2NVLA

Crystal structure of archaeal peroxiredoxin, thioredoxin peroxidase from aeropyrum pernix k1 (sulfonic acid form)
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
242
structure length
241
Chain Sequence
b'SIPLIGERFPEMEVTTDHGVIKLPDHYVSQGKWFVLFSHPADFTPVTTEFVSFARRYEDFQRLGVDLIGLSVDSVFSHIKWKEWIERHIGVRIPFPIIADPQGTVARRLGLLHAESATHTVRGVFIVDARGVIRTMLYYPMELGRLVDEILRIVKALKLGDSLKRAVPADWPNNEIIGEGLIVPPPTTEDQARARMESGQYRSLDWWFCWDTPASRDDVEEARRYLRRAAEKPAKLLYEEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable peroxiredoxin
publication title Oxidation of archaeal peroxiredoxin involves a hypervalent sulfur intermediate
pubmed doi rcsb
source organism Aeropyrum pernix
molecule tags Oxidoreductase
total genus 76
structure length 241
sequence length 242
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2006-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
A PF10417 1-cysPrx_C C-terminal domain of 1-Cys peroxiredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1020.20 Alpha Beta 2-Layer Sandwich Antioxidant, Horf6; Chain A, domain 2 Antioxidant, Horf6; Chain A, domain 2 2nvlA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2nvlA01
4GRFA 2B1KA 1K0AA 1VF3A 3GN3A 2H75A 1Q98A 1SYXA 4J56E 3ZREA 1SJZA 1BJXA 2HE3A 2IFQA 2O7KA 2YJ7A 1ZGNA 5A5KA 6GSWA 1H4OA 3QAWA 3DKSA 4K1FA 1TW9A 1XVWA 1ZCPA 5IPHA 1OKDA 2WGRA 4MJCA 1XWKA 1JZWA 1NHYA 1A2LA 2CV4A 3FHKA 1A8LA 2FY6A 3KXOA 3QFAC 4MF7A 4NWYA 3RAZA 3GL5A 2I81A 2CQ9A 2FCHA 1SL1B 4Q5NA 5ECMB 2B6MA 1PQNA 2B5XA 1TK5B 3E3EA 2E0QA 5A4UA 1XW9A 1U88A 1PD21 2B5EA 2F9SA 4EDYA 1WWJA 1XW5A 4MH2A 4IQ1A 3F4RA 1CQGA 2GTUA 2H6YA 2AAWA 1XWBA 5COHA 3KJYA 3HY2A 2PWJA 4MDCA 3F8UA 1R5PA 3HKRA 2FWEA 1M99A 5JCWA 2HT9A 3IPZA 4IP6A 2CX3A 2VLUA 4OCEA 3W8SA 4RI7A 1PKZA 4BA7A 1WRYA 3HZ4A 1J9BA 2C0EA 2JZSA 4EC0A 3K8NA 5F05A 1LJRA 1GNEA 3HVSA 4HUAA 1ILOA 2J9HA 3TJGA 2CX4A 3H4KA 3D22A 4ACSA 5ECLB 3G7YA 1Z6NA 3MNGA 3EINA 5DJMA 3A3TA 3BCKA 1SL2B 1JZOA 4CW9A 2DJ3A 1B4QA 4KCEA 2AJQB 1GP1A 5DBQA 3GKXA 1THXA 12GSA 1PSQA 4WR4A 2XHFA 2O87A 1PA3A 5FHIA 3I43A 1FHEA 2GLRA 3IOSA 4TXOB 3A5WA 1WIKA 3QAGA 2KOKA 1HQOA 3GTUA 2IIYA 1EEJA 3KM6A 3D4TA 1X5CA 3D0ZA 3F63A 2FA8A 4XIHA 3GYKA 1PN9A 1TRVA 4DSSA 1WPIA 2BTOT 3DVWA 3VI5A 2YV9A 3APSA 4V1Ag 3JCML 4POLA 2QC7A 4OCFA 1PRXA 2VOCA 5HR0A 2L59A 3GKMA 3QDNA 3APOA 2B7KA 2XBIA 2EIOA 3H79A 1QQ2A 2NVLA 1B4PA 1ST9A 1A24A 2AHEA 2K6VA 4N0ZA 1WE0A 2R3XA 2B3SA 2WDUA 1V57A 3IXRA 5IMDA 1Z9HA 2H19A 5HR3A 1GULA 4GXZA 4EXJA 4MLYA 4KUNA 3SWLA 18GSA 2NDOA 4ULXA 2IN3A 1GRXA 1JLWA 4FYUA 4MA9A 1TP9A 2M80A 1Z7RA 1DE2A 3KD0A 3O3TA 1PL2A 2DJJA 1GSQA 4HZ2A 2P5QA 4WBJA 3KMOA 3J7Yb 4KE3A 1M9AA 2VM2A 5GSSA 1O85A 1GH2A 4X43A 4NHZA 2YCDA 4YAPA 3CMIA 1U3AA 2GQKA 3C8EA 1AC1A 5DAKA 1ERWA 3ME7A 2GVPA 5ECKB 2Z9SA 5EVOA 10GSA 2NBSA 3LG6A 3QFBC 3GSTA 1NM3A 3VPTA 3ZTLA 3GH6A 1TU7A 8GSSA 4K7IA 1V9WA 2AV4A 4POBA 1AQXA 3KGKA 4MCUA 1R4WA 3HJMA 3FZAA 2NPBA 3FEUA 3BCIA 4KX4A 1G7OA 1Z5YE 2CA8A 3GSSA 4XS1A 3IC4A 2C80A 5D9VA 5G5FA 3UBKA 1X5EA 3Q18A 4ZB8A 2H76A 2OA7A 2WFCA 3H8QA 4HQZA 3G7IA 4KDYA 2H8LA 1TK8B 4O5RA 5CRGA 5ID2B 11GSA 1YJ6A 3FR3A 2VCQA 4ZBBA 3HVXA 3TB2A 2DJ0A 5AISA 1GLQA 5IOXA 2CZ2A 1ACVA 5ECIB 3ERWA 1XPVA 1SKWB 1X5DA 3PINA 5CO3A 3FYGA 5C04A 3WGDA 1SKRB 2RUFA 1ABAA 3TRQA 2MYGA 1MTCA 1YDKA 3CSJA 1XFLA 1OE7A 2WRTA 2VL2A 2LNSA 5G30A 4MABA 2K8VA 1OVNA 3KZQA 2RM6A 3C1SA 2N5BA 2L5LA 1EGOA 2YWMA 3GV1A 3HVVA 2JZTA 2E7PA 3DGQA 5D93A 1A8YA 5EY6A 2KP1A 5ECQB 2TRCP 4IVFA 3UVHA 4O32A 4ECIA 4RQRA 4L0UA 3KH9A 1AW9A 1W89A 3CXGA 3GFKA 5D9XA 1A0FA 4EVMA 2MBTA 4FYCA 2EIQA 3KTLA 2C0DA 4GQCA 3SBCA 4HOJA 4OO4A 3C7MA 2PPTA 2REMA 3DEXA 1B9YC 4KNDA 2IMEA 4BPYA 3WGEA 4TOPA 1A0RP 4MH3A 1WMJA 3L9VA 4LA1A 2LV3A 2VLTA 3BBYA 2GS3A 3UVTA 2PBJA 1BAYA 2L4QA 5ABRA 4D73B 3IR4A 1T8EB 1GSYA 1QGVA 3L4NA 2H73A 4HI7A 4F0BA 4AF2A 3FKFA 3L9SA 4MMMA 4MJEA 5ECRB 1ZOFA 4TXVA 1A23A 3CBUA 1C72A 4PUFC 1F6MC 1GSUA 4MPGA 2LJRA 1NW2A 2YZHA 4FH8A 1TI1A 2I3YA 1SK0A 1K3LA 2H6ZA 2YWIA 2HLSA 4GTUA 4JZQA 1AAZA 1B9XC 3QPMA 2O89A 4PQHA 4TW5A 2GSRA 4N30A 3P8WA 3KP8A 2PUKC 1V40A 2R6KA 3DIEA 5J9CA 1ERTA 2GSSA 2HRFA 4YQVA 2HFDA 4WXTA 4Z7XA 1URMA 2L6CA 2HI7A 3IAS2 3N5OA 1QMVA 1XCCA 4OO5A 2MBSA 2FGXA 2H1DA 4KW6A 1BQ7A 1TI3A 5INYA 3IE3A 6GSYA 1E6BA 1JZDA 2E2MA 1JLVA 4ZL8A 3GA4A 4I2TA 3WD6A 2ON5A 1T4YA 1THOA 1MDIA 2VCZA 5CYYA 1TU8A 5A4VA 1DBYA 2KHPA 2IMIA 4F0CA 5DJLA 3EU4A 4JR4A 4TVEA 3QD9A 4LMWA 1U3IA 1VF4A 1S3AA 1B48A 1MD4A 4E8HA 4NHWA 3UARA 4E8EA 4HZ4A 2GT6A 3EMPA 2V2GA 2MZCA 3TDGA 3FR6A 3BD2A 2MMZA 16GSA 1FVJA 3RHCA 4I97A 4WEYA 4K7OA 2ES7A 1G6YA 3ZRDA 1F9MA 1GSFA 4TR1A 2K8SA 3TUEA 4BVXA 1OAZA 1J0FA 1TRUA 3BOAA 4FYBA 4HJ2A 4N0VA 2DLXA 1FO5A 2C8UA 1LBKA 1JFUA 4KSMA 3TKRA 2FWHA 3Q74A 2H1BA 4G2EA 2LRCA 2F8AA 2C4JA 2LSTA 5IIZA 3DMLA 4YQUA 3IA1A 2C1YA 20GSA 2FUG2 4EDZA 4ML1A 2OBKA 2YV7A 5J9BA 1OC9B 2ZNMA 5F8BA 5J4UA 1EGRA 3GUSA 1M0UA 2YPMA 1ERVA 1GTBA 1DUGA 1YY7A 3TOUA 5HR2A 1PGTA 1M2DA 4K9ZA 4MZWA 3ZL5A 2F8FA 4LLRA 2LRNA 2HZFA 1TDIA 2RUEA 5B6NA 4I6XA 4ZXGA 4NXIA 5KEJA 4ML6A 1EP8A 3HJOA 3E0UA 2KP2A 2WS2A 4QQ7A 2PGTA 2IL3A 4DSRA 5CNWA 1EV9A 1O8WA 2K9FA 1QXHA 3U5RE 5ECHB 3ZFBA 1SK1A 4O92A 1X9SB 2PU9C 4JE1A 3ZYWA 5IQYA 1GSEA 4LMVA 2R2JA 2IWTA 2A2SA 3KTBA 2JACA 3VWXA 2HZEA 2FNOA 4ECCA 4KSOA 2AUVA 1YEPA 2HSYA 1G7EA 1MEKA 2A2RA 3HXSA 1K0OA 5ECOB 14GSA 4TR4A 2OKAA 4XS4B 6GSUA 2DJKA 1DSBA 1S3DA 3ZIJA 5B7CA 3CRUA 3I9V2 4XRAA 3F3RA 3FR9A 4NMUA 5F07A 3P2AA 3ED3A 3PR8A 4GQFA 2C0FA 2C3QA 2OBIA 2CAIA 2C0GA 2V6KA 1JHBA 5DALB 2GZZA 2ZCTA 2FA4A 1E2YA 2XBQA 4K7NA 3UL3A 2A4VA 1M9BA 3HHVA 4WF5A 5IM9A 5ECSA 5HFGA 3GKKA 4K0NA 4EKZA 4V2MA 5G2ZA 5AN1A 3M3MA 3VWVA 3UMAA 1R7HA 1R26A 2WULA 5JWQB 3UJ1A 3W6GA 3IBHA 4OWYA 3VK9A 3M9KA 4OMVA 5LD0A 2OACA 4K8MA 5KN0A 2NTOA 2L4CA 3GURA 2DIZA 4X1UA 1YF0A 1B8XA 2H1AA 4TR0A 13GSA 3HYPA 4EF0A 4F9ZA 2VL9A 4GWRA 1OC8A 2H70A 4IHUA 1GTUA 2OE3A 1XWCA 1F37A 3D4MA 2FWGA 2PVOC 5G1LA 22GSA 5KN2A 1DE1A 1SJ6A 3EVIA 1MDJA 2VCTA 3L9UA 4HS1A 2WJUA 1SK2A 1GNWA 1A2MA 3W8JA 3IK7A 5G1KA 2V1MA 2FLSA 4QL7A 4RUVA 1Z7PA 4XRDA 3DYRA 3I6AA 6GSTA 1BG5A 1OKTA 3TJJA 2OADA 5CAXA 2LUSA 5HFIA 5D96A 1XW6A 2MMOA 4IBPA 3UEMA 4DEJA 4HJMA 3CSIA 3TKSA 4PQIA 1GL8A 1SL0B 2VO4A 1F3BA 1EEMA 5LNKe 2YOIA 4BWSA 3F3QA 3LJRA 3OR5A 3ERFA 3GH9A 5ENUA 2MMNA 1Z3EA 4TN8A 2WZ9A 3HD5A 4ZILA 2JADA 3ZITA 4IW9A 2YWOA 4I8BA 3HCZA 1JZRA 4OFNA 4CHSA 1M2BA 2VL2C 4YQMA 1AIUA 1EOGA 2HYXA 4MF6A 5JWOB 2VM1A 5DDLA 3CYNA 3GL3A 3IAM2 2B7JA 4IN0A 4K6XA 1F2EA 1GUMA 3C73A 3GRXA 1R5AA 2IFQB 2JSZA 1PKWA 4G10A 3H93A 1KBNA 2LJKA 1M2AA 2YWNA 3A2VA 2X8CA 2YANA 3DRNA 4TXOA 2HSHA 3VWWA 3M9JA 3D6IA 2O8VB 3FY7A 1F3AA 4I5QA 1QFNA 1TOFA 4KA0A 1EV4A 4V2LA 2VAFA 4K0GA 5DCGA 1K0BA 2HNLA 4WR5A 1N2AA 2G2QA 1TK0B 4KCAA 2H0GA 4HEA2 2EC4A 1SU9A 2ALBA 4L0WA 1PX7A 4IELA 3U6VA 3TRXA 5IMFA 2O85A 4JEDA 2EIRA 1K3YA 2C3NA 1AXDA 4DVCA 1XBSA 1YEXA 2H72A 3G9BA 2F3MA 2V6OA 3LFLA 2LQQA 3F0IA 3KEBA 5G5EA 1GUKA 1OE8A 5CREA 3VI7A 2GZPA 3CRTA 3PGTA 3GX0A 5J3RA 1WOUA 3US3A 3LXZA 3TJFA 3H1NA 3GNJA 5B8BA 4O7HA 2BMXA 1UC7A 2H74A 2N5FA 4BL7A 3LQ7A 5AGYA 1GLPA 3F6FA 2GSTA 3IHQA 1O7UA 2LJAA 2GGTA 4K2DA 4F03A 3APQA 5AIVA 1NSWA 2P0GA 3MDKA 1TRWA 3C1RA 4YH2A 1KEBA 4PNFA 1EP7A 2LRTA 5HFKA 3TKPA 2H6XA 2KLXA 2ZUPA 3VLNA 3E9JB 3M1GA 5LCZA 1OC3A 1SKSB 3ISOA 6GSXA 4IKHA 5IOWA 2K18A 2R5GA 3LXTA 4PUAA 5GSTA 3ZVJA 4P3YB 2XPEA 4MP4A 1ZMAA 2LS5A 3GTUB 1ZYQB 2VLVA 1OYJA 4POKA 3ZLPA 3ME8A 2M46A 3UIWA 1GSSA 1KNGA 2BJXA 5ID2A 5C00A 4DSSB 1T00A 5IMCA 1V98A 4KH7A 2QSIA 4POMA 3GKNA 1NHOA 5AIXA 1SD8A 1IYHA 3LWAA 1Z6MA 4ZB9A 4GSNA 2YJHA 4BVYA 2JU5A 4AJ8A 5F0GA 4PQ1A 2LNTA 5E4WA 2WCIA 3ERGA 3HA9A 1LU4A 1PX6A 2FWFA 3GHAA 4MZBA 3S9FA 3VPQA 3F6DA 3EC3A 1XOAA 4YAVA 1TTZA 3FK8A 3MWHA 5CRWA 2DC5A 4ECBA 3G7JA 3UBLA 3C71A 1FW1A 5KN3A 3V1WA 1GWCA 1I9DA 2J23A 2YP6A 4Q5RA 4NV2A 4V2NA 5DAKB 2E2GA 4IS0A 4ISDA 1PL1A 2VCWA 3IK9A 1U87A 1O8XA 3HJPA 2VCVA 3F9UA 3EWLA 4IP1A 2LTKA 3QMXA 2H1GA 2CT6A 1T7PB 2CAQA 1J08A 3VFIA 1XXUA 3L0HA 1K3OA 1HNCA 4MJBA 1XWAA 1H75A 3D21A 2HRNA 5ECPB 4RI6A 3NZNA 5JCGA 2YN1A 1AUCA 3CTFA 5D73A 1WJKA 4KB3A 3KIJA 2JSYA 1IYIA 2B5YA 3I69A 1BYEA 4XHMA 2X99A 2TRXA 3RDWA 3BJ5A 4JR6A 4D73A 4ZBAA 3LSZA 5ECNB 1SENA 1SJIA 3EURA 2FHEA 3LYPA 2LKUA 2P31A 3RPPA 4BWQA 1T4ZA 1AQVA 4IGJA 3TOTA 3AY8A 5GAPD 1UA5A 4MZCA 2GZYA 2QGVA 1FAAA 1ML6A 2M72A 6GSVA 1FVKA 2GQLA 2IPAA 4KGIA 2CVKA 5KN1A 3O76A 1RQMA 4AJ7A 1HNBA 1VRSD 3QAVA 3TKSE 2DSAA 4OD7A 2H01A 5GZZB 1X0RA 2VL3A 3DD3A 3M0FA 4V1Ap 3FRCA 4RQXA 4WBRD 1FG4A 6GSSA 3HZ8A 3MAKA 3TRPA 1U6TA 3UAPA 4WKWA 2N5AA 5CRHA 4TKYA 4KAEA 2IMDA 3PH9A 3LEFA 3F4SA 4TR3A 5F06A 1ZZYA 4EO3A 3DVXA 1FB6A 3ZIVA 2AB6A 1WP0A 3IDVA 4MF5A 5IO0A 5IMZA 1QUWA 1BEDA 1ZL9A 1K0CA 3EYTA 3TJKA 1BX9A 5G31A 5IPGA 5IMAA 9GSSA 4KDXA 2X64A 4L5LA 1HYUA 4ZIJA 2DJ1A 4N11A 2AYTA 4CDOA 1GUHA 2D2ZA 5ELGA 5H5SA 4OFTA 2R4VA 5D8IA 4L5OA 2VIMA 1G0TA 3VURA 5B6MA 1UN2A 2G0FA 5DCHA 2P5RA 2H0HA 1V2AA 1FB0A 3RHBA 4MJAA 1YKCA 4XTSA 3EE2A 3D5JA 4GLTA 2L6DA 3KH7A 2H66A 4HDEA 4PURA 1MDKA 1XVQA 2DBCA 3VWUA 5A4WA 4GF0A 5GAND 2VCXA 1AQWA 3FW2A 1OC9A 2H71A 5H5QA 4HU7A 2I9HA 3WYWA 4ZBDA 5DVBA 4PX1A 2LEGA 4PNGA 4I2UA 1YF1A 4XS6A 3TKSC 1XOBA 2CZ3A 1XZOA 1UVZA 1FOVA 4FO5A 1EWXA 3QOUA 3WGXA 4GSTA 4G19A 1GTAA 1USBA 1MD3A 1VGLA 4F82A 3P7XA 4ECJA 5CRDA 3LYKA 3ZVJD 1ON4A 2YZUA 4EL1A 2YNXA 3LORA 2DJ2A 3F4TA 2HXKA 3R2QA 1K0DA 5B8AA 1YQ1A 3GMFA 4KDUA 3KMNA 3QR6A 4AGSA 3TGZA 2FD3A 1XWGA 2XPDA 1VF2A 4TRXA 5J41A 5ELAA 4NAXA 4FIWA 3J7Yk 1X9WB 2GQMA 3LGCA 4PXOA 2RM5A 17GSA 1I5GA 1T3BA 3GIXA 3FZ9A 1S3CA 19GSA 1X9MB 1TRSA 2JZRA 4ZB6A 3DXBA 1EOHA 5DQYA 1A2JA 2PVQA 4IQAA 5EPFA 1Y6EA 1K0NA 4XS4A 3Q6OA 4WETA 1XIYA 1VF1A 4AJ6A 4DSQA 3L78A 3TJBA 4LL4B 2H30A 4HQSA 4TR1B 4IJ3A 5D9WA 3CSHA 1Q4JA 5L71A 4JU5A 1YKAA 4Q5FA 1O73A 3HDCA 3EU3A 5DALA 5CP1A 3EMXA 5DQSA 5D9TA 2CVBA 1GSDA 2R37A 3ZMKA 1M7TA 1O6JA 2TIRA 3WT1A 4ID0A 3NOFA 4WF4A 4XCSA 3UOMA 4ZL9A 2C3TA 4H86A 2GSQA 3MSZA 4J2FA 3ZMLA 5IMVA 1ERUA 3A2XA 2I1UA 4G9HA 4J57E 2XC2A 1T1VA 2L5OA 1TXXA 2PERA 3RPNA 2VD1A 2X8GA 4EE0A 3CTGA 1V58A 1W4VA 2IJYA 3Q19A 1RK4A 2MMAA 2OE1A 7GSSA 1HD2A 4PGTA 3GX8A 5E59A 3KCMA 4EUYA 3M8NA 2I4AA 2LQOA 4F2IA 1EZKA 4GCIA 4NV5A 3IV4A 3RBTA 3IRAA 2OE0A 2H0IA 3QCPA 4MK3A 1YZXA 1RW1A 2DIYA 4OFMA 1TJDA 3WT2A 4ILFA 2CVDA 4JRRA 4ZL7A 2HZEB 1CQHA 2DMMA 3NIVA 3ZZXA 2JL4A 4IJIA 5JCUA 2KUCA 4HU9A 2WB9A 2OJLA 1O81A 2IMFA 1GTIA 2IMKA 4X0XA 2L57A 3A2WA 1Y25A 5EL8A 3P90A 3TKQA 1SD9A 1HNAA 5HR1A 4GSSA 5J5NA 2PMTA 4N10A 1SYRA 4JBBA 2V32A 2RIIA 5IO2A 1TKDB 4NPBA 4QL9A 3N9JA 2PN8A 4Q5QA 2GDRA 1QK8A 3ZFLA 3TCOA 5HQPA 3O6TA 5FT3A 2GT5A 2VUPA 3DWVA 2DMLA 1PMTA 2QKEA 3FZ5A 2VD0A 1ZYEA 1N8JA 4L8EA 2X8HA 1G6WA 2ON7A 2B1LA 2F51A 2RLIA 1K0MA 5JWRB 3KP9A 2V41A 5FWGA 5H5RA 1KTEA 4MPFA 3FZ4A 4LL1B
