3EMXA

Crystal structure of thioredoxin from aeropyrum pernix
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
124
structure length
124
Chain Sequence
b'SLSYVKEGLAVLEDGRLIYITPEEFRQLLQGDAILAVYSKTCPHCHRDWPQLIQASKEVDVPIVMFIWGSLIGERELSAARLEMNKAGVEGTPTLVFYKEGRIVDKLVGATPWSLKVEKAREIY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Thioredoxin
publication title Crystal structure of thioredoxin from Aeropyrum pernix
rcsb
source organism Aeropyrum pernix
molecule tags Oxidoreductase
total genus 42
structure length 124
sequence length 124
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3emxA00
1U88A 2GQLA 3HY2A 3IPZA 3QDNA 2K8SA 3FEUA 3ZVJA 1M2BA 2GQMA 2ON5A 5CRWA 2KP2A 5IIZA 2GSQA 3WD6A 4JBBA 4MZCA 3RPPA 2ZUPA 3TJJA 1JHBA 1K0AA 1SJZA 19GSA 1QMVA 5G30A 2E0QA 1YF1A 2FCHA 1AIUA 2DJ1A 5B7CA 5CRDA 1QUWA 1ZOFA 1K3OA 3HJOA 2RLIA 1O6JA 1V58A 2NTOA 1Z6MA 2H30A 1TK0B 3WGEA 5E59A 1XWAA 5GSSA 2WRTA 3ED3A 3MWHA 1BG5A 1RW1A 4WR5A 6GSYA 10GSA 1MTCA 1S3DA 3A3TA 1GTAA 2HFDA 1RK4A 4EXJA 4GCIA 2H01A 3CYNA 4DSQA 3GIXA 2O89A 3U6VA 1NSWA 2TRCP 2FLSA 2H0HA 1JLVA 4YH2A 4MCUA 1XVQA 2C3TA 6GSTA 1EV9A 5HR3A 3DVXA 4NPBA 4MF7A 4V2NA 3C73A 1TK5B 1O73A 5AISA 3KCMA 4ZL8A 2RM6A 2DJ2A 1QK8A 1Z5YE 2PBJA 1G6YA 4G10A 1V40A 2P5QA 4KSMA 4PQIA 5EVOA 1JFUA 3LEFA 3P8WA 4KCEA 4G2EA 4IBPA 1M7TA 3I69A 4WETA 1WE0A 1EGRA 3FHKA 2H1AA 2VUPA 2B7JA 5DVBA 5HFGA 1A2MA 2RUEA 4JRRA 4MABA 1OVNA 4XTSA 4OFMA 3KEBA 4ZL7A 4JR4A 1J08A 2NPBA 4RI6A 3GTUA 2R6KA 4PNFA 1SD8A 2NDOA 4MA9A 2GTUA 5J9BA 5LCZA 3O76A 2R4VA 4WBJA 5D9XA 4ML6A 4N11A 5JCUA 2VM2A 1UVZA 2C0EA 2IMEA 1R4WA 4D73B 2LNTA 2E7PA 2EIOA 2M80A 2V6OA 1X9SB 1V9WA 4WR4A 5H5QA 4EUYA 1T1VA 1OAZA 1KEBA 4TOPA 1ABAA 2DIYA 3FY7A 1SKSB 1M2DA 1ML6A 3EMPA 2F9SA 6GSVA 3TJGA 3M9JA 3QOUA 1THOA 3UVHA 4QL9A 4MPFA 3HD5A 3CMIA 2OKAA 3FKFA 1XPVA 3UMAA 1R26A 4YAPA 3O3TA 3ZFLA 2WULA 3I6AA 1JZOA 3H8QA 3VWUA 5IMDA 3I9V2 2F3MA 4BVYA 3P7XA 2GZPA 1XZOA 1Z9HA 2R2JA 2LQOA 2DJKA 5JWQB 2EIQA 3GV1A 3UJ1A 4HU7A 4XIHA 4MZWA 4HJMA 4ECJA 3RDWA 5ELGA 5ECNB 3TCOA 4L0UA 2B5XA 2FY6A 2NVLA 5GZZB 3KMNA 2O7KA 4NV5A 2YV9A 3L9UA 1EOHA 3TKSE 4Q5FA 3EU4A 5D9TA 3VPQA 1TW9A 1ZYQB 3WT1A 2QKEA 2CZ3A 2WGRA 3SBCA 4HJ2A 4I97A 4K6XA 4E8HA 2L5OA 5IQYA 1ZGNA 1HQOA 2JADA 2H66A 3TKSA 4OFTA 2DMMA 3FR3A 1FVJA 3IOSA 3GKMA 4MJCA 2J9HA 3MNGA 5GAPD 4ISDA 1THXA 2DIZA 1JZWA 1YKCA 1XOBA 3TJFA 3HA9A 5A5KA 5E4WA 1Q4JA 3E0UA 1MD4A 3ERFA 1OYJA 3Q6OA 3BJ5A 1WMJA 5G2ZA 2VCVA 2YN1A 4DSSB 5HR0A 3M0FA 11GSA 2I81A 3TJKA 1TOFA 5ID2A 2LSTA 4N0ZA 4IJIA 2VLUA 4LMVA 1GSQA 4I2UA 2ALBA 2H0IA 2JZSA 2KHPA 2BJXA 4AGSA 1K3YA 2GS3A 4HZ2A 1GSUA 4J2FA 1GLQA 4MF5A 1N2AA 1QFNA 1GSEA 2YWIA 2CZ2A 2LUSA 2L6DA 3LSZA 17GSA 3VLNA 3C71A 2OADA 3ERGA 3M8NA 3A2XA 4Q5RA 5ABRA 3UBLA 3TGZA 5A4UA 3MDKA 5B8AA 3VK9A 2A2SA 1ILOA 1GL8A 4TKYA 1T8EB 2C3QA 3TDGA 1XWGA 1ERVA 5ECHB 1SK0A 3ZFBA 2GSSA 4TXOB 5KN0A 2GSRA 2AHEA 2B5YA 3U5RE 4GWRA 5IOWA 2HNLA 3EVIA 1AQVA 2JACA 5CO3A 2H8LA 3GL3A 3BOAA 2YP6A 2CX3A 4Z7XA 4Q5NA 3APOA 5G5EA 5IPHA 1YEPA 3NZNA 2H6XA 1JZDA 2GZYA 3VWXA 3A2VA 2IFQB 3GSSA 4N0VA 3D5JA 5HR1A 3ZTLA 3IAS2 1A8LA 2GQKA 1AQXA 1K0BA 2VCQA 2B1LA 5B6MA 1O8WA 3GURA 4HUAA 3F4SA 2C3NA 4CW9A 2CV4A 3A2WA 5HR2A 2ZNMA 4V2MA 3TKRA 3WT2A 2EIRA 2PGTA 2CAQA 3DYRA 2YWOA 3GMFA 3K8NA 5FWGA 1DSBA 3UBKA 1DUGA 4IVFA 3HVVA 1FW1A 2IMKA 4HS1A 1OC9A 5ECRB 3ZYWA 1T4YA 3EC3A 2DLXA 5LNKe 5J9CA 3F6FA 3SWLA 2PN8A 3L4NA 3D4TA 4ZB8A 2P5RA 3F3RA 3D0ZA 3L78A 4OCFA 4PNGA 2CA8A 4IP6A 4NAXA 5ID2B 3LYPA 5IMAA 1VF4A 2X8GA 1IYHA 1VF1A 1X5DA 2DSAA 2VL2A 3GFKA 14GSA 5D93A 1EEMA 2BMXA 3APSA 2QSIA 1AUCA 2YCDA 1NM3A 5C00A 5GAND 3F63A 1SL0B 3M1GA 4D73A 5AN1A 5GSTA 3HJPA 4WF5A 3QR6A 2CT6A 3J7Yk 4MH2A 3WGDA 4BPYA 3GN3A 2HLSA 4K7IA 4GTUA 4ZBDA 2E2MA 4H86A 1X9MB 2V32A 1V98A 1G7EA 2TRXA 2B7KA 2K6VA 1H4OA 1T4ZA 1VGLA 3D22A 3C8EA 1XVWA 4MZBA 3QAGA 2MZCA 1XIYA 3CXGA 1XWBA 1GTBA 4X1UA 2B5EA 2WZ9A 4IELA 3GH6A 4IN0A 3W8SA 1HNBA 1Z6NA 3F4RA 2PVQA 5ELAA 1SKRB 1PD21 2V2GA 1B4QA 2AYTA 1O8XA 4L8EA 3KGKA 4KNDA 2XHFA 3O6TA 3HHVA 1YDKA 3KH7A 2ON7A 2H0GA 4XHMA 2DC5A 5C04A 4EDZA 4X43A 4BVXA 4IHUA 1TDIA 3UARA 1WJKA 2LJAA 1DE2A 3LYKA 2V6KA 4JEDA 1SK1A 3ZL5A 4HEA2 4KSOA 4IQAA 3GUSA 4GRFA 5CRHA 2LRNA 1EZKA 2MMNA 2PVOC 1VF2A 6GSUA 1Z7PA 3HCZA 4V1Ag 1GSFA 3UVTA 1FOVA 2WCIA 4BA7A 5DCHA 1OC9B 1WOUA 4TXVA 1A0RP 1XWCA 1ZMAA 1WPIA 3QD9A 4AJ8A 3M9KA 4MJBA 1A2JA 1GULA 3FYGA 3RPNA 5DJLA 5IMCA 4JE1A 5ECPB 2FWHA 4KH7A 4KE3A 3DWVA 3D6IA 4FYUA 2AB6A 4OO5A 1EEJA 5HQPA 2FA8A 2HE3A 2LRCA 5FHIA 3GHAA 3H93A 3HKRA 2OACA 2VCTA 2IPAA 3CTGA 1QQ2A 1K0OA 1XW9A 20GSA 4DSSA 1DE1A 4AJ6A 1A2LA 1OC3A 1PX7A 4TR0A 2IMDA 2FD3A 3N9JA 1TRVA 1LBKA 3H4KA 3F4TA 1HD2A 4FYBA 1YEXA 2V41A 1KTEA 4KX4A 3LGCA 3WYWA 5INYA 3DVWA 5IPGA 4KUNA 3EMXA 4RUVA 5AIVA 3WGXA 3QMXA 2G0FA 9GSSA 1V57A 1R5PA 2QC7A 2VOCA 3QFAC 2HRNA 1HYUA 3F3QA 4BL7A 4F9ZA 2I4AA 4AF2A 2GT6A 3C1SA 1SKWB 2IMIA 3BCKA 3BCIA 4PUAA 1H75A 1GUKA 4ZXGA 1OE8A 1BYEA 2Z9SA 1BEDA 4L5LA 1GTIA 4GXZA 3D4MA 5CREA 5CNWA 1TRWA 1ERTA 4XS1A 5COHA 1ZCPA 2KUCA 1TKDB 2DMLA 4MPGA 4DSRA 1TRUA 4TXOA 2L6CA 2KOKA 1KNGA 4FH8A 5J5NA 3CBUA 4ULXA 3TUEA 4MH3A 5J4UA 3I43A 3VPTA 2H1GA 2VLVA 1IYIA 1Z7RA 18GSA 1UC7A 3M3MA 2IFQA 4KB3A 1SJ6A 3FRCA 1T7PB 3ZIJA 5G1LA 1LJRA 1U6TA 1K0CA 5J3RA 2MMZA 2PPTA 2FUG2 1A8YA 5ECMB 4EO3A 1ERUA 5D73A 3ME8A 5DALB 1GUMA 2GLRA 3IDVA 2FA4A 1NHYA 4QQ7A 5B8BA 4HI7A 1S3AA 4LMWA 4MMMA 2REMA 2IWTA 4NHWA 5F0GA 2HSHA 2H19A 2FWFA 2I3YA 1B9XC 1G7OA 5ECKB 1EGOA 3C1RA 3RHCA 1YQ1A 3CRUA 3PR8A 3DIEA 5F06A 4N10A 1G0TA 2GSTA 2K8VA 4K7NA 4F03A 4EKZA 2MBSA 2WS2A 3EWLA 3IA1A 3DRNA 3DGQA 4I6XA 3GRXA 1K3LA 1GP1A 2O85A 1F3AA 2MBTA 3ZMLA 8GSSA 2LS5A 1X5CA 2FNOA 3IE3A 2LNSA 2L4QA 4O32A 4YAVA 3ZRDA 1M9BA 1ACVA 2DBCA 2H75A 3IRAA 4CHSA 5D9WA 5IO2A 2HXKA 2H73A 4PUFC 3FR6A 4KDUA 5D96A 1ZYEA 4XS4B 5CYYA 2RM5A 2VCZA 1EP7A 3MAKA 2F8AA 3GKNA 3J7Yb 2PWJA 2C0FA 1FO5A 2O87A 2HRFA 5J41A 4Q5QA 4GLTA 4PX1A 7GSSA 1A0FA 3GX8A 1A23A 2CVDA 4POKA 3PGTA 1PQNA 4RI7A 1F9MA 3EURA 3VWVA 4ZBAA 5IMVA 2QGVA 4ECIA 2HZEB 2H76A 5HFKA 1GUHA 2WFCA 4MJAA 3LORA 3LFLA 3BD2A 3ZITA 1GWCA 4DVCA 1X9WB 4I8BA 1O81A 1GSYA 4IP1A 4TW5A 2H1BA 1SYRA 3IXRA 3Q19A 1CQHA 1J0FA 3GKKA 1SU9A 2C0DA 2H1DA 12GSA 2IIYA 3ZVJD 1YF0A 5IM9A 2R3XA 2FHEA 3RAZA 5IMFA 3C7MA 1B9YC 2WB9A 3ZIVA 4GF0A 2H72A 2OA7A 4YQMA 5DAKB 2C80A 3HZ4A 1T3BA 1RQMA 3VWWA 4EF0A 1TI3A 3IBHA 1TK8B 1W89A 5ECSA 5F8BA 2E2GA 5AIXA 4OMVA 3GL5A 4ZIJA 2XBIA 4XCSA 1I5GA 4KW6A 5G1KA 1J9BA 4L5OA 5ENUA 5G31A 3IV4A 2VIMA 2B1KA 2CVBA 4AJ7A 4PXOA 3W6GA 3KP9A 5H5SA 3GSTA 2CVKA 2HT9A 1GNWA 4L0WA 3TKQA 1PL2A 4TR1B 2A2RA 4ZL9A 2H71A 1EWXA 2I1UA 3OR5A 1EOGA 3PINA 2LQQA 2IMFA 4X0XA 1JZRA 3LXTA 4LL4B 4J57E 2D2ZA 5D8IA 2C0GA 3IAM2 1XOAA 3KIJA 2AUVA 3V1WA 1FAAA 3TRQA 4N30A 5F07A 4K9ZA 4KCAA 3HYPA 1DBYA 4PURA 4PQHA 2DJ3A 5AGYA 3TKSC 1SK2A 2PMTA 3G7YA 22GSA 4MJEA 1XW5A 4ECCA 5KN3A 4TN8A 3LWAA 4FIWA 2EC4A 1ON4A 2F8FA 4F0CA 3NOFA 2OE3A 3LXZA 4JU5A 5JWRB 4PGTA 3CSHA 5ECQB 3VI5A 3GYKA 3KJYA 2YWNA 2H74A 3HJMA 2MMAA 1TI1A 3KXOA 4G9HA 3ZREA 3QCPA 4BWSA 3ZMKA 3UOMA 4RQRA 3L0HA 5DQYA 1AXDA 2O8VB 4V1Ap 3KZQA 2L4CA 1WWJA 2L5LA 3KTBA 4IS0A 4MK3A 2JU5A 2H70A 1BX9A 4HU9A 4IJ3A 16GSA 5LD0A 4O5RA 3KM6A 3S9FA 3QPMA 1USBA 3MSZA 3N5OA 3US3A 3IC4A 2MMOA 2LRTA 3P2AA 5CAXA 5G5FA 4ZILA 5FT3A 4YQVA 4O92A 2LJRA 4FYCA 4ILFA 1XFLA 1PRXA 3H79A 3P90A 1YKAA 1LU4A 1SYXA 3L9VA 4DEJA 4POMA 2TIRA 3IHQA 1A24A 1AAZA 1ZZYA 1X0RA 4ACSA 2H6ZA 1M9AA 1R7HA 2L57A 4XRDA 1B8XA 2F51A 3IK9A 4LL1B 2AAWA 3GA4A 4LLRA 2LTKA 1GSDA 1JLWA 3KMOA 2K18A 3W8JA 4TR3A 3PH9A 3VI7A 4WXTA 4G19A 1GLPA 4EL1A 1WP0A 4WKWA 3GH9A 4MF6A 5ECOB 4HQSA 3TRXA 2J23A 2VL3A 1SJIA 4NV2A 5DALA 1NHOA 1F37A 4IGJA 5DBQA 4EE0A 2PUKC 1VRSD 4YQUA 1SL2B 5EY6A 5DCGA 3HZ8A 4IQ1A 4I2TA 2YANA 1TP9A 4WBRD 3RBTA 1YZXA 2PERA 1AQWA 2KLXA 1UN2A 1U3AA 2C4JA 3FW2A 3G7JA 4K1FA 1GH2A 1GNEA 2ZCTA 3LJRA 3RHBA 4XS6A 4KDYA 4LA1A 2JZTA 2BTOT 4WEYA 3EYTA 2OJLA 2X99A 3E3EA 1W4VA 4NHZA 2HSYA 1B48A 1TRSA 2LEGA 2NBSA 2CAIA 5DDLA 1B4PA 2JSYA 3FR9A 4GQFA 2KP1A 5F05A 4HDEA 5KN1A 1F3BA 1PN9A 5HFIA 2R37A 5A4VA 2YJHA 2XC2A 3Q74A 3VFIA 4XS4A 4EC0A 2VO4A 3GNJA 3CSIA 1YJ6A 4MLYA 4O7HA 1XBSA 4MP4A 1FB0A 1SENA 1F2EA 3FZ9A 3APQA 2LJKA 1Y25A 5ECIB 4JZQA 2VL2C 1OE7A 3ERWA 1T00A 1V2AA 2YZUA 3R2QA 1MD3A 2YOIA 3GX0A 1FHEA 4MDCA 4GSSA 1M99A 4F0BA 5CRGA 3DXBA 2JZRA 2YWMA 5DJMA 2YJ7A 1BJXA 4ML1A 2HZEA 1SD9A 1PA3A 3GKXA 3CTFA 2HI7A 2MYGA 2M72A 4TVEA 1K0DA 5IO0A 1MDKA 1PSQA 1PKZA 2OE0A 2WDUA 4KA0A 4TRXA 1FB6A 2XPDA 1TTZA 3F9UA 4HOJA 1YY7A 2JSZA 1M2AA 3CSJA 4RQXA 5JWOB 2B6MA 3ZLPA 2VM1A 3F6DA 3L9SA 2YNXA 5ECLB 3VURA 2G2QA 4HZ4A 2X8HA 3ISOA 5EL8A 2WJUA 3A5WA 3ZZXA 3LQ7A 1GSSA 4FO5A 5DAKA 4NMUA 2VL9A 2I9HA 2ES7A 1N8JA 2C1YA 1ERWA 4ECBA 5DQSA 3F8UA 1TJDA 3JCML 3UAPA 1Q98A 1MDJA 3AY8A 6GSWA 1BQ7A 1KBNA 3EU3A 4K2DA 3HVSA 1EP8A 2L59A 3HVXA 2B3SA 3HXSA 2OE1A 3GTUB 4K0GA 2VAFA 3QAWA 2C8UA 4TR1A 1OKDA 3DKSA 3D21A 3CRTA 4K0NA 4V2LA 1OC8A 2VLTA 4E8EA 1C72A 5JCGA 3UL3A 1GRXA 1TU8A 3FK8A 1PGTA 3KD0A 1XWKA 4IKHA 1X5EA 1QXHA 3LG6A 3BBYA 1XW6A 1VF3A 2JL4A 4BWQA 1S3CA 3E9JB 2P31A 3HDCA 4XRAA 3TRPA 6GSXA 2X8CA 1K0NA 2GGTA 3G7IA 1Z3EA 1E2YA 4ID0A 4KDXA 2FWEA 1HNCA 3UIWA 2YPMA 3TB2A 3Q18A 5L71A 5EPFA 1UA5A 2N5AA 2OBKA 1QGVA 5KN2A 2RUFA 1ZL9A 2VD0A 1U87A 1U3IA 4ZB9A 3F0IA 4GSNA 2GDRA 2YZHA 2H6YA 4ZBBA 4J56E 3ME7A 4F82A 2FGXA 4NXIA 3TOUA 2P0GA 4K8MA 2HYXA 1OKTA 1FG4A 2PU9C 3KP8A 4QL7A 3EE2A 1ST9A 1I9DA 3QAVA 2N5BA 4KGIA 2RIIA 1MDIA 5IMZA 2LV3A 2CX4A 1XXUA 1PMTA 1R5AA 2CQ9A 2FWGA 5A4WA 3FZ4A 4POLA 1O7UA 3FZ5A 1BAYA 3G9BA 2M46A 2IJYA 4I5QA 2N5FA 1MEKA 4TR4A 3TOTA 3DD3A 5JCWA 4WF4A 1G6WA 2AJQB 1XCCA 2GZZA 2V1MA 1AW9A 1AC1A 4KAEA 4OFNA 1WRYA 1E6BA 1PKWA 1Y6EA 5H5RA 2AV4A 3QFBC 5KEJA 5CP1A 4OD7A 4OWYA 2K9FA 2IN3A 4OCEA 3FZAA 1FVKA 4POBA 3EINA 2GT5A 3IK7A 4P3YB 6GSSA 2DJ0A 1PL1A 1HNAA 2R5GA 2VD1A 4JR6A 3NIVA 3H1NA 4EVMA 3IR4A 5IOXA 2A4VA 3DMLA 4K7OA 3KH9A 2DJJA 4NWYA 4GSTA 3DEXA 1WIKA 4PQ1A 1O85A 2HZFA 1EV4A 2OBIA 2YV7A 2VCXA 4EDYA 3KTLA 1CQGA 4ZB6A 1K0MA 4HQZA 1TXXA 4OO4A 2X64A 3TKPA 2XPEA 1NW2A 3UEMA 1URMA 3TJBA 2LKUA 1GTUA 1PX6A 4CDOA 1TU7A 4IW9A 4F2IA 2XBQA 1M0UA 13GSA 2IL3A 2GVPA 2VCWA 1F6MC 4GQCA 5D9VA 1SL1B 5B6NA
