2NVLA

Crystal structure of archaeal peroxiredoxin, thioredoxin peroxidase from aeropyrum pernix k1 (sulfonic acid form)
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
242
structure length
241
Chain Sequence
SIPLIGERFPEMEVTTDHGVIKLPDHYVSQGKWFVLFSHPADFTPVTTEFVSFARRYEDFQRLGVDLIGLSVDSVFSHIKWKEWIERHIGVRIPFPIIADPQGTVARRLGLLHAESATHTVRGVFIVDARGVIRTMLYYPMELGRLVDEILRIVKALKLGDSLKRAVPADWPNNEIIGEGLIVPPPTTEDQARARMESGQYRSLDWWFCWDTPASRDDVEEARRYLRRAAEKPAKLLYEEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable peroxiredoxin
publication title Oxidation of archaeal peroxiredoxin involves a hypervalent sulfur intermediate
pubmed doi rcsb
source organism Aeropyrum pernix
molecule tags Oxidoreductase
total genus 76
structure length 241
sequence length 242
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2006-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
A PF10417 1-cysPrx_C C-terminal domain of 1-Cys peroxiredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1020.20 Alpha Beta 2-Layer Sandwich Antioxidant, Horf6; Chain A, domain 2 Antioxidant, Horf6; Chain A, domain 2 2nvlA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2nvlA01
2IIYA 1PX7A 4XS4B 2B3SA 2ON7A 4V2NA 3H93A 1M7TA 2D2ZA 2CT6A 4CDOA 1ERWA 4F9ZA 3GSSA 3IOSA 3UBLA 1VF3A 4I5QA 1V9WA 2WFCA 2N5BA 5HFGA 4HQZA 3WT1A 2EIQA 4ZBDA 5D9WA 2AJQB 1K0MA 4I8BA 5ECHB 4X0XA 3NOFA 2L6DA 3MDKA 4KCAA 4J56E 5CRDA 2OADA 16GSA 2LJRA 1NHOA 4NXIA 5KN2A 4MA9A 2FLSA 3A2XA 2WJUA 2G0FA 1M2BA 3FEUA 1W4VA 2JZRA 4POBA 1SKSB 4AJ8A 3E0UA 3JCML 2GTUA 2CVDA 3MNGA 2H6YA 2YZHA 4MZBA 4RI6A 1AXDA 4LLRA 3GKNA 3M9JA 3KP8A 2J9HA 3TRXA 3ED3A 5CNWA 5IMFA 2M72A 2XPEA 2FA8A 5EY6A 5INYA 1RK4A 2C80A 3KMNA 5DALA 1T7PB 2ES7A 5KN0A 1LBKA 3HKRA 1O81A 2B5XA 1XWAA 1AW9A 1ILOA 3P8WA 3L0HA 4HU7A 1AUCA 4QL7A 5IO0A 1SJIA 1XPVA 2BMXA 3UARA 4CW9A 3N9JA 4I2UA 2P5QA 4I6XA 1EEJA 3NZNA 3VLNA 4MP4A 3TOUA 3W6GA 3GKMA 4MLYA 1PL2A 4IQAA 1X5CA 2HE3A 17GSA 1SD9A 3HCZA 3L9VA 4FYUA 2KOKA 5F05A 1MDKA 3CBUA 3UBKA 4WR4A 2FGXA 3C73A 2PUKC 2QC7A 1SJZA 3IC4A 5H5RA 1TRVA 2YWOA 5DJMA 4TKYA 1OC9A 2MBTA 3FZAA 5J9BA 1Q4JA 1XVWA 4F82A 2C3QA 1EOHA 1MD4A 2JZSA 2C8UA 3TJJA 2HNLA 4JRRA 4IHUA 4MF6A 4FO5A 4MCUA 4ZXGA 1GUMA 5DDLA 4GSSA 2FCHA 4O92A 4X43A 4L8EA 3F9UA 3C71A 1XOAA 1G7OA 4H86A 5D9VA 2DBCA 2VLUA 4GQFA 1GP1A 5JCWA 4K6XA 2L6CA 3O3TA 3RPPA 3ZZXA 2VOCA 5G31A 3C8EA 1Q98A 2JZTA 3FR9A 3DXBA 4ZILA 4PNGA 3M8NA 3BJ5A 3VI5A 4LMWA 3DD3A 2DLXA 4MPFA 4KE3A 3IDVA 3W8SA 2VCXA 1OYJA 4OMVA 3FHKA 3RPNA 3FZ5A 3GFKA 4OFTA 4MZCA 3CSHA 5C00A 1Z5YE 2KUCA 4NHZA 4WBRD 2FHEA 4AF2A 2CX3A 4D73B 3HXSA 1TJDA 4EL1A 5EVOA 1URMA 2WCIA 3DIEA 1W89A 5FHIA 1H75A 4GLTA 2L5LA 4KA0A 1G0TA 1JZDA 2DJ3A 2H75A 3EWLA 2MMOA 1E6BA 1FW1A 1GH2A 2H1AA 1GSFA 3GNJA 3HZ8A 5KEJA 1FVKA 5FWGA 1OKDA 2ALBA 3HA9A 4TR0A 4K8MA 4MMMA 4YQMA 5CREA 3GHAA 2C3NA 1B9XC 1Z9HA 1O85A 2H1DA 5ECIB 5B6MA 5EPFA 3ZVJA 2H01A 5D9XA 3UVHA 3M3MA 2DIYA 5B6NA 3G7YA 4JE1A 4PUAA 1TK0B 1B48A 1BX9A 2H30A 1TI1A 3L78A 5E59A 4PNFA 5ELGA 3TRPA 1YJ6A 2IMFA 1GNEA 3ERFA 3CYNA 3RBTA 2WZ9A 2KP1A 5JWOB 1FB0A 2TIRA 2H1GA 3IV4A 3ZVJD 4POMA 3HHVA 4O5RA 3ZMKA 4ZBBA 5KN3A 5B8BA 3SBCA 1PGTA 4WBJA 5ELAA 5DQYA 5KN1A 1TOFA 2VO4A 5ECQB 1MDIA 1TXXA 1Z7PA 1TRWA 3HZ4A 3AY8A 1H4OA 1KNGA 3HJPA 1T3BA 3EC3A 2AAWA 1A8YA 4NV5A 5DCGA 2F51A 3D5JA 4MJBA 4OFNA 2DIZA 3ZIVA 1ZYQB 4TN8A 5GSSA 1ERVA 2HSHA 2CAIA 4GSNA 5L71A 1GTUA 2AUVA 4TVEA 5ECOB 2RUFA 2H0GA 1UC7A 4EXJA 3CMIA 2IPAA 1HNBA 5DALB 5J5NA 2JACA 2FWGA 3D21A 3IBHA 2DJ2A 4JR6A 4EC0A 1G6YA 4AJ6A 5IIZA 3LQ7A 3P90A 11GSA 5HR2A 4HDEA 1YKAA 1OKTA 4TXOA 1YF1A 1R26A 3F3QA 1A0FA 1KBNA 5E4WA 5AIXA 1ZL9A 3US3A 3RAZA 3LGCA 4IP1A 3R2QA 2XHFA 2B5YA 1O6JA 4JEDA 2NBSA 1S3AA 2O87A 4MJAA 3LSZA 4FYBA 4E8EA 2EIRA 1N2AA 1JLWA 1WJKA 3GX0A 1EP8A 1Z6MA 1A23A 2L59A 1XWBA 1YY7A 2GZPA 2K8VA 3HYPA 3D4MA 1T4ZA 2ZNMA 1ZYEA 2JSYA 1X0RA 1OC9B 2NVLA 2F9SA 2GLRA 1IYIA 1V58A 3TCOA 5D8IA 2O7KA 3CTFA 4HJMA 3UL3A 5AGYA 1HQOA 3J7Yk 1BJXA 1TI3A 4KNDA 2B1KA 4IVFA 4BVXA 1CQHA 1I9DA 1AQWA 1A24A 3DVWA 1DUGA 1GNWA 2OE3A 3LXZA 1QQ2A 2C4JA 4DSRA 2C1YA 4I2TA 4IJ3A 3H8QA 1OAZA 3IAS2 1WE0A 3IHQA 3FY7A 4V1Ag 3VWVA 3QD9A 1NM3A 1U3IA 2J23A 1UN2A 3APOA 4GSTA 1GRXA 1R5PA 4KDUA 1T8EB 4OWYA 1J08A 2LQOA 1BAYA 1XWGA 1MTCA 5CRHA 2YWNA 4ECCA 3TDGA 2O89A 2VIMA 1PMTA 2C0EA 1TW9A 3GA4A 3I9V2 3KCMA 2KHPA 3LJRA 4TR1A 1XZOA 4J2FA 4RQRA 5F07A 1XCCA 3UMAA 2OBKA 3GV1A 1GUKA 4EKZA 2VL3A 2HZFA 1U88A 2GVPA 2N5FA 2YOIA 1PKZA 4MPGA 2OACA 1ZZYA 3FYGA 3GKXA 2GQLA 2VCWA 2GSTA 4KSOA 3M1GA 3GKKA 4KH7A 1FOVA 3KTLA 5DJLA 4PQ1A 4GXZA 4WETA 5ABRA 3IA1A 2PU9C 5AISA 2I9HA 3VI7A 4ZIJA 1HNAA 2GQKA 4Z7XA 1T00A 3OR5A 4O7HA 1XIYA 3FRCA 2YWMA 1XWKA 3A5WA 3FKFA 1AAZA 4ZL7A 4YQVA 1A2JA 2QGVA 4K0NA 1XW6A 1SK2A 2VCZA 5IMZA 1YZXA 1Z6NA 3I69A 4POKA 1YQ1A 1MD3A 1OVNA 3VWWA 1WRYA 5IPHA 4K1FA 3TKSE 6GSSA 3C1SA 3QAWA 2B7JA 5GAND 1TDIA 3O76A 3MWHA 4NHWA 2FUG2 3TOTA 2M46A 2IMDA 3QFBC 3UAPA 1SKWB 3KTBA 1RW1A 5ECNB 1A2MA 2PBJA 2IL3A 1SL0B 3UJ1A 1F3BA 1B4PA 3ME8A 3GURA 2XBIA 3MSZA 3RHBA 4ECBA 1M2DA 4TRXA 5IMAA 1WP0A 2LV3A 3RDWA 1XXUA 4ECIA 3ERWA 3A2WA 5IM9A 3QMXA 4TOPA 4QQ7A 2F8FA 2GSQA 3HY2A 3KZQA 3KJYA 2H1BA 2K8SA 4HZ2A 2B6MA 1THXA 3I6AA 3U6VA 4FIWA 3ISOA 2NPBA 4HJ2A 4IW9A 4ACSA 2F8AA 4DSSB 4XRAA 2OBIA 1YKCA 5H5QA 1GSSA 1LJRA 2HYXA 3P7XA 4MABA 5CRGA 1B4QA 4OO4A 3LXTA 1F9MA 3EYTA 3QOUA 2FWFA 3HD5A 3VFIA 4ID0A 2P0GA 3VPQA 2IWTA 2HSYA 5DAKA 4ILFA 1EOGA 3ZYWA 2HZEA 1F6MC 1JHBA 5F06A 5DVBA 4IBPA 5CYYA 4TW5A 2C0FA 4N11A 4TXOB 2FWEA 1E2YA 1JZRA 4Q5NA 3PH9A 4G19A 2FWHA 2YV7A 1X9MB 2L4CA 1BG5A 3FK8A 2VD1A 5J3RA 1THOA 4XCSA 1M9BA 2CQ9A 4QL9A 2RM5A 2OJLA 4YH2A 3EU4A 4FYCA 4MF7A 2LEGA 14GSA 3CRUA 1WMJA 2PVQA 1WPIA 3EMXA 3F63A 4TXVA 2ZCTA 3KXOA 2PMTA 2KP2A 2WULA 1B8XA 4OO5A 2H71A 1F2EA 5H5SA 4V1Ap 1R4WA 4POLA 2JU5A 2E2MA 5CO3A 1TP9A 2LRTA 3GN3A 1ABAA 4FH8A 3QPMA 1SYRA 4N0VA 1DE2A 3GH6A 3HVXA 5G5FA 1X9WB 2A4VA 2B1LA 1FVJA 2H0IA 1EGOA 4G2EA 2H6XA 4Q5FA 5CP1A 3IK7A 1FAAA 2DMMA 4JU5A 4BPYA 3GRXA 4XRDA 1K3YA 3IR4A 1OC8A 3C7MA 3NIVA 4HOJA 4DVCA 4IJIA 3QR6A 2E2GA 4TR1B 3IK9A 3I43A 2K18A 3D4TA 4V2LA 2YJHA 2YPMA 4XHMA 2RM6A 3P2AA 2LS5A 2VCQA 2LRCA 4EF0A 4KDYA 2BJXA 6GSUA 3C1RA 3PINA 3D22A 4N30A 1JZWA 5G1LA 1USBA 4ISDA 4MJCA 2KLXA 1G6WA 1N8JA 2MMAA 1A2LA 1R5AA 2YZUA 2VUPA 3ZL5A 3UIWA 1UVZA 2VL9A 4IQ1A 2YN1A 3J7Yb 1ACVA 4ML1A 5A4UA 4PGTA 4EVMA 3O6TA 1LU4A 2GT6A 4PX1A 2YANA 2LSTA 1K0NA 3F6DA 1FHEA 1GTAA 2DC5A 4KSMA 2V41A 4NV2A 4DSSA 1ZGNA 18GSA 4NPBA 2H74A 1O8WA 5LD0A 3DVXA 2K9FA 5IPGA 1XFLA 1QXHA 5DCHA 2XC2A 3G9BA 4F2IA 5IQYA 1HNCA 1TRUA 3N5OA 2OKAA 4WF5A 1YF0A 3QCPA 1NW2A 1EZKA 1F3AA 2R6KA 1GSEA 3BCKA 3BOAA 3L4NA 1V2AA 3M9KA 4ULXA 2C0DA 5LCZA 4ZB9A 4GCIA 3SWLA 1PA3A 3IPZA 3WGXA 2CV4A 2FA4A 4JR4A 4LA1A 4XTSA 3CTGA 3BCIA 4EUYA 4N10A 3TJKA 1K0CA 3EE2A 4XIHA 5A4WA 1EP7A 5IMVA 2GS3A 1FG4A 2ZUPA 3F8UA 2H70A 1M0UA 4L5LA 3GMFA 2I1UA 3VPTA 1T4YA 1YEXA 10GSA 4X1UA 4GRFA 1SU9A 4RUVA 2HFDA 3GL5A 4ZB8A 2GQMA 2H8LA 3Q6OA 2GGTA 2Z9SA 2QKEA 1SK0A 1MDJA 2F3MA 5ID2A 1VF1A 3TKRA 4N0ZA 1K3LA 5DAKB 3IE3A 3FZ4A 3CRTA 4OD7A 4KDXA 2HI7A 2HZEB 3KP9A 4K2DA 3DRNA 2MYGA 3MAKA 3KMOA 5JWRB 4GF0A 1X9SB 3Q19A 2WDUA 5IOXA 4LL1B 1Z3EA 3APSA 3ZTLA 2CVBA 4WF4A 3CXGA 1BEDA 4EDZA 4PQHA 4V2MA 4HUAA 1SK1A 2LTKA 5C04A 3TGZA 2PWJA 9GSSA 5ECLB 4GWRA 2LNTA 2QSIA 1OE8A 2H0HA 2DJJA 4EDYA 1K0DA 4IELA 2VL2C 4TR4A 2RIIA 1XW9A 1ZCPA 4K9ZA 2H66A 3VK9A 5B7CA 5LNKe 5CAXA 1TRSA 5F0GA 3S9FA 1I5GA 3GH9A 4BWSA 2L5OA 2EIOA 1JLVA 3V1WA 2JSZA 1A0RP 1K0OA 4HZ4A 2R4VA 1S3CA 4NAXA 1OE7A 2IN3A 4MZWA 2V6OA 2TRCP 3FR3A 5HR3A 2R37A 3L9UA 4MH2A 4XS1A 4KX4A 3HJOA 4HEA2 3HJMA 2DSAA 4IS0A 2DJ0A 4MK3A 4HQSA 3WD6A 4ZL8A 4TR3A 1AQXA 2IMEA 1T1VA 1CQGA 2JADA 5JCUA 1Y25A 1GLPA 2M80A 1SKRB 3LYKA 2CA8A 2G2QA 5IO2A 1ZOFA 1DE1A 4J57E 3ZFBA 3E9JB 3EURA 2E0QA 1S3DA 4KGIA 1EGRA 4BA7A 1WIKA 5IOWA 1SL2B 1GUHA 3A2VA 3RHCA 3UVTA 2YWIA 1WWJA 1KTEA 2HRFA 4RI7A 3ME7A 5HFIA 1BYEA 1PRXA 2CAQA 4KCEA 4EE0A 2X99A 1IYHA 2R2JA 1GWCA 4ZB6A 3EU3A 1J9BA 1MEKA 1QGVA 3TJGA 2HT9A 1U87A 2XBQA 3DYRA 3KD0A 2PPTA 4WKWA 2OA7A 1QMVA 4IKHA 3LWAA 1ERUA 3VWXA 1PQNA 1XWCA 4LL4B 3IXRA 2FNOA 3ZIJA 5ECRB 2HRNA 5GZZB 3WYWA 1ON4A 3M0FA 1UA5A 3GX8A 3G7JA 3TUEA 5B8AA 1EEMA 5HFKA 2ON5A 3DKSA 1ZMAA 3K8NA 3HDCA 1SENA 2FY6A 2RUEA 2VLVA 5JWQB 4P3YB 4F0CA 3TKSC 2VL2A 1NSWA 2H72A 1J0FA 3VURA 2V6KA 1TK8B 2LJKA 2GT5A 1GTBA 2PGTA 2DMLA 1TU7A 1FB6A 2I3YA 4Q5QA 4PUFC 3GUSA 3TB2A 2PN8A 1G7EA 1U6TA 1ML6A 1SJ6A 3KIJA 2YV9A 3KM6A 1TK5B 4K7NA 2A2RA 4BVYA 2LNSA 3CSJA 2P31A 4HU9A 1K0AA 8GSSA 4F0BA 3ZLPA 2H76A 3WGEA 1PKWA 4LMVA 3H79A 2VCVA 1JZOA 1M99A 2IFQA 2LRNA 2MZCA 6GSYA 2I4AA 13GSA 2EC4A 2NTOA 4NMUA 5IMDA 5D9TA 4WXTA 1WOUA 2VLTA 1SL1B 4PQIA 2HXKA 2YP6A 5AIVA 2L4QA 19GSA 1HYUA 5ENUA 20GSA 4ZL9A 1GULA 2CZ3A 1DSBA 2I81A 5G5EA 3FR6A 1V40A 3A3TA 4MJEA 2AB6A 3GTUA 1XBSA 2GDRA 1M2AA 5ID2B 3PGTA 3KEBA 1TU8A 5F8BA 2VM2A 1BQ7A 6GSTA 5HQPA 4XS4A 2AHEA 6GSXA 3IAM2 1GSYA 2C0GA 3HVVA 1PX6A 1YDKA 2H6ZA 1AQVA 5ECKB 5D96A 3D6IA 5GAPD 5COHA 1B9YC 4ECJA 3FZ9A 2AYTA 1O7UA 4CHSA 3F4TA 5D93A 4KAEA 2YJ7A 4OFMA 2DJ1A 3DEXA 3TRQA 1OC3A 1EV9A 2WB9A 4PURA 4F03A 3F4SA 3ZREA 4G9HA 5DQSA 2H19A 2VM1A 3PR8A 2NDOA 2FD3A 3ERGA 3TKQA 2E7PA 2TRXA 3BBYA 1GSDA 3TJFA 4EO3A 1FO5A 3QAGA 4YAPA 2P5RA 3TJBA 3LEFA 1X5EA 4MDCA 2LKUA 2N5AA 1XOBA 3VWUA 5ECSA 5J4UA 6GSWA 4BL7A 5A4VA 2MMZA 4E8HA 1V98A 1PD21 5DBQA 3TKSA 3UOMA 2OE0A 4NWYA 3EVIA 3WGDA 3U5RE 3Q74A 1VF4A 2K6VA 3LFLA 3E3EA 4JZQA 5D73A 4JBBA 3ZITA 2VAFA 3GYKA 3H1NA 1TKDB 1GSUA 3GIXA 1TTZA 1SD8A 4WR5A 5G2ZA 1PL1A 3QAVA 3H4KA 1GL8A 4L0UA 2C3TA 1U3AA 5FT3A 4YQUA 2OE1A 2A2SA 1EV4A 3UEMA 1O73A 1ST9A 2JL4A 1K0BA 3FW2A 4DSQA 1VGLA 4K7OA 2PERA 1QK8A 4K7IA 3F3RA 3LORA 2R5GA 3TKPA 2GZYA 2L57A 1QUWA 1K3OA 2LUSA 2WRTA 2V1MA 2REMA 1O8XA 1A8LA 1SYXA 1YEPA 3ZRDA 3DWVA 5CRWA 4BWQA 1ERTA 2VCTA 3G7IA 3W8JA 5G1KA 2CZ2A 7GSSA 2WGRA 1PN9A 1X5DA 2PVOC 4WEYA 1GLQA 5IMCA 2X64A 3IRAA 2R3XA 5HR1A 1HD2A 3WT2A 4YAVA 4L5OA 2YCDA 2X8HA 3F4RA 4ML6A 2VD0A 1C72A 5A5KA 1VRSD 2HLSA 5GSTA 1JFUA 2V2GA 2AV4A 3DGQA 1Z7RA 3EINA 1KEBA 4KB3A 2WS2A 2GZZA 3GL3A 3ZFLA 1R7HA 4KW6A 4HI7A 1V57A 4IN0A 1EWXA 4GTUA 2B5EA 2CX4A 2O8VB 1RQMA 1F37A 1M9AA 5EL8A 4RQXA 4I97A 2H73A 3QDNA 3KGKA 4IGJA 1XVQA 2XPDA 2LJAA 1NHYA 3HVSA 2IMKA 4MF5A 3LYPA 2MMNA 2X8GA 4K0GA 1XW5A 1Y6EA 3KH9A 4OCFA 2X8CA 22GSA 4ZBAA 4AJ7A 1DBYA 3KH7A 1PSQA 12GSA 4O32A 2GSSA 6GSVA 4D73A 5HR0A 3GSTA 3ZMLA 2MBSA 4PXOA 2DJKA 4L0WA 3CSIA 2B7KA 2LQQA 1VF2A 2IFQB 3BD2A 3QFAC 3DMLA 1AIUA 1AC1A 5J9CA 3EMPA 4Q5RA 5JCGA 3F6FA 2GSRA 2YNXA 4KUNA 4DEJA 2BTOT 4OCEA 4MH3A 3F0IA 4HS1A 5ECPB 2RLIA 3Q18A 3L9SA 4AGSA 2V32A 4GQCA 5J41A 5AN1A 2IJYA 2IMIA 1QFNA 4IP6A 2CVKA 3D0ZA 5ECMB 3GTUB 3APQA 4G10A 1GTIA 5G30A 2O85A 3LG6A 1GSQA 4XS6A
