2ALBA

Nmr structure of the n-terminal domain a of the glycoprotein chaperone erp57
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
113
structure length
113
Chain Sequence
SDVLELTDDNFESRISDTGSAGLMLVEFFAPWCGHCKRLAPEYEAAATRLKGIVPLAKVDCTANTNTCNKYGVSGYPTLKIFRDGEEAGAYDGPRTADGIVSHLKKQAGPASV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Protein disulfide-isomerase A3
publication title NMR structure of the N-terminal domain a of the glycoprotein chaperone ERp57
rcsb
total genus 28
structure length 113
sequence length 113
ec nomenclature ec 5.3.4.1: Protein disulfide-isomerase.
pdb deposition date 2005-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2albA00
1PL1A 3W8SA 3OR5A 4PUAA 2DIZA 5GAPD 3BBYA 5CRHA 4KNDA 1WP0A 3CSJA 4CHSA 5J5NA 2FCHA 2C0FA 4HJMA 2H1AA 1WE0A 2K9FA 4K9ZA 2X8HA 5DVBA 2QSIA 4G10A 4XHMA 5J9CA 1PGTA 3QAWA 3ZLPA 4L8EA 2YV7A 4CW9A 2WS2A 1GWCA 3EMPA 4EC0A 4NXIA 6GSVA 4MABA 1LU4A 3WT1A 3WGXA 2TRCP 1TW9A 2OADA 1GUMA 3RHBA 3ZMLA 3Q6OA 3D5JA 3P8WA 2H74A 1F6MC 4RI6A 4ZB8A 1X5DA 3RBTA 1YF1A 1GLPA 2IIYA 4GSNA 3HCZA 2R2JA 3FYGA 5DJMA 4KCAA 4AF2A 1X5EA 3BCIA 4L0WA 1V40A 5LNKe 7GSSA 2H66A 1EV9A 2XHFA 4LL4B 3C71A 3R2QA 17GSA 1FHEA 4GCIA 5G2ZA 5B7CA 2YZHA 2NDOA 2NVLA 3ZL5A 3CBUA 3DRNA 2FA4A 2H30A 4KA0A 2C1YA 3GIXA 2V6OA 2IPAA 1B4PA 3CRUA 1T4YA 2LNTA 2CT6A 4RUVA 1GRXA 3UBLA 2QC7A 4K2DA 5AGYA 4ZL8A 1RW1A 1K0AA 4FH8A 4EF0A 2XBQA 2H70A 4N10A 1E2YA 4JE1A 1R5AA 1YJ6A 2DJ0A 1NW2A 4RI7A 4HZ2A 2H6ZA 2VLTA 3F4TA 3DD3A 5D9TA 2IJYA 3FZ9A 5J3RA 3VI7A 1PRXA 3IR4A 3UIWA 3GX0A 2CAIA 3FKFA 2DJKA 2D2ZA 2C4JA 3RHCA 1SL2B 2LJKA 4TXOA 4V2MA 1M2BA 2GQMA 2N5FA 2ZNMA 3WGEA 1I9DA 1OKTA 5LCZA 4PURA 2VL9A 2B3SA 4POKA 3VWUA 3CMIA 2MBSA 3CXGA 2MMNA 1SD8A 1U88A 3I9V2 3PINA 1FB0A 2LKUA 4DVCA 5IO2A 2RUEA 3ERGA 4NV5A 8GSSA 2V41A 3JCML 1UC7A 3EURA 3FR6A 3KMOA 1LJRA 3H93A 1X9SB 2YWMA 4I8BA 2P5QA 1THXA 4IJIA 5IOWA 3G9BA 5D96A 2X8CA 2H01A 4MCUA 4XIHA 3IXRA 1A8LA 4IKHA 4MZCA 4NV2A 4EKZA 4MJCA 5IPHA 2H0GA 1TU8A 1K0DA 4IBPA 5J4UA 1A0FA 1MDJA 3D4MA 2DSAA 3KD0A 1PSQA 1B48A 2WCIA 2WGRA 3LXZA 2PVOC 3TJJA 3IRAA 2PMTA 1OC9A 1XFLA 1TK5B 2GZPA 3GL3A 4F82A 4ECJA 5ELGA 2TIRA 3VURA 1KNGA 3KIJA 1QUWA 3J7Yb 3M1GA 1MDKA 1XWAA 2P31A 5JCGA 1UVZA 3ZVJA 1PN9A 1GSQA 5JCUA 2ON5A 3F63A 1XW5A 3ERFA 5A4VA 1GUKA 1PA3A 5IIZA 1N8JA 4HOJA 1W4VA 4MH2A 4RQXA 5G5FA 1LBKA 1FAAA 4LMWA 1Z3EA 5ELAA 1ZMAA 3IAM2 3TKSC 3HKRA 3KP9A 4GSTA 2OJLA 1QQ2A 4D73B 3C8EA 3IC4A 3GH6A 4WETA 6GSXA 4BPYA 3TJGA 3TKPA 1OE7A 2L59A 3DKSA 3L9SA 5CP1A 6GSSA 5IMVA 1TI3A 2H75A 2XPDA 1ERVA 3GUSA 4XS6A 3H4KA 3PR8A 2YPMA 1GP1A 2GVPA 3D21A 14GSA 1XXUA 4IGJA 2H8LA 4LA1A 6GSYA 2PBJA 3A2VA 20GSA 2PU9C 2C8UA 2YV9A 5B8BA 3Q19A 10GSA 5D8IA 13GSA 2YJHA 3K8NA 1ZYEA 2KUCA 4MJBA 1QK8A 5IO0A 5B6NA 1ZGNA 4K7OA 5C04A 1M9BA 3A2XA 1TI1A 4WF4A 1SJZA 4ID0A 4OCEA 4IQAA 4N0ZA 1UA5A 1FB6A 4TKYA 5G30A 1U3IA 4ILFA 3ED3A 3HZ8A 4JU5A 1M2DA 4K6XA 3A3TA 1FW1A 5B6MA 19GSA 2DBCA 2AJQB 1HNBA 2ES7A 4YQUA 4XTSA 2PGTA 2VIMA 1AQWA 1M0UA 4MH3A 3QAVA 2QKEA 2WFCA 2OE1A 2KOKA 3FEUA 4ACSA 2X64A 4ZXGA 3WD6A 1A23A 2RM6A 1EGOA 4RQRA 2P5RA 1A0RP 1ERWA 2BMXA 1Y6EA 3UL3A 4YH2A 3VFIA 4IW9A 2KLXA 1SYRA 4I2TA 2EIOA 4KSOA 5EVOA 2L6DA 4GQFA 5EY6A 1TJDA 2AYTA 3UOMA 2JADA 2HZFA 1YKAA 2DJJA 4PUFC 1VF3A 1XVWA 5JWQB 5B8AA 1ACVA 3UJ1A 3P2AA 5DCGA 4KDXA 3GSTA 5CREA 2MYGA 3TJFA 2L5OA 2HFDA 3WT2A 4V2NA 3KMNA 3HD5A 3TCOA 1URMA 1KBNA 9GSSA 1FO5A 2FNOA 1O8WA 4WR4A 3S9FA 4XS4A 4AJ8A 2VL2C 5A4UA 3BJ5A 4ZBBA 2K18A 1BYEA 4Q5QA 5JWOB 3TKQA 1NHOA 3F4SA 2LS5A 1YQ1A 5H5QA 2LRCA 5F8BA 3F0IA 1HNAA 5F06A 1DBYA 2OACA 4GLTA 3GKKA 4N11A 2JZRA 5DJLA 3ZVJD 3VWVA 5DQYA 2H19A 5GSSA 2F8FA 4DSSA 3F8UA 3MWHA 4GXZA 4WBJA 2VO4A 1X9MB 5G31A 2O89A 4IJ3A 3LQ7A 2L4QA 2B6MA 2N5AA 1MDIA 2CV4A 3TOUA 2IL3A 2I9HA 2MMZA 5J9BA 1DSBA 2YZUA 5F05A 2VL2A 3EU3A 4EE0A 3EWLA 1GSSA 1YY7A 1K3OA 4F0CA 4X0XA 4JRRA 1VGLA 4YQVA 1XVQA 5A4WA 2C3QA 4POBA 4TR0A 2E0QA 5IMFA 3GFKA 11GSA 1ZL9A 3KCMA 3EE2A 4HQSA 4IVFA 3TKSE 5GZZB 2DJ1A 1H75A 1WWJA 2B5EA 5DAKB 1ERUA 4DEJA 2WB9A 4DSSB 3I69A 3QR6A 5DDLA 1NM3A 1Y25A 1YDKA 4HEA2 1O6JA 4MP4A 3DMLA 2LRNA 16GSA 2L5LA 4IQ1A 4O32A 3J7Yk 3VPTA 2YP6A 4MK3A 2MMOA 1R26A 2HRFA 4GRFA 3IPZA 3NIVA 4ECCA 2AV4A 3FR9A 4G19A 4GQCA 1PKWA 2VCWA 1TRVA 4Z7XA 4AGSA 2LEGA 1M99A 4KUNA 3W8JA 3G7IA 2DMMA 3HY2A 1RQMA 3LWAA 5ECOB 5ID2B 3KGKA 1XW9A 3ZZXA 5IOXA 2VCQA 2R4VA 3DGQA 3IOSA 4O7HA 3EU4A 1SK1A 2FLSA 2CZ2A 2JL4A 3IDVA 1YEPA 2OE0A 2J9HA 1K0OA 2P0GA 1TKDB 1GSUA 1EEMA 2B5YA 5E4WA 2LRTA 1T8EB 1BQ7A 4NHZA 4OCFA 1RK4A 4PX1A 3ME8A 1JLWA 3APSA 2GDRA 4DSQA 5DQSA 3KH9A 4O5RA 1SKSB 5JWRB 3LYPA 1K0CA 2KP2A 1WOUA 1EP7A 2LSTA 3ZMKA 4K7IA 3IHQA 1SK0A 3DYRA 2LTKA 1XOAA 4FO5A 2H1GA 4L5OA 5CRGA 3E3EA 3DWVA 1ABAA 3GRXA 2B1LA 3C1SA 2QGVA 5ECLB 2OBIA 4DSRA 1BEDA 1J9BA 1BAYA 3P90A 2O8VB 4GF0A 4ZL9A 4Q5FA 1AAZA 2VD1A 1ZZYA 2C3TA 3FW2A 4I2UA 2L57A 2B7JA 3APOA 3FR3A 4N30A 1XZOA 3ERWA 4IHUA 4HQZA 1ST9A 2F8AA 4F9ZA 5ABRA 2AUVA 1V57A 1QXHA 2LQQA 2WJUA 1O8XA 4PQHA 5AISA 4EL1A 1XW6A 2PPTA 1XWKA 1MEKA 2CX4A 3QFAC 4J57E 2YWNA 3U5RE 3LORA 4PNFA 1USBA 3ZFBA 3HVXA 3KXOA 3WYWA 1TDIA 2DC5A 1T4ZA 5DCHA 4MZWA 1VF2A 4D73A 1AUCA 3D6IA 1PMTA 2YCDA 2MMAA 4HS1A 2O85A 2IMKA 2H1DA 3FZ4A 2J23A 2ZUPA 3HJMA 1S3DA 1XWBA 4WXTA 4G2EA 4ZL7A 2KP1A 3HDCA 4TRXA 4BVXA 1Z5YE 4QL7A 1SYXA 4XRAA 2G2QA 2R5GA 3PGTA 4MA9A 3WGDA 2DIYA 4KX4A 1JZDA 2L6CA 1QMVA 1ZCPA 1R7HA 1A24A 3DEXA 4MZBA 4K7NA 1V9WA 2LUSA 4HZ4A 4MF5A 1SKWB 5HR3A 2KHPA 5J41A 1N2AA 3F3QA 2B7KA 4KGIA 4MLYA 3HVVA 2OKAA 4OD7A 1EV4A 3BD2A 1NHYA 2XC2A 2O7KA 4HU7A 3VWXA 1M7TA 2REMA 1MD3A 1TOFA 1T1VA 3UAPA 4LLRA 1YEXA 1PL2A 1U6TA 4JEDA 2DLXA 5ECIB 2HZEB 1BG5A 4MMMA 2ALBA 1A2JA 4K0NA 4WEYA 5IMAA 4TN8A 1ML6A 3GTUA 4F03A 3CSIA 4OMVA 5DALA 1JHBA 1PX6A 1B9YC 3VWWA 5LD0A 5ECQB 5IQYA 4V1Ag 3LG6A 1THOA 2FWFA 1XOBA 3VPQA 3RPPA 3GA4A 5E59A 1OC8A 2F9SA 1MD4A 3LXTA 1F2EA 4XS1A 5CYYA 2VM2A 2VCTA 2A2SA 3GX8A 2GT5A 4MDCA 5D9VA 2CVBA 3A5WA 5AIVA 1S3CA 4POLA 2NTOA 3TKSA 4YAPA 5H5SA 3GL5A 5GAND 2GLRA 3FRCA 3H1NA 1OYJA 3EVIA 2R37A 5CAXA 2JACA 1GSEA 4L0UA 4ECIA 3GTUB 2H0HA 5DALB 4ML6A 4K0GA 1E6BA 1GLQA 1DUGA 4KH7A 3IBHA 6GSTA 1UN2A 3GN3A 4ZB9A 2N5BA 2HNLA 3TRPA 4QL9A 4HU9A 1KTEA 3D0ZA 1GUHA 4KB3A 5IMDA 3F6FA 1M9AA 5AN1A 3IAS2 4E8HA 4J56E 4Q5NA 2L4CA 4KDUA 1GSYA 3KM6A 3HVSA 2HXKA 1K3LA 3TJBA 4HI7A 3HJPA 3KJYA 4K8MA 3RPNA 2HE3A 1O81A 2VUPA 1HD2A 1XBSA 3UARA 2A4VA 5ECNB 3QDNA 3W6GA 6GSWA 2M80A 1WIKA 5G5EA 3EINA 1SKRB 5DBQA 3N5OA 1B4QA 4ZILA 3LSZA 1VF4A 1PKZA 6GSUA 3HA9A 2VCZA 3O76A 5HFIA 2X8GA 4EXJA 1FVJA 2HRNA 3EC3A 3ZITA 3VLNA 3ME7A 4JZQA 2XBIA 4HJ2A 3QFBC 3ZTLA 2VL3A 4QQ7A 3LGCA 4KCEA 1QFNA 1AIUA 2GSSA 2WDUA 2H73A 2M46A 2LJAA 4P3YB 3VK9A 2R6KA 4MJEA 2NPBA 3FY7A 1SL0B 2AHEA 3GSSA 5DAKA 3MNGA 4OFTA 4NHWA 3NZNA 1K0NA 4V1Ap 3IK9A 1VF1A 5IM9A 1V98A 4MPFA 5HR1A 4F0BA 1OVNA 1O85A 3TOTA 2H1BA 1SK2A 1MTCA 2V6KA 1TTZA 2MBTA 1XIYA 2C80A 3ZIJA 2CA8A 1Z7PA 4E8EA 2A2RA 1H4OA 1J08A 1BX9A 2YOIA 2GQKA 1GSFA 1TK8B 3GV1A 2ZCTA 1DE1A 3ZFLA 