3EMXA

Crystal structure of thioredoxin from aeropyrum pernix
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
124
structure length
124
Chain Sequence
SLSYVKEGLAVLEDGRLIYITPEEFRQLLQGDAILAVYSKTCPHCHRDWPQLIQASKEVDVPIVMFIWGSLIGERELSAARLEMNKAGVEGTPTLVFYKEGRIVDKLVGATPWSLKVEKAREIY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Thioredoxin
publication title Crystal structure of thioredoxin from Aeropyrum pernix
rcsb
source organism Aeropyrum pernix
molecule tags Oxidoreductase
total genus 42
structure length 124
sequence length 124
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3emxA00
1ML6A 3F3RA 2X64A 3ZITA 1ACVA 2OE0A 4LMWA 2TRCP 3S9FA 3F4RA 3RHCA 3D5JA 2JACA 3CTGA 4BL7A 1SJIA 4FO5A 2H6ZA 2I4AA 1T4YA 1K0AA 1ERUA 4QQ7A 5EL8A 4CDOA 1YDKA 3KMOA 3UIWA 3DYRA 5IMCA 3US3A 1EZKA 4F03A 1PQNA 3D4TA 2LNSA 5B6NA 2FCHA 3G7IA 4O92A 3LXZA 3LQ7A 2N5AA 5F8BA 1WJKA 3WGEA 4PNFA 2N5FA 1OKTA 5IOWA 3HJOA 5DALB 3KZQA 4IHUA 3D0ZA 2O7KA 1GRXA 4K1FA 2AB6A 4MPFA 4KSMA 3GUSA 1B4PA 3UL3A 1SK2A 2V41A 1A8YA 3KD0A 4G2EA 1M2AA 4DSSA 3NZNA 3L0HA 5G30A 1PN9A 2FHEA 4YQVA 2YANA 4G19A 1X0RA 3EWLA 2LJAA 5ECHB 3GIXA 3KXOA 1EP8A 2BTOT 2HT9A 4RI6A 4V1Ag 1XIYA 4ZIJA 3CRTA 4CHSA 2HE3A 5HR2A 10GSA 2LRTA 4KUNA 4IKHA 2H30A 1MDKA 5DDLA 3ZRDA 3E9JB 1XOBA 1J9BA 2P5RA 5IPGA 1YQ1A 2TRXA 1YZXA 2GTUA 4K6XA 2LNTA 5F05A 1UA5A 2C80A 1GTAA 2PERA 1BJXA 2XBQA 2MMAA 1TU7A 3CTFA 3APOA 3TB2A 1FAAA 3EURA 3HD5A 1MDJA 1ABAA 1F2EA 2IMDA 4LL4B 1JHBA 2DMMA 5FWGA 3DIEA 1QK8A 5H5RA 2VIMA 3IDVA 1QUWA 1A0RP 3GSSA 1AUCA 2PVQA 1U88A 3TOUA 5LD0A 3KIJA 4N10A 1SYXA 5IIZA 2VLUA 3SBCA 2LTKA 4FYUA 1PL1A 4RQRA 1V58A 4MJBA 3D4MA 4YQMA 2VM1A 1SENA 3MWHA 1URMA 4AJ6A 1Z9HA 2B1KA 2H6YA 1HNAA 3TRPA 1J08A 4NAXA 2YWMA 1GWCA 4FIWA 1DE2A 3U6VA 2LKUA 2F8FA 2XPDA 1T1VA 5AIVA 3CYNA 3C71A 3M3MA 2J9HA 2WGRA 1CQHA 1M7TA 4ZL9A 4JR4A 3N5OA 1TU8A 3IHQA 2DJKA 1VF4A 2OJLA 1M99A 1B9XC 3VK9A 1FOVA 1A23A 3HCZA 2CX4A 3UBKA 1X9WB 3CXGA 4TKYA 4I8BA 5DVBA 2H19A 5IM9A 4OWYA 4DSRA 5ECNB 4TR3A 4KGIA 4GRFA 4OMVA 2L5OA 3TKQA 3GL3A 1TDIA 2VLTA 1SL2B 1VF1A 5F07A 1GLPA 1AQVA 4ZBAA 1A2LA 1X9SB 4TXVA 4K0NA 2GVPA 5ELAA 2HYXA 2LSTA 22GSA 2JU5A 2WJUA 3QR6A 1TK0B 2K8VA 4RI7A 5J9BA 3R2QA 3HKRA 1ZYQB 3APQA 4OFTA 2GQKA 2PGTA 2REMA 2H71A 2KHPA 2YN1A 2LJRA 4GSSA 1XVQA 2GT5A 3J7Yk 3APSA 3DD3A 5HFGA 3WGXA 3M8NA 5DJMA 4IJ3A 1TK5B 2X99A 4XS6A 13GSA 5B8BA 3F63A 5D73A 2VD0A 2G2QA 3QAWA 1TI3A 2VL2C 4L5OA 4PX1A 2VAFA 4HU7A 4JR6A 4MPGA 1JZOA 3HXSA 1XOAA 2H66A 1MD4A 1QFNA 2OKAA 3L9SA 7GSSA 3VI7A 1GUKA 1SJZA 1ZMAA 2BJXA 2OE1A 3CSIA 1OE7A 3LXTA 3CSJA 3VFIA 4KX4A 5ECRB 4OD7A 2WRTA 4J56E 4POBA 3TKPA 1XVWA 2YZHA 5IQYA 2O8VB 2H0IA 2VO4A 2A2SA 4KSOA 3KH9A 19GSA 1ZCPA 4ZL8A 2R4VA 1TRVA 2E7PA 3EU4A 4TRXA 2DLXA 1T00A 2K18A 2VUPA 4JEDA 5IMAA 1OC9A 2WZ9A 3E3EA 1ERWA 5B8AA 1RW1A 3PINA 5J41A 4MJAA 3I69A 4DSSB 2C3QA 1SL1B 3ZL5A 2IMIA 3A2XA 1B4QA 5E59A 1AAZA 4Q5NA 3L9UA 5CREA 2ALBA 1OE8A 4NPBA 4X1UA 1EOGA 4ECBA 5FT3A 2B7KA 1Z5YE 1GSDA 2AHEA 4YH2A 5G5FA 4I2TA 2VLVA 3VPTA 3C1RA 4BWSA 1BAYA 3LYKA 3ME7A 4JRRA 3ED3A 4DEJA 5A4WA 2QGVA 2OACA 2F8AA 3BCKA 4PGTA 3WD6A 3LFLA 2GSSA 4IS0A 4MCUA 5ECLB 3BOAA 5HR3A 2VL9A 1M2DA 3WGDA 1THOA 1FB0A 3FKFA 2YOIA 2C3NA 3VWVA 4KDUA 3DEXA 4GCIA 1SK1A 2YWOA 1HNBA 2DIYA 4JU5A 5EVOA 1HD2A 4NV2A 1ILOA 2H73A 5DAKA 5ECKB 2YJHA 6GSWA 3GURA 4FH8A 2WULA 3DGQA 1EWXA 2A2RA 2IMFA 1O73A 2R3XA 4ML1A 2HLSA 4N0VA 4FYCA 1O81A 1GSYA 2C8UA 4RUVA 2E2GA 1A0FA 3GFKA 5ELGA 3ERFA 3M0FA 1TK8B 2I3YA 3RAZA 4MF5A 4KAEA 4F9ZA 3ZZXA 3N9JA 3JCML 2HFDA 2ZCTA 5D96A 4WF5A 3M9KA 1ERVA 3LJRA 2YZUA 2VCQA 5ID2A 1F3AA 3TCOA 1XW9A 1XWBA 4NV5A 5DCHA 1ZGNA 1SJ6A 3L4NA 1XW5A 1EP7A 2PBJA 3F6FA 2B5YA 2M80A 2EIOA 2MYGA 1XPVA 2ON7A 1LU4A 3FR9A 1G0TA 3P7XA 1H4OA 3PH9A 1GNWA 2JZRA 3FEUA 4XS1A 2NTOA 1ON4A 5A4VA 4PQIA 5B6MA 4JZQA 3KMNA 3TJFA 3FZAA 5KN3A 1DE1A 2HZEA 4KA0A 1GSEA 1QGVA 4MABA 4BVXA 4MJEA 2PN8A 5HFIA 1SU9A 5IMFA 2DJ1A 5AISA 4L0UA 2IMEA 2KLXA 1J0FA 3KM6A 3F4TA 4TOPA 11GSA 1R7HA 1JZRA 2YV9A 4TR1A 2X8CA 3UMAA 2CVBA 1FHEA 3ERWA 1U3IA 3DRNA 4BWQA 3CRUA 3BD2A 1K3YA 20GSA 4WXTA 1TI1A 2VCZA 3F0IA 3GA4A 2LRNA 5HFKA 3WYWA 1NHYA 1TTZA 3GMFA 1HNCA 3VI5A 3GKXA 2FA4A 3EYTA 4XCSA 2G0FA 1O7UA 5F0GA 1TW9A 3HVXA 3HJMA 3GH6A 4LA1A 2PVOC 3LORA 4GLTA 4ECJA 1S3DA 3FW2A 1XWCA 3QOUA 4IELA 2B3SA 4WR4A 1HYUA 1O8WA 4AGSA 2YNXA 3EU3A 2DJ2A 4KDYA 3UAPA 1K0NA 4GSNA 2DJ0A 3W8JA 1TKDB 1V2AA 1SL0B 3GX8A 1SKRB 1FG4A 3Q74A 5IOXA 5ECMB 2V1MA 1Y25A 1PMTA 4GSTA 4O32A 5CYYA 2QC7A 1XW6A 1FO5A 3D6IA 2ES7A 4OCEA 2CT6A 5E4WA 5ECQB 1QQ2A 8GSSA 2JZSA 1V98A 2R6KA 1CQGA 3GN3A 5A5KA 1EGOA 1X5EA 3GNJA 2K8SA 1K3OA 1U87A 1AQWA 3C1SA 4XTSA 1E6BA 3MSZA 4K0GA 2HRFA 5J3RA 1WPIA 3O76A 5DJLA 5HQPA 1O85A 1FB6A 4N30A 2HZFA 2GSTA 1THXA 4IQAA 3TKSC 2JSYA 2MMOA 2GQMA 4MZCA 1O8XA 2VCWA 3P2AA 4V1Ap 2GLRA 1TOFA 2DJ3A 3GRXA 1OC9B 4OCFA 3TRQA 1TP9A 4HEA2 2PU9C 1Q4JA 4MH3A 5KN1A 3MAKA 1EEMA 1E2YA 4ID0A 1ST9A 4HJ2A 2VM2A 2LEGA 1XXUA 4WBRD 2VCXA 2RUEA 4D73A 1YJ6A 5GAPD 3KCMA 2I1UA 1JZDA 4POMA 4KH7A 4OFNA 2KOKA 1WE0A 1R5PA 2WB9A 5CRHA 3LYPA 1JFUA 2FWFA 2MMNA 4PQHA 4AJ8A 4ML6A 3RBTA 3UEMA 4KB3A 2LQOA 4RQXA 5LCZA 2B5XA 2EIRA 5CRWA 1GTIA 3C7MA 5JCGA 4HDEA 2C0GA 2RLIA 1PRXA 2JL4A 4H86A 1RQMA 4KW6A 4EUYA 1G7OA 4GTUA 4K7OA 4XS4A 3GHAA 1EEJA 6GSXA 2AUVA 4ISDA 4ZILA 1GLQA 1O6JA 4IVFA 4P3YB 1KEBA 5CP1A 1WIKA 1A24A 3HDCA 3IV4A 2P31A 3ZYWA 1I5GA 3IR4A 2R5GA 2HRNA 2OADA 2KP2A 5DAKB 4Q5QA 3UBLA 2AV4A 2HSHA 2H1AA 3LEFA 4O5RA 3HVVA 4NWYA 1Z3EA 2FWGA 5G2ZA 2J23A 1PSQA 1M0UA 3DKSA 2WS2A 2TIRA 2LQQA 3VURA 3KP8A 4IW9A 1XFLA 4IP1A 1FW1A 2PUKC 2R37A 1V9WA 4JE1A 5KN2A 1Y6EA 2IL3A 1PGTA 1XCCA 2H0HA 2CX3A 4ZBDA 3FZ4A 3FYGA 3KGKA 2IIYA 3D21A 2LJKA 4ZL7A 4PNGA 5ID2B 5J4UA 2CV4A 3HYPA 1UVZA 4E8HA 4O7HA 1C72A 1X5DA 1GUMA 2O85A 4ZXGA 5JWOB 5KN0A 4YQUA 2C4JA 4KCAA 3F8UA 3ZIVA 4I6XA 2C0EA 3GKNA 5C04A 2C1YA 1S3AA 4GQCA 2GQLA 1A2MA 5G5EA 1LBKA 1BEDA 6GSSA 1QMVA 2QKEA 2L57A 1YEXA 2HZEB 4K9ZA 3FY7A 4IBPA 4OO4A 1SKSB 4N11A 3TJGA 4AF2A 3TJJA 4TR1B 3DMLA 1PKZA 1S3CA 1K3LA 4L0WA 5CO3A 5KEJA 1GTBA 3A2VA 4X0XA 4L8EA 1NM3A 2H01A 3ERGA 5JWQB 3TGZA 3ZFBA 2AYTA 2IPAA 4NMUA 1HQOA 3A2WA 3LWAA 3UOMA 5AN1A 1TRUA 4HJMA 5DCGA 2GS3A 3TKSA 3PR8A 5EPFA 2YPMA 2YP6A 2DC5A 3AY8A 1NSWA 5JWRB 5B7CA 1MD3A 5ECOB 3D22A 2LRCA 2X8GA 3EC3A 4NHZA 3F3QA 4ZB6A 1K0CA 3BBYA 5AGYA 2CAQA 3FHKA 1B8XA 1OKDA 3EMPA 4L5LA 4J57E 1U6TA 2JSZA 3TRXA 4ZB9A 3TOTA 1OVNA 4OFMA 5GSSA 4MF7A 4Q5FA 3WT2A 3EE2A 3EINA 2MMZA 4X43A 5D9TA 3KEBA 5ECPB 3G7YA 4TVEA 3H4KA 5FHIA 1ZZYA 1Q98A 6GSTA 3QFAC 5IMZA 1H75A 2WFCA 3ZMKA 3A5WA 1FVJA 1ZYEA 5H5SA 2O87A 2V2GA 1PL2A 2YWIA 1G6YA 1VGLA 2KP1A 4E8EA 1SKWB 3EMXA 5H5QA 2P5QA 5LNKe 3IK9A 3EVIA 4ACSA 2K9FA 2H72A 4MK3A 2IWTA 3VPQA 2E2MA 3P8WA 3GKMA 2GGTA 3IPZA 3IBHA 4F0CA 1RK4A 1Z6MA 2E0QA 5JCWA 4IQ1A 4EKZA 1OC8A 1T4ZA 3MDKA 1YKAA 3IK7A 3P90A 3GYKA 3TKRA 3SWLA 3G7JA 3HZ8A 3H93A 3WT1A 5ENUA 1VRSD 3RDWA 1YEPA 3RPPA 4K8MA 3KTBA 4D73B 1ZL9A 2Z9SA 2B5EA 4DSQA 5EY6A 1JLVA 2H8LA 3PGTA 3VWXA 2C0DA 1EGRA 2MBSA 4I5QA 3W6GA 2IMKA 1AC1A 3IXRA 3I43A 1G7EA 2VL2A 3DWVA 1K0BA 2P0GA 3C73A 4ECIA 1X5CA 2L6DA 4YAPA 1K0DA 2PMTA 2DIZA 4XS4B 2JADA 4PXOA 2RUFA 3IE3A 1WMJA 4EDZA 5L71A 4LMVA 3CBUA 4HOJA 4F82A 1Z6NA 2NVLA 1YF1A 2NPBA 4PQ1A 3UVTA 2CAIA 2RIIA 1WWJA 3QAGA 3ZTLA 1R5AA 2CQ9A 3L9VA 2KUCA 1X9MB 1GL8A 4IJIA 12GSA 1YF0A 4WEYA 1U3AA 3TUEA 4XRDA 2OBKA 2XPEA 5ABRA 2ZUPA 2GZYA 4MJCA 4IGJA 1GSQA 1XWAA 2IFQA 1K0MA 3LSZA 4HS1A 4K7NA 4GQFA 2B1LA 2M72A 3UARA 4YAVA 3RPNA 1F3BA 1KNGA 1YY7A 2V32A 3QFBC 2F3MA 1GULA 4BVYA 4MA9A 5IPHA 4LL1B 4MF6A 4FYBA 1KTEA 4MDCA 3GSTA 1AW9A 1GTUA 2BMXA 3FK8A 4WF4A 2GT6A 1GUHA 2DJJA 1DSBA 4HQSA 5GSTA 4HUAA 1T7PB 3F6DA 4WR5A 3TDGA 4QL7A 5C00A 2FA8A 2C0FA 1VF3A 6GSVA 1I9DA 1XWGA 5DBQA 1B9YC 3IAM2 5D9VA 4I97A 5G1LA 2L59A 1GSUA 3FR3A 1GH2A 2XC2A 2X8HA 5A4UA 1V57A 2O89A 3KH7A 4V2MA 2H75A 3H79A 4MZWA 4ZB8A 1KBNA 3KTLA 3E0UA 3GTUA 2GZZA 3IRAA 1T8EB 9GSSA 2YWNA 5DQSA 1MDIA 3FZ5A 2CA8A 4HI7A 2VCTA 4EVMA 3F4SA 3H8QA 1WRYA 1M9AA 3LGCA 2FGXA 3M9JA 3ZREA 2H70A 4F0BA 1R26A 5ECSA 2H76A 2PPTA 2VOCA 3UJ1A 2LV3A 4BPYA 4TXOA 1TRWA 4WBJA 2HI7A 2AJQB 4POKA 2VL3A 3G9BA 3M1GA 5IMVA 2H74A 4AJ7A 3QMXA 2YJ7A 3Q18A 2WCIA 5GZZB 2L5LA 1PA3A 3IOSA 1BX9A 1N2AA 5AIXA 1AQXA 1QXHA 4CW9A 1K0OA 3W8SA 5HR1A 2FWEA 3HZ4A 2H1DA 1PX6A 4GWRA 3GL5A 4G9HA 6GSUA 1UN2A 3HA9A 3QD9A 1EOHA 1OC3A 17GSA 1AIUA 5COHA 3OR5A 5F06A 4DVCA 3MNGA 1BYEA 3DVWA 2F51A 2I81A 3HJPA 2EC4A 3DXBA 3FR6A 3ZVJD 1LJRA 3DVXA 3GH9A 2YV7A 3Q6OA 1BQ7A 1A8LA 3ZLPA 3LG6A 4EO3A 4Q5RA 1AXDA 4IN0A 3HY2A 2F9SA 1IYIA 2WDUA 2NBSA 2VD1A 5DALA 1N8JA 2HXKA 1MEKA 1F6MC 2AAWA 2LUSA 1EV9A 4MMMA 4MLYA 3ZIJA 4WKWA 4V2LA 2FWHA 3NIVA 5CNWA 4BA7A 1XZOA 3QAVA 1BG5A 14GSA 1Z7RA 1NHOA 3TKSE 1PD21 3IA1A 3KJYA 1MTCA 1WP0A 5IMDA 4Z7XA 2PWJA 2EIQA 2MBTA 5IO2A 3I6AA 1IYHA 2GDRA 2GZPA 1JLWA 4EXJA 5D93A 2OA7A 4PURA 5G31A 1TXXA 4V2NA 1W4VA 1DBYA 2NDOA 5G1KA 1ZOFA 2D2ZA 5CRDA 4XRAA 3C8EA 2OE3A 3UVHA 1OAZA 4JBBA 4TR0A 2L6CA 4KNDA 4XIHA 4HZ4A 1GP1A 1FVKA 4TN8A 3I9V2 5IO0A 3ZFLA 2QSIA 1UC7A 4N0ZA 4ECCA 3TJKA 4NHWA 3F9UA 4EF0A 3ME8A 3A3TA 4G10A 4NXIA 5INYA 2CZ3A 6GSYA 3IC4A 1JZWA 4QL9A 2VCVA 2DSAA 3QDNA 1XWKA 3V1WA 1V40A 4IP6A 3RHBA 2CZ2A 1ERTA 1PX7A 1YKCA 2HNLA 4MH2A 4HZ2A 4GXZA 4EC0A 1XBSA 3VWUA 2XHFA 18GSA 3GV1A 1EV4A 4HQZA 1TJDA 2L4CA 3O6TA 2IN3A 1B48A 5GAND 2I9HA 5HR0A 3BCIA 3CMIA 4K7IA 4PUFC 2IFQB 2B6MA 2FD3A 1A2JA 2M46A 3QCPA 2RM5A 5D9XA 5D8IA 2N5BA 2ZNMA 4XHMA 2L4QA 5D9WA 2C3TA 3QPMA 1F37A 2H1GA 3TJBA 2A4VA 3FRCA 4PUAA 1M9BA 2FUG2 2JZTA 4WETA 4POLA 1Z7PA 3BJ5A 3VLNA 3HHVA 2RM6A 2CVDA 2FY6A 2FNOA 1SYRA 2K6VA 1GSSA 1G6WA 4KE3A 5ECIB 1TRSA 4EL1A 4OO5A 1SD8A 2H0GA 1WOUA 2GSQA 2OBIA 2V6KA 3KP9A 4F2IA 4ILFA 1GSFA 1M2BA 1SK0A 3L78A 4J2FA 4MZBA 4GF0A 1T3BA 4HU9A 5CRGA 2H6XA 4KCEA 2MZCA 2DBCA 1DUGA 2R2JA 1OYJA 2H1BA 1SD9A 2V6OA 2B7JA 1PKWA 3GTUB 3GX0A 4KDXA 3HVSA 2ON5A 3IAS2 4EDYA 2GSRA 4I2UA 3Q19A 3FZ9A 3ISOA 4ULXA 3H1NA 4K2DA 5J5NA 3ZVJA 3NOFA 2XBIA 5J9CA 3J7Yb 3O3TA 3VWWA 4TXOB 5DQYA 4MP4A 1R4WA 4TR4A 1NW2A 4TW5A 1F9MA 3U5RE 5CAXA 2HSYA 2DMLA 3CSHA 2LS5A 2YCDA 3GKKA 4LLRA 3K8NA 4EE0A 4ZBBA 1USBA 2FLSA 1GNEA 1W89A 16GSA 3ZMLA 2IJYA 5JCUA 2CVKA 1VF2A
