2NVLA

Crystal structure of archaeal peroxiredoxin, thioredoxin peroxidase from aeropyrum pernix k1 (sulfonic acid form)
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
242
structure length
241
Chain Sequence
SIPLIGERFPEMEVTTDHGVIKLPDHYVSQGKWFVLFSHPADFTPVTTEFVSFARRYEDFQRLGVDLIGLSVDSVFSHIKWKEWIERHIGVRIPFPIIADPQGTVARRLGLLHAESATHTVRGVFIVDARGVIRTMLYYPMELGRLVDEILRIVKALKLGDSLKRAVPADWPNNEIIGEGLIVPPPTTEDQARARMESGQYRSLDWWFCWDTPASRDDVEEARRYLRRAAEKPAKLLYEEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Probable peroxiredoxin
publication title Oxidation of archaeal peroxiredoxin involves a hypervalent sulfur intermediate
pubmed doi rcsb
source organism Aeropyrum pernix
total genus 76
structure length 241
sequence length 242
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2006-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
A PF10417 1-cysPrx_C C-terminal domain of 1-Cys peroxiredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1020.20 Alpha Beta 2-Layer Sandwich Antioxidant, Horf6; Chain A, domain 2 Antioxidant, Horf6; Chain A, domain 2 2nvlA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2nvlA01
2WB9A 2FLSA 2GGTA 3IAM2 4LMVA 4MLYA 3QAVA 4XRAA 4MF7A 4V2LA 2LSTA 3GNJA 1ZMAA 3GA4A 1ZYEA 3LYKA 3H4KA 1A24A 1FHEA 2AAWA 4HU7A 3TRPA 4MZCA 4WF5A 2KP1A 1OC9A 1YZXA 2VLVA 3L9SA 2NBSA 2GQKA 1S3AA 1SJ6A 3F4SA 3ED3A 2B3SA 1VF4A 5J5NA 4BVXA 3NOFA 4RQXA 3FKFA 5DQSA 3CTGA 3FR6A 2KHPA 4EE0A 6GSYA 2IJYA 2DJ3A 1VF2A 5COHA 3Q19A 3IR4A 2WZ9A 1FAAA 5AIXA 4ZILA 3RHCA 1N8JA 2C3QA 1UA5A 3LG6A 3ZREA 1BEDA 1YKAA 2R5GA 4JR4A 2IL3A 5CP1A 2FWHA 5A4WA 2P31A 5ECRB 2X8GA 3GKXA 2KLXA 4BL7A 5ECQB 1J0FA 2VAFA 5J3RA 1FW1A 3GL5A 2RUFA 2RIIA 2PERA 1SJZA 2NPBA 2LRNA 2IIYA 3QAWA 2O8VB 4IS0A 1DE2A 2HT9A 2A2SA 3I43A 4TRXA 2V6KA 1SYXA 1V40A 5B8BA 1K0DA 3LWAA 3GHAA 4BWQA 1ST9A 4LL4B 1C72A 3IE3A 1PGTA 3A2WA 1ZOFA 5IOWA 5J9BA 3CSJA 2PUKC 3LJRA 2GSQA 1F3BA 2GQMA 3IA1A 4I2TA 4F2IA 1R7HA 4N30A 2LTKA 2LRTA 3CBUA 5L71A 4QL7A 4EC0A 3EU4A 2IMFA 3KD0A 4POBA 1UC7A 3TCOA 1G7OA 2DJ2A 5CNWA 1JLWA 2CVKA 4PX1A 2ZUPA 4CDOA 1HQOA 3TJGA 2YJ7A 3PINA 1SYRA 4KAEA 2B1LA 5IIZA 4N10A 2AHEA 1MEKA 4EKZA 1TDIA 2LJKA 1PRXA 1Y25A 2VM2A 3K8NA 3F6FA 1A0RP 4JRRA 1M2BA 3O6TA 4MJBA 1IYIA 3TRXA 1U6TA 4CW9A 1XWAA 2AUVA 1K3YA 4XRDA 2H1DA 2XPEA 2AYTA 4OCFA 5ID2A 2M72A 3WT2A 4Q5QA 1IYHA 1JZRA 3F6DA 4IELA 1PX6A 3KCMA 2E2MA 4L8EA 1MTCA 4KDYA 4Q5RA 2CAQA 5B6NA 2MYGA 4N0ZA 4GLTA 2EIOA 3GTUB 4O32A 3UJ1A 3UEMA 5FT3A 2MMZA 1F37A 3Q74A 2H6YA 5GAND 5EY6A 4WF4A 1SENA 2C0DA 2RM6A 1EV4A 4IHUA 4ID0A 2V41A 11GSA 4Z7XA 2GTUA 3P8WA 1LU4A 4DSSB 1M99A 2G2QA 4MZWA 1EWXA 5G2ZA 2FWGA 4ECCA 5D93A 3DXBA 3IXRA 2IMEA 4EO3A 4QL9A 2FWFA 1YF1A 3ERFA 1DBYA 2C80A 4KDUA 2K8SA 5D9WA 2YZUA 4MMMA 1Y6EA 1EOHA 1ACVA 2N5FA 3EWLA 2OJLA 3EINA 1GLPA 2QSIA 3C8EA 5F07A 4XTSA 4P3YB 3PH9A 2DMLA 6GSUA 3TJKA 4E8HA 1XFLA 2BMXA 2CVDA 4JE1A 4FIWA 4JZQA 1FVJA 6GSTA 3GUSA 1XZOA 2H1AA 2K6VA 1ERWA 1PL2A 2PU9C 5HQPA 4KB3A 1M9AA 2XBIA 4K8MA 1QGVA 3DWVA 3IHQA 2FA4A 5IMDA 2X8HA 1QMVA 3LORA 3DIEA 2VCXA 1FB0A 3U6VA 2GVPA 2DJKA 4IQ1A 1JZOA 4DSQA 1O8XA 2R6KA 2L4CA 2DSAA 4WR4A 4HJ2A 4MJAA 3SBCA 1OE8A 5J4UA 5KN1A 2PN8A 4GWRA 3CSIA 2RM5A 1O85A 5IOXA 5AGYA 4AJ6A 4PUFC 1K3OA 2NDOA 2DJ1A 1YDKA 1T4ZA 4HQSA 4KW6A 4BWSA 2H73A 4ECJA 1NM3A 3LXTA 4ZBDA 1SU9A 4N0VA 4NHZA 5JCGA 2PVQA 4F0CA 4RI6A 4G9HA 1SKWB 3GMFA 5C04A 1QUWA 1S3CA 3RHBA 1Z6MA 1TK5B 3SWLA 2H19A 1AQXA 1YF0A 1Z6NA 3GURA 2F51A 3L0HA 2DJJA 5LNKe 3APOA 3EURA 4L0UA 3PGTA 4F9ZA 1MD4A 4D73B 2AJQB 5F05A 4MJCA 4ZBBA 2Z9SA 4I2UA 1RK4A 4IP6A 1U3IA 5ECIB 2N5AA 1PN9A 1U3AA 4MDCA 4L0WA 2LQQA 1HNAA 3A2XA 2L59A 4EDZA 1EZKA 2WCIA 2C3NA 4ZBAA 3KP9A 3GKKA 1NSWA 4MZBA 1Z7RA 2AV4A 5KN3A 1T1VA 3IV4A 7GSSA 2FY6A 2LJAA 5ECSA 2ZNMA 5LCZA 5F0GA 17GSA 4HZ2A 2O7KA 2HRFA 1PX7A 4AGSA 4D73A 3G7IA 3LQ7A 4QQ7A 3ZMKA 1WP0A 2H0GA 2YANA 1PSQA 4PNFA 1Z7PA 3VURA 4WR5A 5B6MA 4G19A 3C7MA 4KDXA 4PUAA 4Q5NA 2PMTA 2WDUA 3TJBA 2H0HA 1TK8B 5DQYA 2FNOA 2VL2C 4V1Ap 1EV9A 4XS6A 3WGDA 2X64A 2R37A 5EVOA 3CSHA 2ZCTA 1AQWA 3HVVA 4KGIA 2B6MA 4L5OA 3OR5A 2EIQA 4V2NA 3UAPA 2M80A 5FHIA 1BQ7A 1XWKA 3HKRA 1WJKA 2RUEA 3CYNA 3DYRA 1TI1A 4PNGA 3ERWA 2LV3A 5DDLA 3TKRA 4MK3A 1MD3A 2YWOA 3P2AA 4OCEA 1EEMA 2PWJA 3MNGA 1GLQA 2WGRA 3FR9A 3TKPA 3TB2A 2VCTA 2L5OA 5ECLB 1XW6A 3MDKA 4N11A 1PMTA 4X43A 3VWUA 1U87A 3MWHA 3EC3A 1B8XA 3N5OA 3BD2A 3DD3A 4IVFA 2IMIA 1GRXA 3MSZA 2HLSA 3FZAA 2LQOA 5G5FA 3WGXA 3QCPA 2CX4A 4OFNA 4HU9A 4MCUA 4G10A 3QAGA 2CQ9A 3HD5A 5CO3A 3VI5A 3F3RA 2JZSA 3US3A 4ACSA 3NZNA 1G0TA 3IK7A 2C3TA 2F8AA 1TU8A 2REMA 1ZYQB 3D4MA 4O5RA 4GQFA 1WOUA 3LEFA 1GP1A 3TGZA 2HFDA 2XBQA 3ZVJD 3ZYWA 3ZITA 1T00A 4ZB8A 4BVYA 3RPNA 3GSSA 4HI7A 3QFBC 5ELAA 1AQVA 4DVCA 2JSYA 4TR1B 2GLRA 5IO0A 4WEYA 1K0BA 1VRSD 2LNSA 2C0FA 4NMUA 4KX4A 2L57A 3GL3A 2GSTA 2IMDA 2HI7A 1TTZA 1EGRA 2E2GA 4WETA 2TRCP 4O92A 3HXSA 4OFMA 3G7YA 4YQUA 3F8UA 4ISDA 2B5XA 3LXZA 1M7TA 1X9WB 3ZRDA 3DGQA 5H5QA 5ECOB 2RLIA 4ZL8A 1V2AA 1GSFA 4TR1A 3A2VA 3KMOA 5EPFA 3EU3A 1Z9HA 4XIHA 2OBKA 18GSA 3F4RA 2YOIA 2CX3A 2WULA 1TK0B 3I9V2 1ZGNA 3J7Yb 2F3MA 2H1GA 2YWIA 2CZ3A 4V1Ag 4WKWA 2ON5A 3C1SA 2VL2A 4PQIA 4KA0A 1Q98A 2L4QA 5ID2B 4BPYA 3F3QA 1EOGA 1THOA 2B5EA 5KEJA 1T3BA 2H6ZA 1TU7A 1SJIA 1V9WA 2DIYA 4XHMA 4EUYA 1AXDA 3GKNA 5D9XA 3LYPA 1HYUA 2I1UA 2CA8A 2LRCA 1W4VA 2H70A 3GFKA 12GSA 5IMVA 3FHKA 5KN0A 3L9UA 4PQHA 4MJEA 1YQ1A 1AAZA 2VUPA 3UVHA 1HD2A 3HVXA 2HNLA 4X0XA 1QFNA 4YAVA 1NHYA 1V98A 2MMNA 1WMJA 3TKQA 3IC4A 5ECHB 2LNTA 3TOTA 3GRXA 4TXVA 1USBA 4ZXGA 1G6WA 2B7JA 5A4VA 4NV5A 5CREA 4IBPA 4ZIJA 3O3TA 6GSXA 1YKCA 4GCIA 5G31A 5IMZA 1ZL9A 2D2ZA 1BJXA 1N2AA 3G7JA 5D8IA 14GSA 2R4VA 3I69A 3WYWA 1B4QA 5ECKB 2WS2A 2P5RA 3DMLA 1TW9A 2GSRA 4J2FA 2WRTA 2GZPA 3ISOA 1BAYA 2GQLA 5IMCA 3U5RE 2KP2A 5C00A 1SK0A 3QPMA 2YP6A 1PKWA 3KTBA 2ALBA 2OE1A 4IW9A 2H1BA 3KIJA 4G2EA 3DVXA 4TXOA 3EE2A 1FOVA 3DRNA 4MABA 5IMFA 1X0RA 5G1LA 1GTIA 3KGKA 1B4PA 2V32A 3LGCA 3UOMA 2JADA 4DSRA 4K7NA 3ZMLA 4GF0A 1XCCA 3KXOA 5AISA 2CT6A 2G0FA 3TJJA 3F9UA 3FZ4A 5JWQB 2H01A 5LD0A 5ENUA 3FY7A 1K3LA 2BTOT 1JZWA 5IO2A 2LUSA 4FYCA 3C1RA 2WJUA 1KEBA 2GDRA 3D6IA 1FB6A 5E59A 3WT1A 4ZL7A 3GH9A 1VF1A 2JACA 1MDKA 2H75A 2LEGA 2EIRA 3UIWA 1DSBA 4XS1A 4HS1A 3ZVJA 5E4WA 1GNEA 1S3DA 1XOAA 2VD1A 4OO4A 2VIMA 1GSEA 3GSTA 1ERUA 2VLTA 4MF5A 4F03A 2IWTA 1YY7A 5HFIA 1URMA 3P7XA 1O8WA 1F9MA 2KOKA 2IN3A 1TI3A 1ZCPA 3ZLPA 4XS4B 4MPGA 4I5QA 2VD0A 4NWYA 4PGTA 2YPMA 2HZEA 1V58A 3RAZA 1PA3A 3BCKA 3VWVA 4ZL9A 3D5JA 1OKDA 5CRWA 2L6CA 1A0FA 4IJ3A 4TW5A 1G7EA 2VCVA 4TKYA 1ON4A 1M0UA 2OA7A 3ME8A 1OVNA 1SKSB 4FH8A 5HR1A 1R5AA 4GSTA 1O73A 2H8LA 2VOCA 2MMOA 2MZCA 4MH3A 4IP1A 3Q6OA 4XS4A 3QDNA 4GSSA 3GH6A 1QQ2A 2JL4A 1XPVA 2GZZA 3M9JA 1K0OA 1UVZA 1SD8A 1K0CA 1HNBA 1YJ6A 3IAS2 3CMIA 1X9SB 2AB6A 3FW2A 1AUCA 3IBHA 3EVIA 4WXTA 1O6JA 1QXHA 4MF6A 5G1KA 2FD3A 4K0GA 1Q4JA 4K2DA 2IPAA 1WIKA 1BG5A 3D0ZA 3LSZA 4KSOA 1I9DA 1PL1A 1V57A 2PPTA 5CAXA 2YZHA 1FG4A 3IK9A 5D96A 5IM9A 2J9HA 3NIVA 5DJLA 5CRDA 1SL0B 2A4VA 1TP9A 3D4TA 5GZZB 4MH2A 2FGXA 3UBLA 3GX8A 4MP4A 3N9JA 1FO5A 3VLNA 3CRTA 2EC4A 1XW5A 4NV2A 2F8FA 4IN0A 1LJRA 1XVWA 5F8BA 1XOBA 1WE0A 1TRUA 3BJ5A 3A5WA 5DVBA 1M9BA 4TN8A 4HEA2 2H0IA 3H8QA 2IFQA 5F06A 3E3EA 2DMMA 1O7UA 1BX9A 4KNDA 1K0NA 1A23A 1JFUA 5A5KA 2FWEA 4AF2A 1SL2B 2DLXA 3Q18A 2YN1A 2HSYA 4NPBA 2GT6A 1ILOA 1EEJA 4MA9A 3RBTA 4RI7A 2XHFA 3G9BA 5DAKA 3IRAA 1JLVA 1GSDA 5ELGA 3O76A 1XWCA 5DALA 2K18A 3EMXA 3HYPA 5FWGA 2VL3A 1GNWA 3TRQA 2CZ2A 5GSSA 4TOPA 5CRHA 2J23A 2C1YA 1TRSA 1K0MA 3S9FA 4GRFA 5G5EA 2C8UA 2QC7A 4TR4A 3W6GA 1GTBA 3TJFA 2VL9A 2O85A 1OAZA 2KUCA 3R2QA 2F9SA 1Z5YE 3HVSA 4WBRD 4DEJA 2H76A 3HJMA 3FEUA 1KBNA 13GSA 2DIZA 4V2MA 1H75A 2NVLA 1R4WA 1QK8A 3EMPA 3WGEA 5IMAA 3QR6A 1A8LA 1GUHA 2FUG2 3TUEA 1EP8A 2V2GA 3C71A 4BA7A 2A2RA 10GSA 3E0UA 4JU5A 3P90A 1KNGA 4GTUA 2PVOC 4J56E 4POLA 2CAIA 2VLUA 1LBKA 4ULXA 3FK8A 4OMVA 3DEXA 3E9JB 3HDCA 4RQRA 2B5YA 5HR0A 4F82A 3GYKA 3TDGA 1RQMA 2NTOA 1XWBA 3HA9A 5A4UA 5GAPD 3HCZA 4OFTA 2M46A 1A8YA 1R5PA 3FR3A 4IJIA 1T7PB 1VF3A 5ECNB 2MMAA 3CXGA 1DUGA 3IOSA 2I3YA 2OE0A 3FYGA 1J08A 2LJRA 3F0IA 3EYTA 3VPTA 3RPPA 3JCML 1UN2A 5H5RA 3CRUA 4EDYA 1TRWA 1X9MB 4HJMA 1GUKA 2FHEA 4KUNA 2TIRA 4RUVA 1GTAA 5H5SA 5DCGA 1ERVA 20GSA 2OBIA 2LKUA 9GSSA 2MBSA 4IGJA 4NXIA 4K1FA 4CHSA 1B48A 5JWOB 5JCWA 4KCAA 2C0GA 3ZIVA 1H4OA 3APSA 3HJPA 2HE3A 3ZTLA 4YQMA 3ZIJA 2GT5A 22GSA 4NAXA 2IMKA 4O7HA 2PGTA 1TRVA 2V1MA 4EF0A 1X5EA 1E2YA 1F3AA 5G30A 4EXJA 1OYJA 3KM6A 3M3MA 5J41A 3KTLA 5IQYA 3A3TA 1XXUA 3MAKA 4GXZA 2TRXA 4E8EA 1GTUA 2HZFA 4K0NA 3UARA 2K9FA 2N5BA 2H66A 2H6XA 2MBTA 1B9YC 4IKHA 3IDVA 4HDEA 1TKDB 2VCWA 4ML6A 5ECMB 1ZZYA 5DCHA 2BJXA 16GSA 1GSUA 5HR3A 2GZYA 3VPQA 4TXOB 4HQZA 1Z3EA 3C73A 1F2EA 1OC8A 1GSYA 4HZ4A 6GSWA 1NHOA 1MDIA 2L5LA 2OADA 3HZ4A 5IPHA 3HHVA 4XCSA 2OACA 2LS5A 1PD21 1OC3A 1HNCA 3IPZA 3GX0A 1XIYA 1K0AA 2X8CA 3HZ8A 3HY2A 3ZZXA 1GWCA 2I9HA 1J9BA 3VWWA 5AIVA 3W8JA 4H86A 3RDWA 1SK1A 1ERTA 1YEXA 4YAPA 4KCEA 4LMWA 3D22A 3AY8A 3GN3A 4MPFA 3H93A 3WD6A 3F4TA 3GTUA 2K8VA 4F0BA 5GSTA 2JZRA 4ECBA 2YJHA 1JHBA 3KEBA 4L5LA 4Q5FA 3I6AA 4POMA 1O81A 2O89A 1AW9A 2R2JA 3KH9A 3QFAC 1W89A 2CV4A 2VO4A 1CQGA 4DSSA 1THXA 3F63A 3UL3A 1PKZA 2HRNA 3ZL5A 4PURA 2HZEB 4I97A 6GSSA 2VCZA 1KTEA 2I4AA 2QKEA 1WWJA 4FYUA 3TKSC 2E0QA 3TOUA 2I81A 2B1KA 3CTFA 4K7OA 5HR2A 2WFCA 5B7CA 1SL1B 5D9TA 1GULA 1A2MA 2C0EA 1DE1A 3UBKA 1GL8A 3ZFLA 5HFKA 2V6OA 5CRGA 2YV9A 1XWGA 4ZB6A 5DJMA 3TKSE 3KP8A 1B9XC 4OWYA 5ABRA 2FCHA 3M8NA 2FA8A 3QD9A 4I6XA 3ZFBA 3ERGA 1FVKA 1T4YA 4FO5A 4WBJA 4KSMA 4HUAA 2E7PA 4KE3A 1JZDA 4K6XA 3H79A 1X5CA 1AIUA 4IQAA 4X1UA 2B7KA 3LFLA 2HSHA 3M0FA 1CQHA 2QGVA 3J7Yk 1XBSA 5JWRB 1BYEA 1X5DA 4EL1A 1TJDA 4NHWA 4HOJA 4AJ7A 4GQCA 1EP7A 1M2AA 4OO5A 1GH2A 1PQNA 1E6BA 2YWMA 4ZB9A 19GSA 3UMAA 4K7IA 2HXKA 3M9KA 1R26A 2H30A 4LA1A 2H74A 1G6YA 3PR8A 2GS3A 4JEDA 3DKSA 3M1GA 2XC2A 2JSZA 6GSVA 1A2JA 3BCIA 5ECPB 5INYA 4J57E 1SK2A 4TVEA 2P0GA 2H71A 2HYXA 2ES7A 3DVWA 3H1NA 2YNXA 2VM1A 1U88A 2H72A 3ME7A 5D73A 4YH2A 5IPGA 3L9VA 1RW1A 3BBYA 1XVQA 2YWNA 2YCDA 3L78A 3W8SA 4K9ZA 5KN2A 1A2LA 4PXOA 1ABAA 4AJ8A 2DC5A 1SKRB 2IFQB 4EVMA 2OKAA 2X99A 1ML6A 1OE7A 2P5QA 1TXXA 2XPDA 1XW9A 2O87A 3FZ5A 4I8BA 1WPIA 4LL1B 2YV7A 3HJOA 3VK9A 1GUMA 5EL8A 4JR6A 1AC1A 1T8EB 3QOUA 3GIXA 4ML1A 3D21A 4TR3A 2OE3A 5DAKB 3UVTA 4FYBA 2JU5A 5DALB 1I5GA 3APQA 3KZQA 5D9VA 2C4JA 1TOFA 3FZ9A 4KH7A 2PBJA 1EGOA 3FRCA 2GSSA 3VI7A 2L6DA 3KJYA 1NW2A 5AN1A 2R3XA 5HFGA 1WRYA 3L4NA 5DBQA 2JZTA 3GKMA 4LLRA 4ECIA 3V1WA 5J9CA 3GV1A 8GSSA 4JBBA 3KH7A 2ON7A 1VGLA 5CYYA 1GSSA 1SD9A 3TKSA 1MDJA 3BOAA 2CVBA 1GSQA 5JCUA 4TR0A 2VCQA 3KMNA 3VFIA 4YQVA 1OC9B 2DBCA 3QMXA 4OD7A 4GSNA 3VWXA 1F6MC 1M2DA 4POKA 1YEPA 4ILFA 2DJ0A 1OKTA 5B8AA 4PQ1A