2C3NA 4EUYA 3SWLA 1AC1A 1O73A 2IMDA 5ECSA 2VOCA 5HFGA 4AJ7A 2VLVA 4BWQA 1T3BA 1F9MA 5ID2A 1Q98A 3QOUA 3EMXA 3F3RA 3F9UA 3QD9A 1DE2A 2IMIA 2E7PA 3C1RA 1B9XC 1U3AA 2GSQA 3UBKA 1YKCA 3M0FA 3APQA 4N0VA 4IN0A 1PQNA 5ECRB 5IMCA 2YWIA 3FHKA 4EVMA 4JBBA 3KTBA 5KN3A 5ECMB 3Q18A 2RM5A 2AB6A 5ECPB 5F0GA 2YJ7A 1YF0A 2LJRA 4BL7A 3US3A 2I3YA 3MAKA 5COHA 1Z6MA 5KN1A 5ECKB 2IFQB 2YANA 2DMLA 3HXSA 1EP8A 4I97A 1G7OA 3RAZA 1HYUA 2CVDA 1K0MA 2F3MA 2IN3A 2JZSA 1HNCA 1EZKA 2EIQA 1W89A 2CX3A 2VLUA 3L4NA 2JZTA 4TR3A 1GNEA 4PXOA 4X1UA 4G9HA 4ISDA 3HJOA 1JLVA 5FWGA 1R4WA 2IMFA 3E9JB 2VD0A 3M3MA 4OO4A 2FA8A 1OC3A 2HLSA 1SU9A 4LMVA 3QPMA 4EDYA 1HQOA 3VI5A 3IA1A 2CAQA 4FIWA 3MSZA 4IELA 2CQ9A 2YWOA 3G7JA 3LEFA 2LV3A 4KDYA 1GSDA 3ZRDA 1ILOA 3CRTA 3GKMA 3QMXA 2HSYA 3DXBA 3L78A 1FG4A 3I6AA 3L9VA 2GGTA 4TR1A 1ZYQB 1XPVA 3FZ5A 1VRSD 3HHVA 3V1WA 1EGRA 3NOFA 1BJXA 2FWEA 3D4TA 2CVKA 4I6XA 1JZWA 1TRUA 1GTBA 4HDEA 4MF7A 4GSSA 2IWTA 1JFUA 4K1FA 2C0EA 4H86A 4FYBA 1WRYA 1M2AA 4NAXA 1G6YA 3D22A 2FUG2 1S3AA 2V32A 1TRSA 1GTAA 2HYXA 5JCWA 1SJIA 2H0IA 3IK7A 1TXXA 3BOAA 3LYKA 2XPEA 2E2MA 2VAFA 4TR1B 2M72A 4ZBDA 1ON4A 3IV4A 1ERTA 12GSA 1A2LA 3GKNA 2HT9A 3GKXA 3GMFA 4TR4A 2OBKA 2H6XA 4PQIA 3TRXA 1EWXA 1SENA 3TGZA 1IYHA 3FK8A 5GSTA 2GS3A 4L5LA 2GSTA 3CSHA 2ON7A 2WRTA 2G0FA 1Z6NA 3LFLA 2GSRA 2HZEA 1XWGA 4WBRD 3CTGA 2X99A 3KZQA 3LJRA 4TOPA 4LL1B 4JR4A 2MZCA 4WKWA 1F3BA 4KW6A 3TJKA 1J0FA 2GZZA 3M9KA 5KN0A 4TXOB 2BTOT 2DJ3A 3MDKA 2NBSA 2RIIA 3SBCA 3TRQA 3QAGA 2C0GA 4PNGA 4PGTA 4KSMA 1EOHA 1JZRA 1OKDA 4BVYA 2BJXA 4X43A 2K6VA 2GT6A 1GH2A 3BCKA 3O3TA 3P7XA 5AIXA 2C0DA 4HUAA 4NMUA 5ENUA 1WPIA 2WZ9A 1G6WA 3HZ4A 1KEBA 2PVQA 1C72A 1TP9A 1XCCA 5H5RA 2O87A 3KEBA 1TRWA 3IE3A 5HR2A 4IP1A 1CQHA 4IS0A 2H71A 2FWHA 5D93A 3F4RA 1TU7A 2PWJA 3F6DA 2F51A 3DIEA 3G7YA 2JSZA 1OC9B 4I5QA 3I43A 3ZIVA 1GTUA 2LQOA 3H79A 18GSA 3GH9A 2VCXA 2GZYA 1V2AA 4BWSA 5EL8A 3AY8A 4V2LA 3UEMA 1B8XA 4POMA 1EOGA 1GL8A 3U6VA 3DVWA 5FHIA 3EYTA 2EIRA 2OE3A 1YZXA 3UMAA 1QGVA 4EO3A 4F2IA 4MF6A 5HFKA 4ULXA 2B1KA 3ZREA 1Z7RA 2V1MA 1XWCA 1FVKA 3O6TA 3UVTA 5KN2A 4YAVA 1T7PB 2VCVA 1AW9A 1AQVA 3GNJA 5CNWA 1AXDA 3GHAA 4OFNA 4JR6A 4BA7A 3PH9A 1WJKA 4FYUA 4YQMA 1X0RA 4ZBAA 2YNXA 1NSWA 2HSHA 1O7UA 1G7EA 2I1UA 3DVXA 5C00A 4FYCA 1T00A 2PN8A 3M8NA 1X5CA 2PUKC 3N9JA 1K0BA 2FGXA 1F3AA 1PD21 5ECHB 5G1KA 1I5GA 1OE8A 1A2MA 3ZYWA 2JSYA 2YN1A 1SD9A 3FZAA 5CO3A 5D9XA 2TRXA 3RDWA 1WMJA 3M9JA 2V2GA 3L9UA 3L0HA 5HR0A 2HI7A 1GTIA 5KEJA 2B5XA 5FT3A 4ZB6A 2EC4A 2H76A 2RLIA 2PERA 2DJ2A 5D9WA 3KH7A 2VM1A 4AJ6A 4J2FA 2GQLA 5IPGA 3UVHA 2R3XA 3E0UA 3QCPA 3CYNA 4NWYA 4PQ1A 4GTUA 1ZOFA 1CQGA 4KE3A 4OWYA 1JZOA 5EPFA 2I81A 1GNWA 5L71A 4XCSA 1IYIA 4ECBA 5F07A 3TDGA 2FD3A 1X9WB 1OAZA 3KP8A 2JU5A 1FOVA 1EEJA 2WULA 3ISOA 2LNSA 3GYKA 3TUEA 2H6YA 1PX7A 4IP6A 4TXVA 4OO5A 2FHEA 4EDZA 3GURA 4WR5A 2GTUA 5IMZA 2OA7A 4ZIJA 1A8YA 4MJAA 2AAWA 5CRWA 3HYPA 2K8SA 4TW5A 4CDOA 4GWRA 2FY6A 4XRDA 5INYA 1TK0B 3CTFA 3Q74A 1K3YA 5G1LA 4OFMA 2H72A 2IFQA 1SL1B 4MPGA 5D73A 2K8VA 2IMEA 4ML1A 3H8QA 4TVEA 4Q5RA 5CRDA 1Q4JA 1V58A 1F37A 22GSA 4O92A 3KTLA 1U87A 1R5PA 1G0TA 4XS4B 4WF5A 1SJ6A 3A2WA 3TKRA 3C73A 2RUFA 2I4AA 4KAEA 1Z9HA 3TB2A 2FWGA 3C7MA 1AQXA 1GULA 5HQPA 2CZ3A 4NPBA 5A5KA 2E2GA 2Z9SA
chains in the Genus database with same CATH superfamily
1PL1A 3W8SA 3OR5A 3MYDA 4PUAA 2DIZA 5GAPD 3BBYA 5CRHA 4KNDA 1WP0A 3CSJA 4CHSA 5J5NA 2FCHA 2C0FA 4HJMA 2H1AA 1WE0A 2K9FA 4K9ZA 2X8HA 5DVBA 2QSIA 4G10A 4XHMA 5J9CA 1PGTA 3QAWA 3ZLPA 4L8EA 2YV7A 4CW9A 2WS2A 1GWCA 3EMPA 4EC0A 4NXIA 6GSVA 4MABA 1LU4A 3WT1A 3WGXA 2TRCP 1TW9A 2OADA 1GUMA 3RHBA 3ZMLA 3Q6OA 3D5JA 3P8WA 2H74A 1F6MC 4RI6A 4ZB8A 1X5DA 3RBTA 1YF1A 1GLPA 2IIYA 4GSNA 3HCZA 2R2JA 3FYGA 5DJMA 4KCAA 4AF2A 1X5EA 3BCIA 4L0WA 1V40A 5LNKe 7GSSA 2H66A 1EV9A 2XHFA 4LL4B 3C71A 3R2QA 4Z2UA 17GSA 1FHEA 4GCIA 5G2ZA 5B7CA 2YZHA 2NDOA 2NVLA 3ZL5A 3CBUA 3DRNA 2FA4A 2H30A 4KA0A 2C1YA 3GIXA 2V6OA 2IPAA 1B4PA 3CRUA 1T4YA 2LNTA 2CT6A 4RUVA 1GRXA 3UBLA 2QC7A 4K2DA 5AGYA 4ZL8A 1RW1A 1K0AA 3IC8A 4FH8A 4EF0A 2XBQA 2H70A 4N10A 1E2YA 4JE1A 1R5AA 1YJ6A 2DJ0A 1NW2A 4RI7A 4HZ2A 4EIQA 2H6ZA 2VLTA 3F4TA 3DD3A 5D9TA 2IJYA 3FZ9A 5J3RA 3VI7A 1PRXA 3IR4A 3UIWA 3GX0A 2CAIA 3FKFA 2DJKA 2D2ZA 2C4JA 3RHCA 1SL2B 2LJKA 4TXOA 4V2MA 1M2BA 2GQMA 2N5FA 2ZNMA 3WGEA 1I9DA 1OKTA 5LCZA 4PURA 2VL9A 2B3SA 4POKA 3VWUA 3CMIA 2MBSA 2UZ8A 3CXGA 2MMNA 1SD8A 1U88A 3I9V2 3PINA 1FB0A 2LKUA 4DVCA 5IO2A 2RUEA 3ERGA 4NV5A 8GSSA 2V41A 3JCML 1UC7A 3EURA 3FR6A 3KMOA 1LJRA 3H93A 1X9SB 2YWMA 4I8BA 2P5QA 1THXA 4IJIA 5IOWA 3G9BA 5D96A 2X8CA 2H01A 4MCUA 4XIHA 3IXRA 1A8LA 4IKHA 4MZCA 4NV2A 4EKZA 4MJCA 5IPHA 2H0GA 1TU8A 1K0DA 4IBPA 5J4UA 1A0FA 1MDJA 3D4MA 2DSAA 3KD0A 1PSQA 1B48A 2WCIA 2WGRA 3LXZA 2PVOC 3TJJA 3IRAA 2PMTA 1OC9A 1XFLA 1TK5B 2GZPA 3GL3A 4F82A 4ECJA 5ELGA 2TIRA 3VURA 1KNGA 3KIJA 1QUWA 3J7Yb 4ICYA 3M1GA 1MDKA 1XWAA 2P31A 5JCGA 1UVZA 3ZVJA 1PN9A 1GSQA 5JCUA 2ON5A 3F63A 1XW5A 3ERFA 5A4VA 1GUKA 1PA3A 5IIZA 1N8JA 4HOJA 1W4VA 4MH2A 4RQXA 5G5FA 1LBKA 1FAAA 4LMWA 1Z3EA 5ELAA 1ZMAA 3IAM2 3TKSC 3HKRA 3KP9A 4GSTA 2OJLA 1QQ2A 4D73B 3C8EA 3IC4A 3GH6A 4WETA 6GSXA 4BPYA 3TJGA 3TKPA 1OE7A 2L59A 3DKSA 3L9SA 5CP1A 6GSSA 5IMVA 1TI3A 2H75A 2XPDA 1ERVA 3GUSA 4XS6A 3H4KA 3PR8A 2X49A 2YPMA 1GP1A 4Z2TA 2GVPA 3D21A 14GSA 1XXUA 4IGJA 4BVXB 2H8LA 4LA1A 6GSYA 2PBJA 3A2VA 20GSA 2PU9C 2C8UA 2YV9A 5B8BA 3Q19A 4MNNA 10GSA 5D8IA 13GSA 2YJHA 3K8NA 1ZYEA 4K2XA 2KUCA 4MJBA 1QK8A 5IO0A 5B6NA 1ZGNA 4K7OA 5C04A 1M9BA 3A2XA 1TI1A 4WF4A 1SJZA 4ID0A 4OCEA 4IQAA 4N0ZA 1UA5A 1FB6A 4TKYA 5G30A 1U3IA 4ILFA 3ED3A 3HZ8A 4JU5A 1M2DA 4K6XA 3A3TA 4G0KA 1FW1A 5B6MA 1FOHA 19GSA 2DBCA 2AJQB 1HNBA 2ES7A 4YQUA 4XTSA 2PGTA 2HRKA 2VIMA 1AQWA 1M0UA 4MH3A 3QAVA 2QKEA 2WFCA 2OE1A 2KOKA 3FEUA 4ACSA 2X64A 4ZXGA 3WD6A 1A23A 2RM6A 1EGOA 1PFOA 4RQRA 2P5RA 1A0RP 1ERWA 2BMXA 1Y6EA 3UL3A 4YH2A 3VFIA 4IW9A 2KLXA 1SYRA 4I2TA 2EIOA 4KSOA 5EVOA 2L6DA 4GQFA 5EY6A 1TJDA 2AYTA 3UOMA 2JADA 2HZFA 1YKAA 2DJJA 4PUFC 1VF3A 1XVWA 5JWQB 5B8AA 1ACVA 3UJ1A 3P2AA 5DCGA 4KDXA 3GSTA 5CREA 2MYGA 3TJFA 2L5OA 2HFDA 3WT2A 4V2NA 3FMWA 3KMNA 3HD5A 3TCOA 1URMA 1KBNA 9GSSA 1FO5A 2FNOA 1O8WA 4WR4A 3S9FA 4XS4A 4AJ8A 2VL2C 5A4UA 3BJ5A 4ZBBA 2K18A 1BYEA 3MIXA 4Q5QA 5JWOB 3TKQA 1NHOA 3F4SA 2LS5A 1YQ1A 5H5QA 2LRCA 5F8BA 3F0IA 1HNAA 5F06A 1DBYA 2OACA 4GLTA 3GKKA 2DKHA 2JZRA 4N11A 5DJLA 3ZVJD 3VWVA 5DQYA 2H19A 5KOWA 5GSSA 2F8FA 4USSA 4DSSA 3F8UA 3MWHA 4GXZA 4WBJA 2VO4A 1X9MB 5G31A 2O89A 4IJ3A 3LQ7A 2L4QA 2B6MA 2N5AA 1MDIA 2CV4A 3TOUA 2IL3A 2I9HA 2MMZA 5J9BA 1DSBA 2YZUA 5BRTA 5F05A 2VL2A 3EU3A 4Z2RA 4EE0A 3EWLA 1GSSA 1YY7A 1K3OA 4F0CA 4X0XA 4JRRA 1VGLA 4YQVA 1XVQA 5A4WA 2C3QA 4POBA 4TR0A 2E0QA 5IMFA 3GFKA 11GSA 1ZL9A 2A2PA 3KCMA 3EE2A 4HQSA 4IVFA 3TKSE 5GZZB 2DJ1A 1H75A 1WWJA 2B5EA 5DAKB 1ERUA 4DEJA 2WB9A 4DSSB 3I69A 3QR6A 5DDLA 1NM3A 1Y25A 1YDKA 4HEA2 1O6JA 2HSMA 4MP4A 3DMLA 2LRNA 16GSA 2L5LA 4IQ1A 4O32A 3J7Yk 3VPTA 2YP6A 4MK3A 2MMOA 1R26A 2HRFA 4GRFA 3IPZA 3NIVA 4ECCA 2AV4A 3FR9A 4G19A 4GQCA 