chains in the Genus database with same CATH superfamily
1ML6A 3F3RA 2X64A 3ZITA 1ACVA 2OE0A 4LMWA 4FQUA 2TRCP 3S9FA 3EPTA 3F4RA 3RHCA 3D5JA 2JACA 3CTGA 4BL7A 1SJIA 4FO5A 2H6ZA 2I4AA 1T4YA 1K0AA 1ERUA 4QQ7A 5EL8A 4CDOA 1YDKA 3KMOA 3UIWA 3DYRA 5IMCA 3US3A 1EZKA 4F03A 1PQNA 3D4TA 2LNSA 5B6NA 2FCHA 3G7IA 4O92A 3LXZA 3LQ7A 2N5AA 5F8BA 1WJKA 3WGEA 4PNFA 2N5FA 4HSCX 1OKTA 5IOWA 3HJOA 5DALB 3KZQA 4IHUA 3D0ZA 2O7KA 1GRXA 4K1FA 2AB6A 4MPFA 4KSMA 3GUSA 1B4PA 3UL3A 1SK2A 2V41A 1A8YA 3KD0A 4G2EA 4O5UA 1M2AA 4DSSA 3NZNA 3L0HA 5G30A 1PN9A 2FHEA 4YQVA 2YANA 4G19A 1X0RA 3EWLA 2LJAA 5ECHB 3GIXA 3KXOA 1EP8A 2BTOT 2HT9A 4RI6A 4V1Ag 1XIYA 4ZIJA 3CRTA 4CHSA 2HE3A 5HR2A 10GSA 2LRTA 4KUNA 4IKHA 2H30A 1MDKA 5DDLA 3ZRDA 3E9JB 1XOBA 1J9BA 2P5RA 2X4AA 5IPGA 1YQ1A 2TRXA 1YZXA 2GTUA 4K6XA 2LNTA 5F05A 1UA5A 2C80A 1GTAA 2PERA 1BJXA 2XBQA 2MMAA 1TU7A 3CTFA 3APOA 3TB2A 1FAAA 3EURA 3HD5A 1MDJA 1ABAA 1F2EA 2IMDA 4LL4B 1JHBA 2DMMA 5FWGA 3DIEA 1QK8A 1S3RA 5H5RA 2VIMA 3IDVA 1QUWA 1A0RP 3GSSA 1AUCA 2PVQA 1U88A 3TOUA 5LD0A 3KIJA 4N10A 1SYXA 5IIZA 2VLUA 3SBCA 2LTKA 4FYUA 1PL1A 4RQRA 1V58A 4MJBA 3D4MA 4YQMA 2VM1A 1SENA 3MWHA 1URMA 4AJ6A 1Z9HA 3MYDA 2B1KA 2H6YA 1HNAA 3TRPA 3A5IA 1J08A 4NAXA 3PPUA 2YWMA 1PFOA 1GWCA 4FIWA 1DE2A 3U6VA 2LKUA 2F8FA 2XPDA 1T1VA 5AIVA 3CYNA 3C71A 3M3MA 2J9HA 2WGRA 1CQHA 1M7TA 4ZL9A 4JR4A 2A4HA 3N5OA 1TU8A 3IHQA 2DJKA 1VF4A 2OJLA 4ICYA 1M99A 2HRKA 1B9XC 3VK9A 1FOVA 3CQFA 4EIQA 1A23A 3HCZA 2CX4A 3UBKA 1X9WB 3CXGA 4TKYA 4I8BA 5DVBA 2H19A 5IM9A 4OWYA 4DSRA 5ECNB 4TR3A 4KGIA 4GRFA 4OMVA 2L5OA 3TKQA 3GL3A 1TDIA 2VLTA 1SL2B 1VF1A 3LW9A 5F07A 1GLPA 1AQVA 4ZBAA 1A2LA 1X9SB 4TXVA 4K0NA 3R3EA 2GVPA 5ELAA 2HYXA 2LSTA 22GSA 2JU5A 2WJUA 3QR6A 1TK0B 2K8VA 4RI7A 5J9BA 3R2QA 3HKRA 1ZYQB 3APQA 1M3IA 4OFTA 2GQKA 2PGTA 2REMA 2H71A 2KHPA 2YN1A 2LJRA 4GSSA 1XVQA 2GT5A 3J7Yk 3APSA 3DD3A 5HFGA 3WGXA 2R0PA 3M8NA 5DJMA 4IJ3A 1TK5B 2X99A 4XS6A 13GSA 5B8BA 3F63A 5D73A 2VD0A 2G2QA 3QAWA 1TI3A 2VL2C 4L5OA 1XG8A 4PX1A 2VAFA 4HU7A 4JR6A 4MPGA 1JZOA 3HXSA 1XOAA 2H66A 1MD4A 1QFNA 2OKAA 3L9SA 4BL7B 7GSSA 3VI7A 1GUKA 1SJZA 1ZMAA 2BJXA 2OE1A 3CSIA 1OE7A 4G0IA 3LXTA 3CSJA 3VFIA 4KX4A 5ECRB 4OD7A 2WRTA 4J56E 4POBA 3TKPA 1XVWA 2YZHA 5IQYA 1ZYNA 2O8VB 2H0IA 2VO4A 2A2SA 4KSOA 3KH9A 19GSA 1ZCPA 4ZL8A 2R4VA 1TRVA 2E7PA 3EU4A 4TRXA 2DLXA 1T00A 2K18A 2VUPA 4JEDA 5IMAA 1OC9A 4BIKA 2WZ9A 3E3EA 1ERWA 5B8AA 1RW1A 3PINA 5J41A 4MJAA 3I69A 4DSSB 2C3QA 1SL1B 3ZL5A 2IMIA 3A2XA 1B4QA 1FOHA 5E59A 4MNNA 1AAZA 4Q5NA 3L9UA 5CREA 2ALBA 1OE8A 4NPBA 4X1UA 1EOGA 4ECBA 5FT3A 2B7KA 1Z5YE 1GSDA 2AHEA 4YH2A 5G5FA 4I2TA 2VLVA 3VPTA 3C1RA 4BWSA 1BAYA 3LYKA 3ME7A 4JRRA 3ED3A 4DEJA 5A4WA 2QGVA 2OACA 2F8AA 3BCKA 4PGTA 3WD6A 3LFLA 2GSSA 4IS0A 4MCUA 5ECLB 3BOAA 5HR3A 2VL9A 1M2DA 3WGDA 1THOA 1FB0A 3FKFA 2YOIA 2C3NA 3VWVA 4KDUA 3DEXA 4GCIA 1SK1A 4Z2RA 2YWOA 1HNBA 2DIYA 4JU5A 5EVOA 1HD2A 4NV2A 1ILOA 2H73A 5DAKA 5ECKB 2YJHA 6GSWA 3GURA 4FH8A 2UZ8A 2WULA 3DGQA 1EWXA 2A2RA 2IMFA 1O73A 2R3XA 4ML1A 2HLSA 4N0VA 4FYCA 1O81A 1GSYA 2C8UA 4RUVA 2E2GA 1A0FA 3GFKA 5ELGA 3ERFA 3M0FA 1TK8B 2I3YA 3RAZA 4MF5A 4KAEA 4F9ZA 3ZZXA 3N9JA 3JCML 2HFDA 2ZCTA 5D96A 4WF5A 3M9KA 1ERVA 3LJRA 2YZUA 2VCQA 5ID2A 1F3AA 3TCOA 1XW9A 1XWBA 4NV5A 5DCHA 1ZGNA 1SJ6A 3L4NA 1XW5A 1EP7A 2PBJA 3F6FA 2B5YA 2M80A 2EIOA 2MYGA 1XPVA 2ON7A 1LU4A 3FR9A 1G0TA 3P7XA 1H4OA 3PH9A 1GNWA 2JZRA 3FEUA 4XS1A 2NTOA 1ON4A 5A4VA 4PQIA 5B6MA 4JZQA 1M3JA 3KMNA 3TJFA 3FZAA 5KN3A 1DE1A 2HZEA 4KA0A 4G0KA 1GSEA 1QGVA 4MABA 4BVXA 4MJEA 2PN8A 5HFIA 1SU9A 5IMFA 2DJ1A 5AISA 4L0UA 2IMEA 2KLXA 1J0FA 3KM6A 3F4TA 4TOPA 11GSA 1R7HA 1JZRA 2YV9A 4TR1A 2X8CA 3UMAA 2CVBA 1FHEA 3ERWA 1U3IA 3DRNA 4BWQA 3CRUA 3BD2A 1K3YA 20GSA 4WXTA 1TI1A 2VCZA 3F0IA 3GA4A 2LRNA 5HFKA 3WYWA 1NHYA 1TTZA 3GMFA 1HNCA 3VI5A 3GKXA 2FA4A 3EYTA 4XCSA 2G0FA 1O7UA 5F0GA 1TW9A 3HVXA 3HJMA 3GH6A 4CY8A 4LA1A 2PVOC 3LORA 4GLTA 4ECJA 1S3DA 3FW2A 1XWCA 3QOUA 4IELA 2B3SA 4WR4A 1HYUA 1O8WA 4AGSA 2YNXA 3EU3A 2DJ2A 4KDYA 3UAPA 1K0NA 4GSNA 2DJ0A 3W8JA 1TKDB 1V2AA 1SL0B 3GX8A 1SKRB 1FG4A 3Q74A 5IOXA 5ECMB 2V1MA 1Y25A 1PMTA 4GSTA 4O32A 5CYYA 2QC7A 1XW6A 1FO5A 3D6IA 2ES7A 4OCEA 2CT6A 5E4WA 5ECQB 1QQ2A 8GSSA 2JZSA 1V98A 2R6KA 1CQGA 3GN3A 5A5KA 1EGOA 1X5EA 3GNJA 4EIPA 2K8SA 1K3OA 1U87A 1AQWA 3C1SA 4XTSA 4G0LA 1E6BA 3MSZA 4K0GA 2HRFA 5J3RA 1WPIA 3O76A 5DJLA 5HQPA 1O85A 2HRAA 1FB6A 4N30A 2HZFA 2GSTA 1THXA 4IQAA 3TKSC 2JSYA 2MMOA 2GQMA 4MZCA 1O8XA 2VCWA 3P2AA 4V1Ap 2GLRA 1TOFA 2DJ3A 3GRXA 1OC9B 4OCFA 3TRQA 1TP9A 4HEA2 2PU9C 1Q4JA 4MH3A 5KN1A 3MAKA 1EEMA 1E2YA 4ID0A 1ST9A 4HJ2A 2VM2A 2LEGA 1XXUA 4WBRD 2VCXA 2RUEA 4D73A 1YJ6A 5GAPD 3KCMA 2I1UA 1JZDA 4POMA 4KH7A 2R0CA 4OFNA 2KOKA 1WE0A 1R5PA 2WB9A 5CRHA 3LYPA 1JFUA 2FWFA 2MMNA 4PQHA 4AJ8A 4ML6A 4PTSA 3RBTA 3UEMA 4KB3A 2LQOA 4RQXA 5LCZA 2B5XA 2EIRA 5CRWA 1GTIA 3C7MA 5JCGA 4HDEA 2C0GA 2RLIA 1PRXA 2JL4A 4H86A 1RQMA 4KW6A 4EUYA 1G7OA 2QA1A 4GTUA 4K7OA 4CY6A 4XS4A 3GHAA 1EEJA 6GSXA 2AUVA 4ISDA 4ZILA 1GLQA 1O6JA 4IVFA 4P3YB 1KEBA 5CP1A 1WIKA 1A24A 4YKGA 3HDCA 3IV4A 2P31A 3ZYWA 1I5GA 3IR4A 2R5GA 2HRNA 2OADA 2KP2A 5DAKB 4Q5QA 3UBLA 2AV4A 2HSHA 2H1AA 3LEFA 4O5RA 3HVVA 4NWYA 1Z3EA 2FWGA 5G2ZA 2J23A 1PSQA 1M0UA 3DKSA 2WS2A 2TIRA 2LQQA 3VURA 3KP8A 4IW9A 1XFLA 4IP1A 1FW1A 2PUKC 2R37A 1V9WA 4JE1A 5KN2A 1Y6EA 2IL3A 1PGTA 1XCCA 2H0HA 2CX3A 4ZBDA 3FZ4A 2R0GA 3FYGA 3KGKA 2IIYA 3D21A 2LJKA 4ZL7A 4PNGA 5ID2B 5J4UA 2CV4A 4Z2TA 3HYPA 1UVZA 4E8HA 4O7HA 1C72A 1X5DA 1GUMA 2O85A 4ZXGA 5JWOB 5KN0A 4YQUA 2C4JA 4KCAA 3F8UA 3ZIVA 4I6XA 2C0EA 3GKNA 5C04A 2C1YA 1S3AA 4GQCA 2GQLA 1A2MA 4Z2UA 5G5EA 1LBKA 1BEDA 6GSSA 1QMVA 2QKEA 2L57A 1YEXA 2HZEB 4K9ZA 4BVXB 3FY7A 4IBPA 4OO4A 1SKSB 4N11A 3TJGA 4AF2A 3TJJA 4TR1B 3DMLA 4YKFA 1PKZA 1S3CA 1K3LA 4L0WA 5CO3A 5KEJA 1GTBA 3A2VA 4X0XA 4L8EA 1NM3A 2H01A 3ERGA 5JWQB 3TGZA 3ZFBA 2AYTA 2IPAA 4NMUA 1HQOA 3A2WA 3LWAA 3UOMA 5AN1A 1TRUA 4HJMA 5DCGA 2GS3A 3TKSA 3PR8A 5EPFA 2YPMA 2YP6A 2DC5A 3AY8A 1NSWA 5JWRB 5B7CA 1MD3A 5ECOB 3D22A 2LRCA 2X8GA 3EC3A 4NHZA 3F3QA 4ZB6A 1K0CA 3BBYA 5AGYA 2CAQA 3FHKA 1B8XA 1OKDA 3EMPA 4L5LA 4J57E 1U6TA 2JSZA 3TRXA 4ZB9A 3TOTA 1OVNA 4OFMA 5GSSA 4MF7A 4Q5FA 3WT2A 3EE2A 3EINA 2MMZA 4X43A 5D9TA 3KEBA 5ECPB 3G7YA 4TVEA 3H4KA 5FHIA 1ZZYA 1Q98A 6GSTA 3QFAC 5IMZA 2QA2A 1H75A 2WFCA 3ZMKA 3A5WA 1FVJA 1ZYEA 5H5SA 2O87A 2V2GA 1PL2A 2YWIA 1G6YA 1VGLA 2KP1A 4E8EA 1SKWB 3EMXA 5H5QA 2P5QA 2HSMA 5LNKe 3IK9A 3EVIA 4ACSA 2K9FA 2H72A 4MK3A 2IWTA 3VPQA 2E2MA 3P8WA 3GKMA 2GGTA 3IPZA 3IBHA 4F0CA 1RK4A 1Z6MA 2E0QA 5JCWA 4IQ1A 4EKZA 1OC8A 1T4ZA 3MDKA 2DKHA 1YKAA 3IK7A 3P90A 3GYKA 3TKRA 3SWLA 3G7JA 3HZ8A 3H93A 3WT1A 5ENUA 1VRSD 3RDWA 1YEPA 3RPPA 4K8MA 3KTBA 4D73B 1ZL9A 2Z9SA 2B5EA 4DSQA 5EY6A 1JLVA 2H8LA 3PGTA 3VWXA 2C0DA 1EGRA 2MBSA 4I5QA 3W6GA 2IMKA 1AC1A 3IXRA 3I43A 1G7EA 2VL2A 3DWVA 5KOXA 1K0BA 2P0GA 3C73A 4ECIA 1X5CA 2L6DA 4YAPA 1K0DA 2PMTA 2DIZA 4XS4B 2JADA 3IHGA 4PXOA 2RUFA 3IE3A 1WMJA 4EDZA 5L71A 4LMVA 3CBUA 4HOJA 4F82A 1Z6NA 2NVLA 1YF1A 2NPBA 4PQ1A 3UVTA 2CAIA 2RIIA 1WWJA 3QAGA 3ZTLA 1R5AA 2CQ9A 1ZYPA 3L9VA 2KUCA 1X9MB 1GL8A 4IJIA 12GSA 1YF0A 4WEYA 1U3AA 3TUEA 4XRDA 2OBKA 2XPEA 5ABRA 2ZUPA 2GZYA 4MJCA 4IGJA 1GSQA 1XWAA 2IFQA 1K0MA 3LSZA 4HS1A 4K7NA 4GQFA 2B1LA 2M72A 3UARA 4YAVA 3RPNA 1F3BA 1KNGA 1YY7A 2V32A 3QFBC 2F3MA 1GULA 4BVYA 4MA9A 5IPHA 4LL1B 4MF6A 4FYBA 1KTEA 4MDCA 3GSTA 1AW9A 1GTUA 2BMXA 3FK8A 4WF4A 2GT6A 5BRTA 1GUHA 2DJJA 1DSBA 4HQSA 5GSTA 4HUAA 1T7PB 3F6DA 4WR5A 3TDGA 4QL7A 5C00A 2FA8A 2C0FA 1VF3A 6GSVA 1I9DA 1XWGA 5DBQA 1B9YC 3IAM2 5D9VA 4I97A 5G1LA 2L59A 1GSUA 3FR3A 1GH2A 2XC2A 2X8HA 5A4UA 1V57A 2O89A 3KH7A 4V2MA 2H75A 3H79A 4MZWA 4A5PA 3FMWA 4ZB8A 1KBNA 3KTLA 3E0UA 3GTUA 2GZZA 3IRAA 1T8EB 9GSSA 2YWNA 5DQSA 1MDIA 3FZ5A 2CA8A 4HI7A 2VCTA 4EVMA 3F4SA 3H8QA 1WRYA 1M9AA 3LGCA 2FGXA 3M9JA 3ZREA 2H70A 4F0BA 1R26A 5ECSA 2H76A 2PPTA 2A2PA 2VOCA 3UJ1A 2LV3A 4BPYA 4TXOA 3MIXA 1TRWA 4WBJA 2HI7A 2AJQB 4POKA 2VL3A 3G9BA 3M1GA 5IMVA 2H74A 4AJ7A 3QMXA 2YJ7A 3Q18A 2WCIA 5GZZB 2L5LA 1PA3A 3IOSA 1BX9A 1N2AA 5AIXA 1AQXA 1QXHA 4CW9A 1K0OA 3W8SA 5HR1A 2FWEA 3HZ4A 2H1DA 1PX6A 4GWRA 3GL5A 4G9HA 6GSUA 1UN2A 3HA9A 3QD9A 1EOHA 1OC3A 17GSA 1AIUA 5COHA 3OR5A 5F06A 4DVCA 3MNGA 1BYEA 3DVWA 2F51A 2I81A 3HJPA 2EC4A 3DXBA 3FR6A 3ZVJD 1LJRA 3DVXA 3GH9A 2YV7A 3Q6OA 5BMUA 1BQ7A 1A8LA 3ZLPA 3LG6A 2X49A 4EO3A 4Q5RA 1AXDA 4IN0A 3HY2A 2F9SA 1IYIA 2WDUA 2NBSA 2VD1A 5DALA 1N8JA 2HXKA 1MEKA 1F6MC 2AAWA 2LUSA 1EV9A 4MMMA 4MLYA 3ZIJA 4WKWA 4V2LA 2FWHA 3NIVA 5CNWA 4BA7A 1XZOA 