chains in the Genus database with same CATH superfamily
2WB9A 2FLSA 2GGTA 3IAM2 4LMVA 4MLYA 3QAVA 4XRAA 4MF7A 4V2LA 2LSTA 3GNJA 1ZMAA 3GA4A 1ZYEA 3LYKA 3H4KA 1A24A 1FHEA 2AAWA 4HU7A 3TRPA 4MZCA 4WF5A 2KP1A 1OC9A 1YZXA 2VLVA 3L9SA 2NBSA 2GQKA 1S3AA 3PPUA 1SJ6A 3F4SA 3ED3A 2B3SA 1VF4A 5J5NA 4BVXA 3NOFA 4BL7B 4RQXA 3FKFA 5DQSA 3CTGA 3FR6A 2KHPA 4EE0A 6GSYA 2IJYA 2DJ3A 1VF2A 5COHA 3Q19A 3IR4A 2WZ9A 1FAAA 5AIXA 4ZILA 3RHCA 1N8JA 2R0PA 3LW9A 2C3QA 1UA5A 3LG6A 3ZREA 1BEDA 1YKAA 4O5UA 2R5GA 4JR4A 2IL3A 5CP1A 4FQUA 2FWHA 5A4WA 2P31A 5ECRB 2X8GA 3GKXA 2KLXA 4BL7A 5ECQB 1J0FA 2VAFA 5J3RA 1FW1A 3GL5A 2RUFA 2RIIA 2PERA 1SJZA 2NPBA 2LRNA 2IIYA 3QAWA 2O8VB 4IS0A 1DE2A 2HT9A 2A2SA 3I43A 4TRXA 2V6KA 1SYXA 1V40A 5B8BA 1K0DA 3LWAA 3GHAA 4BWQA 1ST9A 4MNNA 4LL4B 1C72A 3IE3A 1PGTA 3A2WA 1ZOFA 5IOWA 5J9BA 3CSJA 2PUKC 3LJRA 2GSQA 1F3BA 2GQMA 3IA1A 4I2TA 4F2IA 1R7HA 4N30A 2LTKA 2LRTA 3CBUA 5L71A 4QL7A 4EC0A 3EU4A 2IMFA 3KD0A 4POBA 1UC7A 3TCOA 1G7OA 2DJ2A 5CNWA 1JLWA 2CVKA 4PX1A 2ZUPA 4CDOA 1HQOA 3TJGA 2YJ7A 3PINA 4HSCX 1SYRA 4KAEA 2B1LA 5IIZA 4N10A 2AHEA 1MEKA 4EKZA 1TDIA 2LJKA 1PRXA 1Y25A 2VM2A 3K8NA 3F6FA 1A0RP 4JRRA 1M2BA 3O6TA 4MJBA 3IC8A 1IYIA 3TRXA 1U6TA 4CW9A 1XWAA 2AUVA 1K3YA 4XRDA 2H1DA 2XPEA 2AYTA 4OCFA 5ID2A 2M72A 3WT2A 4Q5QA 2R0GA 1IYHA 1JZRA 2QA1A 3F6DA 4IELA 1PX6A 3KCMA 2E2MA 4L8EA 1MTCA 4KDYA 4Q5RA 2CAQA 5B6NA 2MYGA 4N0ZA 4GLTA 2EIOA 3GTUB 4O32A 3UJ1A 4G0IA 3UEMA 5FT3A 2MMZA 1F37A 3Q74A 2HSMA 2H6YA 5GAND 5EY6A 4WF4A 1SENA 2C0DA 2RM6A 1EV4A 4IHUA 4ID0A 2V41A 11GSA 4Z7XA 2GTUA 3P8WA 1LU4A 4DSSB 1M99A 2G2QA 4MZWA 1EWXA 5G2ZA 2FWGA 4ECCA 5D93A 3DXBA 3IXRA 2IMEA 4EO3A 4QL9A 2FWFA 1YF1A 3ERFA 1DBYA 2C80A 4KDUA 2K8SA 5D9WA 2YZUA 4MMMA 1Y6EA 1EOHA 1ACVA 2N5FA 3EWLA 2OJLA 3EINA 1GLPA 2QSIA 3C8EA 5F07A 4XTSA 4P3YB 3PH9A 2DMLA 6GSUA 3TJKA 4E8HA 1XFLA 2BMXA 2CVDA 4JE1A 4FIWA 4JZQA 1FVJA 6GSTA 3GUSA 1XZOA 2H1AA 2K6VA 1ERWA 1PL2A 2PU9C 5HQPA 4KB3A 1M9AA 5BMUA 2XBIA 4K8MA 1QGVA 3DWVA 3IHQA 2FA4A 5IMDA 2X8HA 1QMVA 3LORA 3DIEA 2VCXA 1FB0A 3U6VA 2GVPA 2DJKA 4IQ1A 1JZOA 4DSQA 1O8XA 2R6KA 2L4CA 2DSAA 4WR4A 4HJ2A 4MJAA 3SBCA 1OE8A 5J4UA 5KN1A 3R3EA 2PN8A 4GWRA 3CSIA 2RM5A 1O85A 5IOXA 5AGYA 4BIKA 4AJ6A 4PUFC 1K3OA 2NDOA 2DJ1A 1YDKA 1T4ZA 4HQSA 4KW6A 4BWSA 2H73A 4ECJA 1NM3A 3LXTA 4ZBDA 1SU9A 4N0VA 4NHZA 5JCGA 2PVQA 4F0CA 4RI6A 4G9HA 1SKWB 3GMFA 5C04A 1QUWA 1S3CA 3RHBA 1Z6MA 4X4JA 1TK5B 3SWLA 2H19A 1AQXA 1YF0A 1Z6NA 3GURA 2F51A 3IHGA 3L0HA 2DJJA 5LNKe 3APOA 3EURA 4L0UA 3PGTA 4F9ZA 1MD4A 4D73B 2AJQB 5F05A 4MJCA 4ZBBA 2Z9SA 4I2UA 1RK4A 4IP6A 1U3IA 5ECIB 2N5AA 1PN9A 1U3AA 4MDCA 4L0WA 2LQQA 1HNAA 3A2XA 2L59A 4EDZA 1EZKA 2WCIA 2C3NA 4ZBAA 3KP9A 3GKKA 1NSWA 4MZBA 1Z7RA 2AV4A 5KN3A 1T1VA 3IV4A 7GSSA 2FY6A 2LJAA 5ECSA 2ZNMA 5LCZA 5F0GA 17GSA 4HZ2A 2O7KA 2HRFA 1PX7A 4AGSA 4D73A 3G7IA 3LQ7A 4QQ7A 3ZMKA 1WP0A 2H0GA 2YANA 1PSQA 4PNFA 1Z7PA 5KOWA 3VURA 4WR5A 5B6MA 4G19A 3C7MA 4KDXA 4PUAA 4Q5NA 2PMTA 2WDUA 4K5RA 3TJBA 3A5IA 2H0HA 1TK8B 5DQYA 2FNOA 2VL2C 4V1Ap 1EV9A 4XS6A 3WGDA 2X64A 2R37A 5EVOA 3CSHA 2ZCTA 1AQWA 3HVVA 4K5SA 4KGIA 2B6MA 4CY8A 4L5OA 3OR5A 2EIQA 4V2NA 3UAPA 2M80A 5FHIA 1BQ7A 1XWKA 3HKRA 1WJKA 2RUEA 3CYNA 3DYRA 1TI1A 4PNGA 3ERWA 2LV3A 5DDLA 2DKIA 3TKRA 4MK3A 1MD3A 2YWOA 3P2AA 4OCEA 1EEMA 2PWJA 3MNGA 1GLQA 2WGRA 3FR9A 3TKPA 3TB2A 2VCTA 2L5OA 5ECLB 1XW6A 3MDKA 4N11A 1PMTA 4X43A 3VWUA 1U87A 3MWHA 3EC3A 1B8XA 3N5OA 3BD2A 3DD3A 4IVFA 2IMIA 1GRXA 4BVXB 3MSZA 2HLSA 3FZAA 2HRAA 2LQOA 5G5FA 3WGXA 3QCPA 2CX4A 4OFNA 4HU9A 4MCUA 4G10A 3QAGA 2CQ9A 3HD5A 5CO3A 2A2PA 3VI5A 3F3RA 2JZSA 3US3A 4ACSA 3NZNA 1G0TA 3IK7A 2C3TA 2F8AA 1TU8A 2REMA 1ZYQB 3D4MA 4O5RA 4GQFA 1WOUA 3LEFA 1GP1A 3TGZA 2HFDA 2XBQA 3ZVJD 3ZYWA 3ZITA 1T00A 4ZB8A 4BVYA 3RPNA 3GSSA 4HI7A 3QFBC 5ELAA 1AQVA 4DVCA 2JSYA 4TR1B 2GLRA 5IO0A 4WEYA 1K0BA 1VRSD 2LNSA 2C0FA 4NMUA 4KX4A 2L57A 3GL3A 2GSTA 2IMDA 2HI7A 1ZYPA 1TTZA 1EGRA 2E2GA 4WETA 2TRCP 4O92A 3HXSA 4OFMA 3G7YA 4YQUA 4ICYA 3F8UA 4ISDA 2B5XA 3LXZA 1M7TA 1X9WB 3ZRDA 3DGQA 5H5QA 5ECOB 2RLIA 4ZL8A 1V2AA 1GSFA 4TR1A 3A2VA 3KMOA 5EPFA 3EU3A 1Z9HA 4XIHA 2OBKA 18GSA 3F4RA 2YOIA 2CX3A 2WULA 1TK0B 4YKFA 3I9V2 1ZGNA 3J7Yb 2F3MA 2H1GA 2YWIA 2CZ3A 4Z2TA 4V1Ag 1PN0A 4WKWA 2ON5A 3C1SA 2VL2A 4PQIA 4KA0A 1Q98A 2L4QA 5ID2B 4BPYA 3F3QA 1EOGA 1THOA 2B5EA 5KEJA 1T3BA 2H6ZA 1TU7A 3MIXA 1SJIA 1V9WA 2DIYA 4XHMA 4EUYA 1AXDA 3GKNA 5D9XA 3HVNA 3LYPA 1HYUA 2I1UA 2CA8A 2LRCA 1W4VA 2H70A 3GFKA 12GSA 5IMVA 3FHKA 5KN0A 3L9UA 4PQHA 4MJEA 1YQ1A 1AAZA 2VUPA 3UVHA 1HD2A 3HVXA 2HNLA 4X0XA 1QFNA 4YAVA 1NHYA 1V98A 2MMNA 1WMJA 3TKQA 3IC4A 2LNTA 5ECHB 3TOTA 3GRXA 4TXVA 1USBA 4ZXGA 1G6WA 2B7JA 5A4VA 4NV5A 5CREA 4IBPA 4ZIJA 3O3TA 6GSXA 1YKCA 4GCIA 5G31A 5IMZA 1ZL9A 2D2ZA 1BJXA 1N2AA 3G7JA 4O5QA 5D8IA 14GSA 2R4VA 3I69A 3WYWA 1B4QA 5ECKB 2WS2A 2P5RA 3DMLA 1TW9A 2GSRA 4J2FA 4G0LA 2WRTA 2GZPA 3ISOA 1BAYA 2GQLA 5IMCA 3U5RE 2KP2A 5C00A 1SK0A 3QPMA 2YP6A 1PKWA 3KTBA 2ALBA 2OE1A 4IW9A 2H1BA 3KIJA 4G2EA 3DVXA 4TXOA 3EE2A 1FOVA 3DRNA 4MABA 5IMFA 1X0RA 5G1LA 1GTIA 3KGKA 1B4PA 2V32A 3LGCA 3UOMA 2JADA 4DSRA 4K7NA 3ZMLA 4GF0A 1XCCA 3KXOA 5AISA 2CT6A 3MYDA 2G0FA 3TJJA 3F9UA 3FZ4A 5JWQB 2H01A 5LD0A 5ENUA 3FY7A 1K3LA 2BTOT 1JZWA 5IO2A 2LUSA 4FYCA 3C1RA 2WJUA 1KEBA 2GDRA 3D6IA 1FB6A 5E59A 3WT1A 4ZL7A 3GH9A 3EPTA 1VF1A 2JACA 1MDKA 2H75A 2LEGA 2EIRA 3UIWA 1DSBA 4XS1A 4HS1A 3ZVJA 5E4WA 1GNEA 1S3DA 1XOAA 2VD1A 4OO4A 2VIMA 1GSEA 3GSTA 1ERUA 2VLTA 4MF5A 4F03A 2IWTA 1YY7A 5HFIA 1URMA 3P7XA 1O8WA 1F9MA 2KOKA 2IN3A 1TI3A 1ZCPA 3ZLPA 4XS4B 4MPGA 4I5QA 2VD0A 4NWYA 4PGTA 2YPMA 2HZEA 1V58A 3RAZA 1PA3A 3BCKA 3VWVA 4ZL9A 3D5JA 1OKDA 5CRWA 2L6CA 1A0FA 4IJ3A 4TW5A 1G7EA 2VCVA 4TKYA 1ON4A 1M0UA 2OA7A 3ME8A 1OVNA 1SKSB 4FH8A 5HR1A 1R5AA 4GSTA 1O73A 2H8LA 2VOCA 2MMOA 2MZCA 4MH3A 4IP1A 3Q6OA 4XS4A 3QDNA 4GSSA 3GH6A 1QQ2A 2JL4A 1XPVA 2GZZA 3M9JA 1K0OA 1UVZA 4CY6A 1SD8A 1K0CA 1HNBA 1YJ6A 3IAS2 3CMIA 1X9SB 2AB6A 3FW2A 1AUCA 1M3JA 3IBHA 3EVIA 4WXTA 1O6JA 1QXHA 4MF6A 5G1KA 2FD3A 4K0GA 1Q4JA 4K2DA 2IPAA 1WIKA 1BG5A 3D0ZA 3LSZA 4KSOA 1I9DA 1PL1A 1V57A 2PPTA 5CAXA 2YZHA 1FG4A 3IK9A 5D96A 5IM9A 2J9HA 3NIVA 5DJLA 4EIQA 5CRDA 1SL0B 2A4VA 1TP9A 3D4TA 5GZZB 4MH2A 2FGXA 3UBLA 3GX8A 4MP4A 2QA2A 3N9JA 1FO5A 3VLNA 3CRTA 2EC4A 1XW5A 4NV2A 2F8FA 4IN0A 4A5PA 1LJRA 1XVWA 5F8BA 1XOBA 1WE0A 1TRUA 3BJ5A 3A5WA 5DVBA 1M9BA 4TN8A 4HEA2 2H0IA 3H8QA 2IFQA 5F06A 3E3EA 2DMMA 1O7UA 1BX9A 4KNDA 1K0NA 2A4HA 1A23A 1JFUA 5A5KA 2FWEA 2R0CA 4AF2A 1SL2B 2DLXA 3Q18A 2YN1A 2HSYA 4NPBA 2GT6A 1ILOA 4USSA 1EEJA 4MA9A 3RBTA 4RI7A 2XHFA 3G9BA 5DAKA 3IRAA 1JLVA 1GSDA 5ELGA 3O76A 1XWCA 5DALA 2K18A 3EMXA 3HYPA 5FWGA 2VL3A 1GNWA 3TRQA 2CZ2A 5GSSA 4TOPA 5CRHA 2J23A 2C1YA 1TRSA 1K0MA 5KOXA 3S9FA 4GRFA 5G5EA 2C8UA 2QC7A 4BVYB 3W6GA 4TR4A 1GTBA 3TJFA 2VL9A 2O85A 1OAZA 2KUCA 3R2QA 2F9SA 1Z5YE 3HVSA 4WBRD 4DEJA 2H76A 3HJMA 3FEUA 3FMWA 1KBNA 13GSA 2DIZA 4V2MA 1H75A 2NVLA 1R4WA 1QK8A 3EMPA 3WGEA 5IMAA 3QR6A 1A8LA 1GUHA 2FUG2 3TUEA 1EP8A 2V2GA 3C71A 4BA7A 2A2RA 10GSA 3E0UA 4JU5A 3P90A 1KNGA 4GTUA 2PVOC 1ZYNA 4J56E 4POLA 4G0KA 2CAIA 2VLUA 1LBKA 4ULXA 3FK8A 4OMVA 3DEXA 3E9JB 3HDCA 4RQRA 2B5YA 5HR0A 4F82A 3GYKA 3TDGA 1RQMA 2NTOA 1XWBA 3HA9A 5A4UA 5GAPD 3HCZA 4OFTA 2M46A 1A8YA 1R5PA 3FR3A 4IJIA 1T7PB 1VF3A 4PTSA 5ECNB 2MMAA 2UZ8A 3CXGA 1DUGA 3IOSA 2I3YA 2OE0A 3FYGA 1J08A 2LJRA 3F0IA 3EYTA 3VPTA 3RPPA 3JCML 1UN2A 5H5RA 3CRUA 4EDYA 1TRWA 1X9MB 4HJMA 1GUKA 2FHEA 4KUNA 2TIRA 4RUVA 1GTAA 5H5SA 5DCGA 1ERVA 1PFOA 20GSA 1S3RA 2OBIA 2LKUA 9GSSA 2MBSA 4IGJA 4NXIA 4K1FA 4CHSA 1B48A 5JWOB 5JCWA 4KCAA 2C0GA 3ZIVA 1H4OA 3APSA 3HJPA 2HE3A 3ZTLA 4YQMA 5BRTA 3ZIJA 2GT5A 22GSA 4NAXA 2IMKA 4O7HA 2PGTA 1M3IA 1TRVA 2V1MA 4EF0A 1X5EA 1E2YA 1F3AA 5G30A 4EXJA 1OYJA 3KM6A 3M3MA 5J41A 3KTLA 5IQYA 3A3TA 1XXUA 3MAKA 4GXZA 2TRXA 4E8EA 1GTUA 2HZFA 4K0NA 3UARA 2K9FA 2N5BA 2H66A 2H6XA 2MBTA 1B9YC 4IKHA 3IDVA 4HDEA 1TKDB 2VCWA 4ML6A 5ECMB 1ZZYA 5DCHA 2BJXA 16GSA 1GSUA 5HR3A 2GZYA 3VPQA 4TXOB 4HQZA 1Z3EA 3C73A 1F2EA 1OC8A 1GSYA 4HZ4A 6GSWA 1NHOA 1MDIA 2L5LA 2OADA 3HZ4A 5IPHA 3HHVA 4XCSA 2OACA 2LS5A 1PD21 