chains in the Genus database with same CATH superfamily
2IIYA 1PX7A 4XS4B 2B3SA 2ON7A 4V2NA 3H93A 1M7TA 2D2ZA 2CT6A 4CDOA 1ERWA 4F9ZA 3GSSA 3IOSA 3UBLA 1VF3A 4FQUA 4I5QA 1V9WA 2WFCA 2N5BA 5HFGA 4HQZA 3WT1A 2EIQA 4ZBDA 5D9WA 2AJQB 1K0MA 4I8BA 5ECHB 4X0XA 3NOFA 2L6DA 3MDKA 4KCAA 4J56E 5CRDA 2OADA 16GSA 2LJRA 1NHOA 4NXIA 5KN2A 4MA9A 2FLSA 3A2XA 2WJUA 2G0FA 1M2BA 3FEUA 1W4VA 2JZRA 4POBA 1SKSB 4AJ8A 3E0UA 3JCML 2GTUA 2CVDA 3MNGA 2H6YA 2YZHA 4MZBA 1S3RA 4RI6A 1AXDA 4LLRA 3GKNA 3M9JA 3KP8A 2J9HA 3TRXA 3ED3A 5CNWA 5IMFA 4BL7B 2M72A 2XPEA 2FA8A 5EY6A 5INYA 1RK4A 2C80A 3KMNA 5DALA 1T7PB 2ES7A 5KN0A 1LBKA 3HKRA 1O81A 2B5XA 2A2PA 1XWAA 1AW9A 1ILOA 3P8WA 3L0HA 4HU7A 1AUCA 4QL7A 5IO0A 1SJIA 1XPVA 2BMXA 3UARA 4CW9A 3N9JA 4I2UA 2P5QA 4I6XA 4EIQA 1EEJA 3NZNA 3VLNA 4MP4A 4O5QA 3TOUA 3W6GA 3GKMA 4MLYA 1PL2A 4IQAA 1X5CA 2HE3A 17GSA 1SD9A 3HCZA 3L9VA 4FYUA 2KOKA 5F05A 1MDKA 3CBUA 3UBKA 4WR4A 2FGXA 3C73A 2PUKC 2QC7A 1SJZA 3IC4A 5H5RA 1TRVA 2YWOA 5DJMA 4TKYA 1OC9A 2MBTA 3FZAA 5J9BA 1Q4JA 1XVWA 4F82A 2C3QA 1EOHA 1MD4A 2JZSA 2C8UA 3TJJA 2QA2A 2HNLA 4JRRA 4IHUA 4MF6A 4FO5A 4MCUA 4ZXGA 1GUMA 5DDLA 4GSSA 2FCHA 4O92A 4X43A 4L8EA 3F9UA 3C71A 1XOAA 1G7OA 4H86A 5D9VA 2DBCA 2VLUA 4GQFA 4EIPA 1GP1A 5JCWA 4K6XA 2L6CA 3O3TA 3RPPA 3ZZXA 2VOCA 5G31A 3C8EA 1Q98A 2JZTA 3FR9A 3DXBA 4ZILA 4PNGA 3M8NA 3BJ5A 3VI5A 4LMWA 3A5IA 3DD3A 2DLXA 4MPFA 4KE3A 2QA1A 3IDVA 3W8SA 2VCXA 1OYJA 4OMVA 3FHKA 3RPNA 3FZ5A 3GFKA 4OFTA 4MZCA 3CSHA 5C00A 1Z5YE 2KUCA 4NHZA 4WBRD 2FHEA 4AF2A 2CX3A 4O5UA 4D73B 4Z2UA 3HXSA 1TJDA 4EL1A 1M3IA 5EVOA 1URMA 2WCIA 3DIEA 1W89A 5FHIA 1H75A 4GLTA 2L5LA 2DKIA 4KA0A 2R0GA 1G0TA 1JZDA 2DJ3A 2H75A 3EWLA 2MMOA 1E6BA 1FW1A 1GH2A 2H1AA 1GSFA 1PFOA 3GNJA 3HZ8A 3FMWA 5KEJA 1FVKA 5FWGA 1OKDA 2ALBA 3HA9A 4TR0A 4K8MA 4MMMA 4YQMA 5CREA 3GHAA 2C3NA 1B9XC 1Z9HA 1O85A 2H1DA 5B6MA 5ECIB 5EPFA 3ZVJA 2H01A 5D9XA 3UVHA 3M3MA 2DIYA 5B6NA 3G7YA 4JE1A 4PUAA 1TK0B 1B48A 1BX9A 2H30A 1TI1A 3L78A 5E59A 4PNFA 5ELGA 3TRPA 1YJ6A 2IMFA 1GNEA 3ERFA 3CYNA 3RBTA 2WZ9A 2KP1A 5JWOB 1FB0A 2TIRA 2H1GA 3IV4A 3ZVJD 4POMA 3HHVA 4O5RA 3ZMKA 4ZBBA 5KN3A 5B8BA 3SBCA 1PGTA 4WBJA 5ELAA 5DQYA 5KN1A 1TOFA 2VO4A 5ECQB 1MDIA 1TXXA 1Z7PA 1TRWA 3HZ4A 3AY8A 1H4OA 1KNGA 3HJPA 1T3BA 3EC3A 4YKFA 2AAWA 1A8YA 4NV5A 5DCGA 2F51A 3D5JA 4MJBA 4OFNA 2DIZA 3ZIVA 1ZYQB 4TN8A 5GSSA 1ERVA 2HSHA 2CAIA 4GSNA 5L71A 1GTUA 2AUVA 4TVEA 5ECOB 2RUFA 2H0GA 1UC7A 4EXJA 3CMIA 2IPAA 1HNBA 5DALB 5J5NA 3IHGA 2JACA 2FWGA 3D21A 3IBHA 2DJ2A 4JR6A 4EC0A 1G6YA 4AJ6A 5IIZA 3LQ7A 3P90A 11GSA 5HR2A 4HDEA 1YKAA 1OKTA 4TXOA 1YF1A 1R26A 3F3QA 1A0FA 1KBNA 5E4WA 5AIXA 1ZL9A 3US3A 3RAZA 3LGCA 4IP1A 3R2QA 2XHFA 2B5YA 1O6JA 4JEDA 2NBSA 1S3AA 2O87A 4MJAA 3LSZA 4FYBA 4E8EA 2EIRA 1N2AA 1JLWA 1WJKA 3GX0A 1EP8A 1Z6MA 1A23A 2L59A 1XWBA 1YY7A 2GZPA 2K8VA 3HYPA 3D4MA 1T4ZA 2ZNMA 1ZYEA 2JSYA 1X0RA 1OC9B 4K2XA 2NVLA 2F9SA 2GLRA 1IYIA 1V58A 3TCOA 5D8IA 2O7KA 3CTFA 4HJMA 3UL3A 5AGYA 1HQOA 3J7Yk 1BJXA 1TI3A 4KNDA 2B1KA 4IVFA 4BVXA 1CQHA 1I9DA 1AQWA 1A24A 3DVWA 1DUGA 4K5SA 1GNWA 2OE3A 3LXZA 1QQ2A 2C4JA 4DSRA 2C1YA 4I2TA 4IJ3A 3H8QA 1OAZA 3IAS2 4CY6A 1WE0A 3IHQA 3FY7A 4V1Ag 3VWVA 3QD9A 1NM3A 1U3IA 2J23A 1UN2A 3APOA 4GSTA 1GRXA 1R5PA 4KDUA 1T8EB 4OWYA 1J08A 2LQOA 1BAYA 1XWGA 1MTCA 5CRHA 2YWNA 4ECCA 3TDGA 2O89A 2VIMA 1PMTA 2C0EA 4K5RA 1TW9A 3GA4A 3I9V2 3KCMA 2KHPA 3LJRA 4TR1A 1XZOA 4J2FA 4RQRA 5F07A 1XCCA 3UMAA 1ZYPA 2OBKA 3GV1A 1GUKA 2R0PA 4EKZA 2VL3A 2HZFA 1U88A 2GVPA 2N5FA 2YOIA 1PKZA 4MPGA 2OACA 1ZZYA 3FYGA 3GKXA 2GQLA 2VCWA 2GSTA 4KSOA 3M1GA 3GKKA 4KH7A 1FOVA 3KTLA 5DJLA 4PQ1A 4GXZA 4MNNA 4WETA 5ABRA 3IA1A 2PU9C 5AISA 2I9HA 3VI7A 4ZIJA 1HNAA 2GQKA 4G0IA 4Z7XA 1T00A 3OR5A 4O7HA 4KF9A 1XIYA 3FRCA 2YWMA 1XWKA 3A5WA 3FKFA 1M3JA 1AAZA 4ZL7A 4YQVA 1A2JA 2QGVA 4K0NA 1XW6A 1SK2A 2VCZA 5IMZA 1YZXA 1Z6NA 3I69A 4POKA 1YQ1A 1MD3A 1OVNA 3VWWA 1WRYA 5IPHA 3EPTA 4K1FA 3TKSE 6GSSA 3C1SA 3QAWA 2B7JA 5GAND 1TDIA 3O76A 3MWHA 4NHWA 2FUG2 3TOTA 2M46A 2IMDA 3QFBC 3UAPA 1SKWB 3KTBA 1RW1A 5ECNB 1A2MA 2PBJA 2IL3A 1SL0B 3UJ1A 1F3BA 1B4PA 4PTSA 3ME8A 3GURA 2XBIA 3MSZA 3RHBA 4ECBA 1M2DA 4TRXA 5IMAA 1WP0A 2LV3A 2HSMA 3RDWA 1XXUA 4ECIA 3ERWA 3A2WA 5IM9A 3QMXA 4TOPA 4QQ7A 2F8FA 2GSQA 3HY2A 3KZQA 3KJYA 2H1BA 2K8SA 4HZ2A 2B6MA 1THXA 3I6AA 3U6VA 4FIWA 3ISOA 2NPBA 4HJ2A 4IW9A 4ACSA 2F8AA 4DSSB 4XRAA 2OBIA 1YKCA 5H5QA 1GSSA 5KOWA 1LJRA 2HYXA 3P7XA 4MABA 5CRGA 1B4QA 4OO4A 3LXTA 1F9MA 3EYTA 3QOUA 2FWFA 3HD5A 3VFIA 4ID0A 2P0GA 3VPQA 2IWTA 2HSYA 5DAKA 4ILFA 1EOGA 3ZYWA 2HZEA 4A5PA 1F6MC 1JHBA 5DVBA 5F06A 4IBPA 4TW5A 5CYYA 2C0FA 4N11A 4TXOB 2FWEA 1E2YA 1JZRA 4Q5NA 3PH9A 4G19A 2FWHA 3CQFA 2YV7A 1X9MB 2L4CA 1BG5A 3FK8A 2VD1A 5J3RA 1THOA 4XCSA 1M9BA 2CQ9A 4QL9A 4G0LA 4USSA 2RM5A 2OJLA 4YH2A 3EU4A 4FYCA 4Z2RA 4MF7A 2LEGA 14GSA 3CRUA 1WMJA 2PVQA 1WPIA 3EMXA 3F63A 4TXVA 2ZCTA 3KXOA 2PMTA 2KP2A 2WULA 1B8XA 4OO5A 2H71A 1F2EA 5H5SA 4V1Ap 1R4WA 4POLA 4BVXB 2JU5A 2E2MA 5CO3A 1TP9A 2LRTA 3GN3A 1ABAA 4FH8A 3QPMA 1SYRA 4N0VA 1DE2A 3GH6A 3HVXA 5G5FA 1X9WB 2A4VA 2B1LA 1ZYNA 1FVJA 2H0IA 1EGOA 4G2EA 2H6XA 4Q5FA 5CP1A 3IK7A 3IC8A 1FAAA 2DMMA 4JU5A 4BPYA 3GRXA 4XRDA 1K3YA 3IR4A 1OC8A 3C7MA 3NIVA 4HOJA 4DVCA 4IJIA 3QR6A 2E2GA 4TR1B 3IK9A 3I43A 2K18A 3D4TA 4V2LA 2YJHA 2YPMA 4XHMA 2RM6A 3P2AA 2LS5A 2VCQA 1FOHA 2LRCA 4EF0A 4KDYA 2BJXA 6GSUA 3C1RA 3PINA 3D22A 4N30A 1JZWA 5G1LA 1USBA 4ISDA 4MJCA 2KLXA 1G6WA 1N8JA 3R3EA 2MMAA 1A2LA 1R5AA 2YZUA 2VUPA 3ZL5A 3UIWA 1UVZA 2VL9A 4IQ1A 2YN1A 3J7Yb 1ACVA 4ML1A 5A4UA 4PGTA 4EVMA 3O6TA 1LU4A 2GT6A 4PX1A 2YANA 2LSTA 1K0NA 3F6DA 1FHEA 1GTAA 2DC5A 4KSMA 2V41A 4NV2A 4DSSA 1ZGNA 18GSA 4NPBA 2H74A 1O8WA 5LD0A 3DVXA 2K9FA 5IPGA 1XFLA 1QXHA 5DCHA 2XC2A 3G9BA 4F2IA 5IQYA 1HNCA 1TRUA 3N5OA 2OKAA 4WF5A 1YF0A 3QCPA 1NW2A 1EZKA 1F3AA 2R6KA 1GSEA 3BCKA 3BOAA 3L4NA 1V2AA 3M9KA 4ULXA 2C0DA 5LCZA 4ZB9A 4GCIA 3SWLA 1PA3A 3IPZA 3WGXA 4ICYA 2CV4A 2FA4A 4JR4A 4LA1A 4XTSA 3CTGA 3BCIA 4EUYA 4N10A 3TJKA 1K0CA 3EE2A 4XIHA 5A4WA 1EP7A 5IMVA 2GS3A 1FG4A 2ZUPA 3F8UA 2H70A 1M0UA 4L5LA 3GMFA 2I1UA 3VPTA 1T4YA 1YEXA 10GSA 4X1UA 4GRFA 1SU9A 4RUVA 2HFDA 3GL5A 4ZB8A 2GQMA 2H8LA 3Q6OA 2GGTA 2Z9SA 2QKEA 1SK0A 1MDJA 2F3MA 5ID2A 1VF1A 3TKRA 4N0ZA 1K3LA 5DAKB 3IE3A 3FZ4A 3CRTA 4OD7A 4KDXA 2HI7A 2HZEB 3KP9A 4K2DA 3DRNA 2MYGA 3MAKA 3KMOA 5JWRB 4GF0A 1X9SB 3Q19A 2WDUA 5IOXA 4LL1B 1Z3EA 3APSA 3ZTLA 2CVBA 4WF4A 3CXGA 1BEDA 4EDZA 4PQHA 4V2MA 4HUAA 1SK1A 2LTKA 5C04A 3TGZA 2PWJA 9GSSA 5ECLB 4GWRA 2LNTA 2QSIA 1OE8A 2H0HA 2DJJA 4EDYA 1K0DA 4IELA 2VL2C 4TR4A 2RIIA 1XW9A 1ZCPA 4K9ZA 2H66A 3VK9A 5B7CA 5LNKe 5CAXA 1TRSA 5F0GA 3S9FA 1I5GA 3GH9A 4BWSA 2L5OA 2EIOA 1JLVA 3V1WA 2JSZA 1A0RP 1K0OA 4HZ4A 2R4VA 1S3CA 4NAXA 1OE7A 2IN3A 4MZWA 3MIXA 2V6OA 2TRCP 3FR3A 5HR3A 2R37A 3L9UA 4MH2A 4XS1A 4KX4A 3HJOA 4HEA2 3HJMA 2DSAA 4IS0A 2DJ0A 4MK3A 4HQSA 3WD6A 4ZL8A 4TR3A 1AQXA 2IMEA 1T1VA 1CQGA 2JADA 5JCUA 1Y25A 1GLPA 2M80A 1SKRB 3LYKA 2CA8A 2G2QA 5IO2A 1ZOFA 2HRAA 4J57E 1DE1A 3ZFBA 3E9JB 3EURA 2E0QA 1S3DA 4KGIA 1EGRA 4BA7A 1WIKA 5IOWA 1SL2B 1GUHA 3A2VA 3RHCA 3UVTA 2YWIA 1WWJA 1KTEA 2HRFA 4RI7A 3ME7A 5HFIA 1BYEA 1PRXA 2CAQA 4KCEA 4EE0A 2X99A 1IYHA 2R2JA 1GWCA 4ZB6A 3EU3A 1J9BA 1MEKA 1QGVA 3TJGA 2HT9A 1U87A 2XBQA 3LW9A 3DYRA 3KD0A 2PPTA 4WKWA 2OA7A 1QMVA 4IKHA 3LWAA 1ERUA 3VWXA 1PQNA 1XWCA 4LL4B 3IXRA 2FNOA 3ZIJA 5ECRB 2HRNA 5GZZB 3WYWA 1ON4A 3M0FA 1UA5A 3GX8A 3G7JA 3TUEA 5B8AA 1EEMA 5HFKA 2ON5A 4HSCX 3DKSA 1ZMAA 3K8NA 3HDCA 1SENA 2FY6A 2RUEA 2VLVA 5JWQB 4P3YB 4F0CA 3TKSC 2VL2A 1NSWA 2H72A 1J0FA 3VURA 2V6KA 1TK8B 2LJKA 2GT5A 1GTBA 2PGTA 2DMLA 1TU7A 1FB6A 2I3YA 4Q5QA 3MYDA 3GUSA 4PUFC 3TB2A 2PN8A 1G7EA 1U6TA 1ML6A 1SJ6A 3KIJA 2YV9A 3KM6A 1TK5B 4K7NA 2A2RA 4BVYA 2LNSA 3CSJA 2P31A 4HU9A 1K0AA 8GSSA 4F0BA 3ZLPA 2H76A 3WGEA 1PKWA 4LMVA 3H79A 2VCVA 1JZOA 1M99A 2IFQA 2LRNA 2MZCA 6GSYA 2I4AA 13GSA 2EC4A 2NTOA 4NMUA 5IMDA 5D9TA 1XG8A 4WXTA 1WOUA 2VLTA 1SL1B 4PQIA 2HXKA 2YP6A 5AIVA 2L4QA 19GSA 1HYUA 5ENUA 20GSA 4ZL9A 1GULA 2CZ3A 1DSBA 2I81A 5G5EA 3HVNA 3FR6A 1V40A 3A3TA 4MJEA 2AB6A 3GTUA 1XBSA 2GDRA 1M2AA 5ID2B 3PGTA 