 3EVIA 3HZ4A 1GSQA 2KHPA 4FYCA 2YNXA 3KM6A 4WBJA 3QFAC 4XS4B 6GSYA 2OADA 1F3BA 2FCHA 1TI1A 3ZYWA 1A0FA 3D6IA 5HFGA 4N11A 1WMJA 2VM1A 4I6XA 5G30A 2A4VA 1PL1A 2AAWA 18GSA 4MLYA 2LEGA 3CTGA 2B5XA 2R4VA 4HQSA 3IAS2 2NDOA 2CAIA 2LJKA 2YOIA 2MZCA 5G5FA 4IP1A 2JU5A 2HSHA 4HEA2 5IO2A 3O76A 3V1WA 1OC9B 1GUKA 1HNAA 5D96A 2IWTA 2JSYA 4N0ZA 1SKWB 5HQPA 1OE8A 4FYUA 4HI7A 4MF6A 4KCEA 3KTBA 4E8HA 1K3LA 2PERA 3TCOA 1CQHA 4NPBA 1YZXA 1XW9A 3H8QA 1K0BA 1GNEA 2C0GA 2CVKA 3GN3A 12GSA 1EEJA 2IPAA 3L78A 2H75A 3C7MA 4LL1B 4V2MA 1C72A 2H19A 3IC4A 2TRCP 3ZRDA 2ES7A 7GSSA 1O85A 1K0NA 1V98A 2FHEA 1HYUA 2GSTA 3ZMKA 3KTLA 5CO3A 2GGTA 2IJYA 1GLPA 1TTZA 2MMNA 4KW6A 3VFIA 1UVZA 3HY2A 4OFMA 2FWGA 5H5QA 1Z7RA 3D4TA 2GDRA 5DJLA 3CSIA 2K8SA 3C73A 2C0EA 1T7PB 1K0MA 1LJRA 1XWKA 3HDCA 2K9FA 2JACA 4FYBA 4AJ8A 1RW1A 1NM3A 4GSNA 2D2ZA 1GRXA 5E4WA 4ZBAA 5ID2B 4J56E 1TK5B 2CQ9A 4WR4A 5A4VA 4IVFA 3UEMA 4RUVA 2MBTA 3FZ9A 1KTEA 1XCCA 1GSEA 4YH2A 3EYTA 1G6WA 2IFQA 1W89A 1ZYQB 4GLTA 3UOMA 1ACVA 3LYKA 5ELGA 1FVKA 2VAFA 3HJMA 4TW5A 2C3QA 5AIVA 3UMAA 1GP1A 1BX9A 1O8XA 1JHBA 4K6XA 4ZBBA 2OBIA 4PX1A 2I9HA 4XS4A 1SL1B 2F9SA 1GTBA 2KUCA 3EWLA 2XHFA 2YWOA 4DSRA 4KDXA 2B1KA 2LSTA 3KMOA 4KNDA 2VIMA 2GVPA 4DSQA 1XWGA 2AV4A 3DMLA 4XRAA 1Z3EA 2CX3A 4ZL7A 4HJ2A 3HCZA 2V6KA 2H71A 1GH2A 4L5OA 3LJRA 4IN0A 2C3NA 3GUSA 1I9DA 3ZITA 1OC9A 4EUYA 3DD3A 3L0HA 2J9HA 1ERVA 3APOA 3IDVA 4EXJA 2E2GA 2DJ3A 2GQKA 2LJAA 5GAND 4ML1A 3GTUB 2VCQA 2GT5A 3MWHA 1CQGA 2WS2A 1ERWA 1YKCA 4I2UA 4KX4A 5IPGA 2WRTA 3E0UA 1M0UA 2YZUA 2H01A 4K1FA 2L5LA 3DXBA 3DEXA 3GKXA 2H8LA 3TGZA 1EWXA 2I81A 1SYRA 4KDUA 2GTUA 2F51A 3KGKA 4MABA 1S3CA 5DAKB 4PQ1A 3LG6A 4MF5A 1TJDA 1K0OA 1TRWA 3MSZA 2LV3A 1T3BA 4HZ2A 4EKZA 2VL9A 1SENA 4ECCA 1FVJA 2L6DA 3HVVA 5JCGA 3UAPA 5IIZA 3ZMLA 3FK8A 4GSTA 1KBNA 2P5QA 5CNWA 1YEPA 3TB2A 1MD3A 5ID2A 1TRSA 4JR4A 3ERFA 3UVHA 5HR3A 3GSSA 4KA0A 4AGSA 3RAZA 2FA4A 2GQLA 3F6DA 2X99A 4IGJA 2IMEA 4LL4B 9GSSA 1GUMA 2OJLA 5B6NA 1BJXA 3LSZA 2X8HA 2K6VA 1H4OA 2HZEB 4LMWA 1PKWA 3BBYA 1ZZYA 4CHSA 4GQCA 1SK2A 2EIRA 10GSA 1EOHA 2F8FA 2I4AA 1XFLA 3GRXA 1EOGA 1SJZA 4NMUA 1UC7A 1XBSA 4F03A 3C1SA 5DQYA 1K0AA 1GL8A 1Q98A 2G2QA 2YV9A 4RQXA 2YPMA 5CRHA 3EMXA 4XS1A 3GURA 2VD0A 5D9VA 3CMIA 2DSAA 4ECJA 4MZWA 3F63A 4F0BA 3L9UA 2MMOA 2A2SA 5D8IA 4V2NA 3WGDA 1BG5A 4P3YB 5EL8A 2YWIA 4MA9A 4I5QA 2FWHA 5F07A 2IMDA 2VCZA 5CRGA 1S3DA 2HI7A 3GTUA 1A8YA 1GSYA 4MJAA 1Z9HA 5AGYA 4NXIA 2HE3A 3DGQA 1J0FA 1GSUA 4OMVA 3KP9A 5EPFA 1HNCA 4HU7A 3PR8A 3VWXA 2LS5A 3EMPA 2M80A 1X9MB 5KN0A 3WGXA 4MCUA 3DIEA 1H75A 1OKDA 2WZ9A 3IXRA 2H1BA 4MF7A 2FWEA 1QK8A 5DAKA 2PVOC 2XBIA 4FO5A 1FB6A 4LMVA 4L0UA 3Q74A 5ECLB 2F8AA 2L6CA 1SJIA 5DALB 4DEJA 2KLXA 5DCHA 1Q4JA 3HHVA 5KN2A 5ECHB 3MNGA 2E0QA 1ZL9A 2C1YA 3LORA 2M72A 5AIXA 2JZTA 1PMTA 5G1LA 1A0RP 3ZL5A 4JE1A 2WB9A 2DJ0A 3SWLA 3OR5A 4IELA 2PVQA 2HYXA 2F3MA 3D21A 4K9ZA 1V2AA 1JFUA 1B48A 2OKAA 4RQRA 3KD0A 3GL3A 1O6JA 3Q18A 1PSQA 4TXVA 2PN8A 1B9XC 4OFNA 4YQVA 2V6OA 3L9SA 1SJ6A 3E3EA 2VUPA 1AIUA 3H4KA 1HD2A 1ILOA 3IA1A 4MP4A 4F9ZA 5DCGA 2HZEA 4IHUA 4EL1A 2I3YA 1PKZA 2MMZA 1SD9A 4KUNA 4NV5A 5D93A 3TDGA 1TXXA 2C4JA 1XW5A 4PQIA 3G7IA 3QAVA 4GCIA 5ENUA 3U6VA 2PGTA 2I1UA 3D0ZA 1T8EB 2HT9A 2OE3A 1WRYA 1X9SB 3O3TA 4BVXA 1OE7A 1KNGA 3EU3A 2H1DA 3FR3A 3MAKA 1Y25A 5EVOA 2B3SA 3MDKA 4X1UA 3A2XA 4XCSA 4BWQA 4MZBA 20GSA 5ECOB 4BVYA 4TXOB 3F4TA 1X5CA 2L4QA 1GSFA 4HDEA 1YY7A 3GKMA 1M9BA 4LLRA 3E9JB 3FRCA 1K3OA 1S3AA 3A2VA 1AUCA 3EU4A 3GH9A 3GH6A 3GSTA 3FY7A 4QQ7A 3IR4A 4I97A 1G0TA 2FWFA 3DVWA 2VL2A 2LRNA 3ED3A 3FZ4A 4BWSA 1O7UA 4KE3A 4IS0A 2GQMA 5HR0A 1Z6MA 4K0NA 3H93A 1BEDA 5ECKB 2VO4A 1U87A 2ZNMA 3R2QA 4ZIJA 3APSA 11GSA 2R3XA 4IJ3A 1UA5A 4PGTA 2V1MA 5FWGA 2GZPA 2YN1A 5D9TA 5DALA 4KGIA 1OAZA 1A23A 1SYXA 1YDKA 4ZILA 5JCWA 2KOKA 4J57E 5D9XA 3APQA 2N5FA 1QQ2A 2V2GA 2HSYA 1T4ZA 3DKSA 3TOTA 2EIQA 4HU9A 2RM6A 2OE1A 2N5AA 3DYRA
chains in the Genus database with same CATH superfamily
5G2ZA 2VD1A 2HRFA 2JL4A 2YZHA 1EV4A 5CAXA 4GSSA 3ERWA 3UARA 3IV4A 3IAM2 3EC3A 1YEXA 4K0GA 1M2DA 4LA1A 1IYIA 2KP1A 2RM5A 1FOVA 2EIOA 3J7Yb 1F6MC 3VWVA 3LXTA 4CY8A 3BD2A 4ECBA 4HSCX 2NBSA 2J23A 5AISA 3D22A 4ICYA 4MMMA 3UJ1A 3CYNA 4G19A 2QKEA 1Z7PA 1B4PA 4A5PA 2H6ZA 1FB0A 5KN1A 5J3RA 1PA3A 2QA2A 3ZVJD 2RIIA 1AXDA 4TXOA 5FHIA 4O7HA 3M9JA 4V2LA 3VPQA 2CAQA 2VLUA 3LXZA 3H79A 5HFKA 1T4YA 5GSTA 2K18A 1E6BA 1M3JA 1GTIA 3VI5A 1ZCPA 3P7XA 3GV1A 5CRWA 5DQSA 1ZYEA 2REMA 1DE2A 3M8NA 4G9HA 2FY6A 3EE2A 4POKA 2WFCA 2WDUA 1G6YA 5AN1A 3BJ5A 1Z6NA 4N10A 3QCPA 4WKWA 4K7NA 1K3YA 3GKKA 3A3TA 4NV2A 2LNSA 2YV7A 3KZQA 3L9VA 1VF4A 1X5DA 4OWYA 4OCEA 5A5KA 4HOJA 2LJRA 3WT1A 4YAPA 3GNJA 1WP0A 1PRXA 1ZYNA 2LRTA 17GSA 1TU7A 3I6AA 4TOPA 1EGOA 4O5RA 4Q5FA 3FZ5A 2CVBA 2YCDA 3TRQA 5JWRB 3QAWA 4XTSA 3C8EA 2P5RA 3ZREA 2PMTA 2CZ3A 2ALBA 2N5BA 2PUKC 2R2JA 1ST9A 3KMNA 5G5EA 5BMUA 5FT3A 3TRXA 4HUAA 1M7TA 2CA8A 4IJIA 5ECIB 2VCWA 1R4WA 1FAAA 3IE3A 2H0GA 2GSRA 2IN3A 3HJPA 3VWUA 5IMZA 5DVBA 2C0DA 3O6TA 1AW9A 5IPHA 1EEMA 3W8JA 5ABRA 3GIXA 1QUWA 2X64A 4L0WA 4ULXA 1XG8A 4Z7XA 3CSJA 3Q19A 4G0LA 4XRDA 3FW2A 3IOSA 2ZCTA 1FG4A 4TRXA 1WIKA 4V1Ap 5J9BA 4QL7A 1MDIA 1V9WA 4O92A 5DJMA 1SL0B 1GULA 3PINA 3I9V2 5IMFA 4XIHA 1YKAA 2CT6A 3F6FA 4MPGA 4D73B 2PWJA 3KIJA 3ERGA 3HZ8A 3TKRA 3D5JA 2P31A 3J7Yk 4MJCA 1GSDA 4BPYA 1B4QA 4KAEA 2QGVA 3SBCA 3TKQA 4MK3A 2L4CA 4JEDA 1PFOA 4G0KA 4IP6A 3LEFA 5IOXA 3TJKA 1EP8A 4PUAA 1TRVA 3S9FA 3KEBA 5ECRB 3U5RE 2VCXA 1QXHA 4ZB8A 4ZL8A 4MZCA 1Z5YE 4YAVA 2DC5A 1RQMA 2XBQA 4IKHA 5DBQA 1SK0A 4K7OA 2R5GA 1LBKA 3FEUA 4RI7A 2LTKA 1XOBA 2HNLA 1K0CA 5HFIA 3EINA 5B8AA 1F3AA 3DVXA 3AY8A 4PNGA 5LCZA 2M46A 1JZDA 1K0DA 2FD3A 2CX4A 4EO3A 2IMKA 1VF2A 3CSHA 4IQAA 4EDYA 4POMA 3M9KA 4Q5NA 3HKRA 1MDJA 4NHZA 3IBHA 3GA4A 2L57A 3KXOA 5E59A 1B9YC 3D4MA 5ECPB 1QFNA 3F0IA 1ABAA 2YJ7A 3KH9A 3HVXA 2C8UA 4HZ4A 2GSQA 5KEJA 1EZKA 3TOUA 3A2WA 2R6KA 2DMMA 5L71A 1YF0A 2OACA 3FYGA 2H1AA 4ML6A 2B7JA 2LQOA 3RPNA 3ISOA 1N2AA 5B7CA 5IMDA 5J9CA 1OKTA 4RI6A 1WPIA 1T1VA 1TK0B 1O81A 4HJMA 2KP2A 4ILFA 1M2BA 1JZWA 2R0GA 5HR2A 4Z2UA 4JBBA 5F05A 1OC3A 5D73A 2YWMA 2G0FA 3ZIJA 3VLNA 1VGLA 2VCTA 4D73A 2PU9C 3FZAA 1X9WB 2L5OA 4MH2A 5G1KA 4CDOA 1A24A 1FW1A 2RUEA 2HZFA 1I5GA 5G31A 3TKSE 1TP9A 1R5AA 4L8EA 1DE1A 4WR5A 4Z2TA 1ON4A 2IL3A 6GSXA 2IMFA 2AJQB 2B1LA 4GQFA 4MNNA 3KCMA 2LNTA 3KH7A 4PTSA 1EP7A 1V58A 3G7JA 3GFKA 1SKSB 3GKNA 4EE0A 4HS1A 3L4NA 2VL3A 3LW9A 2HFDA 2VL2C 3N9JA 5D9WA 4YQMA 2GS3A 3M0FA 5A4UA 3ZFBA 3LWAA 2XPEA 4N0VA 2JZSA 5ECQB 3M3MA 19GSA 1UN2A 1PX6A 2X4AA 4AJ7A 5CYYA 5IMCA 3IPZA 1GWCA 2DJKA 3FR9A 1MD4A 6GSUA 1A2JA 3BCIA 1JLVA 2GT6A 3WYWA 1KEBA 3TKSA 1WJKA 3TUEA 3ME8A 3IHQA 1A2MA 3TJJA 1IYHA 3P90A 1BYEA 4J2FA 3RHBA 1U3IA 3G7YA 2FUG2 2Z9SA 2ZUPA 5H5SA 5GAPD 1WE0A 1XOAA 3QAGA 1SK1A 4PNFA 3QMXA 1TRUA 1FO5A 4ID0A 4KCAA 2LUSA 1SD8A 1EV9A 1R5PA 2CZ2A 4K2XA 3I43A 1GNWA 2OA7A 2WGRA 5B8BA 1QGVA 3EURA 4JR6A 2LQQA 4MJBA 1MEKA 4EVMA 2TRXA 4G10A 1AQVA 2H66A 4EIQA 4I2TA 1NHYA 2YP6A 1XIYA 3GMFA 2H6YA 4Z2RA 1XXUA 1AQWA 3IHGA 6GSTA 5GSSA 4TN8A 1XW6A 6GSSA 1XWBA 4FQUA 5B6MA 3PH9A 1GLQA 2XC2A 4OO5A 2H30A 1WWJA 4IQ1A 4NAXA 5A4WA 5J5NA 2C3TA 4EC0A 1USBA 2NTOA 3ZTLA 2HLSA 4WXTA 5ELAA 4H86A 2FA8A 3VK9A 3KJYA 4OD7A 1PQNA 4YQUA 13GSA 4ZL9A 4JRRA 6GSWA 1VF3A 3HJOA 5LD0A 2H74A 1PN9A 5J41A 22GSA 4JZQA 1HQOA 4OO4A 2O87A 1XVQA 5JWQB 4ISDA 2WCIA 1U3AA 4GF0A 5C00A 1ERTA 3R3EA 3FKFA 3P2AA 1HNBA 2AHEA 3LYPA 5IMVA 1YJ6A 2YANA 4WF4A 3RPPA 2V32A 4DVCA 1B8XA 1ZYPA 3F3QA 4XS6A 1DSBA 14GSA 4POBA 3NZNA 3ME7A 2DIZA 4K7IA 4TR4A 5IM9A 2YWNA 4TKYA 2HRNA 4TR1B 3VWWA 4ACSA 5DDLA 1QMVA 4YKGA 3C71A 5IQYA 4G2EA 1PD21 2VCVA 3ZZXA 2BTOT 1R7HA 5CRDA 2BJXA 5IO0A 3K8NA 1N8JA 3NOFA 3CRUA 3ZLPA 2MYGA 1O73A 3HD5A 2WJUA 5IOWA 3TJGA 2WULA 3RHCA 3RDWA 2VOCA 1TK8B 4AF2A 3F3RA 1SL2B 1TU8A 1GUHA 2NPBA 2RUFA 1TW9A 4KSMA 4BIKA 2VLVA 5JCUA 3TJBA 3UIWA 4F82A 1U88A 4ZXGA 2C0FA 8GSSA 2MBSA 1V40A 1JLWA 4BA7A 3LQ7A 1ZOFA 3JCML 1F9MA 3US3A 2E7PA 2A2RA 3F8UA 1U6TA 1NHOA 1SU9A 2JSZA 4X43A 1T00A 3ZVJA 1F37A 4USSA 1G7OA 1SKRB 4WF5A 2B5YA 4X0XA 2C80A 1LU4A 1AC1A 1M2AA 4GWRA 4MH3A 4JU5A 5C04A 2ON5A 1DUGA 3UBKA 4PQHA 1YQ1A 1XWCA 2L59A 1ZGNA 1TDIA 5CREA 4ZB9A 3CRTA 3UL3A 4POLA 1THOA 1PL2A 1XWAA 3N5OA 4ZB6A 2ON7A 2LKUA 3GX0A 1OC8A 3TJFA 4OFTA 1BQ7A 4HQZA 1TOFA 3TRPA 4MDCA 2E2MA 3HVSA 3FHKA 2B5EA 5KN3A 2DJJA 3QD9A 2O85A 1MDKA 1J9BA 1AQXA 1O8WA 2AUVA 3QPMA 3CBUA 3ZIVA 1OYJA 1A8LA 2A2PA 3VURA 4GRFA 3RBTA 2FLSA 2DJ2A 2JZRA 5EY6A 3UVTA 4FIWA 4Q5RA 1VRSD 2MMAA 2VLTA 4K8MA 5COHA 4MPFA 2CV4A 2FGXA 1XZOA 1AAZA 5KOXA 1MTCA 2CVDA 5ECMB 