3QAVA 1BG5A 14GSA 1Z7RA 1NHOA 3TKSE 1PD21 3IA1A 3KJYA 1MTCA 1WP0A 5IMDA 4Z7XA 2PWJA 2EIQA 2MBTA 5IO2A 3I6AA 1IYHA 2GDRA 2GZPA 4K5RA 1JLWA 4EXJA 5D93A 2OA7A 4PURA 5G31A 1TXXA 4V2NA 1W4VA 1DBYA 2NDOA 5G1KA 1ZOFA 2D2ZA 5CRDA 4XRAA 3C8EA 2OE3A 3UVHA 1OAZA 4JBBA 4TR0A 4KF9A 2L6CA 4KNDA 4XIHA 4HZ4A 1GP1A 1FVKA 4TN8A 3I9V2 5IO0A 3ZFLA 2QSIA 1UC7A 4N0ZA 4ECCA 3TJKA 4NHWA 3F9UA 4EF0A 3ME8A 3A3TA 4G10A 4NXIA 5KOWA 5INYA 2CZ3A 6GSYA 3IC4A 1JZWA 4USSA 4QL9A 2VCVA 2DSAA 3QDNA 1XWKA 3V1WA 1V40A 4IP6A 3RHBA 2CZ2A 1ERTA 1PX7A 1YKCA 2HNLA 4MH2A 4HZ2A 4GXZA 4EC0A 1XBSA 3VWUA 2XHFA 18GSA 3GV1A 1EV4A 4HQZA 1TJDA 2L4CA 3O6TA 2IN3A 1B48A 5GAND 2I9HA 5HR0A 1PN0A 3BCIA 3CMIA 4K7IA 4PUFC 2IFQB 2B6MA 2FD3A 1A2JA 2M46A 4X4JA 3QCPA 2RM5A 5D9XA 5D8IA 2N5BA 2ZNMA 4XHMA 2L4QA 5D9WA 2C3TA 3QPMA 1F37A 2H1GA 3TJBA 2A4VA 3FRCA 4PUAA 1M9BA 2FUG2 2JZTA 4BVYB 4WETA 4POLA 1Z7PA 4K5SA 3BJ5A 3VLNA 3HHVA 2RM6A 2CVDA 2FY6A 2FNOA 1SYRA 2K6VA 1GSSA 1G6WA 4KE3A 5ECIB 1TRSA 4EL1A 4OO5A 1SD8A 2H0GA 1WOUA 2GSQA 2OBIA 4O5QA 2V6KA 3KP9A 4F2IA 4ILFA 1GSFA 1M2BA 1SK0A 3L78A 4J2FA 4MZBA 4GF0A 1T3BA 4HU9A 5CRGA 2H6XA 4KCEA 2MZCA 2DBCA 1DUGA 2R2JA 1OYJA 2H1BA 1SD9A 2V6OA 2B7JA 1PKWA 3GTUB 3GX0A 4KDXA 3HVSA 2ON5A 3IAS2 4EDYA 3HVNA 2GSRA 4I2UA 3Q19A 3FZ9A 3ISOA 4ULXA 3H1NA 4K2XA 4K2DA 5J5NA 3ZVJA 3NOFA 2XBIA 5J9CA 3J7Yb 3O3TA 3VWWA 3IC8A 4TXOB 4MP4A 1R4WA 5DQYA 4TR4A 1NW2A 4TW5A 1F9MA 3U5RE 5CAXA 2HSYA 2DMLA 3CSHA 2LS5A 2YCDA 3GKKA 4LLRA 3K8NA 4EE0A 4ZBBA 1USBA 2FLSA 1GNEA 2DKIA 1W89A 16GSA 3ZMLA 2IJYA 5JCUA 2CVKA 1VF2A
chains in the Genus database with same CATH topology
1ML6A 3F3RA 2X64A 3ZITA 1ACVA 2OE0A 4LMWA 4FQUA 2TRCP 3S9FA 3EPTA 3F4RA 3RHCA 3D5JA 2JACA 3CTGA 4BL7A 1SJIA 4FO5A 2H6ZA 2I4AA 1T4YA 1K0AA 1ERUA 4QQ7A 5EL8A 4CDOA 1YDKA 3KMOA 3UIWA 3DYRA 5IMCA 3US3A 1EZKA 4F03A 1PQNA 3D4TA 2LNSA 5B6NA 2FCHA 3G7IA 4O92A 3LXZA 3LQ7A 2N5AA 5F8BA 1WJKA 3WGEA 4PNFA 2N5FA 1OKTA 5IOWA 3HJOA 5DALB 3KZQA 4IHUA 3D0ZA 2O7KA 1GRXA 4K1FA 2AB6A 4MPFA 4KSMA 3GUSA 1B4PA 3UL3A 1SK2A 2V41A 1A8YA 3KD0A 4G2EA 4O5UA 1M2AA 4DSSA 3NZNA 3L0HA 5G30A 1PN9A 2FHEA 4YQVA 2YANA 4G19A 1X0RA 3EWLA 2LJAA 5ECHB 3GIXA 3KXOA 1EP8A 2BTOT 2HT9A 4RI6A 4V1Ag 1XIYA 4ZIJA 3CRTA 4CHSA 2HE3A 5HR2A 10GSA 2LRTA 4KUNA 4IKHA 2H30A 1MDKA 5DDLA 3ZRDA 3E9JB 1XOBA 1J9BA 2P5RA 2X4AA 5IPGA 1YQ1A 2TRXA 1YZXA 2GTUA 4K6XA 2LNTA 5F05A 1UA5A 2C80A 1GTAA 2PERA 1BJXA 2XBQA 2MMAA 1TU7A 3CTFA 3APOA 3TB2A 1FAAA 3EURA 3HD5A 1MDJA 1ABAA 1F2EA 2IMDA 4LL4B 1JHBA 2DMMA 5FWGA 3DIEA 1QK8A 5H5RA 2VIMA 3IDVA 1QUWA 1A0RP 3GSSA 1AUCA 2PVQA 1U88A 3TOUA 5LD0A 3KIJA 4N10A 1SYXA 5IIZA 2VLUA 3SBCA 2LTKA 4FYUA 1PL1A 4RQRA 1V58A 4MJBA 3D4MA 4YQMA 2VM1A 1SENA 3MWHA 1URMA 4AJ6A 1Z9HA 3MYDA 2B1KA 2H6YA 1HNAA 3TRPA 3A5IA 1J08A 4NAXA 3PPUA 2YWMA 1GWCA 4FIWA 1DE2A 3U6VA 2LKUA 2F8FA 2XPDA 1T1VA 5AIVA 3CYNA 3C71A 3M3MA 2J9HA 2WGRA 1CQHA 1M7TA 4ZL9A 4JR4A 2A4HA 3N5OA 1TU8A 3IHQA 2DJKA 1VF4A 2OJLA 4ICYA 1M99A 2HRKA 1B9XC 3VK9A 1FOVA 4EIQA 1A23A 3HCZA 2CX4A 3UBKA 1X9WB 3CXGA 4TKYA 4I8BA 5DVBA 2H19A 5IM9A 4OWYA 4DSRA 5ECNB 4TR3A 4KGIA 4GRFA 4OMVA 2L5OA 3TKQA 3GL3A 1TDIA 2VLTA 1SL2B 1VF1A 3LW9A 5F07A 1GLPA 1AQVA 4ZBAA 1A2LA 1X9SB 4TXVA 4K0NA 3R3EA 2GVPA 5ELAA 2HYXA 2LSTA 22GSA 2JU5A 2WJUA 3QR6A 1TK0B 2K8VA 4RI7A 5J9BA 3R2QA 3HKRA 1ZYQB 3APQA 4OFTA 2GQKA 2PGTA 2REMA 2H71A 2KHPA 2YN1A 2LJRA 4GSSA 1XVQA 2GT5A 3J7Yk 3APSA 3DD3A 5HFGA 3WGXA 2R0PA 3M8NA 5DJMA 4IJ3A 1TK5B 2X99A 4XS6A 13GSA 5B8BA 3F63A 5D73A 2VD0A 2G2QA 3QAWA 1TI3A 2VL2C 4L5OA 4PX1A 2VAFA 4HU7A 4JR6A 4MPGA 1JZOA 3HXSA 1XOAA 2H66A 1MD4A 1QFNA 2OKAA 3L9SA 4BL7B 7GSSA 3VI7A 1GUKA 1SJZA 1ZMAA 2BJXA 2OE1A 3CSIA 1OE7A 4G0IA 3LXTA 3CSJA 3VFIA 4KX4A 5ECRB 4OD7A 2WRTA 4J56E 4POBA 3TKPA 1XVWA 2YZHA 5IQYA 1ZYNA 2O8VB 2H0IA 2VO4A 2A2SA 4KSOA 3KH9A 19GSA 1ZCPA 4ZL8A 2R4VA 1TRVA 2E7PA 3EU4A 4TRXA 2DLXA 1T00A 2K18A 2VUPA 4JEDA 5IMAA 1OC9A 2WZ9A 3E3EA 1ERWA 5B8AA 1RW1A 3PINA 5J41A 4MJAA 3I69A 4DSSB 2C3QA 1SL1B 3ZL5A 2IMIA 3A2XA 1B4QA 1FOHA 5E59A 4MNNA 1AAZA 4Q5NA 3L9UA 5CREA 2ALBA 1OE8A 4NPBA 4X1UA 1EOGA 4ECBA 5FT3A 2B7KA 1Z5YE 1GSDA 2AHEA 4YH2A 5G5FA 4I2TA 2VLVA 3VPTA 3C1RA 4BWSA 1BAYA 3LYKA 3ME7A 4JRRA 3ED3A 4DEJA 5A4WA 2QGVA 2OACA 2F8AA 3BCKA 4PGTA 3WD6A 3LFLA 2GSSA 4IS0A 4MCUA 5ECLB 3BOAA 5HR3A 2VL9A 1M2DA 3WGDA 1THOA 1FB0A 3FKFA 2YOIA 2C3NA 3VWVA 4KDUA 3DEXA 4GCIA 1SK1A 4Z2RA 2YWOA 1HNBA 2DIYA 4JU5A 5EVOA 1HD2A 4NV2A 1ILOA 2H73A 5DAKA 5ECKB 2YJHA 6GSWA 3GURA 4FH8A 2UZ8A 2WULA 3DGQA 1EWXA 2A2RA 2IMFA 1O73A 2R3XA 4ML1A 2HLSA 4N0VA 4FYCA 1O81A 1GSYA 2C8UA 4RUVA 2E2GA 1A0FA 3GFKA 5ELGA 3ERFA 3M0FA 1TK8B 2I3YA 3RAZA 4MF5A 4KAEA 4F9ZA 3ZZXA 3N9JA 3JCML 2HFDA 2ZCTA 5D96A 4WF5A 3M9KA 1ERVA 3LJRA 2YZUA 2VCQA 5ID2A 1F3AA 3TCOA 1XW9A 1XWBA 4NV5A 5DCHA 1ZGNA 1SJ6A 3L4NA 1XW5A 1EP7A 2PBJA 3F6FA 2B5YA 2M80A 2EIOA 2MYGA 1XPVA 2ON7A 1LU4A 3FR9A 1G0TA 3P7XA 1H4OA 3PH9A 1GNWA 2JZRA 3FEUA 4XS1A 2NTOA 1ON4A 5A4VA 4PQIA 5B6MA 4JZQA 3KMNA 3TJFA 3FZAA 5KN3A 1DE1A 2HZEA 4KA0A 4G0KA 1GSEA 1QGVA 4MABA 4BVXA 4MJEA 2PN8A 5HFIA 1SU9A 5IMFA 2DJ1A 5AISA 4L0UA 2IMEA 2KLXA 1J0FA 3KM6A 3F4TA 4TOPA 11GSA 1R7HA 1JZRA 2YV9A 4TR1A 2X8CA 3UMAA 2CVBA 1FHEA 3ERWA 1U3IA 3DRNA 4BWQA 3CRUA 3BD2A 1K3YA 20GSA 4WXTA 1TI1A 2VCZA 3F0IA 3GA4A 2LRNA 5HFKA 3WYWA 1NHYA 1TTZA 3GMFA 1HNCA 3VI5A 3GKXA 2FA4A 3EYTA 4XCSA 2G0FA 1O7UA 5F0GA 1TW9A 3HVXA 3HJMA 3GH6A 4CY8A 4LA1A 2PVOC 3LORA 4GLTA 4ECJA 1S3DA 3FW2A 1XWCA 3QOUA 4IELA 2B3SA 4WR4A 1HYUA 1O8WA 4AGSA 2YNXA 3EU3A 2DJ2A 4KDYA 3UAPA 1K0NA 4GSNA 2DJ0A 3W8JA 1TKDB 1V2AA 1SL0B 3GX8A 1SKRB 1FG4A 3Q74A 5IOXA 5ECMB 2V1MA 1Y25A 1PMTA 4GSTA 4O32A 5CYYA 2QC7A 1XW6A 1FO5A 3D6IA 2ES7A 4OCEA 2CT6A 5E4WA 5ECQB 1QQ2A 8GSSA 2JZSA 1V98A 2R6KA 1CQGA 3GN3A 5A5KA 1EGOA 1X5EA 3GNJA 4EIPA 2K8SA 1K3OA 1U87A 1AQWA 3C1SA 4XTSA 4G0LA 1E6BA 3MSZA 4K0GA 2HRFA 5J3RA 1WPIA 3O76A 5DJLA 5HQPA 1O85A 2HRAA 1FB6A 4N30A 2HZFA 2GSTA 1THXA 4IQAA 3TKSC 2JSYA 2MMOA 2GQMA 4MZCA 1O8XA 2VCWA 3P2AA 4V1Ap 2GLRA 1TOFA 2DJ3A 3GRXA 1OC9B 4OCFA 3TRQA 1TP9A 4HEA2 2PU9C 1Q4JA 4MH3A 5KN1A 3MAKA 1EEMA 1E2YA 4ID0A 1ST9A 4HJ2A 2VM2A 2LEGA 1XXUA 4WBRD 2VCXA 2RUEA 4D73A 1YJ6A 5GAPD 3KCMA 2I1UA 1JZDA 4POMA 4KH7A 2R0CA 4OFNA 2KOKA 1WE0A 1R5PA 2WB9A 5CRHA 3LYPA 1JFUA 2FWFA 2MMNA 4PQHA 4AJ8A 4ML6A 4PTSA 3RBTA 3UEMA 4KB3A 2LQOA 4RQXA 5LCZA 2B5XA 2EIRA 5CRWA 1GTIA 3C7MA 5JCGA 4HDEA 2C0GA 2RLIA 1PRXA 2JL4A 4H86A 1RQMA 4KW6A 4EUYA 1G7OA 2QA1A 4GTUA 4K7OA 4CY6A 4XS4A 3GHAA 1EEJA 6GSXA 2AUVA 4ISDA 4ZILA 1GLQA 1O6JA 4IVFA 4P3YB 1KEBA 5CP1A 1WIKA 1A24A 4YKGA 3HDCA 3IV4A 2P31A 3ZYWA 1I5GA 3IR4A 2R5GA 2HRNA 2OADA 2KP2A 5DAKB 4Q5QA 3UBLA 2AV4A 2HSHA 2H1AA 3LEFA 4O5RA 3HVVA 4NWYA 1Z3EA 2FWGA 5G2ZA 2J23A 1PSQA 1M0UA 3DKSA 2WS2A 2TIRA 2LQQA 3VURA 3KP8A 4IW9A 1XFLA 4IP1A 1FW1A 2PUKC 2R37A 1V9WA 4JE1A 5KN2A 1Y6EA 2IL3A 1PGTA 1XCCA 2H0HA 2CX3A 4ZBDA 3FZ4A 2R0GA 3FYGA 3KGKA 2IIYA 3D21A 2LJKA 4ZL7A 4PNGA 5ID2B 5J4UA 2CV4A 4Z2TA 3HYPA 1UVZA 4E8HA 4O7HA 1C72A 1X5DA 1GUMA 2O85A 4ZXGA 5JWOB 5KN0A 4YQUA 2C4JA 4KCAA 3F8UA 3ZIVA 4I6XA 2C0EA 3GKNA 5C04A 2C1YA 1S3AA 4GQCA 2GQLA 1A2MA 4Z2UA 5G5EA 1LBKA 1BEDA 6GSSA 1QMVA 2QKEA 2L57A 1YEXA 2HZEB 4K9ZA 4BVXB 3FY7A 4IBPA 4OO4A 1SKSB 4N11A 3TJGA 4AF2A 3TJJA 4TR1B 3DMLA 4YKFA 1PKZA 1S3CA 1K3LA 4L0WA 5CO3A 5KEJA 1GTBA 3A2VA 4X0XA 4L8EA 1NM3A 2H01A 3ERGA 5JWQB 3TGZA 3ZFBA 2AYTA 2IPAA 4NMUA 1HQOA 3A2WA 3LWAA 3UOMA 5AN1A 1TRUA 4HJMA 5DCGA 2GS3A 3TKSA 3PR8A 5EPFA 2YPMA 2YP6A 2DC5A 3AY8A 1NSWA 5JWRB 5B7CA 1MD3A 5ECOB 3D22A 2LRCA 2X8GA 3EC3A 4NHZA 3F3QA 4ZB6A 1K0CA 3BBYA 5AGYA 2CAQA 3FHKA 1B8XA 1OKDA 3EMPA 4L5LA 4J57E 1U6TA 2JSZA 3TRXA 4ZB9A 3TOTA 1OVNA 4OFMA 5GSSA 4MF7A 4Q5FA 3WT2A 3EE2A 3EINA 2MMZA 4X43A 5D9TA 3KEBA 5ECPB 3G7YA 4TVEA 3H4KA 5FHIA 1ZZYA 1Q98A 6GSTA 3QFAC 5IMZA 2QA2A 1H75A 2WFCA 3ZMKA 3A5WA 1FVJA 1ZYEA 5H5SA 2O87A 2V2GA 1PL2A 2YWIA 1G6YA 1VGLA 2KP1A 4E8EA 1SKWB 3EMXA 5H5QA 2P5QA 2HSMA 5LNKe 3IK9A 3EVIA 4ACSA 2K9FA 2H72A 4MK3A 2IWTA 3VPQA 2E2MA 3P8WA 3GKMA 2GGTA 3IPZA 3IBHA 4F0CA 1RK4A 1Z6MA 2E0QA 5JCWA 4IQ1A 4EKZA 1OC8A 1T4ZA 3MDKA 2DKHA 1YKAA 3IK7A 3P90A 3GYKA 3TKRA 3SWLA 3G7JA 3HZ8A 3H93A 3WT1A 5ENUA 1VRSD 3RDWA 1YEPA 3RPPA 4K8MA 3KTBA 4D73B 1ZL9A 2Z9SA 2B5EA 4DSQA 5EY6A 1JLVA 2H8LA 3PGTA 3VWXA 2C0DA 1EGRA 2MBSA 4I5QA 3W6GA 2IMKA 1AC1A 3IXRA 3I43A 1G7EA 2VL2A 3DWVA 5KOXA 1K0BA 2P0GA 3C73A 4ECIA 1X5CA 2L6DA 4YAPA 1K0DA 2PMTA 2DIZA 4XS4B 2JADA 3IHGA 4PXOA 2RUFA 3IE3A 1WMJA 4EDZA 5L71A 4LMVA 3CBUA 4HOJA 4F82A 1Z6NA 2NVLA 1YF1A 2NPBA 4PQ1A 3UVTA 2CAIA 2RIIA 1WWJA 3QAGA 3ZTLA 1R5AA 2CQ9A 1ZYPA 3L9VA 2KUCA 1X9MB 1GL8A 4IJIA 12GSA 1YF0A 4WEYA 1U3AA 3TUEA 4XRDA 2OBKA 2XPEA 5ABRA 2ZUPA 2GZYA 4MJCA 4IGJA 1GSQA 1XWAA 2IFQA 1K0MA 3LSZA 4HS1A 4K7NA 4GQFA 2B1LA 2M72A 3UARA 4YAVA 3RPNA 1F3BA 1KNGA 1YY7A 2V32A 3QFBC 2F3MA 1GULA 4BVYA 4MA9A 5IPHA 4LL1B 4MF6A 4FYBA 1KTEA 4MDCA 3GSTA 1AW9A 1GTUA 2BMXA 3FK8A 4WF4A 2GT6A 5BRTA 1GUHA 2DJJA 1DSBA 4HQSA 5GSTA 4HUAA 1T7PB 3F6DA 4WR5A 3TDGA 4QL7A 5C00A 2FA8A 2C0FA 1VF3A 6GSVA 1I9DA 1XWGA 5DBQA 1B9YC 3IAM2 5D9VA 4I97A 5G1LA 2L59A 1GSUA 3FR3A 1GH2A 2XC2A 2X8HA 5A4UA 1V57A 2O89A 3KH7A 4V2MA 2H75A 3H79A 4MZWA 4A5PA 3FMWA 4ZB8A 1KBNA 3KTLA 3E0UA 3GTUA 2GZZA 3IRAA 1T8EB 9GSSA 2YWNA 5DQSA 1MDIA 3FZ5A 2CA8A 4HI7A 2VCTA 4EVMA 3F4SA 3H8QA 1WRYA 1M9AA 3LGCA 2FGXA 3M9JA 3ZREA 2H70A 4F0BA 1R26A 5ECSA 