3KEBA 1TU8A 5F8BA 2VM2A 1BQ7A 6GSTA 5HQPA 4XS4A 4BIKA 2AHEA 6GSXA 3IAM2 1GSYA 2C0GA 3HVVA 1PX6A 1YDKA 5KOXA 2H6ZA 1AQVA 5ECKB 5D96A 3D6IA 5GAPD 5COHA 1B9YC 2DKHA 4ECJA 3FZ9A 2AYTA 1O7UA 4CHSA 3F4TA 5D93A 4KAEA 2YJ7A 4OFMA 2DJ1A 3DEXA 2UZ8A 3TRQA 1OC3A 1EV9A 2WB9A 4YKGA 4PURA 4F03A 3F4SA 3ZREA 5BMUA 4G9HA 5DQSA 2H19A 2VM1A 3PR8A 2NDOA 2FD3A 3ERGA 3TKQA 2E7PA 2TRXA 2X4AA 3BBYA 1GSDA 3TJFA 4EO3A 1FO5A 3QAGA 4YAPA 2P5RA 3TJBA 3LEFA 1X5EA 4MDCA 2LKUA 2N5AA 1XOBA 3VWUA 5ECSA 5J4UA 6GSWA 4BL7A 5A4VA 2MMZA 4E8HA 1V98A 1PD21 5DBQA 3TKSA 3UOMA 2OE0A 4NWYA 3EVIA 3WGDA 3U5RE 3Q74A 1VF4A 2K6VA 3LFLA 3E3EA 4JZQA 5D73A 4JBBA 3ZITA 2VAFA 3GYKA 3H1NA 1TKDB 1GSUA 3GIXA 1TTZA 1SD8A 2R0CA 4WR5A 5G2ZA 1PL1A 3QAVA 3H4KA 1GL8A 4L0UA 2C3TA 1U3AA 5FT3A 4YQUA 2OE1A 2A2SA 1EV4A 3UEMA 5BRTA 1O73A 1ST9A 2JL4A 1K0BA 3FW2A 4DSQA 1VGLA 4K7OA 2X49A 2PERA 1QK8A 4K7IA 3F3RA 3LORA 2R5GA 3TKPA 2GZYA 2L57A 1QUWA 1K3OA 2LUSA 2WRTA 2V1MA 2REMA 1O8XA 1A8LA 1SYXA 1YEPA 3ZRDA 3DWVA 5CRWA 4BWQA 1ERTA 2VCTA 3G7IA 3W8JA 5G1KA 2CZ2A 7GSSA 2WGRA 1PN9A 1X5DA 2PVOC 4WEYA 1GLQA 5IMCA 2X64A 3IRAA 2R3XA 5HR1A 1HD2A 3WT2A 4YAVA 4L5OA 2YCDA 2X8HA 3F4RA 4ML6A 2VD0A 1C72A 5A5KA 1VRSD 2HLSA 5GSTA 1JFUA 2V2GA 2AV4A 3DGQA 1Z7RA 3EINA 1KEBA 4KB3A 2WS2A 2GZZA 3GL3A 3ZFLA 1R7HA 4KW6A 4HI7A 1V57A 4IN0A 1EWXA 4GTUA 2B5EA 2CX4A 2O8VB 1RQMA 1F37A 1M9AA 5EL8A 4RQXA 4I97A 2H73A 1PN0A 3QDNA 3KGKA 4IGJA 1XVQA 2XPDA 2LJAA 1NHYA 3HVSA 2IMKA 4MF5A 3LYPA 2MMNA 2X8GA 4K0GA 1XW5A 1Y6EA 3KH9A 3PPUA 4OCFA 2X8CA 22GSA 4ZBAA 4AJ7A 1DBYA 3KH7A 4Z2TA 1PSQA 12GSA 4O32A 2GSSA 4BVYB 6GSVA 2HRKA 4D73A 5HR0A 3GSTA 3ZMLA 2MBSA 4PXOA 2DJKA 4L0WA 3CSIA 2B7KA 2LQQA 1VF2A 2A4HA 2IFQB 3BD2A 3QFAC 3DMLA 1AIUA 1AC1A 5J9CA 3EMPA 4Q5RA 5JCGA 3F6FA 2GSRA 2YNXA 4KUNA 4DEJA 2BTOT 4OCEA 4MH3A 3F0IA 4X4JA 4HS1A 5ECPB 2RLIA 3Q18A 3L9SA 4AGSA 2V32A 4GQCA 5J41A 5AN1A 2IJYA 2IMIA 1QFNA 4IP6A 2CVKA 3D0ZA 5ECMB 3GTUB 3APQA 4G10A 4G0KA 1GTIA 5G30A 2O85A 3LG6A 1GSQA 4CY8A 4XS6A
chains in the Genus database with same CATH topology
2IIYA 1PX7A 4XS4B 2B3SA 2ON7A 4V2NA 3H93A 1M7TA 2D2ZA 2CT6A 4CDOA 1ERWA 4F9ZA 3GSSA 3IOSA 3UBLA 1VF3A 4FQUA 4I5QA 1V9WA 2WFCA 2N5BA 5HFGA 4HQZA 3WT1A 2EIQA 4ZBDA 5D9WA 2AJQB 1K0MA 4I8BA 5ECHB 4X0XA 3NOFA 2L6DA 3MDKA 4KCAA 4J56E 5CRDA 2OADA 16GSA 2LJRA 1NHOA 4NXIA 5KN2A 4MA9A 2FLSA 3A2XA 2WJUA 2G0FA 1M2BA 3FEUA 1W4VA 2JZRA 4POBA 1SKSB 4AJ8A 3E0UA 3JCML 2GTUA 2CVDA 3MNGA 2H6YA 2YZHA 4MZBA 4RI6A 1AXDA 4LLRA 3GKNA 3M9JA 3KP8A 2J9HA 3TRXA 3ED3A 5CNWA 5IMFA 4BL7B 2M72A 2XPEA 2FA8A 5EY6A 5INYA 1RK4A 2C80A 3KMNA 5DALA 1T7PB 2ES7A 5KN0A 1LBKA 3HKRA 1O81A 2B5XA 2A2PA 1XWAA 1AW9A 1ILOA 3P8WA 3L0HA 4HU7A 1AUCA 4QL7A 5IO0A 1SJIA 1XPVA 2BMXA 3UARA 4CW9A 3N9JA 4I2UA 2P5QA 4I6XA 4EIQA 1EEJA 3NZNA 3VLNA 4MP4A 4O5QA 3TOUA 3W6GA 3GKMA 4MLYA 1PL2A 4IQAA 1X5CA 2HE3A 17GSA 1SD9A 3HCZA 3L9VA 4FYUA 2KOKA 5F05A 1MDKA 3CBUA 3UBKA 4WR4A 2FGXA 3C73A 2PUKC 2QC7A 1SJZA 3IC4A 5H5RA 1TRVA 2YWOA 5DJMA 4TKYA 1OC9A 2MBTA 3FZAA 5J9BA 1Q4JA 1XVWA 4F82A 2C3QA 1EOHA 1MD4A 2JZSA 2C8UA 3TJJA 2QA2A 2HNLA 4JRRA 4IHUA 4MF6A 4FO5A 4MCUA 4ZXGA 1GUMA 5DDLA 4GSSA 2FCHA 4O92A 4X43A 4L8EA 3F9UA 3C71A 1XOAA 1G7OA 4H86A 5D9VA 2DBCA 2VLUA 4GQFA 4EIPA 1GP1A 5JCWA 4K6XA 2L6CA 3O3TA 3RPPA 3ZZXA 2VOCA 5G31A 3C8EA 1Q98A 2JZTA 3FR9A 3DXBA 4ZILA 4PNGA 3M8NA 3BJ5A 3VI5A 4LMWA 3A5IA 3DD3A 2DLXA 4MPFA 4KE3A 2QA1A 3IDVA 3W8SA 2VCXA 1OYJA 4OMVA 3FHKA 3RPNA 3FZ5A 3GFKA 4OFTA 4MZCA 3CSHA 5C00A 1Z5YE 2KUCA 4NHZA 4WBRD 2FHEA 4AF2A 2CX3A 4O5UA 4D73B 4Z2UA 3HXSA 1TJDA 4EL1A 5EVOA 1URMA 2WCIA 3DIEA 1W89A 5FHIA 1H75A 4GLTA 2L5LA 2DKIA 4KA0A 2R0GA 1G0TA 1JZDA 2DJ3A 2H75A 3EWLA 2MMOA 1E6BA 1FW1A 1GH2A 2H1AA 1GSFA 3GNJA 3HZ8A 3FMWA 5KEJA 1FVKA 5FWGA 1OKDA 2ALBA 3HA9A 4TR0A 4K8MA 4MMMA 4YQMA 5CREA 3GHAA 2C3NA 1B9XC 1Z9HA 1O85A 2H1DA 5ECIB 5B6MA 5EPFA 3ZVJA 2H01A 5D9XA 3UVHA 3M3MA 2DIYA 5B6NA 3G7YA 4JE1A 4PUAA 1TK0B 1B48A 1BX9A 2H30A 1TI1A 3L78A 5E59A 4PNFA 5ELGA 3TRPA 1YJ6A 2IMFA 1GNEA 3ERFA 3CYNA 3RBTA 2WZ9A 2KP1A 5JWOB 1FB0A 2TIRA 2H1GA 3IV4A 3ZVJD 4POMA 3HHVA 4O5RA 3ZMKA 4ZBBA 5KN3A 5B8BA 3SBCA 1PGTA 4WBJA 5ELAA 5DQYA 5KN1A 1TOFA 2VO4A 5ECQB 1MDIA 1TXXA 1Z7PA 1TRWA 3HZ4A 3AY8A 1H4OA 1KNGA 3HJPA 1T3BA 3EC3A 4YKFA 2AAWA 1A8YA 4NV5A 5DCGA 2F51A 3D5JA 4MJBA 4OFNA 2DIZA 3ZIVA 1ZYQB 4TN8A 5GSSA 1ERVA 2HSHA 2CAIA 4GSNA 5L71A 1GTUA 2AUVA 4TVEA 5ECOB 2RUFA 2H0GA 1UC7A 4EXJA 3CMIA 2IPAA 1HNBA 5DALB 5J5NA 3IHGA 2JACA 2FWGA 3D21A 3IBHA 2DJ2A 4JR6A 4EC0A 1G6YA 4AJ6A 5IIZA 3LQ7A 3P90A 11GSA 5HR2A 4HDEA 1YKAA 1OKTA 4TXOA 1YF1A 1R26A 3F3QA 1A0FA 1KBNA 5E4WA 5AIXA 1ZL9A 3US3A 3RAZA 3LGCA 4IP1A 3R2QA 2XHFA 2B5YA 1O6JA 4JEDA 2NBSA 1S3AA 2O87A 4MJAA 3LSZA 4FYBA 4E8EA 2EIRA 1N2AA 1JLWA 1WJKA 3GX0A 1EP8A 1Z6MA 1A23A 2L59A 1XWBA 1YY7A 2GZPA 2K8VA 3HYPA 3D4MA 1T4ZA 2ZNMA 1ZYEA 2JSYA 1X0RA 1OC9B 4K2XA 2NVLA 2F9SA 2GLRA 1IYIA 1V58A 3TCOA 5D8IA 2O7KA 3CTFA 4HJMA 3UL3A 5AGYA 1HQOA 3J7Yk 1BJXA 1TI3A 4KNDA 2B1KA 4IVFA 4BVXA 1CQHA 1I9DA 1AQWA 1A24A 3DVWA 1DUGA 4K5SA 1GNWA 2OE3A 3LXZA 1QQ2A 2C4JA 4DSRA 2C1YA 4I2TA 4IJ3A 3H8QA 1OAZA 3IAS2 4CY6A 1WE0A 3IHQA 3FY7A 4V1Ag 3VWVA 3QD9A 1NM3A 1U3IA 2J23A 1UN2A 3APOA 4GSTA 1GRXA 1R5PA 4KDUA 1T8EB 4OWYA 1J08A 2LQOA 1BAYA 1XWGA 1MTCA 5CRHA 2YWNA 4ECCA 3TDGA 2O89A 2VIMA 1PMTA 2C0EA 4K5RA 1TW9A 3GA4A 3I9V2 3KCMA 2KHPA 3LJRA 4TR1A 1XZOA 4J2FA 4RQRA 5F07A 1XCCA 3UMAA 1ZYPA 2OBKA 3GV1A 1GUKA 2R0PA 4EKZA 2VL3A 2HZFA 1U88A 2GVPA 2N5FA 2YOIA 1PKZA 4MPGA 2OACA 1ZZYA 3FYGA 3GKXA 2GQLA 2VCWA 2GSTA 4KSOA 3M1GA 3GKKA 4KH7A 1FOVA 3KTLA 5DJLA 4PQ1A 4GXZA 4MNNA 4WETA 5ABRA 3IA1A 2PU9C 5AISA 2I9HA 3VI7A 4ZIJA 1HNAA 2GQKA 4G0IA 4Z7XA 1T00A 3OR5A 4O7HA 4KF9A 1XIYA 3FRCA 2YWMA 1XWKA 3A5WA 3FKFA 1AAZA 4ZL7A 4YQVA 1A2JA 2QGVA 4K0NA 1XW6A 1SK2A 2VCZA 5IMZA 1YZXA 1Z6NA 3I69A 4POKA 1YQ1A 1MD3A 1OVNA 3VWWA 1WRYA 5IPHA 3EPTA 4K1FA 3TKSE 6GSSA 3C1SA 3QAWA 2B7JA 5GAND 1TDIA 3O76A 3MWHA 4NHWA 2FUG2 3TOTA 2M46A 2IMDA 3QFBC 3UAPA 1SKWB 3KTBA 1RW1A 5ECNB 1A2MA 2PBJA 2IL3A 1SL0B 3UJ1A 1F3BA 1B4PA 4PTSA 3ME8A 3GURA 2XBIA 3MSZA 3RHBA 4ECBA 1M2DA 4TRXA 5IMAA 1WP0A 2LV3A 2HSMA 3RDWA 1XXUA 4ECIA 3ERWA 3A2WA 5IM9A 3QMXA 4TOPA 4QQ7A 2F8FA 2GSQA 3HY2A 3KZQA 3KJYA 2H1BA 2K8SA 4HZ2A 2B6MA 1THXA 3I6AA 3U6VA 4FIWA 3ISOA 2NPBA 4HJ2A 4IW9A 4ACSA 2F8AA 4DSSB 4XRAA 2OBIA 1YKCA 5H5QA 1GSSA 5KOWA 1LJRA 2HYXA 3P7XA 4MABA 5CRGA 1B4QA 4OO4A 3LXTA 1F9MA 3EYTA 3QOUA 2FWFA 3HD5A 3VFIA 4ID0A 2P0GA 3VPQA 2IWTA 2HSYA 5DAKA 4ILFA 1EOGA 3ZYWA 2HZEA 4A5PA 1F6MC 1JHBA 5DVBA 5F06A 4IBPA 5CYYA 4TW5A 2C0FA 4N11A 4TXOB 2FWEA 1E2YA 1JZRA 4Q5NA 3PH9A 4G19A 2FWHA 2YV7A 1X9MB 2L4CA 1BG5A 3FK8A 2VD1A 5J3RA 1THOA 4XCSA 1M9BA 2CQ9A 4QL9A 4G0LA 4USSA 2RM5A 2OJLA 4YH2A 3EU4A 4FYCA 4Z2RA 4MF7A 2LEGA 14GSA 3CRUA 1WMJA 2PVQA 1WPIA 3EMXA 3F63A 4TXVA 2ZCTA 3KXOA 2PMTA 2KP2A 2WULA 1B8XA 4OO5A 2H71A 1F2EA 5H5SA 4V1Ap 1R4WA 4POLA 4BVXB 2JU5A 2E2MA 5CO3A 1TP9A 2LRTA 3GN3A 1ABAA 4FH8A 3QPMA 1SYRA 4N0VA 1DE2A 3GH6A 3HVXA 5G5FA 1X9WB 2A4VA 2B1LA 1ZYNA 1FVJA 2H0IA 1EGOA 4G2EA 2H6XA 4Q5FA 5CP1A 3IK7A 3IC8A 1FAAA 2DMMA 4JU5A 4BPYA 3GRXA 4XRDA 1K3YA 3IR4A 1OC8A 3C7MA 3NIVA 4HOJA 4DVCA 4IJIA 3QR6A 2E2GA 4TR1B 3IK9A 3I43A 2K18A 3D4TA 4V2LA 2YJHA 2YPMA 4XHMA 2RM6A 3P2AA 2LS5A 2VCQA 1FOHA 2LRCA 4EF0A 4KDYA 2BJXA 6GSUA 3C1RA 3PINA 3D22A 4N30A 1JZWA 5G1LA 1USBA 4ISDA 4MJCA 2KLXA 1G6WA 1N8JA 3R3EA 2MMAA 1A2LA 1R5AA 2YZUA 2VUPA 3ZL5A 3UIWA 1UVZA 2VL9A 4IQ1A 2YN1A 3J7Yb 1ACVA 4ML1A 5A4UA 4PGTA 4EVMA 3O6TA 1LU4A 2GT6A 4PX1A 2YANA 2LSTA 1K0NA 3F6DA 1FHEA 1GTAA 2DC5A 4KSMA 2V41A 4NV2A 4DSSA 1ZGNA 18GSA 4NPBA 2H74A 1O8WA 5LD0A 3DVXA 2K9FA 5IPGA 1XFLA 1QXHA 5DCHA 2XC2A 3G9BA 4F2IA 5IQYA 1HNCA 1TRUA 3N5OA 2OKAA 4WF5A 1YF0A 3QCPA 1NW2A 1EZKA 1F3AA 2R6KA 1GSEA 3BCKA 3BOAA 3L4NA 1V2AA 3M9KA 4ULXA 2C0DA 5LCZA 4ZB9A 4GCIA 3SWLA 1PA3A 3IPZA 3WGXA 4ICYA 2CV4A 2FA4A 4JR4A 4LA1A 4XTSA 3CTGA 3BCIA 4EUYA 4N10A 3TJKA 1K0CA 3EE2A 4XIHA 5A4WA 1EP7A 5IMVA 2GS3A 1FG4A 2ZUPA 3F8UA 2H70A 1M0UA 4L5LA 3GMFA 2I1UA 3VPTA 1T4YA 1YEXA 10GSA 4X1UA 4GRFA 1SU9A 4RUVA 2HFDA 3GL5A 4ZB8A 2GQMA 2H8LA 3Q6OA 2GGTA 2Z9SA 2QKEA 1SK0A 1MDJA 2F3MA 5ID2A 1VF1A 3TKRA 4N0ZA 1K3LA 5DAKB 3IE3A 3FZ4A 3CRTA 4OD7A 4KDXA 2HI7A 2HZEB 3KP9A 4K2DA 3DRNA 2MYGA 3MAKA 3KMOA 5JWRB 4GF0A 1X9SB 3Q19A 2WDUA 5IOXA 4LL1B 1Z3EA 3APSA 3ZTLA 2CVBA 4WF4A 3CXGA 1BEDA 4EDZA 4PQHA 4V2MA 4HUAA 1SK1A 2LTKA 5C04A 3TGZA 2PWJA 9GSSA 5ECLB 4GWRA 2LNTA 2QSIA 1OE8A 2H0HA 2DJJA 4EDYA 1K0DA 4IELA 2VL2C 4TR4A 2RIIA 1XW9A 1ZCPA 4K9ZA 2H66A 3VK9A 5B7CA 5LNKe 5CAXA 1TRSA 5F0GA 3S9FA 1I5GA 3GH9A 4BWSA 2L5OA 2EIOA 1JLVA 3V1WA 2JSZA 1A0RP 1K0OA 4HZ4A 2R4VA 1S3CA 4NAXA 1OE7A 2IN3A 4MZWA 3MIXA 2V6OA 2TRCP 3FR3A 5HR3A 2R37A 3L9UA 4MH2A 4XS1A 4KX4A 3HJOA 4HEA2 3HJMA 2DSAA 4IS0A 2DJ0A 4MK3A 4HQSA 3WD6A 4ZL8A 4TR3A 1AQXA 2IMEA 1T1VA 1CQGA 2JADA 5JCUA 1Y25A 1GLPA 2M80A 1SKRB 3LYKA 2CA8A 2G2QA 5IO2A 1ZOFA 2HRAA 4J57E 1DE1A 3ZFBA 3E9JB 3EURA 2E0QA 1S3DA 4KGIA 1EGRA 4BA7A 1WIKA 5IOWA 1SL2B 1GUHA 3A2VA 3RHCA 3UVTA 2YWIA 1WWJA 1KTEA 2HRFA 4RI7A 3ME7A 5HFIA 1BYEA 1PRXA 2CAQA 4KCEA 4EE0A 2X99A 1IYHA 2R2JA 1GWCA 4ZB6A 3EU3A 1J9BA 1MEKA 1QGVA 3TJGA 2HT9A 1U87A 2XBQA 3LW9A 3DYRA 3KD0A 2PPTA 4WKWA 2OA7A 1QMVA 4IKHA 3LWAA 1ERUA 3VWXA 1PQNA 1XWCA 4LL4B 3IXRA 2FNOA 3ZIJA 5ECRB 2HRNA 5GZZB 3WYWA 1ON4A 3M0FA 1UA5A 3GX8A 3G7JA 3TUEA 5B8AA 1EEMA 5HFKA 2ON5A 3DKSA 1ZMAA 3K8NA 3HDCA 1SENA 2FY6A 2RUEA 