1PKWA 2VCWA 1TRVA 4Z7XA 4AGSA 2LEGA 1M99A 4KUNA 3W8JA 3G7IA 2DMMA 3HY2A 1RQMA 3LWAA 5ECOB 5ID2B 3KGKA 1XW9A 3ZZXA 5IOXA 2VCQA 2R4VA 1ZYPA 3DGQA 3IOSA 4O7HA 3EU4A 1SK1A 2FLSA 2CZ2A 2JL4A 3IDVA 1YEPA 2OE0A 2J9HA 1K0OA 2P0GA 1TKDB 1GSUA 1EEMA 2B5YA 5E4WA 2LRTA 1T8EB 1BQ7A 4NHZA 4OCFA 1RK4A 4PX1A 2R0GA 3ME8A 1JLWA 3APSA 2GDRA 4DSQA 5DQSA 3KH9A 4O5RA 1SKSB 5JWRB 3LYPA 1K0CA 2KP2A 1WOUA 1EP7A 2LSTA 3ZMKA 4K7IA 3IHQA 1SK0A 3DYRA 2LTKA 4FQUA 1XOAA 4FO5A 2H1GA 4L5OA 5CRGA 3E3EA 3DWVA 1ABAA 3GRXA 2B1LA 3C1SA 2QGVA 5ECLB 2OBIA 4DSRA 1BEDA 1J9BA 1BAYA 3P90A 2O8VB 4GF0A 4ZL9A 4Q5FA 1AAZA 2VD1A 1ZZYA 2C3TA 3FW2A 4I2UA 2L57A 2B7JA 3APOA 3FR3A 4N30A 1XZOA 3ERWA 4IHUA 4HQZA 1ST9A 2F8AA 4F9ZA 5ABRA 3CQFA 2AUVA 1V57A 1QXHA 2LQQA 2WJUA 1O8XA 4PQHA 5AISA 4EL1A 1XW6A 2PPTA 1XWKA 1MEKA 3IHGA 2CX4A 3QFAC 4J57E 2YWNA 3U5RE 3LORA 2A4HA 4PNFA 1USBA 3ZFBA 3HVXA 3KXOA 3WYWA 1TDIA 2DC5A 1T4ZA 5DCHA 4MZWA 1VF2A 4D73A 1AUCA 3D6IA 1PMTA 2YCDA 2MMAA 4HS1A 2O85A 2IMKA 2H1DA 3FZ4A 2J23A 2ZUPA 3HJMA 1S3DA 1XWBA 4WXTA 4G2EA 4ZL7A 2KP1A 3HDCA 4TRXA 4BVXA 1Z5YE 4QL7A 1SYXA 4XRAA 2G2QA 2R5GA 3PGTA 4MA9A 3WGDA 2DIYA 4KX4A 1JZDA 2L6CA 1QMVA 1ZCPA 1R7HA 1A24A 3DEXA 4MZBA 4K7NA 1V9WA 2LUSA 4HZ4A 4MF5A 1SKWB 5HR3A 2KHPA 5J41A 1N2AA 3F3QA 2B7KA 4KGIA 4MLYA 3HVVA 2OKAA 4OD7A 1EV4A 3BD2A 1NHYA 2XC2A 2O7KA 4HU7A 3VWXA 1M7TA 4PTSA 2REMA 1MD3A 1TOFA 1T1VA 3EPTA 3UAPA 4LLRA 1YEXA 1PL2A 1U6TA 4JEDA 2DLXA 5ECIB 2HZEB 1BG5A 4MMMA 2ALBA 1A2JA 4K0NA 4WEYA 5IMAA 4TN8A 1ML6A 3GTUA 4F03A 3CSIA 4OMVA 5DALA 1JHBA 1PX6A 1B9YC 3VWWA 5LD0A 5ECQB 5IQYA 4V1Ag 3LG6A 1THOA 2FWFA 1XOBA 5KOXA 3VPQA 3RPPA 3GA4A 5E59A 1OC8A 2F9SA 1MD4A 3LXTA 1F2EA 4XS1A 5CYYA 2VM2A 4BVYB 2VCTA 1S3RA 2A2SA 3GX8A 2GT5A 4MDCA 5D9VA 2CVBA 3A5WA 5AIVA 1S3CA 4POLA 2NTOA 3TKSA 4YAPA 5H5SA 3GL5A 5GAND 2GLRA 3FRCA 3H1NA 1OYJA 3EVIA 2R37A 5CAXA 2JACA 1GSEA 4L0UA 4ECIA 3GTUB 2H0HA 5DALB 4ML6A 4K0GA 1ZYNA 1E6BA 1GLQA 1DUGA 4KH7A 3PPUA 3IBHA 6GSTA 1UN2A 3GN3A 4ZB9A 2N5BA 2HNLA 3TRPA 4QL9A 4HU9A 1KTEA 3D0ZA 1GUHA 4KB3A 5IMDA 3F6FA 1M9AA 5AN1A 3IAS2 4E8HA 4J56E 4Q5NA 2L4CA 4KDUA 1GSYA 3KM6A 3HVSA 2HXKA 1K3LA 3TJBA 4HI7A 3HJPA 3KJYA 4K8MA 3RPNA 2HE3A 1O81A 2VUPA 1HD2A 1XBSA 3UARA 2A4VA 3QDNA 5ECNB 3W6GA 6GSWA 2M80A 1WIKA 5G5EA 3EINA 1SKRB 5DBQA 3N5OA 1B4QA 4ZILA 3LSZA 1VF4A 1PKZA 6GSUA 3HA9A 2VCZA 3O76A 5HFIA 2X8GA 4EXJA 1FVJA 2HRNA 3EC3A 3ZITA 3VLNA 3ME7A 4JZQA 4EIPA 2XBIA 4HJ2A 3QFBC 3ZTLA 4KF9A 2VL3A 4QQ7A 3LGCA 4KCEA 1QFNA 1AIUA 2GSSA 2WDUA 2H73A 2M46A 2LJAA 4P3YB 3VK9A 2R6KA 4MJEA 2NPBA 3FY7A 1SL0B 2AHEA 3GSSA 5DAKA 3MNGA 4OFTA 4NHWA 4BIKA 3NZNA 1K0NA 4V1Ap 3IK9A 1VF1A 5IM9A 1V98A 4MPFA 5HR1A 4F0BA 1OVNA 1O85A 3TOTA 2H1BA 1SK2A 1MTCA 2V6KA 1TTZA 2MBTA 1XIYA 2C80A 3ZIJA 2CA8A 1Z7PA 4E8EA 2A2RA 1H4OA 1J08A 1BX9A 2YOIA 2GQKA 1GSFA 1TK8B 3GV1A 2ZCTA 1DE1A 3ZFLA 2C3NA 4EUYA 3SWLA 1AC1A 1O73A 2IMDA 5ECSA 2VOCA 5HFGA 4AJ7A 2VLVA 4BWQA 1T3BA 1F9MA 5ID2A 1Q98A 3QOUA 3EMXA 3F3RA 3F9UA 3QD9A 4O5UA 1DE2A 2IMIA 2E7PA 3C1RA 1B9XC 1U3AA 2GSQA 3UBKA 1YKCA 3M0FA 3APQA 4N0VA 4IN0A 1PQNA 5ECRB 5IMCA 2YWIA 3FHKA 4EVMA 4JBBA 3KTBA 5KN3A 4G0IA 4HSCX 5ECMB 3Q18A 2RM5A 2X4AA 2AB6A 5ECPB 5F0GA 4CY8A 2YJ7A 1YF0A 4K5RA 2LJRA 4BL7A 3US3A 2I3YA 3A5IA 3MAKA 5COHA 1Z6MA 5KN1A 5ECKB 2IFQB 2YANA 4G0LA 2DMLA 3HXSA 1EP8A 4I97A 1G7OA 3RAZA 1HYUA 2CVDA 1K0MA 2F3MA 2IN3A 2JZSA 1HNCA 1EZKA 2EIQA 1W89A 4O5QA 2CX3A 2VLUA 3L4NA 2JZTA 4TR3A 1GNEA 4PXOA 4X1UA 4G9HA 4ISDA 3HJOA 1JLVA 5FWGA 1R4WA 2IMFA 3E9JB 2VD0A 3M3MA 4OO4A 2FA8A 1OC3A 2HLSA 1SU9A 1M3JA 4LMVA 1M3IA 3QPMA 4EDYA 1HQOA 3VI5A 3IA1A 2CAQA 4FIWA 3MSZA 4IELA 2CQ9A 2YWOA 3G7JA 3LEFA 2LV3A 4KDYA 1GSDA 3ZRDA 1ILOA 3CRTA 3GKMA 3QMXA 2HSYA 3DXBA 3L78A 4BL7B 1FG4A 3I6AA 3L9VA 2GGTA 4TR1A 1ZYQB 1XPVA 3FZ5A 1VRSD 3HHVA 3V1WA 1EGRA 3NOFA 1BJXA 2FWEA 3D4TA 2CVKA 4I6XA 1JZWA 1TRUA 1GTBA 4CY6A 4HDEA 4MF7A 4GSSA 2IWTA 1JFUA 2R0PA 4K1FA 2C0EA 3LW9A 4H86A 4FYBA 1WRYA 1M2AA 4NAXA 1G6YA 3D22A 2FUG2 1S3AA 2V32A 1TRSA 1PN0A 1GTAA 2HYXA 5JCWA 1SJIA 2H0IA 3IK7A 1TXXA 3BOAA 3LYKA 2XPEA 2E2MA 2VAFA 4TR1B 2M72A 4ZBDA 1ON4A 3IV4A 1ERTA 12GSA 1A2LA 3GKNA 2HT9A 3GKXA 3GMFA 4TR4A 2OBKA 2H6XA 4PQIA 3TRXA 1EWXA 1SENA 3TGZA 1IYHA 3FK8A 5GSTA 2GS3A 4L5LA 2GSTA 4X4JA 3CSHA 2ON7A 2WRTA 2G0FA 1Z6NA 3LFLA 2GSRA 2HZEA 1XWGA 4WBRD 3CTGA 2X99A 3KZQA 3LJRA 4TOPA 4LL1B 4JR4A 2MZCA 4WKWA 1F3BA 4KW6A 3TJKA 1J0FA 2GZZA 3M9KA 4YKGA 5KN0A 4TXOB 2BTOT 2DJ3A 3MDKA 2NBSA 2RIIA 3SBCA 3TRQA 3QAGA 2C0GA 4PNGA 4PGTA 4KSMA 1EOHA 1JZRA 1OKDA 4BVYA 2BJXA 4X43A 1XG8A 2K6VA 2GT6A 1GH2A 3BCKA 3O3TA 3P7XA 5AIXA 2C0DA 4HUAA 4NMUA 5ENUA 1WPIA 2WZ9A 1G6WA 3HZ4A 1KEBA 2PVQA 2R0CA 1C72A 1TP9A 1XCCA 5H5RA 2O87A 3KEBA 1TRWA 3IE3A 5HR2A 4IP1A 1CQHA 4IS0A 2H71A 2FWHA 5D93A 3F4RA 1TU7A 2PWJA 3F6DA 2F51A 3DIEA 3G7YA 2JSZA 1OC9B 4I5QA 3I43A 3ZIVA 1GTUA 2LQOA 3H79A 18GSA 3GH9A 2VCXA 2GZYA 1V2AA 4BWSA 5EL8A 3AY8A 4V2LA 3UEMA 1B8XA 4POMA 1EOGA 1GL8A 3U6VA 3DVWA 5FHIA 3EYTA 2EIRA 2OE3A 1YZXA 3UMAA 1QGVA 4EO3A 4F2IA 4MF6A 5HFKA 4ULXA 2B1KA 3ZREA 1Z7RA 2V1MA 1XWCA 1FVKA 2DKIA 3O6TA 3UVTA 5KN2A 4YAVA 1T7PB 2VCVA 3R3EA 1AW9A 4A5PA 1AQVA 3GNJA 5CNWA 1AXDA 3GHAA 4OFNA 4JR6A 4BA7A 3PH9A 1WJKA 4FYUA 4YQMA 1X0RA 4ZBAA 2YNXA 1NSWA 2HSHA 1O7UA 1G7EA 2I1UA 3DVXA 5C00A 4FYCA 1T00A 2PN8A 3M8NA 1X5CA 2PUKC 3N9JA 1K0BA 2FGXA 1F3AA 1PD21 5ECHB 5G1KA 1I5GA 1OE8A 1A2MA 3ZYWA 2JSYA 2YN1A 1SD9A 3FZAA 5CO3A 5D9XA 4YKFA 2TRXA 3RDWA 1WMJA 3M9JA 2V2GA 3L9UA 3L0HA 5HR0A 2HI7A 1GTIA 5KEJA 2B5XA 5FT3A 4ZB6A 2EC4A 2H76A 2RLIA 2PERA 2DJ2A 3HVNA 5D9WA 3KH7A 2VM1A 4AJ6A 4J2FA 2GQLA 5IPGA 3UVHA 2R3XA 3E0UA 3QCPA 4K5SA 3CYNA 4NWYA 4PQ1A 4GTUA 1ZOFA 1CQGA 4KE3A 4OWYA 1JZOA 5EPFA 2I81A 1GNWA 5L71A 4XCSA 1IYIA 4ECBA 5F07A 3TDGA 2FD3A 1X9WB 1OAZA 3KP8A 2JU5A 1FOVA 1EEJA 2WULA 3ISOA 2LNSA 3GYKA 3TUEA 2H6YA 1PX7A 4IP6A 4TXVA 4OO5A 2FHEA 4EDZA 3GURA 4WR5A 2GTUA 5IMZA 2OA7A 4ZIJA 1A8YA 4MJAA 2AAWA 5CRWA 3HYPA 2K8SA 4TW5A 4CDOA 4GWRA 2FY6A 4XRDA 5INYA 1TK0B 2QA2A 3CTFA 3Q74A 1K3YA 2QA1A 5G1LA 4OFMA 2H72A 2IFQA 1SL1B 4MPGA 5D73A 2K8VA 2IMEA 4ML1A 3H8QA 4TVEA 4Q5RA 5CRDA 1Q4JA 1V58A 1F37A 22GSA 4O92A 3KTLA 1U87A 1R5PA 1G0TA 4XS4B 4WF5A 1SJ6A 3A2WA 3TKRA 3C73A 2RUFA 2I4AA 5BMUA 4KAEA 1Z9HA 3TB2A 2FWGA 3C7MA 2HRAA 1AQXA 1GULA 5HQPA 2CZ3A 4NPBA 5A5KA 2E2GA 2Z9SA
chains in the Genus database with same CATH topology