2LRCA 2GZYA 1RK4A 4PUFC 4DSSB 1VF1A 1W4VA 1EGRA 3VPTA 4PURA 4TR1A 3QOUA 4KDYA 2XPDA 3F4RA 3DRNA 2DJ1A 5CP1A 1XPVA 5H5RA 3W8SA 4IW9A 3NIVA 2GSSA 1PN0A 2HRAA 4CY6A 1M3IA 4AJ6A 4WETA 1ERUA 2H73A 2B6MA 2DLXA 4KB3A 2UZ8A 4QL9A 2K8VA 2X8GA 4K2DA 2PPTA 4E8EA 3I69A 2H6XA 4TVEA 4O5QA 2DMLA 1THXA 2AYTA 5ECNB 2X8CA 4BL7B 1V57A 4MJEA 1X0RA 2VM2A 1GTUA 3ZFLA 2JADA 3G9BA 5IMAA 3IK9A 1GTAA 2YJHA 1M99A 5F0GA 1A2LA 1JZOA 2IMIA 2H72A 2IIYA 2R37A 4XHMA 3CXGA 16GSA 3A5WA 1PGTA 2RLIA 4GTUA 2HRKA 3QFBC 1WOUA 4F2IA 4O32A 2TIRA 2HXKA 1ML6A 5ECSA 1JZRA 3GL5A 3F9UA 2O89A 3PPUA 3WD6A 4WEYA 2BMXA 1M9AA 4NHWA 5F06A 3H1NA 3LGCA 2GZZA 1DBYA 2EC4A 3LFLA 3PGTA 4TR0A 5GZZB 4TR3A 3QR6A 2GLRA 4V1Ag 2H0IA 6GSVA 3WGEA 2O7KA 1URMA 4GXZA 2NVLA 1XVWA 3BOAA 3W6GA 3BCKA 3HXSA 4N30A 3F4SA 3HA9A 1GSSA 4L5LA 4OCFA 1Y6EA 2O8VB 2QC7A 2QSIA 4PXOA 4KH7A 3P8WA 4IBPA 5KOWA 2H76A 3WT2A 3IK7A 5LNKe 4Q5QA 3GYKA 5J4UA 3C1RA 3GX8A 4F0CA 2B7KA 2H1GA 3KP8A 4DSSA 2DBCA 3IRAA 1S3RA 2OE0A 3VI7A 4ECIA 4FH8A 1NW2A 1F2EA 1PX7A 4WBRD 4CW9A 2V41A 1R26A 1TI3A 3TKSC 1FHEA 3M1GA 5JWOB 1J08A 3TKPA 4KSOA 3HVNA 3QDNA 5INYA 3Q6OA 1ZMAA 2AB6A 4I8BA 1OVNA 3DWVA 2FNOA 2H0HA 5HR1A 5F8BA 3CTFA 2P0GA 2IFQB 2DIYA 4EDZA 1YF1A 1E2YA 1NSWA 3FR6A 3GHAA 1TKDB 2H70A 1BAYA 4ZBDA 3HYPA 2PBJA 4EF0A 2OBKA 3UBLA 1X5EA 4NWYA 4BL7A 1G7EA 3EVIA 3HZ4A 1GSQA 2KHPA 4FYCA 2YNXA 3KM6A 4WBJA 3QFAC 4XS4B 6GSYA 2OADA 1F3BA 2FCHA 1TI1A 3ZYWA 1A0FA 3D6IA 5HFGA 4N11A 1WMJA 2VM1A 4I6XA 5G30A 2A4VA 1PL1A 2AAWA 18GSA 4MLYA 2LEGA 3CTGA 2B5XA 2R4VA 4HQSA 1FOHA 3IAS2 2NDOA 2CAIA 4O5UA 2LJKA 2YOIA 2MZCA 5G5FA 4IP1A 2JU5A 2HSHA 4HEA2 5IO2A 3O76A 3V1WA 1OC9B 1GUKA 1HNAA 5D96A 2IWTA 2JSYA 4N0ZA 1SKWB 5HQPA 1OE8A 4FYUA 2DKIA 4HI7A 4MF6A 4KCEA 3KTBA 4E8HA 1K3LA 2PERA 3TCOA 1CQHA 4NPBA 1YZXA 1XW9A 3H8QA 1K0BA 1GNEA 2C0GA 2CVKA 3GN3A 12GSA 1EEJA 2IPAA 3L78A 2H75A 3C7MA 4LL1B 4V2MA 1C72A 2H19A 3IC4A 2TRCP 3ZRDA 2ES7A 7GSSA 1O85A 1K0NA 1V98A 2FHEA 1HYUA 2GSTA 3ZMKA 3KTLA 5CO3A 2GGTA 2IJYA 1GLPA 1TTZA 2MMNA 4KW6A 3VFIA 1UVZA 3HY2A 4OFMA 2FWGA 5H5QA 1Z7RA 3D4TA 2GDRA 5DJLA 3CSIA 2K8SA 3C73A 2C0EA 1T7PB 1K0MA 1LJRA 1XWKA 3HDCA 2K9FA 2JACA 4FYBA 4AJ8A 1RW1A 1NM3A 4GSNA 2D2ZA 1GRXA 5E4WA 4ZBAA 5ID2B 4J56E 1TK5B 2CQ9A 4WR4A 5A4VA 4IVFA 3UEMA 4RUVA 2MBTA 3FZ9A 1KTEA 1XCCA 1GSEA 4YH2A 3EYTA 1G6WA 2IFQA 1W89A 1ZYQB 4GLTA 3MIXA 3UOMA 1ACVA 3LYKA 5ELGA 1FVKA 2VAFA 3HJMA 4TW5A 2C3QA 5AIVA 3UMAA 1GP1A 3MYDA 1BX9A 1O8XA 1JHBA 4K6XA 4ZBBA 2OBIA 4PX1A 2I9HA 4XS4A 1SL1B 2F9SA 1GTBA 2HSMA 2KUCA 3EWLA 2XHFA 2YWOA 4DSRA 4KDXA 2B1KA 2LSTA 3KMOA 4KNDA 2VIMA 2GVPA 4DSQA 1XWGA 2AV4A 3DMLA 4XRAA 1Z3EA 2CX3A 4ZL7A 4HJ2A 3HCZA 2V6KA 2H71A 1GH2A 4KF9A 4L5OA 3LJRA 4IN0A 2R0PA 2C3NA 3GUSA 1I9DA 2A4HA 3ZITA 1OC9A 4EUYA 3DD3A 5BRTA 3L0HA 4K5SA 2J9HA 1ERVA 3APOA 3IDVA 4X4JA 4EXJA 2E2GA 2DJ3A 2GQKA 2LJAA 5GAND 4ML1A 3GTUB 2VCQA 2GT5A 3MWHA 1CQGA 2WS2A 1ERWA 1YKCA 4I2UA 4KX4A 5IPGA 2WRTA 3E0UA 1M0UA 2YZUA 2H01A 4K1FA 2L5LA 3DXBA 3DEXA 3GKXA 2H8LA 3TGZA 1EWXA 2I81A 1SYRA 4KDUA 2GTUA 2F51A 3KGKA 4MABA 1S3CA 5DAKB 4PQ1A 3LG6A 4MF5A 1TJDA 1K0OA 1TRWA 3MSZA 2LV3A 1T3BA 4HZ2A 4EKZA 2VL9A 1SENA 4ECCA 1FVJA 2L6DA 3HVVA 5JCGA 3UAPA 5IIZA 3ZMLA 3FK8A 3FMWA 4GSTA 1KBNA 2P5QA 5CNWA 1YEPA 3TB2A 1MD3A 5ID2A 1TRSA 4JR4A 3ERFA 3UVHA 5HR3A 3GSSA 4KA0A 4AGSA 3RAZA 2FA4A 2GQLA 3F6DA 2X99A 4IGJA 2IMEA 4LL4B 9GSSA 1GUMA 2OJLA 5B6NA 1BJXA 3LSZA 2X8HA 2K6VA 1H4OA 2HZEB 4LMWA 1PKWA 3BBYA 1ZZYA 4CHSA 4GQCA 1SK2A 3IC8A 2EIRA 2QA1A 10GSA 1EOHA 2F8FA 2I4AA 1XFLA 3GRXA 1EOGA 1SJZA 4NMUA 1UC7A 1XBSA 4F03A 4G0IA 3C1SA 5DQYA 1K0AA 1GL8A 1Q98A 2G2QA 4BVXB 2YV9A 4RQXA 2YPMA 5CRHA 3EMXA 4XS1A 3GURA 2VD0A 5D9VA 3CMIA 4BVYB 2DSAA 4ECJA 4MZWA 3F63A 4F0BA 3L9UA 2MMOA 2A2SA 5D8IA 4V2NA 3WGDA 1BG5A 4P3YB 5EL8A 2YWIA 4MA9A 4I5QA 2FWHA 5F07A 2IMDA 2VCZA 5CRGA 4EIPA 1S3DA 2HI7A 3GTUA 1A8YA 2R0CA 1GSYA 4MJAA 1Z9HA 5AGYA 4NXIA 2HE3A 3DGQA 1J0FA 2DKHA 1GSUA 4OMVA 3KP9A 5EPFA 4K5RA 1HNCA 4HU7A 3PR8A 3VWXA 2LS5A 3EMPA 2M80A 1X9MB 5KN0A 2X49A 4MCUA 3WGXA 3DIEA 1H75A 1OKDA 2WZ9A 3IXRA 2H1BA 4MF7A 2FWEA 1QK8A 5DAKA 2PVOC 2XBIA 4FO5A 1FB6A 4LMVA 4L0UA 3Q74A 5ECLB 2F8AA 2L6CA 1SJIA 5DALB 4DEJA 2KLXA 5DCHA 1Q4JA 3HHVA 5KN2A 5ECHB 3MNGA 2E0QA 1ZL9A 2C1YA 3LORA 2M72A 5AIXA 2JZTA 1PMTA 5G1LA 1A0RP 3ZL5A 4JE1A 2WB9A 2DJ0A 3SWLA 3OR5A 4IELA 2PVQA 2HYXA 2F3MA 3D21A 4K9ZA 1V2AA 1JFUA 1B48A 2OKAA 4RQRA 3KD0A 3GL3A 1O6JA 3Q18A 1PSQA 4TXVA 2PN8A 1B9XC 4YKFA 4OFNA 4YQVA 2V6OA 3L9SA 1SJ6A 3E3EA 2VUPA 1AIUA 3H4KA 1HD2A 1ILOA 3IA1A 4MP4A 4F9ZA 5DCGA 2HZEA 4IHUA 4EL1A 2I3YA 3A5IA 1PKZA 2MMZA 1SD9A 4KUNA 4NV5A 5D93A 3TDGA 1TXXA 2C4JA 1XW5A 4PQIA 3G7IA 3QAVA 4GCIA 5ENUA 3U6VA 2PGTA 2I1UA 3D0ZA 1T8EB 2HT9A 2OE3A 1WRYA 1X9SB 3O3TA 4BVXA 1OE7A 1KNGA 3EU3A 2H1DA 3FR3A 3MAKA 1Y25A 5EVOA 2B3SA 3MDKA 4X1UA 3A2XA 4XCSA 4BWQA 4MZBA 20GSA 5ECOB 4BVYA 4TXOB 3F4TA 1X5CA 2L4QA 1GSFA 4HDEA 1YY7A 3EPTA 3GKMA 1M9BA 4LLRA 3E9JB 3FRCA 1K3OA 1S3AA 3A2VA 1AUCA 3EU4A 3GH9A 3GH6A 3GSTA 3FY7A 4QQ7A 3IR4A 4I97A 1G0TA 2FWFA 3DVWA 2VL2A 2LRNA 3ED3A 3FZ4A 4BWSA 1O7UA 4KE3A 4IS0A 2GQMA 5HR0A 1Z6MA 4K0NA 3H93A 1BEDA 5ECKB 2VO4A 1U87A 2ZNMA 3R2QA 4ZIJA 3APSA 11GSA 2R3XA 4IJ3A 1UA5A 4PGTA 2V1MA 5FWGA 2GZPA 2YN1A 5D9TA 5DALA 4KGIA 1OAZA 1A23A 1SYXA 1YDKA 4ZILA 5JCWA 2KOKA 4J57E 5D9XA 3APQA 2N5FA 1QQ2A 2V2GA 2HSYA 1T4ZA 3DKSA 3TOTA 2EIQA 4HU9A 2RM6A 2OE1A 2N5AA 3CQFA 3DYRA
chains in the Genus database with same CATH topology
5G2ZA 2VD1A 2HRFA 2JL4A 2YZHA 1EV4A 5CAXA 4GSSA 3ERWA 3UARA 3IV4A 3IAM2 3EC3A 1YEXA 4K0GA 1M2DA 4LA1A 1IYIA 2KP1A 2RM5A 1FOVA 2EIOA 3J7Yb 1F6MC 3VWVA 3LXTA 4CY8A 3BD2A 4ECBA 2NBSA 2J23A 5AISA 3D22A 4ICYA 4MMMA 3UJ1A 3CYNA 4G19A 2QKEA 1Z7PA 1B4PA 4A5PA 2H6ZA 1FB0A 5KN1A 5J3RA 1PA3A 2QA2A 3ZVJD 2RIIA 1AXDA 4TXOA 5FHIA 4O7HA 3M9JA 4V2LA 3VPQA 2CAQA 2VLUA 3LXZA 3H79A 5HFKA 1T4YA 5GSTA 2K18A 1E6BA 1GTIA 3VI5A 1ZCPA 3P7XA 3GV1A 5CRWA 5DQSA 1ZYEA 2REMA 1DE2A 3M8NA 4G9HA 2FY6A 3EE2A 4POKA 2WFCA 2WDUA 1G6YA 5AN1A 3BJ5A 1Z6NA 4N10A 3QCPA 4WKWA 4K7NA 1K3YA 3GKKA 3A3TA 4NV2A 2LNSA 2YV7A 3KZQA 3L9VA 1VF4A 1X5DA 4OWYA 4OCEA 5A5KA 4HOJA 2LJRA 3WT1A 4YAPA 3GNJA 1WP0A 1PRXA 1ZYNA 2LRTA 17GSA 1TU7A 3I6AA 4TOPA 1EGOA 4O5RA 4Q5FA 3FZ5A 2CVBA 2YCDA 3TRQA 5JWRB 3QAWA 4XTSA 3C8EA 2P5RA 3ZREA 2PMTA 2CZ3A 2ALBA 2N5BA 2PUKC 2R2JA 1ST9A 3KMNA 5G5EA 5BMUA 5FT3A 3TRXA 4HUAA 1M7TA 2CA8A 4IJIA 5ECIB 2VCWA 1R4WA 1FAAA 3IE3A 2H0GA 2GSRA 2IN3A 3HJPA 3VWUA 5IMZA 5DVBA 2C0DA 3O6TA 1AW9A 5IPHA 1EEMA 3W8JA 5ABRA 3GIXA 1QUWA 2X64A 4L0WA 4ULXA 4Z7XA 3CSJA 3Q19A 4G0LA 4XRDA 3FW2A 3IOSA 2ZCTA 1FG4A 4TRXA 1WIKA 4V1Ap 5J9BA 4QL7A 1MDIA 1V9WA 4O92A 5DJMA 1SL0B 1GULA 3PINA 3I9V2 5IMFA 4XIHA 1YKAA 2CT6A 3F6FA 4MPGA 4D73B 2PWJA 3KIJA 3ERGA 3HZ8A 3TKRA 3D5JA 2P31A 3J7Yk 4MJCA 1GSDA 4BPYA 1B4QA 4KAEA 2QGVA 3SBCA 3TKQA 4MK3A 2L4CA 4JEDA 4G0KA 4IP6A 3LEFA 5IOXA 3TJKA 1EP8A 4PUAA 1TRVA 3S9FA 3KEBA 5ECRB 3U5RE 2VCXA 1QXHA 4ZB8A 4ZL8A 4MZCA 1Z5YE 4YAVA 2DC5A 1RQMA 2XBQA 4IKHA 5DBQA 1SK0A 4K7OA 2R5GA 1LBKA 3FEUA 4RI7A 2LTKA 1XOBA 2HNLA 1K0CA 5HFIA 3EINA 5B8AA 1F3AA 3DVXA 3AY8A 4PNGA 5LCZA 2M46A 1JZDA 1K0DA 2FD3A 2CX4A 4EO3A 2IMKA 1VF2A 3CSHA 4IQAA 4EDYA 4POMA 3M9KA 4Q5NA 3HKRA 1MDJA 4NHZA 3IBHA 3GA4A 2L57A 3KXOA 5E59A 1B9YC 3D4MA 5ECPB 1QFNA 3F0IA 1ABAA 2YJ7A 3KH9A 3HVXA 2C8UA 4HZ4A 2GSQA 5KEJA 1EZKA 3TOUA 3A2WA 2R6KA 2DMMA 5L71A 1YF0A 2OACA 3FYGA 2H1AA 4ML6A 2B7JA 2LQOA 3RPNA 3ISOA 1N2AA 5B7CA 5IMDA 5J9CA 1OKTA 4RI6A 1WPIA 1T1VA 1TK0B 1O81A 4HJMA 2KP2A 4ILFA 1M2BA 1JZWA 2R0GA 5HR2A 4Z2UA 4JBBA 5F05A 1OC3A 5D73A 2YWMA 2G0FA 3ZIJA 3VLNA 1VGLA 2VCTA 4D73A 2PU9C 3FZAA 1X9WB 2L5OA 4MH2A 5G1KA 4CDOA 1A24A 1FW1A 2RUEA 2HZFA 1I5GA 5G31A 3TKSE 1TP9A 1R5AA 4L8EA 1DE1A 4WR5A 4Z2TA 1ON4A 2IL3A 6GSXA 2IMFA 2AJQB 2B1LA 4GQFA 4MNNA 3KCMA 2LNTA 3KH7A 4PTSA 1EP7A 1V58A 3G7JA 3GFKA 1SKSB 3GKNA 4EE0A 4HS1A 3L4NA 2VL3A 3LW9A 2HFDA 2VL2C 3N9JA 5D9WA 4YQMA 2GS3A 3M0FA 5A4UA 3ZFBA 3LWAA 2XPEA 4N0VA 2JZSA 5ECQB 3M3MA 19GSA 1UN2A 1PX6A 2X4AA 4AJ7A 5CYYA 5IMCA 3IPZA 1GWCA 2DJKA 3FR9A 1MD4A 6GSUA 1A2JA 3BCIA 1JLVA 2GT6A 3WYWA 1KEBA 3TKSA 1WJKA 3TUEA 3ME8A 3IHQA 1A2MA 3TJJA 1IYHA 3P90A 1BYEA 4J2FA 3RHBA 1U3IA 3G7YA 2FUG2 2Z9SA 2ZUPA 5H5SA 5GAPD 1WE0A 1XOAA 3QAGA 1SK1A 4PNFA 3QMXA 1TRUA 1FO5A 4ID0A 4KCAA 2LUSA 1SD8A 1EV9A 1R5PA 2CZ2A 4K2XA 3I43A 1GNWA 2OA7A 2WGRA 5B8BA 1QGVA 3EURA 4JR6A 2LQQA 4MJBA 1MEKA 4EVMA 2TRXA 4G10A 1AQVA 2H66A 4EIQA 4I2TA 1NHYA 2YP6A 1XIYA 3GMFA 2H6YA 4Z2RA 1XXUA 1AQWA 3IHGA 6GSTA 5GSSA 4TN8A 1XW6A 6GSSA 1XWBA 4FQUA 5B6MA 3PH9A 1GLQA 2XC2A 