2VLVA 5JWQB 4P3YB 4F0CA 3TKSC 2VL2A 1NSWA 2H72A 1J0FA 3VURA 2V6KA 1TK8B 2LJKA 2GT5A 1GTBA 2PGTA 2DMLA 1TU7A 1FB6A 2I3YA 4Q5QA 3MYDA 3GUSA 4PUFC 3TB2A 2PN8A 1G7EA 1U6TA 1ML6A 1SJ6A 3KIJA 2YV9A 3KM6A 1TK5B 4K7NA 2A2RA 4BVYA 2LNSA 3CSJA 2P31A 4HU9A 1K0AA 8GSSA 4F0BA 3ZLPA 2H76A 3WGEA 1PKWA 4LMVA 3H79A 2VCVA 1JZOA 1M99A 2IFQA 2LRNA 2MZCA 6GSYA 2I4AA 13GSA 2EC4A 2NTOA 4NMUA 5IMDA 5D9TA 4WXTA 1WOUA 2VLTA 1SL1B 4PQIA 2HXKA 2YP6A 5AIVA 2L4QA 19GSA 1HYUA 5ENUA 20GSA 4ZL9A 1GULA 2CZ3A 1DSBA 2I81A 5G5EA 3FR6A 1V40A 3A3TA 4MJEA 2AB6A 3GTUA 1XBSA 2GDRA 1M2AA 5ID2B 3PGTA 3KEBA 1TU8A 5F8BA 2VM2A 1BQ7A 6GSTA 5HQPA 4XS4A 2AHEA 6GSXA 3IAM2 1GSYA 2C0GA 3HVVA 1PX6A 1YDKA 5KOXA 2H6ZA 1AQVA 5ECKB 5D96A 3D6IA 5GAPD 5COHA 1B9YC 2DKHA 4ECJA 3FZ9A 2AYTA 1O7UA 4CHSA 3F4TA 5D93A 4KAEA 2YJ7A 4OFMA 2DJ1A 3DEXA 2UZ8A 3TRQA 1OC3A 1EV9A 2WB9A 4YKGA 4PURA 4F03A 3F4SA 3ZREA 5BMUA 4G9HA 5DQSA 2H19A 2VM1A 3PR8A 2NDOA 2FD3A 3ERGA 3TKQA 2E7PA 2TRXA 2X4AA 3BBYA 1GSDA 3TJFA 4EO3A 1FO5A 3QAGA 4YAPA 2P5RA 3TJBA 3LEFA 1X5EA 4MDCA 2LKUA 2N5AA 1XOBA 3VWUA 5ECSA 5J4UA 6GSWA 4BL7A 5A4VA 2MMZA 4E8HA 1V98A 1PD21 5DBQA 3TKSA 3UOMA 2OE0A 4NWYA 3EVIA 3WGDA 3U5RE 3Q74A 1VF4A 2K6VA 3LFLA 3E3EA 4JZQA 5D73A 4JBBA 3ZITA 2VAFA 3GYKA 3H1NA 1TKDB 1GSUA 3GIXA 1TTZA 1SD8A 2R0CA 4WR5A 5G2ZA 1PL1A 3QAVA 3H4KA 1GL8A 4L0UA 2C3TA 1U3AA 5FT3A 4YQUA 2OE1A 2A2SA 1EV4A 3UEMA 5BRTA 1O73A 1ST9A 2JL4A 1K0BA 3FW2A 4DSQA 1VGLA 4K7OA 2X49A 2PERA 1QK8A 4K7IA 3F3RA 3LORA 2R5GA 3TKPA 2GZYA 2L57A 1QUWA 1K3OA 2LUSA 2WRTA 2V1MA 2REMA 1O8XA 1A8LA 1SYXA 1YEPA 3ZRDA 3DWVA 5CRWA 4BWQA 1ERTA 2VCTA 3G7IA 3W8JA 5G1KA 2CZ2A 7GSSA 2WGRA 1PN9A 1X5DA 2PVOC 4WEYA 1GLQA 5IMCA 2X64A 3IRAA 2R3XA 5HR1A 1HD2A 3WT2A 4YAVA 4L5OA 2YCDA 2X8HA 3F4RA 4ML6A 2VD0A 1C72A 5A5KA 1VRSD 2HLSA 5GSTA 1JFUA 2V2GA 2AV4A 3DGQA 1Z7RA 3EINA 1KEBA 4KB3A 2WS2A 2GZZA 3GL3A 3ZFLA 1R7HA 4KW6A 4HI7A 1V57A 4IN0A 1EWXA 4GTUA 2B5EA 2CX4A 2O8VB 1RQMA 1F37A 1M9AA 5EL8A 4RQXA 4I97A 2H73A 1PN0A 3QDNA 3KGKA 4IGJA 1XVQA 2XPDA 2LJAA 1NHYA 3HVSA 2IMKA 4MF5A 3LYPA 2MMNA 2X8GA 4K0GA 1XW5A 1Y6EA 3KH9A 3PPUA 4OCFA 2X8CA 22GSA 4ZBAA 4AJ7A 1DBYA 3KH7A 4Z2TA 1PSQA 12GSA 4O32A 2GSSA 4BVYB 6GSVA 2HRKA 4D73A 5HR0A 3GSTA 3ZMLA 2MBSA 4PXOA 2DJKA 4L0WA 3CSIA 2B7KA 2LQQA 1VF2A 2A4HA 2IFQB 3BD2A 3QFAC 3DMLA 1AIUA 1AC1A 5J9CA 3EMPA 4Q5RA 5JCGA 3F6FA 2GSRA 2YNXA 4KUNA 4DEJA 2BTOT 4OCEA 4MH3A 3F0IA 4X4JA 4HS1A 5ECPB 2RLIA 3Q18A 3L9SA 4AGSA 2V32A 4GQCA 5J41A 5AN1A 2IJYA 2IMIA 1QFNA 4IP6A 2CVKA 3D0ZA 5ECMB 3GTUB 3APQA 4G10A 4G0KA 1GTIA 5G30A 2O85A 3LG6A 1GSQA 4CY8A 4XS6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IIY A;  1PX7 A;  4XS4 B;  2B3S A;  2ON7 A;  4V2N A;  3H93 A;  1M7T A;  2D2Z A;  2CT6 A;  4CDO A;  1ERW A;  4F9Z A;  3GSS A;  3IOS A;  3UBL A;  1VF3 A;  4I5Q A;  1V9W A;  2WFC A;  2N5B A;  5HFG A;  4HQZ A;  3WT1 A;  2EIQ A;  4ZBD A;  5D9W A;  2AJQ B;  1K0M A;  4I8B A;  5ECH B;  4X0X A;  3NOF A;  2L6D A;  3MDK A;  4KCA A;  4J56 E;  5CRD A;  2OAD A;  16GS A;  2LJR A;  1NHO A;  4NXI A;  5KN2 A;  4MA9 A;  2FLS A;  3A2X A;  2WJU A;  2G0F A;  1M2B A;  3FEU A;  1W4V A;  2JZR A;  4POB A;  1SKS B;  4AJ8 A;  3E0U A;  3JCM L;  2GTU A;  2CVD A;  3MNG A;  2H6Y A;  2YZH A;  4MZB A;  4RI6 A;  1AXD A;  4LLR A;  3GKN A;  3M9J A;  3KP8 A;  2J9H A;  3TRX A;  3ED3 A;  5CNW A;  5IMF A;  2M72 A;  2XPE A;  2FA8 A;  5EY6 A;  5INY A;  1RK4 A;  2C80 A;  3KMN A;  5DAL A;  1T7P B;  2ES7 A;  5KN0 A;  1LBK A;  3HKR A;  1O81 A;  2B5X A;  1XWA A;  1AW9 A;  1ILO A;  3P8W A;  3L0H A;  4HU7 A;  1AUC A;  4QL7 A;  5IO0 A;  1SJI A;  1XPV A;  2BMX A;  3UAR A;  4CW9 A;  3N9J A;  4I2U A;  2P5Q A;  4I6X A;  1EEJ A;  3NZN A;  3VLN A;  4MP4 A;  3TOU A;  3W6G A;  3GKM A;  4MLY A;  1PL2 A;  4IQA A;  1X5C A;  2HE3 A;  17GS A;  1SD9 A;  3HCZ A;  3L9V A;  4FYU A;  2KOK A;  5F05 A;  1MDK A;  3CBU A;  3UBK A;  4WR4 A;  2FGX A;  3C73 A;  2PUK C;  2QC7 A;  1SJZ A;  3IC4 A;  5H5R A;  1TRV A;  2YWO A;  5DJM A;  4TKY A;  1OC9 A;  2MBT A;  3FZA A;  5J9B A;  1Q4J A;  1XVW A;  4F82 A;  2C3Q A;  1EOH A;  1MD4 A;  2JZS A;  2C8U A;  3TJJ A;  2HNL A;  4JRR A;  4IHU A;  4MF6 A;  4FO5 A;  4MCU A;  4ZXG A;  1GUM A;  5DDL A;  4GSS A;  2FCH A;  4O92 A;  4X43 A;  4L8E A;  3F9U A;  3C71 A;  1XOA A;  1G7O A;  4H86 A;  5D9V A;  2DBC A;  2VLU A;  4GQF A;  1GP1 A;  5JCW A;  4K6X A;  2L6C A;  3O3T A;  3RPP A;  3ZZX A;  2VOC A;  5G31 A;  3C8E A;  1Q98 A;  2JZT A;  3FR9 A;  3DXB A;  4ZIL A;  4PNG A;  3M8N A;  3BJ5 A;  3VI5 A;  4LMW A;  3DD3 A;  2DLX A;  4MPF A;  4KE3 A;  3IDV A;  3W8S A;  2VCX A;  1OYJ A;  4OMV A;  3FHK A;  3RPN A;  3FZ5 A;  3GFK A;  4OFT A;  4MZC A;  3CSH A;  5C00 A;  1Z5Y E;  2KUC A;  4NHZ A;  4WBR D;  2FHE A;  4AF2 A;  2CX3 A;  4D73 B;  3HXS A;  1TJD A;  4EL1 A;  5EVO A;  1URM A;  2WCI A;  3DIE A;  1W89 A;  5FHI A;  1H75 A;  4GLT A;  2L5L A;  4KA0 A;  1G0T A;  1JZD A;  2DJ3 A;  2H75 A;  3EWL A;  2MMO A;  1E6B A;  1FW1 A;  1GH2 A;  2H1A A;  1GSF A;  3GNJ A;  3HZ8 A;  5KEJ A;  1FVK A;  5FWG A;  1OKD A;  2ALB A;  3HA9 A;  4TR0 A;  4K8M A;  4MMM A;  4YQM A;  5CRE A;  3GHA A;  2C3N A;  1B9X C;  1Z9H A;  1O85 A;  2H1D A;  5ECI B;  5B6M A;  5EPF A;  3ZVJ A;  2H01 A;  5D9X A;  3UVH A;  3M3M A;  2DIY A;  5B6N A;  3G7Y A;  4JE1 A;  4PUA A;  1TK0 B;  1B48 A;  1BX9 A;  2H30 A;  1TI1 A;  3L78 A;  5E59 A;  4PNF A;  5ELG A;  3TRP A;  1YJ6 A;  2IMF A;  1GNE A;  3ERF A;  3CYN A;  3RBT A;  2WZ9 A;  2KP1 A;  5JWO B;  1FB0 A;  2TIR A;  2H1G A;  3IV4 A;  3ZVJ D;  4POM A;  3HHV A;  4O5R A;  3ZMK A;  4ZBB A;  5KN3 A;  5B8B A;  3SBC A;  1PGT A;  4WBJ A;  5ELA A;  5DQY A;  5KN1 A;  1TOF A;  2VO4 A;  5ECQ B;  1MDI A;  1TXX A;  1Z7P A;  1TRW A;  3HZ4 A;  3AY8 A;  1H4O A;  1KNG A;  3HJP A;  1T3B A;  3EC3 A;  2AAW A;  1A8Y A;  4NV5 A;  5DCG A;  2F51 A;  3D5J A;  4MJB A;  4OFN A;  2DIZ A;  3ZIV A;  1ZYQ B;  4TN8 A;  5GSS A;  1ERV A;  2HSH A;  2CAI A;  4GSN A;  5L71 A;  1GTU A;  2AUV A;  4TVE A;  5ECO B;  2RUF A;  2H0G A;  1UC7 A;  4EXJ A;  3CMI A;  2IPA A;  1HNB A;  5DAL B;  5J5N A;  2JAC A;  2FWG A;  3D21 A;  3IBH A;  2DJ2 A;  4JR6 A;  4EC0 A;  1G6Y A;  4AJ6 A;  5IIZ A;  3LQ7 A;  3P90 A;  11GS A;  5HR2 A;  4HDE A;  1YKA A;  1OKT A;  4TXO A;  1YF1 A;  1R26 A;  3F3Q A;  1A0F A;  1KBN A;  5E4W A;  5AIX A;  1ZL9 A;  3US3 A;  3RAZ A;  3LGC A;  4IP1 A;  3R2Q A;  2XHF A;  2B5Y A;  1O6J A;  4JED A;  2NBS A;  1S3A A;  2O87 A;  4MJA A;  3LSZ A;  4FYB A;  4E8E A;  2EIR A;  1N2A A;  1JLW A;  1WJK A;  3GX0 A;  1EP8 A;  1Z6M A;  1A23 A;  2L59 A;  1XWB A;  1YY7 A;  2GZP A;  2K8V A;  3HYP A;  3D4M A;  1T4Z A;  2ZNM A;  1ZYE A;  2JSY A;  1X0R A;  1OC9 B;  2NVL A;  2F9S A;  2GLR A;  1IYI A;  1V58 A;  3TCO A;  5D8I A;  2O7K A;  3CTF A;  4HJM A;  3UL3 A;  5AGY A;  1HQO A;  3J7Y k;  1BJX A;  1TI3 A;  4KND A;  2B1K A;  4IVF A;  4BVX A;  1CQH A;  1I9D A;  1AQW A;  1A24 A;  3DVW A;  1DUG A;  1GNW A;  2OE3 A;  3LXZ A;  1QQ2 A;  2C4J A;  4DSR A;  2C1Y A;  4I2T A;  4IJ3 A;  3H8Q A;  1OAZ A;  3IAS 2;  1WE0 A;  3IHQ A;  3FY7 A;  4V1A g;  3VWV A;  3QD9 A;  1NM3 A;  1U3I A;  2J23 A;  1UN2 A;  3APO A;  4GST A;  1GRX A;  1R5P A;  4KDU A;  1T8E B;  4OWY A;  1J08 A;  2LQO A;  1BAY A;  1XWG A;  1MTC A;  5CRH A;  2YWN A;  4ECC A;  3TDG A;  2O89 A;  2VIM A;  1PMT A;  2C0E A;  1TW9 A;  3GA4 A;  3I9V 2;  3KCM A;  2KHP A;  3LJR A;  4TR1 A;  1XZO A;  4J2F A;  4RQR A;  5F07 A;  1XCC A;  3UMA A;  2OBK A;  3GV1 A;  1GUK A;  4EKZ A;  2VL3 A;  2HZF A;  1U88 A;  2GVP A;  2N5F A;  2YOI A;  1PKZ A;  4MPG A;  2OAC A;  1ZZY A;  3FYG A;  3GKX A;  2GQL A;  2VCW A;  2GST A;  4KSO A;  3M1G A;  3GKK A;  4KH7 A;  1FOV A;  3KTL A;  5DJL A;  4PQ1 A;  4GXZ A;  4WET A;  5ABR A;  3IA1 A;  2PU9 C;  5AIS A;  2I9H A;  3VI7 A;  4ZIJ A;  1HNA A;  2GQK A;  4Z7X A;  1T00 A;  3OR5 A;  4O7H A;  1XIY A;  3FRC A;  2YWM A;  1XWK A;  3A5W A;  3FKF A;  1AAZ A;  4ZL7 A;  4YQV A;  1A2J A;  2QGV A;  4K0N A;  1XW6 A;  1SK2 A;  2VCZ A;  5IMZ A;  1YZX A;  1Z6N A;  3I69 A;  4POK A;  1YQ1 A;  1MD3 A;  1OVN A;  3VWW A;  1WRY A;  5IPH A;  4K1F A;  3TKS E;  6GSS A;  3C1S A;  3QAW A;  2B7J A;  5GAN D;  1TDI A;  3O76 A;  3MWH A;  4NHW A;  2FUG 2;  3TOT A;  2M46 A;  2IMD A;  3QFB C;  3UAP A;  1SKW B;  3KTB A;  1RW1 A;  5ECN B;  1A2M A;  2PBJ A;  2IL3 A;  1SL0 B;  3UJ1 A;  1F3B A;  1B4P A;  3ME8 A;  3GUR A;  2XBI A;  3MSZ A;  3RHB A;  4ECB A;  1M2D A;  4TRX A;  5IMA A;  1WP0 A;  2LV3 A;  3RDW A;  1XXU A;  4ECI A;  3ERW A;  3A2W A;  5IM9 A;  3QMX A;  4TOP A;  4QQ7 A;  2F8F A;  2GSQ A;  3HY2 A;  3KZQ A;  3KJY A;  2H1B A;  2K8S A;  4HZ2 A;  2B6M A;  1THX A;  3I6A A;  3U6V A;  4FIW A;  3ISO A;  2NPB A;  4HJ2 A;  4IW9 A;  4ACS A;  2F8A A;  4DSS B;  4XRA A;  2OBI A;  1YKC A;  5H5Q A;  1GSS A;  1LJR A;  2HYX A;  3P7X A;  4MAB A;  5CRG A;  1B4Q A;  4OO4 A;  3LXT A;  1F9M A;  3EYT A;  3QOU A;  2FWF A;  3HD5 A;  3VFI A;  4ID0 A;  2P0G A;  3VPQ A;  2IWT A;  2HSY A;  5DAK A;  4ILF A;  1EOG A;  3ZYW A;  2HZE A;  1F6M C;  1JHB A;  5F06 A;  5DVB A;  4IBP A;  5CYY A;  4TW5 A;  2C0F A;  4N11 A;  4TXO B;  2FWE A;  1E2Y A;  1JZR A;  4Q5N A;  3PH9 A;  4G19 A;  2FWH A;  2YV7 A;  1X9M B;  2L4C A;  1BG5 A;  3FK8 A;  2VD1 A;  5J3R A;  1THO A;  4XCS A;  1M9B A;  2CQ9 A;  4QL9 A;  2RM5 A;  2OJL A;  4YH2 A;  3EU4 A;  4FYC A;  4MF7 A;  2LEG A;  14GS A;  3CRU A;  1WMJ A;  2PVQ A;  1WPI