2H76A 2PPTA 2A2PA 2VOCA 3UJ1A 2LV3A 4BPYA 4TXOA 3MIXA 1TRWA 4WBJA 2HI7A 2AJQB 4POKA 2VL3A 3G9BA 3M1GA 5IMVA 2H74A 4AJ7A 3QMXA 2YJ7A 3Q18A 2WCIA 5GZZB 2L5LA 1PA3A 3IOSA 1BX9A 1N2AA 5AIXA 1AQXA 1QXHA 4CW9A 1K0OA 3W8SA 5HR1A 2FWEA 3HZ4A 2H1DA 1PX6A 4GWRA 3GL5A 4G9HA 6GSUA 1UN2A 3HA9A 3QD9A 1EOHA 1OC3A 17GSA 1AIUA 5COHA 3OR5A 5F06A 4DVCA 3MNGA 1BYEA 3DVWA 2F51A 2I81A 3HJPA 2EC4A 3DXBA 3FR6A 3ZVJD 1LJRA 3DVXA 3GH9A 2YV7A 3Q6OA 5BMUA 1BQ7A 1A8LA 3ZLPA 3LG6A 2X49A 4EO3A 4Q5RA 1AXDA 4IN0A 3HY2A 2F9SA 1IYIA 2WDUA 2NBSA 2VD1A 5DALA 1N8JA 2HXKA 1MEKA 1F6MC 2AAWA 2LUSA 1EV9A 4MMMA 4MLYA 3ZIJA 4WKWA 4V2LA 2FWHA 3NIVA 5CNWA 4BA7A 1XZOA 3QAVA 1BG5A 14GSA 1Z7RA 1NHOA 3TKSE 1PD21 3IA1A 3KJYA 1MTCA 1WP0A 5IMDA 4Z7XA 2PWJA 2EIQA 2MBTA 5IO2A 3I6AA 1IYHA 2GDRA 2GZPA 4K5RA 1JLWA 4EXJA 5D93A 2OA7A 4PURA 5G31A 1TXXA 4V2NA 1W4VA 1DBYA 2NDOA 5G1KA 1ZOFA 2D2ZA 5CRDA 4XRAA 3C8EA 2OE3A 3UVHA 1OAZA 4JBBA 4TR0A 4KF9A 2L6CA 4KNDA 4XIHA 4HZ4A 1GP1A 1FVKA 4TN8A 3I9V2 5IO0A 3ZFLA 2QSIA 1UC7A 4N0ZA 4ECCA 3TJKA 4NHWA 3F9UA 4EF0A 3ME8A 3A3TA 4G10A 4NXIA 5KOWA 5INYA 2CZ3A 6GSYA 3IC4A 1JZWA 4USSA 4QL9A 2VCVA 2DSAA 3QDNA 1XWKA 3V1WA 1V40A 4IP6A 3RHBA 2CZ2A 1ERTA 1PX7A 1YKCA 2HNLA 4MH2A 4HZ2A 4GXZA 4EC0A 1XBSA 3VWUA 2XHFA 18GSA 3GV1A 1EV4A 4HQZA 1TJDA 2L4CA 3O6TA 2IN3A 1B48A 5GAND 2I9HA 5HR0A 1PN0A 3BCIA 3CMIA 4K7IA 4PUFC 2IFQB 2B6MA 2FD3A 1A2JA 2M46A 4X4JA 3QCPA 2RM5A 5D9XA 5D8IA 2N5BA 2ZNMA 4XHMA 2L4QA 5D9WA 2C3TA 3QPMA 1F37A 2H1GA 3TJBA 2A4VA 3FRCA 4PUAA 1M9BA 2FUG2 2JZTA 4BVYB 4WETA 4POLA 1Z7PA 4K5SA 3BJ5A 3VLNA 3HHVA 2RM6A 2CVDA 2FY6A 2FNOA 1SYRA 2K6VA 1GSSA 1G6WA 4KE3A 5ECIB 1TRSA 4EL1A 4OO5A 1SD8A 2H0GA 1WOUA 2GSQA 2OBIA 4O5QA 2V6KA 3KP9A 4F2IA 4ILFA 1GSFA 1M2BA 1SK0A 3L78A 4J2FA 4MZBA 4GF0A 1T3BA 4HU9A 5CRGA 2H6XA 4KCEA 2MZCA 2DBCA 1DUGA 2R2JA 1OYJA 2H1BA 1SD9A 2V6OA 2B7JA 1PKWA 3GTUB 3GX0A 4KDXA 3HVSA 2ON5A 3IAS2 4EDYA 2GSRA 4I2UA 3Q19A 3FZ9A 3ISOA 4ULXA 3H1NA 4K2XA 4K2DA 5J5NA 3ZVJA 3NOFA 2XBIA 5J9CA 3J7Yb 3O3TA 3VWWA 3IC8A 4TXOB 4MP4A 1R4WA 5DQYA 4TR4A 1NW2A 4TW5A 1F9MA 3U5RE 5CAXA 2HSYA 2DMLA 3CSHA 2LS5A 2YCDA 3GKKA 4LLRA 3K8NA 4EE0A 4ZBBA 1USBA 2FLSA 1GNEA 2DKIA 1W89A 16GSA 3ZMLA 2IJYA 5JCUA 2CVKA 1VF2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ML6 A;  3F3R A;  2X64 A;  3ZIT A;  1ACV A;  2OE0 A;  4LMW A;  2TRC P;  3S9F A;  3F4R A;  3RHC A;  3D5J A;  2JAC A;  3CTG A;  4BL7 A;  1SJI A;  4FO5 A;  2H6Z A;  2I4A A;  1T4Y A;  1K0A A;  1ERU A;  4QQ7 A;  5EL8 A;  4CDO A;  1YDK A;  3KMO A;  3UIW A;  3DYR A;  5IMC A;  3US3 A;  1EZK A;  4F03 A;  1PQN A;  3D4T A;  2LNS A;  5B6N A;  2FCH A;  3G7I A;  4O92 A;  3LXZ A;  3LQ7 A;  2N5A A;  5F8B A;  1WJK A;  3WGE A;  4PNF A;  2N5F A;  1OKT A;  5IOW A;  3HJO A;  5DAL B;  3KZQ A;  4IHU A;  3D0Z A;  2O7K A;  1GRX A;  4K1F A;  2AB6 A;  4MPF A;  4KSM A;  3GUS A;  1B4P A;  3UL3 A;  1SK2 A;  2V41 A;  1A8Y A;  3KD0 A;  4G2E A;  1M2A A;  4DSS A;  3NZN A;  3L0H A;  5G30 A;  1PN9 A;  2FHE A;  4YQV A;  2YAN A;  4G19 A;  1X0R A;  3EWL A;  2LJA A;  5ECH B;  3GIX A;  3KXO A;  1EP8 A;  2BTO T;  2HT9 A;  4RI6 A;  4V1A g;  1XIY A;  4ZIJ A;  3CRT A;  4CHS A;  2HE3 A;  5HR2 A;  10GS A;  2LRT A;  4KUN A;  4IKH A;  2H30 A;  1MDK A;  5DDL A;  3ZRD A;  3E9J B;  1XOB A;  1J9B A;  2P5R A;  5IPG A;  1YQ1 A;  2TRX A;  1YZX A;  2GTU A;  4K6X A;  2LNT A;  5F05 A;  1UA5 A;  2C80 A;  1GTA A;  2PER A;  1BJX A;  2XBQ A;  2MMA A;  1TU7 A;  3CTF A;  3APO A;  3TB2 A;  1FAA A;  3EUR A;  3HD5 A;  1MDJ A;  1ABA A;  1F2E A;  2IMD A;  4LL4 B;  1JHB A;  2DMM A;  5FWG A;  3DIE A;  1QK8 A;  5H5R A;  2VIM A;  3IDV A;  1QUW A;  1A0R P;  3GSS A;  1AUC A;  2PVQ A;  1U88 A;  3TOU A;  5LD0 A;  3KIJ A;  4N10 A;  1SYX A;  5IIZ A;  2VLU A;  3SBC A;  2LTK A;  4FYU A;  1PL1 A;  4RQR A;  1V58 A;  4MJB A;  3D4M A;  4YQM A;  2VM1 A;  1SEN A;  3MWH A;  1URM A;  4AJ6 A;  1Z9H A;  2B1K A;  2H6Y A;  1HNA A;  3TRP A;  1J08 A;  4NAX A;  2YWM A;  1GWC A;  4FIW A;  1DE2 A;  3U6V A;  2LKU A;  2F8F A;  2XPD A;  1T1V A;  5AIV A;  3CYN A;  3C71 A;  3M3M A;  2J9H A;  2WGR A;  1CQH A;  1M7T A;  4ZL9 A;  4JR4 A;  3N5O A;  1TU8 A;  3IHQ A;  2DJK A;  1VF4 A;  2OJL A;  1M99 A;  1B9X C;  3VK9 A;  1FOV A;  1A23 A;  3HCZ A;  2CX4 A;  3UBK A;  1X9W B;  3CXG A;  4TKY A;  4I8B A;  5DVB A;  2H19 A;  5IM9 A;  4OWY A;  4DSR A;  5ECN B;  4TR3 A;  4KGI A;  4GRF A;  4OMV A;  2L5O A;  3TKQ A;  3GL3 A;  1TDI A;  2VLT A;  1SL2 B;  1VF1 A;  5F07 A;  1GLP A;  1AQV A;  4ZBA A;  1A2L A;  1X9S B;  4TXV A;  4K0N A;  2GVP A;  5ELA A;  2HYX A;  2LST A;  22GS A;  2JU5 A;  2WJU A;  3QR6 A;  1TK0 B;  2K8V A;  4RI7 A;  5J9B A;  3R2Q A;  3HKR A;  1ZYQ B;  3APQ A;  4OFT A;  2GQK A;  2PGT A;  2REM A;  2H71 A;  2KHP A;  2YN1 A;  2LJR A;  4GSS A;  1XVQ A;  2GT5 A;  3J7Y k;  3APS A;  3DD3 A;  5HFG A;  3WGX A;  3M8N A;  5DJM A;  4IJ3 A;  1TK5 B;  2X99 A;  4XS6 A;  13GS A;  5B8B A;  3F63 A;  5D73 A;  2VD0 A;  2G2Q A;  3QAW A;  1TI3 A;  2VL2 C;  4L5O A;  4PX1 A;  2VAF A;  4HU7 A;  4JR6 A;  4MPG A;  1JZO A;  3HXS A;  1XOA A;  2H66 A;  1MD4 A;  1QFN A;  2OKA A;  3L9S A;  7GSS A;  3VI7 A;  1GUK A;  1SJZ A;  1ZMA A;  2BJX A;  2OE1 A;  3CSI A;  1OE7 A;  3LXT A;  3CSJ A;  3VFI A;  4KX4 A;  5ECR B;  4OD7 A;  2WRT A;  4J56 E;  4POB A;  3TKP A;  1XVW A;  2YZH A;  5IQY A;  2O8V B;  2H0I A;  2VO4 A;  2A2S A;  4KSO A;  3KH9 A;  19GS A;  1ZCP A;  4ZL8 A;  2R4V A;  1TRV A;  2E7P A;  3EU4 A;  4TRX A;  2DLX A;  1T00 A;  2K18 A;  2VUP A;  4JED A;  5IMA A;  1OC9 A;  2WZ9 A;  3E3E A;  1ERW A;  5B8A A;  1RW1 A;  3PIN A;  5J41 A;  4MJA A;  3I69 A;  4DSS B;  2C3Q A;  1SL1 B;  3ZL5 A;  2IMI A;  3A2X A;  1B4Q A;  5E59 A;  1AAZ A;  4Q5N A;  3L9U A;  5CRE A;  2ALB A;  1OE8 A;  4NPB A;  4X1U A;  1EOG A;  4ECB A;  5FT3 A;  2B7K A;  1Z5Y E;  1GSD A;  2AHE A;  4YH2 A;  5G5F A;  4I2T A;  2VLV A;  3VPT A;  3C1R A;  4BWS A;  1BAY A;  3LYK A;  3ME7 A;  4JRR A;  3ED3 A;  4DEJ A;  5A4W A;  2QGV A;  2OAC A;  2F8A A;  3BCK A;  4PGT A;  3WD6 A;  3LFL A;  2GSS A;  4IS0 A;  4MCU A;  5ECL B;  3BOA A;  5HR3 A;  2VL9 A;  1M2D A;  3WGD A;  1THO A;  1FB0 A;  3FKF A;  2YOI A;  2C3N A;  3VWV A;  4KDU A;  3DEX A;  4GCI A;  1SK1 A;  2YWO A;  1HNB A;  2DIY A;  4JU5 A;  5EVO A;  1HD2 A;  4NV2 A;  1ILO A;  2H73 A;  5DAK A;  5ECK B;  2YJH A;  6GSW A;  3GUR A;  4FH8 A;  2WUL A;  3DGQ A;  1EWX A;  2A2R A;  2IMF A;  1O73 A;  2R3X A;  4ML1 A;  2HLS A;  4N0V A;  4FYC A;  1O81 A;  1GSY A;  2C8U A;  4RUV A;  2E2G A;  1A0F A;  3GFK A;  5ELG A;  3ERF A;  3M0F A;  1TK8 B;  2I3Y A;  3RAZ A;  4MF5 A;  4KAE A;  4F9Z A;  3ZZX A;  3N9J A;  3JCM L;  2HFD A;  2ZCT A;  5D96 A;  4WF5 A;  3M9K A;  1ERV A;  3LJR A;  2YZU A;  2VCQ A;  5ID2 A;  1F3A A;  3TCO A;  1XW9 A;  1XWB A;  4NV5 A;  5DCH A;  1ZGN A;  1SJ6 A;  3L4N A;  1XW5 A;  1EP7 A;  2PBJ A;  3F6F A;  2B5Y A;  2M80 A;  2EIO A;  2MYG A;  1XPV A;  2ON7 A;  1LU4 A;  3FR9 A;  1G0T A;  3P7X A;  1H4O A;  3PH9 A;  1GNW A;  2JZR A;  3FEU A;  4XS1 A;  2NTO A;  1ON4 A;  5A4V A;  4PQI A;  5B6M A;  4JZQ A;  3KMN A;  3TJF A;  3FZA A;  5KN3 A;  1DE1 A;  2HZE A;  4KA0 A;  1GSE A;  1QGV A;  4MAB A;  4BVX A;  4MJE A;  2PN8 A;  5HFI A;  1SU9 A;  5IMF A;  2DJ1 A;  5AIS A;  4L0U A;  2IME A;  2KLX A;  1J0F A;  3KM6 A;  3F4T A;  4TOP A;  11GS A;  1R7H A;  1JZR A;  2YV9 A;  4TR1 A;  2X8C A;  3UMA A;  2CVB A;  1FHE A;  3ERW A;  1U3I A;  3DRN A;  4BWQ A;  3CRU A;  3BD2 A;  1K3Y A;  20GS A;  4WXT A;  1TI1 A;  2VCZ A;  3F0I A;  3GA4 A;  2LRN A;  5HFK A;  3WYW A;  1NHY A;  1TTZ A;  3GMF A;  1HNC A;  3VI5 A;  3GKX A;  2FA4 A;  3EYT A;  4XCS A;  2G0F A;  1O7U A;  5F0G A;  1TW9 A;  3HVX A;  3HJM A;  3GH6 A;  4LA1 A;  2PVO C;  3LOR A;  4GLT A;  4ECJ A;  1S3D A;  3FW2 A;  1XWC A;  3QOU A;  4IEL A;  2B3S A;  4WR4 A;  1HYU A;  1O8W A;  4AGS A;  2YNX A;  3EU3 A;  2DJ2 A;  4KDY A;  3UAP A;  1K0N A;  4GSN A;  2DJ0 A;  3W8J A;  1TKD B;  1V2A A;  1SL0 B;  3GX8 A;  1SKR B;  1FG4 A;  3Q74 A;  5IOX A;  5ECM B;  2V1M A;  1Y25 A;  1PMT A;  4GST A;  4O32 A;  5CYY A;  2QC7 A;  1XW6 A;  1FO5 A;  3D6I A;  2ES7 A;  4OCE A;  2CT6 A;  5E4W A;  5ECQ B;  1QQ2 A;  8GSS A;  2JZS A;  1V98 A;  2R6K A;  1CQG A;  3GN3 A;  5A5K A;  1EGO A;  1X5E A;  3GNJ A;  2K8S A;  1K3O A;  1U87 A;  1AQW A;  3C1S A;  4XTS A;  1E6B A;  3MSZ A;  4K0G A;  2HRF A;  5J3R A;  1WPI A;  3O76 A;  5DJL A;  5HQP A;  1O85 A;  1FB6 A;  4N30 A;  2HZF A;  2GST A;  1THX A;  4IQA A;  3TKS C;  2JSY A;  2MMO A;  2GQM A;  4MZC A;  1O8X A;  2VCW A;  3P2A A;  4V1A p;  2GLR A;  1TOF A;  2DJ3 A;  3GRX A;  1OC9 B;  4OCF A;  3TRQ A;  1TP9 A;  4HEA 2;  2PU9 C;  1Q4J A;  4MH3 A;  5KN1 A;  3MAK A;  1EEM A;  1E2Y A;  4ID0 A;  1ST9 A;  4HJ2 A;  2VM2 A;  2LEG A;  1XXU A;  4WBR D;  2VCX A;  2RUE A;  4D73 A;  1YJ6 A;  5GAP D;  3KCM A;  2I1U A;  1JZD A;  4POM A;  4KH7 A;  4OFN A;  2KOK A;  1WE0 A;  1R5P A;  2WB9 A;  5CRH A;  3LYP A;  1JFU A;  2FWF A;  2MMN A;  4PQH A;  4AJ8 A;  4ML6 A;  3RBT A;  3UEM A;  4KB3 A;  2LQO A;  4RQX A;  5LCZ A;  2B5X A;  2EIR A;  5CRW A;  1GTI A;  3C7M A;  5JCG A;  4HDE A;  2C0G A;  2RLI A;  1PRX A;  2JL4 A;  4H86 A;  1RQM A;  4KW6 A;  4EUY A;  1G7O A;  4GTU A;  4K7O A;  4XS4 A;  3GHA A;  1EEJ A;  6GSX A;  2AUV A;  4ISD A;  4ZIL A;  1GLQ A;  1O6J A;  4IVF A;  4P3Y B;  1KEB