4OO5A 2H30A 1WWJA 4IQ1A 4NAXA 5A4WA 5J5NA 2C3TA 4EC0A 1USBA 2NTOA 3ZTLA 2HLSA 4WXTA 5ELAA 4H86A 2FA8A 3VK9A 3KJYA 4OD7A 1PQNA 4YQUA 13GSA 4ZL9A 4JRRA 6GSWA 1VF3A 3HJOA 5LD0A 2H74A 1PN9A 5J41A 22GSA 4JZQA 1HQOA 4OO4A 2O87A 1XVQA 5JWQB 4ISDA 2WCIA 1U3AA 4GF0A 5C00A 1ERTA 3R3EA 3FKFA 3P2AA 1HNBA 2AHEA 3LYPA 5IMVA 1YJ6A 2YANA 4WF4A 3RPPA 2V32A 4DVCA 1B8XA 1ZYPA 3F3QA 4XS6A 1DSBA 14GSA 4POBA 3NZNA 3ME7A 2DIZA 4K7IA 4TR4A 5IM9A 2YWNA 4TKYA 2HRNA 4TR1B 3VWWA 4ACSA 5DDLA 1QMVA 4YKGA 3C71A 5IQYA 4G2EA 1PD21 2VCVA 3ZZXA 2BTOT 1R7HA 5CRDA 2BJXA 5IO0A 3K8NA 1N8JA 3NOFA 3CRUA 3ZLPA 2MYGA 1O73A 3HD5A 2WJUA 5IOWA 3TJGA 2WULA 3RHCA 3RDWA 2VOCA 1TK8B 4AF2A 3F3RA 1SL2B 1TU8A 1GUHA 2NPBA 2RUFA 1TW9A 4KSMA 2VLVA 5JCUA 3TJBA 3UIWA 4F82A 1U88A 4ZXGA 2C0FA 8GSSA 2MBSA 1V40A 1JLWA 4BA7A 3LQ7A 1ZOFA 3JCML 1F9MA 3US3A 2E7PA 2A2RA 3F8UA 1U6TA 1NHOA 1SU9A 2JSZA 4X43A 1T00A 3ZVJA 1F37A 4USSA 1G7OA 1SKRB 4WF5A 2B5YA 4X0XA 2C80A 1LU4A 1AC1A 1M2AA 4GWRA 4MH3A 4JU5A 5C04A 2ON5A 1DUGA 3UBKA 4PQHA 1YQ1A 1XWCA 2L59A 1ZGNA 1TDIA 5CREA 4ZB9A 3CRTA 3UL3A 4POLA 1THOA 1PL2A 1XWAA 3N5OA 4ZB6A 2ON7A 2LKUA 3GX0A 1OC8A 3TJFA 4OFTA 1BQ7A 4HQZA 1TOFA 3TRPA 4MDCA 2E2MA 3HVSA 3FHKA 2B5EA 5KN3A 2DJJA 3QD9A 2O85A 1MDKA 1J9BA 1AQXA 1O8WA 2AUVA 3QPMA 3CBUA 3ZIVA 1OYJA 1A8LA 2A2PA 3VURA 4GRFA 3RBTA 2FLSA 2DJ2A 2JZRA 5EY6A 3UVTA 4FIWA 4Q5RA 1VRSD 2MMAA 2VLTA 4K8MA 5COHA 4MPFA 2CV4A 2FGXA 1XZOA 1AAZA 5KOXA 1MTCA 2CVDA 5ECMB 2LRCA 2GZYA 1RK4A 4PUFC 4DSSB 1VF1A 1W4VA 1EGRA 3VPTA 4PURA 4TR1A 3QOUA 4KDYA 2XPDA 3F4RA 3DRNA 2DJ1A 5CP1A 1XPVA 5H5RA 3W8SA 4IW9A 3NIVA 2GSSA 1PN0A 2HRAA 4CY6A 4AJ6A 4WETA 1ERUA 2H73A 2B6MA 2DLXA 4KB3A 2UZ8A 4QL9A 2K8VA 2X8GA 4K2DA 2PPTA 4E8EA 3I69A 2H6XA 4TVEA 4O5QA 2DMLA 1THXA 2AYTA 5ECNB 2X8CA 4BL7B 1V57A 4MJEA 1X0RA 2VM2A 1GTUA 3ZFLA 2JADA 3G9BA 5IMAA 3IK9A 1GTAA 2YJHA 1M99A 5F0GA 1A2LA 1JZOA 2IMIA 2H72A 2IIYA 2R37A 4XHMA 3CXGA 16GSA 3A5WA 1PGTA 2RLIA 4GTUA 2HRKA 3QFBC 1WOUA 4F2IA 4O32A 2TIRA 2HXKA 1ML6A 5ECSA 1JZRA 3GL5A 3F9UA 2O89A 3PPUA 3WD6A 4WEYA 2BMXA 1M9AA 4NHWA 5F06A 3H1NA 3LGCA 2GZZA 1DBYA 2EC4A 3LFLA 3PGTA 4TR0A 5GZZB 4TR3A 3QR6A 2GLRA 4V1Ag 2H0IA 6GSVA 3WGEA 2O7KA 1URMA 4GXZA 2NVLA 1XVWA 3BOAA 3W6GA 3BCKA 3HXSA 4N30A 3F4SA 3HA9A 1GSSA 4L5LA 4OCFA 1Y6EA 2O8VB 2QC7A 2QSIA 4PXOA 4KH7A 3P8WA 4IBPA 5KOWA 2H76A 3WT2A 3IK7A 5LNKe 4Q5QA 3GYKA 5J4UA 3C1RA 3GX8A 4F0CA 2B7KA 2H1GA 3KP8A 4DSSA 2DBCA 3IRAA 2OE0A 3VI7A 4ECIA 4FH8A 1NW2A 1F2EA 1PX7A 4WBRD 4CW9A 2V41A 1R26A 1TI3A 3TKSC 1FHEA 3M1GA 5JWOB 1J08A 3TKPA 4KSOA 3QDNA 5INYA 3Q6OA 1ZMAA 2AB6A 4I8BA 1OVNA 3DWVA 2FNOA 2H0HA 5HR1A 5F8BA 3CTFA 2P0GA 2IFQB 2DIYA 4EDZA 1YF1A 1E2YA 1NSWA 3FR6A 3GHAA 1TKDB 2H70A 1BAYA 4ZBDA 3HYPA 2PBJA 4EF0A 2OBKA 3UBLA 1X5EA 4NWYA 4BL7A 1G7EA 3EVIA 3HZ4A 1GSQA 2KHPA 4FYCA 2YNXA 3KM6A 4WBJA 3QFAC 4XS4B 6GSYA 2OADA 1F3BA 2FCHA 1TI1A 3ZYWA 1A0FA 3D6IA 5HFGA 4N11A 1WMJA 2VM1A 4I6XA 5G30A 2A4VA 1PL1A 2AAWA 18GSA 4MLYA 2LEGA 3CTGA 2B5XA 2R4VA 4HQSA 1FOHA 3IAS2 2NDOA 2CAIA 4O5UA 2LJKA 2YOIA 2MZCA 5G5FA 4IP1A 2JU5A 2HSHA 4HEA2 5IO2A 3O76A 3V1WA 1OC9B 1GUKA 1HNAA 5D96A 2IWTA 2JSYA 4N0ZA 1SKWB 5HQPA 1OE8A 4FYUA 2DKIA 4HI7A 4MF6A 4KCEA 3KTBA 4E8HA 1K3LA 2PERA 3TCOA 1CQHA 4NPBA 1YZXA 1XW9A 3H8QA 1K0BA 1GNEA 2C0GA 2CVKA 3GN3A 12GSA 1EEJA 2IPAA 3L78A 2H75A 3C7MA 4LL1B 4V2MA 1C72A 2H19A 3IC4A 2TRCP 3ZRDA 2ES7A 7GSSA 1O85A 1K0NA 1V98A 2FHEA 1HYUA 2GSTA 3ZMKA 3KTLA 5CO3A 2GGTA 2IJYA 1GLPA 1TTZA 2MMNA 4KW6A 3VFIA 1UVZA 3HY2A 4OFMA 2FWGA 5H5QA 1Z7RA 3D4TA 2GDRA 5DJLA 3CSIA 2K8SA 3C73A 2C0EA 1T7PB 1K0MA 1LJRA 1XWKA 3HDCA 2K9FA 2JACA 4FYBA 4AJ8A 1RW1A 1NM3A 4GSNA 2D2ZA 1GRXA 5E4WA 4ZBAA 5ID2B 4J56E 1TK5B 2CQ9A 4WR4A 5A4VA 4IVFA 3UEMA 4RUVA 2MBTA 3FZ9A 1KTEA 1XCCA 1GSEA 4YH2A 3EYTA 1G6WA 2IFQA 1W89A 1ZYQB 4GLTA 3MIXA 3UOMA 1ACVA 3LYKA 5ELGA 1FVKA 2VAFA 3HJMA 4TW5A 2C3QA 5AIVA 3UMAA 1GP1A 3MYDA 1BX9A 1O8XA 1JHBA 4K6XA 4ZBBA 2OBIA 4PX1A 2I9HA 4XS4A 1SL1B 2F9SA 1GTBA 2HSMA 2KUCA 3EWLA 2XHFA 2YWOA 4DSRA 4KDXA 2B1KA 2LSTA 3KMOA 4KNDA 2VIMA 2GVPA 4DSQA 1XWGA 2AV4A 3DMLA 4XRAA 1Z3EA 2CX3A 4ZL7A 4HJ2A 3HCZA 2V6KA 2H71A 1GH2A 4KF9A 4L5OA 3LJRA 4IN0A 2R0PA 2C3NA 3GUSA 1I9DA 2A4HA 3ZITA 1OC9A 4EUYA 3DD3A 5BRTA 3L0HA 4K5SA 2J9HA 1ERVA 3APOA 3IDVA 4X4JA 4EXJA 2E2GA 2DJ3A 2GQKA 2LJAA 5GAND 4ML1A 3GTUB 2VCQA 2GT5A 3MWHA 1CQGA 2WS2A 1ERWA 1YKCA 4I2UA 4KX4A 5IPGA 2WRTA 3E0UA 1M0UA 2YZUA 2H01A 4K1FA 2L5LA 3DXBA 3DEXA 3GKXA 2H8LA 3TGZA 1EWXA 2I81A 1SYRA 4KDUA 2GTUA 2F51A 3KGKA 4MABA 1S3CA 5DAKB 4PQ1A 3LG6A 4MF5A 1TJDA 1K0OA 1TRWA 3MSZA 2LV3A 1T3BA 4HZ2A 4EKZA 2VL9A 1SENA 4ECCA 1FVJA 2L6DA 3HVVA 5JCGA 3UAPA 5IIZA 3ZMLA 3FK8A 3FMWA 4GSTA 1KBNA 2P5QA 5CNWA 1YEPA 3TB2A 1MD3A 5ID2A 1TRSA 4JR4A 3ERFA 3UVHA 5HR3A 3GSSA 4KA0A 4AGSA 3RAZA 2FA4A 2GQLA 3F6DA 2X99A 4IGJA 2IMEA 4LL4B 9GSSA 1GUMA 2OJLA 5B6NA 1BJXA 3LSZA 2X8HA 2K6VA 1H4OA 2HZEB 4LMWA 1PKWA 3BBYA 1ZZYA 4CHSA 4GQCA 1SK2A 3IC8A 2EIRA 2QA1A 10GSA 1EOHA 2F8FA 2I4AA 1XFLA 3GRXA 1EOGA 1SJZA 4NMUA 1UC7A 1XBSA 4F03A 4G0IA 3C1SA 5DQYA 1K0AA 1GL8A 1Q98A 2G2QA 4BVXB 2YV9A 4RQXA 2YPMA 5CRHA 3EMXA 4XS1A 3GURA 2VD0A 5D9VA 3CMIA 4BVYB 2DSAA 4ECJA 4MZWA 3F63A 4F0BA 3L9UA 2MMOA 2A2SA 5D8IA 4V2NA 3WGDA 1BG5A 4P3YB 5EL8A 2YWIA 4MA9A 4I5QA 2FWHA 5F07A 2IMDA 2VCZA 5CRGA 4EIPA 1S3DA 2HI7A 3GTUA 1A8YA 2R0CA 1GSYA 4MJAA 1Z9HA 5AGYA 4NXIA 2HE3A 3DGQA 1J0FA 2DKHA 1GSUA 4OMVA 3KP9A 5EPFA 4K5RA 1HNCA 4HU7A 3PR8A 3VWXA 2LS5A 3EMPA 2M80A 1X9MB 5KN0A 2X49A 4MCUA 3WGXA 3DIEA 1H75A 1OKDA 2WZ9A 3IXRA 2H1BA 4MF7A 2FWEA 1QK8A 5DAKA 2PVOC 2XBIA 4FO5A 1FB6A 4LMVA 4L0UA 3Q74A 5ECLB 2F8AA 2L6CA 1SJIA 5DALB 4DEJA 2KLXA 5DCHA 1Q4JA 3HHVA 5KN2A 5ECHB 3MNGA 2E0QA 1ZL9A 2C1YA 3LORA 2M72A 5AIXA 2JZTA 1PMTA 5G1LA 1A0RP 3ZL5A 4JE1A 2WB9A 2DJ0A 3SWLA 3OR5A 4IELA 2PVQA 2HYXA 2F3MA 3D21A 4K9ZA 1V2AA 1JFUA 1B48A 2OKAA 4RQRA 3KD0A 3GL3A 1O6JA 3Q18A 1PSQA 4TXVA 2PN8A 1B9XC 4YKFA 4OFNA 4YQVA 2V6OA 3L9SA 1SJ6A 3E3EA 2VUPA 1AIUA 3H4KA 1HD2A 1ILOA 3IA1A 4MP4A 4F9ZA 5DCGA 2HZEA 4IHUA 4EL1A 2I3YA 3A5IA 1PKZA 2MMZA 1SD9A 4KUNA 4NV5A 5D93A 3TDGA 1TXXA 2C4JA 1XW5A 4PQIA 3G7IA 3QAVA 4GCIA 5ENUA 3U6VA 2PGTA 2I1UA 3D0ZA 1T8EB 2HT9A 2OE3A 1WRYA 1X9SB 3O3TA 4BVXA 1OE7A 1KNGA 3EU3A 2H1DA 3FR3A 3MAKA 1Y25A 5EVOA 2B3SA 3MDKA 4X1UA 3A2XA 4XCSA 4BWQA 4MZBA 20GSA 5ECOB 4BVYA 4TXOB 3F4TA 1X5CA 2L4QA 1GSFA 4HDEA 1YY7A 3EPTA 3GKMA 1M9BA 4LLRA 3E9JB 3FRCA 1K3OA 1S3AA 3A2VA 1AUCA 3EU4A 3GH9A 3GH6A 3GSTA 3FY7A 4QQ7A 3IR4A 4I97A 1G0TA 2FWFA 3DVWA 2VL2A 2LRNA 3ED3A 3FZ4A 4BWSA 1O7UA 4KE3A 4IS0A 2GQMA 5HR0A 1Z6MA 4K0NA 3H93A 1BEDA 5ECKB 2VO4A 1U87A 2ZNMA 3R2QA 4ZIJA 3APSA 11GSA 2R3XA 4IJ3A 1UA5A 4PGTA 2V1MA 5FWGA 2GZPA 2YN1A 5D9TA 5DALA 4KGIA 1OAZA 1A23A 1SYXA 1YDKA 4ZILA 5JCWA 2KOKA 4J57E 5D9XA 3APQA 2N5FA 1QQ2A 2V2GA 2HSYA 1T4ZA 3DKSA 3TOTA 2EIQA 4HU9A 2RM6A 2OE1A 2N5AA 3DYRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5G2Z A;  2VD1 A;  2HRF A;  2JL4 A;  2YZH A;  1EV4 A;  5CAX A;  4GSS A;  3ERW A;  3UAR A;  3IV4 A;  3IAM 2;  3EC3 A;  1YEX A;  4K0G A;  1M2D A;  4LA1 A;  1IYI A;  2KP1 A;  2RM5 A;  1FOV A;  2EIO A;  3J7Y b;  1F6M C;  3VWV A;  3LXT A;  3BD2 A;  4ECB A;  2NBS A;  2J23 A;  5AIS A;  3D22 A;  4MMM A;  3UJ1 A;  3CYN A;  4G19 A;  2QKE A;  1Z7P A;  1B4P A;  2H6Z A;  1FB0 A;  5KN1 A;  5J3R A;  1PA3 A;  3ZVJ D;  2RII A;  1AXD A;  4TXO A;  5FHI A;  4O7H A;  3M9J A;  4V2L A;  3VPQ A;  2CAQ A;  2VLU A;  3LXZ A;  3H79 A;  5HFK A;  1T4Y A;  5GST A;  2K18 A;  1E6B A;  1GTI A;  3VI5 A;  1ZCP A;  3P7X A;  3GV1 A;  5CRW A;  5DQS A;  1ZYE A;  2REM A;  1DE2 A;  3M8N A;  4G9H A;  2FY6 A;  3EE2 A;  4POK A;  2WFC A;  2WDU A;  1G6Y A;  5AN1 A;  3BJ5 A;  1Z6N A;  4N10 A;  3QCP A;  4WKW A;  4K7N A;  1K3Y A;  3GKK A;  3A3T A;  4NV2 A;  2LNS A;  2YV7 A;  3KZQ A;  3L9V A;  1VF4 A;  1X5D A;  4OWY A;  4OCE A;  5A5K A;  4HOJ A;  2LJR A;  3WT1 A;  4YAP A;  3GNJ A;  1WP0 A;  1PRX A;  2LRT A;  17GS A;  1TU7 A;  3I6A A;  4TOP A;  1EGO A;  4O5R A;  4Q5F A;  3FZ5 A;  2CVB A;  2YCD A;  3TRQ A;  5JWR B;  3QAW A;  4XTS A;  3C8E A;  2P5R A;  3ZRE A;  2PMT A;  2CZ3 A;  2ALB A;  2N5B A;  2PUK C;  2R2J A;  1ST9 A;  3KMN A;  5G5E A;  5FT3 A;  3TRX A;  4HUA A;  1M7T A;  2CA8 A;  4IJI A;  5ECI B;  2VCW A;  1R4W A;  1FAA A;  3IE3 A;  2H0G A;  2GSR A;  2IN3 A;  3HJP A;  3VWU A;  5IMZ A;  5DVB A;  2C0D A;  3O6T A;  1AW9 A;  5IPH A;  1EEM A;  3W8J A;  5ABR A;  3GIX A;  1QUW A;  2X64 A;  4L0W A;  4ULX A;  4Z7X A;  3CSJ A;  3Q19 A;  4XRD A;  3FW2 A;  3IOS A;  2ZCT A;  1FG4 A;  4TRX A;  1WIK A;  