A;  3EMX A;  3F63 A;  4TXV A;  2ZCT A;  3KXO A;  2PMT A;  2KP2 A;  2WUL A;  1B8X A;  4OO5 A;  2H71 A;  1F2E A;  5H5S A;  4V1A p;  1R4W A;  4POL A;  2JU5 A;  2E2M A;  5CO3 A;  1TP9 A;  2LRT A;  3GN3 A;  1ABA A;  4FH8 A;  3QPM A;  1SYR A;  4N0V A;  1DE2 A;  3GH6 A;  3HVX A;  5G5F A;  1X9W B;  2A4V A;  2B1L A;  1FVJ A;  2H0I A;  1EGO A;  4G2E A;  2H6X A;  4Q5F A;  5CP1 A;  3IK7 A;  1FAA A;  2DMM A;  4JU5 A;  4BPY A;  3GRX A;  4XRD A;  1K3Y A;  3IR4 A;  1OC8 A;  3C7M A;  3NIV A;  4HOJ A;  4DVC A;  4IJI A;  3QR6 A;  2E2G A;  4TR1 B;  3IK9 A;  3I43 A;  2K18 A;  3D4T A;  4V2L A;  2YJH A;  2YPM A;  4XHM A;  2RM6 A;  3P2A A;  2LS5 A;  2VCQ A;  2LRC A;  4EF0 A;  4KDY A;  2BJX A;  6GSU A;  3C1R A;  3PIN A;  3D22 A;  4N30 A;  1JZW A;  5G1L A;  1USB A;  4ISD A;  4MJC A;  2KLX A;  1G6W A;  1N8J A;  2MMA A;  1A2L A;  1R5A A;  2YZU A;  2VUP A;  3ZL5 A;  3UIW A;  1UVZ A;  2VL9 A;  4IQ1 A;  2YN1 A;  3J7Y b;  1ACV A;  4ML1 A;  5A4U A;  4PGT A;  4EVM A;  3O6T A;  1LU4 A;  2GT6 A;  4PX1 A;  2YAN A;  2LST A;  1K0N A;  3F6D A;  1FHE A;  1GTA A;  2DC5 A;  4KSM A;  2V41 A;  4NV2 A;  4DSS A;  1ZGN A;  18GS A;  4NPB A;  2H74 A;  1O8W A;  5LD0 A;  3DVX A;  2K9F A;  5IPG A;  1XFL A;  1QXH A;  5DCH A;  2XC2 A;  3G9B A;  4F2I A;  5IQY A;  1HNC A;  1TRU A;  3N5O A;  2OKA A;  4WF5 A;  1YF0 A;  3QCP A;  1NW2 A;  1EZK A;  1F3A A;  2R6K A;  1GSE A;  3BCK A;  3BOA A;  3L4N A;  1V2A A;  3M9K A;  4ULX A;  2C0D A;  5LCZ A;  4ZB9 A;  4GCI A;  3SWL A;  1PA3 A;  3IPZ A;  3WGX A;  2CV4 A;  2FA4 A;  4JR4 A;  4LA1 A;  4XTS A;  3CTG A;  3BCI A;  4EUY A;  4N10 A;  3TJK A;  1K0C A;  3EE2 A;  4XIH A;  5A4W A;  1EP7 A;  5IMV A;  2GS3 A;  1FG4 A;  2ZUP A;  3F8U A;  2H70 A;  1M0U A;  4L5L A;  3GMF A;  2I1U A;  3VPT A;  1T4Y A;  1YEX A;  10GS A;  4X1U A;  4GRF A;  1SU9 A;  4RUV A;  2HFD A;  3GL5 A;  4ZB8 A;  2GQM A;  2H8L A;  3Q6O A;  2GGT A;  2Z9S A;  2QKE A;  1SK0 A;  1MDJ A;  2F3M A;  5ID2 A;  1VF1 A;  3TKR A;  4N0Z A;  1K3L A;  5DAK B;  3IE3 A;  3FZ4 A;  3CRT A;  4OD7 A;  4KDX A;  2HI7 A;  2HZE B;  3KP9 A;  4K2D A;  3DRN A;  2MYG A;  3MAK A;  3KMO A;  5JWR B;  4GF0 A;  1X9S B;  3Q19 A;  2WDU A;  5IOX A;  4LL1 B;  1Z3E A;  3APS A;  3ZTL A;  2CVB A;  4WF4 A;  3CXG A;  1BED A;  4EDZ A;  4PQH A;  4V2M A;  4HUA A;  1SK1 A;  2LTK A;  5C04 A;  3TGZ A;  2PWJ A;  9GSS A;  5ECL B;  4GWR A;  2LNT A;  2QSI A;  1OE8 A;  2H0H A;  2DJJ A;  4EDY A;  1K0D A;  4IEL A;  2VL2 C;  4TR4 A;  2RII A;  1XW9 A;  1ZCP A;  4K9Z A;  2H66 A;  3VK9 A;  5B7C A;  5LNK e;  5CAX A;  1TRS A;  5F0G A;  3S9F A;  1I5G A;  3GH9 A;  4BWS A;  2L5O A;  2EIO A;  1JLV A;  3V1W A;  2JSZ A;  1A0R P;  1K0O A;  4HZ4 A;  2R4V A;  1S3C A;  4NAX A;  1OE7 A;  2IN3 A;  4MZW A;  2V6O A;  2TRC P;  3FR3 A;  5HR3 A;  2R37 A;  3L9U A;  4MH2 A;  4XS1 A;  4KX4 A;  3HJO A;  4HEA 2;  3HJM A;  2DSA A;  4IS0 A;  2DJ0 A;  4MK3 A;  4HQS A;  3WD6 A;  4ZL8 A;  4TR3 A;  1AQX A;  2IME A;  1T1V A;  1CQG A;  2JAD A;  5JCU A;  1Y25 A;  1GLP A;  2M80 A;  1SKR B;  3LYK A;  2CA8 A;  2G2Q A;  5IO2 A;  1ZOF A;  1DE1 A;  4J57 E;  3ZFB A;  3E9J B;  3EUR A;  2E0Q A;  1S3D A;  4KGI A;  1EGR A;  4BA7 A;  1WIK A;  5IOW A;  1SL2 B;  1GUH A;  3A2V A;  3RHC A;  3UVT A;  2YWI A;  1WWJ A;  1KTE A;  2HRF A;  4RI7 A;  3ME7 A;  5HFI A;  1BYE A;  1PRX A;  2CAQ A;  4KCE A;  4EE0 A;  2X99 A;  1IYH A;  2R2J A;  1GWC A;  4ZB6 A;  3EU3 A;  1J9B A;  1MEK A;  1QGV A;  3TJG A;  2HT9 A;  1U87 A;  2XBQ A;  3DYR A;  3KD0 A;  2PPT A;  4WKW A;  2OA7 A;  1QMV A;  4IKH A;  3LWA A;  1ERU A;  3VWX A;  1PQN A;  1XWC A;  4LL4 B;  3IXR A;  2FNO A;  3ZIJ A;  5ECR B;  2HRN A;  5GZZ B;  3WYW A;  1ON4 A;  3M0F A;  1UA5 A;  3GX8 A;  3G7J A;  3TUE A;  5B8A A;  1EEM A;  5HFK A;  2ON5 A;  3DKS A;  1ZMA A;  3K8N A;  3HDC A;  1SEN A;  2FY6 A;  2RUE A;  2VLV A;  5JWQ B;  4P3Y B;  4F0C A;  3TKS C;  2VL2 A;  1NSW A;  2H72 A;  1J0F A;  3VUR A;  2V6K A;  1TK8 B;  2LJK A;  2GT5 A;  1GTB A;  2PGT A;  2DML A;  1TU7 A;  1FB6 A;  2I3Y A;  4Q5Q A;  4PUF C;  3GUS A;  3TB2 A;  2PN8 A;  1G7E A;  1U6T A;  1ML6 A;  1SJ6 A;  3KIJ A;  2YV9 A;  3KM6 A;  1TK5 B;  4K7N A;  2A2R A;  4BVY A;  2LNS A;  3CSJ A;  2P31 A;  4HU9 A;  1K0A A;  8GSS A;  4F0B A;  3ZLP A;  2H76 A;  3WGE A;  1PKW A;  4LMV A;  3H79 A;  2VCV A;  1JZO A;  1M99 A;  2IFQ A;  2LRN A;  2MZC A;  6GSY A;  2I4A A;  13GS A;  2EC4 A;  2NTO A;  4NMU A;  5IMD A;  5D9T A;  4WXT A;  1WOU A;  2VLT A;  1SL1 B;  4PQI A;  2HXK A;  2YP6 A;  5AIV A;  2L4Q A;  19GS A;  1HYU A;  5ENU A;  20GS A;  4ZL9 A;  1GUL A;  2CZ3 A;  1DSB A;  2I81 A;  5G5E A;  3FR6 A;  1V40 A;  3A3T A;  4MJE A;  2AB6 A;  3GTU A;  1XBS A;  2GDR A;  1M2A A;  5ID2 B;  3PGT A;  3KEB A;  1TU8 A;  5F8B A;  2VM2 A;  1BQ7 A;  6GST A;  5HQP A;  4XS4 A;  2AHE A;  6GSX A;  3IAM 2;  1GSY A;  2C0G A;  3HVV A;  1PX6 A;  1YDK A;  2H6Z A;  1AQV A;  5ECK B;  5D96 A;  3D6I A;  5GAP D;  5COH A;  1B9Y C;  4ECJ A;  3FZ9 A;  2AYT A;  1O7U A;  4CHS A;  3F4T A;  5D93 A;  4KAE A;  2YJ7 A;  4OFM A;  2DJ1 A;  3DEX A;  3TRQ A;  1OC3 A;  1EV9 A;  2WB9 A;  4PUR A;  4F03 A;  3F4S A;  3ZRE A;  4G9H A;  5DQS A;  2H19 A;  2VM1 A;  3PR8 A;  2NDO A;  2FD3 A;  3ERG A;  3TKQ A;  2E7P A;  2TRX A;  3BBY A;  1GSD A;  3TJF A;  4EO3 A;  1FO5 A;  3QAG A;  4YAP A;  2P5R A;  3TJB A;  3LEF A;  1X5E A;  4MDC A;  2LKU A;  2N5A A;  1XOB A;  3VWU A;  5ECS A;  5J4U A;  6GSW A;  4BL7 A;  5A4V A;  2MMZ A;  4E8H A;  1V98 A;  1PD2 1;  5DBQ A;  3TKS A;  3UOM A;  2OE0 A;  4NWY A;  3EVI A;  3WGD A;  3U5R E;  3Q74 A;  1VF4 A;  2K6V A;  3LFL A;  3E3E A;  4JZQ A;  5D73 A;  4JBB A;  3ZIT A;  2VAF A;  3GYK A;  3H1N A;  1TKD B;  1GSU A;  3GIX A;  1TTZ A;  1SD8 A;  4WR5 A;  5G2Z A;  1PL1 A;  3QAV A;  3H4K A;  1GL8 A;  4L0U A;  2C3T A;  1U3A A;  5FT3 A;  4YQU A;  2OE1 A;  2A2S A;  1EV4 A;  3UEM A;  1O73 A;  1ST9 A;  2JL4 A;  1K0B A;  3FW2 A;  4DSQ A;  1VGL A;  4K7O A;  2PER A;  1QK8 A;  4K7I A;  3F3R A;  3LOR A;  2R5G A;  3TKP A;  2GZY A;  2L57 A;  1QUW A;  1K3O A;  2LUS A;  2WRT A;  2V1M A;  2REM A;  1O8X A;  1A8L A;  1SYX A;  1YEP A;  3ZRD A;  3DWV A;  5CRW A;  4BWQ A;  1ERT A;  2VCT A;  3G7I A;  3W8J A;  5G1K A;  2CZ2 A;  7GSS A;  2WGR A;  1PN9 A;  1X5D A;  2PVO C;  4WEY A;  1GLQ A;  5IMC A;  2X64 A;  3IRA A;  2R3X A;  5HR1 A;  1HD2 A;  3WT2 A;  4YAV A;  4L5O A;  2YCD A;  2X8H A;  3F4R A;  4ML6 A;  2VD0 A;  1C72 A;  5A5K A;  1VRS D;  2HLS A;  5GST A;  1JFU A;  2V2G A;  2AV4 A;  3DGQ A;  1Z7R A;  3EIN A;  1KEB A;  4KB3 A;  2WS2 A;  2GZZ A;  3GL3 A;  3ZFL A;  1R7H A;  4KW6 A;  4HI7 A;  1V57 A;  4IN0 A;  1EWX A;  4GTU A;  2B5E A;  2CX4 A;  2O8V B;  1RQM A;  1F37 A;  1M9A A;  5EL8 A;  4RQX A;  4I97 A;  2H73 A;  3QDN A;  3KGK A;  4IGJ A;  1XVQ A;  2XPD A;  2LJA A;  1NHY A;  3HVS A;  2IMK A;  4MF5 A;  3LYP A;  2MMN A;  2X8G A;  4K0G A;  1XW5 A;  1Y6E A;  3KH9 A;  4OCF A;  2X8C A;  22GS A;  4ZBA A;  4AJ7 A;  1DBY A;  3KH7 A;  1PSQ A;  12GS A;  4O32 A;  2GSS A;  6GSV A;  4D73 A;  5HR0 A;  3GST A;  3ZML A;  2MBS A;  4PXO A;  2DJK A;  4L0W A;  3CSI A;  2B7K A;  2LQQ A;  1VF2 A;  2IFQ B;  3BD2 A;  3QFA C;  3DML A;  1AIU A;  1AC1 A;  5J9C A;  3EMP A;  4Q5R A;  5JCG A;  3F6F A;  2GSR A;  2YNX A;  4KUN A;  4DEJ A;  2BTO T;  4OCE A;  4MH3 A;  3F0I A;  4HS1 A;  5ECP B;  2RLI A;  3Q18 A;  3L9S A;  4AGS A;  2V32 A;  4GQC A;  5J41 A;  5AN1 A;  2IJY A;  2IMI A;  1QFN A;  4IP6 A;  2CVK A;  3D0Z A;  5ECM B;  3GTU B;  3APQ A;  4G10 A;  1GTI A;  5G30 A;  2O85 A;  3LG6 A;  1GSQ A;  4XS6 A; 
#chains in the Genus database with same CATH topology
 2IIY A;  1PX7 A;  4XS4 B;  2B3S A;  2ON7 A;  4V2N A;  3H93 A;  1M7T A;  2D2Z A;  2CT6 A;  4CDO A;  1ERW A;  4F9Z A;  3GSS A;  3IOS A;  3UBL A;  1VF3 A;  4FQU A;  4I5Q A;  1V9W A;  2WFC A;  2N5B A;  5HFG A;  4HQZ A;  3WT1 A;  2EIQ A;  4ZBD A;  5D9W A;  2AJQ B;  1K0M A;  4I8B A;  5ECH B;  4X0X A;  3NOF A;  2L6D A;  3MDK A;  4KCA A;  4J56 E;  5CRD A;  2OAD A;  16GS A;  2LJR A;  1NHO A;  4NXI A;  5KN2 A;  4MA9 A;  2FLS A;  3A2X A;  2WJU A;  2G0F A;  1M2B A;  3FEU A;  1W4V A;  2JZR A;  4POB A;  1SKS B;  4AJ8 A;  3E0U A;  3JCM L;  2GTU A;  2CVD A;  3MNG A;  2H6Y A;  2YZH A;  4MZB A;  1S3R A;  4RI6 A;  1AXD A;  4LLR A;  3GKN A;  3M9J A;  3KP8 A;  2J9H A;  3TRX A;  3ED3 A;  5CNW A;  5IMF A;  4BL7 B;  2M72 A;  2XPE A;  2FA8 A;  5EY6 A;  5INY A;  1RK4 A;  2C80 A;  3KMN A;  5DAL A;  1T7P B;  2ES7 A;  5KN0 A;  1LBK A;  3HKR A;  1O81 A;  2B5X A;  2A2P A;  1XWA A;  1AW9 A;  1ILO A;  3P8W A;  3L0H A;  4HU7 A;  1AUC A;  4QL7 A;  5IO0 A;  1SJI A;  1XPV A;  2BMX A;  3UAR A;  4CW9 A;  3N9J A;  4I2U A;  2P5Q A;  4I6X A;  4EIQ A;  1EEJ A;  3NZN A;  3VLN A;  4MP4 A;  4O5Q A;  3TOU A;  3W6G A;  3GKM A;  4MLY A;  1PL2 A;  4IQA A;  1X5C A;  2HE3 A;  17GS A;  1SD9 A;  3HCZ A;  3L9V A;  4FYU A;  2KOK A;  5F05 A;  1MDK A;  3CBU A;  3UBK A;  4WR4 A;  2FGX A;  3C73 A;  2PUK C;  2QC7 A;  1SJZ A;  3IC4 A;  5H5R A;  1TRV A;  2YWO A;  5DJM A;  4TKY A;  1OC9 A;  2MBT A;  3FZA A;  5J9B A;  1Q4J A;  1XVW A;  4F82 A;  2C3Q A;  1EOH A;  1MD4 A;  2JZS A;  2C8U A;  3TJJ A;  2QA2 A;  2HNL A;  4JRR A;  4IHU A;  4MF6 A;  4FO5 A;  4MCU A;  4ZXG A;  1GUM A;  5DDL A;  4GSS A;  2FCH A;  4O92 A;  4X43 A;  4L8E A;  3F9U A;  3C71 A;  1XOA A;  1G7O A;  4H86 A;  5D9V A;  2DBC A;  2VLU A;  4GQF A;  4EIP A;  1GP1 A;  