1PL1A 3W8SA 3OR5A 3MYDA 4PUAA 2DIZA 5GAPD 3BBYA 5CRHA 4KNDA 1WP0A 3CSJA 4CHSA 5J5NA 2FCHA 2C0FA 4HJMA 2H1AA 1WE0A 2K9FA 4K9ZA 2X8HA 5DVBA 2QSIA 4G10A 4XHMA 5J9CA 1PGTA 3QAWA 3ZLPA 4L8EA 2YV7A 4CW9A 2WS2A 1GWCA 3EMPA 4EC0A 4NXIA 6GSVA 4MABA 1LU4A 3WT1A 3WGXA 2TRCP 1TW9A 2OADA 1GUMA 3RHBA 3ZMLA 3Q6OA 3D5JA 3P8WA 2H74A 1F6MC 4RI6A 4ZB8A 1X5DA 3RBTA 1YF1A 1GLPA 2IIYA 4GSNA 3HCZA 2R2JA 3FYGA 5DJMA 4KCAA 4AF2A 1X5EA 3BCIA 4L0WA 1V40A 5LNKe 7GSSA 2H66A 1EV9A 2XHFA 4LL4B 3C71A 3R2QA 4Z2UA 17GSA 1FHEA 4GCIA 5G2ZA 5B7CA 2YZHA 2NDOA 2NVLA 3ZL5A 3CBUA 3DRNA 2FA4A 2H30A 4KA0A 2C1YA 3GIXA 2V6OA 2IPAA 1B4PA 3CRUA 1T4YA 2LNTA 2CT6A 4RUVA 1GRXA 3UBLA 2QC7A 4K2DA 5AGYA 4ZL8A 1RW1A 1K0AA 3IC8A 4FH8A 4EF0A 2XBQA 2H70A 4N10A 1E2YA 4JE1A 1R5AA 1YJ6A 2DJ0A 1NW2A 4RI7A 4HZ2A 4EIQA 2H6ZA 2VLTA 3F4TA 3DD3A 5D9TA 2IJYA 3FZ9A 5J3RA 3VI7A 1PRXA 3IR4A 3UIWA 3GX0A 2CAIA 3FKFA 2DJKA 2D2ZA 2C4JA 3RHCA 1SL2B 2LJKA 4TXOA 4V2MA 1M2BA 2GQMA 2N5FA 2ZNMA 3WGEA 1I9DA 1OKTA 5LCZA 4PURA 2VL9A 2B3SA 4POKA 3VWUA 3CMIA 2MBSA 2UZ8A 3CXGA 2MMNA 1SD8A 1U88A 3I9V2 3PINA 1FB0A 2LKUA 4DVCA 5IO2A 2RUEA 3ERGA 4NV5A 8GSSA 2V41A 3JCML 1UC7A 3EURA 3FR6A 3KMOA 1LJRA 3H93A 1X9SB 2YWMA 4I8BA 2P5QA 1THXA 4IJIA 5IOWA 3G9BA 5D96A 2X8CA 2H01A 4MCUA 4XIHA 3IXRA 1A8LA 4IKHA 4MZCA 4NV2A 4EKZA 4MJCA 5IPHA 2H0GA 1TU8A 1K0DA 4IBPA 5J4UA 1A0FA 1MDJA 3D4MA 2DSAA 3KD0A 1PSQA 1B48A 2WCIA 2WGRA 3LXZA 2PVOC 3TJJA 3IRAA 2PMTA 1OC9A 1XFLA 1TK5B 2GZPA 3GL3A 4F82A 4ECJA 5ELGA 2TIRA 3VURA 1KNGA 3KIJA 1QUWA 3J7Yb 4ICYA 3M1GA 1MDKA 1XWAA 2P31A 5JCGA 1UVZA 3ZVJA 1PN9A 1GSQA 5JCUA 2ON5A 3F63A 1XW5A 3ERFA 5A4VA 1GUKA 1PA3A 5IIZA 1N8JA 4HOJA 1W4VA 4MH2A 4RQXA 5G5FA 1LBKA 1FAAA 4LMWA 1Z3EA 5ELAA 1ZMAA 3IAM2 3TKSC 3HKRA 3KP9A 4GSTA 2OJLA 1QQ2A 4D73B 3C8EA 3IC4A 3GH6A 4WETA 6GSXA 4BPYA 3TJGA 3TKPA 1OE7A 2L59A 3DKSA 3L9SA 5CP1A 6GSSA 5IMVA 1TI3A 2H75A 2XPDA 1ERVA 3GUSA 4XS6A 3H4KA 3PR8A 2X49A 2YPMA 1GP1A 4Z2TA 2GVPA 3D21A 14GSA 1XXUA 4IGJA 4BVXB 2H8LA 4LA1A 6GSYA 2PBJA 3A2VA 20GSA 2PU9C 2C8UA 2YV9A 5B8BA 3Q19A 4MNNA 10GSA 5D8IA 13GSA 2YJHA 3K8NA 1ZYEA 4K2XA 2KUCA 4MJBA 1QK8A 5IO0A 5B6NA 1ZGNA 4K7OA 5C04A 1M9BA 3A2XA 1TI1A 4WF4A 1SJZA 4ID0A 4OCEA 4IQAA 4N0ZA 1UA5A 1FB6A 4TKYA 5G30A 1U3IA 4ILFA 3ED3A 3HZ8A 4JU5A 1M2DA 4K6XA 3A3TA 4G0KA 1FW1A 5B6MA 1FOHA 19GSA 2DBCA 2AJQB 1HNBA 2ES7A 4YQUA 4XTSA 2PGTA 2HRKA 2VIMA 1AQWA 1M0UA 4MH3A 3QAVA 2QKEA 2WFCA 2OE1A 2KOKA 3FEUA 4ACSA 2X64A 4ZXGA 3WD6A 1A23A 2RM6A 1EGOA 4RQRA 2P5RA 1A0RP 1ERWA 2BMXA 1Y6EA 3UL3A 4YH2A 3VFIA 4IW9A 2KLXA 1SYRA 4I2TA 2EIOA 4KSOA 5EVOA 2L6DA 4GQFA 5EY6A 1TJDA 2AYTA 3UOMA 2JADA 2HZFA 1YKAA 2DJJA 4PUFC 1VF3A 1XVWA 5JWQB 5B8AA 1ACVA 3UJ1A 3P2AA 5DCGA 4KDXA 3GSTA 5CREA 2MYGA 3TJFA 2L5OA 2HFDA 3WT2A 4V2NA 3FMWA 3KMNA 3HD5A 3TCOA 1URMA 1KBNA 9GSSA 1FO5A 2FNOA 1O8WA 4WR4A 3S9FA 4XS4A 4AJ8A 2VL2C 5A4UA 3BJ5A 4ZBBA 2K18A 1BYEA 3MIXA 4Q5QA 5JWOB 3TKQA 1NHOA 3F4SA 2LS5A 1YQ1A 5H5QA 2LRCA 5F8BA 3F0IA 1HNAA 5F06A 1DBYA 2OACA 4GLTA 3GKKA 2DKHA 2JZRA 4N11A 5DJLA 3ZVJD 3VWVA 5DQYA 2H19A 5KOWA 5GSSA 2F8FA 4USSA 4DSSA 3F8UA 3MWHA 4GXZA 4WBJA 2VO4A 1X9MB 5G31A 2O89A 4IJ3A 3LQ7A 2L4QA 2B6MA 2N5AA 1MDIA 2CV4A 3TOUA 2IL3A 2I9HA 2MMZA 5J9BA 1DSBA 2YZUA 5BRTA 5F05A 2VL2A 3EU3A 4Z2RA 4EE0A 3EWLA 1GSSA 1YY7A 1K3OA 4F0CA 4X0XA 4JRRA 1VGLA 4YQVA 1XVQA 5A4WA 2C3QA 4POBA 4TR0A 2E0QA 5IMFA 3GFKA 11GSA 1ZL9A 2A2PA 3KCMA 3EE2A 4HQSA 4IVFA 3TKSE 5GZZB 2DJ1A 1H75A 1WWJA 2B5EA 5DAKB 1ERUA 4DEJA 2WB9A 4DSSB 3I69A 3QR6A 5DDLA 1NM3A 1Y25A 1YDKA 4HEA2 1O6JA 2HSMA 4MP4A 3DMLA 2LRNA 16GSA 2L5LA 4IQ1A 4O32A 3J7Yk 3VPTA 2YP6A 4MK3A 2MMOA 1R26A 2HRFA 4GRFA 3IPZA 3NIVA 4ECCA 2AV4A 3FR9A 4G19A 4GQCA 1PKWA 2VCWA 1TRVA 4Z7XA 4AGSA 2LEGA 1M99A 4KUNA 3W8JA 3G7IA 2DMMA 3HY2A 1RQMA 3LWAA 5ECOB 5ID2B 3KGKA 1XW9A 3ZZXA 5IOXA 2VCQA 2R4VA 1ZYPA 3DGQA 3IOSA 4O7HA 3EU4A 1SK1A 2FLSA 2CZ2A 2JL4A 3IDVA 1YEPA 2OE0A 2J9HA 1K0OA 2P0GA 1TKDB 1GSUA 1EEMA 2B5YA 5E4WA 2LRTA 1T8EB 1BQ7A 4NHZA 4OCFA 1RK4A 4PX1A 2R0GA 3ME8A 1JLWA 3APSA 2GDRA 4DSQA 5DQSA 3KH9A 4O5RA 1SKSB 5JWRB 3LYPA 1K0CA 2KP2A 1WOUA 1EP7A 2LSTA 3ZMKA 4K7IA 3IHQA 1SK0A 3DYRA 2LTKA 4FQUA 1XOAA 4FO5A 2H1GA 4L5OA 5CRGA 3E3EA 3DWVA 1ABAA 3GRXA 2B1LA 3C1SA 2QGVA 5ECLB 2OBIA 4DSRA 1BEDA 1J9BA 1BAYA 3P90A 2O8VB 4GF0A 4ZL9A 4Q5FA 1AAZA 2VD1A 1ZZYA 2C3TA 3FW2A 4I2UA 2L57A 2B7JA 3APOA 3FR3A 4N30A 1XZOA 3ERWA 4IHUA 4HQZA 1ST9A 2F8AA 4F9ZA 5ABRA 2AUVA 1V57A 1QXHA 2LQQA 2WJUA 1O8XA 4PQHA 5AISA 4EL1A 1XW6A 2PPTA 1XWKA 1MEKA 3IHGA 2CX4A 3QFAC 4J57E 2YWNA 3U5RE 3LORA 2A4HA 4PNFA 1USBA 3ZFBA 3HVXA 3KXOA 3WYWA 1TDIA 2DC5A 1T4ZA 5DCHA 4MZWA 1VF2A 4D73A 1AUCA 3D6IA 1PMTA 2YCDA 2MMAA 4HS1A 2O85A 2IMKA 2H1DA 3FZ4A 2J23A 2ZUPA 3HJMA 1S3DA 1XWBA 4WXTA 4G2EA 4ZL7A 2KP1A 3HDCA 4TRXA 4BVXA 1Z5YE 4QL7A 1SYXA 4XRAA 2G2QA 2R5GA 3PGTA 4MA9A 3WGDA 2DIYA 4KX4A 1JZDA 2L6CA 1QMVA 1ZCPA 1R7HA 1A24A 3DEXA 4MZBA 4K7NA 1V9WA 2LUSA 4HZ4A 4MF5A 1SKWB 5HR3A 2KHPA 5J41A 1N2AA 3F3QA 2B7KA 4KGIA 4MLYA 3HVVA 2OKAA 4OD7A 1EV4A 3BD2A 1NHYA 2XC2A 2O7KA 4HU7A 3VWXA 1M7TA 4PTSA 2REMA 1MD3A 1TOFA 1T1VA 3EPTA 3UAPA 4LLRA 1YEXA 1PL2A 1U6TA 4JEDA 2DLXA 5ECIB 2HZEB 1BG5A 4MMMA 2ALBA 1A2JA 4K0NA 4WEYA 5IMAA 4TN8A 1ML6A 3GTUA 4F03A 3CSIA 4OMVA 5DALA 1JHBA 1PX6A 1B9YC 3VWWA 5LD0A 5ECQB 5IQYA 4V1Ag 3LG6A 1THOA 2FWFA 1XOBA 5KOXA 3VPQA 3RPPA 3GA4A 5E59A 1OC8A 2F9SA 1MD4A 3LXTA 1F2EA 4XS1A 5CYYA 2VM2A 4BVYB 2VCTA 2A2SA 3GX8A 2GT5A 4MDCA 5D9VA 2CVBA 3A5WA 5AIVA 1S3CA 4POLA 2NTOA 3TKSA 4YAPA 5H5SA 3GL5A 5GAND 2GLRA 3FRCA 3H1NA 1OYJA 3EVIA 2R37A 5CAXA 2JACA 1GSEA 4L0UA 4ECIA 3GTUB 2H0HA 5DALB 4ML6A 4K0GA 1ZYNA 1E6BA 1GLQA 1DUGA 4KH7A 3PPUA 3IBHA 6GSTA 1UN2A 3GN3A 4ZB9A 2N5BA 2HNLA 3TRPA 4QL9A 4HU9A 1KTEA 3D0ZA 1GUHA 4KB3A 5IMDA 3F6FA 1M9AA 5AN1A 3IAS2 4E8HA 4J56E 4Q5NA 2L4CA 4KDUA 1GSYA 3KM6A 3HVSA 2HXKA 1K3LA 3TJBA 4HI7A 3HJPA 3KJYA 4K8MA 3RPNA 2HE3A 1O81A 2VUPA 1HD2A 1XBSA 3UARA 2A4VA 3QDNA 5ECNB 3W6GA 6GSWA 2M80A 1WIKA 5G5EA 3EINA 1SKRB 5DBQA 3N5OA 1B4QA 4ZILA 3LSZA 1VF4A 1PKZA 6GSUA 3HA9A 2VCZA 3O76A 5HFIA 2X8GA 4EXJA 1FVJA 2HRNA 3EC3A 3ZITA 3VLNA 3ME7A 4JZQA 4EIPA 2XBIA 4HJ2A 3QFBC 3ZTLA 4KF9A 2VL3A 4QQ7A 3LGCA 4KCEA 1QFNA 1AIUA 2GSSA 2WDUA 2H73A 2M46A 2LJAA 4P3YB 3VK9A 2R6KA 4MJEA 2NPBA 3FY7A 1SL0B 2AHEA 3GSSA 5DAKA 3MNGA 4OFTA 4NHWA 3NZNA 1K0NA 4V1Ap 3IK9A 1VF1A 5IM9A 1V98A 4MPFA 5HR1A 4F0BA 1OVNA 1O85A 3TOTA 2H1BA 1SK2A 1MTCA 2V6KA 1TTZA 2MBTA 1XIYA 2C80A 3ZIJA 2CA8A 1Z7PA 4E8EA 2A2RA 1H4OA 1J08A 1BX9A 2YOIA 2GQKA 1GSFA 1TK8B 3GV1A 2ZCTA 1DE1A 3ZFLA 2C3NA 4EUYA 3SWLA 1AC1A 1O73A 2IMDA 5ECSA 2VOCA 5HFGA 4AJ7A 2VLVA 4BWQA 1T3BA 1F9MA 5ID2A 1Q98A 3QOUA 3EMXA 3F3RA 3F9UA 3QD9A 4O5UA 1DE2A 2IMIA 2E7PA 3C1RA 1B9XC 1U3AA 2GSQA 3UBKA 1YKCA 3M0FA 3APQA 4N0VA 4IN0A 1PQNA 5ECRB 5IMCA 2YWIA 3FHKA 4EVMA 4JBBA 3KTBA 5KN3A 4G0IA 5ECMB 3Q18A 2RM5A 2X4AA 2AB6A 5ECPB 5F0GA 4CY8A 2YJ7A 1YF0A 4K5RA 2LJRA 4BL7A 3US3A 2I3YA 3A5IA 3MAKA 5COHA 1Z6MA 5KN1A 5ECKB 2IFQB 2YANA 4G0LA 2DMLA 3HXSA 1EP8A 4I97A 1G7OA 3RAZA 1HYUA 2CVDA 1K0MA 2F3MA 2IN3A 2JZSA 1HNCA 1EZKA 2EIQA 1W89A 4O5QA 2CX3A 2VLUA 3L4NA 2JZTA 4TR3A 1GNEA 4PXOA 4X1UA 4G9HA 4ISDA 3HJOA 1JLVA 5FWGA 1R4WA 2IMFA 3E9JB 2VD0A 3M3MA 4OO4A 2FA8A 1OC3A 2HLSA 1SU9A 4LMVA 3QPMA 4EDYA 1HQOA 3VI5A 3IA1A 2CAQA 4FIWA 3MSZA 4IELA 2CQ9A 2YWOA 3G7JA 3LEFA 2LV3A 4KDYA 1GSDA 3ZRDA 1ILOA 3CRTA 3GKMA 3QMXA 2HSYA 3DXBA 3L78A 4BL7B 1FG4A 3I6AA 3L9VA 2GGTA 4TR1A 1ZYQB 1XPVA 3FZ5A 1VRSD 3HHVA 3V1WA 1EGRA 3NOFA 1BJXA 2FWEA 3D4TA 2CVKA 4I6XA 1JZWA 1TRUA 1GTBA 4CY6A 4HDEA 4MF7A 4GSSA 2IWTA 1JFUA 2R0PA 4K1FA 2C0EA 3LW9A 4H86A 4FYBA 1WRYA 1M2AA 4NAXA 1G6YA 3D22A 2FUG2 1S3AA 2V32A 1TRSA 1PN0A 