4V1A p;  5J9B A;  4QL7 A;  1MDI A;  1V9W A;  4O92 A;  5DJM A;  1SL0 B;  1GUL A;  3PIN A;  3I9V 2;  5IMF A;  4XIH A;  1YKA A;  2CT6 A;  3F6F A;  4MPG A;  4D73 B;  2PWJ A;  3KIJ A;  3ERG A;  3HZ8 A;  3TKR A;  3D5J A;  2P31 A;  3J7Y k;  4MJC A;  1GSD A;  4BPY A;  1B4Q A;  4KAE A;  2QGV A;  3SBC A;  3TKQ A;  4MK3 A;  2L4C A;  4JED A;  4IP6 A;  3LEF A;  5IOX A;  3TJK A;  1EP8 A;  4PUA A;  1TRV A;  3S9F A;  3KEB A;  5ECR B;  3U5R E;  2VCX A;  1QXH A;  4ZB8 A;  4ZL8 A;  4MZC A;  1Z5Y E;  4YAV A;  2DC5 A;  1RQM A;  2XBQ A;  4IKH A;  5DBQ A;  1SK0 A;  4K7O A;  2R5G A;  1LBK A;  3FEU A;  4RI7 A;  2LTK A;  1XOB A;  2HNL A;  1K0C A;  5HFI A;  3EIN A;  5B8A A;  1F3A A;  3DVX A;  3AY8 A;  4PNG A;  5LCZ A;  2M46 A;  1JZD A;  1K0D A;  2FD3 A;  2CX4 A;  4EO3 A;  2IMK A;  1VF2 A;  3CSH A;  4IQA A;  4EDY A;  4POM A;  3M9K A;  4Q5N A;  3HKR A;  1MDJ A;  4NHZ A;  3IBH A;  3GA4 A;  2L57 A;  3KXO A;  5E59 A;  1B9Y C;  3D4M A;  5ECP B;  1QFN A;  3F0I A;  1ABA A;  2YJ7 A;  3KH9 A;  3HVX A;  2C8U A;  4HZ4 A;  2GSQ A;  5KEJ A;  1EZK A;  3TOU A;  3A2W A;  2R6K A;  2DMM A;  5L71 A;  1YF0 A;  2OAC A;  3FYG A;  2H1A A;  4ML6 A;  2B7J A;  2LQO A;  3RPN A;  3ISO A;  1N2A A;  5B7C A;  5IMD A;  5J9C A;  1OKT A;  4RI6 A;  1WPI A;  1T1V A;  1TK0 B;  1O81 A;  4HJM A;  2KP2 A;  4ILF A;  1M2B A;  1JZW A;  5HR2 A;  4JBB A;  5F05 A;  1OC3 A;  5D73 A;  2YWM A;  2G0F A;  3ZIJ A;  3VLN A;  1VGL A;  2VCT A;  4D73 A;  2PU9 C;  3FZA A;  1X9W B;  2L5O A;  4MH2 A;  5G1K A;  4CDO A;  1A24 A;  1FW1 A;  2RUE A;  2HZF A;  1I5G A;  5G31 A;  3TKS E;  1TP9 A;  1R5A A;  4L8E A;  1DE1 A;  4WR5 A;  1ON4 A;  2IL3 A;  6GSX A;  2IMF A;  2AJQ B;  2B1L A;  4GQF A;  3KCM A;  2LNT A;  3KH7 A;  1EP7 A;  1V58 A;  3G7J A;  3GFK A;  1SKS B;  3GKN A;  4EE0 A;  4HS1 A;  3L4N A;  2VL3 A;  2HFD A;  2VL2 C;  3N9J A;  5D9W A;  4YQM A;  2GS3 A;  3M0F A;  5A4U A;  3ZFB A;  3LWA A;  2XPE A;  4N0V A;  2JZS A;  5ECQ B;  3M3M A;  19GS A;  1UN2 A;  1PX6 A;  4AJ7 A;  5CYY A;  5IMC A;  3IPZ A;  1GWC A;  2DJK A;  3FR9 A;  1MD4 A;  6GSU A;  1A2J A;  3BCI A;  1JLV A;  2GT6 A;  3WYW A;  1KEB A;  3TKS A;  1WJK A;  3TUE A;  3ME8 A;  3IHQ A;  1A2M A;  3TJJ A;  1IYH A;  3P90 A;  1BYE A;  4J2F A;  3RHB A;  1U3I A;  3G7Y A;  2FUG 2;  2Z9S A;  2ZUP A;  5H5S A;  5GAP D;  1WE0 A;  1XOA A;  3QAG A;  1SK1 A;  4PNF A;  3QMX A;  1TRU A;  1FO5 A;  4ID0 A;  4KCA A;  2LUS A;  1SD8 A;  1EV9 A;  1R5P A;  2CZ2 A;  3I43 A;  1GNW A;  2OA7 A;  2WGR A;  5B8B A;  1QGV A;  3EUR A;  4JR6 A;  2LQQ A;  4MJB A;  1MEK A;  4EVM A;  2TRX A;  4G10 A;  1AQV A;  2H66 A;  4I2T A;  1NHY A;  2YP6 A;  1XIY A;  3GMF A;  2H6Y A;  1XXU A;  1AQW A;  6GST A;  5GSS A;  4TN8 A;  1XW6 A;  6GSS A;  1XWB A;  5B6M A;  3PH9 A;  1GLQ A;  2XC2 A;  4OO5 A;  2H30 A;  1WWJ A;  4IQ1 A;  4NAX A;  5A4W A;  5J5N A;  2C3T A;  4EC0 A;  1USB A;  2NTO A;  3ZTL A;  2HLS A;  4WXT A;  5ELA A;  4H86 A;  2FA8 A;  3VK9 A;  3KJY A;  4OD7 A;  1PQN A;  4YQU A;  13GS A;  4ZL9 A;  4JRR A;  6GSW A;  1VF3 A;  3HJO A;  5LD0 A;  2H74 A;  1PN9 A;  5J41 A;  22GS A;  4JZQ A;  1HQO A;  4OO4 A;  2O87 A;  1XVQ A;  5JWQ B;  4ISD A;  2WCI A;  1U3A A;  4GF0 A;  5C00 A;  1ERT A;  3FKF A;  3P2A A;  1HNB A;  2AHE A;  3LYP A;  5IMV A;  1YJ6 A;  2YAN A;  4WF4 A;  3RPP A;  2V32 A;  4DVC A;  1B8X A;  3F3Q A;  4XS6 A;  1DSB A;  14GS A;  4POB A;  3NZN A;  3ME7 A;  2DIZ A;  4K7I A;  4TR4 A;  5IM9 A;  2YWN A;  4TKY A;  2HRN A;  4TR1 B;  3VWW A;  4ACS A;  5DDL A;  1QMV A;  5IQY A;  3C71 A;  4G2E A;  1PD2 1;  2VCV A;  3ZZX A;  2BTO T;  1R7H A;  5CRD A;  2BJX A;  5IO0 A;  3K8N A;  1N8J A;  3NOF A;  3CRU A;  3ZLP A;  2MYG A;  1O73 A;  3HD5 A;  2WJU A;  5IOW A;  3TJG A;  2WUL A;  3RHC A;  3RDW A;  2VOC A;  1TK8 B;  4AF2 A;  3F3R A;  1SL2 B;  1TU8 A;  1GUH A;  2NPB A;  2RUF A;  1TW9 A;  4KSM A;  2VLV A;  5JCU A;  3TJB A;  3UIW A;  4F82 A;  1U88 A;  4ZXG A;  2C0F A;  8GSS A;  2MBS A;  1V40 A;  1JLW A;  4BA7 A;  3LQ7 A;  1ZOF A;  3JCM L;  1F9M A;  3US3 A;  2E7P A;  2A2R A;  3F8U A;  1U6T A;  1NHO A;  1SU9 A;  2JSZ A;  4X43 A;  1T00 A;  3ZVJ A;  1F37 A;  1G7O A;  1SKR B;  4WF5 A;  2B5Y A;  4X0X A;  2C80 A;  1LU4 A;  1AC1 A;  1M2A A;  4GWR A;  4MH3 A;  4JU5 A;  5C04 A;  2ON5 A;  1DUG A;  3UBK A;  4PQH A;  1YQ1 A;  1XWC A;  2L59 A;  1ZGN A;  1TDI A;  5CRE A;  4ZB9 A;  3CRT A;  3UL3 A;  4POL A;  1THO A;  1PL2 A;  1XWA A;  3N5O A;  4ZB6 A;  2ON7 A;  2LKU A;  3GX0 A;  1OC8 A;  3TJF A;  4OFT A;  1BQ7 A;  4HQZ A;  1TOF A;  3TRP A;  4MDC A;  2E2M A;  3HVS A;  3FHK A;  2B5E A;  5KN3 A;  2DJJ A;  3QD9 A;  2O85 A;  1MDK A;  1J9B A;  1AQX A;  1O8W A;  2AUV A;  3QPM A;  3CBU A;  3ZIV A;  1OYJ A;  1A8L A;  3VUR A;  4GRF A;  3RBT A;  2FLS A;  2DJ2 A;  2JZR A;  5EY6 A;  3UVT A;  4FIW A;  4Q5R A;  1VRS D;  2MMA A;  2VLT A;  4K8M A;  5COH A;  4MPF A;  2CV4 A;  2FGX A;  1XZO A;  1AAZ A;  1MTC A;  2CVD A;  5ECM B;  2LRC A;  2GZY A;  1RK4 A;  4PUF C;  4DSS B;  1VF1 A;  1W4V A;  1EGR A;  3VPT A;  4PUR A;  4TR1 A;  3QOU A;  4KDY A;  2XPD A;  3F4R A;  3DRN A;  2DJ1 A;  5CP1 A;  1XPV A;  5H5R A;  3W8S A;  4IW9 A;  3NIV A;  2GSS A;  4AJ6 A;  4WET A;  1ERU A;  2H73 A;  2B6M A;  2DLX A;  4KB3 A;  4QL9 A;  2K8V A;  2X8G A;  4K2D A;  2PPT A;  4E8E A;  3I69 A;  2H6X A;  4TVE A;  2DML A;  1THX A;  2AYT A;  5ECN B;  2X8C A;  1V57 A;  4MJE A;  1X0R A;  2VM2 A;  1GTU A;  3ZFL A;  2JAD A;  3G9B A;  5IMA A;  3IK9 A;  1GTA A;  2YJH A;  1M99 A;  5F0G A;  1A2L A;  1JZO A;  2IMI A;  2H72 A;  2IIY A;  2R37 A;  4XHM A;  3CXG A;  16GS A;  3A5W A;  1PGT A;  2RLI A;  4GTU A;  3QFB C;  1WOU A;  4F2I A;  4O32 A;  2TIR A;  2HXK A;  1ML6 A;  5ECS A;  1JZR A;  3GL5 A;  3F9U A;  2O89 A;  3WD6 A;  4WEY A;  2BMX A;  1M9A A;  4NHW A;  5F06 A;  3H1N A;  3LGC A;  2GZZ A;  1DBY A;  2EC4 A;  3LFL A;  3PGT A;  4TR0 A;  5GZZ B;  4TR3 A;  3QR6 A;  2GLR A;  4V1A g;  2H0I A;  6GSV A;  3WGE A;  2O7K A;  1URM A;  4GXZ A;  2NVL A;  1XVW A;  3BOA A;  3W6G A;  3BCK A;  3HXS A;  4N30 A;  3F4S A;  3HA9 A;  1GSS A;  4L5L A;  4OCF A;  1Y6E A;  2O8V B;  2QC7 A;  2QSI A;  4PXO A;  4KH7 A;  3P8W A;  4IBP A;  2H76 A;  3WT2 A;  3IK7 A;  5LNK e;  4Q5Q A;  3GYK A;  5J4U A;  3C1R A;  3GX8 A;  4F0C A;  2B7K A;  2H1G A;  3KP8 A;  4DSS A;  2DBC A;  3IRA A;  2OE0 A;  3VI7 A;  4ECI A;  4FH8 A;  1NW2 A;  1F2E A;  1PX7 A;  4WBR D;  4CW9 A;  2V41 A;  1R26 A;  1TI3 A;  3TKS C;  1FHE A;  3M1G A;  5JWO B;  1J08 A;  3TKP A;  4KSO A;  3QDN A;  5INY A;  3Q6O A;  1ZMA A;  2AB6 A;  4I8B A;  1OVN A;  3DWV A;  2FNO A;  2H0H A;  5HR1 A;  5F8B A;  3CTF A;  2P0G A;  2IFQ B;  2DIY A;  4EDZ A;  1YF1 A;  1E2Y A;  1NSW A;  3FR6 A;  3GHA A;  1TKD B;  2H70 A;  1BAY A;  4ZBD A;  3HYP A;  2PBJ A;  4EF0 A;  2OBK A;  3UBL A;  1X5E A;  4NWY A;  4BL7 A;  1G7E A;  3EVI A;  3HZ4 A;  1GSQ A;  2KHP A;  4FYC A;  2YNX A;  3KM6 A;  4WBJ A;  3QFA C;  4XS4 B;  6GSY A;  2OAD A;  1F3B A;  2FCH A;  1TI1 A;  3ZYW A;  1A0F A;  3D6I A;  5HFG A;  4N11 A;  1WMJ A;  2VM1 A;  4I6X A;  5G30 A;  2A4V A;  1PL1 A;  2AAW A;  18GS A;  4MLY A;  2LEG A;  3CTG A;  2B5X A;  2R4V A;  4HQS A;  3IAS 2;  2NDO A;  2CAI A;  2LJK A;  2YOI A;  2MZC A;  5G5F A;  4IP1 A;  2JU5 A;  2HSH A;  4HEA 2;  5IO2 A;  3O76 A;  3V1W A;  1OC9 B;  1GUK A;  1HNA A;  5D96 A;  2IWT A;  2JSY A;  4N0Z A;  1SKW B;  5HQP A;  1OE8 A;  4FYU A;  4HI7 A;  4MF6 A;  4KCE A;  3KTB A;  4E8H A;  1K3L A;  2PER A;  3TCO A;  1CQH A;  4NPB A;  1YZX A;  1XW9 A;  3H8Q A;  1K0B A;  1GNE A;  2C0G A;  2CVK A;  3GN3 A;  12GS A;  1EEJ A;  2IPA A;  3L78 A;  2H75 A;  3C7M A;  4LL1 B;  4V2M A;  1C72 A;  2H19 A;  3IC4 A;  2TRC P;  3ZRD A;  2ES7 A;  7GSS A;  1O85 A;  1K0N A;  1V98 A;  2FHE A;  1HYU A;  2GST A;  3ZMK A;  3KTL A;  5CO3 A;  2GGT A;  2IJY A;  1GLP A;  1TTZ A;  2MMN A;  4KW6 A;  3VFI A;  1UVZ A;  3HY2 A;  4OFM A;  2FWG A;  5H5Q A;  1Z7R A;  3D4T A;  2GDR A;  5DJL A;  3CSI A;  2K8S A;  3C73 A;  2C0E A;  1T7P B;  1K0M A;  1LJR A;  1XWK A;  3HDC A;  2K9F A;  2JAC A;  4FYB A;  4AJ8 A;  1RW1 A;  1NM3 A;  4GSN A;  2D2Z A;  1GRX A;  5E4W A;  4ZBA A;  5ID2 B;  4J56 E;  1TK5 B;  2CQ9 A;  4WR4 A;  5A4V A;  4IVF A;  3UEM A;  4RUV A;  2MBT A;  3FZ9 A;  1KTE A;  1XCC A;  1GSE A;  4YH2 A;  3EYT A;  1G6W A;  2IFQ A;  1W89 A;  1ZYQ B;  4GLT A;  3UOM A;  1ACV A;  3LYK A;  5ELG A;  1FVK A;  2VAF A;  3HJM A;  4TW5 A;  2C3Q A;  5AIV A;  3UMA A;  1GP1 A;  1BX9 A;  1O8X A;  1JHB A;  4K6X A;  4ZBB A;  2OBI A;  4PX1 A;  2I9H A;  4XS4 A;  1SL1 B;  