1OC3A 1HNCA 3IPZA 3GX0A 1XIYA 1K0AA 2X8CA 3HZ8A 3HY2A 3ZZXA 1GWCA 2I9HA 1J9BA 3VWWA 5AIVA 3W8JA 4H86A 3RDWA 1SK1A 1ERTA 1YEXA 4YAPA 4KCEA 4LMWA 2HRKA 3D22A 3AY8A 3GN3A 4MPFA 3H93A 3WD6A 3F4TA 3GTUA 2K8VA 4F0BA 5GSTA 2JZRA 4ECBA 2YJHA 1JHBA 3KEBA 4L5LA 4Q5FA 3I6AA 4EIPA 4POMA 1O81A 2O89A 1AW9A 2R2JA 3KH9A 3QFAC 1W89A 2CV4A 2VO4A 1CQGA 4DSSA 1THXA 3F63A 3UL3A 1PKZA 2HRNA 3ZL5A 4PURA 2HZEB 4I97A 4Z2RA 6GSSA 2VCZA 1KTEA 2I4AA 2QKEA 1WWJA 4FYUA 3TKSC 2E0QA 3TOUA 2I81A 2B1KA 3CTFA 4K7OA 5HR2A 2WFCA 5B7CA 1SL1B 5D9TA 1GULA 1A2MA 2C0EA 1DE1A 3UBKA 1GL8A 3ZFLA 5HFKA 2V6OA 5CRGA 2YV9A 1FOHA 1XWGA 4ZB6A 5DJMA 3TKSE 3KP8A 1B9XC 4OWYA 5ABRA 2FCHA 3M8NA 2FA8A 3QD9A 4I6XA 3ZFBA 3ERGA 1FVKA 1T4YA 4FO5A 4WBJA 4KSMA 4HUAA 2E7PA 4KE3A 1JZDA 4K6XA 3H79A 1X5CA 1AIUA 4IQAA 4X1UA 2B7KA 3LFLA 2HSHA 3M0FA 1CQHA 2QGVA 3J7Yk 1XBSA 5JWRB 1BYEA 1X5DA 4EL1A 1TJDA 4NHWA 4HOJA 4AJ7A 4GQCA 1EP7A 1M2AA 4OO5A 1GH2A 1PQNA 4KF9A 1E6BA 2YWMA 4ZB9A 19GSA 3UMAA 4K7IA 2HXKA 3M9KA 1R26A 4YKGA 2H30A 4LA1A 2H74A 1G6YA 3PR8A 2GS3A 4JEDA 3DKSA 3M1GA 2XC2A 2JSZA 6GSVA 1A2JA 3BCIA 5ECPB 5INYA 4J57E 1SK2A 4TVEA 2P0GA 2H71A 2HYXA 2ES7A 3DVWA 3H1NA 2YNXA 2VM1A 1U88A 2H72A 3ME7A 5D73A 4YH2A 5IPGA 3L9VA 1RW1A 3BBYA 1XVQA 2YWNA 2YCDA 3L78A 3W8SA 4K9ZA 5KN2A 1A2LA 4PXOA 1ABAA 4AJ8A 2DC5A 1SKRB 2IFQB 4EVMA 2OKAA 2X99A 1ML6A 1OE7A 2P5QA 1TXXA 2XPDA 1XW9A 1XG8A 2O87A 3FZ5A 4I8BA 1WPIA 4LL1B 2X4AA 2YV7A 3HJOA 3VK9A 1GUMA 5EL8A 4JR6A 1AC1A 1T8EB 3QOUA 3GIXA 2X49A 4ML1A 3D21A 4TR3A 2OE3A 5DAKB 3UVTA 4FYBA 2JU5A 5DALB 1I5GA 3APQA 3KZQA 5D9VA 2C4JA 1TOFA 3FZ9A 4KH7A 2PBJA 1EGOA 3FRCA 2GSSA 3VI7A 2L6DA 3KJYA 1NW2A 5AN1A 2R3XA 5HFGA 1WRYA 3L4NA 5DBQA 2JZTA 3GKMA 4LLRA 3CQFA 4ECIA 3V1WA 5J9CA 2DKHA 3GV1A 8GSSA 4JBBA 3KH7A 2ON7A 1VGLA 5CYYA 1GSSA 1SD9A 4Z2UA 4K2XA 3TKSA 1MDJA 3BOAA 2CVBA 1GSQA 5JCUA 4TR0A 2VCQA 3KMNA 3VFIA 4YQVA 1OC9B 2DBCA 3QMXA 4OD7A 4GSNA 3VWXA 1F6MC 1M2DA 4POKA 1YEPA 4ILFA 2DJ0A 1OKTA 5B8AA 4PQ1A
chains in the Genus database with same CATH topology
2WB9A 2FLSA 2GGTA 3IAM2 4LMVA 4MLYA 3QAVA 4XRAA 4MF7A 4V2LA 2LSTA 3GNJA 1ZMAA 3GA4A 1ZYEA 3LYKA 3H4KA 1A24A 1FHEA 2AAWA 4HU7A 3TRPA 4MZCA 4WF5A 2KP1A 1OC9A 1YZXA 2VLVA 3L9SA 2NBSA 2GQKA 1S3AA 3PPUA 1SJ6A 3F4SA 3ED3A 2B3SA 1VF4A 5J5NA 4BVXA 3NOFA 4BL7B 4RQXA 3FKFA 5DQSA 3CTGA 3FR6A 2KHPA 4EE0A 6GSYA 2IJYA 2DJ3A 1VF2A 5COHA 3Q19A 3IR4A 2WZ9A 1FAAA 5AIXA 4ZILA 3RHCA 1N8JA 2R0PA 3LW9A 2C3QA 1UA5A 3LG6A 3ZREA 1BEDA 1YKAA 4O5UA 2R5GA 4JR4A 2IL3A 5CP1A 4FQUA 2FWHA 5A4WA 2P31A 5ECRB 2X8GA 3GKXA 2KLXA 4BL7A 5ECQB 1J0FA 2VAFA 5J3RA 1FW1A 3GL5A 2RUFA 2RIIA 2PERA 1SJZA 2NPBA 2LRNA 2IIYA 3QAWA 2O8VB 4IS0A 1DE2A 2HT9A 2A2SA 3I43A 4TRXA 2V6KA 1SYXA 1V40A 5B8BA 1K0DA 3LWAA 3GHAA 4BWQA 1ST9A 4MNNA 4LL4B 1C72A 3IE3A 1PGTA 3A2WA 1ZOFA 5IOWA 5J9BA 3CSJA 2PUKC 3LJRA 2GSQA 1F3BA 2GQMA 3IA1A 4I2TA 4F2IA 1R7HA 4N30A 2LTKA 2LRTA 3CBUA 5L71A 4QL7A 4EC0A 3EU4A 2IMFA 3KD0A 4POBA 1UC7A 3TCOA 1G7OA 2DJ2A 5CNWA 1JLWA 2CVKA 4PX1A 2ZUPA 4CDOA 1HQOA 3TJGA 2YJ7A 3PINA 1SYRA 4KAEA 2B1LA 5IIZA 4N10A 2AHEA 1MEKA 4EKZA 1TDIA 2LJKA 1PRXA 1Y25A 2VM2A 3K8NA 3F6FA 1A0RP 4JRRA 1M2BA 3O6TA 4MJBA 3IC8A 1IYIA 3TRXA 1U6TA 4CW9A 1XWAA 2AUVA 1K3YA 4XRDA 2H1DA 2XPEA 2AYTA 4OCFA 5ID2A 2M72A 3WT2A 4Q5QA 2R0GA 1IYHA 1JZRA 2QA1A 3F6DA 4IELA 1PX6A 3KCMA 2E2MA 4L8EA 1MTCA 4KDYA 4Q5RA 2CAQA 5B6NA 2MYGA 4N0ZA 4GLTA 2EIOA 3GTUB 4O32A 3UJ1A 4G0IA 3UEMA 5FT3A 2MMZA 1F37A 3Q74A 2HSMA 2H6YA 5GAND 5EY6A 4WF4A 1SENA 2C0DA 2RM6A 1EV4A 4IHUA 4ID0A 2V41A 11GSA 4Z7XA 2GTUA 3P8WA 1LU4A 4DSSB 1M99A 2G2QA 4MZWA 1EWXA 5G2ZA 2FWGA 4ECCA 5D93A 3DXBA 3IXRA 2IMEA 4EO3A 4QL9A 2FWFA 1YF1A 3ERFA 1DBYA 2C80A 4KDUA 2K8SA 5D9WA 2YZUA 4MMMA 1Y6EA 1EOHA 1ACVA 2N5FA 3EWLA 2OJLA 3EINA 1GLPA 2QSIA 3C8EA 5F07A 4XTSA 4P3YB 3PH9A 2DMLA 6GSUA 3TJKA 4E8HA 1XFLA 2BMXA 2CVDA 4JE1A 4FIWA 4JZQA 1FVJA 6GSTA 3GUSA 1XZOA 2H1AA 2K6VA 1ERWA 1PL2A 2PU9C 5HQPA 4KB3A 1M9AA 5BMUA 2XBIA 4K8MA 1QGVA 3DWVA 3IHQA 2FA4A 5IMDA 2X8HA 1QMVA 3LORA 3DIEA 2VCXA 1FB0A 3U6VA 2GVPA 2DJKA 4IQ1A 1JZOA 4DSQA 1O8XA 2R6KA 2L4CA 2DSAA 4WR4A 4HJ2A 4MJAA 3SBCA 1OE8A 5J4UA 5KN1A 3R3EA 2PN8A 4GWRA 3CSIA 2RM5A 1O85A 5IOXA 5AGYA 4AJ6A 4PUFC 1K3OA 2NDOA 2DJ1A 1YDKA 1T4ZA 4HQSA 4KW6A 4BWSA 2H73A 4ECJA 1NM3A 3LXTA 4ZBDA 1SU9A 4N0VA 4NHZA 5JCGA 2PVQA 4F0CA 4RI6A 4G9HA 1SKWB 3GMFA 5C04A 1QUWA 1S3CA 3RHBA 1Z6MA 4X4JA 1TK5B 3SWLA 2H19A 1AQXA 1YF0A 1Z6NA 3GURA 2F51A 3IHGA 3L0HA 2DJJA 5LNKe 3APOA 3EURA 4L0UA 3PGTA 4F9ZA 1MD4A 4D73B 2AJQB 5F05A 4MJCA 4ZBBA 2Z9SA 4I2UA 1RK4A 4IP6A 1U3IA 5ECIB 2N5AA 1PN9A 1U3AA 4MDCA 4L0WA 2LQQA 1HNAA 3A2XA 2L59A 4EDZA 1EZKA 2WCIA 2C3NA 4ZBAA 3KP9A 3GKKA 1NSWA 4MZBA 1Z7RA 2AV4A 5KN3A 1T1VA 3IV4A 7GSSA 2FY6A 2LJAA 5ECSA 2ZNMA 5LCZA 5F0GA 17GSA 4HZ2A 2O7KA 2HRFA 1PX7A 4AGSA 4D73A 3G7IA 3LQ7A 4QQ7A 3ZMKA 1WP0A 2H0GA 2YANA 1PSQA 4PNFA 1Z7PA 5KOWA 3VURA 4WR5A 5B6MA 4G19A 3C7MA 4KDXA 4PUAA 4Q5NA 2PMTA 2WDUA 4K5RA 3TJBA 3A5IA 2H0HA 1TK8B 5DQYA 2FNOA 2VL2C 4V1Ap 1EV9A 4XS6A 3WGDA 2X64A 2R37A 5EVOA 3CSHA 2ZCTA 1AQWA 3HVVA 4K5SA 4KGIA 2B6MA 4CY8A 4L5OA 3OR5A 2EIQA 4V2NA 3UAPA 2M80A 5FHIA 1BQ7A 1XWKA 3HKRA 1WJKA 2RUEA 3CYNA 3DYRA 1TI1A 4PNGA 3ERWA 2LV3A 5DDLA 2DKIA 3TKRA 4MK3A 1MD3A 2YWOA 3P2AA 4OCEA 1EEMA 2PWJA 3MNGA 1GLQA 2WGRA 3FR9A 3TKPA 3TB2A 2VCTA 2L5OA 5ECLB 1XW6A 3MDKA 4N11A 1PMTA 4X43A 3VWUA 1U87A 3MWHA 3EC3A 1B8XA 3N5OA 3BD2A 3DD3A 4IVFA 2IMIA 1GRXA 4BVXB 3MSZA 2HLSA 3FZAA 2HRAA 2LQOA 5G5FA 3WGXA 3QCPA 2CX4A 4OFNA 4HU9A 4MCUA 4G10A 3QAGA 2CQ9A 3HD5A 5CO3A 2A2PA 3VI5A 3F3RA 2JZSA 3US3A 4ACSA 3NZNA 1G0TA 3IK7A 2C3TA 2F8AA 1TU8A 2REMA 1ZYQB 3D4MA 4O5RA 4GQFA 1WOUA 3LEFA 1GP1A 3TGZA 2HFDA 2XBQA 3ZVJD 3ZYWA 3ZITA 1T00A 4ZB8A 4BVYA 3RPNA 3GSSA 4HI7A 3QFBC 5ELAA 1AQVA 4DVCA 2JSYA 4TR1B 2GLRA 5IO0A 4WEYA 1K0BA 1VRSD 2LNSA 2C0FA 4NMUA 4KX4A 2L57A 3GL3A 2GSTA 2IMDA 2HI7A 1ZYPA 1TTZA 1EGRA 2E2GA 4WETA 2TRCP 4O92A 3HXSA 4OFMA 3G7YA 4YQUA 4ICYA 3F8UA 4ISDA 2B5XA 3LXZA 1M7TA 1X9WB 3ZRDA 3DGQA 5H5QA 5ECOB 2RLIA 4ZL8A 1V2AA 1GSFA 4TR1A 3A2VA 3KMOA 5EPFA 3EU3A 1Z9HA 4XIHA 2OBKA 18GSA 3F4RA 2YOIA 2CX3A 2WULA 1TK0B 4YKFA 3I9V2 1ZGNA 3J7Yb 2F3MA 2H1GA 2YWIA 2CZ3A 4Z2TA 4V1Ag 1PN0A 4WKWA 2ON5A 3C1SA 2VL2A 4PQIA 4KA0A 1Q98A 2L4QA 5ID2B 4BPYA 3F3QA 1EOGA 1THOA 2B5EA 5KEJA 1T3BA 2H6ZA 1TU7A 3MIXA 1SJIA 1V9WA 2DIYA 4XHMA 4EUYA 1AXDA 3GKNA 5D9XA 3LYPA 1HYUA 2I1UA 2CA8A 2LRCA 1W4VA 2H70A 3GFKA 12GSA 5IMVA 3FHKA 5KN0A 3L9UA 4PQHA 4MJEA 1YQ1A 1AAZA 2VUPA 3UVHA 1HD2A 3HVXA 2HNLA 4X0XA 1QFNA 4YAVA 1NHYA 1V98A 2MMNA 1WMJA 3TKQA 3IC4A 2LNTA 5ECHB 3TOTA 3GRXA 4TXVA 1USBA 4ZXGA 1G6WA 2B7JA 5A4VA 4NV5A 5CREA 4IBPA 4ZIJA 3O3TA 6GSXA 1YKCA 4GCIA 5G31A 5IMZA 1ZL9A 2D2ZA 1BJXA 1N2AA 3G7JA 4O5QA 5D8IA 14GSA 2R4VA 3I69A 3WYWA 1B4QA 5ECKB 2WS2A 2P5RA 3DMLA 1TW9A 2GSRA 4J2FA 4G0LA 2WRTA 2GZPA 3ISOA 1BAYA 2GQLA 5IMCA 3U5RE 2KP2A 5C00A 1SK0A 3QPMA 2YP6A 1PKWA 3KTBA 2ALBA 2OE1A 4IW9A 2H1BA 3KIJA 4G2EA 3DVXA 4TXOA 3EE2A 1FOVA 3DRNA 4MABA 5IMFA 1X0RA 5G1LA 1GTIA 3KGKA 1B4PA 2V32A 3LGCA 3UOMA 2JADA 4DSRA 4K7NA 3ZMLA 4GF0A 1XCCA 3KXOA 5AISA 2CT6A 3MYDA 2G0FA 3TJJA 3F9UA 3FZ4A 5JWQB 2H01A 5LD0A 5ENUA 3FY7A 1K3LA 2BTOT 1JZWA 5IO2A 2LUSA 4FYCA 3C1RA 2WJUA 1KEBA 2GDRA 3D6IA 1FB6A 5E59A 3WT1A 4ZL7A 3GH9A 3EPTA 1VF1A 2JACA 1MDKA 2H75A 2LEGA 2EIRA 3UIWA 1DSBA 4XS1A 4HS1A 3ZVJA 5E4WA 1GNEA 1S3DA 1XOAA 2VD1A 4OO4A 2VIMA 1GSEA 3GSTA 1ERUA 2VLTA 4MF5A 4F03A 2IWTA 1YY7A 5HFIA 1URMA 3P7XA 1O8WA 1F9MA 2KOKA 2IN3A 1TI3A 1ZCPA 3ZLPA 4XS4B 4MPGA 4I5QA 2VD0A 4NWYA 4PGTA 2YPMA 2HZEA 1V58A 3RAZA 1PA3A 3BCKA 3VWVA 4ZL9A 3D5JA 1OKDA 5CRWA 2L6CA 1A0FA 4IJ3A 4TW5A 1G7EA 2VCVA 4TKYA 1ON4A 1M0UA 2OA7A 3ME8A 1OVNA 1SKSB 4FH8A 5HR1A 1R5AA 4GSTA 1O73A 2H8LA 2VOCA 2MMOA 2MZCA 4MH3A 4IP1A 3Q6OA 4XS4A 3QDNA 4GSSA 3GH6A 1QQ2A 2JL4A 1XPVA 2GZZA 3M9JA 1K0OA 1UVZA 4CY6A 1SD8A 1K0CA 1HNBA 1YJ6A 3IAS2 3CMIA 1X9SB 2AB6A 3FW2A 1AUCA 3IBHA 3EVIA 4WXTA 1O6JA 1QXHA 4MF6A 5G1KA 2FD3A 4K0GA 1Q4JA 4K2DA 2IPAA 1WIKA 1BG5A 3D0ZA 3LSZA 4KSOA 1I9DA 1PL1A 1V57A 2PPTA 5CAXA 2YZHA 1FG4A 3IK9A 5D96A 5IM9A 2J9HA 3NIVA 5DJLA 4EIQA 5CRDA 1SL0B 2A4VA 1TP9A 3D4TA 5GZZB 4MH2A 2FGXA 3UBLA 3GX8A 4MP4A 2QA2A 3N9JA 1FO5A 3VLNA 3CRTA 2EC4A 1XW5A 4NV2A 2F8FA 4IN0A 4A5PA 1LJRA 1XVWA 5F8BA 1XOBA 1WE0A 1TRUA 3BJ5A 3A5WA 5DVBA 1M9BA 4TN8A 4HEA2 2H0IA 3H8QA 2IFQA 5F06A 3E3EA 2DMMA 1O7UA 1BX9A 4KNDA 1K0NA 2A4HA 1A23A 1JFUA 5A5KA 2FWEA 2R0CA 4AF2A 1SL2B 2DLXA 3Q18A 2YN1A 2HSYA 4NPBA 2GT6A 1ILOA 4USSA 1EEJA 4MA9A 3RBTA 4RI7A 2XHFA 3G9BA 5DAKA 3IRAA 1JLVA 1GSDA 5ELGA 3O76A 1XWCA 5DALA 2K18A 3EMXA 3HYPA 5FWGA 2VL3A 1GNWA 3TRQA 2CZ2A 5GSSA 4TOPA 5CRHA 2J23A 2C1YA 1TRSA 1K0MA 5KOXA 3S9FA 4GRFA 5G5EA 2C8UA 2QC7A 4BVYB 4TR4A 3W6GA 1GTBA 3TJFA 2VL9A 2O85A 1OAZA 2KUCA 3R2QA 2F9SA 1Z5YE 3HVSA 4WBRD 4DEJA 2H76A 3HJMA 3FEUA 3FMWA 1KBNA 13GSA 2DIZA 4V2MA 1H75A 2NVLA 1R4WA 1QK8A 3EMPA 3WGEA 5IMAA 3QR6A 1A8LA 1GUHA 2FUG2 3TUEA 1EP8A 2V2GA 3C71A 4BA7A 2A2RA 10GSA 3E0UA 4JU5A 3P90A 1KNGA 4GTUA 2PVOC 1ZYNA 4J56E 4POLA 4G0KA 2CAIA 2VLUA 1LBKA 4ULXA 3FK8A 4OMVA 3DEXA 3E9JB 3HDCA 4RQRA 2B5YA 5HR0A 4F82A 3GYKA 3TDGA 1RQMA 2NTOA 1XWBA 3HA9A 5A4UA 5GAPD 3HCZA 4OFTA 2M46A 1A8YA 1R5PA 3FR3A 4IJIA 1T7PB 1VF3A 4PTSA 5ECNB 2MMAA 2UZ8A 3CXGA 1DUGA 3IOSA 2I3YA 2OE0A 3FYGA 1J08A 2LJRA 3F0IA 3EYTA 3VPTA 3RPPA 3JCML 1UN2A 5H5RA 3CRUA 4EDYA 1TRWA 1X9MB 4HJMA 1GUKA 2FHEA 4KUNA 2TIRA 4RUVA 1GTAA 5H5SA 5DCGA 