1GTAA 2HYXA 5JCWA 1SJIA 2H0IA 3IK7A 1TXXA 3BOAA 3LYKA 2XPEA 2E2MA 2VAFA 4TR1B 2M72A 4ZBDA 1ON4A 3IV4A 1ERTA 12GSA 1A2LA 3GKNA 2HT9A 3GKXA 3GMFA 4TR4A 2OBKA 2H6XA 4PQIA 3TRXA 1EWXA 1SENA 3TGZA 1IYHA 3FK8A 5GSTA 2GS3A 4L5LA 2GSTA 4X4JA 3CSHA 2ON7A 2WRTA 2G0FA 1Z6NA 3LFLA 2GSRA 2HZEA 1XWGA 4WBRD 3CTGA 2X99A 3KZQA 3LJRA 4TOPA 4LL1B 4JR4A 2MZCA 4WKWA 1F3BA 4KW6A 3TJKA 1J0FA 2GZZA 3M9KA 4YKGA 5KN0A 4TXOB 2BTOT 2DJ3A 3MDKA 2NBSA 2RIIA 3SBCA 3TRQA 3QAGA 2C0GA 4PNGA 4PGTA 4KSMA 1EOHA 1JZRA 1OKDA 4BVYA 2BJXA 4X43A 2K6VA 2GT6A 1GH2A 3BCKA 3O3TA 3P7XA 5AIXA 2C0DA 4HUAA 4NMUA 5ENUA 1WPIA 2WZ9A 1G6WA 3HZ4A 1KEBA 2PVQA 2R0CA 1C72A 1TP9A 1XCCA 5H5RA 2O87A 3KEBA 1TRWA 3IE3A 5HR2A 4IP1A 1CQHA 4IS0A 2H71A 2FWHA 5D93A 3F4RA 1TU7A 2PWJA 3F6DA 2F51A 3DIEA 3G7YA 2JSZA 1OC9B 4I5QA 3I43A 3ZIVA 1GTUA 2LQOA 3H79A 18GSA 3GH9A 2VCXA 2GZYA 1V2AA 4BWSA 5EL8A 3AY8A 4V2LA 3UEMA 1B8XA 4POMA 1EOGA 1GL8A 3U6VA 3DVWA 5FHIA 3EYTA 2EIRA 2OE3A 1YZXA 3UMAA 1QGVA 4EO3A 4F2IA 4MF6A 5HFKA 4ULXA 2B1KA 3ZREA 1Z7RA 2V1MA 1XWCA 1FVKA 2DKIA 3O6TA 3UVTA 5KN2A 4YAVA 1T7PB 2VCVA 3R3EA 1AW9A 4A5PA 1AQVA 3GNJA 5CNWA 1AXDA 3GHAA 4OFNA 4JR6A 4BA7A 3PH9A 1WJKA 4FYUA 4YQMA 1X0RA 4ZBAA 2YNXA 1NSWA 2HSHA 1O7UA 1G7EA 2I1UA 3DVXA 5C00A 4FYCA 1T00A 2PN8A 3M8NA 1X5CA 2PUKC 3N9JA 1K0BA 2FGXA 1F3AA 1PD21 5ECHB 5G1KA 1I5GA 1OE8A 1A2MA 3ZYWA 2JSYA 2YN1A 1SD9A 3FZAA 5CO3A 5D9XA 4YKFA 2TRXA 3RDWA 1WMJA 3M9JA 2V2GA 3L9UA 3L0HA 5HR0A 2HI7A 1GTIA 5KEJA 2B5XA 5FT3A 4ZB6A 2EC4A 2H76A 2RLIA 2PERA 2DJ2A 5D9WA 3KH7A 2VM1A 4AJ6A 4J2FA 2GQLA 5IPGA 3UVHA 2R3XA 3E0UA 3QCPA 4K5SA 3CYNA 4NWYA 4PQ1A 4GTUA 1ZOFA 1CQGA 4KE3A 4OWYA 1JZOA 5EPFA 2I81A 1GNWA 5L71A 4XCSA 1IYIA 4ECBA 5F07A 3TDGA 2FD3A 1X9WB 1OAZA 3KP8A 2JU5A 1FOVA 1EEJA 2WULA 3ISOA 2LNSA 3GYKA 3TUEA 2H6YA 1PX7A 4IP6A 4TXVA 4OO5A 2FHEA 4EDZA 3GURA 4WR5A 2GTUA 5IMZA 2OA7A 4ZIJA 1A8YA 4MJAA 2AAWA 5CRWA 3HYPA 2K8SA 4TW5A 4CDOA 4GWRA 2FY6A 4XRDA 5INYA 1TK0B 2QA2A 3CTFA 3Q74A 1K3YA 2QA1A 5G1LA 4OFMA 2H72A 2IFQA 1SL1B 4MPGA 5D73A 2K8VA 2IMEA 4ML1A 3H8QA 4TVEA 4Q5RA 5CRDA 1Q4JA 1V58A 1F37A 22GSA 4O92A 3KTLA 1U87A 1R5PA 1G0TA 4XS4B 4WF5A 1SJ6A 3A2WA 3TKRA 3C73A 2RUFA 2I4AA 5BMUA 4KAEA 1Z9HA 3TB2A 2FWGA 3C7MA 2HRAA 1AQXA 1GULA 5HQPA 2CZ3A 4NPBA 5A5KA 2E2GA 2Z9SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PL1 A;  3W8S A;  3OR5 A;  4PUA A;  2DIZ A;  5GAP D;  3BBY A;  5CRH A;  4KND A;  1WP0 A;  3CSJ A;  4CHS A;  5J5N A;  2FCH A;  2C0F A;  4HJM A;  2H1A A;  1WE0 A;  2K9F A;  4K9Z A;  2X8H A;  5DVB A;  2QSI A;  4G10 A;  4XHM A;  5J9C A;  1PGT A;  3QAW A;  3ZLP A;  4L8E A;  2YV7 A;  4CW9 A;  2WS2 A;  1GWC A;  3EMP A;  4EC0 A;  4NXI A;  6GSV A;  4MAB A;  1LU4 A;  3WT1 A;  3WGX A;  2TRC P;  1TW9 A;  2OAD A;  1GUM A;  3RHB A;  3ZML A;  3Q6O A;  3D5J A;  3P8W A;  2H74 A;  1F6M C;  4RI6 A;  4ZB8 A;  1X5D A;  3RBT A;  1YF1 A;  1GLP A;  2IIY A;  4GSN A;  3HCZ A;  2R2J A;  3FYG A;  5DJM A;  4KCA A;  4AF2 A;  1X5E A;  3BCI A;  4L0W A;  1V40 A;  5LNK e;  7GSS A;  2H66 A;  1EV9 A;  2XHF A;  4LL4 B;  3C71 A;  3R2Q A;  17GS A;  1FHE A;  4GCI A;  5G2Z A;  5B7C A;  2YZH A;  2NDO A;  2NVL A;  3ZL5 A;  3CBU A;  3DRN A;  2FA4 A;  2H30 A;  4KA0 A;  2C1Y A;  3GIX A;  2V6O A;  2IPA A;  1B4P A;  3CRU A;  1T4Y A;  2LNT A;  2CT6 A;  4RUV A;  1GRX A;  3UBL A;  2QC7 A;  4K2D A;  5AGY A;  4ZL8 A;  1RW1 A;  1K0A A;  4FH8 A;  4EF0 A;  2XBQ A;  2H70 A;  4N10 A;  1E2Y A;  4JE1 A;  1R5A A;  1YJ6 A;  2DJ0 A;  1NW2 A;  4RI7 A;  4HZ2 A;  2H6Z A;  2VLT A;  3F4T A;  3DD3 A;  5D9T A;  2IJY A;  3FZ9 A;  5J3R A;  3VI7 A;  1PRX A;  3IR4 A;  3UIW A;  3GX0 A;  2CAI A;  3FKF A;  2DJK A;  2D2Z A;  2C4J A;  3RHC A;  1SL2 B;  2LJK A;  4TXO A;  4V2M A;  1M2B A;  2GQM A;  2N5F A;  2ZNM A;  3WGE A;  1I9D A;  1OKT A;  5LCZ A;  4PUR A;  2VL9 A;  2B3S A;  4POK A;  3VWU A;  3CMI A;  2MBS A;  3CXG A;  2MMN A;  1SD8 A;  1U88 A;  3I9V 2;  3PIN A;  1FB0 A;  2LKU A;  4DVC A;  5IO2 A;  2RUE A;  3ERG A;  4NV5 A;  8GSS A;  2V41 A;  3JCM L;  1UC7 A;  3EUR A;  3FR6 A;  3KMO A;  1LJR A;  3H93 A;  1X9S B;  2YWM A;  4I8B A;  2P5Q A;  1THX A;  4IJI A;  5IOW A;  3G9B A;  5D96 A;  2X8C A;  2H01 A;  4MCU A;  4XIH A;  3IXR A;  1A8L A;  4IKH A;  4MZC A;  4NV2 A;  4EKZ A;  4MJC A;  5IPH A;  2H0G A;  1TU8 A;  1K0D A;  4IBP A;  5J4U A;  1A0F A;  1MDJ A;  3D4M A;  2DSA A;  3KD0 A;  1PSQ A;  1B48 A;  2WCI A;  2WGR A;  3LXZ A;  2PVO C;  3TJJ A;  3IRA A;  2PMT A;  1OC9 A;  1XFL A;  1TK5 B;  2GZP A;  3GL3 A;  4F82 A;  4ECJ A;  5ELG A;  2TIR A;  3VUR A;  1KNG A;  3KIJ A;  1QUW A;  3J7Y b;  3M1G A;  1MDK A;  1XWA A;  2P31 A;  5JCG A;  1UVZ A;  3ZVJ A;  1PN9 A;  1GSQ A;  5JCU A;  2ON5 A;  3F63 A;  1XW5 A;  3ERF A;  5A4V A;  1GUK A;  1PA3 A;  5IIZ A;  1N8J A;  4HOJ A;  1W4V A;  4MH2 A;  4RQX A;  5G5F A;  1LBK A;  1FAA A;  4LMW A;  1Z3E A;  5ELA A;  1ZMA A;  3IAM 2;  3TKS C;  3HKR A;  3KP9 A;  4GST A;  2OJL A;  1QQ2 A;  4D73 B;  3C8E A;  3IC4 A;  3GH6 A;  4WET A;  6GSX A;  4BPY A;  3TJG A;  3TKP A;  1OE7 A;  2L59 A;  3DKS A;  3L9S A;  5CP1 A;  6GSS A;  5IMV A;  1TI3 A;  2H75 A;  2XPD A;  1ERV A;  3GUS A;  4XS6 A;  3H4K A;  3PR8 A;  2YPM A;  1GP1 A;  2GVP A;  3D21 A;  14GS A;  1XXU A;  4IGJ A;  2H8L A;  4LA1 A;  6GSY A;  2PBJ A;  3A2V A;  20GS A;  2PU9 C;  2C8U A;  2YV9 A;  5B8B A;  3Q19 A;  10GS A;  5D8I A;  13GS A;  2YJH A;  3K8N A;  1ZYE A;  2KUC A;  4MJB A;  1QK8 A;  5IO0 A;  5B6N A;  1ZGN A;  4K7O A;  5C04 A;  1M9B A;  3A2X A;  1TI1 A;  4WF4 A;  1SJZ A;  4ID0 A;  4OCE A;  4IQA A;  4N0Z A;  1UA5 A;  1FB6 A;  4TKY A;  5G30 A;  1U3I A;  4ILF A;  3ED3 A;  3HZ8 A;  4JU5 A;  1M2D A;  4K6X A;  3A3T A;  1FW1 A;  5B6M A;  19GS A;  2DBC A;  2AJQ B;  1HNB A;  2ES7 A;  4YQU A;  4XTS A;  2PGT A;  2VIM A;  1AQW A;  1M0U A;  4MH3 A;  3QAV A;  2QKE A;  2WFC A;  2OE1 A;  2KOK A;  3FEU A;  4ACS A;  2X64 A;  4ZXG A;  3WD6 A;  1A23 A;  2RM6 A;  1EGO A;  4RQR A;  2P5R A;  1A0R P;  1ERW A;  2BMX A;  1Y6E A;  3UL3 A;  4YH2 A;  3VFI A;  4IW9 A;  2KLX A;  1SYR A;  4I2T A;  2EIO A;  4KSO A;  5EVO A;  2L6D A;  4GQF A;  5EY6 A;  1TJD A;  2AYT A;  3UOM A;  2JAD A;  2HZF A;  1YKA A;  2DJJ A;  4PUF C;  1VF3 A;  1XVW A;  5JWQ B;  5B8A A;  1ACV A;  3UJ1 A;  3P2A A;  5DCG A;  4KDX A;  3GST A;  5CRE A;  2MYG A;  3TJF A;  2L5O A;  2HFD A;  3WT2 A;  4V2N A;  3KMN A;  3HD5 A;  3TCO A;  1URM A;  1KBN A;  9GSS A;  1FO5 A;  2FNO A;  1O8W A;  4WR4 A;  3S9F A;  4XS4 A;  4AJ8 A;  2VL2 C;  5A4U A;  3BJ5 A;  4ZBB A;  2K18 A;  1BYE A;  4Q5Q A;  5JWO B;  3TKQ A;  1NHO A;  3F4S A;  2LS5 A;  1YQ1 A;  5H5Q A;  2LRC A;  5F8B A;  3F0I A;  1HNA A;  5F06 A;  1DBY A;  2OAC A;  4GLT A;  3GKK A;  4N11 A;  2JZR A;  5DJL A;  3ZVJ D;  3VWV A;  5DQY A;  2H19 A;  5GSS A;  2F8F A;  4DSS A;  3F8U A;  3MWH A;  4GXZ A;  4WBJ A;  2VO4 A;  1X9M B;  5G31 A;  2O89 A;  4IJ3 A;  3LQ7 A;  2L4Q A;  2B6M A;  2N5A A;  1MDI A;  2CV4 A;  3TOU A;  2IL3 A;  2I9H A;  2MMZ A;  5J9B A;  1DSB A;  2YZU A;  5F05 