2F9S A;  1GTB A;  2KUC A;  3EWL A;  2XHF A;  2YWO A;  4DSR A;  4KDX A;  2B1K A;  2LST A;  3KMO A;  4KND A;  2VIM A;  2GVP A;  4DSQ A;  1XWG A;  2AV4 A;  3DML A;  4XRA A;  1Z3E A;  2CX3 A;  4ZL7 A;  4HJ2 A;  3HCZ A;  2V6K A;  2H71 A;  1GH2 A;  4L5O A;  3LJR A;  4IN0 A;  2C3N A;  3GUS A;  1I9D A;  3ZIT A;  1OC9 A;  4EUY A;  3DD3 A;  3L0H A;  2J9H A;  1ERV A;  3APO A;  3IDV A;  4EXJ A;  2E2G A;  2DJ3 A;  2GQK A;  2LJA A;  5GAN D;  4ML1 A;  3GTU B;  2VCQ A;  2GT5 A;  3MWH A;  1CQG A;  2WS2 A;  1ERW A;  1YKC A;  4I2U A;  4KX4 A;  5IPG A;  2WRT A;  3E0U A;  1M0U A;  2YZU A;  2H01 A;  4K1F A;  2L5L A;  3DXB A;  3DEX A;  3GKX A;  2H8L A;  3TGZ A;  1EWX A;  2I81 A;  1SYR A;  4KDU A;  2GTU A;  2F51 A;  3KGK A;  4MAB A;  1S3C A;  5DAK B;  4PQ1 A;  3LG6 A;  4MF5 A;  1TJD A;  1K0O A;  1TRW A;  3MSZ A;  2LV3 A;  1T3B A;  4HZ2 A;  4EKZ A;  2VL9 A;  1SEN A;  4ECC A;  1FVJ A;  2L6D A;  3HVV A;  5JCG A;  3UAP A;  5IIZ A;  3ZML A;  3FK8 A;  4GST A;  1KBN A;  2P5Q A;  5CNW A;  1YEP A;  3TB2 A;  1MD3 A;  5ID2 A;  1TRS A;  4JR4 A;  3ERF A;  3UVH A;  5HR3 A;  3GSS A;  4KA0 A;  4AGS A;  3RAZ A;  2FA4 A;  2GQL A;  3F6D A;  2X99 A;  4IGJ A;  2IME A;  4LL4 B;  9GSS A;  1GUM A;  2OJL A;  5B6N A;  1BJX A;  3LSZ A;  2X8H A;  2K6V A;  1H4O A;  2HZE B;  4LMW A;  1PKW A;  3BBY A;  1ZZY A;  4CHS A;  4GQC A;  1SK2 A;  2EIR A;  10GS A;  1EOH A;  2F8F A;  2I4A A;  1XFL A;  3GRX A;  1EOG A;  1SJZ A;  4NMU A;  1UC7 A;  1XBS A;  4F03 A;  3C1S A;  5DQY A;  1K0A A;  1GL8 A;  1Q98 A;  2G2Q A;  2YV9 A;  4RQX A;  2YPM A;  5CRH A;  3EMX A;  4XS1 A;  3GUR A;  2VD0 A;  5D9V A;  3CMI A;  2DSA A;  4ECJ A;  4MZW A;  3F63 A;  4F0B A;  3L9U A;  2MMO A;  2A2S A;  5D8I A;  4V2N A;  3WGD A;  1BG5 A;  4P3Y B;  5EL8 A;  2YWI A;  4MA9 A;  4I5Q A;  2FWH A;  5F07 A;  2IMD A;  2VCZ A;  5CRG A;  1S3D A;  2HI7 A;  3GTU A;  1A8Y A;  1GSY A;  4MJA A;  1Z9H A;  5AGY A;  4NXI A;  2HE3 A;  3DGQ A;  1J0F A;  1GSU A;  4OMV A;  3KP9 A;  5EPF A;  1HNC A;  4HU7 A;  3PR8 A;  3VWX A;  2LS5 A;  3EMP A;  2M80 A;  1X9M B;  5KN0 A;  3WGX A;  4MCU A;  3DIE A;  1H75 A;  1OKD A;  2WZ9 A;  3IXR A;  2H1B A;  4MF7 A;  2FWE A;  1QK8 A;  5DAK A;  2PVO C;  2XBI A;  4FO5 A;  1FB6 A;  4LMV A;  4L0U A;  3Q74 A;  5ECL B;  2F8A A;  2L6C A;  1SJI A;  5DAL B;  4DEJ A;  2KLX A;  5DCH A;  1Q4J A;  3HHV A;  5KN2 A;  5ECH B;  3MNG A;  2E0Q A;  1ZL9 A;  2C1Y A;  3LOR A;  2M72 A;  5AIX A;  2JZT A;  1PMT A;  5G1L A;  1A0R P;  3ZL5 A;  4JE1 A;  2WB9 A;  2DJ0 A;  3SWL A;  3OR5 A;  4IEL A;  2PVQ A;  2HYX A;  2F3M A;  3D21 A;  4K9Z A;  1V2A A;  1JFU A;  1B48 A;  2OKA A;  4RQR A;  3KD0 A;  3GL3 A;  1O6J A;  3Q18 A;  1PSQ A;  4TXV A;  2PN8 A;  1B9X C;  4OFN A;  4YQV A;  2V6O A;  3L9S A;  1SJ6 A;  3E3E A;  2VUP A;  1AIU A;  3H4K A;  1HD2 A;  1ILO A;  3IA1 A;  4MP4 A;  4F9Z A;  5DCG A;  2HZE A;  4IHU A;  4EL1 A;  2I3Y A;  1PKZ A;  2MMZ A;  1SD9 A;  4KUN A;  4NV5 A;  5D93 A;  3TDG A;  1TXX A;  2C4J A;  1XW5 A;  4PQI A;  3G7I A;  3QAV A;  4GCI A;  5ENU A;  3U6V A;  2PGT A;  2I1U A;  3D0Z A;  1T8E B;  2HT9 A;  2OE3 A;  1WRY A;  1X9S B;  3O3T A;  4BVX A;  1OE7 A;  1KNG A;  3EU3 A;  2H1D A;  3FR3 A;  3MAK A;  1Y25 A;  5EVO A;  2B3S A;  3MDK A;  4X1U A;  3A2X A;  4XCS A;  4BWQ A;  4MZB A;  20GS A;  5ECO B;  4BVY A;  4TXO B;  3F4T A;  1X5C A;  2L4Q A;  1GSF A;  4HDE A;  1YY7 A;  3GKM A;  1M9B A;  4LLR A;  3E9J B;  3FRC A;  1K3O A;  1S3A A;  3A2V A;  1AUC A;  3EU4 A;  3GH9 A;  3GH6 A;  3GST A;  3FY7 A;  4QQ7 A;  3IR4 A;  4I97 A;  1G0T A;  2FWF A;  3DVW A;  2VL2 A;  2LRN A;  3ED3 A;  3FZ4 A;  4BWS A;  1O7U A;  4KE3 A;  4IS0 A;  2GQM A;  5HR0 A;  1Z6M A;  4K0N A;  3H93 A;  1BED A;  5ECK B;  2VO4 A;  1U87 A;  2ZNM A;  3R2Q A;  4ZIJ A;  3APS A;  11GS A;  2R3X A;  4IJ3 A;  1UA5 A;  4PGT A;  2V1M A;  5FWG A;  2GZP A;  2YN1 A;  5D9T A;  5DAL A;  4KGI A;  1OAZ A;  1A23 A;  1SYX A;  1YDK A;  4ZIL A;  5JCW A;  2KOK A;  4J57 E;  5D9X A;  3APQ A;  2N5F A;  1QQ2 A;  2V2G A;  2HSY A;  1T4Z A;  3DKS A;  3TOT A;  2EIQ A;  4HU9 A;  2RM6 A;  2OE1 A;  2N5A A;  3DYR A; 
#chains in the Genus database with same CATH topology
 5G2Z A;  2VD1 A;  2HRF A;  2JL4 A;  2YZH A;  1EV4 A;  5CAX A;  4GSS A;  3ERW A;  3UAR A;  3IV4 A;  3IAM 2;  3EC3 A;  1YEX A;  4K0G A;  1M2D A;  4LA1 A;  1IYI A;  2KP1 A;  2RM5 A;  1FOV A;  2EIO A;  3J7Y b;  1F6M C;  3VWV A;  3LXT A;  4CY8 A;  3BD2 A;  4ECB A;  4HSC X;  2NBS A;  2J23 A;  5AIS A;  3D22 A;  4ICY A;  4MMM A;  3UJ1 A;  3CYN A;  4G19 A;  2QKE A;  1Z7P A;  1B4P A;  4A5P A;  2H6Z A;  1FB0 A;  5KN1 A;  5J3R A;  1PA3 A;  2QA2 A;  3ZVJ D;  2RII A;  1AXD A;  4TXO A;  5FHI A;  4O7H A;  3M9J A;  4V2L A;  3VPQ A;  2CAQ A;  2VLU A;  3LXZ A;  3H79 A;  5HFK A;  1T4Y A;  5GST A;  2K18 A;  1E6B A;  1M3J A;  1GTI A;  3VI5 A;  1ZCP A;  3P7X A;  3GV1 A;  5CRW A;  5DQS A;  1ZYE A;  2REM A;  1DE2 A;  3M8N A;  4G9H A;  2FY6 A;  3EE2 A;  4POK A;  2WFC A;  2WDU A;  1G6Y A;  5AN1 A;  3BJ5 A;  1Z6N A;  4N10 A;  3QCP A;  4WKW A;  4K7N A;  1K3Y A;  3GKK A;  3A3T A;  4NV2 A;  2LNS A;  2YV7 A;  3KZQ A;  3L9V A;  1VF4 A;  1X5D A;  4OWY A;  4OCE A;  5A5K A;  4HOJ A;  2LJR A;  3WT1 A;  4YAP A;  3GNJ A;  1WP0 A;  1PRX A;  1ZYN A;  2LRT A;  17GS A;  1TU7 A;  3I6A A;  4TOP A;  1EGO A;  4O5R A;  4Q5F A;  3FZ5 A;  2CVB A;  2YCD A;  3TRQ A;  5JWR B;  3QAW A;  4XTS A;  3C8E A;  2P5R A;  3ZRE A;  2PMT A;  2CZ3 A;  2ALB A;  2N5B A;  2PUK C;  2R2J A;  1ST9 A;  3KMN A;  5G5E A;  5BMU A;  5FT3 A;  3TRX A;  4HUA A;  1M7T A;  2CA8 A;  4IJI A;  5ECI B;  2VCW A;  1R4W A;  1FAA A;  3IE3 A;  2H0G A;  2GSR A;  2IN3 A;  3HJP A;  3VWU A;  5IMZ A;  5DVB A;  2C0D A;  3O6T A;  1AW9 A;  5IPH A;  1EEM A;  3W8J A;  5ABR A;  3GIX A;  1QUW A;  2X64 A;  4L0W A;  4ULX A;  1XG8 A;  4Z7X A;  3CSJ A;  3Q19 A;  4G0L A;  4XRD A;  3FW2 A;  3IOS A;  2ZCT A;  1FG4 A;  4TRX A;  1WIK A;  4V1A p;  5J9B A;  4QL7 A;  1MDI A;  1V9W A;  4O92 A;  5DJM A;  1SL0 B;  1GUL A;  3PIN A;  3I9V 2;  5IMF A;  4XIH A;  1YKA A;  2CT6 A;  3F6F A;  4MPG A;  4D73 B;  2PWJ A;  3KIJ A;  3ERG A;  3HZ8 A;  3TKR A;  3D5J A;  2P31 A;  3J7Y k;  4MJC A;  1GSD A;  4BPY A;  1B4Q A;  4KAE A;  2QGV A;  3SBC A;  3TKQ A;  4MK3 A;  2L4C A;  4JED A;  1PFO A;  4G0K A;  4IP6 A;  3LEF A;  5IOX A;  3TJK A;  1EP8 A;  4PUA A;  1TRV A;  3S9F A;  3KEB A;  5ECR B;  3U5R E;  2VCX A;  1QXH A;  4ZB8 A;  4ZL8 A;  4MZC A;  1Z5Y E;  4YAV A;  2DC5 A;  1RQM A;  2XBQ A;  4IKH A;  5DBQ A;  1SK0 A;  4K7O A;  2R5G A;  1LBK A;  3FEU A;  4RI7 A;  2LTK A;  1XOB A;  2HNL A;  1K0C A;  5HFI A;  3EIN A;  5B8A A;  1F3A A;  3DVX A;  3AY8 A;  4PNG A;  5LCZ A;  2M46 A;  1JZD A;  1K0D A;  2FD3 A;  2CX4 A;  4EO3 A;  2IMK A;  1VF2 A;  3CSH A;  4IQA A;  4EDY A;  4POM A;  3M9K A;  4Q5N A;  3HKR A;  1MDJ A;  4NHZ A;  3IBH A;  3GA4 A;  2L57 A;  3KXO A;  5E59 A;  1B9Y C;  3D4M A;  5ECP B;  1QFN A;  3F0I A;  1ABA A;  2YJ7 A;  3KH9 A;  3HVX A;  2C8U A;  4HZ4 A;  2GSQ A;  5KEJ A;  1EZK A;  3TOU A;  3A2W A;  2R6K A;  2DMM A;  5L71 A;  1YF0 A;  2OAC A;  3FYG A;  2H1A A;  4ML6 A;  2B7J A;  2LQO A;  3RPN A;  3ISO A;  1N2A A;  5B7C A;  5IMD A;  5J9C A;  1OKT A;  4RI6 A;  1WPI A;  1T1V A;  1TK0 B;  1O81 A;  4HJM A;  2KP2 A;  4ILF A;  1M2B A;  1JZW A;  2R0G A;  5HR2 A;  4Z2U A;  4JBB A;  5F05 A;  1OC3 A;  5D73 A;  2YWM A;  2G0F A;  3ZIJ A;  3VLN A;  1VGL A;  2VCT A;  4D73 A;  2PU9 C;  3FZA A;  1X9W B;  2L5O A;  4MH2 A;  5G1K A;  4CDO A;  1A24 A;  1FW1 A;  2RUE A;  2HZF A;  1I5G A;  5G31 A;  3TKS E;  1TP9 A;  1R5A A;  4L8E A;  1DE1 A;  4WR5 A;  4Z2T A;  1ON4 A;  2IL3 A;  6GSX A;  2IMF A;  2AJQ B;  2B1L A;  4GQF A;  4MNN A;  3KCM A;  2LNT A;  3KH7 A;  4PTS A;  1EP7 A;  1V58 A;  3G7J A;  3GFK A;  1SKS B;  3GKN A;  4EE0 A;  4HS1 A;  3L4N A;  2VL3 A;  3LW9 A;  2HFD A;  2VL2 C;  3N9J A;  5D9W A;  4YQM A;  2GS3 A;  3M0F A;  5A4U A;  3ZFB A;  3LWA A;  2XPE A;  4N0V A;  2JZS A;  5ECQ B;  3M3M A;  19GS A;  1UN2 A;  1PX6 A;  2X4A A;  4AJ7 A;  5CYY A;  5IMC A;  3IPZ A;  1GWC A;  2DJK A;  3FR9 A;  1MD4 A;  6GSU A;  1A2J A;  3BCI A;  1JLV A;  2GT6 A;  3WYW A;  1KEB A;  3TKS A;  1WJK A;  3TUE A;  3ME8 A;  3IHQ A;  1A2M A;  3TJJ A;  1IYH A;  3P90 A;  1BYE A;  4J2F A;  3RHB A;  1U3I A;  3G7Y A;  2FUG 2;  2Z9S A;  2ZUP A;  5H5S A;  5GAP D;  1WE0 A;  1XOA A;  3QAG A;  1SK1 A;  4PNF A;  3QMX A;  1TRU A;  1FO5 A;  4ID0 A;  4KCA A;  2LUS A;  1SD8 A;  1EV9 A;  1R5P A;  2CZ2 A;  4K2X A;  3I43 A;  1GNW A;  2OA7 A;  2WGR A;  5B8B