1ERVA 20GSA 2OBIA 2LKUA 9GSSA 2MBSA 4IGJA 4NXIA 4K1FA 4CHSA 1B48A 5JWOB 5JCWA 4KCAA 2C0GA 3ZIVA 1H4OA 3APSA 3HJPA 2HE3A 3ZTLA 4YQMA 5BRTA 3ZIJA 2GT5A 22GSA 4NAXA 2IMKA 4O7HA 2PGTA 1TRVA 2V1MA 4EF0A 1X5EA 1E2YA 1F3AA 5G30A 4EXJA 1OYJA 3KM6A 3M3MA 5J41A 3KTLA 5IQYA 3A3TA 1XXUA 3MAKA 4GXZA 2TRXA 4E8EA 1GTUA 2HZFA 4K0NA 3UARA 2K9FA 2N5BA 2H66A 2H6XA 2MBTA 1B9YC 4IKHA 3IDVA 4HDEA 1TKDB 2VCWA 4ML6A 5ECMB 1ZZYA 5DCHA 2BJXA 16GSA 1GSUA 5HR3A 2GZYA 3VPQA 4TXOB 4HQZA 1Z3EA 3C73A 1F2EA 1OC8A 1GSYA 4HZ4A 6GSWA 1NHOA 1MDIA 2L5LA 2OADA 3HZ4A 5IPHA 3HHVA 4XCSA 2OACA 2LS5A 1PD21 1OC3A 1HNCA 3IPZA 3GX0A 1XIYA 1K0AA 2X8CA 3HZ8A 3HY2A 3ZZXA 1GWCA 2I9HA 1J9BA 3VWWA 5AIVA 3W8JA 4H86A 3RDWA 1SK1A 1ERTA 1YEXA 4YAPA 4KCEA 4LMWA 2HRKA 3D22A 3AY8A 3GN3A 4MPFA 3H93A 3WD6A 3F4TA 3GTUA 2K8VA 4F0BA 5GSTA 2JZRA 4ECBA 2YJHA 1JHBA 3KEBA 4L5LA 4Q5FA 3I6AA 4EIPA 4POMA 1O81A 2O89A 1AW9A 2R2JA 3KH9A 3QFAC 1W89A 2CV4A 2VO4A 1CQGA 4DSSA 1THXA 3F63A 3UL3A 1PKZA 2HRNA 3ZL5A 4PURA 2HZEB 4I97A 4Z2RA 6GSSA 2VCZA 1KTEA 2I4AA 2QKEA 1WWJA 4FYUA 3TKSC 2E0QA 3TOUA 2I81A 2B1KA 3CTFA 4K7OA 5HR2A 2WFCA 5B7CA 1SL1B 5D9TA 1GULA 1A2MA 2C0EA 1DE1A 3UBKA 1GL8A 3ZFLA 5HFKA 2V6OA 5CRGA 2YV9A 1FOHA 1XWGA 4ZB6A 5DJMA 3TKSE 3KP8A 1B9XC 4OWYA 5ABRA 2FCHA 3M8NA 2FA8A 3QD9A 4I6XA 3ZFBA 3ERGA 1FVKA 1T4YA 4FO5A 4WBJA 4KSMA 4HUAA 2E7PA 4KE3A 1JZDA 4K6XA 3H79A 1X5CA 1AIUA 4IQAA 4X1UA 2B7KA 3LFLA 2HSHA 3M0FA 1CQHA 2QGVA 3J7Yk 1XBSA 5JWRB 1BYEA 1X5DA 4EL1A 1TJDA 4NHWA 4HOJA 4AJ7A 4GQCA 1EP7A 1M2AA 4OO5A 1GH2A 1PQNA 4KF9A 1E6BA 2YWMA 4ZB9A 19GSA 3UMAA 4K7IA 2HXKA 3M9KA 1R26A 4YKGA 2H30A 4LA1A 2H74A 1G6YA 3PR8A 2GS3A 4JEDA 3DKSA 3M1GA 2XC2A 2JSZA 6GSVA 1A2JA 3BCIA 5ECPB 5INYA 4J57E 1SK2A 4TVEA 2P0GA 2H71A 2HYXA 2ES7A 3DVWA 3H1NA 2YNXA 2VM1A 1U88A 2H72A 3ME7A 5D73A 4YH2A 5IPGA 3L9VA 1RW1A 3BBYA 1XVQA 2YWNA 2YCDA 3L78A 3W8SA 4K9ZA 5KN2A 1A2LA 4PXOA 1ABAA 4AJ8A 2DC5A 1SKRB 2IFQB 4EVMA 2OKAA 2X99A 1ML6A 1OE7A 2P5QA 1TXXA 2XPDA 1XW9A 2O87A 3FZ5A 4I8BA 1WPIA 4LL1B 2X4AA 2YV7A 3HJOA 3VK9A 1GUMA 5EL8A 4JR6A 1AC1A 1T8EB 3QOUA 3GIXA 2X49A 4ML1A 3D21A 4TR3A 2OE3A 5DAKB 3UVTA 4FYBA 2JU5A 5DALB 1I5GA 3APQA 3KZQA 5D9VA 2C4JA 1TOFA 3FZ9A 4KH7A 2PBJA 1EGOA 3FRCA 2GSSA 3VI7A 2L6DA 3KJYA 1NW2A 5AN1A 2R3XA 5HFGA 1WRYA 3L4NA 5DBQA 2JZTA 3GKMA 4LLRA 4ECIA 3V1WA 5J9CA 2DKHA 3GV1A 8GSSA 4JBBA 3KH7A 2ON7A 1VGLA 5CYYA 1GSSA 1SD9A 4Z2UA 4K2XA 3TKSA 1MDJA 3BOAA 2CVBA 1GSQA 5JCUA 4TR0A 2VCQA 3KMNA 3VFIA 4YQVA 1OC9B 2DBCA 3QMXA 4OD7A 4GSNA 3VWXA 1F6MC 1M2DA 4POKA 1YEPA 4ILFA 2DJ0A 1OKTA 5B8AA 4PQ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WB9 A;  2FLS A;  2GGT A;  3IAM 2;  4LMV A;  4MLY A;  3QAV A;  4XRA A;  4MF7 A;  4V2L A;  2LST A;  3GNJ A;  1ZMA A;  3GA4 A;  1ZYE A;  3LYK A;  3H4K A;  1A24 A;  1FHE A;  2AAW A;  4HU7 A;  3TRP A;  4MZC A;  4WF5 A;  2KP1 A;  1OC9 A;  1YZX A;  2VLV A;  3L9S A;  2NBS A;  2GQK A;  1S3A A;  1SJ6 A;  3F4S A;  3ED3 A;  2B3S A;  1VF4 A;  5J5N A;  4BVX A;  3NOF A;  4RQX A;  3FKF A;  5DQS A;  3CTG A;  3FR6 A;  2KHP A;  4EE0 A;  6GSY A;  2IJY A;  2DJ3 A;  1VF2 A;  5COH A;  3Q19 A;  3IR4 A;  2WZ9 A;  1FAA A;  5AIX A;  4ZIL A;  3RHC A;  1N8J A;  2C3Q A;  1UA5 A;  3LG6 A;  3ZRE A;  1BED A;  1YKA A;  2R5G A;  4JR4 A;  2IL3 A;  5CP1 A;  2FWH A;  5A4W A;  2P31 A;  5ECR B;  2X8G A;  3GKX A;  2KLX A;  4BL7 A;  5ECQ B;  1J0F A;  2VAF A;  5J3R A;  1FW1 A;  3GL5 A;  2RUF A;  2RII A;  2PER A;  1SJZ A;  2NPB A;  2LRN A;  2IIY A;  3QAW A;  2O8V B;  4IS0 A;  1DE2 A;  2HT9 A;  2A2S A;  3I43 A;  4TRX A;  2V6K A;  1SYX A;  1V40 A;  5B8B A;  1K0D A;  3LWA A;  3GHA A;  4BWQ A;  1ST9 A;  4LL4 B;  1C72 A;  3IE3 A;  1PGT A;  3A2W A;  1ZOF A;  5IOW A;  5J9B A;  3CSJ A;  2PUK C;  3LJR A;  2GSQ A;  1F3B A;  2GQM A;  3IA1 A;  4I2T A;  4F2I A;  1R7H A;  4N30 A;  2LTK A;  2LRT A;  3CBU A;  5L71 A;  4QL7 A;  4EC0 A;  3EU4 A;  2IMF A;  3KD0 A;  4POB A;  1UC7 A;  3TCO A;  1G7O A;  2DJ2 A;  5CNW A;  1JLW A;  2CVK A;  4PX1 A;  2ZUP A;  4CDO A;  1HQO A;  3TJG A;  2YJ7 A;  3PIN A;  1SYR A;  4KAE A;  2B1L A;  5IIZ A;  4N10 A;  2AHE A;  1MEK A;  4EKZ A;  1TDI A;  2LJK A;  1PRX A;  1Y25 A;  2VM2 A;  3K8N A;  3F6F A;  1A0R P;  4JRR A;  1M2B A;  3O6T A;  4MJB A;  1IYI A;  3TRX A;  1U6T A;  4CW9 A;  1XWA A;  2AUV A;  1K3Y A;  4XRD A;  2H1D A;  2XPE A;  2AYT A;  4OCF A;  5ID2 A;  2M72 A;  3WT2 A;  4Q5Q A;  1IYH A;  1JZR A;  3F6D A;  4IEL A;  1PX6 A;  3KCM A;  2E2M A;  4L8E A;  1MTC A;  4KDY A;  4Q5R A;  2CAQ A;  5B6N A;  2MYG A;  4N0Z A;  4GLT A;  2EIO A;  3GTU B;  4O32 A;  3UJ1 A;  3UEM A;  5FT3 A;  2MMZ A;  1F37 A;  3Q74 A;  2H6Y A;  5GAN D;  5EY6 A;  4WF4 A;  1SEN A;  2C0D A;  2RM6 A;  1EV4 A;  4IHU A;  4ID0 A;  2V41 A;  11GS A;  4Z7X A;  2GTU A;  3P8W A;  1LU4 A;  4DSS B;  1M99 A;  2G2Q A;  4MZW A;  1EWX A;  5G2Z A;  2FWG A;  4ECC A;  5D93 A;  3DXB A;  3IXR A;  2IME A;  4EO3 A;  4QL9 A;  2FWF A;  1YF1 A;  3ERF A;  1DBY A;  2C80 A;  4KDU A;  2K8S A;  5D9W A;  2YZU A;  4MMM A;  1Y6E A;  1EOH A;  1ACV A;  2N5F A;  3EWL A;  2OJL A;  3EIN A;  1GLP A;  2QSI A;  3C8E A;  5F07 A;  4XTS A;  4P3Y B;  3PH9 A;  2DML A;  6GSU A;  3TJK A;  4E8H A;  1XFL A;  2BMX A;  2CVD A;  4JE1 A;  4FIW A;  4JZQ A;  1FVJ A;  6GST A;  3GUS A;  1XZO A;  2H1A A;  2K6V A;  1ERW A;  1PL2 A;  2PU9 C;  5HQP A;  4KB3 A;  1M9A A;  2XBI A;  4K8M A;  1QGV A;  3DWV A;  3IHQ A;  2FA4 A;  5IMD A;  2X8H A;  1QMV A;  3LOR A;  3DIE A;  2VCX A;  1FB0 A;  3U6V A;  2GVP A;  2DJK A;  4IQ1 A;  1JZO A;  4DSQ A;  1O8X A;  2R6K A;  2L4C A;  2DSA A;  4WR4 A;  4HJ2 A;  4MJA A;  3SBC A;  1OE8 A;  5J4U A;  5KN1 A;  2PN8 A;  4GWR A;  3CSI A;  2RM5 A;  1O85 A;  5IOX A;  5AGY A;  4AJ6 A;  4PUF C;  1K3O A;  2NDO A;  2DJ1 A;  1YDK A;  1T4Z A;  4HQS A;  4KW6 A;  4BWS A;  2H73 A;  4ECJ A;  1NM3 A;  3LXT A;  4ZBD A;  1SU9 A;  4N0V A;  4NHZ A;  5JCG A;  2PVQ A;  4F0C A;  4RI6 A;  4G9H A;  1SKW B;  3GMF A;  5C04 A;  1QUW A;  1S3C A;  3RHB A;  1Z6M A;  1TK5 B;  3SWL A;  2H19 A;  1AQX A;  1YF0 A;  1Z6N A;  3GUR A;  2F51 A;  3L0H A;  2DJJ A;  5LNK e;  3APO A;  3EUR A;  4L0U A;  3PGT A;  4F9Z A;  1MD4 A;  4D73 B;  2AJQ B;  5F05 A;  4MJC A;  4ZBB A;  2Z9S A;  4I2U A;  1RK4 A;  4IP6 A;  1U3I A;  5ECI B;  2N5A A;  1PN9 A;  1U3A A;  4MDC A;  4L0W A;  2LQQ A;  1HNA A;  3A2X A;  2L59 A;  4EDZ A;  1EZK A;  2WCI A;  2C3N A;  4ZBA A;  3KP9 A;  3GKK A;  1NSW A;  4MZB A;  1Z7R A;  2AV4 A;  5KN3 A;  1T1V A;  3IV4 A;  7GSS A;  2FY6 A;  2LJA A;  5ECS A;  2ZNM A;  5LCZ A;  5F0G A;  17GS A;  4HZ2 A;  2O7K A;  2HRF A;  1PX7 A;  4AGS A;  4D73 A;  3G7I A;  3LQ7 A;  4QQ7 A;  3ZMK A;  1WP0 A;  2H0G A;  2YAN A;  1PSQ A;  4PNF A;  1Z7P A;  3VUR A;  4WR5 A;  5B6M A;  4G19 A;  3C7M A;  4KDX A;  4PUA A;  4Q5N A;  2PMT A;  2WDU A;  3TJB A;  2H0H A;  1TK8 B;  5DQY A;  2FNO A;  2VL2 C;  4V1A p;  1EV9 A;  4XS6 A;  3WGD A;  2X64 A;  2R37 A;  5EVO A;  3CSH A;  2ZCT A;  1AQW A;  3HVV A;  4KGI A;  2B6M A;  4L5O A;  3OR5 A;  2EIQ A;  4V2N A;  3UAP A;  2M80 A;  5FHI A;  1BQ7 A;  1XWK A;  3HKR A;  1WJK A;  2RUE A;  3CYN A;  3DYR A;  1TI1 A;  4PNG A;  3ERW A;  2LV3 A;  5DDL A;  3TKR A;  4MK3 A;  1MD3 A;  2YWO A;  3P2A A;  4OCE A;  1EEM A;  2PWJ A;  3MNG A;  1GLQ A;  2WGR A;  3FR9 A;  3TKP A;  3TB2 A;  2VCT A;  2L5O A;  5ECL B;  1XW6 A;  3MDK A;  4N11 A;  1PMT A;  4X43 A;  3VWU A;  1U87 A;  3MWH A;  3EC3 A;  1B8X A;  3N5O A;  3BD2 A;  3DD3 A;  4IVF A;  2IMI A;  1GRX A;  3MSZ A;  2HLS A;  3FZA A;  2LQO A;  5G5F A;  3WGX A;  3QCP A;  2CX4 A;  4OFN A;  4HU9 A;  4MCU A;  4G10 A;  3QAG A;  2CQ9 A;  3HD5 A;  5CO3 A;  3VI5 A;  3F3R A;  2JZS A;  3US3 A;  4ACS A;  3NZN A;  1G0T A;  3IK7 A;  2C3T A;  2F8A A;  1TU8 A;  2REM A;  1ZYQ B;  3D4M A;  4O5R A;  4GQF A;  1WOU A;  3LEF A;  1GP1 A;  3TGZ A;  2HFD A;  2XBQ A;  3ZVJ D;  3ZYW A;  3ZIT A;  1T00 A;  4ZB8 A;  4BVY A;  3RPN A;  3GSS A;  4HI7 A;  3QFB C;  5ELA A;  1AQV A;  4DVC A;  2JSY A;  4TR1 B;  2GLR A;  5IO0 A;  4WEY A;  1K0B A;  1VRS D;  2LNS A;  2C0F A;  4NMU A;  4KX4 A;  2L57 A;  3GL3 A;  2GST A;  2IMD A;  2HI7 A;  1TTZ A;  1EGR A;  2E2G A;  4WET A;  2TRC P;  4O92 A;  3HXS A;  4OFM A;  3G7Y A;  4YQU A;  3F8U A;  4ISD A;  2B5X A;  3LXZ A;  1M7T A;  1X9W B;  3ZRD A;  3DGQ A;  5H5Q A;  5ECO B;  2RLI A;  4ZL8 A;  1V2A A;  1GSF A;  4TR1 A;  3A2V A;  3KMO A;  5EPF A;  3EU3 A;  1Z9H A;  4XIH A;  2OBK A;  18GS A;  3F4R A;  2YOI A;  2CX3 A;  2WUL A;  1TK0 B;  3I9V 2;  1ZGN A;  3J7Y b;  2F3M A;  2H1G A;  2YWI A;  2CZ3 A;  4V1A g;  4WKW A;  2ON5 A;  3C1S A;  2VL2 A;  4PQI A;  4KA0 A;  1Q98 A;  2L4Q A;  5ID2 B;  4BPY A;  3F3Q A;  1EOG A;  1THO A;  2B5E A;  5KEJ A;  1T3B A;  2H6Z A;  1TU7 A;  1SJI A;  1V9W A;  2DIY A;  4XHM A;  4EUY A;  1AXD A;  3GKN A;  5D9X A;  3LYP A;  1HYU A;  2I1U A;  2CA8 A;  2LRC A;  1W4V A;  2H70 A;  3GFK A;  12GS A;  5IMV A;  3FHK A;  5KN0 A;  3L9U A;  4PQH A;  4MJE A;  1YQ1 A;  1AAZ A;  2VUP A;  3UVH A;  1HD2 A;  3HVX A;  2HNL A;  4X0X A;  1QFN A;  4YAV A;  1NHY A;  1V98 A;  2MMN A;  1WMJ A;  3TKQ A;  3IC4 A;  5ECH B;  2LNT A;  3TOT A;  3GRX A;  4TXV A;  1USB A;  4ZXG A;  1G6W A;  2B7J A;  5A4V A;  4NV5 A;  5CRE A;  4IBP A;  4ZIJ A;  3O3T A;  6GSX A;  1YKC A;  4GCI A;  5G31 A;  5IMZ A;  1ZL9 A;  2D2Z A;  1BJX A;  1N2A A;  3G7J A;  5D8I A;  14GS A;  2R4V A;  3I69 A;  3WYW A;  1B4Q A;  5ECK B;  