chains in the Genus database with same CATH superfamily
4GRFA 2B1KA 1K0AA 1VF3A 3GN3A 2H75A 1Q98A 1SYXA 4J56E 3ZREA 1SJZA 1BJXA 2HE3A 2IFQA 2QA1A 2O7KA 2YJ7A 1ZGNA 5A5KA 6GSWA 1H4OA 3QAWA 2A4HA 3DKSA 4K1FA 1TW9A 1XVWA 1ZCPA 5IPHA 1OKDA 2WGRA 4MJCA 1XWKA 1JZWA 1NHYA 1A2LA 2CV4A 3FHKA 1A8LA 2FY6A 3KXOA 3QFAC 4MF7A 4NWYA 3RAZA 3GL5A 2I81A 2CQ9A 2FCHA 1SL1B 4Q5NA 5ECMB 2B6MA 1PQNA 2B5XA 1TK5B 3E3EA 2E0QA 5A4UA 1XW9A 2DKHA 1U88A 1PD21 2B5EA 2F9SA 4EDYA 3LW9A 1WWJA 1XW5A 2R0PA 4MH2A 4IQ1A 3F4RA 1CQGA 2GTUA 2H6YA 2AAWA 1XWBA 5COHA 3KJYA 3HY2A 2PWJA 4MDCA 3F8UA 1R5PA 3HKRA 2FWEA 1M99A 5JCWA 2HT9A 3IPZA 4IP6A 4MNNA 2CX3A 2VLUA 4OCEA 3W8SA 4RI7A 1PKZA 4BA7A 1WRYA 3HZ4A 1J9BA 2C0EA 2JZSA 4EC0A 3K8NA 5F05A 1LJRA 1GNEA 3HVSA 4HUAA 1ILOA 2J9HA 3TJGA 2CX4A 3H4KA 3D22A 4ACSA 5ECLB 3G7YA 1Z6NA 3MNGA 3EINA 5DJMA 3A3TA 3BCKA 1SL2B 1JZOA 4CW9A 2DJ3A 1B4QA 4KCEA 2AJQB 1GP1A 5DBQA 3GKXA 1THXA 12GSA 1PSQA 4WR4A 2XHFA 2O87A 1PA3A 5FHIA 3I43A 1FHEA 2GLRA 3IOSA 4TXOB 3A5WA 1WIKA 1FOHA 3QAGA 4ICYA 2KOKA 1HQOA 3GTUA 2IIYA 1EEJA 3KM6A 3D4TA 1X5CA 3D0ZA 3F63A 2FA8A 4XIHA 3GYKA 1PN9A 1TRVA 4DSSA 1WPIA 2BTOT 4USSA 3DVWA 3VI5A 2YV9A 3APSA 4V1Ag 3JCML 4POLA 2QC7A 4OCFA 1PRXA 2VOCA 5HR0A 2L59A 1ZYPA 3GKMA 3QDNA 3APOA 2B7KA 2XBIA 2EIOA 3H79A 1QQ2A 2NVLA 1B4PA 4K5SA 1ST9A 1A24A 2AHEA 2K6VA 4N0ZA 1WE0A 2R3XA 2B3SA 2WDUA 1V57A 3IXRA 5IMDA 1Z9HA 2H19A 5HR3A 1GULA 4GXZA 4EXJA 4MLYA 4KUNA 3SWLA 18GSA 2NDOA 4ULXA 2IN3A 1GRXA 1JLWA 4FYUA 4MA9A 1TP9A 2M80A 1Z7RA 1DE2A 3KD0A 3O3TA 1PL2A 2DJJA 1GSQA 4HZ2A 2P5QA 4WBJA 3KMOA 3J7Yb 4KE3A 1M9AA 2VM2A 5GSSA 1O85A 1GH2A 4X43A 4NHZA 2YCDA 4YAPA 3CMIA 1U3AA 2GQKA 3C8EA 1AC1A 5DAKA 1ERWA 3ME7A 2GVPA 5ECKB 2Z9SA 5EVOA 10GSA 2NBSA 3LG6A 3QFBC 3GSTA 1NM3A 3VPTA 3ZTLA 3GH6A 1TU7A 8GSSA 4K7IA 1V9WA 2AV4A 2R0GA 1AQXA 3KGKA 4MCUA 4POBA 1R4WA 3HJMA 3FZAA 2NPBA 3FEUA 3BCIA 4KX4A 1G7OA 1Z5YE 2CA8A 3GSSA 4XS1A 3IC4A 2C80A 5D9VA 5G5FA 3UBKA 1X5EA 3Q18A 4ZB8A 2H76A 2OA7A 2WFCA 3H8QA 4HQZA 3G7IA 4KDYA 2H8LA 1TK8B 4O5RA 5CRGA 5ID2B 11GSA 1YJ6A 3FR3A 2VCQA 4ZBBA 3HVXA 3TB2A 2DJ0A 5AISA 1GLQA 5IOXA 2CZ2A 1ACVA 5ECIB 4BVYB 3ERWA 1XPVA 1SKWB 1X5DA 3PINA 5CO3A 3FYGA 5C04A 3WGDA 1SKRB 2RUFA 1ABAA 3TRQA 2MYGA 1MTCA 1YDKA 4Z2UA 3CSJA 1XFLA 1OE7A 2WRTA 2VL2A 2LNSA 5G30A 4MABA 2K8VA 1OVNA 3KZQA 2RM6A 3C1SA 2N5BA 1M3IA 2L5LA 1EGOA 2YWMA 3GV1A 3HVVA 2JZTA 2E7PA 3DGQA 5D93A 1A8YA 5EY6A 2KP1A 5ECQB 2TRCP 4IVFA 3UVHA 4O32A 4ECIA 4RQRA 4L0UA 3KH9A 1AW9A 1W89A 3CXGA 3GFKA 5D9XA 1A0FA 4EVMA 2MBTA 4FYCA 2EIQA 3KTLA 2C0DA 4GQCA 3SBCA 4HOJA 4OO4A 3C7MA 2PPTA 2REMA 3DEXA 1B9YC 4KNDA 2IMEA 4BPYA 3WGEA 4TOPA 1A0RP 4MH3A 1WMJA 4K5RA 4HSCX 3L9VA 4LA1A 2LV3A 1PN0A 2VLTA 3BBYA 2GS3A 3UVTA 2PBJA 1BAYA 2L4QA 5ABRA 4D73B 3IR4A 1T8EB 1GSYA 1QGVA 3L4NA 2H73A 4HI7A 2HRKA 4F0BA 4AF2A 3FKFA 3L9SA 2UZ8A 3HVNA 4MMMA 4MJEA 5ECRB 1ZOFA 4TXVA 1A23A 3CBUA 1C72A 4PUFC 1F6MC 1GSUA 4MPGA 2LJRA 1NW2A 2YZHA 4FH8A 1TI1A 2I3YA 1SK0A 1K3LA 2H6ZA 2YWIA 2HLSA 4GTUA 4JZQA 1AAZA 1B9XC 3QPMA 2O89A 4PQHA 4TW5A 2GSRA 4N30A 3P8WA 3KP8A 2PUKC 1V40A 2R6KA 3DIEA 5J9CA 1ERTA 2GSSA 1M3JA 2HRFA 4YQVA 2HFDA 4WXTA 4Z7XA 1URMA 2L6CA 2HI7A 3IAS2 3N5OA 1QMVA 1XCCA 4OO5A 2MBSA 2FGXA 2H1DA 4KW6A 4X4JA 1BQ7A 1TI3A 5INYA 3IE3A 6GSYA 1E6BA 1JZDA 2E2MA 1JLVA 4A5PA 4ZL8A 3GA4A 4I2TA 3WD6A 2ON5A 1T4YA 1THOA 1MDIA 2VCZA 5CYYA 1TU8A 5A4VA 1DBYA 2KHPA 2IMIA 4F0CA 3EU4A 5DJLA 4JR4A 4TVEA 3QD9A 4LMWA 1U3IA 1VF4A 1S3AA 1B48A 1MD4A 4E8HA 4NHWA 3UARA 4E8EA 4HZ4A 2GT6A 3EMPA 2V2GA 2MZCA 3TDGA 3FR6A 3BD2A 2MMZA 16GSA 4O5UA 1FVJA 3RHCA 4I97A 4WEYA 4K7OA 2ES7A 1G6YA 3ZRDA 1F9MA 1GSFA 4TR1A 2K8SA 3TUEA 4BVXA 1OAZA 1J0FA 1TRUA 3BOAA 4FYBA 4HJ2A 4N0VA 2DLXA 1FO5A 1XG8A 2C8UA 1LBKA 1JFUA 4KSMA 3TKRA 2FWHA 3Q74A 2H1BA 4G2EA 2LRCA 2F8AA 2C4JA 2LSTA 5IIZA 3DMLA 4YQUA 3IA1A 2C1YA 20GSA 2FUG2 4EDZA 4ML1A 2OBKA 2YV7A 5J9BA 1OC9B 2ZNMA 5F8BA 5J4UA 1EGRA 3GUSA 1M0UA 2YPMA 1ERVA 1GTBA 1DUGA 1YY7A 3TOUA 5HR2A 1PGTA 1M2DA 4K9ZA 4MZWA 3ZL5A 2F8FA 4LLRA 2LRNA 2HZFA 1TDIA 2RUEA 5B6NA 4I6XA 4ZXGA 4NXIA 5KEJA 4ML6A 1EP8A 3HJOA 3E0UA 2KP2A 2WS2A 4QQ7A 2PGTA 2IL3A 4DSRA 5CNWA 1EV9A 3R3EA 1O8WA 2K9FA 1QXHA 3U5RE 5ECHB 3ZFBA 1SK1A 4O92A 1X9SB 2PU9C 4JE1A 3ZYWA 5IQYA 1GSEA 4KF9A 4LMVA 2R2JA 2IWTA 2A2SA 3KTBA 4BIKA 2JACA 3VWXA 2HZEA 2FNOA 4FQUA 4EIQA 4ECCA 4KSOA 2AUVA 1YEPA 2HSYA 1G7EA 1MEKA 2A2RA 3HXSA 1K0OA 5ECOB 14GSA 4TR4A 2OKAA 4XS4B 6GSUA 2X4AA 2DJKA 1DSBA 1S3DA 3ZIJA 5B7CA 3CRUA 3I9V2 4XRAA 3F3RA 3EPTA 3FR9A 4NMUA 5F07A 3P2AA 3ED3A 3PR8A 4GQFA 2C0FA 2C3QA 2OBIA 2CAIA 2C0GA 2V6KA 1JHBA 5DALB 2GZZA 2ZCTA 2FA4A 1E2YA 2XBQA 4K7NA 3UL3A 2A4VA 1M9BA 3HHVA 4WF5A 5IM9A 5ECSA 5HFGA 3GKKA 4K0NA 4EKZA 4V2MA 5G2ZA 5AN1A 3M3MA 3VWVA 3UMAA 1R7HA 1R26A 2WULA 5JWQB 3W6GA 3UJ1A 3IBHA 4OWYA 1ZYNA 3VK9A 3M9KA 4OMVA 5LD0A 2OACA 4K8MA 5KN0A 2NTOA 2L4CA 3GURA 2DIZA 4X1UA 1YF0A 1B8XA 4TR0A 2H1AA 3MIXA 13GSA 4BL7B 3HYPA 4EF0A 4F9ZA 2VL9A 4GWRA 1OC8A 2H70A 4IHUA 1GTUA 2OE3A 1XWCA 1F37A 3D4MA 2FWGA 2PVOC 5G1LA 22GSA 5KN2A 1DE1A 1SJ6A 3EVIA 1MDJA 2VCTA 3L9UA 4HS1A 2WJUA 1SK2A 1GNWA 1A2MA 3W8JA 3IK7A 5G1KA 4G0KA 2V1MA 2FLSA 4QL7A 4RUVA 1Z7PA 4XRDA 3DYRA 3I6AA 6GSTA 1BG5A 1OKTA 3TJJA 2OADA 5CAXA 2LUSA 5HFIA 5D96A 1XW6A 2MMOA 4IBPA 3UEMA 4DEJA 4HJMA 3CSIA 3TKSA 4PQIA 1GL8A 1SL0B 2VO4A 1F3BA 1EEMA 5LNKe 3A5IA 2YOIA 4BWSA 3F3QA 3LJRA 3OR5A 3ERFA 3GH9A 5ENUA 2MMNA 1Z3EA 4TN8A 2WZ9A 3HD5A 4ZILA 2JADA 3ZITA 4IW9A 4Z2RA 2YWOA 4I8BA 3HCZA 1JZRA 4OFNA 4CHSA 1M2BA 2VL2C 4CY8A 4YQMA 1AIUA 1EOGA 2HYXA 4MF6A 5JWOB 2VM1A 5DDLA 3CYNA 3GL3A 3IAM2 2B7JA 4IN0A 4K6XA 1F2EA 1GUMA 3C73A 3GRXA 1R5AA 2IFQB 2JSZA 4YKFA 1PKWA 4G10A 3H93A 1KBNA 2LJKA 1M2AA 2YWNA 3A2VA 2X8CA 2YANA 3DRNA 4TXOA 2HSHA 3VWWA 3M9JA 3D6IA 2O8VB 3FY7A 1F3AA 4I5QA 1QFNA 1TOFA 4KA0A 1EV4A 4V2LA 2VAFA 4K0GA 5DCGA 1K0BA 2HNLA 4WR5A 1N2AA 2G2QA 1TK0B 4KCAA 2H0GA 4HEA2 2EC4A 1SU9A 2ALBA 4L0WA 1PX7A 4IELA 3U6VA 3TRXA 5IMFA 2O85A 4JEDA 3FMWA 2EIRA 1K3YA 2C3NA 1AXDA 4DVCA 1XBSA 1YEXA 2H72A 3G9BA 2F3MA 2V6OA 3LFLA 2LQQA 3F0IA 3KEBA 5G5EA 1GUKA 1OE8A 5CREA 3VI7A 2GZPA 3CRTA 3PGTA 3GX0A 5J3RA 1WOUA 3US3A 3LXZA 3TJFA 3H1NA 3GNJA 5B8BA 4O7HA 2BMXA 1UC7A 2H74A 2N5FA 4BL7A 3LQ7A 5AGYA 1GLPA 3F6FA 2GSTA 3IHQA 1O7UA 2LJAA 2GGTA 4K2DA 4F03A 3APQA 5AIVA 1NSWA 3PPUA 2P0GA 3MDKA 1TRWA 3C1RA 4YH2A 1KEBA 4PNFA 1EP7A 2LRTA 5HFKA 3TKPA 3IHGA 2H6XA 2KLXA 2ZUPA 3VLNA 3E9JB 3M1GA 5LCZA 1OC3A 1SKSB 3ISOA 6GSXA 4IKHA 5IOWA 2K18A 2R5GA 3LXTA 4PUAA 5GSTA 3ZVJA 4P3YB 2XPEA 4MP4A 1ZMAA 2LS5A 3GTUB 1ZYQB 2VLVA 1OYJA 4POKA 3CQFA 3ZLPA 3ME8A 2M46A 3UIWA 1GSSA 1KNGA 2BJXA 5ID2A 5C00A 4DSSB 1T00A 5IMCA 4G0LA 1V98A 4KH7A 2QSIA 4POMA 3GKNA 1NHOA 5AIXA 1SD8A 1IYHA 3LWAA 1Z6MA 4ZB9A 4GSNA 2YJHA 4BVYA 2JU5A 4AJ8A 5F0GA 4PQ1A 2LNTA 5E4WA 2WCIA 3ERGA 3HA9A 1LU4A 1PX6A 2FWFA 3GHAA 4MZBA 3S9FA 3VPQA 3F6DA 3EC3A 1XOAA 4YAVA 1TTZA 3FK8A 3MWHA 5CRWA 2DC5A 4ECBA 3G7JA 3UBLA 3C71A 1FW1A 5KN3A 3V1WA 1GWCA 1I9DA 2J23A 2YP6A 5KOXA 4Q5RA 4NV2A 4V2NA 5DAKB 2E2GA 4IS0A 4ISDA 1PL1A 2VCWA 3IK9A 1U87A 1O8XA 3HJPA 2VCVA 3F9UA 3EWLA 4IP1A 2LTKA 3QMXA 2H1GA 2CT6A 1T7PB 2CAQA 1J08A 3VFIA 1XXUA 3L0HA 1K3OA 1HNCA 4MJBA 1XWAA 1H75A 3D21A 2HRNA 5ECPB 4RI6A 3NZNA 5JCGA 2R0CA 2YN1A 1AUCA 2HSMA 3CTFA 5D73A 1WJKA 4KB3A 3KIJA 2JSYA 1IYIA 2B5YA 3I69A 1BYEA 4XHMA 2X99A 2TRXA 3RDWA 3BJ5A 4G0IA 4JR6A 4D73A 4ZBAA 3LSZA 5ECNB 1SENA 1SJIA 3EURA 2FHEA 3LYPA 2LKUA 2P31A 3RPPA 4BWQA 1T4ZA 1AQVA 4IGJA 3TOTA 3AY8A 5GAPD 1UA5A 4MZCA 5BRTA 2GZYA 2QGVA 1FAAA 1ML6A 2M72A 6GSVA 1FVKA 2GQLA 2IPAA 4KGIA 2CVKA 5KN1A 3O76A 1RQMA 4AJ7A 1HNBA 1VRSD 4K2XA 3QAVA 3TKSE 2DSAA 4OD7A 2H01A 5GZZB 1X0RA 2VL3A 3DD3A 3M0FA 4V1Ap 3FRCA 4RQXA 4WBRD 1FG4A 6GSSA 3HZ8A 3MAKA 3TRPA 1U6TA 3UAPA 4WKWA 2N5AA 5CRHA 4TKYA 4KAEA 2IMDA 3PH9A 3LEFA 3F4SA 4TR3A 5F06A 1ZZYA 4EO3A 3DVXA 1FB6A 3ZIVA 2AB6A 1WP0A 3IDVA 4MF5A 5IO0A 5IMZA 1QUWA 5KOWA 1BEDA 1ZL9A 1K0CA 3EYTA 3TJKA 1BX9A 5G31A 5IPGA 5IMAA 9GSSA 4KDXA 2X64A 4L5LA 1HYUA 4ZIJA 2DJ1A 4N11A 5BMUA 2AYTA 4CDOA 1GUHA 2D2ZA 5ELGA 5H5SA 4OFTA 2R4VA 