chains in the Genus database with same CATH superfamily
1U88A 2GQLA 3HY2A 3IPZA 3QDNA 2K8SA 3FEUA 3ZVJA 1M2BA 2GQMA 2ON5A 5CRWA 2KP2A 5IIZA 2GSQA 1ZYNA 3WD6A 4JBBA 4MZCA 3RPPA 2ZUPA 3TJJA 1JHBA 1K0AA 1SJZA 19GSA 1QMVA 5G30A 2E0QA 1YF1A 2FCHA 1AIUA 2DJ1A 4CY6A 5B7CA 4BIKA 5CRDA 1QUWA 1ZOFA 1K3OA 3HJOA 2RLIA 1O6JA 3IC8A 1V58A 2NTOA 1Z6MA 2H30A 1TK0B 3WGEA 5E59A 1XWAA 3MYDA 5GSSA 2WRTA 3ED3A 3MWHA 1BG5A 1RW1A 4WR5A 3FMWA 6GSYA 10GSA 1MTCA 1S3DA 3A3TA 1GTAA 2HFDA 1RK4A 4EXJA 4GCIA 2H01A 3CYNA 4DSQA 3GIXA 2O89A 3U6VA 1NSWA 2TRCP 2FLSA 2H0HA 1JLVA 4YH2A 4MCUA 1XVQA 2C3TA 6GSTA 1EV9A 5HR3A 3DVXA 4NPBA 4MF7A 4V2NA 3C73A 1TK5B 1O73A 5AISA 3KCMA 4ZL8A 2RM6A 2DJ2A 1QK8A 1Z5YE 2PBJA 1G6YA 4G10A 1V40A 2P5QA 4KSMA 4PQIA 5EVOA 3HVNA 1JFUA 3LEFA 3P8WA 4KCEA 4G2EA 4IBPA 1M7TA 3I69A 4WETA 1WE0A 1EGRA 3FHKA 2X4AA 2H1AA 2VUPA 2B7JA 5DVBA 5HFGA 1A2MA 2RUEA 4JRRA 4MABA 1OVNA 4XTSA 4OFMA 3KEBA 4ZL7A 4JR4A 1J08A 2NPBA 4RI6A 3GTUA 2R6KA 4PNFA 1SD8A 2NDOA 4MA9A 2GTUA 5J9BA 5LCZA 3O76A 2R4VA 4WBJA 5D9XA 4ML6A 2R0GA 4N11A 5JCUA 2VM2A 1UVZA 2C0EA 2IMEA 1R4WA 4D73B 2LNTA 2E7PA 2EIOA 2M80A 5KOWA 2V6OA 1X9SB 1V9WA 4WR4A 5H5QA 4EUYA 1T1VA 1OAZA 1KEBA 4TOPA 1ABAA 2DIYA 3FY7A 1SKSB 1M2DA 3LW9A 1ML6A 3EMPA 4PTSA 2F9SA 6GSVA 3TJGA 3M9JA 3QOUA 1THOA 3UVHA 4QL9A 4MPFA 3HD5A 3CMIA 2OKAA 3FKFA 1XPVA 3UMAA 1R26A 1PFOA 4YAPA 3O3TA 3ZFLA 2WULA 3I6AA 1JZOA 3H8QA 3VWUA 5IMDA 3I9V2 2F3MA 4BVYA 3P7XA 2GZPA 1XZOA 1Z9HA 2R2JA 2LQOA 2DJKA 5JWQB 2EIQA 3GV1A 3UJ1A 4HU7A 4XIHA 4MZWA 4HJMA 4X4JA 4ECJA 3RDWA 5ELGA 5ECNB 3TCOA 4L0UA 2B5XA 2FY6A 2NVLA 5GZZB 3KMNA 4O5UA 2DKHA 4BVXB 3CQFA 2O7KA 4NV5A 2YV9A 3L9UA 1EOHA 3TKSE 4Q5FA 3EU4A 5D9TA 3VPQA 1TW9A 1ZYQB 3WT1A 1M3IA 2QKEA 2CZ3A 2WGRA 3SBCA 4HJ2A 4I97A 4K6XA 4E8HA 2L5OA 5IQYA 1ZGNA 4YKGA 1HQOA 2JADA 2H66A 3TKSA 4OFTA 2DMMA 3FR3A 1FVJA 3IOSA 3GKMA 4MJCA 2J9HA 3MNGA 5GAPD 4ISDA 1THXA 2DIZA 1JZWA 1YKCA 2HRAA 1XOBA 3TJFA 3HA9A 5A5KA 5E4WA 1Q4JA 3E0UA 1MD4A 3ERFA 1OYJA 3Q6OA 4MNNA 3BJ5A 1WMJA 5G2ZA 2VCVA 2YN1A 4DSSB 5HR0A 4K5RA 3M0FA 11GSA 2I81A 3TJKA 1TOFA 5ID2A 2LSTA 4N0ZA 4IJIA 2VLUA 4LMVA 1GSQA 4I2UA 2ALBA 2H0IA 2JZSA 2KHPA 2BJXA 4AGSA 1K3YA 2GS3A 4HZ2A 1GSUA 4J2FA 1GLQA 4MF5A 4BL7B 1N2AA 1QFNA 1GSEA 2YWIA 2CZ2A 2LUSA 2L6DA 3LSZA 17GSA 3VLNA 3C71A 2OADA 3ERGA 3M8NA 3A2XA 4Q5RA 5ABRA 3UBLA 3TGZA 4Z2TA 5A4UA 3MDKA 5B8AA 3VK9A 2A2SA 1ILOA 1GL8A 4TKYA 1T8EB 2C3QA 3TDGA 1XWGA 1ERVA 5ECHB 1SK0A 3ZFBA 2GSSA 4TXOB 5KN0A 2GSRA 2AHEA 2B5YA 3U5RE 4GWRA 5IOWA 2HNLA 3EVIA 1AQVA 2JACA 5CO3A 2H8LA 3GL3A 3BOAA 2YP6A 2CX3A 4Z7XA 4Q5NA 3APOA 5G5EA 5IPHA 1YEPA 3NZNA 2H6XA 1JZDA 2GZYA 3VWXA 3A2VA 2IFQB 3GSSA 4N0VA 3D5JA 5HR1A 3ZTLA 3IAS2 1A8LA 2GQKA 1AQXA 1K0BA 2VCQA 2B1LA 5B6MA 1O8WA 3GURA 1FOHA 4HUAA 3F4SA 2C3NA 4CW9A 2CV4A 3A2WA 5HR2A 2ZNMA 4V2MA 3TKRA 3WT2A 2EIRA 2PGTA 2CAQA 3DYRA 2YWOA 3GMFA 3K8NA 5FWGA 1DSBA 3UBKA 1DUGA 4IVFA 3HVVA 1FW1A 2IMKA 4HS1A 1OC9A 5ECRB 3ZYWA 1T4YA 3EC3A 2DLXA 5LNKe 5J9CA 3F6FA 3SWLA 2PN8A 3L4NA 3D4TA 4ZB8A 2P5RA 3F3RA 3D0ZA 3L78A 4OCFA 4PNGA 2CA8A 4IP6A 4NAXA 5ID2B 3LYPA 5IMAA 1VF4A 2X8GA 1IYHA 1VF1A 1X5DA 2DSAA 2VL2A 3GFKA 14GSA 5D93A 1EEMA 2BMXA 3APSA 2QSIA 1AUCA 2YCDA 1NM3A 5C00A 5GAND 3F63A 1SL0B 3M1GA 4D73A 5AN1A 5GSTA 3HJPA 4WF5A 3QR6A 2CT6A 3J7Yk 4MH2A 3WGDA 4BPYA 3GN3A 2HLSA 4K7IA 4GTUA 4ZBDA 2E2MA 4H86A 1X9MB 2V32A 1V98A 4ICYA 1G7EA 2TRXA 2B7KA 2K6VA 1H4OA 1T4ZA 1VGLA 3D22A 3C8EA 1XVWA 4MZBA 3QAGA 2MZCA 1XIYA 3CXGA 1XWBA 1GTBA 4X1UA 2B5EA 2WZ9A 4IELA 3GH6A 4IN0A 3W8SA 1HNBA 1Z6NA 3F4RA 2PVQA 5ELAA 1S3RA 1SKRB 1PD21 2V2GA 4Z2UA 2AYTA 1O8XA 1B4QA 4L8EA 3KGKA 4KNDA 2XHFA 3O6TA 3HHVA 1YDKA 3KH7A 2ON7A 2H0GA 4XHMA 2DC5A 5C04A 4EDZA 4X43A 4BVXA 4IHUA 1TDIA 3UARA 1WJKA 2LJAA 1DE2A 3LYKA 2V6KA 4JEDA 1SK1A 3ZL5A 4HEA2 4KSOA 4IQAA 3GUSA 4GRFA 5CRHA 2LRNA 1EZKA 2MMNA 3MIXA 4HSCX 2PVOC 1VF2A 6GSUA 1Z7PA 3HCZA 4V1Ag 1GSFA 3PPUA 3UVTA 1FOVA 2WCIA 4BA7A 5DCHA 1OC9B 1WOUA 4TXVA 1A0RP 1XWCA 1ZMAA 1WPIA 3QD9A 4AJ8A 3M9KA 4MJBA 1A2JA 1GULA 3FYGA 3RPNA 5DJLA 5IMCA 4JE1A 2FWHA 4KH7A 4KE3A 5ECPB 3DWVA 3D6IA 4FYUA 2AB6A 4OO5A 1EEJA 5HQPA 2FA8A 2HE3A 2LRCA 5FHIA 3GHAA 3H93A 3HKRA 2OACA 2VCTA 2IPAA 3CTGA 1QQ2A 1K0OA 1XW9A 20GSA 4DSSA 1DE1A 4AJ6A 1A2LA 1OC3A 1PX7A 4TR0A 2IMDA 2QA1A 2FD3A 3N9JA 1TRVA 1LBKA 3H4KA 3F4TA 1HD2A 4FYBA 1YEXA 2V41A 1KTEA 4KX4A 3LGCA 3WYWA 5INYA 3DVWA 5IPGA 4KUNA 3EMXA 4RUVA 5AIVA 3WGXA 3A5IA 3QMXA 2G0FA 9GSSA 1V57A 1R5PA 2QC7A 2VOCA 3QFAC 2HRNA 1HYUA 3F3QA 4BL7A 4F9ZA 2I4AA 4AF2A 2GT6A 4USSA 3C1SA 1SKWB 2IMIA 3BCKA 3BCIA 4PUAA 2UZ8A 1H75A 1GUKA 4ZXGA 1OE8A 1BYEA 2Z9SA 1BEDA 4L5LA 1GTIA 4GXZA 3D4MA 5CREA 5CNWA 1TRWA 1ERTA 4XS1A 5COHA 1ZCPA 2KUCA 1TKDB 2DMLA 4MPGA 4DSRA 1TRUA 4TXOA 2L6CA 2KOKA 1KNGA 4FH8A 5J5NA 3CBUA 4ULXA 3TUEA 4MH3A 5J4UA 5KOXA 3I43A 3VPTA 2H1GA 2VLVA 1IYIA 1Z7RA 18GSA 1UC7A 3M3MA 2IFQA 4KB3A 1SJ6A 2R0CA 3FRCA 1T7PB 3ZIJA 5G1LA 1LJRA 1U6TA 1K0CA 5J3RA 2MMZA 2PPTA 2FUG2 1A8YA 5ECMB 4EO3A 1ERUA 5D73A 3ME8A 5DALB 1GUMA 2GLRA 3IDVA 2FA4A 1NHYA 4QQ7A 2X49A 5B8BA 4HI7A 1S3AA 4LMWA 4MMMA 2REMA 2IWTA 4NHWA 5F0GA 2HSHA 2H19A 2FWFA 2I3YA 1B9XC 1G7OA 5ECKB 4CY8A 1EGOA 3C1RA 3RHCA 1YQ1A 4K5SA 3CRUA 3PR8A 3DIEA 5F06A 4N10A 1G0TA 2GSTA 2K8VA 4K7NA 4F03A 4EKZA 2MBSA 2WS2A 3EWLA 3IA1A 3DRNA 3DGQA 4I6XA 3GRXA 1K3LA 1GP1A 2O85A 1F3AA 2MBTA 3ZMLA 8GSSA 2LS5A 1X5CA 2FNOA 3IE3A 2LNSA 2L4QA 4O32A 4YAVA 3ZRDA 1M9BA 1ACVA 2DBCA 2H75A 3IRAA 4CHSA 5D9WA 5IO2A 2HXKA 2H73A 4PUFC 3FR6A 4KDUA 5D96A 1ZYEA 4XS4B 5CYYA 2RM5A 2VCZA 1EP7A 3MAKA 2F8AA 3GKNA 3J7Yb 2PWJA 2C0FA 1FO5A 2O87A 2HRFA 5J41A 4Q5QA 2R0PA 4GLTA 4PX1A 7GSSA 1A0FA 3GX8A 1A23A 2CVDA 4POKA 3PGTA 2DKIA 1PQNA 4RI7A 1F9MA 3EPTA 3EURA 3VWVA 4ZBAA 5IMVA 2QGVA 4ECIA 2HZEB 2H76A 5HFKA 1GUHA 2WFCA 4MJAA 3LORA 3LFLA 3BD2A 3ZITA 1GWCA 4DVCA 1X9WB 4I8BA 1O81A 1GSYA 4IP1A 4TW5A 2H1BA 1SYRA 3IXRA 3Q19A 1CQHA 1J0FA 3GKKA 1SU9A 2C0DA 2H1DA 12GSA 2IIYA 3ZVJD 1YF0A 5IM9A 2R3XA 2FHEA 3RAZA 5IMFA 3C7MA 1B9YC 2WB9A 3ZIVA 4GF0A 2H72A 2OA7A 4YQMA 5DAKB 2C80A 3HZ4A 1T3BA 1RQMA 3VWWA 4EF0A 1TI3A 3IBHA 1TK8B 1W89A 5ECSA 5F8BA 2E2GA 5AIXA 4Z2RA 4OMVA 3GL5A 4ZIJA 2XBIA 4XCSA 1I5GA 4KW6A 5G1KA 1J9BA 4L5OA 5ENUA 5G31A 3IV4A 2VIMA 2B1KA 2CVBA 4AJ7A 4PXOA 3W6GA 3KP9A 5H5SA 3GSTA 2CVKA 2HT9A 1GNWA 4L0WA 3TKQA 1PL2A 4TR1B 2A2RA 4ZL9A 2H71A 1EWXA 2I1UA 3OR5A 1EOGA 3PINA 2LQQA 2IMFA 4X0XA 1JZRA 3LXTA 4LL4B 4J57E 2D2ZA 5D8IA 2C0GA 3IAM2 1XOAA 3KIJA 2AUVA 3V1WA 1FAAA 3TRQA 1ZYPA 4N30A 5F07A 4K9ZA 4KCAA 3HYPA 1DBYA 4PURA 4PQHA 2DJ3A 5AGYA 3TKSC 1SK2A 2PMTA 3G7YA 22GSA 4MJEA 1XW5A 4ECCA 5KN3A 4TN8A 3LWAA 4FIWA 2EC4A 1ON4A 4EIPA 2F8FA 4F0CA 3NOFA 2OE3A 3LXZA 4JU5A 5JWRB 4PGTA 3CSHA 5ECQB 3VI5A 2A2PA 3GYKA 3KJYA 2YWNA 2H74A 3HJMA 2MMAA 1TI1A 3KXOA 4G9HA 3ZREA 3QCPA 4BWSA 3ZMKA 3UOMA 4RQRA 3L0HA 5DQYA 1AXDA 2O8VB 4V1Ap 3KZQA 2L4CA 1WWJA 2L5LA 3KTBA 4IS0A 4MK3A 2JU5A 2H70A 1BX9A 4HU9A 4IJ3A 16GSA 5LD0A 4O5RA 3KM6A 4G0LA 3S9FA 3QPMA 1USBA 3MSZA 3N5OA 3US3A 3IC4A 2MMOA 2LRTA 3P2AA 5CAXA 5G5FA 4ZILA 5FT3A 4YQVA 4O92A 2HSMA 2LJRA 4FYCA 4ILFA 1XFLA 1PRXA 3H79A 3P90A 1YKAA 1LU4A 1SYXA 3L9VA 4DEJA 4POMA 2TIRA 3IHQA 1A24A 1AAZA 1ZZYA 1X0RA 1PN0A 4ACSA 2H6ZA 1M9AA 1R7HA 2L57A 4XRDA 4G0KA 1B8XA 2F51A 3IK9A 4LL1B 5BMUA 2AAWA 3GA4A 4LLRA 2LTKA 1GSDA 1JLWA 3KMOA 2K18A 3W8JA 4TR3A 3PH9A 3VI7A 4WXTA 4G19A 1GLPA 4EL1A 1WP0A 4WKWA 3GH9A 4MF6A 5ECOB 4HQSA 3TRXA 2J23A 2VL3A 1SJIA 4NV2A 1NHOA 1F37A 4IGJA 5DALA 5DBQA 4EE0A 2PUKC 1VRSD 4YQUA 1SL2B 5EY6A 5DCGA 3HZ8A 4IQ1A 4I2TA 2YANA 1TP9A 4WBRD 3RBTA 1YZXA 2PERA 1AQWA 2KLXA 1UN2A 1U3AA 2C4JA 3FW2A 4K1FA 3G7JA 1GH2A 1GNEA 2ZCTA 3LJRA 3RHBA 4KF9A 4XS6A 4KDYA 4LA1A 2JZTA 2BTOT 4WEYA 3EYTA 2OJLA 2X99A 3E3EA 1W4VA 4NHZA 2HSYA 1B48A 1TRSA 2LEGA 2NBSA 2CAIA 5DDLA 1B4PA 2JSYA 3FR9A 4GQFA 2KP1A 5F05A 4HDEA 5KN1A 1F3BA 1PN9A 5HFIA 2R37A 5A4VA 2YJHA 1XG8A 2XC2A 3Q74A 3VFIA 4XS4A 4EC0A 2VO4A 3GNJA 3CSIA 4EIQA 2HRKA 1YJ6A 3IHGA 4MLYA 4O7HA 1XBSA 4MP4A 4G0IA 1FB0A 1SENA 1F2EA 3FZ9A 3APQA 2LJKA 1Y25A 5ECIB 4JZQA 2VL2C 1OE7A 3ERWA 1T00A 1V2AA 2YZUA 3R2QA 1MD3A 2YOIA 3GX0A 1FHEA 4MDCA 4GSSA 1M99A 4F0BA 5CRGA 3DXBA 2JZRA 2YWMA 5DJMA 2YJ7A 1BJXA 4ML1A 2HZEA 1SD9A 4FQUA 1PA3A 3GKXA 3CTFA 4YKFA 2HI7A 2MYGA 2M72A 4TVEA 1K0DA 5IO0A 1MDKA 1PSQA 1PKZA 2OE0A 2WDUA 4KA0A 4TRXA 1FB6A 2XPDA 1TTZA 3F9UA 4HOJA 2A4HA 1YY7A 2JSZA 1M2AA 3CSJA 4RQXA 5JWOB 2B6MA 3ZLPA 2VM1A 3F6DA 3L9SA 2YNXA 5ECLB 3VURA 2G2QA 4HZ4A 2X8HA 3ISOA 5EL8A 2WJUA 3A5WA 3ZZXA 3LQ7A 1GSSA 3R3EA 