2WS2 A;  2P5R A;  3DML A;  1TW9 A;  2GSR A;  4J2F A;  2WRT A;  2GZP A;  3ISO A;  1BAY A;  2GQL A;  5IMC A;  3U5R E;  2KP2 A;  5C00 A;  1SK0 A;  3QPM A;  2YP6 A;  1PKW A;  3KTB A;  2ALB A;  2OE1 A;  4IW9 A;  2H1B A;  3KIJ A;  4G2E A;  3DVX A;  4TXO A;  3EE2 A;  1FOV A;  3DRN A;  4MAB A;  5IMF A;  1X0R A;  5G1L A;  1GTI A;  3KGK A;  1B4P A;  2V32 A;  3LGC A;  3UOM A;  2JAD A;  4DSR A;  4K7N A;  3ZML A;  4GF0 A;  1XCC A;  3KXO A;  5AIS A;  2CT6 A;  2G0F A;  3TJJ A;  3F9U A;  3FZ4 A;  5JWQ B;  2H01 A;  5LD0 A;  5ENU A;  3FY7 A;  1K3L A;  2BTO T;  1JZW A;  5IO2 A;  2LUS A;  4FYC A;  3C1R A;  2WJU A;  1KEB A;  2GDR A;  3D6I A;  1FB6 A;  5E59 A;  3WT1 A;  4ZL7 A;  3GH9 A;  1VF1 A;  2JAC A;  1MDK A;  2H75 A;  2LEG A;  2EIR A;  3UIW A;  1DSB A;  4XS1 A;  4HS1 A;  3ZVJ A;  5E4W A;  1GNE A;  1S3D A;  1XOA A;  2VD1 A;  4OO4 A;  2VIM A;  1GSE A;  3GST A;  1ERU A;  2VLT A;  4MF5 A;  4F03 A;  2IWT A;  1YY7 A;  5HFI A;  1URM A;  3P7X A;  1O8W A;  1F9M A;  2KOK A;  2IN3 A;  1TI3 A;  1ZCP A;  3ZLP A;  4XS4 B;  4MPG A;  4I5Q A;  2VD0 A;  4NWY A;  4PGT A;  2YPM A;  2HZE A;  1V58 A;  3RAZ A;  1PA3 A;  3BCK A;  3VWV A;  4ZL9 A;  3D5J A;  1OKD A;  5CRW A;  2L6C A;  1A0F A;  4IJ3 A;  4TW5 A;  1G7E A;  2VCV A;  4TKY A;  1ON4 A;  1M0U A;  2OA7 A;  3ME8 A;  1OVN A;  1SKS B;  4FH8 A;  5HR1 A;  1R5A A;  4GST A;  1O73 A;  2H8L A;  2VOC A;  2MMO A;  2MZC A;  4MH3 A;  4IP1 A;  3Q6O A;  4XS4 A;  3QDN A;  4GSS A;  3GH6 A;  1QQ2 A;  2JL4 A;  1XPV A;  2GZZ A;  3M9J A;  1K0O A;  1UVZ A;  1SD8 A;  1K0C A;  1HNB A;  1YJ6 A;  3IAS 2;  3CMI A;  1X9S B;  2AB6 A;  3FW2 A;  1AUC A;  3IBH A;  3EVI A;  4WXT A;  1O6J A;  1QXH A;  4MF6 A;  5G1K A;  2FD3 A;  4K0G A;  1Q4J A;  4K2D A;  2IPA A;  1WIK A;  1BG5 A;  3D0Z A;  3LSZ A;  4KSO A;  1I9D A;  1PL1 A;  1V57 A;  2PPT A;  5CAX A;  2YZH A;  1FG4 A;  3IK9 A;  5D96 A;  5IM9 A;  2J9H A;  3NIV A;  5DJL A;  5CRD A;  1SL0 B;  2A4V A;  1TP9 A;  3D4T A;  5GZZ B;  4MH2 A;  2FGX A;  3UBL A;  3GX8 A;  4MP4 A;  3N9J A;  1FO5 A;  3VLN A;  3CRT A;  2EC4 A;  1XW5 A;  4NV2 A;  2F8F A;  4IN0 A;  1LJR A;  1XVW A;  5F8B A;  1XOB A;  1WE0 A;  1TRU A;  3BJ5 A;  3A5W A;  5DVB A;  1M9B A;  4TN8 A;  4HEA 2;  2H0I A;  3H8Q A;  2IFQ A;  5F06 A;  3E3E A;  2DMM A;  1O7U A;  1BX9 A;  4KND A;  1K0N A;  1A23 A;  1JFU A;  5A5K A;  2FWE A;  4AF2 A;  1SL2 B;  2DLX A;  3Q18 A;  2YN1 A;  2HSY A;  4NPB A;  2GT6 A;  1ILO A;  1EEJ A;  4MA9 A;  3RBT A;  4RI7 A;  2XHF A;  3G9B A;  5DAK A;  3IRA A;  1JLV A;  1GSD A;  5ELG A;  3O76 A;  1XWC A;  5DAL A;  2K18 A;  3EMX A;  3HYP A;  5FWG A;  2VL3 A;  1GNW A;  3TRQ A;  2CZ2 A;  5GSS A;  4TOP A;  5CRH A;  2J23 A;  2C1Y A;  1TRS A;  1K0M A;  3S9F A;  4GRF A;  5G5E A;  2C8U A;  2QC7 A;  4TR4 A;  3W6G A;  1GTB A;  3TJF A;  2VL9 A;  2O85 A;  1OAZ A;  2KUC A;  3R2Q A;  2F9S A;  1Z5Y E;  3HVS A;  4WBR D;  4DEJ A;  2H76 A;  3HJM A;  3FEU A;  1KBN A;  13GS A;  2DIZ A;  4V2M A;  1H75 A;  2NVL A;  1R4W A;  1QK8 A;  3EMP A;  3WGE A;  5IMA A;  3QR6 A;  1A8L A;  1GUH A;  2FUG 2;  3TUE A;  1EP8 A;  2V2G A;  3C71 A;  4BA7 A;  2A2R A;  10GS A;  3E0U A;  4JU5 A;  3P90 A;  1KNG A;  4GTU A;  2PVO C;  4J56 E;  4POL A;  2CAI A;  2VLU A;  1LBK A;  4ULX A;  3FK8 A;  4OMV A;  3DEX A;  3E9J B;  3HDC A;  4RQR A;  2B5Y A;  5HR0 A;  4F82 A;  3GYK A;  3TDG A;  1RQM A;  2NTO A;  1XWB A;  3HA9 A;  5A4U A;  5GAP D;  3HCZ A;  4OFT A;  2M46 A;  1A8Y A;  1R5P A;  3FR3 A;  4IJI A;  1T7P B;  1VF3 A;  5ECN B;  2MMA A;  3CXG A;  1DUG A;  3IOS A;  2I3Y A;  2OE0 A;  3FYG A;  1J08 A;  2LJR A;  3F0I A;  3EYT A;  3VPT A;  3RPP A;  3JCM L;  1UN2 A;  5H5R A;  3CRU A;  4EDY A;  1TRW A;  1X9M B;  4HJM A;  1GUK A;  2FHE A;  4KUN A;  2TIR A;  4RUV A;  1GTA A;  5H5S A;  5DCG A;  1ERV A;  20GS A;  2OBI A;  2LKU A;  9GSS A;  2MBS A;  4IGJ A;  4NXI A;  4K1F A;  4CHS A;  1B48 A;  5JWO B;  5JCW A;  4KCA A;  2C0G A;  3ZIV A;  1H4O A;  3APS A;  3HJP A;  2HE3 A;  3ZTL A;  4YQM A;  3ZIJ A;  2GT5 A;  22GS A;  4NAX A;  2IMK A;  4O7H A;  2PGT A;  1TRV A;  2V1M A;  4EF0 A;  1X5E A;  1E2Y A;  1F3A A;  5G30 A;  4EXJ A;  1OYJ A;  3KM6 A;  3M3M A;  5J41 A;  3KTL A;  5IQY A;  3A3T A;  1XXU A;  3MAK A;  4GXZ A;  2TRX A;  4E8E A;  1GTU A;  2HZF A;  4K0N A;  3UAR A;  2K9F A;  2N5B A;  2H66 A;  2H6X A;  2MBT A;  1B9Y C;  4IKH A;  3IDV A;  4HDE A;  1TKD B;  2VCW A;  4ML6 A;  5ECM B;  1ZZY A;  5DCH A;  2BJX A;  16GS A;  1GSU A;  5HR3 A;  2GZY A;  3VPQ A;  4TXO B;  4HQZ A;  1Z3E A;  3C73 A;  1F2E A;  1OC8 A;  1GSY A;  4HZ4 A;  6GSW A;  1NHO A;  1MDI A;  2L5L A;  2OAD A;  3HZ4 A;  5IPH A;  3HHV A;  4XCS A;  2OAC A;  2LS5 A;  1PD2 1;  1OC3 A;  1HNC A;  3IPZ A;  3GX0 A;  1XIY A;  1K0A A;  2X8C A;  3HZ8 A;  3HY2 A;  3ZZX A;  1GWC A;  2I9H A;  1J9B A;  3VWW A;  5AIV A;  3W8J A;  4H86 A;  3RDW A;  1SK1 A;  1ERT A;  1YEX A;  4YAP A;  4KCE A;  4LMW A;  3D22 A;  3AY8 A;  3GN3 A;  4MPF A;  3H93 A;  3WD6 A;  3F4T A;  3GTU A;  2K8V A;  4F0B A;  5GST A;  2JZR A;  4ECB A;  2YJH A;  1JHB A;  3KEB A;  4L5L A;  4Q5F A;  3I6A A;  4POM A;  1O81 A;  2O89 A;  1AW9 A;  2R2J A;  3KH9 A;  3QFA C;  1W89 A;  2CV4 A;  2VO4 A;  1CQG A;  4DSS A;  1THX A;  3F63 A;  3UL3 A;  1PKZ A;  2HRN A;  3ZL5 A;  4PUR A;  2HZE B;  4I97 A;  6GSS A;  2VCZ A;  1KTE A;  2I4A A;  2QKE A;  1WWJ A;  4FYU A;  3TKS C;  2E0Q A;  3TOU A;  2I81 A;  2B1K A;  3CTF A;  4K7O A;  5HR2 A;  2WFC A;  5B7C A;  1SL1 B;  5D9T A;  1GUL A;  1A2M A;  2C0E A;  1DE1 A;  3UBK A;  1GL8 A;  3ZFL A;  5HFK A;  2V6O A;  5CRG A;  2YV9 A;  1XWG A;  4ZB6 A;  5DJM A;  3TKS E;  3KP8 A;  1B9X C;  4OWY A;  5ABR A;  2FCH A;  3M8N A;  2FA8 A;  3QD9 A;  4I6X A;  3ZFB A;  3ERG A;  1FVK A;  1T4Y A;  4FO5 A;  4WBJ A;  4KSM A;  4HUA A;  2E7P A;  4KE3 A;  1JZD A;  4K6X A;  3H79 A;  1X5C A;  1AIU A;  4IQA A;  4X1U A;  2B7K A;  3LFL A;  2HSH A;  3M0F A;  1CQH A;  2QGV A;  3J7Y k;  1XBS A;  5JWR B;  1BYE A;  1X5D A;  4EL1 A;  1TJD A;  4NHW A;  4HOJ A;  4AJ7 A;  4GQC A;  1EP7 A;  1M2A A;  4OO5 A;  1GH2 A;  1PQN A;  1E6B A;  2YWM A;  4ZB9 A;  19GS A;  3UMA A;  4K7I A;  2HXK A;  3M9K A;  1R26 A;  2H30 A;  4LA1 A;  2H74 A;  1G6Y A;  3PR8 A;  2GS3 A;  4JED A;  3DKS A;  3M1G A;  2XC2 A;  2JSZ A;  6GSV A;  1A2J A;  3BCI A;  5ECP B;  5INY A;  4J57 E;  1SK2 A;  4TVE A;  2P0G A;  2H71 A;  2HYX A;  2ES7 A;  3DVW A;  3H1N A;  2YNX A;  2VM1 A;  1U88 A;  2H72 A;  3ME7 A;  5D73 A;  4YH2 A;  5IPG A;  3L9V A;  1RW1 A;  3BBY A;  1XVQ A;  2YWN A;  2YCD A;  3L78 A;  3W8S A;  4K9Z A;  5KN2 A;  1A2L A;  4PXO A;  1ABA A;  4AJ8 A;  2DC5 A;  1SKR B;  2IFQ B;  4EVM A;  2OKA A;  2X99 A;  1ML6 A;  1OE7 A;  2P5Q A;  1TXX A;  2XPD A;  1XW9 A;  2O87 A;  3FZ5 A;  4I8B A;  1WPI A;  4LL1 B;  2YV7 A;  3HJO A;  3VK9 A;  1GUM A;  5EL8 A;  4JR6 A;  1AC1 A;  1T8E B;  3QOU A;  3GIX A;  4ML1 A;  3D21 A;  4TR3 A;  2OE3 A;  5DAK B;  3UVT A;  4FYB A;  2JU5 A;  5DAL B;  1I5G A;  3APQ A;  3KZQ A;  5D9V A;  2C4J A;  1TOF A;  3FZ9 A;  4KH7 A;  2PBJ A;  1EGO A;  3FRC A;  2GSS A;  3VI7 A;  2L6D A;  3KJY A;  1NW2 A;  5AN1 A;  2R3X A;  5HFG A;  1WRY A;  3L4N A;  5DBQ A;  2JZT A;  3GKM A;  4LLR A;  4ECI A;  3V1W A;  5J9C A;  3GV1 A;  8GSS A;  4JBB A;  3KH7 A;  2ON7 A;  1VGL A;  5CYY A;  1GSS A;  1SD9 A;  3TKS A;  1MDJ A;  3BOA A;  2CVB A;  1GSQ A;  5JCU A;  4TR0 A;  2VCQ A;  3KMN A;  3VFI A;  4YQV A;  1OC9 B;  2DBC A;  3QMX A;  4OD7 A;  4GSN A;  3VWX A;  1F6M C;  1M2D A;  4POK A;  1YEP A;  4ILF A;  2DJ0 A;  1OKT A;  5B8A A;  4PQ1 A; 
#chains in the Genus database with same CATH topology
 2WB9 A;  2FLS A;  2GGT A;  3IAM 2;  4LMV A;  4MLY A;  3QAV A;  4XRA A;  4MF7 A;  4V2L A;  2LST A;  3GNJ A;  1ZMA A;  3GA4 A;  1ZYE A;  3LYK A;  3H4K A;  1A24 A;  1FHE A;  2AAW A;  4HU7 A;  3TRP A;  4MZC A;  4WF5 A;  2KP1 A;  1OC9 A;  1YZX A;  2VLV A;  3L9S A;  2NBS A;  2GQK A;  1S3A A;  3PPU A;  1SJ6 A;  3F4S A;  3ED3 A;  2B3S A;  1VF4 A;  5J5N A;  4BVX A;  3NOF A;  4BL7 B;  4RQX A;  3FKF A;  5DQS A;  3CTG A;  3FR6 A;  2KHP A;  4EE0 A;  6GSY A;  2IJY A;  2DJ3 A;  1VF2 A;  5COH A;  3Q19 A;  3IR4 A;  2WZ9 A;  1FAA A;  5AIX A;  4ZIL A;  3RHC A;  1N8J A;  2R0P A;  3LW9 A;  2C3Q A;  1UA5 A;  3LG6 A;  3ZRE A;  1BED A;  1YKA A;  4O5U A;  2R5G A;  4JR4 A;  2IL3 A;  5CP1 A;  4FQU A;  2FWH A;  5A4W A;  2P31 A;  5ECR B;  2X8G A;  3GKX A;  2KLX A;  4BL7 A;  5ECQ B;  1J0F A;  2VAF A;  5J3R A;  1FW1 A;  3GL5 A;  2RUF A;  2RII A;  2PER A;  1SJZ A;  2NPB A;  2LRN A;  2IIY A;  3QAW A;  2O8V B;  4IS0 A;  1DE2 A;  2HT9 A;  2A2S A;  3I43 A;  4TRX A;  2V6K A;  1SYX A;  1V40 A;  5B8B A;  1K0D A;  3LWA A;  3GHA A;  4BWQ A;  1ST9 A;  4MNN A;  4LL4 B;  1C72 A;  3IE3 A;  1PGT A;  3A2W A;  1ZOF A;  5IOW A;  5J9B A;  3CSJ A;  2PUK C;  3LJR A;  2GSQ A;  1F3B A;  2GQM A;  3IA1 A;  4I2T A;  4F2I A;  1R7H A;  4N30 A;  2LTK A;  2LRT A;  3CBU A;  5L71 A;  4QL7 A;  4EC0 A;  3EU4 A;  2IMF A;  3KD0 A;  4POB A;  1UC7 A;  3TCO A;  1G7O A;  2DJ2 A;  5CNW A;  1JLW A;  2CVK A;  4PX1 A;  2ZUP A;  4CDO A;  1HQO A;  3TJG A;  2YJ7 A;  3PIN A;  4HSC X;  1SYR A;  4KAE A;  2B1L A;  5IIZ A;  4N10 A;  2AHE A;  1MEK A;  4EKZ A;  1TDI A;  2LJK A;  1PRX A;  1Y25 A;  2VM2 A;  3K8N A;  3F6F A;  1A0R P;  4JRR A;  1M2B A;  3O6T A;  4MJB A;  3IC8 A;  1IYI A;  3TRX A;  1U6T A;  4CW9 A;  1XWA A;  2AUV A;  1K3Y A;  4XRD A;  2H1D A;  