A;  2VL2 A;  3EU3 A;  4EE0 A;  3EWL A;  1GSS A;  1YY7 A;  1K3O A;  4F0C A;  4X0X A;  4JRR A;  1VGL A;  4YQV A;  1XVQ A;  5A4W A;  2C3Q A;  4POB A;  4TR0 A;  2E0Q A;  5IMF A;  3GFK A;  11GS A;  1ZL9 A;  3KCM A;  3EE2 A;  4HQS A;  4IVF A;  3TKS E;  5GZZ B;  2DJ1 A;  1H75 A;  1WWJ A;  2B5E A;  5DAK B;  1ERU A;  4DEJ A;  2WB9 A;  4DSS B;  3I69 A;  3QR6 A;  5DDL A;  1NM3 A;  1Y25 A;  1YDK A;  4HEA 2;  1O6J A;  4MP4 A;  3DML A;  2LRN A;  16GS A;  2L5L A;  4IQ1 A;  4O32 A;  3J7Y k;  3VPT A;  2YP6 A;  4MK3 A;  2MMO A;  1R26 A;  2HRF A;  4GRF A;  3IPZ A;  3NIV A;  4ECC A;  2AV4 A;  3FR9 A;  4G19 A;  4GQC A;  1PKW A;  2VCW A;  1TRV A;  4Z7X A;  4AGS A;  2LEG A;  1M99 A;  4KUN A;  3W8J A;  3G7I A;  2DMM A;  3HY2 A;  1RQM A;  3LWA A;  5ECO B;  5ID2 B;  3KGK A;  1XW9 A;  3ZZX A;  5IOX A;  2VCQ A;  2R4V A;  3DGQ A;  3IOS A;  4O7H A;  3EU4 A;  1SK1 A;  2FLS A;  2CZ2 A;  2JL4 A;  3IDV A;  1YEP A;  2OE0 A;  2J9H A;  1K0O A;  2P0G A;  1TKD B;  1GSU A;  1EEM A;  2B5Y A;  5E4W A;  2LRT A;  1T8E B;  1BQ7 A;  4NHZ A;  4OCF A;  1RK4 A;  4PX1 A;  3ME8 A;  1JLW A;  3APS A;  2GDR A;  4DSQ A;  5DQS A;  3KH9 A;  4O5R A;  1SKS B;  5JWR B;  3LYP A;  1K0C A;  2KP2 A;  1WOU A;  1EP7 A;  2LST A;  3ZMK A;  4K7I A;  3IHQ A;  1SK0 A;  3DYR A;  2LTK A;  1XOA A;  4FO5 A;  2H1G A;  4L5O A;  5CRG A;  3E3E A;  3DWV A;  1ABA A;  3GRX A;  2B1L A;  3C1S A;  2QGV A;  5ECL B;  2OBI A;  4DSR A;  1BED A;  1J9B A;  1BAY A;  3P90 A;  2O8V B;  4GF0 A;  4ZL9 A;  4Q5F A;  1AAZ A;  2VD1 A;  1ZZY A;  2C3T A;  3FW2 A;  4I2U A;  2L57 A;  2B7J A;  3APO A;  3FR3 A;  4N30 A;  1XZO A;  3ERW A;  4IHU A;  4HQZ A;  1ST9 A;  2F8A A;  4F9Z A;  5ABR A;  2AUV A;  1V57 A;  1QXH A;  2LQQ A;  2WJU A;  1O8X A;  4PQH A;  5AIS A;  4EL1 A;  1XW6 A;  2PPT A;  1XWK A;  1MEK A;  2CX4 A;  3QFA C;  4J57 E;  2YWN A;  3U5R E;  3LOR A;  4PNF A;  1USB A;  3ZFB A;  3HVX A;  3KXO A;  3WYW A;  1TDI A;  2DC5 A;  1T4Z A;  5DCH A;  4MZW A;  1VF2 A;  4D73 A;  1AUC A;  3D6I A;  1PMT A;  2YCD A;  2MMA A;  4HS1 A;  2O85 A;  2IMK A;  2H1D A;  3FZ4 A;  2J23 A;  2ZUP A;  3HJM A;  1S3D A;  1XWB A;  4WXT A;  4G2E A;  4ZL7 A;  2KP1 A;  3HDC A;  4TRX A;  4BVX A;  1Z5Y E;  4QL7 A;  1SYX A;  4XRA A;  2G2Q A;  2R5G A;  3PGT A;  4MA9 A;  3WGD A;  2DIY A;  4KX4 A;  1JZD A;  2L6C A;  1QMV A;  1ZCP A;  1R7H A;  1A24 A;  3DEX A;  4MZB A;  4K7N A;  1V9W A;  2LUS A;  4HZ4 A;  4MF5 A;  1SKW B;  5HR3 A;  2KHP A;  5J41 A;  1N2A A;  3F3Q A;  2B7K A;  4KGI A;  4MLY A;  3HVV A;  2OKA A;  4OD7 A;  1EV4 A;  3BD2 A;  1NHY A;  2XC2 A;  2O7K A;  4HU7 A;  3VWX A;  1M7T A;  2REM A;  1MD3 A;  1TOF A;  1T1V A;  3UAP A;  4LLR A;  1YEX A;  1PL2 A;  1U6T A;  4JED A;  2DLX A;  5ECI B;  2HZE B;  1BG5 A;  4MMM A;  2ALB A;  1A2J A;  4K0N A;  4WEY A;  5IMA A;  4TN8 A;  1ML6 A;  3GTU A;  4F03 A;  3CSI A;  4OMV A;  5DAL A;  1JHB A;  1PX6 A;  1B9Y C;  3VWW A;  5LD0 A;  5ECQ B;  5IQY A;  4V1A g;  3LG6 A;  1THO A;  2FWF A;  1XOB A;  3VPQ A;  3RPP A;  3GA4 A;  5E59 A;  1OC8 A;  2F9S A;  1MD4 A;  3LXT A;  1F2E A;  4XS1 A;  5CYY A;  2VM2 A;  2VCT A;  2A2S A;  3GX8 A;  2GT5 A;  4MDC A;  5D9V A;  2CVB A;  3A5W A;  5AIV A;  1S3C A;  4POL A;  2NTO A;  3TKS A;  4YAP A;  5H5S A;  3GL5 A;  5GAN D;  2GLR A;  3FRC A;  3H1N A;  1OYJ A;  3EVI A;  2R37 A;  5CAX A;  2JAC A;  1GSE A;  4L0U A;  4ECI A;  3GTU B;  2H0H A;  5DAL B;  4ML6 A;  4K0G A;  1E6B A;  1GLQ A;  1DUG A;  4KH7 A;  3IBH A;  6GST A;  1UN2 A;  3GN3 A;  4ZB9 A;  2N5B A;  2HNL A;  3TRP A;  4QL9 A;  4HU9 A;  1KTE A;  3D0Z A;  1GUH A;  4KB3 A;  5IMD A;  3F6F A;  1M9A A;  5AN1 A;  3IAS 2;  4E8H A;  4J56 E;  4Q5N A;  2L4C A;  4KDU A;  1GSY A;  3KM6 A;  3HVS A;  2HXK A;  1K3L A;  3TJB A;  4HI7 A;  3HJP A;  3KJY A;  4K8M A;  3RPN A;  2HE3 A;  1O81 A;  2VUP A;  1HD2 A;  1XBS A;  3UAR A;  2A4V A;  5ECN B;  3QDN A;  3W6G A;  6GSW A;  2M80 A;  1WIK A;  5G5E A;  3EIN A;  1SKR B;  5DBQ A;  3N5O A;  1B4Q A;  4ZIL A;  3LSZ A;  1VF4 A;  1PKZ A;  6GSU A;  3HA9 A;  2VCZ A;  3O76 A;  5HFI A;  2X8G A;  4EXJ A;  1FVJ A;  2HRN A;  3EC3 A;  3ZIT A;  3VLN A;  3ME7 A;  4JZQ A;  2XBI A;  4HJ2 A;  3QFB C;  3ZTL A;  2VL3 A;  4QQ7 A;  3LGC A;  4KCE A;  1QFN A;  1AIU A;  2GSS A;  2WDU A;  2H73 A;  2M46 A;  2LJA A;  4P3Y B;  3VK9 A;  2R6K A;  4MJE A;  2NPB A;  3FY7 A;  1SL0 B;  2AHE A;  3GSS A;  5DAK A;  3MNG A;  4OFT A;  4NHW A;  3NZN A;  1K0N A;  4V1A p;  3IK9 A;  1VF1 A;  5IM9 A;  1V98 A;  4MPF A;  5HR1 A;  4F0B A;  1OVN A;  1O85 A;  3TOT A;  2H1B A;  1SK2 A;  1MTC A;  2V6K A;  1TTZ A;  2MBT A;  1XIY A;  2C80 A;  3ZIJ A;  2CA8 A;  1Z7P A;  4E8E A;  2A2R A;  1H4O A;  1J08 A;  1BX9 A;  2YOI A;  2GQK A;  1GSF A;  1TK8 B;  3GV1 A;  2ZCT A;  1DE1 A;  3ZFL A;  2C3N A;  4EUY A;  3SWL A;  1AC1 A;  1O73 A;  2IMD A;  5ECS A;  2VOC A;  5HFG A;  4AJ7 A;  2VLV A;  4BWQ A;  1T3B A;  1F9M A;  5ID2 A;  1Q98 A;  3QOU A;  3EMX A;  3F3R A;  3F9U A;  3QD9 A;  1DE2 A;  2IMI A;  2E7P A;  3C1R A;  1B9X C;  1U3A A;  2GSQ A;  3UBK A;  1YKC A;  3M0F A;  3APQ A;  4N0V A;  4IN0 A;  1PQN A;  5ECR B;  5IMC A;  2YWI A;  3FHK A;  4EVM A;  4JBB A;  3KTB A;  5KN3 A;  5ECM B;  3Q18 A;  2RM5 A;  2AB6 A;  5ECP B;  5F0G A;  2YJ7 A;  1YF0 A;  2LJR A;  4BL7 A;  3US3 A;  2I3Y A;  3MAK A;  5COH A;  1Z6M A;  5KN1 A;  5ECK B;  2IFQ B;  2YAN A;  2DML A;  3HXS A;  1EP8 A;  4I97 A;  1G7O A;  3RAZ A;  1HYU A;  2CVD A;  1K0M A;  2F3M A;  2IN3 A;  2JZS A;  1HNC A;  1EZK A;  2EIQ A;  1W89 A;  2CX3 A;  2VLU A;  3L4N A;  2JZT A;  4TR3 A;  1GNE A;  4PXO A;  4X1U A;  4G9H A;  4ISD A;  3HJO A;  1JLV A;  5FWG A;  1R4W A;  2IMF A;  3E9J B;  2VD0 A;  3M3M A;  4OO4 A;  2FA8 A;  1OC3 A;  2HLS A;  1SU9 A;  4LMV A;  3QPM A;  4EDY A;  1HQO A;  3VI5 A;  3IA1 A;  2CAQ A;  4FIW A;  3MSZ A;  4IEL A;  2CQ9 A;  2YWO A;  3G7J A;  3LEF A;  2LV3 A;  4KDY A;  1GSD A;  3ZRD A;  1ILO A;  3CRT A;  3GKM A;  3QMX A;  2HSY A;  3DXB A;  3L78 A;  1FG4 A;  3I6A A;  3L9V A;  2GGT A;  4TR1 A;  1ZYQ B;  1XPV A;  3FZ5 A;  1VRS D;  3HHV A;  3V1W A;  1EGR A;  3NOF A;  1BJX A;  2FWE A;  3D4T A;  2CVK A;  4I6X A;  1JZW A;  1TRU A;  1GTB A;  4HDE A;  4MF7 A;  4GSS A;  2IWT A;  1JFU A;  4K1F A;  2C0E A;  4H86 A;  4FYB A;  1WRY A;  1M2A A;  4NAX A;  1G6Y A;  3D22 A;  2FUG 2;  1S3A A;  2V32 A;  1TRS A;  1GTA A;  2HYX A;  5JCW A;  1SJI A;  2H0I A;  3IK7 A;  1TXX A;  3BOA A;  3LYK A;  2XPE A;  2E2M A;  2VAF A;  4TR1 B;  2M72 A;  4ZBD A;  1ON4 A;  3IV4 A;  1ERT A;  12GS A;  1A2L A;  3GKN A;  2HT9 A;  3GKX A;  3GMF A;  4TR4 A;  2OBK A;  2H6X A;  4PQI A;  3TRX A;  1EWX A;  1SEN A;  3TGZ A;  1IYH A;  3FK8 A;  5GST A;  2GS3 A;  4L5L A;  2GST A;  3CSH A;  2ON7 A;  2WRT A;  2G0F A;  1Z6N A;  3LFL A;  2GSR A;  2HZE A;  1XWG A;  4WBR D;  3CTG A;  2X99 A;  3KZQ A;  3LJR A;  4TOP A;  4LL1 B;  4JR4 A;  2MZC A;  4WKW A;  1F3B A;  4KW6 A;  3TJK A;  1J0F A;  2GZZ A;  3M9K A;  5KN0 A;  4TXO B;  2BTO T;  2DJ3 A;  3MDK A;  2NBS A;  2RII A;  