A;  5CP1 A;  1WIK A;  1A24 A;  3HDC A;  3IV4 A;  2P31 A;  3ZYW A;  1I5G A;  3IR4 A;  2R5G A;  2HRN A;  2OAD A;  2KP2 A;  5DAK B;  4Q5Q A;  3UBL A;  2AV4 A;  2HSH A;  2H1A A;  3LEF A;  4O5R A;  3HVV A;  4NWY A;  1Z3E A;  2FWG A;  5G2Z A;  2J23 A;  1PSQ A;  1M0U A;  3DKS A;  2WS2 A;  2TIR A;  2LQQ A;  3VUR A;  3KP8 A;  4IW9 A;  1XFL A;  4IP1 A;  1FW1 A;  2PUK C;  2R37 A;  1V9W A;  4JE1 A;  5KN2 A;  1Y6E A;  2IL3 A;  1PGT A;  1XCC A;  2H0H A;  2CX3 A;  4ZBD A;  3FZ4 A;  3FYG A;  3KGK A;  2IIY A;  3D21 A;  2LJK A;  4ZL7 A;  4PNG A;  5ID2 B;  5J4U A;  2CV4 A;  3HYP A;  1UVZ A;  4E8H A;  4O7H A;  1C72 A;  1X5D A;  1GUM A;  2O85 A;  4ZXG A;  5JWO B;  5KN0 A;  4YQU A;  2C4J A;  4KCA A;  3F8U A;  3ZIV A;  4I6X A;  2C0E A;  3GKN A;  5C04 A;  2C1Y A;  1S3A A;  4GQC A;  2GQL A;  1A2M A;  5G5E A;  1LBK A;  1BED A;  6GSS A;  1QMV A;  2QKE A;  2L57 A;  1YEX A;  2HZE B;  4K9Z A;  3FY7 A;  4IBP A;  4OO4 A;  1SKS B;  4N11 A;  3TJG A;  4AF2 A;  3TJJ A;  4TR1 B;  3DML A;  1PKZ A;  1S3C A;  1K3L A;  4L0W A;  5CO3 A;  5KEJ A;  1GTB A;  3A2V A;  4X0X A;  4L8E A;  1NM3 A;  2H01 A;  3ERG A;  5JWQ B;  3TGZ A;  3ZFB A;  2AYT A;  2IPA A;  4NMU A;  1HQO A;  3A2W A;  3LWA A;  3UOM A;  5AN1 A;  1TRU A;  4HJM A;  5DCG A;  2GS3 A;  3TKS A;  3PR8 A;  5EPF A;  2YPM A;  2YP6 A;  2DC5 A;  3AY8 A;  1NSW A;  5JWR B;  5B7C A;  1MD3 A;  5ECO B;  3D22 A;  2LRC A;  2X8G A;  3EC3 A;  4NHZ A;  3F3Q A;  4ZB6 A;  1K0C A;  3BBY A;  5AGY A;  2CAQ A;  3FHK A;  1B8X A;  1OKD A;  3EMP A;  4L5L A;  4J57 E;  1U6T A;  2JSZ A;  3TRX A;  4ZB9 A;  3TOT A;  1OVN A;  4OFM A;  5GSS A;  4MF7 A;  4Q5F A;  3WT2 A;  3EE2 A;  3EIN A;  2MMZ A;  4X43 A;  5D9T A;  3KEB A;  5ECP B;  3G7Y A;  4TVE A;  3H4K A;  5FHI A;  1ZZY A;  1Q98 A;  6GST A;  3QFA C;  5IMZ A;  1H75 A;  2WFC A;  3ZMK A;  3A5W A;  1FVJ A;  1ZYE A;  5H5S A;  2O87 A;  2V2G A;  1PL2 A;  2YWI A;  1G6Y A;  1VGL A;  2KP1 A;  4E8E A;  1SKW B;  3EMX A;  5H5Q A;  2P5Q A;  5LNK e;  3IK9 A;  3EVI A;  4ACS A;  2K9F A;  2H72 A;  4MK3 A;  2IWT A;  3VPQ A;  2E2M A;  3P8W A;  3GKM A;  2GGT A;  3IPZ A;  3IBH A;  4F0C A;  1RK4 A;  1Z6M A;  2E0Q A;  5JCW A;  4IQ1 A;  4EKZ A;  1OC8 A;  1T4Z A;  3MDK A;  1YKA A;  3IK7 A;  3P90 A;  3GYK A;  3TKR A;  3SWL A;  3G7J A;  3HZ8 A;  3H93 A;  3WT1 A;  5ENU A;  1VRS D;  3RDW A;  1YEP A;  3RPP A;  4K8M A;  3KTB A;  4D73 B;  1ZL9 A;  2Z9S A;  2B5E A;  4DSQ A;  5EY6 A;  1JLV A;  2H8L A;  3PGT A;  3VWX A;  2C0D A;  1EGR A;  2MBS A;  4I5Q A;  3W6G A;  2IMK A;  1AC1 A;  3IXR A;  3I43 A;  1G7E A;  2VL2 A;  3DWV A;  1K0B A;  2P0G A;  3C73 A;  4ECI A;  1X5C A;  2L6D A;  4YAP A;  1K0D A;  2PMT A;  2DIZ A;  4XS4 B;  2JAD A;  4PXO A;  2RUF A;  3IE3 A;  1WMJ A;  4EDZ A;  5L71 A;  4LMV A;  3CBU A;  4HOJ A;  4F82 A;  1Z6N A;  2NVL A;  1YF1 A;  2NPB A;  4PQ1 A;  3UVT A;  2CAI A;  2RII A;  1WWJ A;  3QAG A;  3ZTL A;  1R5A A;  2CQ9 A;  3L9V A;  2KUC A;  1X9M B;  1GL8 A;  4IJI A;  12GS A;  1YF0 A;  4WEY A;  1U3A A;  3TUE A;  4XRD A;  2OBK A;  2XPE A;  5ABR A;  2ZUP A;  2GZY A;  4MJC A;  4IGJ A;  1GSQ A;  1XWA A;  2IFQ A;  1K0M A;  3LSZ A;  4HS1 A;  4K7N A;  4GQF A;  2B1L A;  2M72 A;  3UAR A;  4YAV A;  3RPN A;  1F3B A;  1KNG A;  1YY7 A;  2V32 A;  3QFB C;  2F3M A;  1GUL A;  4BVY A;  4MA9 A;  5IPH A;  4LL1 B;  4MF6 A;  4FYB A;  1KTE A;  4MDC A;  3GST A;  1AW9 A;  1GTU A;  2BMX A;  3FK8 A;  4WF4 A;  2GT6 A;  1GUH A;  2DJJ A;  1DSB A;  4HQS A;  5GST A;  4HUA A;  1T7P B;  3F6D A;  4WR5 A;  3TDG A;  4QL7 A;  5C00 A;  2FA8 A;  2C0F A;  1VF3 A;  6GSV A;  1I9D A;  1XWG A;  5DBQ A;  1B9Y C;  3IAM 2;  5D9V A;  4I97 A;  5G1L A;  2L59 A;  1GSU A;  3FR3 A;  1GH2 A;  2XC2 A;  2X8H A;  5A4U A;  1V57 A;  2O89 A;  3KH7 A;  4V2M A;  2H75 A;  3H79 A;  4MZW A;  4ZB8 A;  1KBN A;  3KTL A;  3E0U A;  3GTU A;  2GZZ A;  3IRA A;  1T8E B;  9GSS A;  2YWN A;  5DQS A;  1MDI A;  3FZ5 A;  2CA8 A;  4HI7 A;  2VCT A;  4EVM A;  3F4S A;  3H8Q A;  1WRY A;  1M9A A;  3LGC A;  2FGX A;  3M9J A;  3ZRE A;  2H70 A;  4F0B A;  1R26 A;  5ECS A;  2H76 A;  2PPT A;  2VOC A;  3UJ1 A;  2LV3 A;  4BPY A;  4TXO A;  1TRW A;  4WBJ A;  2HI7 A;  2AJQ B;  4POK A;  2VL3 A;  3G9B A;  3M1G A;  5IMV A;  2H74 A;  4AJ7 A;  3QMX A;  2YJ7 A;  3Q18 A;  2WCI A;  5GZZ B;  2L5L A;  1PA3 A;  3IOS A;  1BX9 A;  1N2A A;  5AIX A;  1AQX A;  1QXH A;  4CW9 A;  1K0O A;  3W8S A;  5HR1 A;  2FWE A;  3HZ4 A;  2H1D A;  1PX6 A;  4GWR A;  3GL5 A;  4G9H A;  6GSU A;  1UN2 A;  3HA9 A;  3QD9 A;  1EOH A;  1OC3 A;  17GS A;  1AIU A;  5COH A;  3OR5 A;  5F06 A;  4DVC A;  3MNG A;  1BYE A;  3DVW A;  2F51 A;  2I81 A;  3HJP A;  2EC4 A;  3DXB A;  3FR6 A;  3ZVJ D;  1LJR A;  3DVX A;  3GH9 A;  2YV7 A;  3Q6O A;  1BQ7 A;  1A8L A;  3ZLP A;  3LG6 A;  4EO3 A;  4Q5R A;  1AXD A;  4IN0 A;  3HY2 A;  2F9S A;  1IYI A;  2WDU A;  2NBS A;  2VD1 A;  5DAL A;  1N8J A;  2HXK A;  1MEK A;  1F6M C;  2AAW A;  2LUS A;  1EV9 A;  4MMM A;  4MLY A;  3ZIJ A;  4WKW A;  4V2L A;  2FWH A;  3NIV A;  5CNW A;  4BA7 A;  1XZO A;  3QAV A;  1BG5 A;  14GS A;  1Z7R A;  1NHO A;  3TKS E;  1PD2 1;  3IA1 A;  3KJY A;  1MTC A;  1WP0 A;  5IMD A;  4Z7X A;  2PWJ A;  2EIQ A;  2MBT A;  5IO2 A;  3I6A A;  1IYH A;  2GDR A;  2GZP A;  1JLW A;  4EXJ A;  5D93 A;  2OA7 A;  4PUR A;  5G31 A;  1TXX A;  4V2N A;  1W4V A;  1DBY A;  2NDO A;  5G1K A;  1ZOF A;  2D2Z A;  5CRD A;  4XRA A;  3C8E A;  2OE3 A;  3UVH A;  1OAZ A;  4JBB A;  4TR0 A;  2L6C A;  4KND A;  4XIH A;  4HZ4 A;  1GP1 A;  1FVK A;  4TN8 A;  3I9V 2;  5IO0 A;  3ZFL A;  2QSI A;  1UC7 A;  4N0Z A;  4ECC A;  3TJK A;  4NHW A;  3F9U A;  4EF0 A;  3ME8 A;  3A3T A;  4G10 A;  4NXI A;  5INY A;  2CZ3 A;  6GSY A;  3IC4 A;  1JZW A;  4QL9 A;  2VCV A;  2DSA A;  3QDN A;  1XWK A;  3V1W A;  1V40 A;  4IP6 A;  3RHB A;  2CZ2 A;  1ERT A;  1PX7 A;  1YKC A;  2HNL A;  4MH2 A;  4HZ2 A;  4GXZ A;  4EC0 A;  1XBS A;  3VWU A;  2XHF A;  18GS A;  3GV1 A;  1EV4 A;  4HQZ A;  1TJD A;  2L4C A;  3O6T A;  2IN3 A;  1B48 A;  5GAN D;  2I9H A;  5HR0 A;  3BCI A;  3CMI A;  4K7I A;  4PUF C;  2IFQ B;  2B6M A;  2FD3 A;  1A2J A;  2M46 A;  3QCP A;  2RM5 A;  5D9X A;  5D8I A;  2N5B A;  2ZNM A;  4XHM A;  2L4Q A;  5D9W A;  2C3T A;  3QPM A;  1F37 A;  2H1G A;  3TJB A;  2A4V A;  3FRC A;  4PUA A;  1M9B A;  2FUG 2;  2JZT A;  4WET A;  4POL A;  1Z7P A;  3BJ5 A;  3VLN A;  3HHV A;  2RM6 A;  2CVD A;  2FY6 A;  2FNO A;  1SYR A;  2K6V A;  1GSS A;  1G6W A;  4KE3 A;  5ECI B;  1TRS A;  4EL1 A;  4OO5 A;  1SD8 A;  2H0G A;  1WOU A;  2GSQ A;  2OBI A;  2V6K A;  3KP9 A;  4F2I A;  4ILF A;  1GSF A;  1M2B A;  1SK0 A;  3L78 A;  4J2F A;  4MZB A;  4GF0 A;  1T3B A;  4HU9 A;  5CRG A;  2H6X A;  4KCE A;  2MZC A;  2DBC A;  1DUG A;  2R2J A;  1OYJ A;  2H1B A;  1SD9 A;  2V6O A;  2B7J A;  1PKW A;  3GTU B;  3GX0 A;  4KDX A;  3HVS A;  2ON5 A;  3IAS 2;  4EDY A;  2GSR A;  4I2U A;  3Q19 A;  3FZ9 A;  3ISO A;  4ULX A;  3H1N A;  4K2D A;  5J5N A;  3ZVJ A;  3NOF A;  2XBI A;  5J9C A;  3J7Y b;  3O3T A;  3VWW A;  4TXO B;  5DQY A;  4MP4 A;  1R4W A;  4TR4 A;  1NW2 A;  4TW5 A;  1F9M A;  3U5R E;  5CAX A;  2HSY A;  2DML A;  3CSH A;  2LS5 A;  2YCD A;  3GKK A;  4LLR A;  3K8N A;  4EE0 A;  4ZBB A;  1USB A;  2FLS A;  1GNE A;  1W89 A;  16GS A;  3ZML A;  2IJY A;  5JCU A;  2CVK A;  1VF2 A; 
#chains in the Genus database with same CATH topology
 1ML6 A;  3F3R A;  2X64 A;  3ZIT A;  1ACV A;  2OE0 A;  4LMW A;  4FQU A;  2TRC P;  3S9F A;  3EPT A;  3F4R A;  3RHC A;  3D5J A;  2JAC A;  3CTG A;  4BL7 A;  1SJI A;  4FO5 A;  2H6Z A;  2I4A A;  1T4Y A;  1K0A A;  1ERU A;  4QQ7 A;  5EL8 A;  4CDO A;  1YDK A;  3KMO A;  3UIW A;  3DYR A;  5IMC A;  3US3 A;  1EZK A;  4F03 A;  1PQN A;  3D4T A;  2LNS A;  5B6N A;  2FCH A;  3G7I A;  4O92 A;  3LXZ A;  3LQ7 A;  2N5A A;  5F8B A;  1WJK A;  3WGE A;  4PNF A;  2N5F A;  4HSC X;  1OKT A;  5IOW A;  3HJO A;  5DAL B;  3KZQ A;  4IHU A;  3D0Z A;  2O7K A;  1GRX A;  4K1F A;  2AB6 A;  4MPF A;  4KSM A;  3GUS A;  1B4P A;  3UL3 A;  1SK2 A;  2V41 A;  1A8Y A;  3KD0 A;  4G2E A;  4O5U A;  1M2A A;  4DSS A;  3NZN A;  3L0H A;  5G30 A;  1PN9 A;  2FHE A;  4YQV A;  2YAN A;  4G19 A;  1X0R A;  3EWL A;  2LJA A;  5ECH B;  3GIX A;  3KXO A;  1EP8 A;  2BTO T;  2HT9 A;  4RI6 A;  4V1A g;  1XIY A;  4ZIJ A;  3CRT A;  4CHS A;  2HE3 A;  5HR2 A;  10GS A;  2LRT A;  4KUN A;  4IKH A;  2H30 A;  1MDK A;  5DDL A;  3ZRD A;  3E9J B;  1XOB A;  1J9B A;  2P5R A;  2X4A A;  5IPG A;  1YQ1 A;  2TRX A;  1YZX A;  2GTU A;  4K6X A;  2LNT A;  5F05 A;  1UA5 A;  2C80 A;  1GTA A;  2PER A;  1BJX A;  2XBQ A;  2MMA A;  1TU7 A;  3CTF A;  3APO A;  3TB2 A;  1FAA A;  3EUR A;  3HD5 A;  1MDJ A;  1ABA A;  1F2E A;  2IMD A;  4LL4 B;  1JHB A;  2DMM A;  5FWG A;  3DIE A;  1QK8 A;  1S3R A;  5H5R A;  2VIM A;  3IDV A;  1QUW A;  1A0R P;  3GSS A;  1AUC A;  2PVQ A;  1U88 A;  3TOU A;  5LD0 A;  3KIJ A;  4N10 A;  1SYX A;  5IIZ A;  2VLU A;  3SBC A;  2LTK A;  4FYU A;  1PL1 A;  4RQR A;  1V58 A;  4MJB A;  3D4M A;  4YQM A;  2VM1 A;  1SEN A;  3MWH A;  1URM A;  4AJ6 A;  1Z9H A;  3MYD A;  2B1K A;  2H6Y A;  1HNA A;  3TRP A;  3A5I A;  1J08 A;  4NAX A;  3PPU A;  2YWM A;  1PFO A;  1GWC A;  4FIW A;  1DE2 A;  3U6V A;  2LKU A;  2F8F A;  2XPD A;  1T1V A;  5AIV A;  3CYN A;  3C71 A;  3M3M A;  2J9H A;  2WGR A;  1CQH A;  1M7T A;  4ZL9 A;  4JR4 A;  2A4H A;  3N5O A;  1TU8 A;  3IHQ A;  2DJK A;  