4FO5A 5DAKA 4NMUA 2VL9A 2I9HA 2ES7A 1N8JA 2C1YA 1ERWA 4ECBA 5DQSA 3F8UA 1TJDA 3JCML 3UAPA 1Q98A 1MDJA 3AY8A 6GSWA 1BQ7A 1KBNA 3EU3A 4K2DA 3HVSA 1EP8A 2L59A 3HVXA 2B3SA 3HXSA 2OE1A 3GTUB 4K0GA 2VAFA 3QAWA 2C8UA 4TR1A 1OKDA 3DKSA 4K2XA 3D21A 3CRTA 4K0NA 4V2LA 1OC8A 2VLTA 4E8EA 2QA2A 1C72A 5JCGA 3UL3A 1GRXA 1TU8A 3FK8A 1PGTA 3KD0A 1XWKA 4IKHA 1X5EA 1QXHA 3LG6A 3BBYA 1XW6A 1VF3A 2JL4A 4BWQA 1S3CA 3E9JB 2P31A 3HDCA 4XRAA 3TRPA 6GSXA 2X8CA 1K0NA 2GGTA 3G7IA 1Z3EA 1E2YA 4ID0A 4KDXA 2FWEA 1HNCA 3UIWA 2YPMA 3TB2A 3Q18A 5L71A 5EPFA 1UA5A 2N5AA 2OBKA 1QGVA 5KN2A 2RUFA 1ZL9A 2VD0A 1U87A 1U3IA 4ZB9A 3F0IA 4GSNA 2GDRA 2YZHA 2H6YA 4ZBBA 4J56E 3ME7A 4F82A 4BVYB 2FGXA 4NXIA 3TOUA 2P0GA 4K8MA 2HYXA 1OKTA 1FG4A 2PU9C 3KP8A 4QL7A 3EE2A 1ST9A 1I9DA 3QAVA 2N5BA 4KGIA 4A5PA 2RIIA 1MDIA 5IMZA 2LV3A 2CX4A 1XXUA 1PMTA 1R5AA 1M3JA 2CQ9A 2FWGA 5A4WA 3FZ4A 4POLA 1O7UA 3FZ5A 1BAYA 3G9BA 2M46A 2IJYA 4I5QA 2N5FA 1MEKA 4TR4A 3TOTA 3DD3A 5JCWA 4WF4A 1G6WA 2AJQB 1XCCA 2GZZA 2V1MA 1AW9A 1AC1A 4KAEA 4OFNA 1WRYA 1E6BA 1PKWA 1Y6EA 5H5RA 2AV4A 3QFBC 5KEJA 5CP1A 4OD7A 4OWYA 2K9FA 2IN3A 4OCEA 3FZAA 1FVKA 4POBA 3EINA 2GT5A 3IK7A 4P3YB 6GSSA 2DJ0A 1PL1A 1HNAA 2R5GA 2VD1A 4JR6A 3NIVA 3H1NA 4EVMA 3IR4A 5IOXA 2A4VA 3DMLA 4K7OA 3KH9A 2DJJA 4NWYA 4GSTA 3DEXA 1WIKA 4PQ1A 1O85A 2HZFA 1EV4A 2OBIA 2YV7A 2VCXA 4EDYA 3KTLA 5BRTA 1CQGA 4ZB6A 1K0MA 4HQZA 1TXXA 4OO4A 2X64A 3TKPA 2XPEA 1NW2A 3UEMA 1URMA 3TJBA 2LKUA 1GTUA 1PX6A 4CDOA 1TU7A 4IW9A 4F2IA 2XBQA 1M0UA 13GSA 2IL3A 2GVPA 2VCWA 1F6MC 4GQCA 5D9VA 1SL1B 4O5QA 5B6NA
chains in the Genus database with same CATH topology
1U88A 2GQLA 3HY2A 3IPZA 3QDNA 2K8SA 3FEUA 3ZVJA 1M2BA 2GQMA 2ON5A 5CRWA 2KP2A 5IIZA 2GSQA 1ZYNA 3WD6A 4JBBA 4MZCA 3RPPA 2ZUPA 3TJJA 1JHBA 1K0AA 1SJZA 19GSA 1QMVA 5G30A 2E0QA 1YF1A 2FCHA 1AIUA 2DJ1A 4CY6A 5B7CA 5CRDA 1QUWA 1ZOFA 1K3OA 3HJOA 2RLIA 1O6JA 3IC8A 1V58A 2NTOA 1Z6MA 2H30A 1TK0B 3WGEA 5E59A 1XWAA 3MYDA 5GSSA 2WRTA 3ED3A 3MWHA 1BG5A 1RW1A 4WR5A 3FMWA 6GSYA 10GSA 1MTCA 1S3DA 3A3TA 1GTAA 2HFDA 1RK4A 4EXJA 4GCIA 2H01A 3CYNA 4DSQA 3GIXA 2O89A 3U6VA 1NSWA 2TRCP 2FLSA 2H0HA 1JLVA 4YH2A 4MCUA 1XVQA 2C3TA 6GSTA 1EV9A 5HR3A 3DVXA 4NPBA 4MF7A 4V2NA 3C73A 1TK5B 1O73A 5AISA 3KCMA 4ZL8A 2RM6A 2DJ2A 1QK8A 1Z5YE 2PBJA 1G6YA 4G10A 1V40A 2P5QA 4KSMA 4PQIA 5EVOA 1JFUA 3LEFA 3P8WA 4KCEA 4G2EA 4IBPA 1M7TA 3I69A 4WETA 1WE0A 1EGRA 3FHKA 2X4AA 2H1AA 2VUPA 2B7JA 5DVBA 5HFGA 1A2MA 2RUEA 4JRRA 4MABA 1OVNA 4XTSA 4OFMA 3KEBA 4ZL7A 4JR4A 1J08A 2NPBA 4RI6A 3GTUA 2R6KA 4PNFA 1SD8A 2NDOA 4MA9A 2GTUA 5J9BA 5LCZA 3O76A 2R4VA 4WBJA 5D9XA 4ML6A 2R0GA 4N11A 5JCUA 2VM2A 1UVZA 2C0EA 2IMEA 1R4WA 4D73B 2LNTA 2E7PA 2EIOA 2M80A 5KOWA 2V6OA 1X9SB 1V9WA 4WR4A 5H5QA 4EUYA 1T1VA 1OAZA 1KEBA 4TOPA 1ABAA 2DIYA 3FY7A 1SKSB 1M2DA 3LW9A 1ML6A 3EMPA 4PTSA 2F9SA 6GSVA 3TJGA 3M9JA 3QOUA 1THOA 3UVHA 4QL9A 4MPFA 3HD5A 3CMIA 2OKAA 3FKFA 1XPVA 3UMAA 1R26A 4YAPA 3O3TA 3ZFLA 2WULA 3I6AA 1JZOA 3H8QA 3VWUA 5IMDA 3I9V2 2F3MA 4BVYA 3P7XA 2GZPA 1XZOA 1Z9HA 2R2JA 2LQOA 2DJKA 5JWQB 2EIQA 3GV1A 3UJ1A 4HU7A 4XIHA 4MZWA 4HJMA 4X4JA 4ECJA 3RDWA 5ELGA 5ECNB 3TCOA 4L0UA 2B5XA 2FY6A 2NVLA 5GZZB 3KMNA 4O5UA 2DKHA 4BVXB 2O7KA 4NV5A 2YV9A 3L9UA 1EOHA 3TKSE 4Q5FA 3EU4A 5D9TA 3VPQA 1TW9A 1ZYQB 3WT1A 2QKEA 2CZ3A 2WGRA 3SBCA 4HJ2A 4I97A 4K6XA 4E8HA 2L5OA 5IQYA 1ZGNA 4YKGA 1HQOA 2JADA 2H66A 3TKSA 4OFTA 2DMMA 3FR3A 1FVJA 3IOSA 3GKMA 4MJCA 2J9HA 3MNGA 5GAPD 4ISDA 1THXA 2DIZA 1JZWA 1YKCA 2HRAA 1XOBA 3TJFA 3HA9A 5A5KA 5E4WA 1Q4JA 3E0UA 1MD4A 3ERFA 1OYJA 3Q6OA 4MNNA 3BJ5A 1WMJA 5G2ZA 2VCVA 2YN1A 4DSSB 5HR0A 4K5RA 3M0FA 11GSA 2I81A 3TJKA 1TOFA 5ID2A 2LSTA 4N0ZA 4IJIA 2VLUA 4LMVA 1GSQA 4I2UA 2ALBA 2H0IA 2JZSA 2KHPA 2BJXA 4AGSA 1K3YA 2GS3A 4HZ2A 1GSUA 4J2FA 1GLQA 4MF5A 4BL7B 1N2AA 1QFNA 1GSEA 2YWIA 2CZ2A 2LUSA 2L6DA 3LSZA 17GSA 3VLNA 3C71A 2OADA 3ERGA 3M8NA 3A2XA 4Q5RA 5ABRA 3UBLA 3TGZA 4Z2TA 5A4UA 3MDKA 5B8AA 3VK9A 2A2SA 1ILOA 1GL8A 4TKYA 1T8EB 2C3QA 3TDGA 1XWGA 1ERVA 5ECHB 1SK0A 3ZFBA 2GSSA 4TXOB 5KN0A 2GSRA 2AHEA 2B5YA 3U5RE 4GWRA 5IOWA 2HNLA 3EVIA 1AQVA 2JACA 5CO3A 2H8LA 3GL3A 3BOAA 2YP6A 2CX3A 4Z7XA 4Q5NA 3APOA 5G5EA 5IPHA 1YEPA 3NZNA 2H6XA 1JZDA 2GZYA 3VWXA 3A2VA 2IFQB 3GSSA 4N0VA 3D5JA 5HR1A 3ZTLA 3IAS2 1A8LA 2GQKA 1AQXA 1K0BA 2VCQA 2B1LA 5B6MA 1O8WA 3GURA 1FOHA 4HUAA 3F4SA 2C3NA 4CW9A 2CV4A 3A2WA 5HR2A 2ZNMA 4V2MA 3TKRA 3WT2A 2EIRA 2PGTA 2CAQA 3DYRA 2YWOA 3GMFA 3K8NA 5FWGA 1DSBA 3UBKA 1DUGA 4IVFA 3HVVA 1FW1A 2IMKA 4HS1A 1OC9A 5ECRB 3ZYWA 1T4YA 3EC3A 2DLXA 5LNKe 5J9CA 3F6FA 3SWLA 2PN8A 3L4NA 3D4TA 4ZB8A 2P5RA 3F3RA 3D0ZA 3L78A 4OCFA 4PNGA 2CA8A 4IP6A 4NAXA 5ID2B 3LYPA 5IMAA 1VF4A 2X8GA 1IYHA 1VF1A 1X5DA 2DSAA 2VL2A 3GFKA 14GSA 5D93A 1EEMA 2BMXA 3APSA 2QSIA 1AUCA 2YCDA 1NM3A 5C00A 5GAND 3F63A 1SL0B 3M1GA 4D73A 5AN1A 5GSTA 3HJPA 4WF5A 3QR6A 2CT6A 3J7Yk 4MH2A 3WGDA 4BPYA 3GN3A 2HLSA 4K7IA 4GTUA 4ZBDA 2E2MA 4H86A 1X9MB 2V32A 1V98A 4ICYA 1G7EA 2TRXA 2B7KA 2K6VA 1H4OA 1T4ZA 1VGLA 3D22A 3C8EA 1XVWA 4MZBA 3QAGA 2MZCA 1XIYA 3CXGA 1XWBA 1GTBA 4X1UA 2B5EA 2WZ9A 4IELA 3GH6A 4IN0A 3W8SA 1HNBA 1Z6NA 3F4RA 2PVQA 5ELAA 1SKRB 1PD21 2V2GA 4Z2UA 2AYTA 1O8XA 1B4QA 4L8EA 3KGKA 4KNDA 2XHFA 3O6TA 3HHVA 1YDKA 3KH7A 2ON7A 2H0GA 4XHMA 2DC5A 5C04A 4EDZA 4X43A 4BVXA 4IHUA 1TDIA 3UARA 1WJKA 2LJAA 1DE2A 3LYKA 2V6KA 4JEDA 1SK1A 3ZL5A 4HEA2 4KSOA 4IQAA 3GUSA 4GRFA 5CRHA 2LRNA 1EZKA 2MMNA 3MIXA 2PVOC 1VF2A 6GSUA 1Z7PA 3HCZA 4V1Ag 1GSFA 3PPUA 3UVTA 1FOVA 2WCIA 4BA7A 5DCHA 1OC9B 1WOUA 4TXVA 1A0RP 1XWCA 1ZMAA 1WPIA 3QD9A 4AJ8A 3M9KA 4MJBA 1A2JA 1GULA 3FYGA 3RPNA 5DJLA 5IMCA 4JE1A 2FWHA 4KH7A 4KE3A 5ECPB 3DWVA 3D6IA 4FYUA 2AB6A 4OO5A 1EEJA 5HQPA 2FA8A 2HE3A 2LRCA 5FHIA 3GHAA 3H93A 3HKRA 2OACA 2VCTA 2IPAA 3CTGA 1QQ2A 1K0OA 1XW9A 20GSA 4DSSA 1DE1A 4AJ6A 1A2LA 1OC3A 1PX7A 4TR0A 2IMDA 2QA1A 2FD3A 3N9JA 1TRVA 1LBKA 3H4KA 3F4TA 1HD2A 4FYBA 1YEXA 2V41A 1KTEA 4KX4A 3LGCA 3WYWA 5INYA 3DVWA 5IPGA 4KUNA 3EMXA 4RUVA 5AIVA 3WGXA 3A5IA 3QMXA 2G0FA 9GSSA 1V57A 1R5PA 2QC7A 2VOCA 3QFAC 2HRNA 1HYUA 3F3QA 4BL7A 4F9ZA 2I4AA 4AF2A 2GT6A 4USSA 3C1SA 1SKWB 2IMIA 3BCKA 3BCIA 4PUAA 2UZ8A 1H75A 1GUKA 4ZXGA 1OE8A 1BYEA 2Z9SA 1BEDA 4L5LA 1GTIA 4GXZA 3D4MA 5CREA 5CNWA 1TRWA 1ERTA 4XS1A 5COHA 1ZCPA 2KUCA 1TKDB 2DMLA 4MPGA 4DSRA 1TRUA 4TXOA 2L6CA 2KOKA 1KNGA 4FH8A 5J5NA 3CBUA 4ULXA 3TUEA 4MH3A 5J4UA 5KOXA 3I43A 3VPTA 2H1GA 2VLVA 1IYIA 1Z7RA 18GSA 1UC7A 3M3MA 2IFQA 4KB3A 1SJ6A 2R0CA 3FRCA 1T7PB 3ZIJA 5G1LA 1LJRA 1U6TA 1K0CA 5J3RA 2MMZA 2PPTA 2FUG2 1A8YA 5ECMB 4EO3A 1ERUA 5D73A 3ME8A 5DALB 1GUMA 2GLRA 3IDVA 2FA4A 1NHYA 4QQ7A 2X49A 5B8BA 4HI7A 1S3AA 4LMWA 4MMMA 2REMA 2IWTA 4NHWA 5F0GA 2HSHA 2H19A 2FWFA 2I3YA 1B9XC 1G7OA 5ECKB 4CY8A 1EGOA 3C1RA 3RHCA 1YQ1A 4K5SA 3CRUA 3PR8A 3DIEA 5F06A 4N10A 1G0TA 2GSTA 2K8VA 4K7NA 4F03A 4EKZA 2MBSA 2WS2A 3EWLA 3IA1A 3DRNA 3DGQA 4I6XA 3GRXA 1K3LA 1GP1A 2O85A 1F3AA 2MBTA 3ZMLA 8GSSA 2LS5A 1X5CA 2FNOA 3IE3A 2LNSA 2L4QA 4O32A 4YAVA 3ZRDA 1M9BA 1ACVA 2DBCA 2H75A 3IRAA 4CHSA 5D9WA 5IO2A 2HXKA 2H73A 4PUFC 3FR6A 4KDUA 5D96A 1ZYEA 4XS4B 5CYYA 2RM5A 2VCZA 1EP7A 3MAKA 2F8AA 3GKNA 3J7Yb 2PWJA 2C0FA 1FO5A 2O87A 2HRFA 5J41A 4Q5QA 2R0PA 4GLTA 4PX1A 7GSSA 1A0FA 3GX8A 1A23A 2CVDA 4POKA 3PGTA 2DKIA 1PQNA 4RI7A 1F9MA 3EPTA 3EURA 3VWVA 4ZBAA 5IMVA 2QGVA 4ECIA 2HZEB 2H76A 5HFKA 1GUHA 2WFCA 4MJAA 3LORA 3LFLA 3BD2A 3ZITA 1GWCA 4DVCA 1X9WB 4I8BA 1O81A 1GSYA 4IP1A 4TW5A 2H1BA 1SYRA 3IXRA 3Q19A 1CQHA 1J0FA 3GKKA 1SU9A 2C0DA 2H1DA 12GSA 2IIYA 3ZVJD 1YF0A 5IM9A 2R3XA 2FHEA 3RAZA 5IMFA 3C7MA 1B9YC 2WB9A 3ZIVA 4GF0A 2H72A 2OA7A 4YQMA 5DAKB 2C80A 3HZ4A 1T3BA 1RQMA 3VWWA 4EF0A 1TI3A 3IBHA 1TK8B 1W89A 5ECSA 5F8BA 2E2GA 5AIXA 4Z2RA 4OMVA 3GL5A 4ZIJA 2XBIA 4XCSA 1I5GA 4KW6A 5G1KA 1J9BA 4L5OA 5ENUA 5G31A 3IV4A 2VIMA 2B1KA 2CVBA 4AJ7A 4PXOA 3W6GA 3KP9A 5H5SA 3GSTA 2CVKA 2HT9A 1GNWA 4L0WA 3TKQA 1PL2A 4TR1B 2A2RA 4ZL9A 2H71A 1EWXA 2I1UA 3OR5A 1EOGA 3PINA 2LQQA 2IMFA 4X0XA 1JZRA 3LXTA 4LL4B 4J57E 2D2ZA 5D8IA 2C0GA 3IAM2 1XOAA 3KIJA 2AUVA 3V1WA 1FAAA 3TRQA 1ZYPA 4N30A 5F07A 4K9ZA 4KCAA 3HYPA 1DBYA 4PURA 4PQHA 2DJ3A 5AGYA 3TKSC 1SK2A 2PMTA 3G7YA 22GSA 4MJEA 1XW5A 4ECCA 5KN3A 4TN8A 3LWAA 4FIWA 2EC4A 1ON4A 4EIPA 2F8FA 4F0CA 3NOFA 2OE3A 3LXZA 4JU5A 5JWRB 4PGTA 3CSHA 5ECQB 3VI5A 2A2PA 3GYKA 3KJYA 2YWNA 2H74A 3HJMA 2MMAA 1TI1A 3KXOA 4G9HA 3ZREA 3QCPA 4BWSA 3ZMKA 3UOMA 4RQRA 3L0HA 5DQYA 1AXDA 2O8VB 4V1Ap 3KZQA 2L4CA 1WWJA 2L5LA 3KTBA 4IS0A 4MK3A 2JU5A 2H70A 1BX9A 4HU9A 4IJ3A 16GSA 5LD0A 4O5RA 3KM6A 4G0LA 3S9FA 3QPMA 1USBA 3MSZA 3N5OA 3US3A 3IC4A 2MMOA 2LRTA 3P2AA 5CAXA 5G5FA 4ZILA 5FT3A 4YQVA 4O92A 2HSMA 2LJRA 4FYCA 4ILFA 1XFLA 1PRXA 3H79A 3P90A 1YKAA 1LU4A 1SYXA 3L9VA 4DEJA 4POMA 2TIRA 3IHQA 1A24A 1AAZA 1ZZYA 1X0RA 1PN0A 4ACSA 2H6ZA 1M9AA 1R7HA 2L57A 4XRDA 4G0KA 1B8XA 2F51A 3IK9A 4LL1B 5BMUA 2AAWA 3GA4A 4LLRA 2LTKA 1GSDA 1JLWA 3KMOA 2K18A 3W8JA 4TR3A 3PH9A 3VI7A 4WXTA 4G19A 1GLPA 4EL1A 1WP0A 4WKWA 3GH9A 4MF6A 5ECOB 4HQSA 3TRXA 2J23A 2VL3A 1SJIA 4NV2A 1NHOA 1F37A 4IGJA 5DALA 5DBQA 4EE0A 2PUKC 1VRSD 4YQUA 1SL2B 5EY6A 5DCGA 3HZ8A 4IQ1A 4I2TA 2YANA 1TP9A 4WBRD 3RBTA 1YZXA 2PERA 1AQWA 2KLXA 1UN2A 1U3AA 2C4JA 3FW2A 4K1FA 3G7JA 1GH2A 1GNEA 2ZCTA 3LJRA 3RHBA 4KF9A 4XS6A 4KDYA 4LA1A 2JZTA 2BTOT 4WEYA 3EYTA 2OJLA 2X99A 3E3EA 1W4VA 4NHZA 2HSYA 1B48A 1TRSA 2LEGA 2NBSA 2CAIA 5DDLA 1B4PA 2JSYA 3FR9A 4GQFA 2KP1A 5F05A 4HDEA 5KN1A 1F3BA 