2XPE A;  2AYT A;  4OCF A;  5ID2 A;  2M72 A;  3WT2 A;  4Q5Q A;  2R0G A;  1IYH A;  1JZR A;  2QA1 A;  3F6D A;  4IEL A;  1PX6 A;  3KCM A;  2E2M A;  4L8E A;  1MTC A;  4KDY A;  4Q5R A;  2CAQ A;  5B6N A;  2MYG A;  4N0Z A;  4GLT A;  2EIO A;  3GTU B;  4O32 A;  3UJ1 A;  4G0I A;  3UEM A;  5FT3 A;  2MMZ A;  1F37 A;  3Q74 A;  2HSM A;  2H6Y A;  5GAN D;  5EY6 A;  4WF4 A;  1SEN A;  2C0D A;  2RM6 A;  1EV4 A;  4IHU A;  4ID0 A;  2V41 A;  11GS A;  4Z7X A;  2GTU A;  3P8W A;  1LU4 A;  4DSS B;  1M99 A;  2G2Q A;  4MZW A;  1EWX A;  5G2Z A;  2FWG A;  4ECC A;  5D93 A;  3DXB A;  3IXR A;  2IME A;  4EO3 A;  4QL9 A;  2FWF A;  1YF1 A;  3ERF A;  1DBY A;  2C80 A;  4KDU A;  2K8S A;  5D9W A;  2YZU A;  4MMM A;  1Y6E A;  1EOH A;  1ACV A;  2N5F A;  3EWL A;  2OJL A;  3EIN A;  1GLP A;  2QSI A;  3C8E A;  5F07 A;  4XTS A;  4P3Y B;  3PH9 A;  2DML A;  6GSU A;  3TJK A;  4E8H A;  1XFL A;  2BMX A;  2CVD A;  4JE1 A;  4FIW A;  4JZQ A;  1FVJ A;  6GST A;  3GUS A;  1XZO A;  2H1A A;  2K6V A;  1ERW A;  1PL2 A;  2PU9 C;  5HQP A;  4KB3 A;  1M9A A;  5BMU A;  2XBI A;  4K8M A;  1QGV A;  3DWV A;  3IHQ A;  2FA4 A;  5IMD A;  2X8H A;  1QMV A;  3LOR A;  3DIE A;  2VCX A;  1FB0 A;  3U6V A;  2GVP A;  2DJK A;  4IQ1 A;  1JZO A;  4DSQ A;  1O8X A;  2R6K A;  2L4C A;  2DSA A;  4WR4 A;  4HJ2 A;  4MJA A;  3SBC A;  1OE8 A;  5J4U A;  5KN1 A;  3R3E A;  2PN8 A;  4GWR A;  3CSI A;  2RM5 A;  1O85 A;  5IOX A;  5AGY A;  4BIK A;  4AJ6 A;  4PUF C;  1K3O A;  2NDO A;  2DJ1 A;  1YDK A;  1T4Z A;  4HQS A;  4KW6 A;  4BWS A;  2H73 A;  4ECJ A;  1NM3 A;  3LXT A;  4ZBD A;  1SU9 A;  4N0V A;  4NHZ A;  5JCG A;  2PVQ A;  4F0C A;  4RI6 A;  4G9H A;  1SKW B;  3GMF A;  5C04 A;  1QUW A;  1S3C A;  3RHB A;  1Z6M A;  4X4J A;  1TK5 B;  3SWL A;  2H19 A;  1AQX A;  1YF0 A;  1Z6N A;  3GUR A;  2F51 A;  3IHG A;  3L0H A;  2DJJ A;  5LNK e;  3APO A;  3EUR A;  4L0U A;  3PGT A;  4F9Z A;  1MD4 A;  4D73 B;  2AJQ B;  5F05 A;  4MJC A;  4ZBB A;  2Z9S A;  4I2U A;  1RK4 A;  4IP6 A;  1U3I A;  5ECI B;  2N5A A;  1PN9 A;  1U3A A;  4MDC A;  4L0W A;  2LQQ A;  1HNA A;  3A2X A;  2L59 A;  4EDZ A;  1EZK A;  2WCI A;  2C3N A;  4ZBA A;  3KP9 A;  3GKK A;  1NSW A;  4MZB A;  1Z7R A;  2AV4 A;  5KN3 A;  1T1V A;  3IV4 A;  7GSS A;  2FY6 A;  2LJA A;  5ECS A;  2ZNM A;  5LCZ A;  5F0G A;  17GS A;  4HZ2 A;  2O7K A;  2HRF A;  1PX7 A;  4AGS A;  4D73 A;  3G7I A;  3LQ7 A;  4QQ7 A;  3ZMK A;  1WP0 A;  2H0G A;  2YAN A;  1PSQ A;  4PNF A;  1Z7P A;  5KOW A;  3VUR A;  4WR5 A;  5B6M A;  4G19 A;  3C7M A;  4KDX A;  4PUA A;  4Q5N A;  2PMT A;  2WDU A;  4K5R A;  3TJB A;  3A5I A;  2H0H A;  1TK8 B;  5DQY A;  2FNO A;  2VL2 C;  4V1A p;  1EV9 A;  4XS6 A;  3WGD A;  2X64 A;  2R37 A;  5EVO A;  3CSH A;  2ZCT A;  1AQW A;  3HVV A;  4K5S A;  4KGI A;  2B6M A;  4CY8 A;  4L5O A;  3OR5 A;  2EIQ A;  4V2N A;  3UAP A;  2M80 A;  5FHI A;  1BQ7 A;  1XWK A;  3HKR A;  1WJK A;  2RUE A;  3CYN A;  3DYR A;  1TI1 A;  4PNG A;  3ERW A;  2LV3 A;  5DDL A;  2DKI A;  3TKR A;  4MK3 A;  1MD3 A;  2YWO A;  3P2A A;  4OCE A;  1EEM A;  2PWJ A;  3MNG A;  1GLQ A;  2WGR A;  3FR9 A;  3TKP A;  3TB2 A;  2VCT A;  2L5O A;  5ECL B;  1XW6 A;  3MDK A;  4N11 A;  1PMT A;  4X43 A;  3VWU A;  1U87 A;  3MWH A;  3EC3 A;  1B8X A;  3N5O A;  3BD2 A;  3DD3 A;  4IVF A;  2IMI A;  1GRX A;  4BVX B;  3MSZ A;  2HLS A;  3FZA A;  2HRA A;  2LQO A;  5G5F A;  3WGX A;  3QCP A;  2CX4 A;  4OFN A;  4HU9 A;  4MCU A;  4G10 A;  3QAG A;  2CQ9 A;  3HD5 A;  5CO3 A;  2A2P A;  3VI5 A;  3F3R A;  2JZS A;  3US3 A;  4ACS A;  3NZN A;  1G0T A;  3IK7 A;  2C3T A;  2F8A A;  1TU8 A;  2REM A;  1ZYQ B;  3D4M A;  4O5R A;  4GQF A;  1WOU A;  3LEF A;  1GP1 A;  3TGZ A;  2HFD A;  2XBQ A;  3ZVJ D;  3ZYW A;  3ZIT A;  1T00 A;  4ZB8 A;  4BVY A;  3RPN A;  3GSS A;  4HI7 A;  3QFB C;  5ELA A;  1AQV A;  4DVC A;  2JSY A;  4TR1 B;  2GLR A;  5IO0 A;  4WEY A;  1K0B A;  1VRS D;  2LNS A;  2C0F A;  4NMU A;  4KX4 A;  2L57 A;  3GL3 A;  2GST A;  2IMD A;  2HI7 A;  1ZYP A;  1TTZ A;  1EGR A;  2E2G A;  4WET A;  2TRC P;  4O92 A;  3HXS A;  4OFM A;  3G7Y A;  4YQU A;  4ICY A;  3F8U A;  4ISD A;  2B5X A;  3LXZ A;  1M7T A;  1X9W B;  3ZRD A;  3DGQ A;  5H5Q A;  5ECO B;  2RLI A;  4ZL8 A;  1V2A A;  1GSF A;  4TR1 A;  3A2V A;  3KMO A;  5EPF A;  3EU3 A;  1Z9H A;  4XIH A;  2OBK A;  18GS A;  3F4R A;  2YOI A;  2CX3 A;  2WUL A;  1TK0 B;  4YKF A;  3I9V 2;  1ZGN A;  3J7Y b;  2F3M A;  2H1G A;  2YWI A;  2CZ3 A;  4Z2T A;  4V1A g;  1PN0 A;  4WKW A;  2ON5 A;  3C1S A;  2VL2 A;  4PQI A;  4KA0 A;  1Q98 A;  2L4Q A;  5ID2 B;  4BPY A;  3F3Q A;  1EOG A;  1THO A;  2B5E A;  5KEJ A;  1T3B A;  2H6Z A;  1TU7 A;  3MIX A;  1SJI A;  1V9W A;  2DIY A;  4XHM A;  4EUY A;  1AXD A;  3GKN A;  5D9X A;  3HVN A;  3LYP A;  1HYU A;  2I1U A;  2CA8 A;  2LRC A;  1W4V A;  2H70 A;  3GFK A;  12GS A;  5IMV A;  3FHK A;  5KN0 A;  3L9U A;  4PQH A;  4MJE A;  1YQ1 A;  1AAZ A;  2VUP A;  3UVH A;  1HD2 A;  3HVX A;  2HNL A;  4X0X A;  1QFN A;  4YAV A;  1NHY A;  1V98 A;  2MMN A;  1WMJ A;  3TKQ A;  3IC4 A;  2LNT A;  5ECH B;  3TOT A;  3GRX A;  4TXV A;  1USB A;  4ZXG A;  1G6W A;  2B7J A;  5A4V A;  4NV5 A;  5CRE A;  4IBP A;  4ZIJ A;  3O3T A;  6GSX A;  1YKC A;  4GCI A;  5G31 A;  5IMZ A;  1ZL9 A;  2D2Z A;  1BJX A;  1N2A A;  3G7J A;  4O5Q A;  5D8I A;  14GS A;  2R4V A;  3I69 A;  3WYW A;  1B4Q A;  5ECK B;  2WS2 A;  2P5R A;  3DML A;  1TW9 A;  2GSR A;  4J2F A;  4G0L A;  2WRT A;  2GZP A;  3ISO A;  1BAY A;  2GQL A;  5IMC A;  3U5R E;  2KP2 A;  5C00 A;  1SK0 A;  3QPM A;  2YP6 A;  1PKW A;  3KTB A;  2ALB A;  2OE1 A;  4IW9 A;  2H1B A;  3KIJ A;  4G2E A;  3DVX A;  4TXO A;  3EE2 A;  1FOV A;  3DRN A;  4MAB A;  5IMF A;  1X0R A;  5G1L A;  1GTI A;  3KGK A;  1B4P A;  2V32 A;  3LGC A;  3UOM A;  2JAD A;  4DSR A;  4K7N A;  3ZML A;  4GF0 A;  1XCC A;  3KXO A;  5AIS A;  2CT6 A;  3MYD A;  2G0F A;  3TJJ A;  3F9U A;  3FZ4 A;  5JWQ B;  2H01 A;  5LD0 A;  5ENU A;  3FY7 A;  1K3L A;  2BTO T;  1JZW A;  5IO2 A;  2LUS A;  4FYC A;  3C1R A;  2WJU A;  1KEB A;  2GDR A;  3D6I A;  1FB6 A;  5E59 A;  3WT1 A;  4ZL7 A;  3GH9 A;  3EPT A;  1VF1 A;  2JAC A;  1MDK A;  2H75 A;  2LEG A;  2EIR A;  3UIW A;  1DSB A;  4XS1 A;  4HS1 A;  3ZVJ A;  5E4W A;  1GNE A;  1S3D A;  1XOA A;  2VD1 A;  4OO4 A;  2VIM A;  1GSE A;  3GST A;  1ERU A;  2VLT A;  4MF5 A;  4F03 A;  2IWT A;  1YY7 A;  5HFI A;  1URM A;  3P7X A;  1O8W A;  1F9M A;  2KOK A;  2IN3 A;  1TI3 A;  1ZCP A;  3ZLP A;  4XS4 B;  4MPG A;  4I5Q A;  2VD0 A;  4NWY A;  4PGT A;  2YPM A;  2HZE A;  1V58 A;  3RAZ A;  1PA3 A;  3BCK A;  3VWV A;  4ZL9 A;  3D5J A;  1OKD A;  5CRW A;  2L6C A;  1A0F A;  4IJ3 A;  4TW5 A;  1G7E A;  2VCV A;  4TKY A;  1ON4 A;  1M0U A;  2OA7 A;  3ME8 A;  1OVN A;  1SKS B;  4FH8 A;  5HR1 A;  1R5A A;  4GST A;  1O73 A;  2H8L A;  2VOC A;  2MMO A;  2MZC A;  4MH3 A;  4IP1 A;  3Q6O A;  4XS4 A;  3QDN A;  4GSS A;  3GH6 A;  1QQ2 A;  2JL4 A;  1XPV A;  2GZZ A;  3M9J A;  1K0O A;  1UVZ A;  4CY6 A;  1SD8 A;  1K0C A;  1HNB A;  1YJ6 A;  3IAS 2;  3CMI A;  1X9S B;  2AB6 A;  3FW2 A;  1AUC A;  1M3J A;  3IBH A;  3EVI A;  4WXT A;  1O6J A;  1QXH A;  4MF6 A;  5G1K A;  2FD3 A;  4K0G A;  1Q4J A;  4K2D A;  2IPA A;  1WIK A;  1BG5 A;  3D0Z A;  3LSZ A;  4KSO A;  1I9D A;  1PL1 A;  1V57 A;  2PPT A;  5CAX A;  2YZH A;  1FG4 A;  3IK9 A;  5D96 A;  5IM9 A;  2J9H A;  3NIV A;  5DJL A;  4EIQ A;  5CRD A;  1SL0 B;  2A4V A;  1TP9 A;  3D4T A;  5GZZ B;  4MH2 A;  2FGX A;  3UBL A;  3GX8 A;  4MP4 A;  2QA2 A;  3N9J A;  1FO5 A;  3VLN A;  3CRT A;  2EC4 A;  1XW5 A;  4NV2 A;  2F8F A;  4IN0 A;  4A5P A;  1LJR A;  1XVW A;  5F8B A;  1XOB A;  1WE0 A;  1TRU A;  3BJ5 A;  3A5W A;  5DVB A;  1M9B A;  4TN8 A;  4HEA 2;  2H0I A;  3H8Q A;  2IFQ A;  5F06 A;  3E3E A;  2DMM A;  1O7U A;  1BX9 A;  4KND A;  1K0N A;  2A4H A;  1A23 A;  1JFU A;  5A5K A;  2FWE A;  2R0C A;  4AF2 A;  1SL2 B;  2DLX A;  3Q18 A;  2YN1 A;  2HSY A;  4NPB A;  2GT6 A;  1ILO A;  4USS A;  1EEJ A;  4MA9 A;  3RBT A;  4RI7 A;  2XHF A;  3G9B A;  5DAK A;  3IRA A;  1JLV A;  1GSD A;  5ELG A;  3O76 A;  1XWC A;  5DAL A;  2K18 A;  3EMX A;  3HYP A;  5FWG A;  2VL3 A;  1GNW A;  3TRQ A;  2CZ2 A;  5GSS A;  4TOP A;  5CRH A;  2J23 A;  2C1Y A;  1TRS A;  1K0M A;  5KOX A;  3S9F A;  4GRF A;  5G5E A;  2C8U A;  2QC7 A;  4BVY B;  3W6G A;  4TR4 A;  1GTB A;  3TJF A;  2VL9 A;  2O85 A;  1OAZ A;  2KUC A;  3R2Q A;  2F9S A;  1Z5Y E;  3HVS A;  4WBR D;  4DEJ A;  2H76 A;  3HJM A;  3FEU A;  3FMW A;  1KBN A;  13GS A;  2DIZ A;  4V2M A;  1H75 A;  2NVL A;  1R4W A;  1QK8 A;  3EMP A;  3WGE A;  5IMA A;  3QR6 A;  1A8L A;  1GUH A;  2FUG 2;  3TUE A;  1EP8 A;  2V2G A;  3C71 A;  4BA7 A;  2A2R A;  10GS A;  3E0U A;  4JU5 A;  3P90 A;  1KNG A;  4GTU A;  2PVO C;  1ZYN A;  4J56 E;  4POL A;  4G0K A;  2CAI A;  2VLU A;  1LBK A;  4ULX A;  3FK8 A;  4OMV A;  3DEX A;  3E9J B;  3HDC A;  4RQR A;  2B5Y A;  5HR0 A;  4F82 A;  3GYK A;  3TDG A;  1RQM A;  2NTO A;  1XWB A;  3HA9 A;  5A4U A;  5GAP D;  3HCZ A;  4OFT A;  2M46 A;  1A8Y A;  1R5P A;  3FR3 A;  4IJI A;  1T7P B;  1VF3 A;  4PTS A;  5ECN B;  2MMA A;  2UZ8 A;  3CXG A;  1DUG A;  3IOS A;  2I3Y A;  2OE0 A;  3FYG A;  1J08 A;  2LJR A;  3F0I A;  3EYT A;  3VPT A;  3RPP A;  3JCM L;  1UN2 A;  5H5R A;  3CRU A;  4EDY A;  1TRW A;  1X9M B;  4HJM A;  1GUK A;  2FHE A;  4KUN A;  2TIR A;  4RUV A;  1GTA A;  5H5S A;  5DCG A;  1ERV A;  1PFO A;  20GS A;  1S3R A;  2OBI A;  2LKU A;  9GSS A;  2MBS A;  4IGJ A;  4NXI A;  4K1F A;  4CHS A;  1B48 