3SBC A;  3TRQ A;  3QAG A;  2C0G A;  4PNG A;  4PGT A;  4KSM A;  1EOH A;  1JZR A;  1OKD A;  4BVY A;  2BJX A;  4X43 A;  2K6V A;  2GT6 A;  1GH2 A;  3BCK A;  3O3T A;  3P7X A;  5AIX A;  2C0D A;  4HUA A;  4NMU A;  5ENU A;  1WPI A;  2WZ9 A;  1G6W A;  3HZ4 A;  1KEB A;  2PVQ A;  1C72 A;  1TP9 A;  1XCC A;  5H5R A;  2O87 A;  3KEB A;  1TRW A;  3IE3 A;  5HR2 A;  4IP1 A;  1CQH A;  4IS0 A;  2H71 A;  2FWH A;  5D93 A;  3F4R A;  1TU7 A;  2PWJ A;  3F6D A;  2F51 A;  3DIE A;  3G7Y A;  2JSZ A;  1OC9 B;  4I5Q A;  3I43 A;  3ZIV A;  1GTU A;  2LQO A;  3H79 A;  18GS A;  3GH9 A;  2VCX A;  2GZY A;  1V2A A;  4BWS A;  5EL8 A;  3AY8 A;  4V2L A;  3UEM A;  1B8X A;  4POM A;  1EOG A;  1GL8 A;  3U6V A;  3DVW A;  5FHI A;  3EYT A;  2EIR A;  2OE3 A;  1YZX A;  3UMA A;  1QGV A;  4EO3 A;  4F2I A;  4MF6 A;  5HFK A;  4ULX A;  2B1K A;  3ZRE A;  1Z7R A;  2V1M A;  1XWC A;  1FVK A;  3O6T A;  3UVT A;  5KN2 A;  4YAV A;  1T7P B;  2VCV A;  1AW9 A;  1AQV A;  3GNJ A;  5CNW A;  1AXD A;  3GHA A;  4OFN A;  4JR6 A;  4BA7 A;  3PH9 A;  1WJK A;  4FYU A;  4YQM A;  1X0R A;  4ZBA A;  2YNX A;  1NSW A;  2HSH A;  1O7U A;  1G7E A;  2I1U A;  3DVX A;  5C00 A;  4FYC A;  1T00 A;  2PN8 A;  3M8N A;  1X5C A;  2PUK C;  3N9J A;  1K0B A;  2FGX A;  1F3A A;  1PD2 1;  5ECH B;  5G1K A;  1I5G A;  1OE8 A;  1A2M A;  3ZYW A;  2JSY A;  2YN1 A;  1SD9 A;  3FZA A;  5CO3 A;  5D9X A;  2TRX A;  3RDW A;  1WMJ A;  3M9J A;  2V2G A;  3L9U A;  3L0H A;  5HR0 A;  2HI7 A;  1GTI A;  5KEJ A;  2B5X A;  5FT3 A;  4ZB6 A;  2EC4 A;  2H76 A;  2RLI A;  2PER A;  2DJ2 A;  5D9W A;  3KH7 A;  2VM1 A;  4AJ6 A;  4J2F A;  2GQL A;  5IPG A;  3UVH A;  2R3X A;  3E0U A;  3QCP A;  3CYN A;  4NWY A;  4PQ1 A;  4GTU A;  1ZOF A;  1CQG A;  4KE3 A;  4OWY A;  1JZO A;  5EPF A;  2I81 A;  1GNW A;  5L71 A;  4XCS A;  1IYI A;  4ECB A;  5F07 A;  3TDG A;  2FD3 A;  1X9W B;  1OAZ A;  3KP8 A;  2JU5 A;  1FOV A;  1EEJ A;  2WUL A;  3ISO A;  2LNS A;  3GYK A;  3TUE A;  2H6Y A;  1PX7 A;  4IP6 A;  4TXV A;  4OO5 A;  2FHE A;  4EDZ A;  3GUR A;  4WR5 A;  2GTU A;  5IMZ A;  2OA7 A;  4ZIJ A;  1A8Y A;  4MJA A;  2AAW A;  5CRW A;  3HYP A;  2K8S A;  4TW5 A;  4CDO A;  4GWR A;  2FY6 A;  4XRD A;  5INY A;  1TK0 B;  3CTF A;  3Q74 A;  1K3Y A;  5G1L A;  4OFM A;  2H72 A;  2IFQ A;  1SL1 B;  4MPG A;  5D73 A;  2K8V A;  2IME A;  4ML1 A;  3H8Q A;  4TVE A;  4Q5R A;  5CRD A;  1Q4J A;  1V58 A;  1F37 A;  22GS A;  4O92 A;  3KTL A;  1U87 A;  1R5P A;  1G0T A;  4XS4 B;  4WF5 A;  1SJ6 A;  3A2W A;  3TKR A;  3C73 A;  2RUF A;  2I4A A;  4KAE A;  1Z9H A;  3TB2 A;  2FWG A;  3C7M A;  1AQX A;  1GUL A;  5HQP A;  2CZ3 A;  4NPB A;  5A5K A;  2E2G A;  2Z9S A; 
#chains in the Genus database with same CATH topology
 1PL1 A;  3W8S A;  3OR5 A;  3MYD A;  4PUA A;  2DIZ A;  5GAP D;  3BBY A;  5CRH A;  4KND A;  1WP0 A;  3CSJ A;  4CHS A;  5J5N A;  2FCH A;  2C0F A;  4HJM A;  2H1A A;  1WE0 A;  2K9F A;  4K9Z A;  2X8H A;  5DVB A;  2QSI A;  4G10 A;  4XHM A;  5J9C A;  1PGT A;  3QAW A;  3ZLP A;  4L8E A;  2YV7 A;  4CW9 A;  2WS2 A;  1GWC A;  3EMP A;  4EC0 A;  4NXI A;  6GSV A;  4MAB A;  1LU4 A;  3WT1 A;  3WGX A;  2TRC P;  1TW9 A;  2OAD A;  1GUM A;  3RHB A;  3ZML A;  3Q6O A;  3D5J A;  3P8W A;  2H74 A;  1F6M C;  4RI6 A;  4ZB8 A;  1X5D A;  3RBT A;  1YF1 A;  1GLP A;  2IIY A;  4GSN A;  3HCZ A;  2R2J A;  3FYG A;  5DJM A;  4KCA A;  4AF2 A;  1X5E A;  3BCI A;  4L0W A;  1V40 A;  5LNK e;  7GSS A;  2H66 A;  1EV9 A;  2XHF A;  4LL4 B;  3C71 A;  3R2Q A;  4Z2U A;  17GS A;  1FHE A;  4GCI A;  5G2Z A;  5B7C A;  2YZH A;  2NDO A;  2NVL A;  3ZL5 A;  3CBU A;  3DRN A;  2FA4 A;  2H30 A;  4KA0 A;  2C1Y A;  3GIX A;  2V6O A;  2IPA A;  1B4P A;  3CRU A;  1T4Y A;  2LNT A;  2CT6 A;  4RUV A;  1GRX A;  3UBL A;  2QC7 A;  4K2D A;  5AGY A;  4ZL8 A;  1RW1 A;  1K0A A;  3IC8 A;  4FH8 A;  4EF0 A;  2XBQ A;  2H70 A;  4N10 A;  1E2Y A;  4JE1 A;  1R5A A;  1YJ6 A;  2DJ0 A;  1NW2 A;  4RI7 A;  4HZ2 A;  4EIQ A;  2H6Z A;  2VLT A;  3F4T A;  3DD3 A;  5D9T A;  2IJY A;  3FZ9 A;  5J3R A;  3VI7 A;  1PRX A;  3IR4 A;  3UIW A;  3GX0 A;  2CAI A;  3FKF A;  2DJK A;  2D2Z A;  2C4J A;  3RHC A;  1SL2 B;  2LJK A;  4TXO A;  4V2M A;  1M2B A;  2GQM A;  2N5F A;  2ZNM A;  3WGE A;  1I9D A;  1OKT A;  5LCZ A;  4PUR A;  2VL9 A;  2B3S A;  4POK A;  3VWU A;  3CMI A;  2MBS A;  2UZ8 A;  3CXG A;  2MMN A;  1SD8 A;  1U88 A;  3I9V 2;  3PIN A;  1FB0 A;  2LKU A;  4DVC A;  5IO2 A;  2RUE A;  3ERG A;  4NV5 A;  8GSS A;  2V41 A;  3JCM L;  1UC7 A;  3EUR A;  3FR6 A;  3KMO A;  1LJR A;  3H93 A;  1X9S B;  2YWM A;  4I8B A;  2P5Q A;  1THX A;  4IJI A;  5IOW A;  3G9B A;  5D96 A;  2X8C A;  2H01 A;  4MCU A;  4XIH A;  3IXR A;  1A8L A;  4IKH A;  4MZC A;  4NV2 A;  4EKZ A;  4MJC A;  5IPH A;  2H0G A;  1TU8 A;  1K0D A;  4IBP A;  5J4U A;  1A0F A;  1MDJ A;  3D4M A;  2DSA A;  3KD0 A;  1PSQ A;  1B48 A;  2WCI A;  2WGR A;  3LXZ A;  2PVO C;  3TJJ A;  3IRA A;  2PMT A;  1OC9 A;  1XFL A;  1TK5 B;  2GZP A;  3GL3 A;  4F82 A;  4ECJ A;  5ELG A;  2TIR A;  3VUR A;  1KNG A;  3KIJ A;  1QUW A;  3J7Y b;  4ICY A;  3M1G A;  1MDK A;  1XWA A;  2P31 A;  5JCG A;  1UVZ A;  3ZVJ A;  1PN9 A;  1GSQ A;  5JCU A;  2ON5 A;  3F63 A;  1XW5 A;  3ERF A;  5A4V A;  1GUK A;  1PA3 A;  5IIZ A;  1N8J A;  4HOJ A;  1W4V A;  4MH2 A;  4RQX A;  5G5F A;  1LBK A;  1FAA A;  4LMW A;  1Z3E A;  5ELA A;  1ZMA A;  3IAM 2;  3TKS C;  3HKR A;  3KP9 A;  4GST A;  2OJL A;  1QQ2 A;  4D73 B;  3C8E A;  3IC4 A;  3GH6 A;  4WET A;  6GSX A;  4BPY A;  3TJG A;  3TKP A;  1OE7 A;  2L59 A;  3DKS A;  3L9S A;  5CP1 A;  6GSS A;  5IMV A;  1TI3 A;  2H75 A;  2XPD A;  1ERV A;  3GUS A;  4XS6 A;  3H4K A;  3PR8 A;  2X49 A;  2YPM A;  1GP1 A;  4Z2T A;  2GVP A;  3D21 A;  14GS A;  1XXU A;  4IGJ A;  4BVX B;  2H8L A;  4LA1 A;  6GSY A;  2PBJ A;  3A2V A;  20GS A;  2PU9 C;  2C8U A;  2YV9 A;  5B8B A;  3Q19 A;  4MNN A;  10GS A;  5D8I A;  13GS A;  2YJH A;  3K8N A;  1ZYE A;  4K2X A;  2KUC A;  4MJB A;  1QK8 A;  5IO0 A;  5B6N A;  1ZGN A;  4K7O A;  5C04 A;  1M9B A;  3A2X A;  1TI1 A;  4WF4 A;  1SJZ A;  4ID0 A;  4OCE A;  4IQA A;  4N0Z A;  1UA5 A;  1FB6 A;  4TKY A;  5G30 A;  1U3I A;  4ILF A;  3ED3 A;  3HZ8 A;  4JU5 A;  1M2D A;  4K6X A;  3A3T A;  4G0K A;  1FW1 A;  5B6M A;  1FOH A;  19GS A;  2DBC A;  2AJQ B;  1HNB A;  2ES7 A;  4YQU A;  4XTS A;  2PGT A;  2HRK A;  2VIM A;  1AQW A;  1M0U A;  4MH3 A;  3QAV A;  2QKE A;  2WFC A;  2OE1 A;  2KOK A;  3FEU A;  4ACS A;  2X64 A;  4ZXG A;  3WD6 A;  1A23 A;  2RM6 A;  1EGO A;  1PFO A;  4RQR A;  2P5R A;  1A0R P;  1ERW A;  2BMX A;  1Y6E A;  3UL3 A;  4YH2 A;  3VFI A;  4IW9 A;  2KLX A;  1SYR A;  4I2T A;  2EIO A;  4KSO A;  5EVO A;  2L6D A;  4GQF A;  5EY6 A;  1TJD A;  2AYT A;  3UOM A;  2JAD A;  2HZF A;  1YKA A;  2DJJ A;  4PUF C;  1VF3 A;  1XVW A;  5JWQ B;  5B8A A;  1ACV A;  3UJ1 A;  3P2A A;  5DCG A;  4KDX A;  3GST A;  5CRE A;  2MYG A;  3TJF A;  2L5O A;  2HFD A;  3WT2 A;  4V2N A;  3FMW A;  3KMN A;  3HD5 A;  3TCO A;  1URM A;  1KBN A;  9GSS A;  1FO5 A;  2FNO A;  1O8W A;  4WR4 A;  3S9F A;  4XS4 A;  4AJ8 A;  2VL2 