1PN9A 5HFIA 2R37A 5A4VA 2YJHA 2XC2A 3Q74A 3VFIA 4XS4A 4EC0A 2VO4A 3GNJA 3CSIA 4EIQA 2HRKA 1YJ6A 3IHGA 4MLYA 4O7HA 1XBSA 4MP4A 4G0IA 1FB0A 1SENA 1F2EA 3FZ9A 3APQA 2LJKA 1Y25A 5ECIB 4JZQA 2VL2C 1OE7A 3ERWA 1T00A 1V2AA 2YZUA 3R2QA 1MD3A 2YOIA 3GX0A 1FHEA 4MDCA 4GSSA 1M99A 4F0BA 5CRGA 3DXBA 2JZRA 2YWMA 5DJMA 2YJ7A 1BJXA 4ML1A 2HZEA 1SD9A 4FQUA 1PA3A 3GKXA 3CTFA 4YKFA 2HI7A 2MYGA 2M72A 4TVEA 1K0DA 5IO0A 1MDKA 1PSQA 1PKZA 2OE0A 2WDUA 4KA0A 4TRXA 1FB6A 2XPDA 1TTZA 3F9UA 4HOJA 2A4HA 1YY7A 2JSZA 1M2AA 3CSJA 4RQXA 5JWOB 2B6MA 3ZLPA 2VM1A 3F6DA 3L9SA 2YNXA 5ECLB 3VURA 2G2QA 4HZ4A 2X8HA 3ISOA 5EL8A 2WJUA 3A5WA 3ZZXA 3LQ7A 1GSSA 3R3EA 4FO5A 5DAKA 4NMUA 2VL9A 2I9HA 2ES7A 1N8JA 2C1YA 1ERWA 4ECBA 5DQSA 3F8UA 1TJDA 3JCML 3UAPA 1Q98A 1MDJA 3AY8A 6GSWA 1BQ7A 1KBNA 3EU3A 4K2DA 3HVSA 1EP8A 2L59A 3HVXA 2B3SA 3HXSA 2OE1A 3GTUB 4K0GA 2VAFA 3QAWA 2C8UA 4TR1A 1OKDA 3DKSA 4K2XA 3D21A 3CRTA 4K0NA 4V2LA 1OC8A 2VLTA 4E8EA 2QA2A 1C72A 5JCGA 3UL3A 1GRXA 1TU8A 3FK8A 1PGTA 3KD0A 1XWKA 4IKHA 1X5EA 1QXHA 3LG6A 3BBYA 1XW6A 1VF3A 2JL4A 4BWQA 1S3CA 3E9JB 2P31A 3HDCA 4XRAA 3TRPA 6GSXA 2X8CA 1K0NA 2GGTA 3G7IA 1Z3EA 1E2YA 4ID0A 4KDXA 2FWEA 1HNCA 3UIWA 2YPMA 3TB2A 3Q18A 5L71A 5EPFA 1UA5A 2N5AA 2OBKA 1QGVA 5KN2A 2RUFA 1ZL9A 2VD0A 1U87A 1U3IA 4ZB9A 3F0IA 4GSNA 2GDRA 2YZHA 2H6YA 4ZBBA 4J56E 3ME7A 4F82A 4BVYB 2FGXA 4NXIA 3TOUA 2P0GA 4K8MA 2HYXA 1OKTA 1FG4A 2PU9C 3KP8A 4QL7A 3EE2A 1ST9A 1I9DA 3QAVA 2N5BA 4KGIA 4A5PA 2RIIA 1MDIA 5IMZA 2LV3A 2CX4A 1XXUA 1PMTA 1R5AA 2CQ9A 2FWGA 5A4WA 3FZ4A 4POLA 1O7UA 3FZ5A 1BAYA 3G9BA 2M46A 2IJYA 4I5QA 2N5FA 1MEKA 4TR4A 3TOTA 3DD3A 5JCWA 4WF4A 1G6WA 2AJQB 1XCCA 2GZZA 2V1MA 1AW9A 1AC1A 4KAEA 4OFNA 1WRYA 1E6BA 1PKWA 1Y6EA 5H5RA 2AV4A 3QFBC 5KEJA 5CP1A 4OD7A 4OWYA 2K9FA 2IN3A 4OCEA 3FZAA 1FVKA 4POBA 3EINA 2GT5A 3IK7A 4P3YB 6GSSA 2DJ0A 1PL1A 1HNAA 2R5GA 2VD1A 4JR6A 3NIVA 3H1NA 4EVMA 3IR4A 5IOXA 2A4VA 3DMLA 4K7OA 3KH9A 2DJJA 4NWYA 4GSTA 3DEXA 1WIKA 4PQ1A 1O85A 2HZFA 1EV4A 2OBIA 2YV7A 2VCXA 4EDYA 3KTLA 5BRTA 1CQGA 4ZB6A 1K0MA 4HQZA 1TXXA 4OO4A 2X64A 3TKPA 2XPEA 1NW2A 3UEMA 1URMA 3TJBA 2LKUA 1GTUA 1PX6A 4CDOA 1TU7A 4IW9A 4F2IA 2XBQA 1M0UA 13GSA 2IL3A 2GVPA 2VCWA 1F6MC 4GQCA 5D9VA 1SL1B 4O5QA 5B6NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U88 A;  2GQL A;  3HY2 A;  3IPZ A;  3QDN A;  2K8S A;  3FEU A;  3ZVJ A;  1M2B A;  2GQM A;  2ON5 A;  5CRW A;  2KP2 A;  5IIZ A;  2GSQ A;  3WD6 A;  4JBB A;  4MZC A;  3RPP A;  2ZUP A;  3TJJ A;  1JHB A;  1K0A A;  1SJZ A;  19GS A;  1QMV A;  5G30 A;  2E0Q A;  1YF1 A;  2FCH A;  1AIU A;  2DJ1 A;  5B7C A;  5CRD A;  1QUW A;  1ZOF A;  1K3O A;  3HJO A;  2RLI A;  1O6J A;  1V58 A;  2NTO A;  1Z6M A;  2H30 A;  1TK0 B;  3WGE A;  5E59 A;  1XWA A;  5GSS A;  2WRT A;  3ED3 A;  3MWH A;  1BG5 A;  1RW1 A;  4WR5 A;  6GSY A;  10GS A;  1MTC A;  1S3D A;  3A3T A;  1GTA A;  2HFD A;  1RK4 A;  4EXJ A;  4GCI A;  2H01 A;  3CYN A;  4DSQ A;  3GIX A;  2O89 A;  3U6V A;  1NSW A;  2TRC P;  2FLS A;  2H0H A;  1JLV A;  4YH2 A;  4MCU A;  1XVQ A;  2C3T A;  6GST A;  1EV9 A;  5HR3 A;  3DVX A;  4NPB A;  4MF7 A;  4V2N A;  3C73 A;  1TK5 B;  1O73 A;  5AIS A;  3KCM A;  4ZL8 A;  2RM6 A;  2DJ2 A;  1QK8 A;  1Z5Y E;  2PBJ A;  1G6Y A;  4G10 A;  1V40 A;  2P5Q A;  4KSM A;  4PQI A;  5EVO A;  1JFU A;  3LEF A;  3P8W A;  4KCE A;  4G2E A;  4IBP A;  1M7T A;  3I69 A;  4WET A;  1WE0 A;  1EGR A;  3FHK A;  2H1A A;  2VUP A;  2B7J A;  5DVB A;  5HFG A;  1A2M A;  2RUE A;  4JRR A;  4MAB A;  1OVN A;  4XTS A;  4OFM A;  3KEB A;  4ZL7 A;  4JR4 A;  1J08 A;  2NPB A;  4RI6 A;  3GTU A;  2R6K A;  4PNF A;  1SD8 A;  2NDO A;  4MA9 A;  2GTU A;  5J9B A;  5LCZ A;  3O76 A;  2R4V A;  4WBJ A;  5D9X A;  4ML6 A;  4N11 A;  5JCU A;  2VM2 A;  1UVZ A;  2C0E A;  2IME A;  1R4W A;  4D73 B;  2LNT A;  2E7P A;  2EIO A;  2M80 A;  2V6O A;  1X9S B;  1V9W A;  4WR4 A;  5H5Q A;  4EUY A;  1T1V A;  1OAZ A;  1KEB A;  4TOP A;  1ABA A;  2DIY A;  3FY7 A;  1SKS B;  1M2D A;  1ML6 A;  3EMP A;  2F9S A;  6GSV A;  3TJG A;  3M9J A;  3QOU A;  1THO A;  3UVH A;  4QL9 A;  4MPF A;  3HD5 A;  3CMI A;  2OKA A;  3FKF A;  1XPV A;  3UMA A;  1R26 A;  4YAP A;  3O3T A;  3ZFL A;  2WUL A;  3I6A A;  1JZO A;  3H8Q A;  3VWU A;  5IMD A;  3I9V 2;  2F3M A;  4BVY A;  3P7X A;  2GZP A;  1XZO A;  1Z9H A;  2R2J A;  2LQO A;  2DJK A;  5JWQ B;  2EIQ A;  3GV1 A;  3UJ1 A;  4HU7 A;  4XIH A;  4MZW A;  4HJM A;  4ECJ A;  3RDW A;  5ELG A;  5ECN B;  3TCO A;  4L0U A;  2B5X A;  2FY6 A;  2NVL A;  5GZZ B;  3KMN A;  2O7K A;  4NV5 A;  2YV9 A;  3L9U A;  1EOH A;  3TKS E;  4Q5F A;  3EU4 A;  5D9T A;  3VPQ A;  1TW9 A;  1ZYQ B;  3WT1 A;  2QKE A;  2CZ3 A;  2WGR A;  3SBC A;  4HJ2 A;  4I97 A;  4K6X A;  4E8H A;  2L5O A;  5IQY A;  1ZGN A;  1HQO A;  2JAD A;  2H66 A;  3TKS A;  4OFT A;  2DMM A;  3FR3 A;  1FVJ A;  3IOS A;  3GKM A;  4MJC A;  2J9H A;  3MNG A;  5GAP D;  4ISD A;  1THX A;  2DIZ A;  1JZW A;  1YKC A;  1XOB A;  3TJF A;  3HA9 A;  5A5K A;  5E4W A;  1Q4J A;  3E0U A;  1MD4 A;  3ERF A;  1OYJ A;  3Q6O A;  3BJ5 A;  1WMJ A;  5G2Z A;  2VCV A;  2YN1 A;  4DSS B;  5HR0 A;  3M0F A;  11GS A;  2I81 A;  3TJK A;  1TOF A;  5ID2 A;  2LST A;  4N0Z A;  4IJI A;  2VLU A;  4LMV A;  1GSQ A;  4I2U A;  2ALB A;  2H0I A;  2JZS A;  2KHP A;  2BJX A;  4AGS A;  1K3Y A;  2GS3 A;  4HZ2 A;  1GSU A;  4J2F A;  1GLQ A;  4MF5 A;  1N2A A;  1QFN A;  1GSE A;  2YWI A;  2CZ2 A;  2LUS A;  2L6D A;  3LSZ A;  17GS A;  3VLN A;  3C71 A;  2OAD A;  3ERG A;  3M8N A;  3A2X A;  4Q5R A;  5ABR A;  3UBL A;  3TGZ A;  5A4U A;  3MDK A;  5B8A A;  3VK9 A;  2A2S A;  1ILO A;  1GL8 A;  4TKY A;  1T8E B;  2C3Q A;  3TDG A;  1XWG A;  1ERV A;  5ECH B;  1SK0 A;  3ZFB A;  2GSS A;  4TXO B;  5KN0 A;  2GSR A;  2AHE A;  2B5Y A;  3U5R E;  4GWR A;  5IOW A;  2HNL A;  3EVI A;  1AQV A;  2JAC A;  5CO3 A;  2H8L A;  3GL3 A;  3BOA A;  2YP6 A;  2CX3 A;  4Z7X A;  4Q5N A;  3APO A;  5G5E A;  5IPH A;  1YEP A;  3NZN A;  2H6X A;  1JZD A;  2GZY A;  3VWX A;  3A2V A;  2IFQ B;  3GSS A;  4N0V A;  3D5J A;  5HR1 A;  3ZTL A;  3IAS 2;  1A8L A;  2GQK A;  1AQX A;  1K0B A;  2VCQ A;  2B1L A;  5B6M A;  1O8W A;  3GUR A;  4HUA A;  3F4S A;  2C3N A;  4CW9 A;  2CV4 A;  3A2W A;  5HR2 A;  2ZNM A;  4V2M A;  3TKR A;  3WT2 A;  2EIR A;  2PGT A;  2CAQ A;  3DYR A;  2YWO A;  3GMF A;  3K8N A;  5FWG A;  1DSB A;  3UBK A;  1DUG A;  4IVF A;  3HVV A;  1FW1 A;  2IMK A;  4HS1 A;  1OC9 A;  5ECR B;  3ZYW A;  1T4Y A;  3EC3 A;  2DLX A;  5LNK e;  5J9C A;  3F6F A;  3SWL A;  2PN8 A;  3L4N A;  3D4T A;  4ZB8 A;  2P5R A;  3F3R A;  3D0Z A;  3L78 A;  4OCF A;  4PNG A;  2CA8 A;  4IP6 A;  4NAX A;  5ID2 B;  3LYP A;  5IMA A;  1VF4 A;  2X8G A;  1IYH A;  1VF1 A;  1X5D A;  2DSA A;  2VL2 A;  3GFK A;  14GS A;  5D93 A;  1EEM A;  2BMX A;  3APS A;  2QSI A;  1AUC A;  2YCD A;  1NM3 A;  5C00 A;  5GAN D;  3F63 A;  1SL0 B;  3M1G A;  4D73 A;  5AN1 A;  5GST A;  3HJP A;  4WF5 A;  3QR6 A;  2CT6 A;  3J7Y k;  4MH2 A;  3WGD A;  4BPY A;  3GN3 A;  2HLS A;  4K7I A;  4GTU A;  4ZBD A;  2E2M A;  4H86 A;  1X9M B;  2V32 A;  1V98 A;  1G7E A;  2TRX A;  2B7K A;  2K6V A;  1H4O A;  1T4Z A;  1VGL A;  3D22 A;  3C8E A;  1XVW A;  4MZB A;  3QAG A;  2MZC A;  1XIY A;  3CXG A;  1XWB A;  1GTB A;  4X1U A;  2B5E A;  2WZ9 A;  4IEL A;  3GH6 A;  4IN0 A;  3W8S A;  1HNB A;  1Z6N A;  3F4R A;  2PVQ A;  5ELA A;  1SKR B;  1PD2 1;  2V2G A;  1B4Q A;  2AYT A;  1O8X A;  4L8E A;  3KGK A;  4KND A;  2XHF A;  3O6T A;  3HHV A;  1YDK A;  3KH7 A;  2ON7 A;  2H0G A;  4XHM A;  2DC5 A;  5C04 A;  4EDZ A;  4X43 A;  4BVX A;  4IHU A;  1TDI A;  3UAR A;  1WJK A;  2LJA A;  1DE2 A;  3LYK A;  2V6K A;  4JED A;  1SK1 A;  3ZL5 A;  4HEA 2;  4KSO A;  4IQA A;  3GUS A;  4GRF A;  5CRH A;  2LRN A;  1EZK A;  2MMN A;  2PVO C;  1VF2 A;  6GSU A;  1Z7P A;  3HCZ A;  4V1A g;  1GSF A;  3UVT A;  1FOV A;  2WCI A;  4BA7 A;  5DCH A;  1OC9 B;  1WOU A;  4TXV A;  1A0R P;  1XWC A;  1ZMA A;  1WPI A;  3QD9 A;  4AJ8 A;  3M9K A;  4MJB A;  1A2J A;  1GUL A;  3FYG A;  3RPN A;  5DJL A;  5IMC A;  4JE1 A;  5ECP B;  2FWH A;  4KH7 A;  4KE3 A;  3DWV A;  3D6I A;  4FYU A;  2AB6 A;  4OO5 A;  1EEJ A;  5HQP A;  2FA8 A;  2HE3 A;  2LRC A;  5FHI A;  3GHA A;  3H93 A;  3HKR A;  2OAC A;  2VCT A;  2IPA A;  3CTG A;  1QQ2 A;  1K0O A;  1XW9 A;  20GS A;  4DSS A;  1DE1 A;  4AJ6 A;  1A2L A;  1OC3 A;  1PX7 A;  4TR0 A;  2IMD A;  2FD3 A;  3N9J A;  1TRV A;  1LBK A;  3H4K A;  3F4T A;  1HD2 A;  4FYB A;  1YEX A;  2V41 A;  1KTE A;  4KX4 A;  3LGC A;  3WYW A;  5INY A;  3DVW A;  5IPG A;  4KUN A;  3EMX A;  4RUV A;  5AIV A;  3WGX A;  3QMX A;  2G0F A;  9GSS A;  1V57 A;  1R5P A;  2QC7 A;  2VOC A;  3QFA C;  2HRN A;  1HYU A;  3F3Q A;  4BL7 A;  4F9Z A;  2I4A A;  4AF2 A;  2GT6 A;  3C1S A;  1SKW B;  2IMI A;  3BCK A;  3BCI A;  4PUA A;  1H75 A;  1GUK A;  4ZXG A;  1OE8 A;  1BYE A;  2Z9S A;  1BED A;  4L5L A;  1GTI A;  4GXZ A;  3D4M A;  5CRE A;  5CNW A;  1TRW A;  1ERT A;  4XS1 A;  5COH A;  1ZCP A;  2KUC A;  1TKD B;  2DML A;  4MPG A;  4DSR A;  1TRU A;  4TXO A;  2L6C A;  2KOK A;  1KNG A;  4FH8 A;  5J5N A;  3CBU A;  4ULX A;  3TUE A;  4MH3 A;  5J4U A;  3I43 A;  3VPT A;  2H1G A;  2VLV A;  1IYI A;  1Z7R A;  18GS A;  1UC7 A;  3M3M A;  2IFQ A;  4KB3 A;  1SJ6 A;  3FRC A;  1T7P B;  3ZIJ A;  5G1L A;  1LJR A;  1U6T A;  1K0C A;  5J3R A;  2MMZ A;  2PPT A;  2FUG 2;  1A8Y A;  5ECM B;  4EO3 A;  1ERU A;  5D73 A;  3ME8 A;  5DAL B;  1GUM A;  2GLR