1VF4 A;  2OJL A;  4ICY A;  1M99 A;  2HRK A;  1B9X C;  3VK9 A;  1FOV A;  3CQF A;  4EIQ A;  1A23 A;  3HCZ A;  2CX4 A;  3UBK A;  1X9W B;  3CXG A;  4TKY A;  4I8B A;  5DVB A;  2H19 A;  5IM9 A;  4OWY A;  4DSR A;  5ECN B;  4TR3 A;  4KGI A;  4GRF A;  4OMV A;  2L5O A;  3TKQ A;  3GL3 A;  1TDI A;  2VLT A;  1SL2 B;  1VF1 A;  3LW9 A;  5F07 A;  1GLP A;  1AQV A;  4ZBA A;  1A2L A;  1X9S B;  4TXV A;  4K0N A;  3R3E A;  2GVP A;  5ELA A;  2HYX A;  2LST A;  22GS A;  2JU5 A;  2WJU A;  3QR6 A;  1TK0 B;  2K8V A;  4RI7 A;  5J9B A;  3R2Q A;  3HKR A;  1ZYQ B;  3APQ A;  1M3I A;  4OFT A;  2GQK A;  2PGT A;  2REM A;  2H71 A;  2KHP A;  2YN1 A;  2LJR A;  4GSS A;  1XVQ A;  2GT5 A;  3J7Y k;  3APS A;  3DD3 A;  5HFG A;  3WGX A;  2R0P A;  3M8N A;  5DJM A;  4IJ3 A;  1TK5 B;  2X99 A;  4XS6 A;  13GS A;  5B8B A;  3F63 A;  5D73 A;  2VD0 A;  2G2Q A;  3QAW A;  1TI3 A;  2VL2 C;  4L5O A;  1XG8 A;  4PX1 A;  2VAF A;  4HU7 A;  4JR6 A;  4MPG A;  1JZO A;  3HXS A;  1XOA A;  2H66 A;  1MD4 A;  1QFN A;  2OKA A;  3L9S A;  4BL7 B;  7GSS A;  3VI7 A;  1GUK A;  1SJZ A;  1ZMA A;  2BJX A;  2OE1 A;  3CSI A;  1OE7 A;  4G0I A;  3LXT A;  3CSJ A;  3VFI A;  4KX4 A;  5ECR B;  4OD7 A;  2WRT A;  4J56 E;  4POB A;  3TKP A;  1XVW A;  2YZH A;  5IQY A;  1ZYN A;  2O8V B;  2H0I A;  2VO4 A;  2A2S A;  4KSO A;  3KH9 A;  19GS A;  1ZCP A;  4ZL8 A;  2R4V A;  1TRV A;  2E7P A;  3EU4 A;  4TRX A;  2DLX A;  1T00 A;  2K18 A;  2VUP A;  4JED A;  5IMA A;  1OC9 A;  4BIK A;  2WZ9 A;  3E3E A;  1ERW A;  5B8A A;  1RW1 A;  3PIN A;  5J41 A;  4MJA A;  3I69 A;  4DSS B;  2C3Q A;  1SL1 B;  3ZL5 A;  2IMI A;  3A2X A;  1B4Q A;  1FOH A;  5E59 A;  4MNN A;  1AAZ A;  4Q5N A;  3L9U A;  5CRE A;  2ALB A;  1OE8 A;  4NPB A;  4X1U A;  1EOG A;  4ECB A;  5FT3 A;  2B7K A;  1Z5Y E;  1GSD A;  2AHE A;  4YH2 A;  5G5F A;  4I2T A;  2VLV A;  3VPT A;  3C1R A;  4BWS A;  1BAY A;  3LYK A;  3ME7 A;  4JRR A;  3ED3 A;  4DEJ A;  5A4W A;  2QGV A;  2OAC A;  2F8A A;  3BCK A;  4PGT A;  3WD6 A;  3LFL A;  2GSS A;  4IS0 A;  4MCU A;  5ECL B;  3BOA A;  5HR3 A;  2VL9 A;  1M2D A;  3WGD A;  1THO A;  1FB0 A;  3FKF A;  2YOI A;  2C3N A;  3VWV A;  4KDU A;  3DEX A;  4GCI A;  1SK1 A;  4Z2R A;  2YWO A;  1HNB A;  2DIY A;  4JU5 A;  5EVO A;  1HD2 A;  4NV2 A;  1ILO A;  2H73 A;  5DAK A;  5ECK B;  2YJH A;  6GSW A;  3GUR A;  4FH8 A;  2UZ8 A;  2WUL A;  3DGQ A;  1EWX A;  2A2R A;  2IMF A;  1O73 A;  2R3X A;  4ML1 A;  2HLS A;  4N0V A;  4FYC A;  1O81 A;  1GSY A;  2C8U A;  4RUV A;  2E2G A;  1A0F A;  3GFK A;  5ELG A;  3ERF A;  3M0F A;  1TK8 B;  2I3Y A;  3RAZ A;  4MF5 A;  4KAE A;  4F9Z A;  3ZZX A;  3N9J A;  3JCM L;  2HFD A;  2ZCT A;  5D96 A;  4WF5 A;  3M9K A;  1ERV A;  3LJR A;  2YZU A;  2VCQ A;  5ID2 A;  1F3A A;  3TCO A;  1XW9 A;  1XWB A;  4NV5 A;  5DCH A;  1ZGN A;  1SJ6 A;  3L4N A;  1XW5 A;  1EP7 A;  2PBJ A;  3F6F A;  2B5Y A;  2M80 A;  2EIO A;  2MYG A;  1XPV A;  2ON7 A;  1LU4 A;  3FR9 A;  1G0T A;  3P7X A;  1H4O A;  3PH9 A;  1GNW A;  2JZR A;  3FEU A;  4XS1 A;  2NTO A;  1ON4 A;  5A4V A;  4PQI A;  5B6M A;  4JZQ A;  1M3J A;  3KMN A;  3TJF A;  3FZA A;  5KN3 A;  1DE1 A;  2HZE A;  4KA0 A;  4G0K A;  1GSE A;  1QGV A;  4MAB A;  4BVX A;  4MJE A;  2PN8 A;  5HFI A;  1SU9 A;  5IMF A;  2DJ1 A;  5AIS A;  4L0U A;  2IME A;  2KLX A;  1J0F A;  3KM6 A;  3F4T A;  4TOP A;  11GS A;  1R7H A;  1JZR A;  2YV9 A;  4TR1 A;  2X8C A;  3UMA A;  2CVB A;  1FHE A;  3ERW A;  1U3I A;  3DRN A;  4BWQ A;  3CRU A;  3BD2 A;  1K3Y A;  20GS A;  4WXT A;  1TI1 A;  2VCZ A;  3F0I A;  3GA4 A;  2LRN A;  5HFK A;  3WYW A;  1NHY A;  1TTZ A;  3GMF A;  1HNC A;  3VI5 A;  3GKX A;  2FA4 A;  3EYT A;  4XCS A;  2G0F A;  1O7U A;  5F0G A;  1TW9 A;  3HVX A;  3HJM A;  3GH6 A;  4CY8 A;  4LA1 A;  2PVO C;  3LOR A;  4GLT A;  4ECJ A;  1S3D A;  3FW2 A;  1XWC A;  3QOU A;  4IEL A;  2B3S A;  4WR4 A;  1HYU A;  1O8W A;  4AGS A;  2YNX A;  3EU3 A;  2DJ2 A;  4KDY A;  3UAP A;  1K0N A;  4GSN A;  2DJ0 A;  3W8J A;  1TKD B;  1V2A A;  1SL0 B;  3GX8 A;  1SKR B;  1FG4 A;  3Q74 A;  5IOX A;  5ECM B;  2V1M A;  1Y25 A;  1PMT A;  4GST A;  4O32 A;  5CYY A;  2QC7 A;  1XW6 A;  1FO5 A;  3D6I A;  2ES7 A;  4OCE A;  2CT6 A;  5E4W A;  5ECQ B;  1QQ2 A;  8GSS A;  2JZS A;  1V98 A;  2R6K A;  1CQG A;  3GN3 A;  5A5K A;  1EGO A;  1X5E A;  3GNJ A;  4EIP A;  2K8S A;  1K3O A;  1U87 A;  1AQW A;  3C1S A;  4XTS A;  4G0L A;  1E6B A;  3MSZ A;  4K0G A;  2HRF A;  5J3R A;  1WPI A;  3O76 A;  5DJL A;  5HQP A;  1O85 A;  2HRA A;  1FB6 A;  4N30 A;  2HZF A;  2GST A;  1THX A;  4IQA A;  3TKS C;  2JSY A;  2MMO A;  2GQM A;  4MZC A;  1O8X A;  2VCW A;  3P2A A;  4V1A p;  2GLR A;  1TOF A;  2DJ3 A;  3GRX A;  1OC9 B;  4OCF A;  3TRQ A;  1TP9 A;  4HEA 2;  2PU9 C;  1Q4J A;  4MH3 A;  5KN1 A;  3MAK A;  1EEM A;  1E2Y A;  4ID0 A;  1ST9 A;  4HJ2 A;  2VM2 A;  2LEG A;  1XXU A;  4WBR D;  2VCX A;  2RUE A;  4D73 A;  1YJ6 A;  5GAP D;  3KCM A;  2I1U A;  1JZD A;  4POM A;  4KH7 A;  2R0C A;  4OFN A;  2KOK A;  1WE0 A;  1R5P A;  2WB9 A;  5CRH A;  3LYP A;  1JFU A;  2FWF A;  2MMN A;  4PQH A;  4AJ8 A;  4ML6 A;  4PTS A;  3RBT A;  3UEM A;  4KB3 A;  2LQO A;  4RQX A;  5LCZ A;  2B5X A;  2EIR A;  5CRW A;  1GTI A;  3C7M A;  5JCG A;  4HDE A;  2C0G A;  2RLI A;  1PRX A;  2JL4 A;  4H86 A;  1RQM A;  4KW6 A;  4EUY A;  1G7O A;  2QA1 A;  4GTU A;  4K7O A;  4CY6 A;  4XS4 A;  3GHA A;  1EEJ A;  6GSX A;  2AUV A;  4ISD A;  4ZIL A;  1GLQ A;  1O6J A;  4IVF A;  4P3Y B;  1KEB A;  5CP1 A;  1WIK A;  1A24 A;  4YKG A;  3HDC A;  3IV4 A;  2P31 A;  3ZYW A;  1I5G A;  3IR4 A;  2R5G A;  2HRN A;  2OAD A;  2KP2 A;  5DAK B;  4Q5Q A;  3UBL A;  2AV4 A;  2HSH A;  2H1A A;  3LEF A;  4O5R A;  3HVV A;  4NWY A;  1Z3E A;  2FWG A;  5G2Z A;  2J23 A;  1PSQ A;  1M0U A;  3DKS A;  2WS2 A;  2TIR A;  2LQQ A;  3VUR A;  3KP8 A;  4IW9 A;  1XFL A;  4IP1 A;  1FW1 A;  2PUK C;  2R37 A;  1V9W A;  4JE1 A;  5KN2 A;  1Y6E A;  2IL3 A;  1PGT A;  1XCC A;  2H0H A;  2CX3 A;  4ZBD A;  3FZ4 A;  2R0G A;  3FYG A;  3KGK A;  2IIY A;  3D21 A;  2LJK A;  4ZL7 A;  4PNG A;  5ID2 B;  5J4U A;  2CV4 A;  4Z2T A;  3HYP A;  1UVZ A;  4E8H A;  4O7H A;  1C72 A;  1X5D A;  1GUM A;  2O85 A;  4ZXG A;  5JWO B;  5KN0 A;  4YQU A;  2C4J A;  4KCA A;  3F8U A;  3ZIV A;  4I6X A;  2C0E A;  3GKN A;  5C04 A;  2C1Y A;  1S3A A;  4GQC A;  2GQL A;  1A2M A;  4Z2U A;  5G5E A;  1LBK A;  1BED A;  6GSS A;  1QMV A;  2QKE A;  2L57 A;  1YEX A;  2HZE B;  4K9Z A;  4BVX B;  3FY7 A;  4IBP A;  4OO4 A;  1SKS B;  4N11 A;  3TJG A;  4AF2 A;  3TJJ A;  4TR1 B;  3DML A;  4YKF A;  1PKZ A;  1S3C A;  1K3L A;  4L0W A;  5CO3 A;  5KEJ A;  1GTB A;  3A2V A;  4X0X A;  4L8E A;  1NM3 A;  2H01 A;  3ERG A;  5JWQ B;  3TGZ A;  3ZFB A;  2AYT A;  2IPA A;  4NMU A;  1HQO A;  3A2W A;  3LWA A;  3UOM A;  5AN1 A;  1TRU A;  4HJM A;  5DCG A;  2GS3 A;  3TKS A;  3PR8 A;  5EPF A;  2YPM A;  2YP6 A;  2DC5 A;  3AY8 A;  1NSW A;  5JWR B;  5B7C A;  1MD3 A;  5ECO B;  3D22 A;  2LRC A;  2X8G A;  3EC3 A;  4NHZ A;  3F3Q A;  4ZB6 A;  1K0C A;  3BBY A;  5AGY A;  2CAQ A;  3FHK A;  1B8X A;  1OKD A;  3EMP A;  4L5L A;  4J57 E;  1U6T A;  2JSZ A;  3TRX A;  4ZB9 A;  3TOT A;  1OVN A;  4OFM A;  5GSS A;  4MF7 A;  4Q5F A;  3WT2 A;  3EE2 A;  3EIN A;  2MMZ A;  4X43 A;  5D9T A;  3KEB A;  5ECP B;  3G7Y A;  4TVE A;  3H4K A;  5FHI A;  1ZZY A;  1Q98 A;  6GST A;  3QFA C;  5IMZ A;  2QA2 A;  1H75 A;  2WFC A;  3ZMK A;  3A5W A;  1FVJ A;  1ZYE A;  5H5S A;  2O87 A;  2V2G A;  1PL2 A;  2YWI A;  1G6Y A;  1VGL A;  2KP1 A;  4E8E A;  1SKW B;  3EMX A;  5H5Q A;  2P5Q A;  2HSM A;  5LNK e;  3IK9 A;  3EVI A;  4ACS A;  2K9F A;  2H72 A;  4MK3 A;  2IWT A;  3VPQ A;  2E2M A;  3P8W A;  3GKM A;  2GGT A;  3IPZ A;  3IBH A;  4F0C A;  1RK4 A;  1Z6M A;  2E0Q A;  5JCW A;  4IQ1 A;  4EKZ A;  1OC8 A;  1T4Z A;  3MDK A;  2DKH A;  1YKA A;  3IK7 A;  3P90 A;  3GYK A;  3TKR A;  3SWL A;  3G7J A;  3HZ8 A;  3H93 A;  3WT1 A;  5ENU A;  1VRS D;  3RDW A;  1YEP A;  3RPP A;  4K8M A;  3KTB A;  4D73 B;  1ZL9 A;  2Z9S A;  2B5E A;  4DSQ A;  5EY6 A;  1JLV A;  2H8L A;  3PGT A;  3VWX A;  2C0D A;  1EGR A;  2MBS A;  4I5Q A;  3W6G A;  2IMK A;  1AC1 A;  3IXR A;  3I43 A;  1G7E A;  2VL2 A;  3DWV A;  5KOX A;  1K0B A;  2P0G A;  3C73 A;  4ECI A;  1X5C A;  2L6D A;  4YAP A;  1K0D A;  2PMT A;  2DIZ A;  4XS4 B;  2JAD A;  3IHG A;  4PXO A;  2RUF A;  3IE3 A;  1WMJ A;  4EDZ A;  5L71 A;  4LMV A;  3CBU A;  4HOJ A;  4F82 A;  1Z6N A;  2NVL A;  1YF1 A;  2NPB A;  4PQ1 A;  3UVT A;  2CAI A;  2RII A;  1WWJ A;  3QAG A;  3ZTL A;  1R5A A;  2CQ9 A;  1ZYP A;  3L9V A;  2KUC A;  1X9M B;  1GL8 A;  4IJI A;  12GS A;  1YF0 A;  4WEY A;  1U3A A;  3TUE A;  4XRD A;  2OBK A;  2XPE A;  5ABR A;  2ZUP A;  2GZY A;  4MJC A;  4IGJ A;  1GSQ A;  1XWA A;  2IFQ A;  1K0M A;  3LSZ A;  4HS1 A;  4K7N A;  4GQF A;  2B1L A;  2M72 A;  3UAR A;  4YAV A;  3RPN A;  1F3B A;  1KNG A;  1YY7 A;  2V32 A;  3QFB C;  2F3M A;  1GUL A;  4BVY A;  4MA9 A;  5IPH A;  4LL1 B;  4MF6 A;  4FYB A;  1KTE A;  4MDC A;  3GST A;  1AW9 A;  1GTU A;  2BMX A;  3FK8 A;  4WF4 A;  2GT6 A;  5BRT A;  1GUH A;  2DJJ A;  1DSB A;  4HQS A;  5GST A;  4HUA A;  1T7P B;  3F6D A;  4WR5 A;  3TDG A;  4QL7 A;  5C00 A;  2FA8 A;  2C0F A;  1VF3 A;  6GSV A;  1I9D A;  1XWG A;  5DBQ A;  1B9Y C;  3IAM 2;  5D9V A;  4I97 A;  5G1L A;  2L59 A;  1GSU A;  3FR3 A;  1GH2 A;  2XC2 A;  2X8H A;  5A4U A;  1V57 A;  2O89 A;  3KH7 A;  4V2M A;  2H75 A;  3H79 A;  4MZW