A;  1QGV A;  3EUR A;  4JR6 A;  2LQQ A;  4MJB A;  1MEK A;  4EVM A;  2TRX A;  4G10 A;  1AQV A;  2H66 A;  4EIQ A;  4I2T A;  1NHY A;  2YP6 A;  1XIY A;  3GMF A;  2H6Y A;  4Z2R A;  1XXU A;  1AQW A;  3IHG A;  6GST A;  5GSS A;  4TN8 A;  1XW6 A;  6GSS A;  1XWB A;  4FQU A;  5B6M A;  3PH9 A;  1GLQ A;  2XC2 A;  4OO5 A;  2H30 A;  1WWJ A;  4IQ1 A;  4NAX A;  5A4W A;  5J5N A;  2C3T A;  4EC0 A;  1USB A;  2NTO A;  3ZTL A;  2HLS A;  4WXT A;  5ELA A;  4H86 A;  2FA8 A;  3VK9 A;  3KJY A;  4OD7 A;  1PQN A;  4YQU A;  13GS A;  4ZL9 A;  4JRR A;  6GSW A;  1VF3 A;  3HJO A;  5LD0 A;  2H74 A;  1PN9 A;  5J41 A;  22GS A;  4JZQ A;  1HQO A;  4OO4 A;  2O87 A;  1XVQ A;  5JWQ B;  4ISD A;  2WCI A;  1U3A A;  4GF0 A;  5C00 A;  1ERT A;  3R3E A;  3FKF A;  3P2A A;  1HNB A;  2AHE A;  3LYP A;  5IMV A;  1YJ6 A;  2YAN A;  4WF4 A;  3RPP A;  2V32 A;  4DVC A;  1B8X A;  1ZYP A;  3F3Q A;  4XS6 A;  1DSB A;  14GS A;  4POB A;  3NZN A;  3ME7 A;  2DIZ A;  4K7I A;  4TR4 A;  5IM9 A;  2YWN A;  4TKY A;  2HRN A;  4TR1 B;  3VWW A;  4ACS A;  5DDL A;  1QMV A;  4YKG A;  3C71 A;  5IQY A;  4G2E A;  1PD2 1;  2VCV A;  3ZZX A;  2BTO T;  1R7H A;  5CRD A;  2BJX A;  5IO0 A;  3K8N A;  1N8J A;  3NOF A;  3CRU A;  3ZLP A;  2MYG A;  1O73 A;  3HD5 A;  2WJU A;  5IOW A;  3TJG A;  2WUL A;  3RHC A;  3RDW A;  2VOC A;  1TK8 B;  4AF2 A;  3F3R A;  1SL2 B;  1TU8 A;  1GUH A;  2NPB A;  2RUF A;  1TW9 A;  4KSM A;  4BIK A;  2VLV A;  5JCU A;  3TJB A;  3UIW A;  4F82 A;  1U88 A;  4ZXG A;  2C0F A;  8GSS A;  2MBS A;  1V40 A;  1JLW A;  4BA7 A;  3LQ7 A;  1ZOF A;  3JCM L;  1F9M A;  3US3 A;  2E7P A;  2A2R A;  3F8U A;  1U6T A;  1NHO A;  1SU9 A;  2JSZ A;  4X43 A;  1T00 A;  3ZVJ A;  1F37 A;  4USS A;  1G7O A;  1SKR B;  4WF5 A;  2B5Y A;  4X0X A;  2C80 A;  1LU4 A;  1AC1 A;  1M2A A;  4GWR A;  4MH3 A;  4JU5 A;  5C04 A;  2ON5 A;  1DUG A;  3UBK A;  4PQH A;  1YQ1 A;  1XWC A;  2L59 A;  1ZGN A;  1TDI A;  5CRE A;  4ZB9 A;  3CRT A;  3UL3 A;  4POL A;  1THO A;  1PL2 A;  1XWA A;  3N5O A;  4ZB6 A;  2ON7 A;  2LKU A;  3GX0 A;  1OC8 A;  3TJF A;  4OFT A;  1BQ7 A;  4HQZ A;  1TOF A;  3TRP A;  4MDC A;  2E2M A;  3HVS A;  3FHK A;  2B5E A;  5KN3 A;  2DJJ A;  3QD9 A;  2O85 A;  1MDK A;  1J9B A;  1AQX A;  1O8W A;  2AUV A;  3QPM A;  3CBU A;  3ZIV A;  1OYJ A;  1A8L A;  2A2P A;  3VUR A;  4GRF A;  3RBT A;  2FLS A;  2DJ2 A;  2JZR A;  5EY6 A;  3UVT A;  4FIW A;  4Q5R A;  1VRS D;  2MMA A;  2VLT A;  4K8M A;  5COH A;  4MPF A;  2CV4 A;  2FGX A;  1XZO A;  1AAZ A;  5KOX A;  1MTC A;  2CVD A;  5ECM B;  2LRC A;  2GZY A;  1RK4 A;  4PUF C;  4DSS B;  1VF1 A;  1W4V A;  1EGR A;  3VPT A;  4PUR A;  4TR1 A;  3QOU A;  4KDY A;  2XPD A;  3F4R A;  3DRN A;  2DJ1 A;  5CP1 A;  1XPV A;  5H5R A;  3W8S A;  4IW9 A;  3NIV A;  2GSS A;  1PN0 A;  2HRA A;  4CY6 A;  1M3I A;  4AJ6 A;  4WET A;  1ERU A;  2H73 A;  2B6M A;  2DLX A;  4KB3 A;  2UZ8 A;  4QL9 A;  2K8V A;  2X8G A;  4K2D A;  2PPT A;  4E8E A;  3I69 A;  2H6X A;  4TVE A;  4O5Q A;  2DML A;  1THX A;  2AYT A;  5ECN B;  2X8C A;  4BL7 B;  1V57 A;  4MJE A;  1X0R A;  2VM2 A;  1GTU A;  3ZFL A;  2JAD A;  3G9B A;  5IMA A;  3IK9 A;  1GTA A;  2YJH A;  1M99 A;  5F0G A;  1A2L A;  1JZO A;  2IMI A;  2H72 A;  2IIY A;  2R37 A;  4XHM A;  3CXG A;  16GS A;  3A5W A;  1PGT A;  2RLI A;  4GTU A;  2HRK A;  3QFB C;  1WOU A;  4F2I A;  4O32 A;  2TIR A;  2HXK A;  1ML6 A;  5ECS A;  1JZR A;  3GL5 A;  3F9U A;  2O89 A;  3PPU A;  3WD6 A;  4WEY A;  2BMX A;  1M9A A;  4NHW A;  5F06 A;  3H1N A;  3LGC A;  2GZZ A;  1DBY A;  2EC4 A;  3LFL A;  3PGT A;  4TR0 A;  5GZZ B;  4TR3 A;  3QR6 A;  2GLR A;  4V1A g;  2H0I A;  6GSV A;  3WGE A;  2O7K A;  1URM A;  4GXZ A;  2NVL A;  1XVW A;  3BOA A;  3W6G A;  3BCK A;  3HXS A;  4N30 A;  3F4S A;  3HA9 A;  1GSS A;  4L5L A;  4OCF A;  1Y6E A;  2O8V B;  2QC7 A;  2QSI A;  4PXO A;  4KH7 A;  3P8W A;  4IBP A;  5KOW A;  2H76 A;  3WT2 A;  3IK7 A;  5LNK e;  4Q5Q A;  3GYK A;  5J4U A;  3C1R A;  3GX8 A;  4F0C A;  2B7K A;  2H1G A;  3KP8 A;  4DSS A;  2DBC A;  3IRA A;  1S3R A;  2OE0 A;  3VI7 A;  4ECI A;  4FH8 A;  1NW2 A;  1F2E A;  1PX7 A;  4WBR D;  4CW9 A;  2V41 A;  1R26 A;  1TI3 A;  3TKS C;  1FHE A;  3M1G A;  5JWO B;  1J08 A;  3TKP A;  4KSO A;  3HVN A;  3QDN A;  5INY A;  3Q6O A;  1ZMA A;  2AB6 A;  4I8B A;  1OVN A;  3DWV A;  2FNO A;  2H0H A;  5HR1 A;  5F8B A;  3CTF A;  2P0G A;  2IFQ B;  2DIY A;  4EDZ A;  1YF1 A;  1E2Y A;  1NSW A;  3FR6 A;  3GHA A;  1TKD B;  2H70 A;  1BAY A;  4ZBD A;  3HYP A;  2PBJ A;  4EF0 A;  2OBK A;  3UBL A;  1X5E A;  4NWY A;  4BL7 A;  1G7E A;  3EVI A;  3HZ4 A;  1GSQ A;  2KHP A;  4FYC A;  2YNX A;  3KM6 A;  4WBJ A;  3QFA C;  4XS4 B;  6GSY A;  2OAD A;  1F3B A;  2FCH A;  1TI1 A;  3ZYW A;  1A0F A;  3D6I A;  5HFG A;  4N11 A;  1WMJ A;  2VM1 A;  4I6X A;  5G30 A;  2A4V A;  1PL1 A;  2AAW A;  18GS A;  4MLY A;  2LEG A;  3CTG A;  2B5X A;  2R4V A;  4HQS A;  1FOH A;  3IAS 2;  2NDO A;  2CAI A;  4O5U A;  2LJK A;  2YOI A;  2MZC A;  5G5F A;  4IP1 A;  2JU5 A;  2HSH A;  4HEA 2;  5IO2 A;  3O76 A;  3V1W A;  1OC9 B;  1GUK A;  1HNA A;  5D96 A;  2IWT A;  2JSY A;  4N0Z A;  1SKW B;  5HQP A;  1OE8 A;  4FYU A;  2DKI A;  4HI7 A;  4MF6 A;  4KCE A;  3KTB A;  4E8H A;  1K3L A;  2PER A;  3TCO A;  1CQH A;  4NPB A;  1YZX A;  1XW9 A;  3H8Q A;  1K0B A;  1GNE A;  2C0G A;  2CVK A;  3GN3 A;  12GS A;  1EEJ A;  2IPA A;  3L78 A;  2H75 A;  3C7M A;  4LL1 B;  4V2M A;  1C72 A;  2H19 A;  3IC4 A;  2TRC P;  3ZRD A;  2ES7 A;  7GSS A;  1O85 A;  1K0N A;  1V98 A;  2FHE A;  1HYU A;  2GST A;  3ZMK A;  3KTL A;  5CO3 A;  2GGT A;  2IJY A;  1GLP A;  1TTZ A;  2MMN A;  4KW6 A;  3VFI A;  1UVZ A;  3HY2 A;  4OFM A;  2FWG A;  5H5Q A;  1Z7R A;  3D4T A;  2GDR A;  5DJL A;  3CSI A;  2K8S A;  3C73 A;  2C0E A;  1T7P B;  1K0M A;  1LJR A;  1XWK A;  3HDC A;  2K9F A;  2JAC A;  4FYB A;  4AJ8 A;  1RW1 A;  1NM3 A;  4GSN A;  2D2Z A;  1GRX A;  5E4W A;  4ZBA A;  5ID2 B;  4J56 E;  1TK5 B;  2CQ9 A;  4WR4 A;  5A4V A;  4IVF A;  3UEM A;  4RUV A;  2MBT A;  3FZ9 A;  1KTE A;  1XCC A;  1GSE A;  4YH2 A;  3EYT A;  1G6W A;  2IFQ A;  1W89 A;  1ZYQ B;  4GLT A;  3MIX A;  3UOM A;  1ACV A;  3LYK A;  5ELG A;  1FVK A;  2VAF A;  3HJM A;  4TW5 A;  2C3Q A;  5AIV A;  3UMA A;  1GP1 A;  3MYD A;  1BX9 A;  1O8X A;  1JHB A;  4K6X A;  4ZBB A;  2OBI A;  4PX1 A;  2I9H A;  4XS4 A;  1SL1 B;  2F9S A;  1GTB A;  2HSM A;  2KUC A;  3EWL A;  2XHF A;  2YWO A;  4DSR A;  4KDX A;  2B1K A;  2LST A;  3KMO A;  4KND A;  2VIM A;  2GVP A;  4DSQ A;  1XWG A;  2AV4 A;  3DML A;  4XRA A;  1Z3E A;  2CX3 A;  4ZL7 A;  4HJ2 A;  3HCZ A;  2V6K A;  2H71 A;  1GH2 A;  4KF9 A;  4L5O A;  3LJR A;  4IN0 A;  2R0P A;  2C3N A;  3GUS A;  1I9D A;  2A4H A;  3ZIT A;  1OC9 A;  4EUY A;  3DD3 A;  5BRT A;  3L0H A;  4K5S A;  2J9H A;  1ERV A;  3APO A;  3IDV A;  4X4J A;  4EXJ A;  2E2G A;  2DJ3 A;  2GQK A;  2LJA A;  5GAN D;  4ML1 A;  3GTU B;  2VCQ A;  2GT5 A;  3MWH A;  1CQG A;  2WS2 A;  1ERW A;  1YKC A;  4I2U A;  4KX4 A;  5IPG A;  2WRT A;  3E0U A;  1M0U A;  2YZU A;  2H01 A;  4K1F A;  2L5L A;  3DXB A;  3DEX A;  3GKX A;  2H8L A;  3TGZ A;  1EWX A;  2I81 A;  1SYR A;  4KDU A;  2GTU A;  2F51 A;  3KGK A;  4MAB A;  1S3C A;  5DAK B;  4PQ1 A;  3LG6 A;  4MF5 A;  1TJD A;  1K0O A;  1TRW A;  3MSZ A;  2LV3 A;  1T3B A;  4HZ2 A;  4EKZ A;  2VL9 A;  1SEN A;  4ECC A;  1FVJ A;  2L6D A;  3HVV A;  5JCG A;  3UAP A;  5IIZ A;  3ZML A;  3FK8 A;  3FMW A;  4GST A;  1KBN A;  2P5Q A;  5CNW A;  1YEP A;  3TB2 A;  1MD3 A;  5ID2 A;  1TRS A;  4JR4 A;  3ERF A;  3UVH A;  5HR3 A;  3GSS A;  4KA0 A;  4AGS A;  3RAZ A;  2FA4 A;  2GQL A;  3F6D A;  2X99 A;  4IGJ A;  2IME A;  4LL4 B;  9GSS A;  1GUM A;  2OJL A;  5B6N A;  1BJX A;  3LSZ A;  2X8H A;  2K6V A;  1H4O A;  2HZE B;  4LMW A;  1PKW A;  3BBY A;  1ZZY A;  4CHS A;  4GQC A;  1SK2 A;  3IC8 A;  2EIR A;  2QA1 A;  10GS A;  1EOH A;  2F8F A;  2I4A A;  1XFL A;  3GRX A;  1EOG A;  1SJZ A;  4NMU A;  1UC7 A;  1XBS A;  4F03 A;  4G0I A;  3C1S A;  5DQY A;  1K0A A;  1GL8 A;  1Q98 A;  2G2Q A;  4BVX B;  2YV9 A;  4RQX A;  2YPM A;  5CRH A;  3EMX A;  4XS1 A;  3GUR A;  2VD0 A;  5D9V A;  3CMI A;  4BVY B;  2DSA A;  4ECJ A;  4MZW A;  3F63 A;  4F0B A;  3L9U A;  2MMO A;  2A2S A;  5D8I A;  4V2N A;  3WGD A;  1BG5 A;  4P3Y B;  5EL8 A;  2YWI A;  4MA9 A;  4I5Q A;  2FWH A;  5F07 A;  2IMD A;  2VCZ A;  5CRG A;  4EIP A;  1S3D A;  2HI7 A;  3GTU A;  1A8Y A;  2R0C A;  1GSY A;  4MJA A;  1Z9H A;  5AGY A;  4NXI A;  2HE3 A;  3DGQ A;  1J0F A;  2DKH A;  1GSU A;  4OMV A;  3KP9 A;  5EPF A;  4K5R A;  1HNC A;  4HU7 A;  3PR8 A;  3VWX A;  2LS5 A;  3EMP A;  2M80 A;  1X9M B;  