A;  3IDV A;  2FA4 A;  1NHY A;  4QQ7 A;  5B8B A;  4HI7 A;  1S3A A;  4LMW A;  4MMM A;  2REM A;  2IWT A;  4NHW A;  5F0G A;  2HSH A;  2H19 A;  2FWF A;  2I3Y A;  1B9X C;  1G7O A;  5ECK B;  1EGO A;  3C1R A;  3RHC A;  1YQ1 A;  3CRU A;  3PR8 A;  3DIE A;  5F06 A;  4N10 A;  1G0T A;  2GST A;  2K8V A;  4K7N A;  4F03 A;  4EKZ A;  2MBS A;  2WS2 A;  3EWL A;  3IA1 A;  3DRN A;  3DGQ A;  4I6X A;  3GRX A;  1K3L A;  1GP1 A;  2O85 A;  1F3A A;  2MBT A;  3ZML A;  8GSS A;  2LS5 A;  1X5C A;  2FNO A;  3IE3 A;  2LNS A;  2L4Q A;  4O32 A;  4YAV A;  3ZRD A;  1M9B A;  1ACV A;  2DBC A;  2H75 A;  3IRA A;  4CHS A;  5D9W A;  5IO2 A;  2HXK A;  2H73 A;  4PUF C;  3FR6 A;  4KDU A;  5D96 A;  1ZYE A;  4XS4 B;  5CYY A;  2RM5 A;  2VCZ A;  1EP7 A;  3MAK A;  2F8A A;  3GKN A;  3J7Y b;  2PWJ A;  2C0F A;  1FO5 A;  2O87 A;  2HRF A;  5J41 A;  4Q5Q A;  4GLT A;  4PX1 A;  7GSS A;  1A0F A;  3GX8 A;  1A23 A;  2CVD A;  4POK A;  3PGT A;  1PQN A;  4RI7 A;  1F9M A;  3EUR A;  3VWV A;  4ZBA A;  5IMV A;  2QGV A;  4ECI A;  2HZE B;  2H76 A;  5HFK A;  1GUH A;  2WFC A;  4MJA A;  3LOR A;  3LFL A;  3BD2 A;  3ZIT A;  1GWC A;  4DVC A;  1X9W B;  4I8B A;  1O81 A;  1GSY A;  4IP1 A;  4TW5 A;  2H1B A;  1SYR A;  3IXR A;  3Q19 A;  1CQH A;  1J0F A;  3GKK A;  1SU9 A;  2C0D A;  2H1D A;  12GS A;  2IIY A;  3ZVJ D;  1YF0 A;  5IM9 A;  2R3X A;  2FHE A;  3RAZ A;  5IMF A;  3C7M A;  1B9Y C;  2WB9 A;  3ZIV A;  4GF0 A;  2H72 A;  2OA7 A;  4YQM A;  5DAK B;  2C80 A;  3HZ4 A;  1T3B A;  1RQM A;  3VWW A;  4EF0 A;  1TI3 A;  3IBH A;  1TK8 B;  1W89 A;  5ECS A;  5F8B A;  2E2G A;  5AIX A;  4OMV A;  3GL5 A;  4ZIJ A;  2XBI A;  4XCS A;  1I5G A;  4KW6 A;  5G1K A;  1J9B A;  4L5O A;  5ENU A;  5G31 A;  3IV4 A;  2VIM A;  2B1K A;  2CVB A;  4AJ7 A;  4PXO A;  3W6G A;  3KP9 A;  5H5S A;  3GST A;  2CVK A;  2HT9 A;  1GNW A;  4L0W A;  3TKQ A;  1PL2 A;  4TR1 B;  2A2R A;  4ZL9 A;  2H71 A;  1EWX A;  2I1U A;  3OR5 A;  1EOG A;  3PIN A;  2LQQ A;  2IMF A;  4X0X A;  1JZR A;  3LXT A;  4LL4 B;  4J57 E;  2D2Z A;  5D8I A;  2C0G A;  3IAM 2;  1XOA A;  3KIJ A;  2AUV A;  3V1W A;  1FAA A;  3TRQ A;  4N30 A;  5F07 A;  4K9Z A;  4KCA A;  3HYP A;  1DBY A;  4PUR A;  4PQH A;  2DJ3 A;  5AGY A;  3TKS C;  1SK2 A;  2PMT A;  3G7Y A;  22GS A;  4MJE A;  1XW5 A;  4ECC A;  5KN3 A;  4TN8 A;  3LWA A;  4FIW A;  2EC4 A;  1ON4 A;  2F8F A;  4F0C A;  3NOF A;  2OE3 A;  3LXZ A;  4JU5 A;  5JWR B;  4PGT A;  3CSH A;  5ECQ B;  3VI5 A;  3GYK A;  3KJY A;  2YWN A;  2H74 A;  3HJM A;  2MMA A;  1TI1 A;  3KXO A;  4G9H A;  3ZRE A;  3QCP A;  4BWS A;  3ZMK A;  3UOM A;  4RQR A;  3L0H A;  5DQY A;  1AXD A;  2O8V B;  4V1A p;  3KZQ A;  2L4C A;  1WWJ A;  2L5L A;  3KTB A;  4IS0 A;  4MK3 A;  2JU5 A;  2H70 A;  1BX9 A;  4HU9 A;  4IJ3 A;  16GS A;  5LD0 A;  4O5R A;  3KM6 A;  3S9F A;  3QPM A;  1USB A;  3MSZ A;  3N5O A;  3US3 A;  3IC4 A;  2MMO A;  2LRT A;  3P2A A;  5CAX A;  5G5F A;  4ZIL A;  5FT3 A;  4YQV A;  4O92 A;  2LJR A;  4FYC A;  4ILF A;  1XFL A;  1PRX A;  3H79 A;  3P90 A;  1YKA A;  1LU4 A;  1SYX A;  3L9V A;  4DEJ A;  4POM A;  2TIR A;  3IHQ A;  1A24 A;  1AAZ A;  1ZZY A;  1X0R A;  4ACS A;  2H6Z A;  1M9A A;  1R7H A;  2L57 A;  4XRD A;  1B8X A;  2F51 A;  3IK9 A;  4LL1 B;  2AAW A;  3GA4 A;  4LLR A;  2LTK A;  1GSD A;  1JLW A;  3KMO A;  2K18 A;  3W8J A;  4TR3 A;  3PH9 A;  3VI7 A;  4WXT A;  4G19 A;  1GLP A;  4EL1 A;  1WP0 A;  4WKW A;  3GH9 A;  4MF6 A;  5ECO B;  4HQS A;  3TRX A;  2J23 A;  2VL3 A;  1SJI A;  4NV2 A;  5DAL A;  1NHO A;  1F37 A;  4IGJ A;  5DBQ A;  4EE0 A;  2PUK C;  1VRS D;  4YQU A;  1SL2 B;  5EY6 A;  5DCG A;  3HZ8 A;  4IQ1 A;  4I2T A;  2YAN A;  1TP9 A;  4WBR D;  3RBT A;  1YZX A;  2PER A;  1AQW A;  2KLX A;  1UN2 A;  1U3A A;  2C4J A;  3FW2 A;  3G7J A;  4K1F A;  1GH2 A;  1GNE A;  2ZCT A;  3LJR A;  3RHB A;  4XS6 A;  4KDY A;  4LA1 A;  2JZT A;  2BTO T;  4WEY A;  3EYT A;  2OJL A;  2X99 A;  3E3E A;  1W4V A;  4NHZ A;  2HSY A;  1B48 A;  1TRS A;  2LEG A;  2NBS A;  2CAI A;  5DDL A;  1B4P A;  2JSY A;  3FR9 A;  4GQF A;  2KP1 A;  5F05 A;  4HDE A;  5KN1 A;  1F3B A;  1PN9 A;  5HFI A;  2R37 A;  5A4V A;  2YJH A;  2XC2 A;  3Q74 A;  3VFI A;  4XS4 A;  4EC0 A;  2VO4 A;  3GNJ A;  3CSI A;  1YJ6 A;  4MLY A;  4O7H A;  1XBS A;  4MP4 A;  1FB0 A;  1SEN A;  1F2E A;  3FZ9 A;  3APQ A;  2LJK A;  1Y25 A;  5ECI B;  4JZQ A;  2VL2 C;  1OE7 A;  3ERW A;  1T00 A;  1V2A A;  2YZU A;  3R2Q A;  1MD3 A;  2YOI A;  3GX0 A;  1FHE A;  4MDC A;  4GSS A;  1M99 A;  4F0B A;  5CRG A;  3DXB A;  2JZR A;  2YWM A;  5DJM A;  2YJ7 A;  1BJX A;  4ML1 A;  2HZE A;  1SD9 A;  1PA3 A;  3GKX A;  3CTF A;  2HI7 A;  2MYG A;  2M72 A;  4TVE A;  1K0D A;  5IO0 A;  1MDK A;  1PSQ A;  1PKZ A;  2OE0 A;  2WDU A;  4KA0 A;  4TRX A;  1FB6 A;  2XPD A;  1TTZ A;  3F9U A;  4HOJ A;  1YY7 A;  2JSZ A;  1M2A A;  3CSJ A;  4RQX A;  5JWO B;  2B6M A;  3ZLP A;  2VM1 A;  3F6D A;  3L9S A;  2YNX A;  5ECL B;  3VUR A;  2G2Q A;  4HZ4 A;  2X8H A;  3ISO A;  5EL8 A;  2WJU A;  3A5W A;  3ZZX A;  3LQ7 A;  1GSS A;  4FO5 A;  5DAK A;  4NMU A;  2VL9 A;  2I9H A;  2ES7 A;  1N8J A;  2C1Y A;  1ERW A;  4ECB A;  5DQS A;  3F8U A;  1TJD A;  3JCM L;  3UAP A;  1Q98 A;  1MDJ A;  3AY8 A;  6GSW A;  1BQ7 A;  1KBN A;  3EU3 A;  4K2D A;  3HVS A;  1EP8 A;  2L59 A;  3HVX A;  2B3S A;  3HXS A;  2OE1 A;  3GTU B;  4K0G A;  2VAF A;  3QAW A;  2C8U A;  4TR1 A;  1OKD A;  3DKS A;  3D21 A;  3CRT A;  4K0N A;  4V2L A;  1OC8 A;  2VLT A;  4E8E A;  1C72 A;  5JCG A;  3UL3 A;  1GRX A;  1TU8 A;  3FK8 A;  1PGT A;  3KD0 A;  1XWK A;  4IKH A;  1X5E A;  1QXH A;  3LG6 A;  3BBY A;  1XW6 A;  1VF3 A;  2JL4 A;  4BWQ A;  1S3C A;  3E9J B;  2P31 A;  3HDC A;  4XRA A;  3TRP A;  6GSX A;  2X8C A;  1K0N A;  2GGT A;  3G7I A;  1Z3E A;  1E2Y A;  4ID0 A;  4KDX A;  2FWE A;  1HNC A;  3UIW A;  2YPM A;  3TB2 A;  3Q18 A;  5L71 A;  5EPF A;  1UA5 A;  2N5A A;  2OBK A;  1QGV A;  5KN2 A;  2RUF A;  1ZL9 A;  2VD0 A;  1U87 A;  1U3I A;  4ZB9 A;  3F0I A;  4GSN A;  2GDR A;  2YZH A;  2H6Y A;  4ZBB A;  4J56 E;  3ME7 A;  4F82 A;  2FGX A;  4NXI A;  3TOU A;  2P0G A;  4K8M A;  2HYX A;  1OKT A;  1FG4 A;  2PU9 C;  3KP8 A;  4QL7 A;  3EE2 A;  1ST9 A;  1I9D A;  3QAV A;  2N5B A;  4KGI A;  2RII A;  1MDI A;  5IMZ A;  2LV3 A;  2CX4 A;  1XXU A;  1PMT A;  1R5A A;  2CQ9 A;  2FWG A;  5A4W A;  3FZ4 A;  4POL A;  1O7U A;  3FZ5 A;  1BAY A;  3G9B A;  2M46 A;  2IJY A;  4I5Q A;  2N5F A;  1MEK A;  4TR4 A;  3TOT A;  3DD3 A;  5JCW A;  4WF4 A;  1G6W A;  2AJQ B;  1XCC A;  2GZZ A;  2V1M A;  1AW9 A;  1AC1 A;  4KAE A;  4OFN A;  1WRY A;  1E6B A;  1PKW A;  1Y6E A;  5H5R A;  2AV4 A;  3QFB C;  5KEJ A;  5CP1 A;  4OD7 A;  4OWY A;  2K9F A;  2IN3 A;  4OCE A;  3FZA A;  1FVK A;  4POB A;  3EIN A;  2GT5 A;  3IK7 A;  4P3Y B;  6GSS A;  2DJ0 A;  1PL1 A;  1HNA A;  2R5G A;  2VD1 A;  4JR6 A;  3NIV A;  3H1N A;  4EVM A;  3IR4 A;  5IOX A;  2A4V A;  3DML A;  4K7O A;  3KH9 A;  2DJJ A;  4NWY A;  4GST A;  3DEX A;  1WIK A;  4PQ1 A;  1O85 A;  2HZF A;  1EV4 A;  2OBI A;  2YV7 A;  2VCX A;  4EDY A;  3KTL A;  1CQG A;  4ZB6 A;  1K0M A;  4HQZ A;  1TXX A;  4OO4 A;  2X64 A;  3TKP A;  2XPE A;  1NW2 A;  3UEM A;  1URM A;  3TJB A;  2LKU A;  1GTU A;  1PX6 A;  4CDO A;  1TU7 A;  4IW9 A;  4F2I A;  2XBQ A;  1M0U A;  13GS A;  2IL3 A;  2GVP A;  2VCW A;  1F6M C;  4GQC A;  5D9V A;  1SL1 B;  5B6N A; 
#chains in the Genus database with same CATH topology
 1U88 A;  2GQL A;  3HY2 A;  3IPZ A;  3QDN A;  2K8S A;  3FEU A;  3ZVJ A;  1M2B A;  2GQM A;  2ON5 A;  5CRW A;  2KP2 A;  5IIZ A;  2GSQ A;  1ZYN A;  3WD6 A;  4JBB A;  4MZC A;  3RPP A;  2ZUP A;  3TJJ A;  1JHB A;  1K0A A;  1SJZ A;  19GS A;  1QMV A;  5G30 A;  2E0Q A;  1YF1 A;  2FCH A;  1AIU A;  2DJ1 A;  4CY6 A;  5B7C A;  4BIK A;  5CRD A;  1QUW A;  1ZOF A;  1K3O A;  3HJO A;  2RLI A;  1O6J A;  3IC8 A;  1V58 A;  2NTO A;  1Z6M A;  2H30 A;  1TK0 B;  3WGE A;  5E59 A;  1XWA A;  3MYD A;  5GSS A;  2WRT A;  3ED3 A;  3MWH A;  1BG5 A;  1RW1 A;  4WR5 A;  3FMW A;  6GSY A;  10GS A;  1MTC A;  1S3D A;  3A3T A;  1GTA A;  2HFD A;  1RK4 A;  4EXJ A;  4GCI A;  2H01 A;  3CYN A;  4DSQ A;  3GIX A;  2O89 A;  3U6V A;  1NSW A;  2TRC P;  2FLS A;  2H0H A;  1JLV A;  4YH2 A;  4MCU A;  1XVQ A;  2C3T A;  6GST A;  1EV9 A;  5HR3 A;  3DVX A;  4NPB A;  4MF7 A;  4V2N A;  3C73 A;  1TK5 B;  1O73 A;  5AIS A;  3KCM A;  4ZL8 A;  2RM6 A;  2DJ2 A;  1QK8 A;  1Z5Y E;  2PBJ A;  1G6Y A;  4G10 A;  1V40 A;  2P5Q A;  4KSM A;  4PQI A;  5EVO A;  3HVN A;  1JFU A;  3LEF A;  3P8W A;  4KCE A;  4G2E A;  4IBP A;  1M7T A;  3I69 A;  4WET A;  1WE0 A;  1EGR A;  3FHK A;  2X4A A;  2H1A A;  2VUP A;  2B7J A;  5DVB A;  5HFG A;  1A2M A;  2RUE A;  4JRR A;  4MAB A;  1OVN A;  4XTS A;  4OFM A;  3KEB A;  4ZL7 A;  4JR4 A;  1J08 A;  2NPB A;  4RI6 A;  3GTU A;  2R6K A;  4PNF A;  1SD8 A;  2NDO A;  4MA9 A;  2GTU A;  5J9B A;  5LCZ A;  3O76 A;  2R4V A;  4WBJ A;  5D9X A;  4ML6 A;  2R0G A;  4N11 A;  5JCU A;  2VM2 A;  1UVZ A;  2C0E A;  2IME A;  1R4W A;  4D73 B;  2LNT A;  2E7P A;  2EIO A;  2M80 A;  5KOW A;  2V6O A;  1X9S B;  1V9W A;  4WR4 A;  5H5Q A;  4EUY A;  1T1V A;  1OAZ A;  1KEB A;  4TOP A;  1ABA A;  2DIY A;  3FY7 A;  1SKS B;  1M2D A;  3LW9 A;  1ML6 A;  3EMP A;  4PTS A;  2F9S A;  6GSV A;  3TJG A;  3M9J A;  3QOU A;  1THO A;  3UVH A;  4QL9 A;  4MPF A;  3HD5 A;  3CMI A;  2OKA A;  3FKF A;  1XPV A;  3UMA A;  1R26 A;  1PFO A;  4YAP A;  3O3T A;  3ZFL A;  2WUL A;  