5JCW A;  4K6X A;  2L6C A;  3O3T A;  3RPP A;  3ZZX A;  2VOC A;  5G31 A;  3C8E A;  1Q98 A;  2JZT A;  3FR9 A;  3DXB A;  4ZIL A;  4PNG A;  3M8N A;  3BJ5 A;  3VI5 A;  4LMW A;  3A5I A;  3DD3 A;  2DLX A;  4MPF A;  4KE3 A;  2QA1 A;  3IDV A;  3W8S A;  2VCX A;  1OYJ A;  4OMV A;  3FHK A;  3RPN A;  3FZ5 A;  3GFK A;  4OFT A;  4MZC A;  3CSH A;  5C00 A;  1Z5Y E;  2KUC A;  4NHZ A;  4WBR D;  2FHE A;  4AF2 A;  2CX3 A;  4O5U A;  4D73 B;  4Z2U A;  3HXS A;  1TJD A;  4EL1 A;  1M3I A;  5EVO A;  1URM A;  2WCI A;  3DIE A;  1W89 A;  5FHI A;  1H75 A;  4GLT A;  2L5L A;  2DKI A;  4KA0 A;  2R0G A;  1G0T A;  1JZD A;  2DJ3 A;  2H75 A;  3EWL A;  2MMO A;  1E6B A;  1FW1 A;  1GH2 A;  2H1A A;  1GSF A;  1PFO A;  3GNJ A;  3HZ8 A;  3FMW A;  5KEJ A;  1FVK A;  5FWG A;  1OKD A;  2ALB A;  3HA9 A;  4TR0 A;  4K8M A;  4MMM A;  4YQM A;  5CRE A;  3GHA A;  2C3N A;  1B9X C;  1Z9H A;  1O85 A;  2H1D A;  5B6M A;  5ECI B;  5EPF A;  3ZVJ A;  2H01 A;  5D9X A;  3UVH A;  3M3M A;  2DIY A;  5B6N A;  3G7Y A;  4JE1 A;  4PUA A;  1TK0 B;  1B48 A;  1BX9 A;  2H30 A;  1TI1 A;  3L78 A;  5E59 A;  4PNF A;  5ELG A;  3TRP A;  1YJ6 A;  2IMF A;  1GNE A;  3ERF A;  3CYN A;  3RBT A;  2WZ9 A;  2KP1 A;  5JWO B;  1FB0 A;  2TIR A;  2H1G A;  3IV4 A;  3ZVJ D;  4POM A;  3HHV A;  4O5R A;  3ZMK A;  4ZBB A;  5KN3 A;  5B8B A;  3SBC A;  1PGT A;  4WBJ A;  5ELA A;  5DQY A;  5KN1 A;  1TOF A;  2VO4 A;  5ECQ B;  1MDI A;  1TXX A;  1Z7P A;  1TRW A;  3HZ4 A;  3AY8 A;  1H4O A;  1KNG A;  3HJP A;  1T3B A;  3EC3 A;  4YKF A;  2AAW A;  1A8Y A;  4NV5 A;  5DCG A;  2F51 A;  3D5J A;  4MJB A;  4OFN A;  2DIZ A;  3ZIV A;  1ZYQ B;  4TN8 A;  5GSS A;  1ERV A;  2HSH A;  2CAI A;  4GSN A;  5L71 A;  1GTU A;  2AUV A;  4TVE A;  5ECO B;  2RUF A;  2H0G A;  1UC7 A;  4EXJ A;  3CMI A;  2IPA A;  1HNB A;  5DAL B;  5J5N A;  3IHG A;  2JAC A;  2FWG A;  3D21 A;  3IBH A;  2DJ2 A;  4JR6 A;  4EC0 A;  1G6Y A;  4AJ6 A;  5IIZ A;  3LQ7 A;  3P90 A;  11GS A;  5HR2 A;  4HDE A;  1YKA A;  1OKT A;  4TXO A;  1YF1 A;  1R26 A;  3F3Q A;  1A0F A;  1KBN A;  5E4W A;  5AIX A;  1ZL9 A;  3US3 A;  3RAZ A;  3LGC A;  4IP1 A;  3R2Q A;  2XHF A;  2B5Y A;  1O6J A;  4JED A;  2NBS A;  1S3A A;  2O87 A;  4MJA A;  3LSZ A;  4FYB A;  4E8E A;  2EIR A;  1N2A A;  1JLW A;  1WJK A;  3GX0 A;  1EP8 A;  1Z6M A;  1A23 A;  2L59 A;  1XWB A;  1YY7 A;  2GZP A;  2K8V A;  3HYP A;  3D4M A;  1T4Z A;  2ZNM A;  1ZYE A;  2JSY A;  1X0R A;  1OC9 B;  4K2X A;  2NVL A;  2F9S A;  2GLR A;  1IYI A;  1V58 A;  3TCO A;  5D8I A;  2O7K A;  3CTF A;  4HJM A;  3UL3 A;  5AGY A;  1HQO A;  3J7Y k;  1BJX A;  1TI3 A;  4KND A;  2B1K A;  4IVF A;  4BVX A;  1CQH A;  1I9D A;  1AQW A;  1A24 A;  3DVW A;  1DUG A;  4K5S A;  1GNW A;  2OE3 A;  3LXZ A;  1QQ2 A;  2C4J A;  4DSR A;  2C1Y A;  4I2T A;  4IJ3 A;  3H8Q A;  1OAZ A;  3IAS 2;  4CY6 A;  1WE0 A;  3IHQ A;  3FY7 A;  4V1A g;  3VWV A;  3QD9 A;  1NM3 A;  1U3I A;  2J23 A;  1UN2 A;  3APO A;  4GST A;  1GRX A;  1R5P A;  4KDU A;  1T8E B;  4OWY A;  1J08 A;  2LQO A;  1BAY A;  1XWG A;  1MTC A;  5CRH A;  2YWN A;  4ECC A;  3TDG A;  2O89 A;  2VIM A;  1PMT A;  2C0E A;  4K5R A;  1TW9 A;  3GA4 A;  3I9V 2;  3KCM A;  2KHP A;  3LJR A;  4TR1 A;  1XZO A;  4J2F A;  4RQR A;  5F07 A;  1XCC A;  3UMA A;  1ZYP A;  2OBK A;  3GV1 A;  1GUK A;  2R0P A;  4EKZ A;  2VL3 A;  2HZF A;  1U88 A;  2GVP A;  2N5F A;  2YOI A;  1PKZ A;  4MPG A;  2OAC A;  1ZZY A;  3FYG A;  3GKX A;  2GQL A;  2VCW A;  2GST A;  4KSO A;  3M1G A;  3GKK A;  4KH7 A;  1FOV A;  3KTL A;  5DJL A;  4PQ1 A;  4GXZ A;  4MNN A;  4WET A;  5ABR A;  3IA1 A;  2PU9 C;  5AIS A;  2I9H A;  3VI7 A;  4ZIJ A;  1HNA A;  2GQK A;  4G0I A;  4Z7X A;  1T00 A;  3OR5 A;  4O7H A;  4KF9 A;  1XIY A;  3FRC A;  2YWM A;  1XWK A;  3A5W A;  3FKF A;  1M3J A;  1AAZ A;  4ZL7 A;  4YQV A;  1A2J A;  2QGV A;  4K0N A;  1XW6 A;  1SK2 A;  2VCZ A;  5IMZ A;  1YZX A;  1Z6N A;  3I69 A;  4POK A;  1YQ1 A;  1MD3 A;  1OVN A;  3VWW A;  1WRY A;  5IPH A;  3EPT A;  4K1F A;  3TKS E;  6GSS A;  3C1S A;  3QAW A;  2B7J A;  5GAN D;  1TDI A;  3O76 A;  3MWH A;  4NHW A;  2FUG 2;  3TOT A;  2M46 A;  2IMD A;  3QFB C;  3UAP A;  1SKW B;  3KTB A;  1RW1 A;  5ECN B;  1A2M A;  2PBJ A;  2IL3 A;  1SL0 B;  3UJ1 A;  1F3B A;  1B4P A;  4PTS A;  3ME8 A;  3GUR A;  2XBI A;  3MSZ A;  3RHB A;  4ECB A;  1M2D A;  4TRX A;  5IMA A;  1WP0 A;  2LV3 A;  2HSM A;  3RDW A;  1XXU A;  4ECI A;  3ERW A;  3A2W A;  5IM9 A;  3QMX A;  4TOP A;  4QQ7 A;  2F8F A;  2GSQ A;  3HY2 A;  3KZQ A;  3KJY A;  2H1B A;  2K8S A;  4HZ2 A;  2B6M A;  1THX A;  3I6A A;  3U6V A;  4FIW A;  3ISO A;  2NPB A;  4HJ2 A;  4IW9 A;  4ACS A;  2F8A A;  4DSS B;  4XRA A;  2OBI A;  1YKC A;  5H5Q A;  1GSS A;  5KOW A;  1LJR A;  2HYX A;  3P7X A;  4MAB A;  5CRG A;  1B4Q A;  4OO4 A;  3LXT A;  1F9M A;  3EYT A;  3QOU A;  2FWF A;  3HD5 A;  3VFI A;  4ID0 A;  2P0G A;  3VPQ A;  2IWT A;  2HSY A;  5DAK A;  4ILF A;  1EOG A;  3ZYW A;  2HZE A;  4A5P A;  1F6M C;  1JHB A;  5DVB A;  5F06 A;  4IBP A;  4TW5 A;  5CYY A;  2C0F A;  4N11 A;  4TXO B;  2FWE A;  1E2Y A;  1JZR A;  4Q5N A;  3PH9 A;  4G19 A;  2FWH A;  3CQF A;  2YV7 A;  1X9M B;  2L4C A;  1BG5 A;  3FK8 A;  2VD1 A;  5J3R A;  1THO A;  4XCS A;  1M9B A;  2CQ9 A;  4QL9 A;  4G0L A;  4USS A;  2RM5 A;  2OJL A;  4YH2 A;  3EU4 A;  4FYC A;  4Z2R A;  4MF7 A;  2LEG A;  14GS A;  3CRU A;  1WMJ A;  2PVQ A;  1WPI A;  3EMX A;  3F63 A;  4TXV A;  2ZCT A;  3KXO A;  2PMT A;  2KP2 A;  2WUL A;  1B8X A;  4OO5 A;  2H71 A;  1F2E A;  5H5S A;  4V1A p;  1R4W A;  4POL A;  4BVX B;  2JU5 A;  2E2M A;  5CO3 A;  1TP9 A;  2LRT A;  3GN3 A;  1ABA A;  4FH8 A;  3QPM A;  1SYR A;  4N0V A;  1DE2 A;  3GH6 A;  3HVX A;  5G5F A;  1X9W B;  2A4V A;  2B1L A;  1ZYN A;  1FVJ A;  2H0I A;  1EGO A;  4G2E A;  2H6X A;  4Q5F A;  5CP1 A;  3IK7 A;  3IC8 A;  1FAA A;  2DMM A;  4JU5 A;  4BPY A;  3GRX A;  4XRD A;  1K3Y A;  3IR4 A;  1OC8 A;  3C7M A;  3NIV A;  4HOJ A;  4DVC A;  4IJI A;  3QR6 A;  2E2G A;  4TR1 B;  3IK9 A;  3I43 A;  2K18 A;  3D4T A;  4V2L A;  2YJH A;  2YPM A;  4XHM A;  2RM6 A;  3P2A A;  2LS5 A;  2VCQ A;  1FOH A;  2LRC A;  4EF0 A;  4KDY A;  2BJX A;  6GSU A;  3C1R A;  3PIN A;  3D22 A;  4N30 A;  1JZW A;  5G1L A;  1USB A;  4ISD A;  4MJC A;  2KLX A;  1G6W A;  1N8J A;  3R3E A;  2MMA A;  1A2L A;  1R5A A;  2YZU A;  2VUP A;  3ZL5 A;  3UIW A;  1UVZ A;  2VL9 A;  4IQ1 A;  2YN1 A;  3J7Y b;  1ACV A;  4ML1 A;  5A4U A;  4PGT A;  4EVM A;  3O6T A;  1LU4 A;  2GT6 A;  4PX1 A;  2YAN A;  2LST A;  1K0N A;  3F6D A;  1FHE A;  1GTA A;  2DC5 A;  4KSM A;  2V41 A;  4NV2 A;  4DSS A;  1ZGN A;  18GS A;  4NPB A;  2H74 A;  1O8W A;  5LD0 A;  3DVX A;  2K9F A;  5IPG A;  1XFL A;  1QXH A;  5DCH A;  2XC2 A;  3G9B A;  4F2I A;  5IQY A;  1HNC A;  1TRU A;  3N5O A;  2OKA A;  4WF5 A;  1YF0 A;  3QCP A;  1NW2 A;  1EZK A;  1F3A A;  2R6K A;  1GSE A;  3BCK A;  3BOA A;  3L4N A;  1V2A A;  3M9K A;  4ULX A;  2C0D A;  5LCZ A;  4ZB9 A;  4GCI A;  3SWL A;  1PA3 A;  3IPZ A;  3WGX A;  4ICY A;  2CV4 A;  2FA4 A;  4JR4 A;  4LA1 A;  4XTS A;  3CTG A;  3BCI A;  4EUY A;  4N10 A;  3TJK A;  1K0C A;  3EE2 A;  4XIH A;  5A4W A;  1EP7 A;  5IMV A;  2GS3 A;  1FG4 A;  2ZUP A;  3F8U A;  2H70 A;  1M0U A;  4L5L A;  3GMF A;  2I1U A;  3VPT A;  1T4Y A;  1YEX A;  10GS A;  4X1U A;  4GRF A;  1SU9 A;  4RUV A;  2HFD A;  3GL5 A;  4ZB8 A;  2GQM A;  2H8L A;  3Q6O A;  2GGT A;  2Z9S A;  2QKE A;  1SK0 A;  1MDJ A;  2F3M A;  5ID2 A;  1VF1 A;  3TKR A;  4N0Z A;  1K3L A;  5DAK B;  3IE3 A;  3FZ4 A;  3CRT A;  4OD7 A;  4KDX A;  2HI7 A;  2HZE B;  3KP9 A;  4K2D A;  3DRN A;  2MYG A;  3MAK A;  3KMO A;  5JWR B;  4GF0 A;  1X9S B;  3Q19 A;  2WDU A;  5IOX A;  4LL1 B;  1Z3E A;  3APS A;  3ZTL A;  2CVB A;  4WF4 A;  3CXG A;  1BED A;  4EDZ A;  4PQH A;  4V2M A;  4HUA A;  1SK1 A;  2LTK A;  5C04 A;  3TGZ A;  2PWJ A;  9GSS A;  5ECL B;  4GWR A;  2LNT A;  2QSI A;  1OE8 A;  2H0H A;  2DJJ A;  4EDY A;  1K0D A;  4IEL A;  2VL2 C;  4TR4 A;  2RII A;  1XW9 A;  1ZCP A;  4K9Z A;  2H66 A;  3VK9 A;  5B7C A;  5LNK e;  5CAX A;  1TRS A;  5F0G A;  3S9F A;  1I5G A;  3GH9 A;  4BWS A;  2L5O A;  2EIO A;  1JLV A;  3V1W A;  2JSZ A;  1A0R P;  1K0O A;  4HZ4 A;  2R4V A;  1S3C A;  4NAX A;  1OE7 A;  2IN3 A;  4MZW A;  3MIX A;  2V6O A;  2TRC P;  3FR3 A;  5HR3 A;  2R37 A;  3L9U A;  4MH2 A;  4XS1 A;  4KX4 A;  3HJO A;  4HEA 2;  3HJM A;  2DSA A;  4IS0 A;  2DJ0 A;  4MK3 A;  4HQS A;  3WD6 A;  4ZL8 A;  4TR3 A;  1AQX A;  2IME A;  1T1V A;  1CQG A;  2JAD A;  5JCU A;  1Y25 A;  1GLP A;  2M80 A;  1SKR B;  3LYK A;  2CA8 A;  2G2Q A;  5IO2 A;  1ZOF A;  2HRA A;  4J57 E;  1DE1 A;  3ZFB A;  3E9J B;  3EUR A;  2E0Q A;  1S3D A;  4KGI A;  1EGR A;  4BA7 A;  1WIK A;  5IOW A;  1SL2 B;  1GUH A;  3A2V A;  3RHC A;  3UVT A;  2YWI A;  1WWJ A;  1KTE A;  2HRF A;  4RI7 A;  3ME7 A;  5HFI A;  1BYE A;  1PRX A;  2CAQ A;  4KCE A;  4EE0 A;  2X99 A;  1IYH A;  2R2J A;  1GWC A;  4ZB6 A;  3EU3 A;  1J9B A;  1MEK A;  1QGV A;  3TJG A;  2HT9 A;  1U87 A;  2XBQ A;  3LW9 A;  3DYR A;  3KD0 A;  2PPT A;  4WKW A;  2OA7 A;  1QMV A;  4IKH A;  3LWA A;  1ERU A;  3VWX A;  1PQN A;  1XWC A;  4LL4 B;  3IXR A;  2FNO A;  3ZIJ A;  5ECR B;  2HRN A;  5GZZ B;  3WYW A;  1ON4 A;  3M0F A;  1UA5 A;  3GX8 A;  3G7J A;  3TUE A;  5B8A A;  1EEM A;  5HFK A;  2ON5 A;  4HSC X;  3DKS A;  1ZMA A;  3K8N A;  3HDC A;  1SEN A;  2FY6 A;  2RUE A;  2VLV A;  5JWQ B;  4P3Y B;  4F0C A;  3TKS C;  2VL2 A;  1NSW A;  2H72 A;  1J0F A;  3VUR A;  2V6K A;  1TK8 B;  2LJK A;  