A;  5JWO B;  5JCW A;  4KCA A;  2C0G A;  3ZIV A;  1H4O A;  3APS A;  3HJP A;  2HE3 A;  3ZTL A;  4YQM A;  5BRT A;  3ZIJ A;  2GT5 A;  22GS A;  4NAX A;  2IMK A;  4O7H A;  2PGT A;  1M3I A;  1TRV A;  2V1M A;  4EF0 A;  1X5E A;  1E2Y A;  1F3A A;  5G30 A;  4EXJ A;  1OYJ A;  3KM6 A;  3M3M A;  5J41 A;  3KTL A;  5IQY A;  3A3T A;  1XXU A;  3MAK A;  4GXZ A;  2TRX A;  4E8E A;  1GTU A;  2HZF A;  4K0N A;  3UAR A;  2K9F A;  2N5B A;  2H66 A;  2H6X A;  2MBT A;  1B9Y C;  4IKH A;  3IDV A;  4HDE A;  1TKD B;  2VCW A;  4ML6 A;  5ECM B;  1ZZY A;  5DCH A;  2BJX A;  16GS A;  1GSU A;  5HR3 A;  2GZY A;  3VPQ A;  4TXO B;  4HQZ A;  1Z3E A;  3C73 A;  1F2E A;  1OC8 A;  1GSY A;  4HZ4 A;  6GSW A;  1NHO A;  1MDI A;  2L5L A;  2OAD A;  3HZ4 A;  5IPH A;  3HHV A;  4XCS A;  2OAC A;  2LS5 A;  1PD2 1;  1OC3 A;  1HNC A;  3IPZ A;  3GX0 A;  1XIY A;  1K0A A;  2X8C A;  3HZ8 A;  3HY2 A;  3ZZX A;  1GWC A;  2I9H A;  1J9B A;  3VWW A;  5AIV A;  3W8J A;  4H86 A;  3RDW A;  1SK1 A;  1ERT A;  1YEX A;  4YAP A;  4KCE A;  4LMW A;  2HRK A;  3D22 A;  3AY8 A;  3GN3 A;  4MPF A;  3H93 A;  3WD6 A;  3F4T A;  3GTU A;  2K8V A;  4F0B A;  5GST A;  2JZR A;  4ECB A;  2YJH A;  1JHB A;  3KEB A;  4L5L A;  4Q5F A;  3I6A A;  4EIP A;  4POM A;  1O81 A;  2O89 A;  1AW9 A;  2R2J A;  3KH9 A;  3QFA C;  1W89 A;  2CV4 A;  2VO4 A;  1CQG A;  4DSS A;  1THX A;  3F63 A;  3UL3 A;  1PKZ A;  2HRN A;  3ZL5 A;  4PUR A;  2HZE B;  4I97 A;  4Z2R A;  6GSS A;  2VCZ A;  1KTE A;  2I4A A;  2QKE A;  1WWJ A;  4FYU A;  3TKS C;  2E0Q A;  3TOU A;  2I81 A;  2B1K A;  3CTF A;  4K7O A;  5HR2 A;  2WFC A;  5B7C A;  1SL1 B;  5D9T A;  1GUL A;  1A2M A;  2C0E A;  1DE1 A;  3UBK A;  1GL8 A;  3ZFL A;  5HFK A;  2V6O A;  5CRG A;  2YV9 A;  1FOH A;  1XWG A;  4ZB6 A;  5DJM A;  3TKS E;  3KP8 A;  1B9X C;  4OWY A;  5ABR A;  2FCH A;  3M8N A;  2FA8 A;  3QD9 A;  4I6X A;  3ZFB A;  3ERG A;  1FVK A;  1T4Y A;  4FO5 A;  4WBJ A;  4KSM A;  4HUA A;  2E7P A;  4KE3 A;  1JZD A;  4K6X A;  3H79 A;  1X5C A;  1AIU A;  4IQA A;  4X1U A;  2B7K A;  3LFL A;  2HSH A;  3M0F A;  1CQH A;  2QGV A;  3J7Y k;  1XBS A;  5JWR B;  1BYE A;  1X5D A;  4EL1 A;  1TJD A;  4NHW A;  4HOJ A;  4AJ7 A;  4GQC A;  1EP7 A;  1M2A A;  4OO5 A;  1GH2 A;  1PQN A;  4KF9 A;  1E6B A;  2YWM A;  4ZB9 A;  19GS A;  3UMA A;  4K7I A;  2HXK A;  3M9K A;  1R26 A;  4YKG A;  2H30 A;  4LA1 A;  2H74 A;  1G6Y A;  3PR8 A;  2GS3 A;  4JED A;  3DKS A;  3M1G A;  2XC2 A;  2JSZ A;  6GSV A;  1A2J A;  3BCI A;  5ECP B;  5INY A;  4J57 E;  1SK2 A;  4TVE A;  2P0G A;  2H71 A;  2HYX A;  2ES7 A;  3DVW A;  3H1N A;  2YNX A;  2VM1 A;  1U88 A;  2H72 A;  3ME7 A;  5D73 A;  4YH2 A;  5IPG A;  3L9V A;  1RW1 A;  3BBY A;  1XVQ A;  2YWN A;  2YCD A;  3L78 A;  3W8S A;  4K9Z A;  5KN2 A;  1A2L A;  4PXO A;  1ABA A;  4AJ8 A;  2DC5 A;  1SKR B;  2IFQ B;  4EVM A;  2OKA A;  2X99 A;  1ML6 A;  1OE7 A;  2P5Q A;  1TXX A;  2XPD A;  1XW9 A;  1XG8 A;  2O87 A;  3FZ5 A;  4I8B A;  1WPI A;  4LL1 B;  2X4A A;  2YV7 A;  3HJO A;  3VK9 A;  1GUM A;  5EL8 A;  4JR6 A;  1AC1 A;  1T8E B;  3QOU A;  3GIX A;  2X49 A;  4ML1 A;  3D21 A;  4TR3 A;  2OE3 A;  5DAK B;  3UVT A;  4FYB A;  2JU5 A;  5DAL B;  1I5G A;  3APQ A;  3KZQ A;  5D9V A;  2C4J A;  1TOF A;  3FZ9 A;  4KH7 A;  2PBJ A;  1EGO A;  3FRC A;  2GSS A;  3VI7 A;  2L6D A;  3KJY A;  1NW2 A;  5AN1 A;  2R3X A;  5HFG A;  1WRY A;  3L4N A;  5DBQ A;  2JZT A;  3GKM A;  4LLR A;  3CQF A;  4ECI A;  3V1W A;  5J9C A;  2DKH A;  3GV1 A;  8GSS A;  4JBB A;  3KH7 A;  2ON7 A;  1VGL A;  5CYY A;  1GSS A;  1SD9 A;  4Z2U A;  4K2X A;  3TKS A;  1MDJ A;  3BOA A;  2CVB A;  1GSQ A;  5JCU A;  4TR0 A;  2VCQ A;  3KMN A;  3VFI A;  4YQV A;  1OC9 B;  2DBC A;  3QMX A;  4OD7 A;  4GSN A;  3VWX A;  1F6M C;  1M2D A;  4POK A;  1YEP A;  4ILF A;  2DJ0 A;  1OKT A;  5B8A A;  4PQ1 A; 
#chains in the Genus database with same CATH homology
 2WB9 A;  2FLS A;  2GGT A;  3IAM 2;  4LMV A;  4MLY A;  3QAV A;  4XRA A;  4MF7 A;  4V2L A;  2LST A;  3GNJ A;  1ZMA A;  3GA4 A;  1ZYE A;  3LYK A;  3H4K A;  1A24 A;  1FHE A;  2AAW A;  4HU7 A;  3TRP A;  4MZC A;  4WF5 A;  2KP1 A;  1OC9 A;  1YZX A;  2VLV A;  3L9S A;  2NBS A;  2GQK A;  1S3A A;  3PPU A;  1SJ6 A;  3F4S A;  3ED3 A;  2B3S A;  1VF4 A;  5J5N A;  4BVX A;  3NOF A;  4BL7 B;  4RQX A;  3FKF A;  5DQS A;  3CTG A;  3FR6 A;  2KHP A;  4EE0 A;  6GSY A;  2IJY A;  2DJ3 A;  1VF2 A;  5COH A;  3Q19 A;  3IR4 A;  2WZ9 A;  1FAA A;  5AIX A;  4ZIL A;  3RHC A;  1N8J A;  2R0P A;  3LW9 A;  2C3Q A;  1UA5 A;  3LG6 A;  3ZRE A;  1BED A;  1YKA A;  4O5U A;  2R5G A;  4JR4 A;  2IL3 A;  5CP1 A;  4FQU A;  2FWH A;  5A4W A;  2P31 A;  5ECR B;  2X8G A;  3GKX A;  2KLX A;  4BL7 A;  5ECQ B;  1J0F A;  2VAF A;  5J3R A;  1FW1 A;  3GL5 A;  2RUF A;  2RII A;  2PER A;  1SJZ A;  2NPB A;  2LRN A;  2IIY A;  3QAW A;  2O8V B;  4IS0 A;  1DE2 A;  2HT9 A;  2A2S A;  3I43 A;  4TRX A;  2V6K A;  1SYX A;  1V40 A;  5B8B A;  1K0D A;  3LWA A;  3GHA A;  4BWQ A;  1ST9 A;  4MNN A;  4LL4 B;  1C72 A;  3IE3 A;  1PGT A;  3A2W A;  1ZOF A;  5IOW A;  5J9B A;  3CSJ A;  2PUK C;  3LJR A;  2GSQ A;  1F3B A;  2GQM A;  3IA1 A;  4I2T A;  4F2I A;  1R7H A;  4N30 A;  2LTK A;  2LRT A;  3CBU A;  5L71 A;  4QL7 A;  4EC0 A;  3EU4 A;  2IMF A;  3KD0 A;  4POB A;  1UC7 A;  3TCO A;  1G7O A;  2DJ2 A;  5CNW A;  1JLW A;  2CVK A;  4PX1 A;  2ZUP A;  4CDO A;  1HQO A;  3TJG A;  2YJ7 A;  3PIN A;  1SYR A;  4KAE A;  2B1L A;  5IIZ A;  4N10 A;  2AHE A;  1MEK A;  4EKZ A;  1TDI A;  2LJK A;  1PRX A;  1Y25 A;  2VM2 A;  3K8N A;  3F6F A;  1A0R P;  4JRR A;  1M2B A;  3O6T A;  4MJB A;  3IC8 A;  1IYI A;  3TRX A;  1U6T A;  4CW9 A;  1XWA A;  2AUV A;  1K3Y A;  4XRD A;  2H1D A;  2XPE A;  2AYT A;  4OCF A;  5ID2 A;  2M72 A;  3WT2 A;  4Q5Q A;  2R0G A;  1IYH A;  1JZR A;  2QA1 A;  3F6D A;  4IEL A;  1PX6 A;  3KCM A;  2E2M A;  4L8E A;  1MTC A;  4KDY A;  4Q5R A;  2CAQ A;  5B6N A;  2MYG A;  4N0Z A;  4GLT A;  2EIO A;  3GTU B;  4O32 A;  3UJ1 A;  4G0I A;  3UEM A;  5FT3 A;  2MMZ A;  1F37 A;  3Q74 A;  2HSM A;  2H6Y A;  5GAN D;  5EY6 A;  4WF4 A;  1SEN A;  2C0D A;  2RM6 A;  1EV4 A;  4IHU A;  4ID0 A;  2V41 A;  11GS A;  4Z7X A;  2GTU A;  3P8W A;  1LU4 A;  4DSS B;  1M99 A;  2G2Q A;  4MZW A;  1EWX A;  5G2Z A;  2FWG A;  4ECC A;  5D93 A;  3DXB A;  3IXR A;  2IME A;  4EO3 A;  4QL9 A;  2FWF A;  1YF1 A;  3ERF A;  1DBY A;  2C80 A;  4KDU A;  2K8S A;  5D9W A;  2YZU A;  4MMM A;  1Y6E A;  1EOH A;  1ACV A;  2N5F A;  3EWL A;  2OJL A;  3EIN A;  1GLP A;  2QSI A;  3C8E A;  5F07 A;  4XTS A;  4P3Y B;  3PH9 A;  2DML A;  6GSU A;  3TJK A;  4E8H A;  1XFL A;  2BMX A;  2CVD A;  4JE1 A;  4FIW A;  4JZQ A;  1FVJ A;  6GST A;  3GUS A;  1XZO A;  2H1A A;  2K6V A;  1ERW A;  1PL2 A;  2PU9 C;  5HQP A;  4KB3 A;  1M9A A;  5BMU A;  2XBI A;  4K8M A;  1QGV A;  3DWV A;  3IHQ A;  2FA4 A;  5IMD A;  2X8H A;  1QMV A;  3LOR A;  3DIE A;  2VCX A;  1FB0 A;  3U6V A;  2GVP A;  2DJK A;  4IQ1 A;  1JZO A;  4DSQ A;  1O8X A;  2R6K A;  2L4C A;  2DSA A;  4WR4 A;  4HJ2 A;  4MJA A;  3SBC A;  1OE8 A;  5J4U A;  5KN1 A;  3R3E A;  2PN8 A;  4GWR A;  3CSI A;  2RM5 A;  1O85 A;  5IOX A;  5AGY A;  4AJ6 A;  4PUF C;  1K3O A;  2NDO A;  2DJ1 A;  1YDK A;  1T4Z A;  4HQS A;  4KW6 A;  4BWS A;  2H73 A;  4ECJ A;  1NM3 A;  3LXT A;  4ZBD A;  1SU9 A;  4N0V A;  4NHZ A;  5JCG A;  2PVQ A;  4F0C A;  4RI6 A;  4G9H A;  1SKW B;  3GMF A;  5C04 A;  1QUW A;  1S3C A;  3RHB A;  1Z6M A;  4X4J A;  1TK5 B;  3SWL A;  2H19 A;  1AQX A;  1YF0 A;  1Z6N A;  3GUR A;  2F51 A;  3IHG A;  3L0H A;  2DJJ A;  5LNK e;  3APO A;  3EUR A;  4L0U A;  3PGT A;  4F9Z A;  1MD4 A;  4D73 B;  2AJQ B;  5F05 A;  4MJC A;  4ZBB A;  2Z9S A;  4I2U A;  1RK4 A;  4IP6 A;  1U3I A;  5ECI B;  2N5A A;  1PN9 A;  1U3A A;  4MDC A;  4L0W A;  2LQQ A;  1HNA A;  3A2X A;  2L59 A;  4EDZ A;  1EZK A;  2WCI A;  2C3N A;  4ZBA A;  3KP9 A;  3GKK A;  1NSW A;  4MZB A;  1Z7R A;  2AV4 A;  5KN3 A;  1T1V A;  3IV4 A;  7GSS A;  2FY6 A;  2LJA A;  5ECS A;  2ZNM A;  5LCZ A;  5F0G A;  17GS A;  4HZ2 A;  2O7K A;  2HRF A;  1PX7 A;  4AGS A;  4D73 A;  3G7I A;  3LQ7 A;  4QQ7 A;  3ZMK A;  1WP0 A;  2H0G A;  2YAN A;  1PSQ A;  4PNF A;  1Z7P A;  5KOW A;  3VUR A;  4WR5 A;  5B6M A;  4G19 A;  3C7M A;  4KDX A;  4PUA A;  4Q5N A;  2PMT A;  2WDU A;  4K5R A;  3TJB A;  3A5I A;  2H0H A;  1TK8 B;  5DQY A;  2FNO A;  2VL2 C;  4V1A p;  1EV9 A;  4XS6 A;  3WGD A;  2X64 A;  2R37 A;  5EVO A;  3CSH A;  2ZCT A;  1AQW A;  3HVV A;  4K5S A;  4KGI A;  2B6M A;  4CY8 A;  4L5O A;  3OR5 A;  2EIQ A;  4V2N A;  3UAP A;  2M80 A;  5FHI A;  1BQ7 A;  1XWK A;  3HKR A;  1WJK A;  2RUE A;  3CYN A;  3DYR A;  1TI1 A;  4PNG A;  3ERW A;  2LV3 A;  5DDL A;  2DKI A;  3TKR A;  4MK3 A;  1MD3 A;  2YWO A;  3P2A A;  4OCE A;  1EEM A;  2PWJ A;  3MNG A;  1GLQ A;  2WGR A;  3FR9 A;  3TKP A;  3TB2 A;  2VCT A;  2L5O A;  5ECL B;  1XW6 A;  3MDK A;  4N11 A;  1PMT A;  4X43 A;  3VWU A;  1U87 A;  3MWH A;  3EC3 A;  1B8X A;  3N5O A;  3BD2 A;  3DD3 A;  4IVF A;  2IMI A;  1GRX A;  4BVX B;  3MSZ A;  2HLS A;  3FZA A;  2HRA A;  2LQO A;  5G5F A;  3WGX A;  3QCP A;  2CX4 A;  4OFN A;  4HU9 A;  4MCU A;  4G10 A;  3QAG A;  2CQ9 A;  3HD5 A;  5CO3 A;  2A2P A;  3VI5 A;  3F3R A;  2JZS A;  3US3 A;  4ACS A;  3NZN A;  1G0T A;  3IK7 A;  2C3T A;  2F8A A;  1TU8 A;  2REM A;  1ZYQ B;  3D4M A;  4O5R A;  4GQF A;  1WOU A;  3LEF A;  1GP1 A;  3TGZ A;  2HFD A;  2XBQ A;  3ZVJ D;  3ZYW A;  3ZIT A;  1T00 A;  4ZB8 A;  4BVY A;  3RPN A;  3GSS A;  4HI7 A;  3QFB C;  5ELA