3I6A A;  1JZO A;  3H8Q A;  3VWU A;  5IMD A;  3I9V 2;  2F3M A;  4BVY A;  3P7X A;  2GZP A;  1XZO A;  1Z9H A;  2R2J A;  2LQO A;  2DJK A;  5JWQ B;  2EIQ A;  3GV1 A;  3UJ1 A;  4HU7 A;  4XIH A;  4MZW A;  4HJM A;  4X4J A;  4ECJ A;  3RDW A;  5ELG A;  5ECN B;  3TCO A;  4L0U A;  2B5X A;  2FY6 A;  2NVL A;  5GZZ B;  3KMN A;  4O5U A;  2DKH A;  4BVX B;  3CQF A;  2O7K A;  4NV5 A;  2YV9 A;  3L9U A;  1EOH A;  3TKS E;  4Q5F A;  3EU4 A;  5D9T A;  3VPQ A;  1TW9 A;  1ZYQ B;  3WT1 A;  1M3I A;  2QKE A;  2CZ3 A;  2WGR A;  3SBC A;  4HJ2 A;  4I97 A;  4K6X A;  4E8H A;  2L5O A;  5IQY A;  1ZGN A;  4YKG A;  1HQO A;  2JAD A;  2H66 A;  3TKS A;  4OFT A;  2DMM A;  3FR3 A;  1FVJ A;  3IOS A;  3GKM A;  4MJC A;  2J9H A;  3MNG A;  5GAP D;  4ISD A;  1THX A;  2DIZ A;  1JZW A;  1YKC A;  2HRA A;  1XOB A;  3TJF A;  3HA9 A;  5A5K A;  5E4W A;  1Q4J A;  3E0U A;  1MD4 A;  3ERF A;  1OYJ A;  3Q6O A;  4MNN A;  3BJ5 A;  1WMJ A;  5G2Z A;  2VCV A;  2YN1 A;  4DSS B;  5HR0 A;  4K5R A;  3M0F A;  11GS A;  2I81 A;  3TJK A;  1TOF A;  5ID2 A;  2LST A;  4N0Z A;  4IJI A;  2VLU A;  4LMV A;  1GSQ A;  4I2U A;  2ALB A;  2H0I A;  2JZS A;  2KHP A;  2BJX A;  4AGS A;  1K3Y A;  2GS3 A;  4HZ2 A;  1GSU A;  4J2F A;  1GLQ A;  4MF5 A;  4BL7 B;  1N2A A;  1QFN A;  1GSE A;  2YWI A;  2CZ2 A;  2LUS A;  2L6D A;  3LSZ A;  17GS A;  3VLN A;  3C71 A;  2OAD A;  3ERG A;  3M8N A;  3A2X A;  4Q5R A;  5ABR A;  3UBL A;  3TGZ A;  4Z2T A;  5A4U A;  3MDK A;  5B8A A;  3VK9 A;  2A2S A;  1ILO A;  1GL8 A;  4TKY A;  1T8E B;  2C3Q A;  3TDG A;  1XWG A;  1ERV A;  5ECH B;  1SK0 A;  3ZFB A;  2GSS A;  4TXO B;  5KN0 A;  2GSR A;  2AHE A;  2B5Y A;  3U5R E;  4GWR A;  5IOW A;  2HNL A;  3EVI A;  1AQV A;  2JAC A;  5CO3 A;  2H8L A;  3GL3 A;  3BOA A;  2YP6 A;  2CX3 A;  4Z7X A;  4Q5N A;  3APO A;  5G5E A;  5IPH A;  1YEP A;  3NZN A;  2H6X A;  1JZD A;  2GZY A;  3VWX A;  3A2V A;  2IFQ B;  3GSS A;  4N0V A;  3D5J A;  5HR1 A;  3ZTL A;  3IAS 2;  1A8L A;  2GQK A;  1AQX A;  1K0B A;  2VCQ A;  2B1L A;  5B6M A;  1O8W A;  3GUR A;  1FOH A;  4HUA A;  3F4S A;  2C3N A;  4CW9 A;  2CV4 A;  3A2W A;  5HR2 A;  2ZNM A;  4V2M A;  3TKR A;  3WT2 A;  2EIR A;  2PGT A;  2CAQ A;  3DYR A;  2YWO A;  3GMF A;  3K8N A;  5FWG A;  1DSB A;  3UBK A;  1DUG A;  4IVF A;  3HVV A;  1FW1 A;  2IMK A;  4HS1 A;  1OC9 A;  5ECR B;  3ZYW A;  1T4Y A;  3EC3 A;  2DLX A;  5LNK e;  5J9C A;  3F6F A;  3SWL A;  2PN8 A;  3L4N A;  3D4T A;  4ZB8 A;  2P5R A;  3F3R A;  3D0Z A;  3L78 A;  4OCF A;  4PNG A;  2CA8 A;  4IP6 A;  4NAX A;  5ID2 B;  3LYP A;  5IMA A;  1VF4 A;  2X8G A;  1IYH A;  1VF1 A;  1X5D A;  2DSA A;  2VL2 A;  3GFK A;  14GS A;  5D93 A;  1EEM A;  2BMX A;  3APS A;  2QSI A;  1AUC A;  2YCD A;  1NM3 A;  5C00 A;  5GAN D;  3F63 A;  1SL0 B;  3M1G A;  4D73 A;  5AN1 A;  5GST A;  3HJP A;  4WF5 A;  3QR6 A;  2CT6 A;  3J7Y k;  4MH2 A;  3WGD A;  4BPY A;  3GN3 A;  2HLS A;  4K7I A;  4GTU A;  4ZBD A;  2E2M A;  4H86 A;  1X9M B;  2V32 A;  1V98 A;  4ICY A;  1G7E A;  2TRX A;  2B7K A;  2K6V A;  1H4O A;  1T4Z A;  1VGL A;  3D22 A;  3C8E A;  1XVW A;  4MZB A;  3QAG A;  2MZC A;  1XIY A;  3CXG A;  1XWB A;  1GTB A;  4X1U A;  2B5E A;  2WZ9 A;  4IEL A;  3GH6 A;  4IN0 A;  3W8S A;  1HNB A;  1Z6N A;  3F4R A;  2PVQ A;  5ELA A;  1S3R A;  1SKR B;  1PD2 1;  2V2G A;  4Z2U A;  2AYT A;  1O8X A;  1B4Q A;  4L8E A;  3KGK A;  4KND A;  2XHF A;  3O6T A;  3HHV A;  1YDK A;  3KH7 A;  2ON7 A;  2H0G A;  4XHM A;  2DC5 A;  5C04 A;  4EDZ A;  4X43 A;  4BVX A;  4IHU A;  1TDI A;  3UAR A;  1WJK A;  2LJA A;  1DE2 A;  3LYK A;  2V6K A;  4JED A;  1SK1 A;  3ZL5 A;  4HEA 2;  4KSO A;  4IQA A;  3GUS A;  4GRF A;  5CRH A;  2LRN A;  1EZK A;  2MMN A;  3MIX A;  4HSC X;  2PVO C;  1VF2 A;  6GSU A;  1Z7P A;  3HCZ A;  4V1A g;  1GSF A;  3PPU A;  3UVT A;  1FOV A;  2WCI A;  4BA7 A;  5DCH A;  1OC9 B;  1WOU A;  4TXV A;  1A0R P;  1XWC A;  1ZMA A;  1WPI A;  3QD9 A;  4AJ8 A;  3M9K A;  4MJB A;  1A2J A;  1GUL A;  3FYG A;  3RPN A;  5DJL A;  5IMC A;  4JE1 A;  2FWH A;  4KH7 A;  4KE3 A;  5ECP B;  3DWV A;  3D6I A;  4FYU A;  2AB6 A;  4OO5 A;  1EEJ A;  5HQP A;  2FA8 A;  2HE3 A;  2LRC A;  5FHI A;  3GHA A;  3H93 A;  3HKR A;  2OAC A;  2VCT A;  2IPA A;  3CTG A;  1QQ2 A;  1K0O A;  1XW9 A;  20GS A;  4DSS A;  1DE1 A;  4AJ6 A;  1A2L A;  1OC3 A;  1PX7 A;  4TR0 A;  2IMD A;  2QA1 A;  2FD3 A;  3N9J A;  1TRV A;  1LBK A;  3H4K A;  3F4T A;  1HD2 A;  4FYB A;  1YEX A;  2V41 A;  1KTE A;  4KX4 A;  3LGC A;  3WYW A;  5INY A;  3DVW A;  5IPG A;  4KUN A;  3EMX A;  4RUV A;  5AIV A;  3WGX A;  3A5I A;  3QMX A;  2G0F A;  9GSS A;  1V57 A;  1R5P A;  2QC7 A;  2VOC A;  3QFA C;  2HRN A;  1HYU A;  3F3Q A;  4BL7 A;  4F9Z A;  2I4A A;  4AF2 A;  2GT6 A;  4USS A;  3C1S A;  1SKW B;  2IMI A;  3BCK A;  3BCI A;  4PUA A;  2UZ8 A;  1H75 A;  1GUK A;  4ZXG A;  1OE8 A;  1BYE A;  2Z9S A;  1BED A;  4L5L A;  1GTI A;  4GXZ A;  3D4M A;  5CRE A;  5CNW A;  1TRW A;  1ERT A;  4XS1 A;  5COH A;  1ZCP A;  2KUC A;  1TKD B;  2DML A;  4MPG A;  4DSR A;  1TRU A;  4TXO A;  2L6C A;  2KOK A;  1KNG A;  4FH8 A;  5J5N A;  3CBU A;  4ULX A;  3TUE A;  4MH3 A;  5J4U A;  5KOX A;  3I43 A;  3VPT A;  2H1G A;  2VLV A;  1IYI A;  1Z7R A;  18GS A;  1UC7 A;  3M3M A;  2IFQ A;  4KB3 A;  1SJ6 A;  2R0C A;  3FRC A;  1T7P B;  3ZIJ A;  5G1L A;  1LJR A;  1U6T A;  1K0C A;  5J3R A;  2MMZ A;  2PPT A;  2FUG 2;  1A8Y A;  5ECM B;  4EO3 A;  1ERU A;  5D73 A;  3ME8 A;  5DAL B;  1GUM A;  2GLR A;  3IDV A;  2FA4 A;  1NHY A;  4QQ7 A;  2X49 A;  5B8B A;  4HI7 A;  1S3A A;  4LMW A;  4MMM A;  2REM A;  2IWT A;  4NHW A;  5F0G A;  2HSH A;  2H19 A;  2FWF A;  2I3Y A;  1B9X C;  1G7O A;  5ECK B;  4CY8 A;  1EGO A;  3C1R A;  3RHC A;  1YQ1 A;  4K5S A;  3CRU A;  3PR8 A;  3DIE A;  5F06 A;  4N10 A;  1G0T A;  2GST A;  2K8V A;  4K7N A;  4F03 A;  4EKZ A;  2MBS A;  2WS2 A;  3EWL A;  3IA1 A;  3DRN A;  3DGQ A;  4I6X A;  3GRX A;  1K3L A;  1GP1 A;  2O85 A;  1F3A A;  2MBT A;  3ZML A;  8GSS A;  2LS5 A;  1X5C A;  2FNO A;  3IE3 A;  2LNS A;  2L4Q A;  4O32 A;  4YAV A;  3ZRD A;  1M9B A;  1ACV A;  2DBC A;  2H75 A;  3IRA A;  4CHS A;  5D9W A;  5IO2 A;  2HXK A;  2H73 A;  4PUF C;  3FR6 A;  4KDU A;  5D96 A;  1ZYE A;  4XS4 B;  5CYY A;  2RM5 A;  2VCZ A;  1EP7 A;  3MAK A;  2F8A A;  3GKN A;  3J7Y b;  2PWJ A;  2C0F A;  1FO5 A;  2O87 A;  2HRF A;  5J41 A;  4Q5Q A;  2R0P A;  4GLT A;  4PX1 A;  7GSS A;  1A0F A;  3GX8 A;  1A23 A;  2CVD A;  4POK A;  3PGT A;  2DKI A;  1PQN A;  4RI7 A;  1F9M A;  3EPT A;  3EUR A;  3VWV A;  4ZBA A;  5IMV A;  2QGV A;  4ECI A;  2HZE B;  2H76 A;  5HFK A;  1GUH A;  2WFC A;  4MJA A;  3LOR A;  3LFL A;  3BD2 A;  3ZIT A;  1GWC A;  4DVC A;  1X9W B;  4I8B A;  1O81 A;  1GSY A;  4IP1 A;  4TW5 A;  2H1B A;  1SYR A;  3IXR A;  3Q19 A;  1CQH A;  1J0F A;  3GKK A;  1SU9 A;  2C0D A;  2H1D A;  12GS A;  2IIY A;  3ZVJ D;  1YF0 A;  5IM9 A;  2R3X A;  2FHE A;  3RAZ A;  5IMF A;  3C7M A;  1B9Y C;  2WB9 A;  3ZIV A;  4GF0 A;  2H72 A;  2OA7 A;  4YQM A;  5DAK B;  2C80 A;  3HZ4 A;  1T3B A;  1RQM A;  3VWW A;  4EF0 A;  1TI3 A;  3IBH A;  1TK8 B;  1W89 A;  5ECS A;  5F8B A;  2E2G A;  5AIX A;  4Z2R A;  4OMV A;  3GL5 A;  4ZIJ A;  2XBI A;  4XCS A;  1I5G A;  4KW6 A;  5G1K A;  1J9B A;  4L5O A;  5ENU A;  5G31 A;  3IV4 A;  2VIM A;  2B1K A;  2CVB A;  4AJ7 A;  4PXO A;  3W6G A;  3KP9 A;  5H5S A;  3GST A;  2CVK A;  2HT9 A;  1GNW A;  4L0W A;  3TKQ A;  1PL2 A;  4TR1 B;  2A2R A;  4ZL9 A;  2H71 A;  1EWX A;  2I1U A;  3OR5 A;  1EOG A;  3PIN A;  2LQQ A;  2IMF A;  4X0X A;  1JZR A;  3LXT A;  4LL4 B;  4J57 E;  2D2Z A;  5D8I A;  2C0G A;  3IAM 2;  1XOA A;  3KIJ A;  2AUV A;  3V1W A;  1FAA A;  3TRQ A;  1ZYP A;  4N30 A;  5F07 A;  4K9Z A;  4KCA A;  3HYP A;  1DBY A;  4PUR A;  4PQH A;  2DJ3 A;  5AGY A;  3TKS C;  1SK2 A;  2PMT A;  3G7Y A;  22GS A;  4MJE A;  1XW5 A;  4ECC A;  5KN3 A;  4TN8 A;  3LWA A;  4FIW A;  2EC4 A;  1ON4 A;  4EIP A;  2F8F A;  4F0C A;  3NOF A;  2OE3 A;  3LXZ A;  4JU5 A;  5JWR B;  4PGT A;  3CSH A;  5ECQ B;  3VI5 A;  2A2P A;  3GYK A;  3KJY A;  2YWN A;  2H74 A;  3HJM A;  2MMA A;  1TI1 A;  3KXO A;  4G9H A;  3ZRE A;  3QCP A;  4BWS A;  3ZMK A;  3UOM A;  4RQR A;  3L0H A;  5DQY A;  1AXD A;  2O8V B;  4V1A p;  3KZQ A;  2L4C A;  1WWJ A;  2L5L A;  3KTB A;  4IS0 A;  4MK3 A;  2JU5 A;  2H70 A;  1BX9 A;  4HU9 A;  4IJ3 A;  16GS A;  5LD0 A;  4O5R A;  3KM6 A;  4G0L A;  3S9F A;  3QPM A;  1USB A;  3MSZ A;  3N5O A;  3US3 A;  3IC4 A;  2MMO A;  2LRT A;  3P2A A;  5CAX A;  5G5F A;  4ZIL A;  5FT3 A;  4YQV A;  4O92 A;  2HSM A;  2LJR A;  4FYC A;  4ILF A;  1XFL A;  1PRX A;  3H79 A;  3P90 A;  1YKA A;  1LU4 A;  1SYX A;  3L9V A;  4DEJ A;  4POM A;  2TIR A;  3IHQ A;  1A24 A;  1AAZ A;  1ZZY A;  1X0R A;  1PN0 A;  4ACS A;  2H6Z A;  1M9A A;  1R7H A;  2L57 A;  4XRD A;  4G0K A;  1B8X A;  2F51 A;  3IK9 A;  4LL1 B;  5BMU A;  2AAW A;  3GA4 A;  4LLR A;  2LTK A;  1GSD A;  1JLW A;  3KMO A;  2K18 A;  3W8J A;  4TR3 A;  3PH9 A;  3VI7 A;  4WXT A;  4G19 A;  1GLP A;  4EL1 A;  1WP0 A;  4WKW A;  3GH9 A;  4MF6 A;  5ECO B;  4HQS A;  3TRX A;  2J23 A;  2VL3 A;  1SJI A;  4NV2 A;  1NHO A;  1F37 A;  4IGJ A;  5DAL A;  5DBQ A;  4EE0 A;  2PUK C;  1VRS D;  4YQU A;  1SL2 B;  5EY6 A;  5DCG A;  3HZ8 A;  4IQ1 A;  4I2T A;  2YAN A;  1TP9 A;  4WBR D;  3RBT A;  1YZX A;  2PER A;  1AQW A;  2KLX A;  1UN2 A;  1U3A A;  2C4J A;  3FW2 A;  4K1F A;  3G7J A;  1GH2 A;  1GNE A;  2ZCT A;  3LJR