5D8IA 4L5OA 2VIMA 1G0TA 3VURA 5B6MA 1UN2A 2G0FA 5DCHA 2P5RA 2H0HA 1V2AA 1FB0A 3RHBA 4MJAA 1YKCA 4XTSA 3EE2A 3D5JA 4GLTA 2L6DA 3KH7A 2H66A 4HDEA 4PURA 1MDKA 1XVQA 2DBCA 3VWUA 5A4WA 4GF0A 5GAND 2VCXA 1S3RA 1AQWA 3FW2A 1OC9A 2H71A 5H5QA 4HU7A 2I9HA 3WYWA 4ZBDA 5DVBA 4PX1A 2LEGA 4PNGA 2A2PA 4I2UA 1YF1A 4XS6A 3TKSC 1XOBA 2CZ3A 1XZOA 1UVZA 1FOVA 4FO5A 1EWXA 3QOUA 3WGXA 4GSTA 4G19A 1GTAA 1USBA 1MD3A 1VGLA 4F82A 3P7XA 4ECJA 5CRDA 3LYKA 3ZVJD 1ON4A 2YZUA 4EL1A 2YNXA 3LORA 2DJ2A 3F4TA 2HXKA 3R2QA 1K0DA 5B8AA 1YQ1A 3GMFA 4KDUA 3KMNA 3QR6A 4AGSA 3TGZA 2FD3A 1XWGA 2XPDA 1VF2A 4TRXA 5J41A 5ELAA 4NAXA 4FIWA 3J7Yk 1X9WB 2GQMA 3LGCA 4PXOA 2RM5A 17GSA 1I5GA 1T3BA 3GIXA 3FZ9A 1S3CA 19GSA 1X9MB 1TRSA 2JZRA 4ZB6A 3DXBA 1EOHA 5DQYA 1A2JA 2PVQA 4IQAA 5EPFA 1Y6EA 1K0NA 4XS4A 3Q6OA 4WETA 1XIYA 1VF1A 4AJ6A 4DSQA 3L78A 3TJBA 4LL4B 2H30A 4HQSA 4TR1B 4BVXB 4IJ3A 5D9WA 3CSHA 1Q4JA 5L71A 4JU5A 4Z2TA 1YKAA 4Q5FA 1O73A 3HDCA 3EU3A 5DALA 5CP1A 3EMXA 5DQSA 5D9TA 2HRAA 2CVBA 1GSDA 2R37A 3ZMKA 1M7TA 1O6JA 2TIRA 3WT1A 4ID0A 3NOFA 4WF4A 4XCSA 4EIPA 3UOMA 4ZL9A 2C3TA 4H86A 2GSQA 3MSZA 4J2FA 3ZMLA 5IMVA 1ERUA 3A2XA 2I1UA 4G9HA 4O5QA 4J57E 2XC2A 1T1VA 2L5OA 1TXXA 2PERA 3RPNA 2VD1A 2X8GA 3MYDA 4EE0A 3CTGA 1V58A 2X49A 1W4VA 2IJYA 3Q19A 1RK4A 2MMAA 2OE1A 7GSSA 4PTSA 1HD2A 4PGTA 3GX8A 5E59A 3KCMA 4EUYA 3M8NA 2I4AA 2LQOA 4F2IA 1EZKA 2DKIA 4GCIA 4NV5A 3IV4A 3RBTA 3IRAA 2OE0A 2H0IA 3QCPA 4MK3A 1YZXA 1RW1A 2DIYA 1PFOA 4OFMA 1TJDA 3WT2A 4ILFA 2CVDA 4JRRA 4ZL7A 2HZEB 1CQHA 2DMMA 3NIVA 3ZZXA 2JL4A 4IJIA 5JCUA 2KUCA 4HU9A 2WB9A 2OJLA 1O81A 2IMFA 4YKGA 1GTIA 2IMKA 4X0XA 2L57A 3A2WA 1Y25A 5EL8A 3P90A 3TKQA 1SD9A 1HNAA 5HR1A 4GSSA 5J5NA 2PMTA 2QA2A 4N10A 1SYRA 4JBBA 2V32A 2RIIA 5IO2A 1TKDB 4CY6A 4NPBA 4QL9A 3N9JA 2PN8A 4Q5QA 2GDRA 1QK8A 3ZFLA 3TCOA 5HQPA 3O6TA 5FT3A 2GT5A 2VUPA 3DWVA 2DMLA 1PMTA 2QKEA 3IC8A 3FZ5A 2VD0A 1ZYEA 1N8JA 4L8EA 2X8HA 1G6WA 2ON7A 2B1LA 2F51A 2RLIA 1K0MA 5JWRB 3KP9A 2V41A 5FWGA 5H5RA 1KTEA 4MPFA 3FZ4A 4LL1B
chains in the Genus database with same CATH topology
4GRFA 2B1KA 1K0AA 1VF3A 3GN3A 2H75A 1Q98A 1SYXA 4J56E 3ZREA 1SJZA 1BJXA 2HE3A 2IFQA 2QA1A 2O7KA 2YJ7A 1ZGNA 5A5KA 6GSWA 1H4OA 3QAWA 2A4HA 3DKSA 4K1FA 1TW9A 1XVWA 1ZCPA 5IPHA 1OKDA 2WGRA 4MJCA 1XWKA 1JZWA 1NHYA 1A2LA 2CV4A 3FHKA 1A8LA 2FY6A 3KXOA 3QFAC 4MF7A 4NWYA 3RAZA 3GL5A 2I81A 2CQ9A 2FCHA 1SL1B 4Q5NA 5ECMB 2B6MA 1PQNA 2B5XA 1TK5B 3E3EA 2E0QA 5A4UA 1XW9A 2DKHA 1U88A 1PD21 2B5EA 2F9SA 4EDYA 3LW9A 1WWJA 1XW5A 2R0PA 4MH2A 4IQ1A 3F4RA 1CQGA 2GTUA 2H6YA 2AAWA 1XWBA 5COHA 3KJYA 3HY2A 2PWJA 4MDCA 3F8UA 1R5PA 3HKRA 2FWEA 1M99A 5JCWA 2HT9A 3IPZA 4IP6A 4MNNA 2CX3A 2VLUA 4OCEA 3W8SA 4RI7A 1PKZA 4BA7A 1WRYA 3HZ4A 1J9BA 2C0EA 2JZSA 4EC0A 3K8NA 5F05A 1LJRA 1GNEA 3HVSA 4HUAA 1ILOA 2J9HA 3TJGA 2CX4A 3H4KA 3D22A 4ACSA 5ECLB 3G7YA 1Z6NA 3MNGA 3EINA 5DJMA 3A3TA 3BCKA 1SL2B 1JZOA 4CW9A 2DJ3A 1B4QA 4KCEA 2AJQB 1GP1A 5DBQA 3GKXA 1THXA 12GSA 1PSQA 4WR4A 2XHFA 2O87A 1PA3A 5FHIA 3I43A 1FHEA 2GLRA 3IOSA 4TXOB 3A5WA 1WIKA 1FOHA 3QAGA 4ICYA 2KOKA 1HQOA 3GTUA 2IIYA 1EEJA 3KM6A 3D4TA 1X5CA 3D0ZA 3F63A 2FA8A 4XIHA 3GYKA 1PN9A 1TRVA 4DSSA 1WPIA 2BTOT 4USSA 3DVWA 3VI5A 2YV9A 3APSA 4V1Ag 3JCML 4POLA 2QC7A 4OCFA 1PRXA 2VOCA 5HR0A 2L59A 1ZYPA 3GKMA 3QDNA 3APOA 2B7KA 2XBIA 2EIOA 3H79A 1QQ2A 2NVLA 1B4PA 4K5SA 1ST9A 1A24A 2AHEA 2K6VA 4N0ZA 1WE0A 2R3XA 2B3SA 2WDUA 1V57A 3IXRA 5IMDA 1Z9HA 2H19A 5HR3A 1GULA 4GXZA 4EXJA 4MLYA 4KUNA 3SWLA 18GSA 2NDOA 4ULXA 2IN3A 1GRXA 1JLWA 4FYUA 4MA9A 1TP9A 2M80A 1Z7RA 1DE2A 3KD0A 3O3TA 1PL2A 2DJJA 1GSQA 4HZ2A 2P5QA 4WBJA 3KMOA 3J7Yb 4KE3A 1M9AA 2VM2A 5GSSA 1O85A 1GH2A 4X43A 4NHZA 2YCDA 4YAPA 3CMIA 1U3AA 2GQKA 3C8EA 1AC1A 5DAKA 1ERWA 3ME7A 2GVPA 5ECKB 2Z9SA 5EVOA 10GSA 2NBSA 3LG6A 3QFBC 3GSTA 1NM3A 3VPTA 3ZTLA 3GH6A 1TU7A 8GSSA 4K7IA 1V9WA 2AV4A 2R0GA 1AQXA 3KGKA 4MCUA 4POBA 1R4WA 3HJMA 3FZAA 2NPBA 3FEUA 3BCIA 4KX4A 1G7OA 1Z5YE 2CA8A 3GSSA 4XS1A 3IC4A 2C80A 5D9VA 5G5FA 3UBKA 1X5EA 3Q18A 4ZB8A 2H76A 2OA7A 2WFCA 3H8QA 4HQZA 3G7IA 4KDYA 2H8LA 1TK8B 4O5RA 5CRGA 5ID2B 11GSA 1YJ6A 3FR3A 2VCQA 4ZBBA 3HVXA 3TB2A 2DJ0A 5AISA 1GLQA 5IOXA 2CZ2A 1ACVA 5ECIB 4BVYB 3ERWA 1XPVA 1SKWB 1X5DA 3PINA 5CO3A 3FYGA 5C04A 3WGDA 1SKRB 2RUFA 1ABAA 3TRQA 2MYGA 1MTCA 1YDKA 4Z2UA 3CSJA 1XFLA 1OE7A 2WRTA 2VL2A 2LNSA 5G30A 4MABA 2K8VA 1OVNA 3KZQA 2RM6A 3C1SA 2N5BA 2L5LA 1EGOA 2YWMA 3GV1A 3HVVA 2JZTA 2E7PA 3DGQA 5D93A 1A8YA 5EY6A 2KP1A 5ECQB 2TRCP 4IVFA 3UVHA 4O32A 4ECIA 4RQRA 4L0UA 3KH9A 1AW9A 1W89A 3CXGA 3GFKA 5D9XA 1A0FA 4EVMA 2MBTA 4FYCA 2EIQA 3KTLA 2C0DA 4GQCA 3SBCA 4HOJA 4OO4A 3C7MA 2PPTA 2REMA 3DEXA 1B9YC 4KNDA 2IMEA 4BPYA 3WGEA 4TOPA 1A0RP 4MH3A 1WMJA 4K5RA 3L9VA 4LA1A 2LV3A 1PN0A 2VLTA 3BBYA 2GS3A 3UVTA 2PBJA 1BAYA 2L4QA 5ABRA 4D73B 3IR4A 1T8EB 1GSYA 1QGVA 3L4NA 2H73A 4HI7A 2HRKA 4F0BA 4AF2A 3FKFA 3L9SA 2UZ8A 4MMMA 4MJEA 5ECRB 1ZOFA 4TXVA 1A23A 3CBUA 1C72A 4PUFC 1F6MC 1GSUA 4MPGA 2LJRA 1NW2A 2YZHA 4FH8A 1TI1A 2I3YA 1SK0A 1K3LA 2H6ZA 2YWIA 2HLSA 4GTUA 4JZQA 1AAZA 1B9XC 3QPMA 2O89A 4PQHA 4TW5A 2GSRA 4N30A 3P8WA 3KP8A 2PUKC 1V40A 2R6KA 3DIEA 5J9CA 1ERTA 2GSSA 2HRFA 4YQVA 2HFDA 4WXTA 4Z7XA 1URMA 2L6CA 2HI7A 3IAS2 3N5OA 1QMVA 1XCCA 4OO5A 2MBSA 2FGXA 2H1DA 4KW6A 4X4JA 1BQ7A 1TI3A 5INYA 3IE3A 6GSYA 1E6BA 1JZDA 2E2MA 1JLVA 4A5PA 4ZL8A 3GA4A 4I2TA 3WD6A 2ON5A 1T4YA 1THOA 1MDIA 2VCZA 5CYYA 1TU8A 5A4VA 1DBYA 2KHPA 2IMIA 4F0CA 3EU4A 5DJLA 4JR4A 4TVEA 3QD9A 4LMWA 1U3IA 1VF4A 1S3AA 1B48A 1MD4A 4E8HA 4NHWA 3UARA 4E8EA 4HZ4A 2GT6A 3EMPA 2V2GA 2MZCA 3TDGA 3FR6A 3BD2A 2MMZA 16GSA 4O5UA 1FVJA 3RHCA 4I97A 4WEYA 4K7OA 2ES7A 1G6YA 3ZRDA 1F9MA 1GSFA 4TR1A 2K8SA 3TUEA 4BVXA 1OAZA 1J0FA 1TRUA 3BOAA 4FYBA 4HJ2A 4N0VA 2DLXA 1FO5A 2C8UA 1LBKA 1JFUA 4KSMA 3TKRA 2FWHA 3Q74A 2H1BA 4G2EA 2LRCA 2F8AA 2C4JA 2LSTA 5IIZA 3DMLA 4YQUA 3IA1A 2C1YA 20GSA 2FUG2 4EDZA 4ML1A 2OBKA 2YV7A 5J9BA 1OC9B 2ZNMA 5F8BA 5J4UA 1EGRA 3GUSA 1M0UA 2YPMA 1ERVA 1GTBA 1DUGA 1YY7A 3TOUA 5HR2A 1PGTA 1M2DA 4K9ZA 4MZWA 3ZL5A 2F8FA 4LLRA 2LRNA 2HZFA 1TDIA 2RUEA 5B6NA 4I6XA 4ZXGA 4NXIA 5KEJA 4ML6A 1EP8A 3HJOA 3E0UA 2KP2A 2WS2A 4QQ7A 2PGTA 2IL3A 4DSRA 5CNWA 1EV9A 3R3EA 1O8WA 2K9FA 1QXHA 3U5RE 5ECHB 3ZFBA 1SK1A 4O92A 1X9SB 2PU9C 4JE1A 3ZYWA 5IQYA 1GSEA 4KF9A 4LMVA 2R2JA 2IWTA 2A2SA 3KTBA 2JACA 3VWXA 2HZEA 2FNOA 4FQUA 4EIQA 4ECCA 4KSOA 2AUVA 1YEPA 2HSYA 1G7EA 1MEKA 2A2RA 3HXSA 1K0OA 5ECOB 14GSA 4TR4A 2OKAA 4XS4B 6GSUA 2X4AA 2DJKA 1DSBA 1S3DA 3ZIJA 5B7CA 3CRUA 3I9V2 4XRAA 3F3RA 3EPTA 3FR9A 4NMUA 5F07A 3P2AA 3ED3A 3PR8A 4GQFA 2C0FA 2C3QA 2OBIA 2CAIA 2C0GA 2V6KA 1JHBA 5DALB 2GZZA 2ZCTA 2FA4A 1E2YA 2XBQA 4K7NA 3UL3A 2A4VA 1M9BA 3HHVA 4WF5A 5IM9A 5ECSA 5HFGA 3GKKA 4K0NA 4EKZA 4V2MA 5G2ZA 5AN1A 3M3MA 3VWVA 3UMAA 1R7HA 1R26A 2WULA 5JWQB 3UJ1A 3W6GA 3IBHA 4OWYA 1ZYNA 3VK9A 3M9KA 4OMVA 5LD0A 2OACA 4K8MA 5KN0A 2NTOA 2L4CA 3GURA 2DIZA 4X1UA 1YF0A 1B8XA 2H1AA 3MIXA 4TR0A 13GSA 4BL7B 3HYPA 4EF0A 4F9ZA 2VL9A 4GWRA 1OC8A 2H70A 4IHUA 1GTUA 2OE3A 1XWCA 1F37A 3D4MA 2FWGA 2PVOC 5G1LA 22GSA 5KN2A 1DE1A 1SJ6A 3EVIA 1MDJA 2VCTA 3L9UA 4HS1A 2WJUA 1SK2A 1GNWA 1A2MA 3W8JA 3IK7A 5G1KA 4G0KA 2V1MA 2FLSA 4QL7A 4RUVA 1Z7PA 4XRDA 3DYRA 3I6AA 6GSTA 1BG5A 1OKTA 3TJJA 2OADA 5CAXA 2LUSA 5HFIA 5D96A 1XW6A 2MMOA 4IBPA 3UEMA 4DEJA 4HJMA 3CSIA 3TKSA 4PQIA 1GL8A 1SL0B 2VO4A 1F3BA 1EEMA 5LNKe 3A5IA 2YOIA 4BWSA 3F3QA 3LJRA 3OR5A 3ERFA 3GH9A 5ENUA 2MMNA 1Z3EA 4TN8A 2WZ9A 3HD5A 4ZILA 2JADA 3ZITA 4IW9A 4Z2RA 2YWOA 4I8BA 3HCZA 1JZRA 4OFNA 4CHSA 1M2BA 2VL2C 4CY8A 4YQMA 1AIUA 1EOGA 2HYXA 4MF6A 5JWOB 2VM1A 5DDLA 3CYNA 3GL3A 3IAM2 2B7JA 4IN0A 4K6XA 1F2EA 1GUMA 3C73A 3GRXA 1R5AA 2IFQB 2JSZA 4YKFA 1PKWA 4G10A 3H93A 1KBNA 2LJKA 1M2AA 2YWNA 3A2VA 2X8CA 2YANA 3DRNA 4TXOA 2HSHA 3VWWA 3M9JA 3D6IA 2O8VB 3FY7A 1F3AA 4I5QA 1QFNA 1TOFA 4KA0A 1EV4A 4V2LA 2VAFA 4K0GA 5DCGA 1K0BA 2HNLA 4WR5A 1N2AA 2G2QA 1TK0B 4KCAA 2H0GA 4HEA2 2EC4A 1SU9A 2ALBA 4L0WA 1PX7A 4IELA 3U6VA 3TRXA 5IMFA 2O85A 4JEDA 3FMWA 2EIRA 1K3YA 2C3NA 1AXDA 4DVCA 1XBSA 1YEXA 2H72A 3G9BA 2F3MA 2V6OA 3LFLA 2LQQA 3F0IA 3KEBA 5G5EA 1GUKA 1OE8A 5CREA 3VI7A 2GZPA 3CRTA 3PGTA 3GX0A 5J3RA 1WOUA 3US3A 3LXZA 3TJFA 3H1NA 3GNJA 5B8BA 4O7HA 2BMXA 1UC7A 2H74A 2N5FA 4BL7A 3LQ7A 5AGYA 1GLPA 3F6FA 2GSTA 3IHQA 1O7UA 2LJAA 2GGTA 4K2DA 4F03A 3APQA 5AIVA 1NSWA 3PPUA 2P0GA 3MDKA 1TRWA 3C1RA 4YH2A 1KEBA 4PNFA 1EP7A 2LRTA 5HFKA 3TKPA 3IHGA 2H6XA 2KLXA 2ZUPA 3VLNA 3E9JB 3M1GA 5LCZA 1OC3A 1SKSB 3ISOA 6GSXA 4IKHA 5IOWA 2K18A 2R5GA 3LXTA 4PUAA 5GSTA 3ZVJA 4P3YB 2XPEA 4MP4A 1ZMAA 2LS5A 3GTUB 1ZYQB 2VLVA 1OYJA 4POKA 3ZLPA 3ME8A 2M46A 3UIWA 1GSSA 1KNGA 2BJXA 5ID2A 5C00A 4DSSB 1T00A 5IMCA 4G0LA 1V98A 4KH7A 2QSIA 4POMA 3GKNA 1NHOA 5AIXA 1SD8A 1IYHA 3LWAA 1Z6MA 4ZB9A 4GSNA 2YJHA 4BVYA 2JU5A 4AJ8A 5F0GA 4PQ1A 2LNTA 5E4WA 2WCIA 3ERGA 3HA9A 1LU4A 1PX6A 2FWFA 3GHAA 4MZBA 3S9FA 3VPQA 3F6DA 3EC3A 1XOAA 4YAVA 1TTZA 3FK8A 3MWHA 5CRWA 2DC5A 4ECBA 3G7JA 3UBLA 3C71A 1FW1A 5KN3A 3V1WA 1GWCA 1I9DA 2J23A 2YP6A 5KOXA 4Q5RA 4NV2A 4V2NA 5DAKB 2E2GA 4IS0A 4ISDA 1PL1A 2VCWA 3IK9A 1U87A 1O8XA 3HJPA 2VCVA 3F9UA 3EWLA 4IP1A 2LTKA 3QMXA 2H1GA 2CT6A 1T7PB 2CAQA 1J08A 3VFIA 1XXUA 3L0HA 1K3OA 1HNCA 4MJBA 1XWAA 1H75A 3D21A 2HRNA 5ECPB 4RI6A 3NZNA 5JCGA 2R0CA 2YN1A 1AUCA 2HSMA 3CTFA 5D73A 1WJKA 4KB3A 3KIJA 2JSYA 1IYIA 2B5YA 3I69A 1BYEA 4XHMA 2X99A 2TRXA 3RDWA 3BJ5A 4G0IA 4JR6A 4D73A 4ZBAA 3LSZA 5ECNB 1SENA 1SJIA 3EURA 2FHEA 3LYPA 2LKUA 2P31A 3RPPA 4BWQA 1T4ZA 1AQVA 4IGJA 3TOTA 