A;  1AQV A;  4DVC A;  2JSY A;  4TR1 B;  2GLR A;  5IO0 A;  4WEY A;  1K0B A;  1VRS D;  2LNS A;  2C0F A;  4NMU A;  4KX4 A;  2L57 A;  3GL3 A;  2GST A;  2IMD A;  2HI7 A;  1ZYP A;  1TTZ A;  1EGR A;  2E2G A;  4WET A;  2TRC P;  4O92 A;  3HXS A;  4OFM A;  3G7Y A;  4YQU A;  4ICY A;  3F8U A;  4ISD A;  2B5X A;  3LXZ A;  1M7T A;  1X9W B;  3ZRD A;  3DGQ A;  5H5Q A;  5ECO B;  2RLI A;  4ZL8 A;  1V2A A;  1GSF A;  4TR1 A;  3A2V A;  3KMO A;  5EPF A;  3EU3 A;  1Z9H A;  4XIH A;  2OBK A;  18GS A;  3F4R A;  2YOI A;  2CX3 A;  2WUL A;  1TK0 B;  4YKF A;  3I9V 2;  1ZGN A;  3J7Y b;  2F3M A;  2H1G A;  2YWI A;  2CZ3 A;  4Z2T A;  4V1A g;  1PN0 A;  4WKW A;  2ON5 A;  3C1S A;  2VL2 A;  4PQI A;  4KA0 A;  1Q98 A;  2L4Q A;  5ID2 B;  4BPY A;  3F3Q A;  1EOG A;  1THO A;  2B5E A;  5KEJ A;  1T3B A;  2H6Z A;  1TU7 A;  3MIX A;  1SJI A;  1V9W A;  2DIY A;  4XHM A;  4EUY A;  1AXD A;  3GKN A;  5D9X A;  3LYP A;  1HYU A;  2I1U A;  2CA8 A;  2LRC A;  1W4V A;  2H70 A;  3GFK A;  12GS A;  5IMV A;  3FHK A;  5KN0 A;  3L9U A;  4PQH A;  4MJE A;  1YQ1 A;  1AAZ A;  2VUP A;  3UVH A;  1HD2 A;  3HVX A;  2HNL A;  4X0X A;  1QFN A;  4YAV A;  1NHY A;  1V98 A;  2MMN A;  1WMJ A;  3TKQ A;  3IC4 A;  2LNT A;  5ECH B;  3TOT A;  3GRX A;  4TXV A;  1USB A;  4ZXG A;  1G6W A;  2B7J A;  5A4V A;  4NV5 A;  5CRE A;  4IBP A;  4ZIJ A;  3O3T A;  6GSX A;  1YKC A;  4GCI A;  5G31 A;  5IMZ A;  1ZL9 A;  2D2Z A;  1BJX A;  1N2A A;  3G7J A;  4O5Q A;  5D8I A;  14GS A;  2R4V A;  3I69 A;  3WYW A;  1B4Q A;  5ECK B;  2WS2 A;  2P5R A;  3DML A;  1TW9 A;  2GSR A;  4J2F A;  4G0L A;  2WRT A;  2GZP A;  3ISO A;  1BAY A;  2GQL A;  5IMC A;  3U5R E;  2KP2 A;  5C00 A;  1SK0 A;  3QPM A;  2YP6 A;  1PKW A;  3KTB A;  2ALB A;  2OE1 A;  4IW9 A;  2H1B A;  3KIJ A;  4G2E A;  3DVX A;  4TXO A;  3EE2 A;  1FOV A;  3DRN A;  4MAB A;  5IMF A;  1X0R A;  5G1L A;  1GTI A;  3KGK A;  1B4P A;  2V32 A;  3LGC A;  3UOM A;  2JAD A;  4DSR A;  4K7N A;  3ZML A;  4GF0 A;  1XCC A;  3KXO A;  5AIS A;  2CT6 A;  3MYD A;  2G0F A;  3TJJ A;  3F9U A;  3FZ4 A;  5JWQ B;  2H01 A;  5LD0 A;  5ENU A;  3FY7 A;  1K3L A;  2BTO T;  1JZW A;  5IO2 A;  2LUS A;  4FYC A;  3C1R A;  2WJU A;  1KEB A;  2GDR A;  3D6I A;  1FB6 A;  5E59 A;  3WT1 A;  4ZL7 A;  3GH9 A;  3EPT A;  1VF1 A;  2JAC A;  1MDK A;  2H75 A;  2LEG A;  2EIR A;  3UIW A;  1DSB A;  4XS1 A;  4HS1 A;  3ZVJ A;  5E4W A;  1GNE A;  1S3D A;  1XOA A;  2VD1 A;  4OO4 A;  2VIM A;  1GSE A;  3GST A;  1ERU A;  2VLT A;  4MF5 A;  4F03 A;  2IWT A;  1YY7 A;  5HFI A;  1URM A;  3P7X A;  1O8W A;  1F9M A;  2KOK A;  2IN3 A;  1TI3 A;  1ZCP A;  3ZLP A;  4XS4 B;  4MPG A;  4I5Q A;  2VD0 A;  4NWY A;  4PGT A;  2YPM A;  2HZE A;  1V58 A;  3RAZ A;  1PA3 A;  3BCK A;  3VWV A;  4ZL9 A;  3D5J A;  1OKD A;  5CRW A;  2L6C A;  1A0F A;  4IJ3 A;  4TW5 A;  1G7E A;  2VCV A;  4TKY A;  1ON4 A;  1M0U A;  2OA7 A;  3ME8 A;  1OVN A;  1SKS B;  4FH8 A;  5HR1 A;  1R5A A;  4GST A;  1O73 A;  2H8L A;  2VOC A;  2MMO A;  2MZC A;  4MH3 A;  4IP1 A;  3Q6O A;  4XS4 A;  3QDN A;  4GSS A;  3GH6 A;  1QQ2 A;  2JL4 A;  1XPV A;  2GZZ A;  3M9J A;  1K0O A;  1UVZ A;  4CY6 A;  1SD8 A;  1K0C A;  1HNB A;  1YJ6 A;  3IAS 2;  3CMI A;  1X9S B;  2AB6 A;  3FW2 A;  1AUC A;  3IBH A;  3EVI A;  4WXT A;  1O6J A;  1QXH A;  4MF6 A;  5G1K A;  2FD3 A;  4K0G A;  1Q4J A;  4K2D A;  2IPA A;  1WIK A;  1BG5 A;  3D0Z A;  3LSZ A;  4KSO A;  1I9D A;  1PL1 A;  1V57 A;  2PPT A;  5CAX A;  2YZH A;  1FG4 A;  3IK9 A;  5D96 A;  5IM9 A;  2J9H A;  3NIV A;  5DJL A;  4EIQ A;  5CRD A;  1SL0 B;  2A4V A;  1TP9 A;  3D4T A;  5GZZ B;  4MH2 A;  2FGX A;  3UBL A;  3GX8 A;  4MP4 A;  2QA2 A;  3N9J A;  1FO5 A;  3VLN A;  3CRT A;  2EC4 A;  1XW5 A;  4NV2 A;  2F8F A;  4IN0 A;  4A5P A;  1LJR A;  1XVW A;  5F8B A;  1XOB A;  1WE0 A;  1TRU A;  3BJ5 A;  3A5W A;  5DVB A;  1M9B A;  4TN8 A;  4HEA 2;  2H0I A;  3H8Q A;  2IFQ A;  5F06 A;  3E3E A;  2DMM A;  1O7U A;  1BX9 A;  4KND A;  1K0N A;  2A4H A;  1A23 A;  1JFU A;  5A5K A;  2FWE A;  2R0C A;  4AF2 A;  1SL2 B;  2DLX A;  3Q18 A;  2YN1 A;  2HSY A;  4NPB A;  2GT6 A;  1ILO A;  4USS A;  1EEJ A;  4MA9 A;  3RBT A;  4RI7 A;  2XHF A;  3G9B A;  5DAK A;  3IRA A;  1JLV A;  1GSD A;  5ELG A;  3O76 A;  1XWC A;  5DAL A;  2K18 A;  3EMX A;  3HYP A;  5FWG A;  2VL3 A;  1GNW A;  3TRQ A;  2CZ2 A;  5GSS A;  4TOP A;  5CRH A;  2J23 A;  2C1Y A;  1TRS A;  1K0M A;  5KOX A;  3S9F A;  4GRF A;  5G5E A;  2C8U A;  2QC7 A;  4BVY B;  4TR4 A;  3W6G A;  1GTB A;  3TJF A;  2VL9 A;  2O85 A;  1OAZ A;  2KUC A;  3R2Q A;  2F9S A;  1Z5Y E;  3HVS A;  4WBR D;  4DEJ A;  2H76 A;  3HJM A;  3FEU A;  3FMW A;  1KBN A;  13GS A;  2DIZ A;  4V2M A;  1H75 A;  2NVL A;  1R4W A;  1QK8 A;  3EMP A;  3WGE A;  5IMA A;  3QR6 A;  1A8L A;  1GUH A;  2FUG 2;  3TUE A;  1EP8 A;  2V2G A;  3C71 A;  4BA7 A;  2A2R A;  10GS A;  3E0U A;  4JU5 A;  3P90 A;  1KNG A;  4GTU A;  2PVO C;  1ZYN A;  4J56 E;  4POL A;  4G0K A;  2CAI A;  2VLU A;  1LBK A;  4ULX A;  3FK8 A;  4OMV A;  3DEX A;  3E9J B;  3HDC A;  4RQR A;  2B5Y A;  5HR0 A;  4F82 A;  3GYK A;  3TDG A;  1RQM A;  2NTO A;  1XWB A;  3HA9 A;  5A4U A;  5GAP D;  3HCZ A;  4OFT A;  2M46 A;  1A8Y A;  1R5P A;  3FR3 A;  4IJI A;  1T7P B;  1VF3 A;  4PTS A;  5ECN B;  2MMA A;  2UZ8 A;  3CXG A;  1DUG A;  3IOS A;  2I3Y A;  2OE0 A;  3FYG A;  1J08 A;  2LJR A;  3F0I A;  3EYT A;  3VPT A;  3RPP A;  3JCM L;  1UN2 A;  5H5R A;  3CRU A;  4EDY A;  1TRW A;  1X9M B;  4HJM A;  1GUK A;  2FHE A;  4KUN A;  2TIR A;  4RUV A;  1GTA A;  5H5S A;  5DCG A;  1ERV A;  20GS A;  2OBI A;  2LKU A;  9GSS A;  2MBS A;  4IGJ A;  4NXI A;  4K1F A;  4CHS A;  1B48 A;  5JWO B;  5JCW A;  4KCA A;  2C0G A;  3ZIV A;  1H4O A;  3APS A;  3HJP A;  2HE3 A;  3ZTL A;  4YQM A;  5BRT A;  3ZIJ A;  2GT5 A;  22GS A;  4NAX A;  2IMK A;  4O7H A;  2PGT A;  1TRV A;  2V1M A;  4EF0 A;  1X5E A;  1E2Y A;  1F3A A;  5G30 A;  4EXJ A;  1OYJ A;  3KM6 A;  3M3M A;  5J41 A;  3KTL A;  5IQY A;  3A3T A;  1XXU A;  3MAK A;  4GXZ A;  2TRX A;  4E8E A;  1GTU A;  2HZF A;  4K0N A;  3UAR A;  2K9F A;  2N5B A;  2H66 A;  2H6X A;  2MBT A;  1B9Y C;  4IKH A;  3IDV A;  4HDE A;  1TKD B;  2VCW A;  4ML6 A;  5ECM B;  1ZZY A;  5DCH A;  2BJX A;  16GS A;  1GSU A;  5HR3 A;  2GZY A;  3VPQ A;  4TXO B;  4HQZ A;  1Z3E A;  3C73 A;  1F2E A;  1OC8 A;  1GSY A;  4HZ4 A;  6GSW A;  1NHO A;  1MDI A;  2L5L A;  2OAD A;  3HZ4 A;  5IPH A;  3HHV A;  4XCS A;  2OAC A;  2LS5 A;  1PD2 1;  1OC3 A;  1HNC A;  3IPZ A;  3GX0 A;  1XIY A;  1K0A A;  2X8C A;  3HZ8 A;  3HY2 A;  3ZZX A;  1GWC A;  2I9H A;  1J9B A;  3VWW A;  5AIV A;  3W8J A;  4H86 A;  3RDW A;  1SK1 A;  1ERT A;  1YEX A;  4YAP A;  4KCE A;  4LMW A;  2HRK A;  3D22 A;  3AY8 A;  3GN3 A;  4MPF A;  3H93 A;  3WD6 A;  3F4T A;  3GTU A;  2K8V A;  4F0B A;  5GST A;  2JZR A;  4ECB A;  2YJH A;  1JHB A;  3KEB A;  4L5L A;  4Q5F A;  3I6A A;  4EIP A;  4POM A;  1O81 A;  2O89 A;  1AW9 A;  2R2J A;  3KH9 A;  3QFA C;  1W89 A;  2CV4 A;  2VO4 A;  1CQG A;  4DSS A;  1THX A;  3F63 A;  3UL3 A;  1PKZ A;  2HRN A;  3ZL5 A;  4PUR A;  2HZE B;  4I97 A;  4Z2R A;  6GSS A;  2VCZ A;  1KTE A;  2I4A A;  2QKE A;  1WWJ A;  4FYU A;  3TKS C;  2E0Q A;  3TOU A;  2I81 A;  2B1K A;  3CTF A;  4K7O A;  5HR2 A;  2WFC A;  5B7C A;  1SL1 B;  5D9T A;  1GUL A;  1A2M A;  2C0E A;  1DE1 A;  3UBK A;  1GL8 A;  3ZFL A;  5HFK A;  2V6O A;  5CRG A;  2YV9 A;  1FOH A;  1XWG A;  4ZB6 A;  5DJM A;  3TKS E;  3KP8 A;  1B9X C;  4OWY A;  5ABR A;  2FCH A;  3M8N A;  2FA8 A;  3QD9 A;  4I6X A;  3ZFB A;  3ERG A;  1FVK A;  1T4Y A;  4FO5 A;  4WBJ A;  4KSM A;  4HUA A;  2E7P A;  4KE3 A;  1JZD A;  4K6X A;  3H79 A;  1X5C A;  1AIU A;  4IQA A;  4X1U A;  2B7K A;  3LFL A;  2HSH A;  3M0F A;  1CQH A;  2QGV A;  3J7Y k;  1XBS A;  5JWR B;  1BYE A;  1X5D A;  4EL1 A;  1TJD A;  4NHW A;  4HOJ A;  4AJ7 A;  4GQC A;  1EP7 A;  1M2A A;  4OO5 A;  1GH2 A;  1PQN A;  4KF9 A;  1E6B A;  2YWM A;  4ZB9 A;  19GS A;  3UMA A;  4K7I A;  2HXK A;  3M9K A;  1R26 A;  4YKG A;  2H30 A;  4LA1 A;  2H74 A;  1G6Y A;  3PR8 A;  2GS3 A;  4JED A;  3DKS A;  3M1G A;  2XC2 A;  2JSZ A;  6GSV A;  1A2J A;  3BCI A;  5ECP B;  5INY A;  4J57 E;  1SK2 A;  4TVE A;  2P0G A;  2H71 A;  2HYX A;  2ES7 A;  3DVW A;  3H1N A;  2YNX A;  2VM1 A;  1U88 A;  2H72 A;  3ME7 A;  5D73 A;  4YH2 A;  5IPG A;  3L9V A;  1RW1 A;  3BBY A;  1XVQ A;  2YWN A;  2YCD A;  3L78 A;  3W8S A;  4K9Z A;  5KN2 A;  1A2L A;  4PXO A;  1ABA A;  4AJ8 A;  2DC5 A;  1SKR B;  2IFQ B;  4EVM A;  2OKA A;  2X99 A;  1ML6 A;  1OE7 A;  2P5Q A;  1TXX A;  2XPD A;  1XW9 A;  2O87 A;  3FZ5 A;  4I8B A;  1WPI A;  4LL1 B;  2X4A A;  2YV7 A;  3HJO A;  3VK9 A;  1GUM A;  5EL8 A;  4JR6 A;  1AC1 A;  1T8E B;  3QOU A;  3GIX A;  2X49 A;  4ML1 A;  3D21 A;  4TR3 A;  2OE3 A;  5DAK B;  3UVT A;  4FYB A;  2JU5 A;  5DAL B;  1I5G A;  3APQ A;  3KZQ A;  5D9V A;  2C4J A;  1TOF A;  3FZ9 A;  4KH7 A;  2PBJ A;  1EGO A;  3FRC A;  2GSS A;  3VI7 A;  2L6D A;  3KJY A;  1NW2 A;  5AN1 A;  2R3X A;  5HFG A;  1WRY A;  3L4N A;  5DBQ A;  2JZT A;  3GKM A;  4LLR A;  4ECI A;  3V1W A;  5J9C A;  2DKH A;  3GV1 A;  8GSS A;  4JBB A;  3KH7 A;  2ON7 A;  1VGL A;  5CYY A;  1GSS A;  1SD9 A;  4Z2U A;  4K2X A;  3TKS A;  1MDJ A;  3BOA A;  2CVB A;  1GSQ A;  5JCU A;  4TR0 A;  2VCQ A;  3KMN A;  3VFI A;  4YQV A;  1OC9 B;  2DBC A;  3QMX A;  4OD7 A;  4GSN A;  3VWX A;  1F6M C;  1M2D A;  4POK A;  1YEP A;  4ILF A;  2DJ0 A;  1OKT A;  5B8A A;  4PQ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...