A;  3RHB A;  4KF9 A;  4XS6 A;  4KDY A;  4LA1 A;  2JZT A;  2BTO T;  4WEY A;  3EYT A;  2OJL A;  2X99 A;  3E3E A;  1W4V A;  4NHZ A;  2HSY A;  1B48 A;  1TRS A;  2LEG A;  2NBS A;  2CAI A;  5DDL A;  1B4P A;  2JSY A;  3FR9 A;  4GQF A;  2KP1 A;  5F05 A;  4HDE A;  5KN1 A;  1F3B A;  1PN9 A;  5HFI A;  2R37 A;  5A4V A;  2YJH A;  1XG8 A;  2XC2 A;  3Q74 A;  3VFI A;  4XS4 A;  4EC0 A;  2VO4 A;  3GNJ A;  3CSI A;  4EIQ A;  2HRK A;  1YJ6 A;  3IHG A;  4MLY A;  4O7H A;  1XBS A;  4MP4 A;  4G0I A;  1FB0 A;  1SEN A;  1F2E A;  3FZ9 A;  3APQ A;  2LJK A;  1Y25 A;  5ECI B;  4JZQ A;  2VL2 C;  1OE7 A;  3ERW A;  1T00 A;  1V2A A;  2YZU A;  3R2Q A;  1MD3 A;  2YOI A;  3GX0 A;  1FHE A;  4MDC A;  4GSS A;  1M99 A;  4F0B A;  5CRG A;  3DXB A;  2JZR A;  2YWM A;  5DJM A;  2YJ7 A;  1BJX A;  4ML1 A;  2HZE A;  1SD9 A;  4FQU A;  1PA3 A;  3GKX A;  3CTF A;  4YKF A;  2HI7 A;  2MYG A;  2M72 A;  4TVE A;  1K0D A;  5IO0 A;  1MDK A;  1PSQ A;  1PKZ A;  2OE0 A;  2WDU A;  4KA0 A;  4TRX A;  1FB6 A;  2XPD A;  1TTZ A;  3F9U A;  4HOJ A;  2A4H A;  1YY7 A;  2JSZ A;  1M2A A;  3CSJ A;  4RQX A;  5JWO B;  2B6M A;  3ZLP A;  2VM1 A;  3F6D A;  3L9S A;  2YNX A;  5ECL B;  3VUR A;  2G2Q A;  4HZ4 A;  2X8H A;  3ISO A;  5EL8 A;  2WJU A;  3A5W A;  3ZZX A;  3LQ7 A;  1GSS A;  3R3E A;  4FO5 A;  5DAK A;  4NMU A;  2VL9 A;  2I9H A;  2ES7 A;  1N8J A;  2C1Y A;  1ERW A;  4ECB A;  5DQS A;  3F8U A;  1TJD A;  3JCM L;  3UAP A;  1Q98 A;  1MDJ A;  3AY8 A;  6GSW A;  1BQ7 A;  1KBN A;  3EU3 A;  4K2D A;  3HVS A;  1EP8 A;  2L59 A;  3HVX A;  2B3S A;  3HXS A;  2OE1 A;  3GTU B;  4K0G A;  2VAF A;  3QAW A;  2C8U A;  4TR1 A;  1OKD A;  3DKS A;  4K2X A;  3D21 A;  3CRT A;  4K0N A;  4V2L A;  1OC8 A;  2VLT A;  4E8E A;  2QA2 A;  1C72 A;  5JCG A;  3UL3 A;  1GRX A;  1TU8 A;  3FK8 A;  1PGT A;  3KD0 A;  1XWK A;  4IKH A;  1X5E A;  1QXH A;  3LG6 A;  3BBY A;  1XW6 A;  1VF3 A;  2JL4 A;  4BWQ A;  1S3C A;  3E9J B;  2P31 A;  3HDC A;  4XRA A;  3TRP A;  6GSX A;  2X8C A;  1K0N A;  2GGT A;  3G7I A;  1Z3E A;  1E2Y A;  4ID0 A;  4KDX A;  2FWE A;  1HNC A;  3UIW A;  2YPM A;  3TB2 A;  3Q18 A;  5L71 A;  5EPF A;  1UA5 A;  2N5A A;  2OBK A;  1QGV A;  5KN2 A;  2RUF A;  1ZL9 A;  2VD0 A;  1U87 A;  1U3I A;  4ZB9 A;  3F0I A;  4GSN A;  2GDR A;  2YZH A;  2H6Y A;  4ZBB A;  4J56 E;  3ME7 A;  4F82 A;  4BVY B;  2FGX A;  4NXI A;  3TOU A;  2P0G A;  4K8M A;  2HYX A;  1OKT A;  1FG4 A;  2PU9 C;  3KP8 A;  4QL7 A;  3EE2 A;  1ST9 A;  1I9D A;  3QAV A;  2N5B A;  4KGI A;  4A5P A;  2RII A;  1MDI A;  5IMZ A;  2LV3 A;  2CX4 A;  1XXU A;  1PMT A;  1R5A A;  1M3J A;  2CQ9 A;  2FWG A;  5A4W A;  3FZ4 A;  4POL A;  1O7U A;  3FZ5 A;  1BAY A;  3G9B A;  2M46 A;  2IJY A;  4I5Q A;  2N5F A;  1MEK A;  4TR4 A;  3TOT A;  3DD3 A;  5JCW A;  4WF4 A;  1G6W A;  2AJQ B;  1XCC A;  2GZZ A;  2V1M A;  1AW9 A;  1AC1 A;  4KAE A;  4OFN A;  1WRY A;  1E6B A;  1PKW A;  1Y6E A;  5H5R A;  2AV4 A;  3QFB C;  5KEJ A;  5CP1 A;  4OD7 A;  4OWY A;  2K9F A;  2IN3 A;  4OCE A;  3FZA A;  1FVK A;  4POB A;  3EIN A;  2GT5 A;  3IK7 A;  4P3Y B;  6GSS A;  2DJ0 A;  1PL1 A;  1HNA A;  2R5G A;  2VD1 A;  4JR6 A;  3NIV A;  3H1N A;  4EVM A;  3IR4 A;  5IOX A;  2A4V A;  3DML A;  4K7O A;  3KH9 A;  2DJJ A;  4NWY A;  4GST A;  3DEX A;  1WIK A;  4PQ1 A;  1O85 A;  2HZF A;  1EV4 A;  2OBI A;  2YV7 A;  2VCX A;  4EDY A;  3KTL A;  5BRT A;  1CQG A;  4ZB6 A;  1K0M A;  4HQZ A;  1TXX A;  4OO4 A;  2X64 A;  3TKP A;  2XPE A;  1NW2 A;  3UEM A;  1URM A;  3TJB A;  2LKU A;  1GTU A;  1PX6 A;  4CDO A;  1TU7 A;  4IW9 A;  4F2I A;  2XBQ A;  1M0U A;  13GS A;  2IL3 A;  2GVP A;  2VCW A;  1F6M C;  4GQC A;  5D9V A;  1SL1 B;  4O5Q A;  5B6N A; 
#chains in the Genus database with same CATH homology
 1U88 A;  2GQL A;  3HY2 A;  3IPZ A;  3QDN A;  2K8S A;  3FEU A;  3ZVJ A;  1M2B A;  2GQM A;  2ON5 A;  5CRW A;  2KP2 A;  5IIZ A;  2GSQ A;  1ZYN A;  3WD6 A;  4JBB A;  4MZC A;  3RPP A;  2ZUP A;  3TJJ A;  1JHB A;  1K0A A;  1SJZ A;  19GS A;  1QMV A;  5G30 A;  2E0Q A;  1YF1 A;  2FCH A;  1AIU A;  2DJ1 A;  4CY6 A;  5B7C A;  5CRD A;  1QUW A;  1ZOF A;  1K3O A;  3HJO A;  2RLI A;  1O6J A;  3IC8 A;  1V58 A;  2NTO A;  1Z6M A;  2H30 A;  1TK0 B;  3WGE A;  5E59 A;  1XWA A;  3MYD A;  5GSS A;  2WRT A;  3ED3 A;  3MWH A;  1BG5 A;  1RW1 A;  4WR5 A;  3FMW A;  6GSY A;  10GS A;  1MTC A;  1S3D A;  3A3T A;  1GTA A;  2HFD A;  1RK4 A;  4EXJ A;  4GCI A;  2H01 A;  3CYN A;  4DSQ A;  3GIX A;  2O89 A;  3U6V A;  1NSW A;  2TRC P;  2FLS A;  2H0H A;  1JLV A;  4YH2 A;  4MCU A;  1XVQ A;  2C3T A;  6GST A;  1EV9 A;  5HR3 A;  3DVX A;  4NPB A;  4MF7 A;  4V2N A;  3C73 A;  1TK5 B;  1O73 A;  5AIS A;  3KCM A;  4ZL8 A;  2RM6 A;  2DJ2 A;  1QK8 A;  1Z5Y E;  2PBJ A;  1G6Y A;  4G10 A;  1V40 A;  2P5Q A;  4KSM A;  4PQI A;  5EVO A;  1JFU A;  3LEF A;  3P8W A;  4KCE A;  4G2E A;  4IBP A;  1M7T A;  3I69 A;  4WET A;  1WE0 A;  1EGR A;  3FHK A;  2X4A A;  2H1A A;  2VUP A;  2B7J A;  5DVB A;  5HFG A;  1A2M A;  2RUE A;  4JRR A;  4MAB A;  1OVN A;  4XTS A;  4OFM A;  3KEB A;  4ZL7 A;  4JR4 A;  1J08 A;  2NPB A;  4RI6 A;  3GTU A;  2R6K A;  4PNF A;  1SD8 A;  2NDO A;  4MA9 A;  2GTU A;  5J9B A;  5LCZ A;  3O76 A;  2R4V A;  4WBJ A;  5D9X A;  4ML6 A;  2R0G A;  4N11 A;  5JCU A;  2VM2 A;  1UVZ A;  2C0E A;  2IME A;  1R4W A;  4D73 B;  2LNT A;  2E7P A;  2EIO A;  2M80 A;  5KOW A;  2V6O A;  1X9S B;  1V9W A;  4WR4 A;  5H5Q A;  4EUY A;  1T1V A;  1OAZ A;  1KEB A;  4TOP A;  1ABA A;  2DIY A;  3FY7 A;  1SKS B;  1M2D A;  3LW9 A;  1ML6 A;  3EMP A;  4PTS A;  2F9S A;  6GSV A;  3TJG A;  3M9J A;  3QOU A;  1THO A;  3UVH A;  4QL9 A;  4MPF A;  3HD5 A;  3CMI A;  2OKA A;  3FKF A;  1XPV A;  3UMA A;  1R26 A;  4YAP A;  3O3T A;  3ZFL A;  2WUL A;  3I6A A;  1JZO A;  3H8Q A;  3VWU A;  5IMD A;  3I9V 2;  2F3M A;  4BVY A;  3P7X A;  2GZP A;  1XZO A;  1Z9H A;  2R2J A;  2LQO A;  2DJK A;  5JWQ B;  2EIQ A;  3GV1 A;  3UJ1 A;  4HU7 A;  4XIH A;  4MZW A;  4HJM A;  4X4J A;  4ECJ A;  3RDW A;  5ELG A;  5ECN B;  3TCO A;  4L0U A;  2B5X A;  2FY6 A;  2NVL A;  5GZZ B;  3KMN A;  4O5U A;  2DKH A;  4BVX B;  2O7K A;  4NV5 A;  2YV9 A;  3L9U A;  1EOH A;  3TKS E;  4Q5F A;  3EU4 A;  5D9T A;  3VPQ A;  1TW9 A;  1ZYQ B;  3WT1 A;  2QKE A;  2CZ3 A;  2WGR A;  3SBC A;  4HJ2 A;  4I97 A;  4K6X A;  4E8H A;  2L5O A;  5IQY A;  1ZGN A;  4YKG A;  1HQO A;  2JAD A;  2H66 A;  3TKS A;  4OFT A;  2DMM A;  3FR3 A;  1FVJ A;  3IOS A;  3GKM A;  4MJC A;  2J9H A;  3MNG A;  5GAP D;  4ISD A;  1THX A;  2DIZ A;  1JZW A;  1YKC A;  2HRA A;  1XOB A;  3TJF A;  3HA9 A;  5A5K A;  5E4W A;  1Q4J A;  3E0U A;  1MD4 A;  3ERF A;  1OYJ A;  3Q6O A;  4MNN A;  3BJ5 A;  1WMJ A;  5G2Z A;  2VCV A;  2YN1 A;  4DSS B;  5HR0 A;  4K5R A;  3M0F A;  11GS A;  2I81 A;  3TJK A;  1TOF A;  5ID2 A;  2LST A;  4N0Z A;  4IJI A;  2VLU A;  4LMV A;  1GSQ A;  4I2U A;  2ALB A;  2H0I A;  2JZS A;  2KHP A;  2BJX A;  4AGS A;  1K3Y A;  2GS3 A;  4HZ2 A;  1GSU A;  4J2F A;  1GLQ A;  4MF5 A;  4BL7 B;  1N2A A;  1QFN A;  1GSE A;  2YWI A;  2CZ2 A;  2LUS A;  2L6D A;  3LSZ A;  17GS A;  3VLN A;  3C71 A;  2OAD A;  3ERG A;  3M8N A;  3A2X A;  4Q5R A;  5ABR A;  3UBL A;  3TGZ A;  4Z2T A;  5A4U A;  3MDK A;  5B8A A;  3VK9 A;  2A2S A;  1ILO A;  1GL8 A;  4TKY A;  1T8E B;  2C3Q A;  3TDG A;  1XWG A;  1ERV A;  5ECH B;  1SK0 A;  3ZFB A;  2GSS A;  4TXO B;  5KN0 A;  2GSR A;  2AHE A;  2B5Y A;  3U5R E;  4GWR A;  5IOW A;  2HNL A;  3EVI A;  1AQV A;  2JAC A;  5CO3 A;  2H8L A;  3GL3 A;  3BOA A;  2YP6 A;  2CX3 A;  4Z7X A;  4Q5N A;  3APO A;  5G5E A;  5IPH A;  1YEP A;  3NZN A;  2H6X A;  1JZD A;  2GZY A;  3VWX A;  3A2V A;  2IFQ B;  3GSS A;  4N0V A;  3D5J A;  5HR1 A;  3ZTL A;  3IAS 2;  1A8L A;  2GQK A;  1AQX A;  1K0B A;  2VCQ A;  2B1L A;  5B6M A;  1O8W A;  3GUR A;  1FOH A;  4HUA A;  3F4S A;  2C3N A;  4CW9 A;  2CV4 A;  3A2W A;  5HR2 A;  2ZNM A;  4V2M A;  3TKR A;  3WT2 A;  2EIR A;  2PGT A;  2CAQ A;  3DYR A;  2YWO A;  3GMF A;  3K8N A;  5FWG A;  1DSB A;  3UBK A;  1DUG A;  4IVF A;  3HVV A;  1FW1 A;  2IMK A;  4HS1 A;  1OC9 A;  5ECR B;  3ZYW A;  1T4Y A;  3EC3 A;  2DLX A;  5LNK e;  5J9C A;  3F6F A;  3SWL A;  2PN8 A;  3L4N A;  3D4T A;  4ZB8 A;  2P5R A;  3F3R A;  3D0Z A;  3L78 A;  4OCF A;  4PNG A;  2CA8 A;  4IP6 A;  4NAX A;  5ID2 B;  3LYP A;  5IMA A;  1VF4 A;  2X8G A;  1IYH A;  1VF1 A;  1X5D A;  2DSA A;  2VL2 A;  3GFK A;  14GS A;  5D93 A;  1EEM A;  2BMX A;  3APS A;  2QSI A;  1AUC A;  2YCD A;  1NM3 A;  5C00 A;  5GAN D;  3F63 A;  1SL0 B;  3M1G A;  4D73 A;  5AN1 A;  5GST A;  3HJP A;  4WF5 A;  3QR6 A;  2CT6 A;  3J7Y k;  4MH2 A;  3WGD A;  4BPY A;  3GN3 A;  2HLS A;  4K7I A;  4GTU A;  4ZBD A;  2E2M A;  4H86 A;  1X9M B;  2V32 A;  1V98 A;  4ICY A;  1G7E A;  2TRX A;  2B7K A;  2K6V A;  1H4O A;  1T4Z A;  1VGL A;  3D22 A;  3C8E A;  1XVW A;  4MZB A;  3QAG A;  2MZC A;  1XIY A;  3CXG A;  1XWB A;  1GTB A;  4X1U A;  2B5E A;  2WZ9 A;  4IEL A;  3GH6 A;  4IN0 A;  3W8S A;  1HNB A;  1Z6N A;  3F4R A;  2PVQ A;  5ELA A;  1SKR B;  1PD2 1;  2V2G A;  4Z2U A;  2AYT A;  1O8X A;  1B4Q A;  4L8E A;  3KGK A;  4KND A;  2XHF A;  3O6T A;  3HHV A;  1YDK A;  3KH7 A;  2ON7 A;  2H0G A;  4XHM A;  2DC5 A;  5C04 A;  4EDZ A;  4X43 A;  4BVX A;  4IHU A;  1TDI A;  3UAR A;  1WJK A;  2LJA A;  1DE2 A;  3LYK A;  2V6K A;  4JED A;  1SK1 A;  3ZL5 A;  4HEA 2;  4KSO A;  4IQA A;  3GUS A;  4GRF A;  5CRH A;  2LRN A;  1EZK A;  2MMN A;  3MIX A;  