A;  4A5P A;  3FMW A;  4ZB8 A;  1KBN A;  3KTL A;  3E0U A;  3GTU A;  2GZZ A;  3IRA A;  1T8E B;  9GSS A;  2YWN A;  5DQS A;  1MDI A;  3FZ5 A;  2CA8 A;  4HI7 A;  2VCT A;  4EVM A;  3F4S A;  3H8Q A;  1WRY A;  1M9A A;  3LGC A;  2FGX A;  3M9J A;  3ZRE A;  2H70 A;  4F0B A;  1R26 A;  5ECS A;  2H76 A;  2PPT A;  2A2P A;  2VOC A;  3UJ1 A;  2LV3 A;  4BPY A;  4TXO A;  3MIX A;  1TRW A;  4WBJ A;  2HI7 A;  2AJQ B;  4POK A;  2VL3 A;  3G9B A;  3M1G A;  5IMV A;  2H74 A;  4AJ7 A;  3QMX A;  2YJ7 A;  3Q18 A;  2WCI A;  5GZZ B;  2L5L A;  1PA3 A;  3IOS A;  1BX9 A;  1N2A A;  5AIX A;  1AQX A;  1QXH A;  4CW9 A;  1K0O A;  3W8S A;  5HR1 A;  2FWE A;  3HZ4 A;  2H1D A;  1PX6 A;  4GWR A;  3GL5 A;  4G9H A;  6GSU A;  1UN2 A;  3HA9 A;  3QD9 A;  1EOH A;  1OC3 A;  17GS A;  1AIU A;  5COH A;  3OR5 A;  5F06 A;  4DVC A;  3MNG A;  1BYE A;  3DVW A;  2F51 A;  2I81 A;  3HJP A;  2EC4 A;  3DXB A;  3FR6 A;  3ZVJ D;  1LJR A;  3DVX A;  3GH9 A;  2YV7 A;  3Q6O A;  5BMU A;  1BQ7 A;  1A8L A;  3ZLP A;  3LG6 A;  2X49 A;  4EO3 A;  4Q5R A;  1AXD A;  4IN0 A;  3HY2 A;  2F9S A;  1IYI A;  2WDU A;  2NBS A;  2VD1 A;  5DAL A;  1N8J A;  2HXK A;  1MEK A;  1F6M C;  2AAW A;  2LUS A;  1EV9 A;  4MMM A;  4MLY A;  3ZIJ A;  4WKW A;  4V2L A;  2FWH A;  3NIV A;  5CNW A;  4BA7 A;  1XZO A;  3QAV A;  1BG5 A;  14GS A;  1Z7R A;  1NHO A;  3TKS E;  1PD2 1;  3IA1 A;  3KJY A;  1MTC A;  1WP0 A;  5IMD A;  4Z7X A;  2PWJ A;  2EIQ A;  2MBT A;  5IO2 A;  3I6A A;  1IYH A;  2GDR A;  2GZP A;  4K5R A;  1JLW A;  4EXJ A;  5D93 A;  2OA7 A;  4PUR A;  5G31 A;  1TXX A;  4V2N A;  1W4V A;  1DBY A;  2NDO A;  5G1K A;  1ZOF A;  2D2Z A;  5CRD A;  4XRA A;  3C8E A;  2OE3 A;  3UVH A;  1OAZ A;  4JBB A;  4TR0 A;  4KF9 A;  2L6C A;  4KND A;  4XIH A;  4HZ4 A;  1GP1 A;  1FVK A;  4TN8 A;  3I9V 2;  5IO0 A;  3ZFL A;  2QSI A;  1UC7 A;  4N0Z A;  4ECC A;  3TJK A;  4NHW A;  3F9U A;  4EF0 A;  3ME8 A;  3A3T A;  4G10 A;  4NXI A;  5KOW A;  5INY A;  2CZ3 A;  6GSY A;  3IC4 A;  1JZW A;  4USS A;  4QL9 A;  2VCV A;  2DSA A;  3QDN A;  1XWK A;  3V1W A;  1V40 A;  4IP6 A;  3RHB A;  2CZ2 A;  1ERT A;  1PX7 A;  1YKC A;  2HNL A;  4MH2 A;  4HZ2 A;  4GXZ A;  4EC0 A;  1XBS A;  3VWU A;  2XHF A;  18GS A;  3GV1 A;  1EV4 A;  4HQZ A;  1TJD A;  2L4C A;  3O6T A;  2IN3 A;  1B48 A;  5GAN D;  2I9H A;  5HR0 A;  1PN0 A;  3BCI A;  3CMI A;  4K7I A;  4PUF C;  2IFQ B;  2B6M A;  2FD3 A;  1A2J A;  2M46 A;  4X4J A;  3QCP A;  2RM5 A;  5D9X A;  5D8I A;  2N5B A;  2ZNM A;  4XHM A;  2L4Q A;  5D9W A;  2C3T A;  3QPM A;  1F37 A;  2H1G A;  3TJB A;  2A4V A;  3FRC A;  4PUA A;  1M9B A;  2FUG 2;  2JZT A;  4BVY B;  4WET A;  4POL A;  1Z7P A;  4K5S A;  3BJ5 A;  3VLN A;  3HHV A;  2RM6 A;  2CVD A;  2FY6 A;  2FNO A;  1SYR A;  2K6V A;  1GSS A;  1G6W A;  4KE3 A;  5ECI B;  1TRS A;  4EL1 A;  4OO5 A;  1SD8 A;  2H0G A;  1WOU A;  2GSQ A;  2OBI A;  4O5Q A;  2V6K A;  3KP9 A;  4F2I A;  4ILF A;  1GSF A;  1M2B A;  1SK0 A;  3L78 A;  4J2F A;  4MZB A;  4GF0 A;  1T3B A;  4HU9 A;  5CRG A;  2H6X A;  4KCE A;  2MZC A;  2DBC A;  1DUG A;  2R2J A;  1OYJ A;  2H1B A;  1SD9 A;  2V6O A;  2B7J A;  1PKW A;  3GTU B;  3GX0 A;  4KDX A;  3HVS A;  2ON5 A;  3IAS 2;  4EDY A;  3HVN A;  2GSR A;  4I2U A;  3Q19 A;  3FZ9 A;  3ISO A;  4ULX A;  3H1N A;  4K2X A;  4K2D A;  5J5N A;  3ZVJ A;  3NOF A;  2XBI A;  5J9C A;  3J7Y b;  3O3T A;  3VWW A;  3IC8 A;  4TXO B;  4MP4 A;  1R4W A;  5DQY A;  4TR4 A;  1NW2 A;  4TW5 A;  1F9M A;  3U5R E;  5CAX A;  2HSY A;  2DML A;  3CSH A;  2LS5 A;  2YCD A;  3GKK A;  4LLR A;  3K8N A;  4EE0 A;  4ZBB A;  1USB A;  2FLS A;  1GNE A;  2DKI A;  1W89 A;  16GS A;  3ZML A;  2IJY A;  5JCU A;  2CVK A;  1VF2 A; 
#chains in the Genus database with same CATH homology
 1ML6 A;  3F3R A;  2X64 A;  3ZIT A;  1ACV A;  2OE0 A;  4LMW A;  4FQU A;  2TRC P;  3S9F A;  3EPT A;  3F4R A;  3RHC A;  3D5J A;  2JAC A;  3CTG A;  4BL7 A;  1SJI A;  4FO5 A;  2H6Z A;  2I4A A;  1T4Y A;  1K0A A;  1ERU A;  4QQ7 A;  5EL8 A;  4CDO A;  1YDK A;  3KMO A;  3UIW A;  3DYR A;  5IMC A;  3US3 A;  1EZK A;  4F03 A;  1PQN A;  3D4T A;  2LNS A;  5B6N A;  2FCH A;  3G7I A;  4O92 A;  3LXZ A;  3LQ7 A;  2N5A A;  5F8B A;  1WJK A;  3WGE A;  4PNF A;  2N5F A;  1OKT A;  5IOW A;  3HJO A;  5DAL B;  3KZQ A;  4IHU A;  3D0Z A;  2O7K A;  1GRX A;  4K1F A;  2AB6 A;  4MPF A;  4KSM A;  3GUS A;  1B4P A;  3UL3 A;  1SK2 A;  2V41 A;  1A8Y A;  3KD0 A;  4G2E A;  4O5U A;  1M2A A;  4DSS A;  3NZN A;  3L0H A;  5G30 A;  1PN9 A;  2FHE A;  4YQV A;  2YAN A;  4G19 A;  1X0R A;  3EWL A;  2LJA A;  5ECH B;  3GIX A;  3KXO A;  1EP8 A;  2BTO T;  2HT9 A;  4RI6 A;  4V1A g;  1XIY A;  4ZIJ A;  3CRT A;  4CHS A;  2HE3 A;  5HR2 A;  10GS A;  2LRT A;  4KUN A;  4IKH A;  2H30 A;  1MDK A;  5DDL A;  3ZRD A;  3E9J B;  1XOB A;  1J9B A;  2P5R A;  2X4A A;  5IPG A;  1YQ1 A;  2TRX A;  1YZX A;  2GTU A;  4K6X A;  2LNT A;  5F05 A;  1UA5 A;  2C80 A;  1GTA A;  2PER A;  1BJX A;  2XBQ A;  2MMA A;  1TU7 A;  3CTF A;  3APO A;  3TB2 A;  1FAA A;  3EUR A;  3HD5 A;  1MDJ A;  1ABA A;  1F2E A;  2IMD A;  4LL4 B;  1JHB A;  2DMM A;  5FWG A;  3DIE A;  1QK8 A;  5H5R A;  2VIM A;  3IDV A;  1QUW A;  1A0R P;  3GSS A;  1AUC A;  2PVQ A;  1U88 A;  3TOU A;  5LD0 A;  3KIJ A;  4N10 A;  1SYX A;  5IIZ A;  2VLU A;  3SBC A;  2LTK A;  4FYU A;  1PL1 A;  4RQR A;  1V58 A;  4MJB A;  3D4M A;  4YQM A;  2VM1 A;  1SEN A;  3MWH A;  1URM A;  4AJ6 A;  1Z9H A;  3MYD A;  2B1K A;  2H6Y A;  1HNA A;  3TRP A;  3A5I A;  1J08 A;  4NAX A;  3PPU A;  2YWM A;  1GWC A;  4FIW A;  1DE2 A;  3U6V A;  2LKU A;  2F8F A;  2XPD A;  1T1V A;  5AIV A;  3CYN A;  3C71 A;  3M3M A;  2J9H A;  2WGR A;  1CQH A;  1M7T A;  4ZL9 A;  4JR4 A;  2A4H A;  3N5O A;  1TU8 A;  3IHQ A;  2DJK A;  1VF4 A;  2OJL A;  4ICY A;  1M99 A;  2HRK A;  1B9X C;  3VK9 A;  1FOV A;  4EIQ A;  1A23 A;  3HCZ A;  2CX4 A;  3UBK A;  1X9W B;  3CXG A;  4TKY A;  4I8B A;  5DVB A;  2H19 A;  5IM9 A;  4OWY A;  4DSR A;  5ECN B;  4TR3 A;  4KGI A;  4GRF A;  4OMV A;  2L5O A;  3TKQ A;  3GL3 A;  1TDI A;  2VLT A;  1SL2 B;  1VF1 A;  3LW9 A;  5F07 A;  1GLP A;  1AQV A;  4ZBA A;  1A2L A;  1X9S B;  4TXV A;  4K0N A;  3R3E A;  2GVP A;  5ELA A;  2HYX A;  2LST A;  22GS A;  2JU5 A;  2WJU A;  3QR6 A;  1TK0 B;  2K8V A;  4RI7 A;  5J9B A;  3R2Q A;  3HKR A;  1ZYQ B;  3APQ A;  4OFT A;  2GQK A;  2PGT A;  2REM A;  2H71 A;  2KHP A;  2YN1 A;  2LJR A;  4GSS A;  1XVQ A;  2GT5 A;  3J7Y k;  3APS A;  3DD3 A;  5HFG A;  3WGX A;  2R0P A;  3M8N A;  5DJM A;  4IJ3 A;  1TK5 B;  2X99 A;  4XS6 A;  13GS A;  5B8B A;  3F63 A;  5D73 A;  2VD0 A;  2G2Q A;  3QAW A;  1TI3 A;  2VL2 C;  4L5O A;  4PX1 A;  2VAF A;  4HU7 A;  4JR6 A;  4MPG A;  1JZO A;  3HXS A;  1XOA A;  2H66 A;  1MD4 A;  1QFN A;  2OKA A;  3L9S A;  4BL7 B;  7GSS A;  3VI7 A;  1GUK A;  1SJZ A;  1ZMA A;  2BJX A;  2OE1 A;  3CSI A;  1OE7 A;  4G0I A;  3LXT A;  3CSJ A;  3VFI A;  4KX4 A;  5ECR B;  4OD7 A;  2WRT A;  4J56 E;  4POB A;  3TKP A;  1XVW A;  2YZH A;  5IQY A;  1ZYN A;  2O8V B;  2H0I A;  2VO4 A;  2A2S A;  4KSO A;  3KH9 A;  19GS A;  1ZCP A;  4ZL8 A;  2R4V A;  1TRV A;  2E7P A;  3EU4 A;  4TRX A;  2DLX A;  1T00 A;  2K18 A;  2VUP A;  4JED A;  5IMA A;  1OC9 A;  2WZ9 A;  3E3E A;  1ERW A;  5B8A A;  1RW1 A;  3PIN A;  5J41 A;  4MJA A;  3I69 A;  4DSS B;  2C3Q A;  1SL1 B;  3ZL5 A;  2IMI A;  3A2X A;  1B4Q A;  1FOH A;  5E59 A;  4MNN A;  1AAZ A;  4Q5N A;  3L9U A;  5CRE A;  2ALB A;  1OE8 A;  4NPB A;  4X1U A;  1EOG A;  4ECB A;  5FT3 A;  2B7K A;  1Z5Y E;  1GSD A;  2AHE A;  4YH2 A;  5G5F A;  4I2T A;  2VLV A;  3VPT A;  3C1R A;  4BWS A;  1BAY A;  3LYK A;  3ME7 A;  4JRR A;  3ED3 A;  4DEJ A;  5A4W A;  2QGV A;  2OAC A;  2F8A A;  3BCK A;  4PGT A;  3WD6 A;  3LFL A;  2GSS A;  4IS0 A;  4MCU A;  5ECL B;  3BOA A;  5HR3 A;  2VL9 A;  1M2D A;  3WGD A;  1THO A;  1FB0 A;  3FKF A;  2YOI A;  2C3N A;  3VWV A;  4KDU A;  3DEX A;  4GCI A;  1SK1 A;  4Z2R A;  2YWO A;  1HNB A;  2DIY A;  4JU5 A;  5EVO A;  1HD2 A;  4NV2 A;  1ILO A;  2H73 A;  5DAK A;  5ECK B;  2YJH A;  6GSW A;  3GUR A;  4FH8 A;  2UZ8 A;  2WUL A;  3DGQ A;  1EWX A;  2A2R A;  2IMF A;  1O73 A;  2R3X A;  4ML1 A;  2HLS A;  4N0V A;  4FYC A;  1O81 A;  1GSY A;  2C8U A;  4RUV A;  2E2G A;  1A0F A;  3GFK A;  5ELG A;  3ERF A;  3M0F A;  1TK8 B;  2I3Y A;  3RAZ A;  4MF5 A;  4KAE A;  4F9Z A;  3ZZX A;  3N9J A;  3JCM L;  2HFD A;  2ZCT A;  5D96 A;  4WF5 A;  3M9K A;  1ERV A;  3LJR A;  2YZU A;  2VCQ A;  5ID2 A;  1F3A A;  3TCO A;  1XW9 A;  1XWB A;  4NV5 A;  5DCH A;  1ZGN A;  1SJ6 A;  3L4N A;  1XW5 A;  1EP7 A;  2PBJ A;  3F6F A;  2B5Y A;  2M80 A;  2EIO A;  2MYG A;  1XPV A;  2ON7 A;  1LU4 A;  3FR9 A;  1G0T A;  3P7X A;  1H4O A;  3PH9 A;  1GNW A;  2JZR A;  3FEU A;  4XS1 A;  2NTO A;  1ON4 A;  5A4V A;  4PQI A;  5B6M A;  4JZQ A;  3KMN A;  3TJF A;  3FZA A;  5KN3 A;  1DE1 A;  2HZE A;  4KA0 A;  4G0K A;  1GSE A;  1QGV A;  4MAB A;  4BVX A;  4MJE A;  2PN8 A;  5HFI A;  1SU9 A;  5IMF A;  2DJ1 A;  5AIS A;  4L0U A;  2IME A;  2KLX A;  1J0F A;  3KM6 A;  3F4T A;  4TOP A;  11GS A;  1R7H A;  1JZR A;  2YV9 A;  4TR1 A;  2X8C A;  3UMA A;  2CVB A;  1FHE A;  3ERW A;  1U3I A;  3DRN A;  4BWQ A;  3CRU A;  3BD2 A;  1K3Y A;  20GS A;  4WXT A;  1TI1 A;  2VCZ A;  3F0I A;  3GA4 A;  2LRN A;  5HFK A;  3WYW A;  1NHY A;  1TTZ A;  3GMF A;  1HNC A;  3VI5 A;  3GKX A;  2FA4 A;  3EYT A;  4XCS A;  2G0F A;  1O7U A;  5F0G A;  1TW9 A;  3HVX A;  3HJM A;  