2GT5 A;  1GTB A;  2PGT A;  2DML A;  1TU7 A;  1FB6 A;  2I3Y A;  4Q5Q A;  3MYD A;  3GUS A;  4PUF C;  3TB2 A;  2PN8 A;  1G7E A;  1U6T A;  1ML6 A;  1SJ6 A;  3KIJ A;  2YV9 A;  3KM6 A;  1TK5 B;  4K7N A;  2A2R A;  4BVY A;  2LNS A;  3CSJ A;  2P31 A;  4HU9 A;  1K0A A;  8GSS A;  4F0B A;  3ZLP A;  2H76 A;  3WGE A;  1PKW A;  4LMV A;  3H79 A;  2VCV A;  1JZO A;  1M99 A;  2IFQ A;  2LRN A;  2MZC A;  6GSY A;  2I4A A;  13GS A;  2EC4 A;  2NTO A;  4NMU A;  5IMD A;  5D9T A;  1XG8 A;  4WXT A;  1WOU A;  2VLT A;  1SL1 B;  4PQI A;  2HXK A;  2YP6 A;  5AIV A;  2L4Q A;  19GS A;  1HYU A;  5ENU A;  20GS A;  4ZL9 A;  1GUL A;  2CZ3 A;  1DSB A;  2I81 A;  5G5E A;  3HVN A;  3FR6 A;  1V40 A;  3A3T A;  4MJE A;  2AB6 A;  3GTU A;  1XBS A;  2GDR A;  1M2A A;  5ID2 B;  3PGT A;  3KEB A;  1TU8 A;  5F8B A;  2VM2 A;  1BQ7 A;  6GST A;  5HQP A;  4XS4 A;  4BIK A;  2AHE A;  6GSX A;  3IAM 2;  1GSY A;  2C0G A;  3HVV A;  1PX6 A;  1YDK A;  5KOX A;  2H6Z A;  1AQV A;  5ECK B;  5D96 A;  3D6I A;  5GAP D;  5COH A;  1B9Y C;  2DKH A;  4ECJ A;  3FZ9 A;  2AYT A;  1O7U A;  4CHS A;  3F4T A;  5D93 A;  4KAE A;  2YJ7 A;  4OFM A;  2DJ1 A;  3DEX A;  2UZ8 A;  3TRQ A;  1OC3 A;  1EV9 A;  2WB9 A;  4YKG A;  4PUR A;  4F03 A;  3F4S A;  3ZRE A;  5BMU A;  4G9H A;  5DQS A;  2H19 A;  2VM1 A;  3PR8 A;  2NDO A;  2FD3 A;  3ERG A;  3TKQ A;  2E7P A;  2TRX A;  2X4A A;  3BBY A;  1GSD A;  3TJF A;  4EO3 A;  1FO5 A;  3QAG A;  4YAP A;  2P5R A;  3TJB A;  3LEF A;  1X5E A;  4MDC A;  2LKU A;  2N5A A;  1XOB A;  3VWU A;  5ECS A;  5J4U A;  6GSW A;  4BL7 A;  5A4V A;  2MMZ A;  4E8H A;  1V98 A;  1PD2 1;  5DBQ A;  3TKS A;  3UOM A;  2OE0 A;  4NWY A;  3EVI A;  3WGD A;  3U5R E;  3Q74 A;  1VF4 A;  2K6V A;  3LFL A;  3E3E A;  4JZQ A;  5D73 A;  4JBB A;  3ZIT A;  2VAF A;  3GYK A;  3H1N A;  1TKD B;  1GSU A;  3GIX A;  1TTZ A;  1SD8 A;  2R0C A;  4WR5 A;  5G2Z A;  1PL1 A;  3QAV A;  3H4K A;  1GL8 A;  4L0U A;  2C3T A;  1U3A A;  5FT3 A;  4YQU A;  2OE1 A;  2A2S A;  1EV4 A;  3UEM A;  5BRT A;  1O73 A;  1ST9 A;  2JL4 A;  1K0B A;  3FW2 A;  4DSQ A;  1VGL A;  4K7O A;  2X49 A;  2PER A;  1QK8 A;  4K7I A;  3F3R A;  3LOR A;  2R5G A;  3TKP A;  2GZY A;  2L57 A;  1QUW A;  1K3O A;  2LUS A;  2WRT A;  2V1M A;  2REM A;  1O8X A;  1A8L A;  1SYX A;  1YEP A;  3ZRD A;  3DWV A;  5CRW A;  4BWQ A;  1ERT A;  2VCT A;  3G7I A;  3W8J A;  5G1K A;  2CZ2 A;  7GSS A;  2WGR A;  1PN9 A;  1X5D A;  2PVO C;  4WEY A;  1GLQ A;  5IMC A;  2X64 A;  3IRA A;  2R3X A;  5HR1 A;  1HD2 A;  3WT2 A;  4YAV A;  4L5O A;  2YCD A;  2X8H A;  3F4R A;  4ML6 A;  2VD0 A;  1C72 A;  5A5K A;  1VRS D;  2HLS A;  5GST A;  1JFU A;  2V2G A;  2AV4 A;  3DGQ A;  1Z7R A;  3EIN A;  1KEB A;  4KB3 A;  2WS2 A;  2GZZ A;  3GL3 A;  3ZFL A;  1R7H A;  4KW6 A;  4HI7 A;  1V57 A;  4IN0 A;  1EWX A;  4GTU A;  2B5E A;  2CX4 A;  2O8V B;  1RQM A;  1F37 A;  1M9A A;  5EL8 A;  4RQX A;  4I97 A;  2H73 A;  1PN0 A;  3QDN A;  3KGK A;  4IGJ A;  1XVQ A;  2XPD A;  2LJA A;  1NHY A;  3HVS A;  2IMK A;  4MF5 A;  3LYP A;  2MMN A;  2X8G A;  4K0G A;  1XW5 A;  1Y6E A;  3KH9 A;  3PPU A;  4OCF A;  2X8C A;  22GS A;  4ZBA A;  4AJ7 A;  1DBY A;  3KH7 A;  4Z2T A;  1PSQ A;  12GS A;  4O32 A;  2GSS A;  4BVY B;  6GSV A;  2HRK A;  4D73 A;  5HR0 A;  3GST A;  3ZML A;  2MBS A;  4PXO A;  2DJK A;  4L0W A;  3CSI A;  2B7K A;  2LQQ A;  1VF2 A;  2A4H A;  2IFQ B;  3BD2 A;  3QFA C;  3DML A;  1AIU A;  1AC1 A;  5J9C A;  3EMP A;  4Q5R A;  5JCG A;  3F6F A;  2GSR A;  2YNX A;  4KUN A;  4DEJ A;  2BTO T;  4OCE A;  4MH3 A;  3F0I A;  4X4J A;  4HS1 A;  5ECP B;  2RLI A;  3Q18 A;  3L9S A;  4AGS A;  2V32 A;  4GQC A;  5J41 A;  5AN1 A;  2IJY A;  2IMI A;  1QFN A;  4IP6 A;  2CVK A;  3D0Z A;  5ECM B;  3GTU B;  3APQ A;  4G10 A;  4G0K A;  1GTI A;  5G30 A;  2O85 A;  3LG6 A;  1GSQ A;  4CY8 A;  4XS6 A; 
#chains in the Genus database with same CATH homology
 2IIY A;  1PX7 A;  4XS4 B;  2B3S A;  2ON7 A;  4V2N A;  3H93 A;  1M7T A;  2D2Z A;  2CT6 A;  4CDO A;  1ERW A;  4F9Z A;  3GSS A;  3IOS A;  3UBL A;  1VF3 A;  4FQU A;  4I5Q A;  1V9W A;  2WFC A;  2N5B A;  5HFG A;  4HQZ A;  3WT1 A;  2EIQ A;  4ZBD A;  5D9W A;  2AJQ B;  1K0M A;  4I8B A;  5ECH B;  4X0X A;  3NOF A;  2L6D A;  3MDK A;  4KCA A;  4J56 E;  5CRD A;  2OAD A;  16GS A;  2LJR A;  1NHO A;  4NXI A;  5KN2 A;  4MA9 A;  2FLS A;  3A2X A;  2WJU A;  2G0F A;  1M2B A;  3FEU A;  1W4V A;  2JZR A;  4POB A;  1SKS B;  4AJ8 A;  3E0U A;  3JCM L;  2GTU A;  2CVD A;  3MNG A;  2H6Y A;  2YZH A;  4MZB A;  4RI6 A;  1AXD A;  4LLR A;  3GKN A;  3M9J A;  3KP8 A;  2J9H A;  3TRX A;  3ED3 A;  5CNW A;  5IMF A;  4BL7 B;  2M72 A;  2XPE A;  2FA8 A;  5EY6 A;  5INY A;  1RK4 A;  2C80 A;  3KMN A;  5DAL A;  1T7P B;  2ES7 A;  5KN0 A;  1LBK A;  3HKR A;  1O81 A;  2B5X A;  2A2P A;  1XWA A;  1AW9 A;  1ILO A;  3P8W A;  3L0H A;  4HU7 A;  1AUC A;  4QL7 A;  5IO0 A;  1SJI A;  1XPV A;  2BMX A;  3UAR A;  4CW9 A;  3N9J A;  4I2U A;  2P5Q A;  4I6X A;  4EIQ A;  1EEJ A;  3NZN A;  3VLN A;  4MP4 A;  4O5Q A;  3TOU A;  3W6G A;  3GKM A;  4MLY A;  1PL2 A;  4IQA A;  1X5C A;  2HE3 A;  17GS A;  1SD9 A;  3HCZ A;  3L9V A;  4FYU A;  2KOK A;  5F05 A;  1MDK A;  3CBU A;  3UBK A;  4WR4 A;  2FGX A;  3C73 A;  2PUK C;  2QC7 A;  1SJZ A;  3IC4 A;  5H5R A;  1TRV A;  2YWO A;  5DJM A;  4TKY A;  1OC9 A;  2MBT A;  3FZA A;  5J9B A;  1Q4J A;  1XVW A;  4F82 A;  2C3Q A;  1EOH A;  1MD4 A;  2JZS A;  2C8U A;  3TJJ A;  2QA2 A;  2HNL A;  4JRR A;  4IHU A;  4MF6 A;  4FO5 A;  4MCU A;  4ZXG A;  1GUM A;  5DDL A;  4GSS A;  2FCH A;  4O92 A;  4X43 A;  4L8E A;  3F9U A;  3C71 A;  1XOA A;  1G7O A;  4H86 A;  5D9V A;  2DBC A;  2VLU A;  4GQF A;  4EIP A;  1GP1 A;  5JCW A;  4K6X A;  2L6C A;  3O3T A;  3RPP A;  3ZZX A;  2VOC A;  5G31 A;  3C8E A;  1Q98 A;  2JZT A;  3FR9 A;  3DXB A;  4ZIL A;  4PNG A;  3M8N A;  3BJ5 A;  3VI5 A;  4LMW A;  3A5I A;  3DD3 A;  2DLX A;  4MPF A;  4KE3 A;  2QA1 A;  3IDV A;  3W8S A;  2VCX A;  1OYJ A;  4OMV A;  3FHK A;  3RPN A;  3FZ5 A;  3GFK A;  4OFT A;  4MZC A;  3CSH A;  5C00 A;  1Z5Y E;  2KUC A;  4NHZ A;  4WBR D;  2FHE A;  4AF2 A;  2CX3 A;  4O5U A;  4D73 B;  4Z2U A;  3HXS A;  1TJD A;  4EL1 A;  5EVO A;  1URM A;  2WCI A;  3DIE A;  1W89 A;  5FHI A;  1H75 A;  4GLT A;  2L5L A;  2DKI A;  4KA0 A;  2R0G A;  1G0T A;  1JZD A;  2DJ3 A;  2H75 A;  3EWL A;  2MMO A;  1E6B A;  1FW1 A;  1GH2 A;  2H1A A;  1GSF A;  3GNJ A;  3HZ8 A;  3FMW A;  5KEJ A;  1FVK A;  5FWG A;  1OKD A;  2ALB A;  3HA9 A;  4TR0 A;  4K8M A;  4MMM A;  4YQM A;  5CRE A;  3GHA A;  2C3N A;  1B9X C;  1Z9H A;  1O85 A;  2H1D A;  5ECI B;  5B6M A;  5EPF A;  3ZVJ A;  2H01 A;  5D9X A;  3UVH A;  3M3M A;  2DIY A;  5B6N A;  3G7Y A;  4JE1 A;  4PUA A;  1TK0 B;  1B48 A;  1BX9 A;  2H30 A;  1TI1 A;  3L78 A;  5E59 A;  4PNF A;  5ELG A;  3TRP A;  1YJ6 A;  2IMF A;  1GNE A;  3ERF A;  3CYN A;  3RBT A;  2WZ9 A;  2KP1 A;  5JWO B;  1FB0 A;  2TIR A;  2H1G A;  3IV4 A;  3ZVJ D;  4POM A;  3HHV A;  4O5R A;  3ZMK A;  4ZBB A;  5KN3 A;  5B8B A;  3SBC A;  1PGT A;  4WBJ A;  5ELA A;  5DQY A;  5KN1 A;  1TOF A;  2VO4 A;  5ECQ B;  1MDI A;  1TXX A;  1Z7P A;  1TRW A;  3HZ4 A;  3AY8 A;  1H4O A;  1KNG A;  3HJP A;  1T3B A;  3EC3 A;  4YKF A;  2AAW A;  1A8Y A;  4NV5 A;  5DCG A;  2F51 A;  3D5J A;  4MJB A;  4OFN A;  2DIZ A;  3ZIV A;  1ZYQ B;  4TN8 A;  5GSS A;  1ERV A;  2HSH A;  2CAI A;  4GSN A;  5L71 A;  1GTU A;  2AUV A;  4TVE A;  5ECO B;  2RUF A;  2H0G A;  1UC7 A;  4EXJ A;  3CMI A;  2IPA A;  1HNB A;  5DAL B;  5J5N A;  3IHG A;  2JAC A;  2FWG A;  3D21 A;  3IBH A;  2DJ2 A;  4JR6 A;  4EC0 A;  1G6Y A;  4AJ6 A;  5IIZ A;  3LQ7 A;  3P90 A;  11GS A;  5HR2 A;  4HDE A;  1YKA A;  1OKT A;  4TXO A;  1YF1 A;  1R26 A;  3F3Q A;  1A0F A;  1KBN A;  5E4W A;  5AIX A;  1ZL9 A;  3US3 A;  3RAZ A;  3LGC A;  4IP1 A;  3R2Q A;  2XHF A;  2B5Y A;  1O6J A;  4JED A;  2NBS A;  1S3A A;  2O87 A;  4MJA A;  3LSZ A;  4FYB A;  4E8E A;  2EIR A;  1N2A A;  1JLW A;  1WJK A;  3GX0 A;  1EP8 A;  1Z6M A;  1A23 A;  2L59 A;  1XWB A;  1YY7 A;  2GZP A;  2K8V A;  3HYP A;  3D4M A;  1T4Z A;  2ZNM A;  1ZYE A;  2JSY A;  1X0R A;  1OC9 B;  4K2X A;  2NVL A;  2F9S A;  2GLR A;  1IYI A;  1V58 A;  3TCO A;  5D8I A;  2O7K A;  3CTF A;  4HJM A;  3UL3 A;  5AGY A;  1HQO A;  3J7Y k;  1BJX A;  1TI3 A;  4KND A;  2B1K A;  4IVF A;  4BVX A;  1CQH A;  1I9D A;  1AQW A;  1A24 A;  3DVW A;  1DUG A;  4K5S A;  1GNW A;  2OE3 A;  3LXZ A;  1QQ2 A;  2C4J A;  4DSR A;  2C1Y A;  4I2T A;  4IJ3 A;  3H8Q A;  1OAZ A;  3IAS 2;  4CY6 A;  1WE0 A;  3IHQ A;  3FY7 A;  4V1A g;  3VWV A;  3QD9 A;  1NM3 A;  1U3I A;  2J23 A;  1UN2 A;  3APO A;  4GST A;  1GRX A;  1R5P A;  4KDU A;  1T8E B;  4OWY A;  1J08 A;  2LQO A;  1BAY A;  1XWG A;  1MTC A;  5CRH A;  2YWN A;  4ECC A;  3TDG A;  2O89 A;  2VIM A;  1PMT A;  2C0E A;  4K5R A;  1TW9 A;  3GA4 A;  3I9V 2;  3KCM A;  2KHP A;  3LJR A;  4TR1 A;  1XZO A;  4J2F A;  4RQR A;  5F07 A;  1XCC A;  3UMA A;  1ZYP A;  2OBK A;  3GV1 A;  1GUK A;  2R0P A;  4EKZ A;  2VL3 A;  2HZF A;  1U88 A;  2GVP A;  2N5F A;  2YOI A;  1PKZ A;  4MPG A;  2OAC A;  1ZZY A;  3FYG A;  3GKX A;  2GQL A;  2VCW A;  2GST A;  4KSO A;  3M1G A;  3GKK A;  4KH7 A;  1FOV A;  3KTL A;  5DJL A;  4PQ1 A;  4GXZ A;  4MNN A;  4WET A;  5ABR A;  3IA1 A;  2PU9 C;  5AIS A;  2I9H A;  3VI7 A;  4ZIJ A;  1HNA A;  2GQK A;  4G0I A;  4Z7X A;  1T00 A;  3OR5 A;  4O7H A;  4KF9 A;  1XIY A;  3FRC A;  2YWM A;  1XWK A;  3A5W A;  3FKF A;  1AAZ A;  4ZL7 A;  4YQV A;  1A2J A;  2QGV A;  4K0N