3AY8A 5GAPD 1UA5A 4MZCA 5BRTA 2GZYA 2QGVA 1FAAA 1ML6A 2M72A 6GSVA 1FVKA 2GQLA 2IPAA 4KGIA 2CVKA 5KN1A 3O76A 1RQMA 4AJ7A 1HNBA 1VRSD 4K2XA 3QAVA 3TKSE 2DSAA 4OD7A 2H01A 5GZZB 1X0RA 2VL3A 3DD3A 3M0FA 4V1Ap 3FRCA 4RQXA 4WBRD 1FG4A 6GSSA 3HZ8A 3MAKA 3TRPA 1U6TA 3UAPA 4WKWA 2N5AA 5CRHA 4TKYA 4KAEA 2IMDA 3PH9A 3LEFA 3F4SA 4TR3A 5F06A 1ZZYA 4EO3A 3DVXA 1FB6A 3ZIVA 2AB6A 1WP0A 3IDVA 4MF5A 5IO0A 5IMZA 1QUWA 5KOWA 1BEDA 1ZL9A 1K0CA 3EYTA 3TJKA 1BX9A 5G31A 5IPGA 5IMAA 9GSSA 4KDXA 2X64A 4L5LA 1HYUA 4ZIJA 2DJ1A 4N11A 5BMUA 2AYTA 4CDOA 1GUHA 2D2ZA 5ELGA 5H5SA 4OFTA 2R4VA 5D8IA 4L5OA 2VIMA 1G0TA 3VURA 5B6MA 1UN2A 2G0FA 5DCHA 2P5RA 2H0HA 1V2AA 1FB0A 3RHBA 4MJAA 1YKCA 4XTSA 3EE2A 3D5JA 4GLTA 2L6DA 3KH7A 2H66A 4HDEA 4PURA 1MDKA 1XVQA 2DBCA 3VWUA 5A4WA 4GF0A 5GAND 2VCXA 1AQWA 3FW2A 1OC9A 2H71A 5H5QA 4HU7A 2I9HA 3WYWA 4ZBDA 5DVBA 4PX1A 2LEGA 4PNGA 2A2PA 4I2UA 1YF1A 4XS6A 3TKSC 1XOBA 2CZ3A 1XZOA 1UVZA 1FOVA 4FO5A 1EWXA 3QOUA 3WGXA 4GSTA 4G19A 1GTAA 1USBA 1MD3A 1VGLA 4F82A 3P7XA 4ECJA 5CRDA 3LYKA 3ZVJD 1ON4A 2YZUA 4EL1A 2YNXA 3LORA 2DJ2A 3F4TA 2HXKA 3R2QA 1K0DA 5B8AA 1YQ1A 3GMFA 4KDUA 3KMNA 3QR6A 4AGSA 3TGZA 2FD3A 1XWGA 2XPDA 1VF2A 4TRXA 5J41A 5ELAA 4NAXA 4FIWA 3J7Yk 1X9WB 2GQMA 3LGCA 4PXOA 2RM5A 17GSA 1I5GA 1T3BA 3GIXA 3FZ9A 1S3CA 19GSA 1X9MB 1TRSA 2JZRA 4ZB6A 3DXBA 1EOHA 5DQYA 1A2JA 2PVQA 4IQAA 5EPFA 1Y6EA 1K0NA 4XS4A 3Q6OA 4WETA 1XIYA 1VF1A 4AJ6A 4DSQA 3L78A 3TJBA 4LL4B 2H30A 4HQSA 4TR1B 4BVXB 4IJ3A 5D9WA 3CSHA 1Q4JA 5L71A 4JU5A 4Z2TA 1YKAA 4Q5FA 1O73A 3HDCA 3EU3A 5DALA 5CP1A 3EMXA 5DQSA 5D9TA 2HRAA 2CVBA 1GSDA 2R37A 3ZMKA 1M7TA 1O6JA 2TIRA 3WT1A 4ID0A 3NOFA 4WF4A 4XCSA 4EIPA 3UOMA 4ZL9A 2C3TA 4H86A 2GSQA 3MSZA 4J2FA 3ZMLA 5IMVA 1ERUA 3A2XA 2I1UA 4G9HA 4O5QA 4J57E 2XC2A 1T1VA 2L5OA 1TXXA 2PERA 3RPNA 2VD1A 2X8GA 3MYDA 4EE0A 3CTGA 1V58A 2X49A 1W4VA 2IJYA 3Q19A 1RK4A 2MMAA 2OE1A 7GSSA 4PTSA 1HD2A 4PGTA 3GX8A 5E59A 3KCMA 4EUYA 3M8NA 2I4AA 2LQOA 4F2IA 1EZKA 2DKIA 4GCIA 4NV5A 3IV4A 3RBTA 3IRAA 2OE0A 2H0IA 3QCPA 4MK3A 1YZXA 1RW1A 2DIYA 4OFMA 1TJDA 3WT2A 4ILFA 2CVDA 4JRRA 4ZL7A 2HZEB 1CQHA 2DMMA 3NIVA 3ZZXA 2JL4A 4IJIA 5JCUA 2KUCA 4HU9A 2WB9A 2OJLA 1O81A 2IMFA 4YKGA 1GTIA 2IMKA 4X0XA 2L57A 3A2WA 1Y25A 5EL8A 3P90A 3TKQA 1SD9A 1HNAA 5HR1A 4GSSA 5J5NA 2PMTA 2QA2A 4N10A 1SYRA 4JBBA 2V32A 2RIIA 5IO2A 1TKDB 4CY6A 4NPBA 4QL9A 3N9JA 2PN8A 4Q5QA 2GDRA 1QK8A 3ZFLA 3TCOA 5HQPA 3O6TA 5FT3A 2GT5A 2VUPA 3DWVA 2DMLA 1PMTA 2QKEA 3IC8A 3FZ5A 2VD0A 1ZYEA 1N8JA 4L8EA 2X8HA 1G6WA 2ON7A 2B1LA 2F51A 2RLIA 1K0MA 5JWRB 3KP9A 2V41A 5FWGA 5H5RA 1KTEA 4MPFA 3FZ4A 4LL1B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GRF A;  2B1K A;  1K0A A;  1VF3 A;  3GN3 A;  2H75 A;  1Q98 A;  1SYX A;  4J56 E;  3ZRE A;  1SJZ A;  1BJX A;  2HE3 A;  2IFQ A;  2O7K A;  2YJ7 A;  1ZGN A;  5A5K A;  6GSW A;  1H4O A;  3QAW A;  3DKS A;  4K1F A;  1TW9 A;  1XVW A;  1ZCP A;  5IPH A;  1OKD A;  2WGR A;  4MJC A;  1XWK A;  1JZW A;  1NHY A;  1A2L A;  2CV4 A;  3FHK A;  1A8L A;  2FY6 A;  3KXO A;  3QFA C;  4MF7 A;  4NWY A;  3RAZ A;  3GL5 A;  2I81 A;  2CQ9 A;  2FCH A;  1SL1 B;  4Q5N A;  5ECM B;  2B6M A;  1PQN A;  2B5X A;  1TK5 B;  3E3E A;  2E0Q A;  5A4U A;  1XW9 A;  1U88 A;  1PD2 1;  2B5E A;  2F9S A;  4EDY A;  1WWJ A;  1XW5 A;  4MH2 A;  4IQ1 A;  3F4R A;  1CQG A;  2GTU A;  2H6Y A;  2AAW A;  1XWB A;  5COH A;  3KJY A;  3HY2 A;  2PWJ A;  4MDC A;  3F8U A;  1R5P A;  3HKR A;  2FWE A;  1M99 A;  5JCW A;  2HT9 A;  3IPZ A;  4IP6 A;  2CX3 A;  2VLU A;  4OCE A;  3W8S A;  4RI7 A;  1PKZ A;  4BA7 A;  1WRY A;  3HZ4 A;  1J9B A;  2C0E A;  2JZS A;  4EC0 A;  3K8N A;  5F05 A;  1LJR A;  1GNE A;  3HVS A;  4HUA A;  1ILO A;  2J9H A;  3TJG A;  2CX4 A;  3H4K A;  3D22 A;  4ACS A;  5ECL B;  3G7Y A;  1Z6N A;  3MNG A;  3EIN A;  5DJM A;  3A3T A;  3BCK A;  1SL2 B;  1JZO A;  4CW9 A;  2DJ3 A;  1B4Q A;  4KCE A;  2AJQ B;  1GP1 A;  5DBQ A;  3GKX A;  1THX A;  12GS A;  1PSQ A;  4WR4 A;  2XHF A;  2O87 A;  1PA3 A;  5FHI A;  3I43 A;  1FHE A;  2GLR A;  3IOS A;  4TXO B;  3A5W A;  1WIK A;  3QAG A;  2KOK A;  1HQO A;  3GTU A;  2IIY A;  1EEJ A;  3KM6 A;  3D4T A;  1X5C A;  3D0Z A;  3F63 A;  2FA8 A;  4XIH A;  3GYK A;  1PN9 A;  1TRV A;  4DSS A;  1WPI A;  2BTO T;  3DVW A;  3VI5 A;  2YV9 A;  3APS A;  4V1A g;  3JCM L;  4POL A;  2QC7 A;  4OCF A;  1PRX A;  2VOC A;  5HR0 A;  2L59 A;  3GKM A;  3QDN A;  3APO A;  2B7K A;  2XBI A;  2EIO A;  3H79 A;  1QQ2 A;  2NVL A;  1B4P A;  1ST9 A;  1A24 A;  2AHE A;  2K6V A;  4N0Z A;  1WE0 A;  2R3X A;  2B3S A;  2WDU A;  1V57 A;  3IXR A;  5IMD A;  1Z9H A;  2H19 A;  5HR3 A;  1GUL A;  4GXZ A;  4EXJ A;  4MLY A;  4KUN A;  3SWL A;  18GS A;  2NDO A;  4ULX A;  2IN3 A;  1GRX A;  1JLW A;  4FYU A;  4MA9 A;  1TP9 A;  2M80 A;  1Z7R A;  1DE2 A;  3KD0 A;  3O3T A;  1PL2 A;  2DJJ A;  1GSQ A;  4HZ2 A;  2P5Q A;  4WBJ A;  3KMO A;  3J7Y b;  4KE3 A;  1M9A A;  2VM2 A;  5GSS A;  1O85 A;  1GH2 A;  4X43 A;  4NHZ A;  2YCD A;  4YAP A;  3CMI A;  1U3A A;  2GQK A;  3C8E A;  1AC1 A;  5DAK A;  1ERW A;  3ME7 A;  2GVP A;  5ECK B;  2Z9S A;  5EVO A;  10GS A;  2NBS A;  3LG6 A;  3QFB C;  3GST A;  1NM3 A;  3VPT A;  3ZTL A;  3GH6 A;  1TU7 A;  8GSS A;  4K7I A;  1V9W A;  2AV4 A;  4POB A;  1AQX A;  3KGK A;  4MCU A;  1R4W A;  3HJM A;  3FZA A;  2NPB A;  3FEU A;  3BCI A;  4KX4 A;  1G7O A;  1Z5Y E;  2CA8 A;  3GSS A;  4XS1 A;  3IC4 A;  2C80 A;  5D9V A;  5G5F A;  3UBK A;  1X5E A;  3Q18 A;  4ZB8 A;  2H76 A;  2OA7 A;  2WFC A;  3H8Q A;  4HQZ A;  3G7I A;  4KDY A;  2H8L A;  1TK8 B;  4O5R A;  5CRG A;  5ID2 B;  11GS A;  1YJ6 A;  3FR3 A;  2VCQ A;  4ZBB A;  3HVX A;  3TB2 A;  2DJ0 A;  5AIS A;  1GLQ A;  5IOX A;  2CZ2 A;  1ACV A;  5ECI B;  3ERW A;  1XPV A;  1SKW B;  1X5D A;  3PIN A;  5CO3 A;  3FYG A;  5C04 A;  3WGD A;  1SKR B;  2RUF A;  1ABA A;  3TRQ A;  2MYG A;  1MTC A;  1YDK A;  3CSJ A;  1XFL A;  1OE7 A;  2WRT A;  2VL2 A;  2LNS A;  5G30 A;  4MAB A;  2K8V A;  1OVN A;  3KZQ A;  2RM6 A;  3C1S A;  2N5B A;  2L5L A;  1EGO A;  2YWM A;  3GV1 A;  3HVV A;  2JZT A;  2E7P A;  3DGQ A;  5D93 A;  1A8Y A;  5EY6 A;  2KP1 A;  5ECQ B;  2TRC P;  4IVF A;  3UVH A;  4O32 A;  4ECI A;  4RQR A;  4L0U A;  3KH9 A;  1AW9 A;  1W89 A;  3CXG A;  3GFK A;  5D9X A;  1A0F A;  4EVM A;  2MBT A;  4FYC A;  2EIQ A;  3KTL A;  2C0D A;  4GQC A;  3SBC A;  4HOJ A;  4OO4 A;  3C7M A;  2PPT A;  2REM A;  3DEX A;  1B9Y C;  4KND A;  2IME A;  4BPY A;  3WGE A;  4TOP A;  1A0R P;  4MH3 A;  1WMJ A;  3L9V A;  4LA1 A;  2LV3 A;  2VLT A;  3BBY A;  2GS3 A;  3UVT A;  2PBJ A;  1BAY A;  2L4Q A;  5ABR A;  4D73 B;  3IR4 A;  1T8E B;  1GSY A;  1QGV A;  3L4N A;  2H73 A;  4HI7 A;  4F0B A;  4AF2 A;  3FKF A;  3L9S A;  4MMM A;  4MJE A;  5ECR B;  1ZOF A;  4TXV A;  1A23 A;  3CBU A;  1C72 A;  4PUF C;  1F6M C;  1GSU A;  4MPG A;  2LJR A;  1NW2 A;  2YZH A;  4FH8 A;  1TI1 A;  2I3Y A;  1SK0 A;  1K3L A;  2H6Z A;  2YWI A;  2HLS A;  4GTU A;  4JZQ A;  1AAZ A;  1B9X C;  3QPM A;  2O89 A;  4PQH A;  4TW5 A;  2GSR A;  4N30 A;  3P8W A;  3KP8 A;  2PUK C;  1V40 A;  2R6K A;  3DIE A;  5J9C A;  1ERT A;  2GSS A;  2HRF A;  4YQV A;  2HFD A;  4WXT A;  4Z7X A;  1URM A;  2L6C A;  2HI7 A;  3IAS 2;  3N5O A;  1QMV A;  1XCC A;  4OO5 A;  2MBS A;  2FGX A;  2H1D A;  4KW6 A;  1BQ7 A;  1TI3 A;  5INY A;  3IE3 A;  6GSY A;  1E6B A;  1JZD A;  2E2M A;  1JLV A;  4ZL8 A;  3GA4 A;  4I2T A;  3WD6 A;  2ON5 A;  1T4Y A;  1THO A;  1MDI A;  2VCZ A;  5CYY A;  1TU8 A;  5A4V A;  1DBY A;  2KHP A;  2IMI A;  4F0C A;  5DJL A;  3EU4 A;  4JR4 A;  4TVE A;  3QD9 A;  4LMW A;  1U3I A;  1VF4 A;  1S3A A;  1B48 A;  1MD4 A;  4E8H A;  4NHW A;  3UAR A;  4E8E A;  4HZ4 A;  2GT6 A;  3EMP A;  2V2G A;  2MZC A;  3TDG A;  3FR6 A;  3BD2 A;  2MMZ A;  16GS A;  1FVJ A;  3RHC A;  4I97 A;  4WEY A;  4K7O A;  2ES7 A;  1G6Y A;  3ZRD A;  1F9M A;  1GSF A;  4TR1 A;  2K8S A;  3TUE A;  4BVX A;  1OAZ A;  1J0F A;  1TRU A;  3BOA A;  4FYB A;  4HJ2 A;  4N0V A;  2DLX A;  1FO5 A;  2C8U A;  1LBK A;  1JFU A;  4KSM A;  3TKR A;  2FWH A;  3Q74 A;  2H1B A;  4G2E A;  2LRC A;  2F8A A;  2C4J A;  2LST A;  5IIZ A;  3DML A;  4YQU A;  3IA1 A;  2C1Y A;  20GS A;  2FUG 2;  4EDZ A;  4ML1 A;  2OBK A;  2YV7 A;  5J9B A;  1OC9 B;  2ZNM A;  5F8B A;  5J4U A;  1EGR A;  3GUS A;  1M0U A;  2YPM A;  1ERV A;  1GTB A;  1DUG A;  1YY7 A;  3TOU A;  5HR2 A;  1PGT A;  1M2D A;  4K9Z A;  4MZW A;  3ZL5 A;  2F8F A;  4LLR A;  2LRN A;  2HZF A;  1TDI A;  2RUE A;  5B6N A;  4I6X A;  4ZXG A;  4NXI A;  5KEJ A;  4ML6 A;  1EP8 A;  3HJO A;  3E0U A;  2KP2 A;  2WS2 A;  4QQ7 A;  2PGT A;  2IL3 A;  4DSR A;  5CNW A;  1EV9 A;  1O8W A;  2K9F A;  1QXH A;  3U5R E;  5ECH B;  3ZFB A;  1SK1 A;  4O92 A;  1X9S B;  2PU9 C;  4JE1 A;  3ZYW A;  5IQY A;  1GSE A;  4LMV A;  2R2J A;  2IWT A;  2A2S A;  3KTB A;  2JAC A;  3VWX A;  2HZE A;  2FNO A;  4ECC A;  4KSO A;  2AUV A;  1YEP A;  2HSY A;  1G7E A;  1MEK A;  2A2R A;  3HXS A;  1K0O A;  5ECO B;  14GS A;  4TR4 A;  2OKA A;  4XS4 B;  6GSU A;  2DJK A;  1DSB A;  1S3D A;  3ZIJ A;  5B7C A;  3CRU A;  3I9V 2;  4XRA A;  3F3R A;  3FR9 A;  4NMU A;  5F07 A;  3P2A A;  3ED3 A;  3PR8 A;  4GQF A;  2C0F A;  2C3Q A;  2OBI A;  2CAI A;  2C0G A;  2V6K A;  1JHB A;  5DAL B;  2GZZ A;  2ZCT A;  2FA4 A;  1E2Y A;  2XBQ A;  4K7N A;  3UL3 A;  2A4V A;  1M9B A;  3HHV A;  4WF5 A;  5IM9 A;  5ECS A;  5HFG A;  3GKK A;  4K0N A;  4EKZ A;  4V2M A;  5G2Z A;  5AN1 A;  3M3M A;  3VWV A;  3UMA A;  1R7H A;  1R26 A;  2WUL A;  5JWQ B;  3UJ1 A;  3W6G A;  3IBH