2PVO C;  1VF2 A;  6GSU A;  1Z7P A;  3HCZ A;  4V1A g;  1GSF A;  3PPU A;  3UVT A;  1FOV A;  2WCI A;  4BA7 A;  5DCH A;  1OC9 B;  1WOU A;  4TXV A;  1A0R P;  1XWC A;  1ZMA A;  1WPI A;  3QD9 A;  4AJ8 A;  3M9K A;  4MJB A;  1A2J A;  1GUL A;  3FYG A;  3RPN A;  5DJL A;  5IMC A;  4JE1 A;  2FWH A;  4KH7 A;  4KE3 A;  5ECP B;  3DWV A;  3D6I A;  4FYU A;  2AB6 A;  4OO5 A;  1EEJ A;  5HQP A;  2FA8 A;  2HE3 A;  2LRC A;  5FHI A;  3GHA A;  3H93 A;  3HKR A;  2OAC A;  2VCT A;  2IPA A;  3CTG A;  1QQ2 A;  1K0O A;  1XW9 A;  20GS A;  4DSS A;  1DE1 A;  4AJ6 A;  1A2L A;  1OC3 A;  1PX7 A;  4TR0 A;  2IMD A;  2QA1 A;  2FD3 A;  3N9J A;  1TRV A;  1LBK A;  3H4K A;  3F4T A;  1HD2 A;  4FYB A;  1YEX A;  2V41 A;  1KTE A;  4KX4 A;  3LGC A;  3WYW A;  5INY A;  3DVW A;  5IPG A;  4KUN A;  3EMX A;  4RUV A;  5AIV A;  3WGX A;  3A5I A;  3QMX A;  2G0F A;  9GSS A;  1V57 A;  1R5P A;  2QC7 A;  2VOC A;  3QFA C;  2HRN A;  1HYU A;  3F3Q A;  4BL7 A;  4F9Z A;  2I4A A;  4AF2 A;  2GT6 A;  4USS A;  3C1S A;  1SKW B;  2IMI A;  3BCK A;  3BCI A;  4PUA A;  2UZ8 A;  1H75 A;  1GUK A;  4ZXG A;  1OE8 A;  1BYE A;  2Z9S A;  1BED A;  4L5L A;  1GTI A;  4GXZ A;  3D4M A;  5CRE A;  5CNW A;  1TRW A;  1ERT A;  4XS1 A;  5COH A;  1ZCP A;  2KUC A;  1TKD B;  2DML A;  4MPG A;  4DSR A;  1TRU A;  4TXO A;  2L6C A;  2KOK A;  1KNG A;  4FH8 A;  5J5N A;  3CBU A;  4ULX A;  3TUE A;  4MH3 A;  5J4U A;  5KOX A;  3I43 A;  3VPT A;  2H1G A;  2VLV A;  1IYI A;  1Z7R A;  18GS A;  1UC7 A;  3M3M A;  2IFQ A;  4KB3 A;  1SJ6 A;  2R0C A;  3FRC A;  1T7P B;  3ZIJ A;  5G1L A;  1LJR A;  1U6T A;  1K0C A;  5J3R A;  2MMZ A;  2PPT A;  2FUG 2;  1A8Y A;  5ECM B;  4EO3 A;  1ERU A;  5D73 A;  3ME8 A;  5DAL B;  1GUM A;  2GLR A;  3IDV A;  2FA4 A;  1NHY A;  4QQ7 A;  2X49 A;  5B8B A;  4HI7 A;  1S3A A;  4LMW A;  4MMM A;  2REM A;  2IWT A;  4NHW A;  5F0G A;  2HSH A;  2H19 A;  2FWF A;  2I3Y A;  1B9X C;  1G7O A;  5ECK B;  4CY8 A;  1EGO A;  3C1R A;  3RHC A;  1YQ1 A;  4K5S A;  3CRU A;  3PR8 A;  3DIE A;  5F06 A;  4N10 A;  1G0T A;  2GST A;  2K8V A;  4K7N A;  4F03 A;  4EKZ A;  2MBS A;  2WS2 A;  3EWL A;  3IA1 A;  3DRN A;  3DGQ A;  4I6X A;  3GRX A;  1K3L A;  1GP1 A;  2O85 A;  1F3A A;  2MBT A;  3ZML A;  8GSS A;  2LS5 A;  1X5C A;  2FNO A;  3IE3 A;  2LNS A;  2L4Q A;  4O32 A;  4YAV A;  3ZRD A;  1M9B A;  1ACV A;  2DBC A;  2H75 A;  3IRA A;  4CHS A;  5D9W A;  5IO2 A;  2HXK A;  2H73 A;  4PUF C;  3FR6 A;  4KDU A;  5D96 A;  1ZYE A;  4XS4 B;  5CYY A;  2RM5 A;  2VCZ A;  1EP7 A;  3MAK A;  2F8A A;  3GKN A;  3J7Y b;  2PWJ A;  2C0F A;  1FO5 A;  2O87 A;  2HRF A;  5J41 A;  4Q5Q A;  2R0P A;  4GLT A;  4PX1 A;  7GSS A;  1A0F A;  3GX8 A;  1A23 A;  2CVD A;  4POK A;  3PGT A;  2DKI A;  1PQN A;  4RI7 A;  1F9M A;  3EPT A;  3EUR A;  3VWV A;  4ZBA A;  5IMV A;  2QGV A;  4ECI A;  2HZE B;  2H76 A;  5HFK A;  1GUH A;  2WFC A;  4MJA A;  3LOR A;  3LFL A;  3BD2 A;  3ZIT A;  1GWC A;  4DVC A;  1X9W B;  4I8B A;  1O81 A;  1GSY A;  4IP1 A;  4TW5 A;  2H1B A;  1SYR A;  3IXR A;  3Q19 A;  1CQH A;  1J0F A;  3GKK A;  1SU9 A;  2C0D A;  2H1D A;  12GS A;  2IIY A;  3ZVJ D;  1YF0 A;  5IM9 A;  2R3X A;  2FHE A;  3RAZ A;  5IMF A;  3C7M A;  1B9Y C;  2WB9 A;  3ZIV A;  4GF0 A;  2H72 A;  2OA7 A;  4YQM A;  5DAK B;  2C80 A;  3HZ4 A;  1T3B A;  1RQM A;  3VWW A;  4EF0 A;  1TI3 A;  3IBH A;  1TK8 B;  1W89 A;  5ECS A;  5F8B A;  2E2G A;  5AIX A;  4Z2R A;  4OMV A;  3GL5 A;  4ZIJ A;  2XBI A;  4XCS A;  1I5G A;  4KW6 A;  5G1K A;  1J9B A;  4L5O A;  5ENU A;  5G31 A;  3IV4 A;  2VIM A;  2B1K A;  2CVB A;  4AJ7 A;  4PXO A;  3W6G A;  3KP9 A;  5H5S A;  3GST A;  2CVK A;  2HT9 A;  1GNW A;  4L0W A;  3TKQ A;  1PL2 A;  4TR1 B;  2A2R A;  4ZL9 A;  2H71 A;  1EWX A;  2I1U A;  3OR5 A;  1EOG A;  3PIN A;  2LQQ A;  2IMF A;  4X0X A;  1JZR A;  3LXT A;  4LL4 B;  4J57 E;  2D2Z A;  5D8I A;  2C0G A;  3IAM 2;  1XOA A;  3KIJ A;  2AUV A;  3V1W A;  1FAA A;  3TRQ A;  1ZYP A;  4N30 A;  5F07 A;  4K9Z A;  4KCA A;  3HYP A;  1DBY A;  4PUR A;  4PQH A;  2DJ3 A;  5AGY A;  3TKS C;  1SK2 A;  2PMT A;  3G7Y A;  22GS A;  4MJE A;  1XW5 A;  4ECC A;  5KN3 A;  4TN8 A;  3LWA A;  4FIW A;  2EC4 A;  1ON4 A;  4EIP A;  2F8F A;  4F0C A;  3NOF A;  2OE3 A;  3LXZ A;  4JU5 A;  5JWR B;  4PGT A;  3CSH A;  5ECQ B;  3VI5 A;  2A2P A;  3GYK A;  3KJY A;  2YWN A;  2H74 A;  3HJM A;  2MMA A;  1TI1 A;  3KXO A;  4G9H A;  3ZRE A;  3QCP A;  4BWS A;  3ZMK A;  3UOM A;  4RQR A;  3L0H A;  5DQY A;  1AXD A;  2O8V B;  4V1A p;  3KZQ A;  2L4C A;  1WWJ A;  2L5L A;  3KTB A;  4IS0 A;  4MK3 A;  2JU5 A;  2H70 A;  1BX9 A;  4HU9 A;  4IJ3 A;  16GS A;  5LD0 A;  4O5R A;  3KM6 A;  4G0L A;  3S9F A;  3QPM A;  1USB A;  3MSZ A;  3N5O A;  3US3 A;  3IC4 A;  2MMO A;  2LRT A;  3P2A A;  5CAX A;  5G5F A;  4ZIL A;  5FT3 A;  4YQV A;  4O92 A;  2HSM A;  2LJR A;  4FYC A;  4ILF A;  1XFL A;  1PRX A;  3H79 A;  3P90 A;  1YKA A;  1LU4 A;  1SYX A;  3L9V A;  4DEJ A;  4POM A;  2TIR A;  3IHQ A;  1A24 A;  1AAZ A;  1ZZY A;  1X0R A;  1PN0 A;  4ACS A;  2H6Z A;  1M9A A;  1R7H A;  2L57 A;  4XRD A;  4G0K A;  1B8X A;  2F51 A;  3IK9 A;  4LL1 B;  5BMU A;  2AAW A;  3GA4 A;  4LLR A;  2LTK A;  1GSD A;  1JLW A;  3KMO A;  2K18 A;  3W8J A;  4TR3 A;  3PH9 A;  3VI7 A;  4WXT A;  4G19 A;  1GLP A;  4EL1 A;  1WP0 A;  4WKW A;  3GH9 A;  4MF6 A;  5ECO B;  4HQS A;  3TRX A;  2J23 A;  2VL3 A;  1SJI A;  4NV2 A;  1NHO A;  1F37 A;  4IGJ A;  5DAL A;  5DBQ A;  4EE0 A;  2PUK C;  1VRS D;  4YQU A;  1SL2 B;  5EY6 A;  5DCG A;  3HZ8 A;  4IQ1 A;  4I2T A;  2YAN A;  1TP9 A;  4WBR D;  3RBT A;  1YZX A;  2PER A;  1AQW A;  2KLX A;  1UN2 A;  1U3A A;  2C4J A;  3FW2 A;  4K1F A;  3G7J A;  1GH2 A;  1GNE A;  2ZCT A;  3LJR A;  3RHB A;  4KF9 A;  4XS6 A;  4KDY A;  4LA1 A;  2JZT A;  2BTO T;  4WEY A;  3EYT A;  2OJL A;  2X99 A;  3E3E A;  1W4V A;  4NHZ A;  2HSY A;  1B48 A;  1TRS A;  2LEG A;  2NBS A;  2CAI A;  5DDL A;  1B4P A;  2JSY A;  3FR9 A;  4GQF A;  2KP1 A;  5F05 A;  4HDE A;  5KN1 A;  1F3B A;  1PN9 A;  5HFI A;  2R37 A;  5A4V A;  2YJH A;  2XC2 A;  3Q74 A;  3VFI A;  4XS4 A;  4EC0 A;  2VO4 A;  3GNJ A;  3CSI A;  4EIQ A;  2HRK A;  1YJ6 A;  3IHG A;  4MLY A;  4O7H A;  1XBS A;  4MP4 A;  4G0I A;  1FB0 A;  1SEN A;  1F2E A;  3FZ9 A;  3APQ A;  2LJK A;  1Y25 A;  5ECI B;  4JZQ A;  2VL2 C;  1OE7 A;  3ERW A;  1T00 A;  1V2A A;  2YZU A;  3R2Q A;  1MD3 A;  2YOI A;  3GX0 A;  1FHE A;  4MDC A;  4GSS A;  1M99 A;  4F0B A;  5CRG A;  3DXB A;  2JZR A;  2YWM A;  5DJM A;  2YJ7 A;  1BJX A;  4ML1 A;  2HZE A;  1SD9 A;  4FQU A;  1PA3 A;  3GKX A;  3CTF A;  4YKF A;  2HI7 A;  2MYG A;  2M72 A;  4TVE A;  1K0D A;  5IO0 A;  1MDK A;  1PSQ A;  1PKZ A;  2OE0 A;  2WDU A;  4KA0 A;  4TRX A;  1FB6 A;  2XPD A;  1TTZ A;  3F9U A;  4HOJ A;  2A4H A;  1YY7 A;  2JSZ A;  1M2A A;  3CSJ A;  4RQX A;  5JWO B;  2B6M A;  3ZLP A;  2VM1 A;  3F6D A;  3L9S A;  2YNX A;  5ECL B;  3VUR A;  2G2Q A;  4HZ4 A;  2X8H A;  3ISO A;  5EL8 A;  2WJU A;  3A5W A;  3ZZX A;  3LQ7 A;  1GSS A;  3R3E A;  4FO5 A;  5DAK A;  4NMU A;  2VL9 A;  2I9H A;  2ES7 A;  1N8J A;  2C1Y A;  1ERW A;  4ECB A;  5DQS A;  3F8U A;  1TJD A;  3JCM L;  3UAP A;  1Q98 A;  1MDJ A;  3AY8 A;  6GSW A;  1BQ7 A;  1KBN A;  3EU3 A;  4K2D A;  3HVS A;  1EP8 A;  2L59 A;  3HVX A;  2B3S A;  3HXS A;  2OE1 A;  3GTU B;  4K0G A;  2VAF A;  3QAW A;  2C8U A;  4TR1 A;  1OKD A;  3DKS A;  4K2X A;  3D21 A;  3CRT A;  4K0N A;  4V2L A;  1OC8 A;  2VLT A;  4E8E A;  2QA2 A;  1C72 A;  5JCG A;  3UL3 A;  1GRX A;  1TU8 A;  3FK8 A;  1PGT A;  3KD0 A;  1XWK A;  4IKH A;  1X5E A;  1QXH A;  3LG6 A;  3BBY A;  1XW6 A;  1VF3 A;  2JL4 A;  4BWQ A;  1S3C A;  3E9J B;  2P31 A;  3HDC A;  4XRA A;  3TRP A;  6GSX A;  2X8C A;  1K0N A;  2GGT A;  3G7I A;  1Z3E A;  1E2Y A;  4ID0 A;  4KDX A;  2FWE A;  1HNC A;  3UIW A;  2YPM A;  3TB2 A;  3Q18 A;  5L71 A;  5EPF A;  1UA5 A;  2N5A A;  2OBK A;  1QGV A;  5KN2 A;  2RUF A;  1ZL9 A;  2VD0 A;  1U87 A;  1U3I A;  4ZB9 A;  3F0I A;  4GSN A;  2GDR A;  2YZH A;  2H6Y A;  4ZBB A;  4J56 E;  3ME7 A;  4F82 A;  4BVY B;  2FGX A;  4NXI A;  3TOU A;  2P0G A;  4K8M A;  2HYX A;  1OKT A;  1FG4 A;  2PU9 C;  3KP8 A;  4QL7 A;  3EE2 A;  1ST9 A;  1I9D A;  3QAV A;  2N5B A;  4KGI A;  4A5P A;  2RII A;  1MDI A;  5IMZ A;  2LV3 A;  2CX4 A;  1XXU A;  1PMT A;  1R5A A;  2CQ9 A;  2FWG A;  5A4W A;  3FZ4 A;  4POL A;  1O7U A;  3FZ5 A;  1BAY A;  3G9B A;  2M46 A;  2IJY A;  4I5Q A;  2N5F A;  1MEK A;  4TR4 A;  3TOT A;  3DD3 A;  5JCW A;  4WF4 A;  1G6W A;  2AJQ B;  1XCC A;  2GZZ A;  2V1M A;  1AW9 A;  1AC1 A;  4KAE A;  4OFN A;  1WRY A;  1E6B A;  1PKW A;  1Y6E A;  5H5R A;  2AV4 A;  3QFB C;  5KEJ A;  5CP1 A;  4OD7 A;  4OWY A;  2K9F A;  2IN3 A;  4OCE A;  3FZA A;  1FVK A;  4POB A;  3EIN A;  2GT5 A;  3IK7 A;  4P3Y B;  6GSS A;  2DJ0 A;  1PL1 A;  1HNA A;  2R5G A;  2VD1 A;  4JR6 A;  3NIV A;  3H1N A;  4EVM A;  3IR4 A;  5IOX A;  2A4V A;  3DML A;  4K7O A;  3KH9 A;  2DJJ A;  4NWY A;  4GST A;  3DEX A;  1WIK A;  4PQ1 A;  1O85 A;  2HZF A;  1EV4 A;  2OBI A;  2YV7 A;  2VCX A;  4EDY A;  3KTL A;  5BRT A;  1CQG A;  4ZB6 A;  1K0M A;  4HQZ A;  1TXX A;  4OO4 A;  2X64 A;  3TKP A;  2XPE A;  1NW2 A;  3UEM A;  1URM A;  3TJB A;  2LKU A;  1GTU A;  1PX6 A;  4CDO A;  1TU7 A;  4IW9 A;  4F2I A;  2XBQ A;  1M0U A;  13GS A;  2IL3 A;  2GVP A;  2VCW A;  1F6M C;  4GQC A;  5D9V A;  1SL1 B;  4O5Q A;  5B6N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...