3GH6 A;  4CY8 A;  4LA1 A;  2PVO C;  3LOR A;  4GLT A;  4ECJ A;  1S3D A;  3FW2 A;  1XWC A;  3QOU A;  4IEL A;  2B3S A;  4WR4 A;  1HYU A;  1O8W A;  4AGS A;  2YNX A;  3EU3 A;  2DJ2 A;  4KDY A;  3UAP A;  1K0N A;  4GSN A;  2DJ0 A;  3W8J A;  1TKD B;  1V2A A;  1SL0 B;  3GX8 A;  1SKR B;  1FG4 A;  3Q74 A;  5IOX A;  5ECM B;  2V1M A;  1Y25 A;  1PMT A;  4GST A;  4O32 A;  5CYY A;  2QC7 A;  1XW6 A;  1FO5 A;  3D6I A;  2ES7 A;  4OCE A;  2CT6 A;  5E4W A;  5ECQ B;  1QQ2 A;  8GSS A;  2JZS A;  1V98 A;  2R6K A;  1CQG A;  3GN3 A;  5A5K A;  1EGO A;  1X5E A;  3GNJ A;  4EIP A;  2K8S A;  1K3O A;  1U87 A;  1AQW A;  3C1S A;  4XTS A;  4G0L A;  1E6B A;  3MSZ A;  4K0G A;  2HRF A;  5J3R A;  1WPI A;  3O76 A;  5DJL A;  5HQP A;  1O85 A;  2HRA A;  1FB6 A;  4N30 A;  2HZF A;  2GST A;  1THX A;  4IQA A;  3TKS C;  2JSY A;  2MMO A;  2GQM A;  4MZC A;  1O8X A;  2VCW A;  3P2A A;  4V1A p;  2GLR A;  1TOF A;  2DJ3 A;  3GRX A;  1OC9 B;  4OCF A;  3TRQ A;  1TP9 A;  4HEA 2;  2PU9 C;  1Q4J A;  4MH3 A;  5KN1 A;  3MAK A;  1EEM A;  1E2Y A;  4ID0 A;  1ST9 A;  4HJ2 A;  2VM2 A;  2LEG A;  1XXU A;  4WBR D;  2VCX A;  2RUE A;  4D73 A;  1YJ6 A;  5GAP D;  3KCM A;  2I1U A;  1JZD A;  4POM A;  4KH7 A;  2R0C A;  4OFN A;  2KOK A;  1WE0 A;  1R5P A;  2WB9 A;  5CRH A;  3LYP A;  1JFU A;  2FWF A;  2MMN A;  4PQH A;  4AJ8 A;  4ML6 A;  4PTS A;  3RBT A;  3UEM A;  4KB3 A;  2LQO A;  4RQX A;  5LCZ A;  2B5X A;  2EIR A;  5CRW A;  1GTI A;  3C7M A;  5JCG A;  4HDE A;  2C0G A;  2RLI A;  1PRX A;  2JL4 A;  4H86 A;  1RQM A;  4KW6 A;  4EUY A;  1G7O A;  2QA1 A;  4GTU A;  4K7O A;  4CY6 A;  4XS4 A;  3GHA A;  1EEJ A;  6GSX A;  2AUV A;  4ISD A;  4ZIL A;  1GLQ A;  1O6J A;  4IVF A;  4P3Y B;  1KEB A;  5CP1 A;  1WIK A;  1A24 A;  4YKG A;  3HDC A;  3IV4 A;  2P31 A;  3ZYW A;  1I5G A;  3IR4 A;  2R5G A;  2HRN A;  2OAD A;  2KP2 A;  5DAK B;  4Q5Q A;  3UBL A;  2AV4 A;  2HSH A;  2H1A A;  3LEF A;  4O5R A;  3HVV A;  4NWY A;  1Z3E A;  2FWG A;  5G2Z A;  2J23 A;  1PSQ A;  1M0U A;  3DKS A;  2WS2 A;  2TIR A;  2LQQ A;  3VUR A;  3KP8 A;  4IW9 A;  1XFL A;  4IP1 A;  1FW1 A;  2PUK C;  2R37 A;  1V9W A;  4JE1 A;  5KN2 A;  1Y6E A;  2IL3 A;  1PGT A;  1XCC A;  2H0H A;  2CX3 A;  4ZBD A;  3FZ4 A;  2R0G A;  3FYG A;  3KGK A;  2IIY A;  3D21 A;  2LJK A;  4ZL7 A;  4PNG A;  5ID2 B;  5J4U A;  2CV4 A;  4Z2T A;  3HYP A;  1UVZ A;  4E8H A;  4O7H A;  1C72 A;  1X5D A;  1GUM A;  2O85 A;  4ZXG A;  5JWO B;  5KN0 A;  4YQU A;  2C4J A;  4KCA A;  3F8U A;  3ZIV A;  4I6X A;  2C0E A;  3GKN A;  5C04 A;  2C1Y A;  1S3A A;  4GQC A;  2GQL A;  1A2M A;  4Z2U A;  5G5E A;  1LBK A;  1BED A;  6GSS A;  1QMV A;  2QKE A;  2L57 A;  1YEX A;  2HZE B;  4K9Z A;  4BVX B;  3FY7 A;  4IBP A;  4OO4 A;  1SKS B;  4N11 A;  3TJG A;  4AF2 A;  3TJJ A;  4TR1 B;  3DML A;  4YKF A;  1PKZ A;  1S3C A;  1K3L A;  4L0W A;  5CO3 A;  5KEJ A;  1GTB A;  3A2V A;  4X0X A;  4L8E A;  1NM3 A;  2H01 A;  3ERG A;  5JWQ B;  3TGZ A;  3ZFB A;  2AYT A;  2IPA A;  4NMU A;  1HQO A;  3A2W A;  3LWA A;  3UOM A;  5AN1 A;  1TRU A;  4HJM A;  5DCG A;  2GS3 A;  3TKS A;  3PR8 A;  5EPF A;  2YPM A;  2YP6 A;  2DC5 A;  3AY8 A;  1NSW A;  5JWR B;  5B7C A;  1MD3 A;  5ECO B;  3D22 A;  2LRC A;  2X8G A;  3EC3 A;  4NHZ A;  3F3Q A;  4ZB6 A;  1K0C A;  3BBY A;  5AGY A;  2CAQ A;  3FHK A;  1B8X A;  1OKD A;  3EMP A;  4L5L A;  4J57 E;  1U6T A;  2JSZ A;  3TRX A;  4ZB9 A;  3TOT A;  1OVN A;  4OFM A;  5GSS A;  4MF7 A;  4Q5F A;  3WT2 A;  3EE2 A;  3EIN A;  2MMZ A;  4X43 A;  5D9T A;  3KEB A;  5ECP B;  3G7Y A;  4TVE A;  3H4K A;  5FHI A;  1ZZY A;  1Q98 A;  6GST A;  3QFA C;  5IMZ A;  2QA2 A;  1H75 A;  2WFC A;  3ZMK A;  3A5W A;  1FVJ A;  1ZYE A;  5H5S A;  2O87 A;  2V2G A;  1PL2 A;  2YWI A;  1G6Y A;  1VGL A;  2KP1 A;  4E8E A;  1SKW B;  3EMX A;  5H5Q A;  2P5Q A;  2HSM A;  5LNK e;  3IK9 A;  3EVI A;  4ACS A;  2K9F A;  2H72 A;  4MK3 A;  2IWT A;  3VPQ A;  2E2M A;  3P8W A;  3GKM A;  2GGT A;  3IPZ A;  3IBH A;  4F0C A;  1RK4 A;  1Z6M A;  2E0Q A;  5JCW A;  4IQ1 A;  4EKZ A;  1OC8 A;  1T4Z A;  3MDK A;  2DKH A;  1YKA A;  3IK7 A;  3P90 A;  3GYK A;  3TKR A;  3SWL A;  3G7J A;  3HZ8 A;  3H93 A;  3WT1 A;  5ENU A;  1VRS D;  3RDW A;  1YEP A;  3RPP A;  4K8M A;  3KTB A;  4D73 B;  1ZL9 A;  2Z9S A;  2B5E A;  4DSQ A;  5EY6 A;  1JLV A;  2H8L A;  3PGT A;  3VWX A;  2C0D A;  1EGR A;  2MBS A;  4I5Q A;  3W6G A;  2IMK A;  1AC1 A;  3IXR A;  3I43 A;  1G7E A;  2VL2 A;  3DWV A;  5KOX A;  1K0B A;  2P0G A;  3C73 A;  4ECI A;  1X5C A;  2L6D A;  4YAP A;  1K0D A;  2PMT A;  2DIZ A;  4XS4 B;  2JAD A;  3IHG A;  4PXO A;  2RUF A;  3IE3 A;  1WMJ A;  4EDZ A;  5L71 A;  4LMV A;  3CBU A;  4HOJ A;  4F82 A;  1Z6N A;  2NVL A;  1YF1 A;  2NPB A;  4PQ1 A;  3UVT A;  2CAI A;  2RII A;  1WWJ A;  3QAG A;  3ZTL A;  1R5A A;  2CQ9 A;  1ZYP A;  3L9V A;  2KUC A;  1X9M B;  1GL8 A;  4IJI A;  12GS A;  1YF0 A;  4WEY A;  1U3A A;  3TUE A;  4XRD A;  2OBK A;  2XPE A;  5ABR A;  2ZUP A;  2GZY A;  4MJC A;  4IGJ A;  1GSQ A;  1XWA A;  2IFQ A;  1K0M A;  3LSZ A;  4HS1 A;  4K7N A;  4GQF A;  2B1L A;  2M72 A;  3UAR A;  4YAV A;  3RPN A;  1F3B A;  1KNG A;  1YY7 A;  2V32 A;  3QFB C;  2F3M A;  1GUL A;  4BVY A;  4MA9 A;  5IPH A;  4LL1 B;  4MF6 A;  4FYB A;  1KTE A;  4MDC A;  3GST A;  1AW9 A;  1GTU A;  2BMX A;  3FK8 A;  4WF4 A;  2GT6 A;  5BRT A;  1GUH A;  2DJJ A;  1DSB A;  4HQS A;  5GST A;  4HUA A;  1T7P B;  3F6D A;  4WR5 A;  3TDG A;  4QL7 A;  5C00 A;  2FA8 A;  2C0F A;  1VF3 A;  6GSV A;  1I9D A;  1XWG A;  5DBQ A;  1B9Y C;  3IAM 2;  5D9V A;  4I97 A;  5G1L A;  2L59 A;  1GSU A;  3FR3 A;  1GH2 A;  2XC2 A;  2X8H A;  5A4U A;  1V57 A;  2O89 A;  3KH7 A;  4V2M A;  2H75 A;  3H79 A;  4MZW A;  4A5P A;  3FMW A;  4ZB8 A;  1KBN A;  3KTL A;  3E0U A;  3GTU A;  2GZZ A;  3IRA A;  1T8E B;  9GSS A;  2YWN A;  5DQS A;  1MDI A;  3FZ5 A;  2CA8 A;  4HI7 A;  2VCT A;  4EVM A;  3F4S A;  3H8Q A;  1WRY A;  1M9A A;  3LGC A;  2FGX A;  3M9J A;  3ZRE A;  2H70 A;  4F0B A;  1R26 A;  5ECS A;  2H76 A;  2PPT A;  2A2P A;  2VOC A;  3UJ1 A;  2LV3 A;  4BPY A;  4TXO A;  3MIX A;  1TRW A;  4WBJ A;  2HI7 A;  2AJQ B;  4POK A;  2VL3 A;  3G9B A;  3M1G A;  5IMV A;  2H74 A;  4AJ7 A;  3QMX A;  2YJ7 A;  3Q18 A;  2WCI A;  5GZZ B;  2L5L A;  1PA3 A;  3IOS A;  1BX9 A;  1N2A A;  5AIX A;  1AQX A;  1QXH A;  4CW9 A;  1K0O A;  3W8S A;  5HR1 A;  2FWE A;  3HZ4 A;  2H1D A;  1PX6 A;  4GWR A;  3GL5 A;  4G9H A;  6GSU A;  1UN2 A;  3HA9 A;  3QD9 A;  1EOH A;  1OC3 A;  17GS A;  1AIU A;  5COH A;  3OR5 A;  5F06 A;  4DVC A;  3MNG A;  1BYE A;  3DVW A;  2F51 A;  2I81 A;  3HJP A;  2EC4 A;  3DXB A;  3FR6 A;  3ZVJ D;  1LJR A;  3DVX A;  3GH9 A;  2YV7 A;  3Q6O A;  5BMU A;  1BQ7 A;  1A8L A;  3ZLP A;  3LG6 A;  2X49 A;  4EO3 A;  4Q5R A;  1AXD A;  4IN0 A;  3HY2 A;  2F9S A;  1IYI A;  2WDU A;  2NBS A;  2VD1 A;  5DAL A;  1N8J A;  2HXK A;  1MEK A;  1F6M C;  2AAW A;  2LUS A;  1EV9 A;  4MMM A;  4MLY A;  3ZIJ A;  4WKW A;  4V2L A;  2FWH A;  3NIV A;  5CNW A;  4BA7 A;  1XZO A;  3QAV A;  1BG5 A;  14GS A;  1Z7R A;  1NHO A;  3TKS E;  1PD2 1;  3IA1 A;  3KJY A;  1MTC A;  1WP0 A;  5IMD A;  4Z7X A;  2PWJ A;  2EIQ A;  2MBT A;  5IO2 A;  3I6A A;  1IYH A;  2GDR A;  2GZP A;  4K5R A;  1JLW A;  4EXJ A;  5D93 A;  2OA7 A;  4PUR A;  5G31 A;  1TXX A;  4V2N A;  1W4V A;  1DBY A;  2NDO A;  5G1K A;  1ZOF A;  2D2Z A;  5CRD A;  4XRA A;  3C8E A;  2OE3 A;  3UVH A;  1OAZ A;  4JBB A;  4TR0 A;  4KF9 A;  2L6C A;  4KND A;  4XIH A;  4HZ4 A;  1GP1 A;  1FVK A;  4TN8 A;  3I9V 2;  5IO0 A;  3ZFL A;  2QSI A;  1UC7 A;  4N0Z A;  4ECC A;  3TJK A;  4NHW A;  3F9U A;  4EF0 A;  3ME8 A;  3A3T A;  4G10 A;  4NXI A;  5KOW A;  5INY A;  2CZ3 A;  6GSY A;  3IC4 A;  1JZW A;  4USS A;  4QL9 A;  2VCV A;  2DSA A;  3QDN A;  1XWK A;  3V1W A;  1V40 A;  4IP6 A;  3RHB A;  2CZ2 A;  1ERT A;  1PX7 A;  1YKC A;  2HNL A;  4MH2 A;  4HZ2 A;  4GXZ A;  4EC0 A;  1XBS A;  3VWU A;  2XHF A;  18GS A;  3GV1 A;  1EV4 A;  4HQZ A;  1TJD A;  2L4C A;  3O6T A;  2IN3 A;  1B48 A;  5GAN D;  2I9H A;  5HR0 A;  1PN0 A;  3BCI A;  3CMI A;  4K7I A;  4PUF C;  2IFQ B;  2B6M A;  2FD3 A;  1A2J A;  2M46 A;  4X4J A;  3QCP A;  2RM5 A;  5D9X A;  5D8I A;  2N5B A;  2ZNM A;  4XHM A;  2L4Q A;  5D9W A;  2C3T A;  3QPM A;  1F37 A;  2H1G A;  3TJB A;  2A4V A;  3FRC A;  4PUA A;  1M9B A;  2FUG 2;  2JZT A;  4BVY B;  4WET A;  4POL A;  1Z7P A;  4K5S A;  3BJ5 A;  3VLN A;  3HHV A;  2RM6 A;  2CVD A;  2FY6 A;  2FNO A;  1SYR A;  2K6V A;  1GSS A;  1G6W A;  4KE3 A;  5ECI B;  1TRS A;  4EL1 A;  4OO5 A;  1SD8 A;  2H0G A;  1WOU A;  2GSQ A;  2OBI A;  4O5Q A;  2V6K A;  3KP9 A;  4F2I A;  4ILF A;  1GSF A;  1M2B A;  1SK0 A;  3L78 A;  4J2F A;  4MZB A;  4GF0 A;  1T3B A;  4HU9 A;  5CRG A;  2H6X A;  4KCE A;  2MZC A;  2DBC A;  1DUG A;  2R2J A;  1OYJ A;  2H1B A;  1SD9 A;  2V6O A;  2B7J A;  1PKW A;  3GTU B;  3GX0 A;  4KDX A;  3HVS A;  2ON5 A;  3IAS 2;  4EDY A;  2GSR A;  4I2U A;  3Q19 A;  3FZ9 A;  3ISO A;  4ULX A;  3H1N A;  4K2X A;  4K2D A;  5J5N A;  3ZVJ A;  3NOF A;  2XBI A;  5J9C A;  3J7Y b;  3O3T A;  3VWW A;  3IC8 A;  4TXO B;  4MP4 A;  1R4W A;  5DQY A;  4TR4 A;  1NW2 A;  4TW5 A;  1F9M A;  3U5R E;  5CAX A;  2HSY A;  2DML A;  3CSH A;  2LS5 A;  2YCD A;  3GKK A;  4LLR A;  3K8N A;  4EE0 A;  4ZBB A;  1USB A;  2FLS A;  1GNE A;  2DKI A;  1W89 A;  16GS A;  3ZML A;  2IJY A;  5JCU A;  2CVK A;  1VF2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...