A;  4OWY A;  3VK9 A;  3M9K A;  4OMV A;  5LD0 A;  2OAC A;  4K8M A;  5KN0 A;  2NTO A;  2L4C A;  3GUR A;  2DIZ A;  4X1U A;  1YF0 A;  1B8X A;  2H1A A;  4TR0 A;  13GS A;  3HYP A;  4EF0 A;  4F9Z A;  2VL9 A;  4GWR A;  1OC8 A;  2H70 A;  4IHU A;  1GTU A;  2OE3 A;  1XWC A;  1F37 A;  3D4M A;  2FWG A;  2PVO C;  5G1L A;  22GS A;  5KN2 A;  1DE1 A;  1SJ6 A;  3EVI A;  1MDJ A;  2VCT A;  3L9U A;  4HS1 A;  2WJU A;  1SK2 A;  1GNW A;  1A2M A;  3W8J A;  3IK7 A;  5G1K A;  2V1M A;  2FLS A;  4QL7 A;  4RUV A;  1Z7P A;  4XRD A;  3DYR A;  3I6A A;  6GST A;  1BG5 A;  1OKT A;  3TJJ A;  2OAD A;  5CAX A;  2LUS A;  5HFI A;  5D96 A;  1XW6 A;  2MMO A;  4IBP A;  3UEM A;  4DEJ A;  4HJM A;  3CSI A;  3TKS A;  4PQI A;  1GL8 A;  1SL0 B;  2VO4 A;  1F3B A;  1EEM A;  5LNK e;  2YOI A;  4BWS A;  3F3Q A;  3LJR A;  3OR5 A;  3ERF A;  3GH9 A;  5ENU A;  2MMN A;  1Z3E A;  4TN8 A;  2WZ9 A;  3HD5 A;  4ZIL A;  2JAD A;  3ZIT A;  4IW9 A;  2YWO A;  4I8B A;  3HCZ A;  1JZR A;  4OFN A;  4CHS A;  1M2B A;  2VL2 C;  4YQM A;  1AIU A;  1EOG A;  2HYX A;  4MF6 A;  5JWO B;  2VM1 A;  5DDL A;  3CYN A;  3GL3 A;  3IAM 2;  2B7J A;  4IN0 A;  4K6X A;  1F2E A;  1GUM A;  3C73 A;  3GRX A;  1R5A A;  2IFQ B;  2JSZ A;  1PKW A;  4G10 A;  3H93 A;  1KBN A;  2LJK A;  1M2A A;  2YWN A;  3A2V A;  2X8C A;  2YAN A;  3DRN A;  4TXO A;  2HSH A;  3VWW A;  3M9J A;  3D6I A;  2O8V B;  3FY7 A;  1F3A A;  4I5Q A;  1QFN A;  1TOF A;  4KA0 A;  1EV4 A;  4V2L A;  2VAF A;  4K0G A;  5DCG A;  1K0B A;  2HNL A;  4WR5 A;  1N2A A;  2G2Q A;  1TK0 B;  4KCA A;  2H0G A;  4HEA 2;  2EC4 A;  1SU9 A;  2ALB A;  4L0W A;  1PX7 A;  4IEL A;  3U6V A;  3TRX A;  5IMF A;  2O85 A;  4JED A;  2EIR A;  1K3Y A;  2C3N A;  1AXD A;  4DVC A;  1XBS A;  1YEX A;  2H72 A;  3G9B A;  2F3M A;  2V6O A;  3LFL A;  2LQQ A;  3F0I A;  3KEB A;  5G5E A;  1GUK A;  1OE8 A;  5CRE A;  3VI7 A;  2GZP A;  3CRT A;  3PGT A;  3GX0 A;  5J3R A;  1WOU A;  3US3 A;  3LXZ A;  3TJF A;  3H1N A;  3GNJ A;  5B8B A;  4O7H A;  2BMX A;  1UC7 A;  2H74 A;  2N5F A;  4BL7 A;  3LQ7 A;  5AGY A;  1GLP A;  3F6F A;  2GST A;  3IHQ A;  1O7U A;  2LJA A;  2GGT A;  4K2D A;  4F03 A;  3APQ A;  5AIV A;  1NSW A;  2P0G A;  3MDK A;  1TRW A;  3C1R A;  4YH2 A;  1KEB A;  4PNF A;  1EP7 A;  2LRT A;  5HFK A;  3TKP A;  2H6X A;  2KLX A;  2ZUP A;  3VLN A;  3E9J B;  3M1G A;  5LCZ A;  1OC3 A;  1SKS B;  3ISO A;  6GSX A;  4IKH A;  5IOW A;  2K18 A;  2R5G A;  3LXT A;  4PUA A;  5GST A;  3ZVJ A;  4P3Y B;  2XPE A;  4MP4 A;  1ZMA A;  2LS5 A;  3GTU B;  1ZYQ B;  2VLV A;  1OYJ A;  4POK A;  3ZLP A;  3ME8 A;  2M46 A;  3UIW A;  1GSS A;  1KNG A;  2BJX A;  5ID2 A;  5C00 A;  4DSS B;  1T00 A;  5IMC A;  1V98 A;  4KH7 A;  2QSI A;  4POM A;  3GKN A;  1NHO A;  5AIX A;  1SD8 A;  1IYH A;  3LWA A;  1Z6M A;  4ZB9 A;  4GSN A;  2YJH A;  4BVY A;  2JU5 A;  4AJ8 A;  5F0G A;  4PQ1 A;  2LNT A;  5E4W A;  2WCI A;  3ERG A;  3HA9 A;  1LU4 A;  1PX6 A;  2FWF A;  3GHA A;  4MZB A;  3S9F A;  3VPQ A;  3F6D A;  3EC3 A;  1XOA A;  4YAV A;  1TTZ A;  3FK8 A;  3MWH A;  5CRW A;  2DC5 A;  4ECB A;  3G7J A;  3UBL A;  3C71 A;  1FW1 A;  5KN3 A;  3V1W A;  1GWC A;  1I9D A;  2J23 A;  2YP6 A;  4Q5R A;  4NV2 A;  4V2N A;  5DAK B;  2E2G A;  4IS0 A;  4ISD A;  1PL1 A;  2VCW A;  3IK9 A;  1U87 A;  1O8X A;  3HJP A;  2VCV A;  3F9U A;  3EWL A;  4IP1 A;  2LTK A;  3QMX A;  2H1G A;  2CT6 A;  1T7P B;  2CAQ A;  1J08 A;  3VFI A;  1XXU A;  3L0H A;  1K3O A;  1HNC A;  4MJB A;  1XWA A;  1H75 A;  3D21 A;  2HRN A;  5ECP B;  4RI6 A;  3NZN A;  5JCG A;  2YN1 A;  1AUC A;  3CTF A;  5D73 A;  1WJK A;  4KB3 A;  3KIJ A;  2JSY A;  1IYI A;  2B5Y A;  3I69 A;  1BYE A;  4XHM A;  2X99 A;  2TRX A;  3RDW A;  3BJ5 A;  4JR6 A;  4D73 A;  4ZBA A;  3LSZ A;  5ECN B;  1SEN A;  1SJI A;  3EUR A;  2FHE A;  3LYP A;  2LKU A;  2P31 A;  3RPP A;  4BWQ A;  1T4Z A;  1AQV A;  4IGJ A;  3TOT A;  3AY8 A;  5GAP D;  1UA5 A;  4MZC A;  2GZY A;  2QGV A;  1FAA A;  1ML6 A;  2M72 A;  6GSV A;  1FVK A;  2GQL A;  2IPA A;  4KGI A;  2CVK A;  5KN1 A;  3O76 A;  1RQM A;  4AJ7 A;  1HNB A;  1VRS D;  3QAV A;  3TKS E;  2DSA A;  4OD7 A;  2H01 A;  5GZZ B;  1X0R A;  2VL3 A;  3DD3 A;  3M0F A;  4V1A p;  3FRC A;  4RQX A;  4WBR D;  1FG4 A;  6GSS A;  3HZ8 A;  3MAK A;  3TRP A;  1U6T A;  3UAP A;  4WKW A;  2N5A A;  5CRH A;  4TKY A;  4KAE A;  2IMD A;  3PH9 A;  3LEF A;  3F4S A;  4TR3 A;  5F06 A;  1ZZY A;  4EO3 A;  3DVX A;  1FB6 A;  3ZIV A;  2AB6 A;  1WP0 A;  3IDV A;  4MF5 A;  5IO0 A;  5IMZ A;  1QUW A;  1BED A;  1ZL9 A;  1K0C A;  3EYT A;  3TJK A;  1BX9 A;  5G31 A;  5IPG A;  5IMA A;  9GSS A;  4KDX A;  2X64 A;  4L5L A;  1HYU A;  4ZIJ A;  2DJ1 A;  4N11 A;  2AYT A;  4CDO A;  1GUH A;  2D2Z A;  5ELG A;  5H5S A;  4OFT A;  2R4V A;  5D8I A;  4L5O A;  2VIM A;  1G0T A;  3VUR A;  5B6M A;  1UN2 A;  2G0F A;  5DCH A;  2P5R A;  2H0H A;  1V2A A;  1FB0 A;  3RHB A;  4MJA A;  1YKC A;  4XTS A;  3EE2 A;  3D5J A;  4GLT A;  2L6D A;  3KH7 A;  2H66 A;  4HDE A;  4PUR A;  1MDK A;  1XVQ A;  2DBC A;  3VWU A;  5A4W A;  4GF0 A;  5GAN D;  2VCX A;  1AQW A;  3FW2 A;  1OC9 A;  2H71 A;  5H5Q A;  4HU7 A;  2I9H A;  3WYW A;  4ZBD A;  5DVB A;  4PX1 A;  2LEG A;  4PNG A;  4I2U A;  1YF1 A;  4XS6 A;  3TKS C;  1XOB A;  2CZ3 A;  1XZO A;  1UVZ A;  1FOV A;  4FO5 A;  1EWX A;  3QOU A;  3WGX A;  4GST A;  4G19 A;  1GTA A;  1USB A;  1MD3 A;  1VGL A;  4F82 A;  3P7X A;  4ECJ A;  5CRD A;  3LYK A;  3ZVJ D;  1ON4 A;  2YZU A;  4EL1 A;  2YNX A;  3LOR A;  2DJ2 A;  3F4T A;  2HXK A;  3R2Q A;  1K0D A;  5B8A A;  1YQ1 A;  3GMF A;  4KDU A;  3KMN A;  3QR6 A;  4AGS A;  3TGZ A;  2FD3 A;  1XWG A;  2XPD A;  1VF2 A;  4TRX A;  5J41 A;  5ELA A;  4NAX A;  4FIW A;  3J7Y k;  1X9W B;  2GQM A;  3LGC A;  4PXO A;  2RM5 A;  17GS A;  1I5G A;  1T3B A;  3GIX A;  3FZ9 A;  1S3C A;  19GS A;  1X9M B;  1TRS A;  2JZR A;  4ZB6 A;  3DXB A;  1EOH A;  5DQY A;  1A2J A;  2PVQ A;  4IQA A;  5EPF A;  1Y6E A;  1K0N A;  4XS4 A;  3Q6O A;  4WET A;  1XIY A;  1VF1 A;  4AJ6 A;  4DSQ A;  3L78 A;  3TJB A;  4LL4 B;  2H30 A;  4HQS A;  4TR1 B;  4IJ3 A;  5D9W A;  3CSH A;  1Q4J A;  5L71 A;  4JU5 A;  1YKA A;  4Q5F A;  1O73 A;  3HDC A;  3EU3 A;  5DAL A;  5CP1 A;  3EMX A;  5DQS A;  5D9T A;  2CVB A;  1GSD A;  2R37 A;  3ZMK A;  1M7T A;  1O6J A;  2TIR A;  3WT1 A;  4ID0 A;  3NOF A;  4WF4 A;  4XCS A;  3UOM A;  4ZL9 A;  2C3T A;  4H86 A;  2GSQ A;  3MSZ A;  4J2F A;  3ZML A;  5IMV A;  1ERU A;  3A2X A;  2I1U A;  4G9H A;  4J57 E;  2XC2 A;  1T1V A;  2L5O A;  1TXX A;  2PER A;  3RPN A;  2VD1 A;  2X8G A;  4EE0 A;  3CTG A;  1V58 A;  1W4V A;  2IJY A;  3Q19 A;  1RK4 A;  2MMA A;  2OE1 A;  7GSS A;  1HD2 A;  4PGT A;  3GX8 A;  5E59 A;  3KCM A;  4EUY A;  3M8N A;  2I4A A;  2LQO A;  4F2I A;  1EZK A;  4GCI A;  4NV5 A;  3IV4 A;  3RBT A;  3IRA A;  2OE0 A;  2H0I A;  3QCP A;  4MK3 A;  1YZX A;  1RW1 A;  2DIY A;  4OFM A;  1TJD A;  3WT2 A;  4ILF A;  2CVD A;  4JRR A;  4ZL7 A;  2HZE B;  1CQH A;  2DMM A;  3NIV A;  3ZZX A;  2JL4 A;  4IJI A;  5JCU A;  2KUC A;  4HU9 A;  2WB9 A;  2OJL A;  1O81 A;  2IMF A;  1GTI A;  2IMK A;  4X0X A;  2L57 A;  3A2W A;  1Y25 A;  5EL8 A;  3P90 A;  3TKQ A;  1SD9 A;  1HNA A;  5HR1 A;  4GSS A;  5J5N A;  2PMT A;  4N10 A;  1SYR A;  4JBB A;  2V32 A;  2RII A;  5IO2 A;  1TKD B;  4NPB A;  4QL9 A;  3N9J A;  2PN8 A;  4Q5Q A;  2GDR A;  1QK8 A;  3ZFL A;  3TCO A;  5HQP A;  3O6T A;  5FT3 A;  2GT5 A;  2VUP A;  3DWV A;  2DML A;  1PMT A;  2QKE A;  3FZ5 A;  2VD0 A;  1ZYE A;  1N8J A;  4L8E A;  2X8H A;  1G6W A;  2ON7 A;  2B1L A;  2F51 A;  2RLI A;  1K0M A;  5JWR B;  3KP9 A;  2V41 A;  5FWG A;  5H5R A;  1KTE A;  4MPF A;  3FZ4 A;  4LL1 B; 
#chains in the Genus database with same CATH topology
 4GRF A;  2B1K A;  1K0A A;  1VF3 A;  3GN3 A;  2H75 A;  1Q98 A;  1SYX A;  4J56 E;  3ZRE A;  1SJZ A;  1BJX A;  2HE3 A;  2IFQ A;  2QA1 A;  2O7K A;  2YJ7 A;  1ZGN A;  5A5K A;  6GSW A;  1H4O A;  3QAW A;  2A4H A;  3DKS A;  4K1F A;  1TW9 A;  1XVW A;  1ZCP A;  5IPH A;  1OKD A;  2WGR A;  4MJC A;  1XWK A;  1JZW A;  1NHY A;  1A2L A;  2CV4 A;  3FHK A;  1A8L A;  2FY6 A;  3KXO A;  3QFA C;  4MF7 A;  4NWY A;  3RAZ A;  3GL5 A;  2I81 A;  2CQ9 A;  2FCH A;  1SL1 B;  4Q5N A;  5ECM B;  2B6M A;  1PQN A;  2B5X A;  1TK5 B;  3E3E A;  2E0Q A;  5A4U A;  1XW9 A;  2DKH A;  1U88 A;  1PD2 1;  2B5E A;  2F9S A;  4EDY A;  3LW9 A;  1WWJ A;  1XW5 A;  2R0P A;  4MH2 A;  4IQ1 A;  3F4R A;  1CQG A;  2GTU A;  2H6Y A;  2AAW A;  1XWB A;  5COH A;  3KJY A;  3HY2 A;  2PWJ A;  4MDC A;  3F8U A;  1R5P A;  3HKR A;  2FWE A;  1M99 A;  5JCW A;  2HT9 A;  3IPZ A;  4IP6 A;  4MNN A;  2CX3 A;  2VLU A;  4OCE A;  3W8S A;  4RI7 A;  1PKZ A;  4BA7 A;  1WRY A;  3HZ4 A;  1J9B A;  2C0E A;  2JZS A;  4EC0 A;  3K8N A;  5F05 A;  1LJR A;  1GNE A;  3HVS A;  4HUA A;  1ILO A;  2J9H A;  3TJG A;  2CX4 A;  3H4K A;  3D22 A;  4ACS A;  5ECL B;  3G7Y A;  1Z6N A;  3MNG A;  3EIN A;  5DJM A;  3A3T A;  3BCK A;  1SL2 B;  1JZO A;  4CW9 A;  2DJ3 A;  1B4Q A;  4KCE A;  2AJQ B;  1GP1 A;  5DBQ A;  3GKX A;  1THX A;  12GS A;  1PSQ A;  4WR4 A;  2XHF A;  2O87 A;  1PA3 A;  5FHI A;  3I43 A;  1FHE A;  2GLR A;  3IOS A;  4TXO B;  3A5W A;  1WIK A;  1FOH A;  3QAG A;  4ICY A;  2KOK A;  1HQO A;  3GTU A;  2IIY A;  1EEJ A;  3KM6 A;  3D4T A;  1X5C A;  3D0Z A;  3F63 A;  2FA8 A;  4XIH A;  3GYK A;  1PN9 A;  1TRV A;  4DSS A;  1WPI A;  2BTO T;  4USS A;  3DVW A;  3VI5 A;  2YV9 A;  3APS A;  4V1A g;  3JCM L;  4POL A;  2QC7 A;  4OCF A;  1PRX A;  2VOC A;  5HR0 A;  2L59 A;  1ZYP