A;  1XW6 A;  1SK2 A;  2VCZ A;  5IMZ A;  1YZX A;  1Z6N A;  3I69 A;  4POK A;  1YQ1 A;  1MD3 A;  1OVN A;  3VWW A;  1WRY A;  5IPH A;  3EPT A;  4K1F A;  3TKS E;  6GSS A;  3C1S A;  3QAW A;  2B7J A;  5GAN D;  1TDI A;  3O76 A;  3MWH A;  4NHW A;  2FUG 2;  3TOT A;  2M46 A;  2IMD A;  3QFB C;  3UAP A;  1SKW B;  3KTB A;  1RW1 A;  5ECN B;  1A2M A;  2PBJ A;  2IL3 A;  1SL0 B;  3UJ1 A;  1F3B A;  1B4P A;  4PTS A;  3ME8 A;  3GUR A;  2XBI A;  3MSZ A;  3RHB A;  4ECB A;  1M2D A;  4TRX A;  5IMA A;  1WP0 A;  2LV3 A;  2HSM A;  3RDW A;  1XXU A;  4ECI A;  3ERW A;  3A2W A;  5IM9 A;  3QMX A;  4TOP A;  4QQ7 A;  2F8F A;  2GSQ A;  3HY2 A;  3KZQ A;  3KJY A;  2H1B A;  2K8S A;  4HZ2 A;  2B6M A;  1THX A;  3I6A A;  3U6V A;  4FIW A;  3ISO A;  2NPB A;  4HJ2 A;  4IW9 A;  4ACS A;  2F8A A;  4DSS B;  4XRA A;  2OBI A;  1YKC A;  5H5Q A;  1GSS A;  5KOW A;  1LJR A;  2HYX A;  3P7X A;  4MAB A;  5CRG A;  1B4Q A;  4OO4 A;  3LXT A;  1F9M A;  3EYT A;  3QOU A;  2FWF A;  3HD5 A;  3VFI A;  4ID0 A;  2P0G A;  3VPQ A;  2IWT A;  2HSY A;  5DAK A;  4ILF A;  1EOG A;  3ZYW A;  2HZE A;  4A5P A;  1F6M C;  1JHB A;  5DVB A;  5F06 A;  4IBP A;  5CYY A;  4TW5 A;  2C0F A;  4N11 A;  4TXO B;  2FWE A;  1E2Y A;  1JZR A;  4Q5N A;  3PH9 A;  4G19 A;  2FWH A;  2YV7 A;  1X9M B;  2L4C A;  1BG5 A;  3FK8 A;  2VD1 A;  5J3R A;  1THO A;  4XCS A;  1M9B A;  2CQ9 A;  4QL9 A;  4G0L A;  4USS A;  2RM5 A;  2OJL A;  4YH2 A;  3EU4 A;  4FYC A;  4Z2R A;  4MF7 A;  2LEG A;  14GS A;  3CRU A;  1WMJ A;  2PVQ A;  1WPI A;  3EMX A;  3F63 A;  4TXV A;  2ZCT A;  3KXO A;  2PMT A;  2KP2 A;  2WUL A;  1B8X A;  4OO5 A;  2H71 A;  1F2E A;  5H5S A;  4V1A p;  1R4W A;  4POL A;  4BVX B;  2JU5 A;  2E2M A;  5CO3 A;  1TP9 A;  2LRT A;  3GN3 A;  1ABA A;  4FH8 A;  3QPM A;  1SYR A;  4N0V A;  1DE2 A;  3GH6 A;  3HVX A;  5G5F A;  1X9W B;  2A4V A;  2B1L A;  1ZYN A;  1FVJ A;  2H0I A;  1EGO A;  4G2E A;  2H6X A;  4Q5F A;  5CP1 A;  3IK7 A;  3IC8 A;  1FAA A;  2DMM A;  4JU5 A;  4BPY A;  3GRX A;  4XRD A;  1K3Y A;  3IR4 A;  1OC8 A;  3C7M A;  3NIV A;  4HOJ A;  4DVC A;  4IJI A;  3QR6 A;  2E2G A;  4TR1 B;  3IK9 A;  3I43 A;  2K18 A;  3D4T A;  4V2L A;  2YJH A;  2YPM A;  4XHM A;  2RM6 A;  3P2A A;  2LS5 A;  2VCQ A;  1FOH A;  2LRC A;  4EF0 A;  4KDY A;  2BJX A;  6GSU A;  3C1R A;  3PIN A;  3D22 A;  4N30 A;  1JZW A;  5G1L A;  1USB A;  4ISD A;  4MJC A;  2KLX A;  1G6W A;  1N8J A;  3R3E A;  2MMA A;  1A2L A;  1R5A A;  2YZU A;  2VUP A;  3ZL5 A;  3UIW A;  1UVZ A;  2VL9 A;  4IQ1 A;  2YN1 A;  3J7Y b;  1ACV A;  4ML1 A;  5A4U A;  4PGT A;  4EVM A;  3O6T A;  1LU4 A;  2GT6 A;  4PX1 A;  2YAN A;  2LST A;  1K0N A;  3F6D A;  1FHE A;  1GTA A;  2DC5 A;  4KSM A;  2V41 A;  4NV2 A;  4DSS A;  1ZGN A;  18GS A;  4NPB A;  2H74 A;  1O8W A;  5LD0 A;  3DVX A;  2K9F A;  5IPG A;  1XFL A;  1QXH A;  5DCH A;  2XC2 A;  3G9B A;  4F2I A;  5IQY A;  1HNC A;  1TRU A;  3N5O A;  2OKA A;  4WF5 A;  1YF0 A;  3QCP A;  1NW2 A;  1EZK A;  1F3A A;  2R6K A;  1GSE A;  3BCK A;  3BOA A;  3L4N A;  1V2A A;  3M9K A;  4ULX A;  2C0D A;  5LCZ A;  4ZB9 A;  4GCI A;  3SWL A;  1PA3 A;  3IPZ A;  3WGX A;  4ICY A;  2CV4 A;  2FA4 A;  4JR4 A;  4LA1 A;  4XTS A;  3CTG A;  3BCI A;  4EUY A;  4N10 A;  3TJK A;  1K0C A;  3EE2 A;  4XIH A;  5A4W A;  1EP7 A;  5IMV A;  2GS3 A;  1FG4 A;  2ZUP A;  3F8U A;  2H70 A;  1M0U A;  4L5L A;  3GMF A;  2I1U A;  3VPT A;  1T4Y A;  1YEX A;  10GS A;  4X1U A;  4GRF A;  1SU9 A;  4RUV A;  2HFD A;  3GL5 A;  4ZB8 A;  2GQM A;  2H8L A;  3Q6O A;  2GGT A;  2Z9S A;  2QKE A;  1SK0 A;  1MDJ A;  2F3M A;  5ID2 A;  1VF1 A;  3TKR A;  4N0Z A;  1K3L A;  5DAK B;  3IE3 A;  3FZ4 A;  3CRT A;  4OD7 A;  4KDX A;  2HI7 A;  2HZE B;  3KP9 A;  4K2D A;  3DRN A;  2MYG A;  3MAK A;  3KMO A;  5JWR B;  4GF0 A;  1X9S B;  3Q19 A;  2WDU A;  5IOX A;  4LL1 B;  1Z3E A;  3APS A;  3ZTL A;  2CVB A;  4WF4 A;  3CXG A;  1BED A;  4EDZ A;  4PQH A;  4V2M A;  4HUA A;  1SK1 A;  2LTK A;  5C04 A;  3TGZ A;  2PWJ A;  9GSS A;  5ECL B;  4GWR A;  2LNT A;  2QSI A;  1OE8 A;  2H0H A;  2DJJ A;  4EDY A;  1K0D A;  4IEL A;  2VL2 C;  4TR4 A;  2RII A;  1XW9 A;  1ZCP A;  4K9Z A;  2H66 A;  3VK9 A;  5B7C A;  5LNK e;  5CAX A;  1TRS A;  5F0G A;  3S9F A;  1I5G A;  3GH9 A;  4BWS A;  2L5O A;  2EIO A;  1JLV A;  3V1W A;  2JSZ A;  1A0R P;  1K0O A;  4HZ4 A;  2R4V A;  1S3C A;  4NAX A;  1OE7 A;  2IN3 A;  4MZW A;  3MIX A;  2V6O A;  2TRC P;  3FR3 A;  5HR3 A;  2R37 A;  3L9U A;  4MH2 A;  4XS1 A;  4KX4 A;  3HJO A;  4HEA 2;  3HJM A;  2DSA A;  4IS0 A;  2DJ0 A;  4MK3 A;  4HQS A;  3WD6 A;  4ZL8 A;  4TR3 A;  1AQX A;  2IME A;  1T1V A;  1CQG A;  2JAD A;  5JCU A;  1Y25 A;  1GLP A;  2M80 A;  1SKR B;  3LYK A;  2CA8 A;  2G2Q A;  5IO2 A;  1ZOF A;  2HRA A;  4J57 E;  1DE1 A;  3ZFB A;  3E9J B;  3EUR A;  2E0Q A;  1S3D A;  4KGI A;  1EGR A;  4BA7 A;  1WIK A;  5IOW A;  1SL2 B;  1GUH A;  3A2V A;  3RHC A;  3UVT A;  2YWI A;  1WWJ A;  1KTE A;  2HRF A;  4RI7 A;  3ME7 A;  5HFI A;  1BYE A;  1PRX A;  2CAQ A;  4KCE A;  4EE0 A;  2X99 A;  1IYH A;  2R2J A;  1GWC A;  4ZB6 A;  3EU3 A;  1J9B A;  1MEK A;  1QGV A;  3TJG A;  2HT9 A;  1U87 A;  2XBQ A;  3LW9 A;  3DYR A;  3KD0 A;  2PPT A;  4WKW A;  2OA7 A;  1QMV A;  4IKH A;  3LWA A;  1ERU A;  3VWX A;  1PQN A;  1XWC A;  4LL4 B;  3IXR A;  2FNO A;  3ZIJ A;  5ECR B;  2HRN A;  5GZZ B;  3WYW A;  1ON4 A;  3M0F A;  1UA5 A;  3GX8 A;  3G7J A;  3TUE A;  5B8A A;  1EEM A;  5HFK A;  2ON5 A;  3DKS A;  1ZMA A;  3K8N A;  3HDC A;  1SEN A;  2FY6 A;  2RUE A;  2VLV A;  5JWQ B;  4P3Y B;  4F0C A;  3TKS C;  2VL2 A;  1NSW A;  2H72 A;  1J0F A;  3VUR A;  2V6K A;  1TK8 B;  2LJK A;  2GT5 A;  1GTB A;  2PGT A;  2DML A;  1TU7 A;  1FB6 A;  2I3Y A;  4Q5Q A;  3MYD A;  3GUS A;  4PUF C;  3TB2 A;  2PN8 A;  1G7E A;  1U6T A;  1ML6 A;  1SJ6 A;  3KIJ A;  2YV9 A;  3KM6 A;  1TK5 B;  4K7N A;  2A2R A;  4BVY A;  2LNS A;  3CSJ A;  2P31 A;  4HU9 A;  1K0A A;  8GSS A;  4F0B A;  3ZLP A;  2H76 A;  3WGE A;  1PKW A;  4LMV A;  3H79 A;  2VCV A;  1JZO A;  1M99 A;  2IFQ A;  2LRN A;  2MZC A;  6GSY A;  2I4A A;  13GS A;  2EC4 A;  2NTO A;  4NMU A;  5IMD A;  5D9T A;  4WXT A;  1WOU A;  2VLT A;  1SL1 B;  4PQI A;  2HXK A;  2YP6 A;  5AIV A;  2L4Q A;  19GS A;  1HYU A;  5ENU A;  20GS A;  4ZL9 A;  1GUL A;  2CZ3 A;  1DSB A;  2I81 A;  5G5E A;  3FR6 A;  1V40 A;  3A3T A;  4MJE A;  2AB6 A;  3GTU A;  1XBS A;  2GDR A;  1M2A A;  5ID2 B;  3PGT A;  3KEB A;  1TU8 A;  5F8B A;  2VM2 A;  1BQ7 A;  6GST A;  5HQP A;  4XS4 A;  2AHE A;  6GSX A;  3IAM 2;  1GSY A;  2C0G A;  3HVV A;  1PX6 A;  1YDK A;  5KOX A;  2H6Z A;  1AQV A;  5ECK B;  5D96 A;  3D6I A;  5GAP D;  5COH A;  1B9Y C;  2DKH A;  4ECJ A;  3FZ9 A;  2AYT A;  1O7U A;  4CHS A;  3F4T A;  5D93 A;  4KAE A;  2YJ7 A;  4OFM A;  2DJ1 A;  3DEX A;  2UZ8 A;  3TRQ A;  1OC3 A;  1EV9 A;  2WB9 A;  4YKG A;  4PUR A;  4F03 A;  3F4S A;  3ZRE A;  5BMU A;  4G9H A;  5DQS A;  2H19 A;  2VM1 A;  3PR8 A;  2NDO A;  2FD3 A;  3ERG A;  3TKQ A;  2E7P A;  2TRX A;  2X4A A;  3BBY A;  1GSD A;  3TJF A;  4EO3 A;  1FO5 A;  3QAG A;  4YAP A;  2P5R A;  3TJB A;  3LEF A;  1X5E A;  4MDC A;  2LKU A;  2N5A A;  1XOB A;  3VWU A;  5ECS A;  5J4U A;  6GSW A;  4BL7 A;  5A4V A;  2MMZ A;  4E8H A;  1V98 A;  1PD2 1;  5DBQ A;  3TKS A;  3UOM A;  2OE0 A;  4NWY A;  3EVI A;  3WGD A;  3U5R E;  3Q74 A;  1VF4 A;  2K6V A;  3LFL A;  3E3E A;  4JZQ A;  5D73 A;  4JBB A;  3ZIT A;  2VAF A;  3GYK A;  3H1N A;  1TKD B;  1GSU A;  3GIX A;  1TTZ A;  1SD8 A;  2R0C A;  4WR5 A;  5G2Z A;  1PL1 A;  3QAV A;  3H4K A;  1GL8 A;  4L0U A;  2C3T A;  1U3A A;  5FT3 A;  4YQU A;  2OE1 A;  2A2S A;  1EV4 A;  3UEM A;  5BRT A;  1O73 A;  1ST9 A;  2JL4 A;  1K0B A;  3FW2 A;  4DSQ A;  1VGL A;  4K7O A;  2X49 A;  2PER A;  1QK8 A;  4K7I A;  3F3R A;  3LOR A;  2R5G A;  3TKP A;  2GZY A;  2L57 A;  1QUW A;  1K3O A;  2LUS A;  2WRT A;  2V1M A;  2REM A;  1O8X A;  1A8L A;  1SYX A;  1YEP A;  3ZRD A;  3DWV A;  5CRW A;  4BWQ A;  1ERT A;  2VCT A;  3G7I A;  3W8J A;  5G1K A;  2CZ2 A;  7GSS A;  2WGR A;  1PN9 A;  1X5D A;  2PVO C;  4WEY A;  1GLQ A;  5IMC A;  2X64 A;  3IRA A;  2R3X A;  5HR1 A;  1HD2 A;  3WT2 A;  4YAV A;  4L5O A;  2YCD A;  2X8H A;  3F4R A;  4ML6 A;  2VD0 A;  1C72 A;  5A5K A;  1VRS D;  2HLS A;  5GST A;  1JFU A;  2V2G A;  2AV4 A;  3DGQ A;  1Z7R A;  3EIN A;  1KEB A;  4KB3 A;  2WS2 A;  2GZZ A;  3GL3 A;  3ZFL A;  1R7H A;  4KW6 A;  4HI7 A;  1V57 A;  4IN0 A;  1EWX A;  4GTU A;  2B5E A;  2CX4 A;  2O8V B;  1RQM A;  1F37 A;  1M9A A;  5EL8 A;  4RQX A;  4I97 A;  2H73 A;  1PN0 A;  3QDN A;  3KGK A;  4IGJ A;  1XVQ A;  2XPD A;  2LJA A;  1NHY A;  3HVS A;  2IMK A;  4MF5 A;  3LYP A;  2MMN A;  2X8G A;  4K0G A;  1XW5 A;  1Y6E A;  3KH9 A;  3PPU A;  4OCF A;  2X8C A;  22GS A;  4ZBA A;  4AJ7 A;  1DBY A;  3KH7 A;  4Z2T A;  1PSQ A;  12GS A;  4O32 A;  2GSS A;  4BVY B;  6GSV A;  2HRK A;  4D73 A;  5HR0 A;  3GST A;  3ZML A;  2MBS A;  4PXO A;  2DJK A;  4L0W A;  3CSI A;  2B7K A;  2LQQ A;  1VF2 A;  2A4H A;  2IFQ B;  3BD2 A;  3QFA C;  3DML A;  1AIU A;  1AC1 A;  5J9C A;  3EMP A;  4Q5R A;  5JCG A;  3F6F A;  2GSR A;  2YNX A;  4KUN A;  4DEJ A;  2BTO T;  4OCE A;  4MH3 A;  3F0I A;  4X4J A;  4HS1 A;  5ECP B;  2RLI A;  3Q18 A;  3L9S A;  4AGS A;  2V32 A;  4GQC A;  5J41 A;  5AN1 A;  2IJY A;  2IMI A;  1QFN A;  4IP6 A;  2CVK A;  3D0Z A;  5ECM B;  3GTU B;  3APQ A;  4G10 A;  4G0K A;  1GTI A;  5G30 A;  2O85 A;  3LG6 A;  1GSQ A;  4CY8 A;  4XS6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...