5KN0 A;  2X49 A;  4MCU A;  3WGX A;  3DIE A;  1H75 A;  1OKD A;  2WZ9 A;  3IXR A;  2H1B A;  4MF7 A;  2FWE A;  1QK8 A;  5DAK A;  2PVO C;  2XBI A;  4FO5 A;  1FB6 A;  4LMV A;  4L0U A;  3Q74 A;  5ECL B;  2F8A A;  2L6C A;  1SJI A;  5DAL B;  4DEJ A;  2KLX A;  5DCH A;  1Q4J A;  3HHV A;  5KN2 A;  5ECH B;  3MNG A;  2E0Q A;  1ZL9 A;  2C1Y A;  3LOR A;  2M72 A;  5AIX A;  2JZT A;  1PMT A;  5G1L A;  1A0R P;  3ZL5 A;  4JE1 A;  2WB9 A;  2DJ0 A;  3SWL A;  3OR5 A;  4IEL A;  2PVQ A;  2HYX A;  2F3M A;  3D21 A;  4K9Z A;  1V2A A;  1JFU A;  1B48 A;  2OKA A;  4RQR A;  3KD0 A;  3GL3 A;  1O6J A;  3Q18 A;  1PSQ A;  4TXV A;  2PN8 A;  1B9X C;  4YKF A;  4OFN A;  4YQV A;  2V6O A;  3L9S A;  1SJ6 A;  3E3E A;  2VUP A;  1AIU A;  3H4K A;  1HD2 A;  1ILO A;  3IA1 A;  4MP4 A;  4F9Z A;  5DCG A;  2HZE A;  4IHU A;  4EL1 A;  2I3Y A;  3A5I A;  1PKZ A;  2MMZ A;  1SD9 A;  4KUN A;  4NV5 A;  5D93 A;  3TDG A;  1TXX A;  2C4J A;  1XW5 A;  4PQI A;  3G7I A;  3QAV A;  4GCI A;  5ENU A;  3U6V A;  2PGT A;  2I1U A;  3D0Z A;  1T8E B;  2HT9 A;  2OE3 A;  1WRY A;  1X9S B;  3O3T A;  4BVX A;  1OE7 A;  1KNG A;  3EU3 A;  2H1D A;  3FR3 A;  3MAK A;  1Y25 A;  5EVO A;  2B3S A;  3MDK A;  4X1U A;  3A2X A;  4XCS A;  4BWQ A;  4MZB A;  20GS A;  5ECO B;  4BVY A;  4TXO B;  3F4T A;  1X5C A;  2L4Q A;  1GSF A;  4HDE A;  1YY7 A;  3EPT A;  3GKM A;  1M9B A;  4LLR A;  3E9J B;  3FRC A;  1K3O A;  1S3A A;  3A2V A;  1AUC A;  3EU4 A;  3GH9 A;  3GH6 A;  3GST A;  3FY7 A;  4QQ7 A;  3IR4 A;  4I97 A;  1G0T A;  2FWF A;  3DVW A;  2VL2 A;  2LRN A;  3ED3 A;  3FZ4 A;  4BWS A;  1O7U A;  4KE3 A;  4IS0 A;  2GQM A;  5HR0 A;  1Z6M A;  4K0N A;  3H93 A;  1BED A;  5ECK B;  2VO4 A;  1U87 A;  2ZNM A;  3R2Q A;  4ZIJ A;  3APS A;  11GS A;  2R3X A;  4IJ3 A;  1UA5 A;  4PGT A;  2V1M A;  5FWG A;  2GZP A;  2YN1 A;  5D9T A;  5DAL A;  4KGI A;  1OAZ A;  1A23 A;  1SYX A;  1YDK A;  4ZIL A;  5JCW A;  2KOK A;  4J57 E;  5D9X A;  3APQ A;  2N5F A;  1QQ2 A;  2V2G A;  2HSY A;  1T4Z A;  3DKS A;  3TOT A;  2EIQ A;  4HU9 A;  2RM6 A;  2OE1 A;  2N5A A;  3CQF A;  3DYR A; 
#chains in the Genus database with same CATH homology
 5G2Z A;  2VD1 A;  2HRF A;  2JL4 A;  2YZH A;  1EV4 A;  5CAX A;  4GSS A;  3ERW A;  3UAR A;  3IV4 A;  3IAM 2;  3EC3 A;  1YEX A;  4K0G A;  1M2D A;  4LA1 A;  1IYI A;  2KP1 A;  2RM5 A;  1FOV A;  2EIO A;  3J7Y b;  1F6M C;  3VWV A;  3LXT A;  4CY8 A;  3BD2 A;  4ECB A;  2NBS A;  2J23 A;  5AIS A;  3D22 A;  4ICY A;  4MMM A;  3UJ1 A;  3CYN A;  4G19 A;  2QKE A;  1Z7P A;  1B4P A;  4A5P A;  2H6Z A;  1FB0 A;  5KN1 A;  5J3R A;  1PA3 A;  2QA2 A;  3ZVJ D;  2RII A;  1AXD A;  4TXO A;  5FHI A;  4O7H A;  3M9J A;  4V2L A;  3VPQ A;  2CAQ A;  2VLU A;  3LXZ A;  3H79 A;  5HFK A;  1T4Y A;  5GST A;  2K18 A;  1E6B A;  1GTI A;  3VI5 A;  1ZCP A;  3P7X A;  3GV1 A;  5CRW A;  5DQS A;  1ZYE A;  2REM A;  1DE2 A;  3M8N A;  4G9H A;  2FY6 A;  3EE2 A;  4POK A;  2WFC A;  2WDU A;  1G6Y A;  5AN1 A;  3BJ5 A;  1Z6N A;  4N10 A;  3QCP A;  4WKW A;  4K7N A;  1K3Y A;  3GKK A;  3A3T A;  4NV2 A;  2LNS A;  2YV7 A;  3KZQ A;  3L9V A;  1VF4 A;  1X5D A;  4OWY A;  4OCE A;  5A5K A;  4HOJ A;  2LJR A;  3WT1 A;  4YAP A;  3GNJ A;  1WP0 A;  1PRX A;  1ZYN A;  2LRT A;  17GS A;  1TU7 A;  3I6A A;  4TOP A;  1EGO A;  4O5R A;  4Q5F A;  3FZ5 A;  2CVB A;  2YCD A;  3TRQ A;  5JWR B;  3QAW A;  4XTS A;  3C8E A;  2P5R A;  3ZRE A;  2PMT A;  2CZ3 A;  2ALB A;  2N5B A;  2PUK C;  2R2J A;  1ST9 A;  3KMN A;  5G5E A;  5BMU A;  5FT3 A;  3TRX A;  4HUA A;  1M7T A;  2CA8 A;  4IJI A;  5ECI B;  2VCW A;  1R4W A;  1FAA A;  3IE3 A;  2H0G A;  2GSR A;  2IN3 A;  3HJP A;  3VWU A;  5IMZ A;  5DVB A;  2C0D A;  3O6T A;  1AW9 A;  5IPH A;  1EEM A;  3W8J A;  5ABR A;  3GIX A;  1QUW A;  2X64 A;  4L0W A;  4ULX A;  4Z7X A;  3CSJ A;  3Q19 A;  4G0L A;  4XRD A;  3FW2 A;  3IOS A;  2ZCT A;  1FG4 A;  4TRX A;  1WIK A;  4V1A p;  5J9B A;  4QL7 A;  1MDI A;  1V9W A;  4O92 A;  5DJM A;  1SL0 B;  1GUL A;  3PIN A;  3I9V 2;  5IMF A;  4XIH A;  1YKA A;  2CT6 A;  3F6F A;  4MPG A;  4D73 B;  2PWJ A;  3KIJ A;  3ERG A;  3HZ8 A;  3TKR A;  3D5J A;  2P31 A;  3J7Y k;  4MJC A;  1GSD A;  4BPY A;  1B4Q A;  4KAE A;  2QGV A;  3SBC A;  3TKQ A;  4MK3 A;  2L4C A;  4JED A;  4G0K A;  4IP6 A;  3LEF A;  5IOX A;  3TJK A;  1EP8 A;  4PUA A;  1TRV A;  3S9F A;  3KEB A;  5ECR B;  3U5R E;  2VCX A;  1QXH A;  4ZB8 A;  4ZL8 A;  4MZC A;  1Z5Y E;  4YAV A;  2DC5 A;  1RQM A;  2XBQ A;  4IKH A;  5DBQ A;  1SK0 A;  4K7O A;  2R5G A;  1LBK A;  3FEU A;  4RI7 A;  2LTK A;  1XOB A;  2HNL A;  1K0C A;  5HFI A;  3EIN A;  5B8A A;  1F3A A;  3DVX A;  3AY8 A;  4PNG A;  5LCZ A;  2M46 A;  1JZD A;  1K0D A;  2FD3 A;  2CX4 A;  4EO3 A;  2IMK A;  1VF2 A;  3CSH A;  4IQA A;  4EDY A;  4POM A;  3M9K A;  4Q5N A;  3HKR A;  1MDJ A;  4NHZ A;  3IBH A;  3GA4 A;  2L57 A;  3KXO A;  5E59 A;  1B9Y C;  3D4M A;  5ECP B;  1QFN A;  3F0I A;  1ABA A;  2YJ7 A;  3KH9 A;  3HVX A;  2C8U A;  4HZ4 A;  2GSQ A;  5KEJ A;  1EZK A;  3TOU A;  3A2W A;  2R6K A;  2DMM A;  5L71 A;  1YF0 A;  2OAC A;  3FYG A;  2H1A A;  4ML6 A;  2B7J A;  2LQO A;  3RPN A;  3ISO A;  1N2A A;  5B7C A;  5IMD A;  5J9C A;  1OKT A;  4RI6 A;  1WPI A;  1T1V A;  1TK0 B;  1O81 A;  4HJM A;  2KP2 A;  4ILF A;  1M2B A;  1JZW A;  2R0G A;  5HR2 A;  4Z2U A;  4JBB A;  5F05 A;  1OC3 A;  5D73 A;  2YWM A;  2G0F A;  3ZIJ A;  3VLN A;  1VGL A;  2VCT A;  4D73 A;  2PU9 C;  3FZA A;  1X9W B;  2L5O A;  4MH2 A;  5G1K A;  4CDO A;  1A24 A;  1FW1 A;  2RUE A;  2HZF A;  1I5G A;  5G31 A;  3TKS E;  1TP9 A;  1R5A A;  4L8E A;  1DE1 A;  4WR5 A;  4Z2T A;  1ON4 A;  2IL3 A;  6GSX A;  2IMF A;  2AJQ B;  2B1L A;  4GQF A;  4MNN A;  3KCM A;  2LNT A;  3KH7 A;  4PTS A;  1EP7 A;  1V58 A;  3G7J A;  3GFK A;  1SKS B;  3GKN A;  4EE0 A;  4HS1 A;  3L4N A;  2VL3 A;  3LW9 A;  2HFD A;  2VL2 C;  3N9J A;  5D9W A;  4YQM A;  2GS3 A;  3M0F A;  5A4U A;  3ZFB A;  3LWA A;  2XPE A;  4N0V A;  2JZS A;  5ECQ B;  3M3M A;  19GS A;  1UN2 A;  1PX6 A;  2X4A A;  4AJ7 A;  5CYY A;  5IMC A;  3IPZ A;  1GWC A;  2DJK A;  3FR9 A;  1MD4 A;  6GSU A;  1A2J A;  3BCI A;  1JLV A;  2GT6 A;  3WYW A;  1KEB A;  3TKS A;  1WJK A;  3TUE A;  3ME8 A;  3IHQ A;  1A2M A;  3TJJ A;  1IYH A;  3P90 A;  1BYE A;  4J2F A;  3RHB A;  1U3I A;  3G7Y A;  2FUG 2;  2Z9S A;  2ZUP A;  5H5S A;  5GAP D;  1WE0 A;  1XOA A;  3QAG A;  1SK1 A;  4PNF A;  3QMX A;  1TRU A;  1FO5 A;  4ID0 A;  4KCA A;  2LUS A;  1SD8 A;  1EV9 A;  1R5P A;  2CZ2 A;  4K2X A;  3I43 A;  1GNW A;  2OA7 A;  2WGR A;  5B8B A;  1QGV A;  3EUR A;  4JR6 A;  2LQQ A;  4MJB A;  1MEK A;  4EVM A;  2TRX A;  4G10 A;  1AQV A;  2H66 A;  4EIQ A;  4I2T A;  1NHY A;  2YP6 A;  1XIY A;  3GMF A;  2H6Y A;  4Z2R A;  1XXU A;  1AQW A;  3IHG A;  6GST A;  5GSS A;  4TN8 A;  1XW6 A;  6GSS A;  1XWB A;  4FQU A;  5B6M A;  3PH9 A;  1GLQ A;  2XC2 A;  4OO5 A;  2H30 A;  1WWJ A;  4IQ1 A;  4NAX A;  5A4W A;  5J5N A;  2C3T A;  4EC0 A;  1USB A;  2NTO A;  3ZTL A;  2HLS A;  4WXT A;  5ELA A;  4H86 A;  2FA8 A;  3VK9 A;  3KJY A;  4OD7 A;  1PQN A;  4YQU A;  13GS A;  4ZL9 A;  4JRR A;  6GSW A;  1VF3 A;  3HJO A;  5LD0 A;  2H74 A;  1PN9 A;  5J41 A;  22GS A;  4JZQ A;  1HQO A;  4OO4 A;  2O87 A;  1XVQ A;  5JWQ B;  4ISD A;  2WCI A;  1U3A A;  4GF0 A;  5C00 A;  1ERT A;  3R3E A;  3FKF A;  3P2A A;  1HNB A;  2AHE A;  3LYP A;  5IMV A;  1YJ6 A;  2YAN A;  4WF4 A;  3RPP A;  2V32 A;  4DVC A;  1B8X A;  1ZYP A;  3F3Q A;  4XS6 A;  1DSB A;  14GS A;  4POB A;  3NZN A;  3ME7 A;  2DIZ A;  4K7I A;  4TR4 A;  5IM9 A;  2YWN A;  4TKY A;  2HRN A;  4TR1 B;  3VWW A;  4ACS A;  5DDL A;  1QMV A;  4YKG A;  3C71 A;  5IQY A;  4G2E A;  1PD2 1;  2VCV A;  3ZZX A;  2BTO T;  1R7H A;  5CRD A;  2BJX A;  5IO0 A;  3K8N A;  1N8J A;  3NOF A;  3CRU A;  3ZLP A;  2MYG A;  1O73 A;  3HD5 A;  2WJU A;  5IOW A;  3TJG A;  2WUL A;  3RHC A;  3RDW A;  2VOC A;  1TK8 B;  4AF2 A;  3F3R A;  1SL2 B;  1TU8 A;  1GUH A;  2NPB A;  2RUF A;  1TW9 A;  4KSM A;  2VLV A;  5JCU A;  3TJB A;  3UIW A;  4F82 A;  1U88 A;  4ZXG A;  2C0F A;  8GSS A;  2MBS A;  1V40 A;  1JLW A;  4BA7 A;  3LQ7 A;  1ZOF A;  3JCM L;  1F9M A;  3US3 A;  2E7P A;  2A2R A;  3F8U A;  1U6T A;  1NHO A;  1SU9 A;  2JSZ A;  4X43 A;  1T00 A;  3ZVJ A;  1F37 A;  4USS A;  1G7O A;  1SKR B;  4WF5 A;  2B5Y A;  4X0X A;  2C80 A;  1LU4 A;  1AC1 A;  1M2A A;  4GWR A;  4MH3 A;  4JU5 A;  5C04 A;  2ON5 A;  1DUG A;  3UBK A;  4PQH A;  1YQ1 A;  1XWC A;  2L59 A;  1ZGN A;  1TDI A;  5CRE A;  4ZB9 A;  3CRT A;  3UL3 A;  4POL A;  1THO A;  1PL2 A;  1XWA A;  3N5O A;  4ZB6 A;  2ON7 A;  2LKU A;  3GX0 A;  1OC8 A;  3TJF A;  4OFT A;  1BQ7 A;  4HQZ A;  