A;  3GKM A;  3QDN A;  3APO A;  2B7K A;  2XBI A;  2EIO A;  3H79 A;  1QQ2 A;  2NVL A;  1B4P A;  4K5S A;  1ST9 A;  1A24 A;  2AHE A;  2K6V A;  4N0Z A;  1WE0 A;  2R3X A;  2B3S A;  2WDU A;  1V57 A;  3IXR A;  5IMD A;  1Z9H A;  2H19 A;  5HR3 A;  1GUL A;  4GXZ A;  4EXJ A;  4MLY A;  4KUN A;  3SWL A;  18GS A;  2NDO A;  4ULX A;  2IN3 A;  1GRX A;  1JLW A;  4FYU A;  4MA9 A;  1TP9 A;  2M80 A;  1Z7R A;  1DE2 A;  3KD0 A;  3O3T A;  1PL2 A;  2DJJ A;  1GSQ A;  4HZ2 A;  2P5Q A;  4WBJ A;  3KMO A;  3J7Y b;  4KE3 A;  1M9A A;  2VM2 A;  5GSS A;  1O85 A;  1GH2 A;  4X43 A;  4NHZ A;  2YCD A;  4YAP A;  3CMI A;  1U3A A;  2GQK A;  3C8E A;  1AC1 A;  5DAK A;  1ERW A;  3ME7 A;  2GVP A;  5ECK B;  2Z9S A;  5EVO A;  10GS A;  2NBS A;  3LG6 A;  3QFB C;  3GST A;  1NM3 A;  3VPT A;  3ZTL A;  3GH6 A;  1TU7 A;  8GSS A;  4K7I A;  1V9W A;  2AV4 A;  2R0G A;  1AQX A;  3KGK A;  4MCU A;  4POB A;  1R4W A;  3HJM A;  3FZA A;  2NPB A;  3FEU A;  3BCI A;  4KX4 A;  1G7O A;  1Z5Y E;  2CA8 A;  3GSS A;  4XS1 A;  3IC4 A;  2C80 A;  5D9V A;  5G5F A;  3UBK A;  1X5E A;  3Q18 A;  4ZB8 A;  2H76 A;  2OA7 A;  2WFC A;  3H8Q A;  4HQZ A;  3G7I A;  4KDY A;  2H8L A;  1TK8 B;  4O5R A;  5CRG A;  5ID2 B;  11GS A;  1YJ6 A;  3FR3 A;  2VCQ A;  4ZBB A;  3HVX A;  3TB2 A;  2DJ0 A;  5AIS A;  1GLQ A;  5IOX A;  2CZ2 A;  1ACV A;  5ECI B;  4BVY B;  3ERW A;  1XPV A;  1SKW B;  1X5D A;  3PIN A;  5CO3 A;  3FYG A;  5C04 A;  3WGD A;  1SKR B;  2RUF A;  1ABA A;  3TRQ A;  2MYG A;  1MTC A;  1YDK A;  4Z2U A;  3CSJ A;  1XFL A;  1OE7 A;  2WRT A;  2VL2 A;  2LNS A;  5G30 A;  4MAB A;  2K8V A;  1OVN A;  3KZQ A;  2RM6 A;  3C1S A;  2N5B A;  1M3I A;  2L5L A;  1EGO A;  2YWM A;  3GV1 A;  3HVV A;  2JZT A;  2E7P A;  3DGQ A;  5D93 A;  1A8Y A;  5EY6 A;  2KP1 A;  5ECQ B;  2TRC P;  4IVF A;  3UVH A;  4O32 A;  4ECI A;  4RQR A;  4L0U A;  3KH9 A;  1AW9 A;  1W89 A;  3CXG A;  3GFK A;  5D9X A;  1A0F A;  4EVM A;  2MBT A;  4FYC A;  2EIQ A;  3KTL A;  2C0D A;  4GQC A;  3SBC A;  4HOJ A;  4OO4 A;  3C7M A;  2PPT A;  2REM A;  3DEX A;  1B9Y C;  4KND A;  2IME A;  4BPY A;  3WGE A;  4TOP A;  1A0R P;  4MH3 A;  1WMJ A;  4K5R A;  4HSC X;  3L9V A;  4LA1 A;  2LV3 A;  1PN0 A;  2VLT A;  3BBY A;  2GS3 A;  3UVT A;  2PBJ A;  1BAY A;  2L4Q A;  5ABR A;  4D73 B;  3IR4 A;  1T8E B;  1GSY A;  1QGV A;  3L4N A;  2H73 A;  4HI7 A;  2HRK A;  4F0B A;  4AF2 A;  3FKF A;  3L9S A;  2UZ8 A;  3HVN A;  4MMM A;  4MJE A;  5ECR B;  1ZOF A;  4TXV A;  1A23 A;  3CBU A;  1C72 A;  4PUF C;  1F6M C;  1GSU A;  4MPG A;  2LJR A;  1NW2 A;  2YZH A;  4FH8 A;  1TI1 A;  2I3Y A;  1SK0 A;  1K3L A;  2H6Z A;  2YWI A;  2HLS A;  4GTU A;  4JZQ A;  1AAZ A;  1B9X C;  3QPM A;  2O89 A;  4PQH A;  4TW5 A;  2GSR A;  4N30 A;  3P8W A;  3KP8 A;  2PUK C;  1V40 A;  2R6K A;  3DIE A;  5J9C A;  1ERT A;  2GSS A;  1M3J A;  2HRF A;  4YQV A;  2HFD A;  4WXT A;  4Z7X A;  1URM A;  2L6C A;  2HI7 A;  3IAS 2;  3N5O A;  1QMV A;  1XCC A;  4OO5 A;  2MBS A;  2FGX A;  2H1D A;  4KW6 A;  4X4J A;  1BQ7 A;  1TI3 A;  5INY A;  3IE3 A;  6GSY A;  1E6B A;  1JZD A;  2E2M A;  1JLV A;  4A5P A;  4ZL8 A;  3GA4 A;  4I2T A;  3WD6 A;  2ON5 A;  1T4Y A;  1THO A;  1MDI A;  2VCZ A;  5CYY A;  1TU8 A;  5A4V A;  1DBY A;  2KHP A;  2IMI A;  4F0C A;  3EU4 A;  5DJL A;  4JR4 A;  4TVE A;  3QD9 A;  4LMW A;  1U3I A;  1VF4 A;  1S3A A;  1B48 A;  1MD4 A;  4E8H A;  4NHW A;  3UAR A;  4E8E A;  4HZ4 A;  2GT6 A;  3EMP A;  2V2G A;  2MZC A;  3TDG A;  3FR6 A;  3BD2 A;  2MMZ A;  16GS A;  4O5U A;  1FVJ A;  3RHC A;  4I97 A;  4WEY A;  4K7O A;  2ES7 A;  1G6Y A;  3ZRD A;  1F9M A;  1GSF A;  4TR1 A;  2K8S A;  3TUE A;  4BVX A;  1OAZ A;  1J0F A;  1TRU A;  3BOA A;  4FYB A;  4HJ2 A;  4N0V A;  2DLX A;  1FO5 A;  1XG8 A;  2C8U A;  1LBK A;  1JFU A;  4KSM A;  3TKR A;  2FWH A;  3Q74 A;  2H1B A;  4G2E A;  2LRC A;  2F8A A;  2C4J A;  2LST A;  5IIZ A;  3DML A;  4YQU A;  3IA1 A;  2C1Y A;  20GS A;  2FUG 2;  4EDZ A;  4ML1 A;  2OBK A;  2YV7 A;  5J9B A;  1OC9 B;  2ZNM A;  5F8B A;  5J4U A;  1EGR A;  3GUS A;  1M0U A;  2YPM A;  1ERV A;  1GTB A;  1DUG A;  1YY7 A;  3TOU A;  5HR2 A;  1PGT A;  1M2D A;  4K9Z A;  4MZW A;  3ZL5 A;  2F8F A;  4LLR A;  2LRN A;  2HZF A;  1TDI A;  2RUE A;  5B6N A;  4I6X A;  4ZXG A;  4NXI A;  5KEJ A;  4ML6 A;  1EP8 A;  3HJO A;  3E0U A;  2KP2 A;  2WS2 A;  4QQ7 A;  2PGT A;  2IL3 A;  4DSR A;  5CNW A;  1EV9 A;  3R3E A;  1O8W A;  2K9F A;  1QXH A;  3U5R E;  5ECH B;  3ZFB A;  1SK1 A;  4O92 A;  1X9S B;  2PU9 C;  4JE1 A;  3ZYW A;  5IQY A;  1GSE A;  4KF9 A;  4LMV A;  2R2J A;  2IWT A;  2A2S A;  3KTB A;  4BIK A;  2JAC A;  3VWX A;  2HZE A;  2FNO A;  4FQU A;  4EIQ A;  4ECC A;  4KSO A;  2AUV A;  1YEP A;  2HSY A;  1G7E A;  1MEK A;  2A2R A;  3HXS A;  1K0O A;  5ECO B;  14GS A;  4TR4 A;  2OKA A;  4XS4 B;  6GSU A;  2X4A A;  2DJK A;  1DSB A;  1S3D A;  3ZIJ A;  5B7C A;  3CRU A;  3I9V 2;  4XRA A;  3F3R A;  3EPT A;  3FR9 A;  4NMU A;  5F07 A;  3P2A A;  3ED3 A;  3PR8 A;  4GQF A;  2C0F A;  2C3Q A;  2OBI A;  2CAI A;  2C0G A;  2V6K A;  1JHB A;  5DAL B;  2GZZ A;  2ZCT A;  2FA4 A;  1E2Y A;  2XBQ A;  4K7N A;  3UL3 A;  2A4V A;  1M9B A;  3HHV A;  4WF5 A;  5IM9 A;  5ECS A;  5HFG A;  3GKK A;  4K0N A;  4EKZ A;  4V2M A;  5G2Z A;  5AN1 A;  3M3M A;  3VWV A;  3UMA A;  1R7H A;  1R26 A;  2WUL A;  5JWQ B;  3W6G A;  3UJ1 A;  3IBH A;  4OWY A;  1ZYN A;  3VK9 A;  3M9K A;  4OMV A;  5LD0 A;  2OAC A;  4K8M A;  5KN0 A;  2NTO A;  2L4C A;  3GUR A;  2DIZ A;  4X1U A;  1YF0 A;  1B8X A;  4TR0 A;  2H1A A;  3MIX A;  13GS A;  4BL7 B;  3HYP A;  4EF0 A;  4F9Z A;  2VL9 A;  4GWR A;  1OC8 A;  2H70 A;  4IHU A;  1GTU A;  2OE3 A;  1XWC A;  1F37 A;  3D4M A;  2FWG A;  2PVO C;  5G1L A;  22GS A;  5KN2 A;  1DE1 A;  1SJ6 A;  3EVI A;  1MDJ A;  2VCT A;  3L9U A;  4HS1 A;  2WJU A;  1SK2 A;  1GNW A;  1A2M A;  3W8J A;  3IK7 A;  5G1K A;  4G0K A;  2V1M A;  2FLS A;  4QL7 A;  4RUV A;  1Z7P A;  4XRD A;  3DYR A;  3I6A A;  6GST A;  1BG5 A;  1OKT A;  3TJJ A;  2OAD A;  5CAX A;  2LUS A;  5HFI A;  5D96 A;  1XW6 A;  2MMO A;  4IBP A;  3UEM A;  4DEJ A;  4HJM A;  3CSI A;  3TKS A;  4PQI A;  1GL8 A;  1SL0 B;  2VO4 A;  1F3B A;  1EEM A;  5LNK e;  3A5I A;  2YOI A;  4BWS A;  3F3Q A;  3LJR A;  3OR5 A;  3ERF A;  3GH9 A;  5ENU A;  2MMN A;  1Z3E A;  4TN8 A;  2WZ9 A;  3HD5 A;  4ZIL A;  2JAD A;  3ZIT A;  4IW9 A;  4Z2R A;  2YWO A;  4I8B A;  3HCZ A;  1JZR A;  4OFN A;  4CHS A;  1M2B A;  2VL2 C;  4CY8 A;  4YQM A;  1AIU A;  1EOG A;  2HYX A;  4MF6 A;  5JWO B;  2VM1 A;  5DDL A;  3CYN A;  3GL3 A;  3IAM 2;  2B7J A;  4IN0 A;  4K6X A;  1F2E A;  1GUM A;  3C73 A;  3GRX A;  1R5A A;  2IFQ B;  2JSZ A;  4YKF A;  1PKW A;  4G10 A;  3H93 A;  1KBN A;  2LJK A;  1M2A A;  2YWN A;  3A2V A;  2X8C A;  2YAN A;  3DRN A;  4TXO A;  2HSH A;  3VWW A;  3M9J A;  3D6I A;  2O8V B;  3FY7 A;  1F3A A;  4I5Q A;  1QFN A;  1TOF A;  4KA0 A;  1EV4 A;  4V2L A;  2VAF A;  4K0G A;  5DCG A;  1K0B A;  2HNL A;  4WR5 A;  1N2A A;  2G2Q A;  1TK0 B;  4KCA A;  2H0G A;  4HEA 2;  2EC4 A;  1SU9 A;  2ALB A;  4L0W A;  1PX7 A;  4IEL A;  3U6V A;  3TRX A;  5IMF A;  2O85 A;  4JED A;  3FMW A;  2EIR A;  1K3Y A;  2C3N A;  1AXD A;  4DVC A;  1XBS A;  1YEX A;  2H72 A;  3G9B A;  2F3M A;  2V6O A;  3LFL A;  2LQQ A;  3F0I A;  3KEB A;  5G5E A;  1GUK A;  1OE8 A;  5CRE A;  3VI7 A;  2GZP A;  3CRT A;  3PGT A;  3GX0 A;  5J3R A;  1WOU A;  3US3 A;  3LXZ A;  3TJF A;  3H1N A;  3GNJ A;  5B8B A;  4O7H A;  2BMX A;  1UC7 A;  2H74 A;  2N5F A;  4BL7 A;  3LQ7 A;  5AGY A;  1GLP A;  3F6F A;  2GST A;  3IHQ A;  1O7U A;  2LJA A;  2GGT A;  4K2D A;  4F03 A;  3APQ A;  5AIV A;  1NSW A;  3PPU A;  2P0G A;  3MDK A;  1TRW A;  3C1R A;  4YH2 A;  1KEB A;  4PNF A;  1EP7 A;  2LRT A;  5HFK A;  3TKP A;  3IHG A;  2H6X A;  2KLX A;  2ZUP A;  3VLN A;  3E9J B;  3M1G A;  5LCZ A;  1OC3 A;  1SKS B;  3ISO A;  6GSX A;  4IKH A;  5IOW A;  2K18 A;  2R5G A;  3LXT A;  4PUA A;  5GST A;  3ZVJ A;  4P3Y B;  2XPE A;  4MP4 A;  1ZMA A;  2LS5 A;  3GTU B;  1ZYQ B;  2VLV A;  1OYJ A;  4POK A;  3CQF A;  3ZLP A;  3ME8 A;  2M46 A;  3UIW A;  1GSS A;  1KNG A;  2BJX A;  5ID2 A;  5C00 A;  4DSS B;  1T00 A;  5IMC A;  4G0L A;  1V98 A;  4KH7 A;  2QSI A;  4POM A;  3GKN A;  1NHO A;  5AIX A;  1SD8 A;  1IYH A;  3LWA A;  1Z6M A;  4ZB9 A;  4GSN A;  2YJH A;  4BVY A;  2JU5 A;  4AJ8 A;  5F0G A;  4PQ1 A;  2LNT A;  5E4W A;  2WCI A;  3ERG A;  3HA9 A;  1LU4 A;  1PX6 A;  2FWF A;  3GHA A;  4MZB A;  3S9F A;  3VPQ A;  3F6D A;  3EC3 A;  1XOA A;  4YAV A;  1TTZ A;  3FK8 A;  3MWH A;  5CRW A;  2DC5 A;  4ECB A;  3G7J A;  3UBL A;  3C71 A;  1FW1 A;  5KN3 A;  3V1W A;  1GWC A;  1I9D A;  2J23 A;  2YP6 A;  5KOX A;  4Q5R A;  4NV2 A;  4V2N A;  5DAK B;  2E2G A;  4IS0 A;  4ISD A;  1PL1 A;  2VCW A;  3IK9 A;  1U87 A;  1O8X A;  3HJP A;  2VCV A;  3F9U A;  3EWL A;  4IP1 A;  2LTK A;  3QMX A;  2H1G A;  2CT6 A;  1T7P B;  2CAQ A;  1J08 A;  3VFI A;  1XXU A;  3L0H A;  1K3O A;  1HNC A;  4MJB A;  1XWA A;  1H75 A;  3D21 A;  2HRN A;  5ECP B;  4RI6 A;  3NZN A;  5JCG A;  2R0C A;  2YN1 A;  1AUC A;  2HSM A;  3CTF A;  5D73 A;  1WJK A;  4KB3 A;  3KIJ A;  2JSY A;  1IYI A;  2B5Y A;  3I69 A;  1BYE A;  4XHM A;  2X99 A;  2TRX A;  3RDW A;  3BJ5 A;  4G0I A;  4JR6 A;  4D73 A;  4ZBA A;  3LSZ A;  5ECN B;  1SEN A;  1SJI A;  3EUR A;  2FHE A;  3LYP A;  2LKU A;  2P31 A;  3RPP A;  4BWQ A;  1T4Z A;  1AQV A;  4IGJ A;  3TOT A;  3AY8 A;  5GAP D;  1UA5 A;  4MZC A;  5BRT A;  2GZY A;  2QGV A;  1FAA A;  1ML6 A;  2M72 A;  6GSV A;  1FVK A;  