1TOF A;  3TRP A;  4MDC A;  2E2M A;  3HVS A;  3FHK A;  2B5E A;  5KN3 A;  2DJJ A;  3QD9 A;  2O85 A;  1MDK A;  1J9B A;  1AQX A;  1O8W A;  2AUV A;  3QPM A;  3CBU A;  3ZIV A;  1OYJ A;  1A8L A;  2A2P A;  3VUR A;  4GRF A;  3RBT A;  2FLS A;  2DJ2 A;  2JZR A;  5EY6 A;  3UVT A;  4FIW A;  4Q5R A;  1VRS D;  2MMA A;  2VLT A;  4K8M A;  5COH A;  4MPF A;  2CV4 A;  2FGX A;  1XZO A;  1AAZ A;  5KOX A;  1MTC A;  2CVD A;  5ECM B;  2LRC A;  2GZY A;  1RK4 A;  4PUF C;  4DSS B;  1VF1 A;  1W4V A;  1EGR A;  3VPT A;  4PUR A;  4TR1 A;  3QOU A;  4KDY A;  2XPD A;  3F4R A;  3DRN A;  2DJ1 A;  5CP1 A;  1XPV A;  5H5R A;  3W8S A;  4IW9 A;  3NIV A;  2GSS A;  1PN0 A;  2HRA A;  4CY6 A;  4AJ6 A;  4WET A;  1ERU A;  2H73 A;  2B6M A;  2DLX A;  4KB3 A;  2UZ8 A;  4QL9 A;  2K8V A;  2X8G A;  4K2D A;  2PPT A;  4E8E A;  3I69 A;  2H6X A;  4TVE A;  4O5Q A;  2DML A;  1THX A;  2AYT A;  5ECN B;  2X8C A;  4BL7 B;  1V57 A;  4MJE A;  1X0R A;  2VM2 A;  1GTU A;  3ZFL A;  2JAD A;  3G9B A;  5IMA A;  3IK9 A;  1GTA A;  2YJH A;  1M99 A;  5F0G A;  1A2L A;  1JZO A;  2IMI A;  2H72 A;  2IIY A;  2R37 A;  4XHM A;  3CXG A;  16GS A;  3A5W A;  1PGT A;  2RLI A;  4GTU A;  2HRK A;  3QFB C;  1WOU A;  4F2I A;  4O32 A;  2TIR A;  2HXK A;  1ML6 A;  5ECS A;  1JZR A;  3GL5 A;  3F9U A;  2O89 A;  3PPU A;  3WD6 A;  4WEY A;  2BMX A;  1M9A A;  4NHW A;  5F06 A;  3H1N A;  3LGC A;  2GZZ A;  1DBY A;  2EC4 A;  3LFL A;  3PGT A;  4TR0 A;  5GZZ B;  4TR3 A;  3QR6 A;  2GLR A;  4V1A g;  2H0I A;  6GSV A;  3WGE A;  2O7K A;  1URM A;  4GXZ A;  2NVL A;  1XVW A;  3BOA A;  3W6G A;  3BCK A;  3HXS A;  4N30 A;  3F4S A;  3HA9 A;  1GSS A;  4L5L A;  4OCF A;  1Y6E A;  2O8V B;  2QC7 A;  2QSI A;  4PXO A;  4KH7 A;  3P8W A;  4IBP A;  5KOW A;  2H76 A;  3WT2 A;  3IK7 A;  5LNK e;  4Q5Q A;  3GYK A;  5J4U A;  3C1R A;  3GX8 A;  4F0C A;  2B7K A;  2H1G A;  3KP8 A;  4DSS A;  2DBC A;  3IRA A;  2OE0 A;  3VI7 A;  4ECI A;  4FH8 A;  1NW2 A;  1F2E A;  1PX7 A;  4WBR D;  4CW9 A;  2V41 A;  1R26 A;  1TI3 A;  3TKS C;  1FHE A;  3M1G A;  5JWO B;  1J08 A;  3TKP A;  4KSO A;  3QDN A;  5INY A;  3Q6O A;  1ZMA A;  2AB6 A;  4I8B A;  1OVN A;  3DWV A;  2FNO A;  2H0H A;  5HR1 A;  5F8B A;  3CTF A;  2P0G A;  2IFQ B;  2DIY A;  4EDZ A;  1YF1 A;  1E2Y A;  1NSW A;  3FR6 A;  3GHA A;  1TKD B;  2H70 A;  1BAY A;  4ZBD A;  3HYP A;  2PBJ A;  4EF0 A;  2OBK A;  3UBL A;  1X5E A;  4NWY A;  4BL7 A;  1G7E A;  3EVI A;  3HZ4 A;  1GSQ A;  2KHP A;  4FYC A;  2YNX A;  3KM6 A;  4WBJ A;  3QFA C;  4XS4 B;  6GSY A;  2OAD A;  1F3B A;  2FCH A;  1TI1 A;  3ZYW A;  1A0F A;  3D6I A;  5HFG A;  4N11 A;  1WMJ A;  2VM1 A;  4I6X A;  5G30 A;  2A4V A;  1PL1 A;  2AAW A;  18GS A;  4MLY A;  2LEG A;  3CTG A;  2B5X A;  2R4V A;  4HQS A;  1FOH A;  3IAS 2;  2NDO A;  2CAI A;  4O5U A;  2LJK A;  2YOI A;  2MZC A;  5G5F A;  4IP1 A;  2JU5 A;  2HSH A;  4HEA 2;  5IO2 A;  3O76 A;  3V1W A;  1OC9 B;  1GUK A;  1HNA A;  5D96 A;  2IWT A;  2JSY A;  4N0Z A;  1SKW B;  5HQP A;  1OE8 A;  4FYU A;  2DKI A;  4HI7 A;  4MF6 A;  4KCE A;  3KTB A;  4E8H A;  1K3L A;  2PER A;  3TCO A;  1CQH A;  4NPB A;  1YZX A;  1XW9 A;  3H8Q A;  1K0B A;  1GNE A;  2C0G A;  2CVK A;  3GN3 A;  12GS A;  1EEJ A;  2IPA A;  3L78 A;  2H75 A;  3C7M A;  4LL1 B;  4V2M A;  1C72 A;  2H19 A;  3IC4 A;  2TRC P;  3ZRD A;  2ES7 A;  7GSS A;  1O85 A;  1K0N A;  1V98 A;  2FHE A;  1HYU A;  2GST A;  3ZMK A;  3KTL A;  5CO3 A;  2GGT A;  2IJY A;  1GLP A;  1TTZ A;  2MMN A;  4KW6 A;  3VFI A;  1UVZ A;  3HY2 A;  4OFM A;  2FWG A;  5H5Q A;  1Z7R A;  3D4T A;  2GDR A;  5DJL A;  3CSI A;  2K8S A;  3C73 A;  2C0E A;  1T7P B;  1K0M A;  1LJR A;  1XWK A;  3HDC A;  2K9F A;  2JAC A;  4FYB A;  4AJ8 A;  1RW1 A;  1NM3 A;  4GSN A;  2D2Z A;  1GRX A;  5E4W A;  4ZBA A;  5ID2 B;  4J56 E;  1TK5 B;  2CQ9 A;  4WR4 A;  5A4V A;  4IVF A;  3UEM A;  4RUV A;  2MBT A;  3FZ9 A;  1KTE A;  1XCC A;  1GSE A;  4YH2 A;  3EYT A;  1G6W A;  2IFQ A;  1W89 A;  1ZYQ B;  4GLT A;  3MIX A;  3UOM A;  1ACV A;  3LYK A;  5ELG A;  1FVK A;  2VAF A;  3HJM A;  4TW5 A;  2C3Q A;  5AIV A;  3UMA A;  1GP1 A;  3MYD A;  1BX9 A;  1O8X A;  1JHB A;  4K6X A;  4ZBB A;  2OBI A;  4PX1 A;  2I9H A;  4XS4 A;  1SL1 B;  2F9S A;  1GTB A;  2HSM A;  2KUC A;  3EWL A;  2XHF A;  2YWO A;  4DSR A;  4KDX A;  2B1K A;  2LST A;  3KMO A;  4KND A;  2VIM A;  2GVP A;  4DSQ A;  1XWG A;  2AV4 A;  3DML A;  4XRA A;  1Z3E A;  2CX3 A;  4ZL7 A;  4HJ2 A;  3HCZ A;  2V6K A;  2H71 A;  1GH2 A;  4KF9 A;  4L5O A;  3LJR A;  4IN0 A;  2R0P A;  2C3N A;  3GUS A;  1I9D A;  2A4H A;  3ZIT A;  1OC9 A;  4EUY A;  3DD3 A;  5BRT A;  3L0H A;  4K5S A;  2J9H A;  1ERV A;  3APO A;  3IDV A;  4X4J A;  4EXJ A;  2E2G A;  2DJ3 A;  2GQK A;  2LJA A;  5GAN D;  4ML1 A;  3GTU B;  2VCQ A;  2GT5 A;  3MWH A;  1CQG A;  2WS2 A;  1ERW A;  1YKC A;  4I2U A;  4KX4 A;  5IPG A;  2WRT A;  3E0U A;  1M0U A;  2YZU A;  2H01 A;  4K1F A;  2L5L A;  3DXB A;  3DEX A;  3GKX A;  2H8L A;  3TGZ A;  1EWX A;  2I81 A;  1SYR A;  4KDU A;  2GTU A;  2F51 A;  3KGK A;  4MAB A;  1S3C A;  5DAK B;  4PQ1 A;  3LG6 A;  4MF5 A;  1TJD A;  1K0O A;  1TRW A;  3MSZ A;  2LV3 A;  1T3B A;  4HZ2 A;  4EKZ A;  2VL9 A;  1SEN A;  4ECC A;  1FVJ A;  2L6D A;  3HVV A;  5JCG A;  3UAP A;  5IIZ A;  3ZML A;  3FK8 A;  3FMW A;  4GST A;  1KBN A;  2P5Q A;  5CNW A;  1YEP A;  3TB2 A;  1MD3 A;  5ID2 A;  1TRS A;  4JR4 A;  3ERF A;  3UVH A;  5HR3 A;  3GSS A;  4KA0 A;  4AGS A;  3RAZ A;  2FA4 A;  2GQL A;  3F6D A;  2X99 A;  4IGJ A;  2IME A;  4LL4 B;  9GSS A;  1GUM A;  2OJL A;  5B6N A;  1BJX A;  3LSZ A;  2X8H A;  2K6V A;  1H4O A;  2HZE B;  4LMW A;  1PKW A;  3BBY A;  1ZZY A;  4CHS A;  4GQC A;  1SK2 A;  3IC8 A;  2EIR A;  2QA1 A;  10GS A;  1EOH A;  2F8F A;  2I4A A;  1XFL A;  3GRX A;  1EOG A;  1SJZ A;  4NMU A;  1UC7 A;  1XBS A;  4F03 A;  4G0I A;  3C1S A;  5DQY A;  1K0A A;  1GL8 A;  1Q98 A;  2G2Q A;  4BVX B;  2YV9 A;  4RQX A;  2YPM A;  5CRH A;  3EMX A;  4XS1 A;  3GUR A;  2VD0 A;  5D9V A;  3CMI A;  4BVY B;  2DSA A;  4ECJ A;  4MZW A;  3F63 A;  4F0B A;  3L9U A;  2MMO A;  2A2S A;  5D8I A;  4V2N A;  3WGD A;  1BG5 A;  4P3Y B;  5EL8 A;  2YWI A;  4MA9 A;  4I5Q A;  2FWH A;  5F07 A;  2IMD A;  2VCZ A;  5CRG A;  4EIP A;  1S3D A;  2HI7 A;  3GTU A;  1A8Y A;  2R0C A;  1GSY A;  4MJA A;  1Z9H A;  5AGY A;  4NXI A;  2HE3 A;  3DGQ A;  1J0F A;  2DKH A;  1GSU A;  4OMV A;  3KP9 A;  5EPF A;  4K5R A;  1HNC A;  4HU7 A;  3PR8 A;  3VWX A;  2LS5 A;  3EMP A;  2M80 A;  1X9M B;  5KN0 A;  2X49 A;  4MCU A;  3WGX A;  3DIE A;  1H75 A;  1OKD A;  2WZ9 A;  3IXR A;  2H1B A;  4MF7 A;  2FWE A;  1QK8 A;  5DAK A;  2PVO C;  2XBI A;  4FO5 A;  1FB6 A;  4LMV A;  4L0U A;  3Q74 A;  5ECL B;  2F8A A;  2L6C A;  1SJI A;  5DAL B;  4DEJ A;  2KLX A;  5DCH A;  1Q4J A;  3HHV A;  5KN2 A;  5ECH B;  3MNG A;  2E0Q A;  1ZL9 A;  2C1Y A;  3LOR A;  2M72 A;  5AIX A;  2JZT A;  1PMT A;  5G1L A;  1A0R P;  3ZL5 A;  4JE1 A;  2WB9 A;  2DJ0 A;  3SWL A;  3OR5 A;  4IEL A;  2PVQ A;  2HYX A;  2F3M A;  3D21 A;  4K9Z A;  1V2A A;  1JFU A;  1B48 A;  2OKA A;  4RQR A;  3KD0 A;  3GL3 A;  1O6J A;  3Q18 A;  1PSQ A;  4TXV A;  2PN8 A;  1B9X C;  4YKF A;  4OFN A;  4YQV A;  2V6O A;  3L9S A;  1SJ6 A;  3E3E A;  2VUP A;  1AIU A;  3H4K A;  1HD2 A;  1ILO A;  3IA1 A;  4MP4 A;  4F9Z A;  5DCG A;  2HZE A;  4IHU A;  4EL1 A;  2I3Y A;  3A5I A;  1PKZ A;  2MMZ A;  1SD9 A;  4KUN A;  4NV5 A;  5D93 A;  3TDG A;  1TXX A;  2C4J A;  1XW5 A;  4PQI A;  3G7I A;  3QAV A;  4GCI A;  5ENU A;  3U6V A;  2PGT A;  2I1U A;  3D0Z A;  1T8E B;  2HT9 A;  2OE3 A;  1WRY A;  1X9S B;  3O3T A;  4BVX A;  1OE7 A;  1KNG A;  3EU3 A;  2H1D A;  3FR3 A;  3MAK A;  1Y25 A;  5EVO A;  2B3S A;  3MDK A;  4X1U A;  3A2X A;  4XCS A;  4BWQ A;  4MZB A;  20GS A;  5ECO B;  4BVY A;  4TXO B;  3F4T A;  1X5C A;  2L4Q A;  1GSF A;  4HDE A;  1YY7 A;  3EPT A;  3GKM A;  1M9B A;  4LLR A;  3E9J B;  3FRC A;  1K3O A;  1S3A A;  3A2V A;  1AUC A;  3EU4 A;  3GH9 A;  3GH6 A;  3GST A;  3FY7 A;  4QQ7 A;  3IR4 A;  4I97 A;  1G0T A;  2FWF A;  3DVW A;  2VL2 A;  2LRN A;  3ED3 A;  3FZ4 A;  4BWS A;  1O7U A;  4KE3 A;  4IS0 A;  2GQM A;  5HR0 A;  1Z6M A;  4K0N A;  3H93 A;  1BED A;  5ECK B;  2VO4 A;  1U87 A;  2ZNM A;  3R2Q A;  4ZIJ A;  3APS A;  11GS A;  2R3X A;  4IJ3 A;  1UA5 A;  4PGT A;  2V1M A;  5FWG A;  2GZP A;  2YN1 A;  5D9T A;  5DAL A;  4KGI A;  1OAZ A;  1A23 A;  1SYX A;  1YDK A;  4ZIL A;  5JCW A;  2KOK A;  4J57 E;  5D9X A;  3APQ A;  2N5F A;  1QQ2 A;  2V2G A;  2HSY A;  1T4Z A;  3DKS A;  3TOT A;  2EIQ A;  4HU9 A;  2RM6 A;  2OE1 A;  2N5A A;  3DYR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...