2GQL A;  2IPA A;  4KGI A;  2CVK A;  5KN1 A;  3O76 A;  1RQM A;  4AJ7 A;  1HNB A;  1VRS D;  4K2X A;  3QAV A;  3TKS E;  2DSA A;  4OD7 A;  2H01 A;  5GZZ B;  1X0R A;  2VL3 A;  3DD3 A;  3M0F A;  4V1A p;  3FRC A;  4RQX A;  4WBR D;  1FG4 A;  6GSS A;  3HZ8 A;  3MAK A;  3TRP A;  1U6T A;  3UAP A;  4WKW A;  2N5A A;  5CRH A;  4TKY A;  4KAE A;  2IMD A;  3PH9 A;  3LEF A;  3F4S A;  4TR3 A;  5F06 A;  1ZZY A;  4EO3 A;  3DVX A;  1FB6 A;  3ZIV A;  2AB6 A;  1WP0 A;  3IDV A;  4MF5 A;  5IO0 A;  5IMZ A;  1QUW A;  5KOW A;  1BED A;  1ZL9 A;  1K0C A;  3EYT A;  3TJK A;  1BX9 A;  5G31 A;  5IPG A;  5IMA A;  9GSS A;  4KDX A;  2X64 A;  4L5L A;  1HYU A;  4ZIJ A;  2DJ1 A;  4N11 A;  5BMU A;  2AYT A;  4CDO A;  1GUH A;  2D2Z A;  5ELG A;  5H5S A;  4OFT A;  2R4V A;  5D8I A;  4L5O A;  2VIM A;  1G0T A;  3VUR A;  5B6M A;  1UN2 A;  2G0F A;  5DCH A;  2P5R A;  2H0H A;  1V2A A;  1FB0 A;  3RHB A;  4MJA A;  1YKC A;  4XTS A;  3EE2 A;  3D5J A;  4GLT A;  2L6D A;  3KH7 A;  2H66 A;  4HDE A;  4PUR A;  1MDK A;  1XVQ A;  2DBC A;  3VWU A;  5A4W A;  4GF0 A;  5GAN D;  2VCX A;  1S3R A;  1AQW A;  3FW2 A;  1OC9 A;  2H71 A;  5H5Q A;  4HU7 A;  2I9H A;  3WYW A;  4ZBD A;  5DVB A;  4PX1 A;  2LEG A;  4PNG A;  2A2P A;  4I2U A;  1YF1 A;  4XS6 A;  3TKS C;  1XOB A;  2CZ3 A;  1XZO A;  1UVZ A;  1FOV A;  4FO5 A;  1EWX A;  3QOU A;  3WGX A;  4GST A;  4G19 A;  1GTA A;  1USB A;  1MD3 A;  1VGL A;  4F82 A;  3P7X A;  4ECJ A;  5CRD A;  3LYK A;  3ZVJ D;  1ON4 A;  2YZU A;  4EL1 A;  2YNX A;  3LOR A;  2DJ2 A;  3F4T A;  2HXK A;  3R2Q A;  1K0D A;  5B8A A;  1YQ1 A;  3GMF A;  4KDU A;  3KMN A;  3QR6 A;  4AGS A;  3TGZ A;  2FD3 A;  1XWG A;  2XPD A;  1VF2 A;  4TRX A;  5J41 A;  5ELA A;  4NAX A;  4FIW A;  3J7Y k;  1X9W B;  2GQM A;  3LGC A;  4PXO A;  2RM5 A;  17GS A;  1I5G A;  1T3B A;  3GIX A;  3FZ9 A;  1S3C A;  19GS A;  1X9M B;  1TRS A;  2JZR A;  4ZB6 A;  3DXB A;  1EOH A;  5DQY A;  1A2J A;  2PVQ A;  4IQA A;  5EPF A;  1Y6E A;  1K0N A;  4XS4 A;  3Q6O A;  4WET A;  1XIY A;  1VF1 A;  4AJ6 A;  4DSQ A;  3L78 A;  3TJB A;  4LL4 B;  2H30 A;  4HQS A;  4TR1 B;  4BVX B;  4IJ3 A;  5D9W A;  3CSH A;  1Q4J A;  5L71 A;  4JU5 A;  4Z2T A;  1YKA A;  4Q5F A;  1O73 A;  3HDC A;  3EU3 A;  5DAL A;  5CP1 A;  3EMX A;  5DQS A;  5D9T A;  2HRA A;  2CVB A;  1GSD A;  2R37 A;  3ZMK A;  1M7T A;  1O6J A;  2TIR A;  3WT1 A;  4ID0 A;  3NOF A;  4WF4 A;  4XCS A;  4EIP A;  3UOM A;  4ZL9 A;  2C3T A;  4H86 A;  2GSQ A;  3MSZ A;  4J2F A;  3ZML A;  5IMV A;  1ERU A;  3A2X A;  2I1U A;  4G9H A;  4O5Q A;  4J57 E;  2XC2 A;  1T1V A;  2L5O A;  1TXX A;  2PER A;  3RPN A;  2VD1 A;  2X8G A;  3MYD A;  4EE0 A;  3CTG A;  1V58 A;  2X49 A;  1W4V A;  2IJY A;  3Q19 A;  1RK4 A;  2MMA A;  2OE1 A;  7GSS A;  4PTS A;  1HD2 A;  4PGT A;  3GX8 A;  5E59 A;  3KCM A;  4EUY A;  3M8N A;  2I4A A;  2LQO A;  4F2I A;  1EZK A;  2DKI A;  4GCI A;  4NV5 A;  3IV4 A;  3RBT A;  3IRA A;  2OE0 A;  2H0I A;  3QCP A;  4MK3 A;  1YZX A;  1RW1 A;  2DIY A;  1PFO A;  4OFM A;  1TJD A;  3WT2 A;  4ILF A;  2CVD A;  4JRR A;  4ZL7 A;  2HZE B;  1CQH A;  2DMM A;  3NIV A;  3ZZX A;  2JL4 A;  4IJI A;  5JCU A;  2KUC A;  4HU9 A;  2WB9 A;  2OJL A;  1O81 A;  2IMF A;  4YKG A;  1GTI A;  2IMK A;  4X0X A;  2L57 A;  3A2W A;  1Y25 A;  5EL8 A;  3P90 A;  3TKQ A;  1SD9 A;  1HNA A;  5HR1 A;  4GSS A;  5J5N A;  2PMT A;  2QA2 A;  4N10 A;  1SYR A;  4JBB A;  2V32 A;  2RII A;  5IO2 A;  1TKD B;  4CY6 A;  4NPB A;  4QL9 A;  3N9J A;  2PN8 A;  4Q5Q A;  2GDR A;  1QK8 A;  3ZFL A;  3TCO A;  5HQP A;  3O6T A;  5FT3 A;  2GT5 A;  2VUP A;  3DWV A;  2DML A;  1PMT A;  2QKE A;  3IC8 A;  3FZ5 A;  2VD0 A;  1ZYE A;  1N8J A;  4L8E A;  2X8H A;  1G6W A;  2ON7 A;  2B1L A;  2F51 A;  2RLI A;  1K0M A;  5JWR B;  3KP9 A;  2V41 A;  5FWG A;  5H5R A;  1KTE A;  4MPF A;  3FZ4 A;  4LL1 B; 
#chains in the Genus database with same CATH homology
 4GRF A;  2B1K A;  1K0A A;  1VF3 A;  3GN3 A;  2H75 A;  1Q98 A;  1SYX A;  4J56 E;  3ZRE A;  1SJZ A;  1BJX A;  2HE3 A;  2IFQ A;  2QA1 A;  2O7K A;  2YJ7 A;  1ZGN A;  5A5K A;  6GSW A;  1H4O A;  3QAW A;  2A4H A;  3DKS A;  4K1F A;  1TW9 A;  1XVW A;  1ZCP A;  5IPH A;  1OKD A;  2WGR A;  4MJC A;  1XWK A;  1JZW A;  1NHY A;  1A2L A;  2CV4 A;  3FHK A;  1A8L A;  2FY6 A;  3KXO A;  3QFA C;  4MF7 A;  4NWY A;  3RAZ A;  3GL5 A;  2I81 A;  2CQ9 A;  2FCH A;  1SL1 B;  4Q5N A;  5ECM B;  2B6M A;  1PQN A;  2B5X A;  1TK5 B;  3E3E A;  2E0Q A;  5A4U A;  1XW9 A;  2DKH A;  1U88 A;  1PD2 1;  2B5E A;  2F9S A;  4EDY A;  3LW9 A;  1WWJ A;  1XW5 A;  2R0P A;  4MH2 A;  4IQ1 A;  3F4R A;  1CQG A;  2GTU A;  2H6Y A;  2AAW A;  1XWB A;  5COH A;  3KJY A;  3HY2 A;  2PWJ A;  4MDC A;  3F8U A;  1R5P A;  3HKR A;  2FWE A;  1M99 A;  5JCW A;  2HT9 A;  3IPZ A;  4IP6 A;  4MNN A;  2CX3 A;  2VLU A;  4OCE A;  3W8S A;  4RI7 A;  1PKZ A;  4BA7 A;  1WRY A;  3HZ4 A;  1J9B A;  2C0E A;  2JZS A;  4EC0 A;  3K8N A;  5F05 A;  1LJR A;  1GNE A;  3HVS A;  4HUA A;  1ILO A;  2J9H A;  3TJG A;  2CX4 A;  3H4K A;  3D22 A;  4ACS A;  5ECL B;  3G7Y A;  1Z6N A;  3MNG A;  3EIN A;  5DJM A;  3A3T A;  3BCK A;  1SL2 B;  1JZO A;  4CW9 A;  2DJ3 A;  1B4Q A;  4KCE A;  2AJQ B;  1GP1 A;  5DBQ A;  3GKX A;  1THX A;  12GS A;  1PSQ A;  4WR4 A;  2XHF A;  2O87 A;  1PA3 A;  5FHI A;  3I43 A;  1FHE A;  2GLR A;  3IOS A;  4TXO B;  3A5W A;  1WIK A;  1FOH A;  3QAG A;  4ICY A;  2KOK A;  1HQO A;  3GTU A;  2IIY A;  1EEJ A;  3KM6 A;  3D4T A;  1X5C A;  3D0Z A;  3F63 A;  2FA8 A;  4XIH A;  3GYK A;  1PN9 A;  1TRV A;  4DSS A;  1WPI A;  2BTO T;  4USS A;  3DVW A;  3VI5 A;  2YV9 A;  3APS A;  4V1A g;  3JCM L;  4POL A;  2QC7 A;  4OCF A;  1PRX A;  2VOC A;  5HR0 A;  2L59 A;  1ZYP A;  3GKM A;  3QDN A;  3APO A;  2B7K A;  2XBI A;  2EIO A;  3H79 A;  1QQ2 A;  2NVL A;  1B4P A;  4K5S A;  1ST9 A;  1A24 A;  2AHE A;  2K6V A;  4N0Z A;  1WE0 A;  2R3X A;  2B3S A;  2WDU A;  1V57 A;  3IXR A;  5IMD A;  1Z9H A;  2H19 A;  5HR3 A;  1GUL A;  4GXZ A;  4EXJ A;  4MLY A;  4KUN A;  3SWL A;  18GS A;  2NDO A;  4ULX A;  2IN3 A;  1GRX A;  1JLW A;  4FYU A;  4MA9 A;  1TP9 A;  2M80 A;  1Z7R A;  1DE2 A;  3KD0 A;  3O3T A;  1PL2 A;  2DJJ A;  1GSQ A;  4HZ2 A;  2P5Q A;  4WBJ A;  3KMO A;  3J7Y b;  4KE3 A;  1M9A A;  2VM2 A;  5GSS A;  1O85 A;  1GH2 A;  4X43 A;  4NHZ A;  2YCD A;  4YAP A;  3CMI A;  1U3A A;  2GQK A;  3C8E A;  1AC1 A;  5DAK A;  1ERW A;  3ME7 A;  2GVP A;  5ECK B;  2Z9S A;  5EVO A;  10GS A;  2NBS A;  3LG6 A;  3QFB C;  3GST A;  1NM3 A;  3VPT A;  3ZTL A;  3GH6 A;  1TU7 A;  8GSS A;  4K7I A;  1V9W A;  2AV4 A;  2R0G A;  1AQX A;  3KGK A;  4MCU A;  4POB A;  1R4W A;  3HJM A;  3FZA A;  2NPB A;  3FEU A;  3BCI A;  4KX4 A;  1G7O A;  1Z5Y E;  2CA8 A;  3GSS A;  4XS1 A;  3IC4 A;  2C80 A;  5D9V A;  5G5F A;  3UBK A;  1X5E A;  3Q18 A;  4ZB8 A;  2H76 A;  2OA7 A;  2WFC A;  3H8Q A;  4HQZ A;  3G7I A;  4KDY A;  2H8L A;  1TK8 B;  4O5R A;  5CRG A;  5ID2 B;  11GS A;  1YJ6 A;  3FR3 A;  2VCQ A;  4ZBB A;  3HVX A;  3TB2 A;  2DJ0 A;  5AIS A;  1GLQ A;  5IOX A;  2CZ2 A;  1ACV A;  5ECI B;  4BVY B;  3ERW A;  1XPV A;  1SKW B;  1X5D A;  3PIN A;  5CO3 A;  3FYG A;  5C04 A;  3WGD A;  1SKR B;  2RUF A;  1ABA A;  3TRQ A;  2MYG A;  1MTC A;  1YDK A;  4Z2U A;  3CSJ A;  1XFL A;  1OE7 A;  2WRT A;  2VL2 A;  2LNS A;  5G30 A;  4MAB A;  2K8V A;  1OVN A;  3KZQ A;  2RM6 A;  3C1S A;  2N5B A;  2L5L A;  1EGO A;  2YWM A;  3GV1 A;  3HVV A;  2JZT A;  2E7P A;  3DGQ A;  5D93 A;  1A8Y A;  5EY6 A;  2KP1 A;  5ECQ B;  2TRC P;  4IVF A;  3UVH A;  4O32 A;  4ECI A;  4RQR A;  4L0U A;  3KH9 A;  1AW9 A;  1W89 A;  3CXG A;  3GFK A;  5D9X A;  1A0F A;  4EVM A;  2MBT A;  4FYC A;  2EIQ A;  3KTL A;  2C0D A;  4GQC A;  3SBC A;  4HOJ A;  4OO4 A;  3C7M A;  2PPT A;  2REM A;  3DEX A;  1B9Y C;  4KND A;  2IME A;  4BPY A;  3WGE A;  4TOP A;  1A0R P;  4MH3 A;  1WMJ A;  4K5R A;  3L9V A;  4LA1 A;  2LV3 A;  1PN0 A;  2VLT A;  3BBY A;  2GS3 A;  3UVT A;  2PBJ A;  1BAY A;  2L4Q A;  5ABR A;  4D73 B;  3IR4 A;  1T8E B;  1GSY A;  1QGV A;  3L4N A;  2H73 A;  4HI7 A;  2HRK A;  4F0B A;  4AF2 A;  3FKF A;  3L9S A;  2UZ8 A;  4MMM A;  4MJE A;  5ECR B;  1ZOF A;  4TXV A;  1A23 A;  3CBU A;  1C72 A;  4PUF C;  1F6M C;  1GSU A;  4MPG A;  2LJR A;  1NW2 A;  2YZH A;  4FH8 A;  1TI1 A;  2I3Y A;  1SK0 A;  1K3L A;  2H6Z A;  2YWI A;  2HLS A;  4GTU A;  4JZQ A;  1AAZ A;  1B9X C;  3QPM A;  2O89 A;  4PQH A;  4TW5 A;  2GSR A;  4N30 A;  3P8W A;  3KP8 A;  2PUK C;  1V40 A;  2R6K A;  3DIE A;  5J9C A;  1ERT A;  2GSS A;  2HRF A;  4YQV A;  2HFD A;  4WXT A;  4Z7X A;  1URM A;  2L6C A;  2HI7 A;  3IAS 2;  3N5O A;  1QMV A;  1XCC A;  4OO5 A;  2MBS A;  2FGX A;  2H1D A;  4KW6 A;  4X4J A;  1BQ7 A;  1TI3 A;  5INY A;  3IE3 A;  6GSY A;  1E6B A;  1JZD A;  2E2M A;  1JLV A;  4A5P A;  4ZL8 A;  3GA4 A;  4I2T A;  3WD6 A;  2ON5 A;  1T4Y A;  1THO A;  1MDI A;  2VCZ A;  5CYY A;  1TU8 A;  5A4V A;  1DBY A;  2KHP A;  2IMI A;  4F0C A;  3EU4 A;  5DJL A;  4JR4 A;  4TVE A;  3QD9 A;  4LMW A;  1U3I A;  1VF4 A;  1S3A A;  1B48 A;  1MD4 A;  4E8H A;  4NHW A;  3UAR A;  4E8E A;  4HZ4 A;  2GT6 A;  3EMP A;  2V2G A;  2MZC A;  3TDG A;  3FR6 A;  3BD2 A;  2MMZ A;  16GS A;  4O5U A;  1FVJ A;  3RHC A;  4I97 A;  4WEY A;  4K7O A;  2ES7 A;  1G6Y A;  3ZRD A;  1F9M A;  1GSF A;  4TR1 A;  2K8S A;  3TUE A;  4BVX A;  1OAZ A;  1J0F A;  1TRU A;  3BOA A;  4FYB A;  4HJ2 A;  4N0V A;  2DLX A;  1FO5 A;  2C8U A;  1LBK A;  1JFU A;  4KSM A;  3TKR A;  2FWH A;  3Q74 A;  2H1B A;  4G2E A;  2LRC A;  2F8A A;  2C4J A;  2LST A;  5IIZ A;  3DML A;  4YQU A;  3IA1 A;  2C1Y A;  20GS A;  2FUG 2;  4EDZ A;  4ML1 A;  2OBK A;  2YV7 A;  5J9B A;  1OC9 B;  2ZNM A;  5F8B A;  5J4U A;  1EGR A;  3GUS A;  1M0U A;  2YPM A;  1ERV A;  1GTB A;  1DUG A;  1YY7 A;  3TOU A;  5HR2 A;  1PGT A;  1M2D A;  4K9Z A;  4MZW A;  3ZL5 A;  2F8F A;  4LLR A;  2LRN A;  2HZF A;  1TDI A;  2RUE A;  5B6N A;  4I6X A;  4ZXG A;  4NXI A;  5KEJ A;  4ML6 A;  1EP8 A;  3HJO A;  3E0U A;  2KP2 A;  2WS2 A;  4QQ7 A;  2PGT A;  2IL3 A;  4DSR A;  5CNW A;  1EV9 A;  3R3E A;  1O8W A;  2K9F A;  1QXH A;  3U5R E;  5ECH B;  3ZFB A;  1SK1 A;  4O92 A;  1X9S B;  2PU9 C;  4JE1 A;  3ZYW A;  5IQY A;  1GSE A;  4KF9 A;  4LMV A;  2R2J A;  2IWT A;  2A2S A;  3KTB A;  2JAC A;  3VWX A;  2HZE A;  2FNO A;  4FQU A;  4EIQ A;  4ECC A;  4KSO A;  2AUV A;  1YEP A;  2HSY A;  1G7E A;  1MEK A;  2A2R A;  3HXS A;  1K0O A;  5ECO B;  14GS A;  4TR4 A;  2OKA A;  4XS4 B;  6GSU A;  2X4A A;  2DJK A;  1DSB A;  1S3D A;  3ZIJ A;  5B7C A;  3CRU A;  3I9V 2;  4XRA A;  3F3R A;  3EPT A;  3FR9 A;  4NMU A;  5F07 A;  3P2A A;  3ED3 A;  3PR8 A;  4GQF A;  2C0F A;  2C3Q A;  2OBI A;  2CAI A;  2C0G A;  2V6K A;  1JHB A;  5DAL B;  2GZZ A;  2ZCT A;  2FA4 A;  1E2Y A;  2XBQ A;  4K7N A;  3UL3 A;  2A4V A;  1M9B A;  3HHV A;  4WF5 A;  5IM9 A;  5ECS A;  5HFG A;  3GKK A;  4K0N A;  4EKZ A;  4V2M A;  5G2Z A;  5AN1 A;  3M3M A;  3VWV A;  3UMA A;  1R7H A;  1R26 A;  2WUL A;  5JWQ B;  3UJ1 A;  3W6G A;  3IBH A;  4OWY A;  1ZYN A;  3VK9 A;  3M9K A;  4OMV A;  5LD0 A;  2OAC A;  4K8M A;  5KN0 A;  2NTO A;  2L4C A;  3GUR A;  2DIZ A;  4X1U A;  1YF0 A;  1B8X A;  2H1A A;  3MIX A;  4TR0 A;  13GS A;  4BL7 B;  3HYP A;  4EF0 A;  4F9Z A;  2VL9 A;  4GWR A;  1OC8 A;  2H70 A;  4IHU A;  1GTU A;  2OE3 A;  1XWC A;  1F37 A;  3D4M A;  2FWG A;  2PVO C;  5G1L A;  22GS A;  5KN2 A;  1DE1 A;  1SJ6 A;  3EVI A;  1MDJ A;  2VCT A;  3L9U A;  4HS1 A;  2WJU A;  1SK2 A;  1GNW A;  1A2M A;  3W8J A;  3IK7 A;  5G1K A;  4G0K A;  2V1M A;  2FLS A;  4QL7 A;  4RUV A;  1Z7P A;  4XRD A;  3DYR A;  3I6A A;  6GST A;  1BG5 A;  1OKT A;  3TJJ A;  2OAD A;  5CAX A;  2LUS A;  5HFI A;  5D96 A;  1XW6 A;  2MMO A;  4IBP A;  3UEM A;  4DEJ A;  4HJM A;  3CSI A;  3TKS A;  4PQI A;  1GL8 A;  1SL0 B;  2VO4 A;  1F3B A;  1EEM A;  5LNK e;  3A5I A;  2YOI A;  4BWS A;  3F3Q A;  3LJR A;  3OR5 A;  3ERF A;  3GH9 A;  5ENU A;  2MMN A;  1Z3E A;  4TN8 A;  2WZ9 A;  3HD5 A;  4ZIL A;  2JAD A;  3ZIT A;  4IW9 A;  4Z2R A;  2YWO A;  4I8B A;  3HCZ A;  1JZR A;  4OFN A;  4CHS A;  1M2B A;  2VL2 C;  4CY8 A;  4YQM A;  1AIU A;  1EOG A;  2HYX A;  4MF6 A;  5JWO B;  2VM1 A;  5DDL A;  3CYN A;  3GL3 A;  3IAM 2;  2B7J A;  4IN0 A;  4K6X A;  1F2E A;  1GUM A;  3C73 A;  3GRX A;  1R5A A;  2IFQ B;  2JSZ A;  4YKF A;  1PKW A;  4G10 A;  3H93 A;  1KBN A;  2LJK A;  1M2A A;  2YWN A;  3A2V A;  2X8C A;  2YAN A;  3DRN A;  4TXO A;  2HSH A;  3VWW A;  3M9J A;  3D6I A;  2O8V B;  3FY7 A;  1F3A A;  4I5Q A;  1QFN A;  1TOF A;  4KA0 A;  1EV4 A;  4V2L A;  2VAF A;  4K0G A;  5DCG A;  1K0B A;  2HNL A;  4WR5 A;  1N2A A;  2G2Q A;  1TK0 B;  4KCA A;  2H0G A;  4HEA 2;  2EC4 A;  1SU9 A;  2ALB A;  4L0W A;  1PX7 A;  4IEL A;  3U6V A;  3TRX A;  5IMF A;  2O85 A;  4JED A;  3FMW A;  2EIR A;  1K3Y A;  2C3N A;  1AXD A;  4DVC A;  1XBS A;  1YEX A;  2H72 A;  3G9B A;  2F3M A;  2V6O A;  3LFL A;  2LQQ A;  3F0I A;  3KEB A;  5G5E A;  1GUK A;  1OE8 A;  5CRE A;  3VI7 A;  2GZP A;  3CRT A;  3PGT A;  3GX0 A;  5J3R A;  1WOU A;  3US3 A;  3LXZ A;  3TJF A;  3H1N A;  3GNJ A;  5B8B A;  4O7H A;  2BMX A;  1UC7 A;  2H74 A;  2N5F A;  4BL7 A;  3LQ7 A;  5AGY A;  1GLP A;  3F6F A;  2GST A;  3IHQ A;  1O7U A;  2LJA A;  2GGT A;  4K2D A;  4F03 A;  3APQ A;  5AIV A;  1NSW A;  3PPU A;  2P0G A;  3MDK A;  1TRW A;  3C1R A;  4YH2 A;  1KEB A;  4PNF A;  1EP7 A;  2LRT A;  5HFK A;  3TKP A;  3IHG A;  2H6X A;  2KLX A;  2ZUP A;  3VLN A;  3E9J B;  3M1G A;  5LCZ A;  1OC3 A;  1SKS B;  3ISO A;  6GSX A;  4IKH A;  5IOW A;  2K18 A;  2R5G A;  3LXT A;  4PUA A;  5GST A;  3ZVJ A;  4P3Y B;  2XPE A;  4MP4 A;  1ZMA A;  2LS5 A;  3GTU B;  1ZYQ B;  2VLV A;  1OYJ A;  4POK A;  3ZLP A;  3ME8 A;  2M46 A;  3UIW A;  1GSS A;  1KNG A;  2BJX A;  5ID2 A;  5C00 A;  4DSS B;  1T00 A;  5IMC A;  4G0L A;  1V98 A;  4KH7 A;  2QSI A;  4POM A;  3GKN A;  1NHO A;  5AIX A;  1SD8 A;  1IYH A;  3LWA A;  1Z6M A;  4ZB9 A;  4GSN A;  2YJH A;  4BVY A;  2JU5 A;  4AJ8 A;  5F0G A;  4PQ1 A;  2LNT A;  5E4W A;  2WCI A;  3ERG A;  3HA9 A;  1LU4 A;  1PX6 A;  2FWF A;  3GHA A;  4MZB A;  3S9F A;  3VPQ A;  3F6D A;  3EC3 A;  1XOA A;  4YAV A;  1TTZ A;  3FK8 A;  3MWH A;  5CRW A;  2DC5 A;  4ECB A;  3G7J A;  3UBL A;  3C71 A;  1FW1 A;  5KN3 A;  3V1W A;  1GWC A;  1I9D A;  2J23 A;  2YP6 A;  5KOX A;  4Q5R A;  4NV2 A;  4V2N A;  5DAK B;  2E2G A;  4IS0 A;  4ISD A;  1PL1 A;  2VCW A;  3IK9 A;  1U87 A;  1O8X A;  3HJP A;  2VCV A;  3F9U A;  3EWL A;  4IP1 A;  2LTK A;  3QMX A;  2H1G A;  2CT6 A;  1T7P B;  2CAQ A;  1J08 A;  3VFI A;  1XXU A;  3L0H A;  1K3O A;  1HNC A;  4MJB A;  1XWA A;  1H75 A;  3D21 A;  2HRN A;  5ECP B;  4RI6 A;  3NZN A;  5JCG A;  2R0C A;  2YN1 A;  1AUC A;  2HSM A;  3CTF A;  5D73 A;  1WJK A;  4KB3 A;  3KIJ A;  2JSY A;  1IYI A;  2B5Y A;  3I69 A;  1BYE A;  4XHM A;  2X99 A;  2TRX A;  3RDW A;  3BJ5 A;  4G0I A;  4JR6 A;  4D73 A;  4ZBA A;  3LSZ A;  5ECN B;  1SEN A;  1SJI A;  3EUR A;  2FHE A;  3LYP A;  2LKU A;  2P31 A;  3RPP A;  4BWQ A;  1T4Z A;  1AQV A;  4IGJ A;  3TOT A;  3AY8 A;  5GAP D;  1UA5 A;  4MZC A;  5BRT A;  2GZY A;  2QGV A;  1FAA A;  1ML6 A;  2M72 A;  6GSV A;  1FVK A;  2GQL A;  2IPA A;  4KGI A;  2CVK A;  5KN1 A;  3O76 A;  1RQM A;  4AJ7 A;  1HNB A;  1VRS D;  4K2X A;  3QAV A;  3TKS E;  2DSA A;  4OD7 A;  2H01 A;  5GZZ B;  1X0R A;  2VL3 A;  3DD3 A;  3M0F A;  4V1A p;  3FRC A;  4RQX A;  4WBR D;  1FG4 A;  6GSS A;  3HZ8 A;  3MAK A;  3TRP A;  1U6T A;  3UAP A;  4WKW A;  2N5A A;  5CRH A;  4TKY A;  4KAE A;  2IMD A;  3PH9 A;  3LEF A;  3F4S A;  4TR3 A;  5F06 A;  1ZZY A;  4EO3 A;  3DVX A;  1FB6 A;  3ZIV A;  2AB6 A;  1WP0 A;  3IDV A;  4MF5 A;  5IO0 A;  5IMZ A;  1QUW A;  5KOW A;  1BED A;  1ZL9 A;  1K0C A;  3EYT A;  3TJK A;  1BX9 A;  5G31 A;  5IPG A;  5IMA A;  9GSS A;  4KDX A;  2X64 A;  4L5L A;  1HYU A;  4ZIJ A;  2DJ1 A;  4N11 A;  5BMU A;  2AYT A;  4CDO A;  1GUH A;  2D2Z A;  5ELG A;  5H5S A;  4OFT A;  2R4V A;  5D8I A;  4L5O A;  2VIM A;  1G0T A;  3VUR A;  5B6M A;  1UN2 A;  2G0F A;  5DCH A;  2P5R A;  2H0H A;  1V2A A;  1FB0 A;  3RHB A;  4MJA A;  1YKC A;  4XTS A;  3EE2 A;  3D5J A;  4GLT A;  2L6D A;  3KH7 A;  2H66 A;  4HDE A;  4PUR A;  1MDK A;  1XVQ A;  2DBC A;  3VWU A;  5A4W A;  4GF0 A;  5GAN D;  2VCX A;  1AQW A;  3FW2 A;  1OC9 A;  2H71 A;  5H5Q A;  4HU7 A;  2I9H A;  3WYW A;  4ZBD A;  5DVB A;  4PX1 A;  2LEG A;  4PNG A;  2A2P A;  4I2U A;  1YF1 A;  4XS6 A;  3TKS C;  1XOB A;  2CZ3 A;  1XZO A;  1UVZ A;  1FOV A;  4FO5 A;  1EWX A;  3QOU A;  3WGX A;  4GST A;  4G19 A;  1GTA A;  1USB A;  1MD3 A;  1VGL A;  4F82 A;  3P7X A;  4ECJ A;  5CRD A;  3LYK A;  3ZVJ D;  1ON4 A;  2YZU A;  4EL1 A;  2YNX A;  3LOR A;  2DJ2 A;  3F4T A;  2HXK A;  3R2Q A;  1K0D A;  5B8A A;  1YQ1 A;  3GMF A;  4KDU A;  3KMN A;  3QR6 A;  4AGS A;  3TGZ A;  2FD3 A;  1XWG A;  2XPD A;  1VF2 A;  4TRX A;  5J41 A;  5ELA A;  4NAX A;  4FIW A;  3J7Y k;  1X9W B;  2GQM A;  3LGC A;  4PXO A;  2RM5 A;  17GS A;  1I5G A;  1T3B A;  3GIX A;  3FZ9 A;  1S3C A;  19GS A;  1X9M B;  1TRS A;  2JZR A;  4ZB6 A;  3DXB A;  1EOH A;  5DQY A;  1A2J A;  2PVQ A;  4IQA A;  5EPF A;  1Y6E A;  1K0N A;  4XS4 A;  3Q6O A;  4WET A;  1XIY A;  1VF1 A;  4AJ6 A;  4DSQ A;  3L78 A;  3TJB A;  4LL4 B;  2H30 A;  4HQS A;  4TR1 B;  4BVX B;  4IJ3 A;  5D9W A;  3CSH A;  1Q4J A;  5L71 A;  4JU5 A;  4Z2T A;  1YKA A;  4Q5F A;  1O73 A;  3HDC A;  3EU3 A;  5DAL A;  5CP1 A;  3EMX A;  5DQS A;  5D9T A;  2HRA A;  2CVB A;  1GSD A;  2R37 A;  3ZMK A;  1M7T A;  1O6J A;  2TIR A;  3WT1 A;  4ID0 A;  3NOF A;  4WF4 A;  4XCS A;  4EIP A;  3UOM A;  4ZL9 A;  2C3T A;  4H86 A;  2GSQ A;  3MSZ A;  4J2F A;  3ZML A;  5IMV A;  1ERU A;  3A2X A;  2I1U A;  4G9H A;  4O5Q A;  4J57 E;  2XC2 A;  1T1V A;  2L5O A;  1TXX A;  2PER A;  3RPN A;  2VD1 A;  2X8G A;  3MYD A;  4EE0 A;  3CTG A;  1V58 A;  2X49 A;  1W4V A;  2IJY A;  3Q19 A;  1RK4 A;  2MMA A;  2OE1 A;  7GSS A;  4PTS A;  1HD2 A;  4PGT A;  3GX8 A;  5E59 A;  3KCM A;  4EUY A;  3M8N A;  2I4A A;  2LQO A;  4F2I A;  1EZK A;  2DKI A;  4GCI A;  4NV5 A;  3IV4 A;  3RBT A;  3IRA A;  2OE0 A;  2H0I A;  3QCP A;  4MK3 A;  1YZX A;  1RW1 A;  2DIY A;  4OFM A;  1TJD A;  3WT2 A;  4ILF A;  2CVD A;  4JRR A;  4ZL7 A;  2HZE B;  1CQH A;  2DMM A;  3NIV A;  3ZZX A;  2JL4 A;  4IJI A;  5JCU A;  2KUC A;  4HU9 A;  2WB9 A;  2OJL A;  1O81 A;  2IMF A;  4YKG A;  1GTI A;  2IMK A;  4X0X A;  2L57 A;  3A2W A;  1Y25 A;  5EL8 A;  3P90 A;  3TKQ A;  1SD9 A;  1HNA A;  5HR1 A;  4GSS A;  5J5N A;  2PMT A;  2QA2 A;  4N10 A;  1SYR A;  4JBB A;  2V32 A;  2RII A;  5IO2 A;  1TKD B;  4CY6 A;  4NPB A;  4QL9 A;  3N9J A;  2PN8 A;  4Q5Q A;  2GDR A;  1QK8 A;  3ZFL A;  3TCO A;  5HQP A;  3O6T A;  5FT3 A;  2GT5 A;  2VUP A;  3DWV A;  2DML A;  1PMT A;  2QKE A;  3IC8 A;  3FZ5 A;  2VD0 A;  1ZYE A;  1N8J A;  4L8E A;  2X8H A;  1G6W A;  2ON7 A;  2B1L A;  2F51 A;  2RLI A;  1K0M A;  5JWR B;  3KP9 A;  2V41 A;  5FWG A;  5H5R A;  1KTE A;  4MPF A;  3FZ4 A;  4LL1 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...