C;  5A4U A;  3BJ5 A;  4ZBB A;  2K18 A;  1BYE A;  3MIX A;  4Q5Q A;  5JWO B;  3TKQ A;  1NHO A;  3F4S A;  2LS5 A;  1YQ1 A;  5H5Q A;  2LRC A;  5F8B A;  3F0I A;  1HNA A;  5F06 A;  1DBY A;  2OAC A;  4GLT A;  3GKK A;  2DKH A;  2JZR A;  4N11 A;  5DJL A;  3ZVJ D;  3VWV A;  5DQY A;  2H19 A;  5KOW A;  5GSS A;  2F8F A;  4USS A;  4DSS A;  3F8U A;  3MWH A;  4GXZ A;  4WBJ A;  2VO4 A;  1X9M B;  5G31 A;  2O89 A;  4IJ3 A;  3LQ7 A;  2L4Q A;  2B6M A;  2N5A A;  1MDI A;  2CV4 A;  3TOU A;  2IL3 A;  2I9H A;  2MMZ A;  5J9B A;  1DSB A;  2YZU A;  5BRT A;  5F05 A;  2VL2 A;  3EU3 A;  4Z2R A;  4EE0 A;  3EWL A;  1GSS A;  1YY7 A;  1K3O A;  4F0C A;  4X0X A;  4JRR A;  1VGL A;  4YQV A;  1XVQ A;  5A4W A;  2C3Q A;  4POB A;  4TR0 A;  2E0Q A;  5IMF A;  3GFK A;  11GS A;  1ZL9 A;  2A2P A;  3KCM A;  3EE2 A;  4HQS A;  4IVF A;  3TKS E;  5GZZ B;  2DJ1 A;  1H75 A;  1WWJ A;  2B5E A;  5DAK B;  1ERU A;  4DEJ A;  2WB9 A;  4DSS B;  3I69 A;  3QR6 A;  5DDL A;  1NM3 A;  1Y25 A;  1YDK A;  4HEA 2;  1O6J A;  2HSM A;  4MP4 A;  3DML A;  2LRN A;  16GS A;  2L5L A;  4IQ1 A;  4O32 A;  3J7Y k;  3VPT A;  2YP6 A;  4MK3 A;  2MMO A;  1R26 A;  2HRF A;  4GRF A;  3IPZ A;  3NIV A;  4ECC A;  2AV4 A;  3FR9 A;  4G19 A;  4GQC A;  1PKW A;  2VCW A;  1TRV A;  4Z7X A;  4AGS A;  2LEG A;  1M99 A;  4KUN A;  3W8J A;  3G7I A;  2DMM A;  3HY2 A;  1RQM A;  3LWA A;  5ECO B;  5ID2 B;  3KGK A;  1XW9 A;  3ZZX A;  5IOX A;  2VCQ A;  2R4V A;  1ZYP A;  3DGQ A;  3IOS A;  4O7H A;  3EU4 A;  1SK1 A;  2FLS A;  2CZ2 A;  2JL4 A;  3IDV A;  1YEP A;  2OE0 A;  2J9H A;  1K0O A;  2P0G A;  1TKD B;  1GSU A;  1EEM A;  2B5Y A;  5E4W A;  2LRT A;  1T8E B;  1BQ7 A;  4NHZ A;  4OCF A;  1RK4 A;  4PX1 A;  2R0G A;  3ME8 A;  1JLW A;  3APS A;  2GDR A;  4DSQ A;  5DQS A;  3KH9 A;  4O5R A;  1SKS B;  5JWR B;  3LYP A;  1K0C A;  2KP2 A;  1WOU A;  1EP7 A;  2LST A;  3ZMK A;  4K7I A;  3IHQ A;  1SK0 A;  3DYR A;  2LTK A;  4FQU A;  1XOA A;  4FO5 A;  2H1G A;  4L5O A;  5CRG A;  3E3E A;  3DWV A;  1ABA A;  3GRX A;  2B1L A;  3C1S A;  2QGV A;  5ECL B;  2OBI A;  4DSR A;  1BED A;  1J9B A;  1BAY A;  3P90 A;  2O8V B;  4GF0 A;  4ZL9 A;  4Q5F A;  1AAZ A;  2VD1 A;  1ZZY A;  2C3T A;  3FW2 A;  4I2U A;  2L57 A;  2B7J A;  3APO A;  3FR3 A;  4N30 A;  1XZO A;  3ERW A;  4IHU A;  4HQZ A;  1ST9 A;  2F8A A;  4F9Z A;  5ABR A;  3CQF A;  2AUV A;  1V57 A;  1QXH A;  2LQQ A;  2WJU A;  1O8X A;  4PQH A;  5AIS A;  4EL1 A;  1XW6 A;  2PPT A;  1XWK A;  1MEK A;  3IHG A;  2CX4 A;  3QFA C;  4J57 E;  2YWN A;  3U5R E;  3LOR A;  2A4H A;  4PNF A;  1USB A;  3ZFB A;  3HVX A;  3KXO A;  3WYW A;  1TDI A;  2DC5 A;  1T4Z A;  5DCH A;  4MZW A;  1VF2 A;  4D73 A;  1AUC A;  3D6I A;  1PMT A;  2YCD A;  2MMA A;  4HS1 A;  2O85 A;  2IMK A;  2H1D A;  3FZ4 A;  2J23 A;  2ZUP A;  3HJM A;  1S3D A;  1XWB A;  4WXT A;  4G2E A;  4ZL7 A;  2KP1 A;  3HDC A;  4TRX A;  4BVX A;  1Z5Y E;  4QL7 A;  1SYX A;  4XRA A;  2G2Q A;  2R5G A;  3PGT A;  4MA9 A;  3WGD A;  2DIY A;  4KX4 A;  1JZD A;  2L6C A;  1QMV A;  1ZCP A;  1R7H A;  1A24 A;  3DEX A;  4MZB A;  4K7N A;  1V9W A;  2LUS A;  4HZ4 A;  4MF5 A;  1SKW B;  5HR3 A;  2KHP A;  5J41 A;  1N2A A;  3F3Q A;  2B7K A;  4KGI A;  4MLY A;  3HVV A;  2OKA A;  4OD7 A;  1EV4 A;  3BD2 A;  1NHY A;  2XC2 A;  2O7K A;  4HU7 A;  3VWX A;  1M7T A;  4PTS A;  2REM A;  1MD3 A;  1TOF A;  1T1V A;  3EPT A;  3UAP A;  4LLR A;  1YEX A;  1PL2 A;  1U6T A;  4JED A;  2DLX A;  5ECI B;  2HZE B;  1BG5 A;  4MMM A;  2ALB A;  1A2J A;  4K0N A;  4WEY A;  5IMA A;  4TN8 A;  1ML6 A;  3GTU A;  4F03 A;  3CSI A;  4OMV A;  5DAL A;  1JHB A;  1PX6 A;  1B9Y C;  3VWW A;  5LD0 A;  5ECQ B;  5IQY A;  4V1A g;  3LG6 A;  1THO A;  2FWF A;  1XOB A;  5KOX A;  3VPQ A;  3RPP A;  3GA4 A;  5E59 A;  1OC8 A;  2F9S A;  1MD4 A;  3LXT A;  1F2E A;  4XS1 A;  5CYY A;  2VM2 A;  4BVY B;  2VCT A;  1S3R A;  2A2S A;  3GX8 A;  2GT5 A;  4MDC A;  5D9V A;  2CVB A;  3A5W A;  5AIV A;  1S3C A;  4POL A;  2NTO A;  3TKS A;  4YAP A;  5H5S A;  3GL5 A;  5GAN D;  2GLR A;  3FRC A;  3H1N A;  1OYJ A;  3EVI A;  2R37 A;  5CAX A;  2JAC A;  1GSE A;  4L0U A;  4ECI A;  3GTU B;  2H0H A;  5DAL B;  4ML6 A;  4K0G A;  1ZYN A;  1E6B A;  1GLQ A;  1DUG A;  4KH7 A;  3PPU A;  3IBH A;  6GST A;  1UN2 A;  3GN3 A;  4ZB9 A;  2N5B A;  2HNL A;  3TRP A;  4QL9 A;  4HU9 A;  1KTE A;  3D0Z A;  1GUH A;  4KB3 A;  5IMD A;  3F6F A;  1M9A A;  5AN1 A;  3IAS 2;  4E8H A;  4J56 E;  4Q5N A;  2L4C A;  4KDU A;  1GSY A;  3KM6 A;  3HVS A;  2HXK A;  1K3L A;  3TJB A;  4HI7 A;  3HJP A;  3KJY A;  4K8M A;  3RPN A;  2HE3 A;  1O81 A;  2VUP A;  1HD2 A;  1XBS A;  3UAR A;  2A4V A;  3QDN A;  5ECN B;  3W6G A;  6GSW A;  2M80 A;  1WIK A;  5G5E A;  3EIN A;  1SKR B;  5DBQ A;  3N5O A;  1B4Q A;  4ZIL A;  3LSZ A;  1VF4 A;  1PKZ A;  6GSU A;  3HA9 A;  2VCZ A;  3O76 A;  5HFI A;  2X8G A;  4EXJ A;  1FVJ A;  2HRN A;  3EC3 A;  3ZIT A;  3VLN A;  3ME7 A;  4JZQ A;  4EIP A;  2XBI A;  4HJ2 A;  3QFB C;  3ZTL A;  4KF9 A;  2VL3 A;  4QQ7 A;  3LGC A;  4KCE A;  1QFN A;  1AIU A;  2GSS A;  2WDU A;  2H73 A;  2M46 A;  2LJA A;  4P3Y B;  3VK9 A;  2R6K A;  4MJE A;  2NPB A;  3FY7 A;  1SL0 B;  2AHE A;  3GSS A;  5DAK A;  3MNG A;  4OFT A;  4NHW A;  4BIK A;  3NZN A;  1K0N A;  4V1A p;  3IK9 A;  1VF1 A;  5IM9 A;  1V98 A;  4MPF A;  5HR1 A;  4F0B A;  1OVN A;  1O85 A;  3TOT A;  2H1B A;  1SK2 A;  1MTC A;  2V6K A;  1TTZ A;  2MBT A;  1XIY A;  2C80 A;  3ZIJ A;  2CA8 A;  1Z7P A;  4E8E A;  2A2R A;  1H4O A;  1J08 A;  1BX9 A;  2YOI A;  2GQK A;  1GSF A;  1TK8 B;  3GV1 A;  2ZCT A;  1DE1 A;  3ZFL A;  2C3N A;  4EUY A;  3SWL A;  1AC1 A;  1O73 A;  2IMD A;  5ECS A;  2VOC A;  5HFG A;  4AJ7 A;  2VLV A;  4BWQ A;  1T3B A;  1F9M A;  5ID2 A;  1Q98 A;  3QOU A;  3EMX A;  3F3R A;  3F9U A;  3QD9 A;  4O5U A;  1DE2 A;  2IMI A;  2E7P A;  3C1R A;  1B9X C;  1U3A A;  2GSQ A;  3UBK A;  1YKC A;  3M0F A;  3APQ A;  4N0V A;  4IN0 A;  1PQN A;  5ECR B;  5IMC A;  2YWI A;  3FHK A;  4EVM A;  4JBB A;  3KTB A;  5KN3 A;  4G0I A;  4HSC X;  5ECM B;  3Q18 A;  2RM5 A;  2X4A A;  2AB6 A;  5ECP B;  5F0G A;  4CY8 A;  2YJ7 A;  1YF0 A;  4K5R A;  2LJR A;  4BL7 A;  3US3 A;  2I3Y A;  3A5I A;  3MAK A;  5COH A;  1Z6M A;  5KN1 A;  5ECK B;  2IFQ B;  2YAN A;  4G0L A;  2DML A;  3HXS A;  1EP8 A;  4I97 A;  1G7O A;  3RAZ A;  1HYU A;  2CVD A;  1K0M A;  2F3M A;  2IN3 A;  2JZS A;  1HNC A;  1EZK A;  2EIQ A;  1W89 A;  4O5Q A;  2CX3 A;  2VLU A;  3L4N A;  2JZT A;  4TR3 A;  1GNE A;  4PXO A;  4X1U A;  4G9H A;  4ISD A;  3HJO A;  1JLV A;  5FWG A;  1R4W A;  2IMF A;  3E9J B;  2VD0 A;  3M3M A;  4OO4 A;  2FA8 A;  1OC3 A;  2HLS A;  1SU9 A;  1M3J A;  4LMV A;  1M3I A;  3QPM A;  4EDY A;  1HQO A;  3VI5 A;  3IA1 A;  2CAQ A;  4FIW A;  3MSZ A;  4IEL A;  2CQ9 A;  2YWO A;  3G7J A;  3LEF A;  2LV3 A;  4KDY A;  1GSD A;  3ZRD A;  1ILO A;  3CRT A;  3GKM A;  3QMX A;  2HSY A;  3DXB A;  3L78 A;  4BL7 B;  1FG4 A;  3I6A A;  3L9V A;  2GGT A;  4TR1 A;  1ZYQ B;  1XPV A;  3FZ5 A;  1VRS D;  3HHV A;  3V1W A;  1EGR A;  3NOF A;  1BJX A;  2FWE A;  3D4T A;  2CVK A;  4I6X A;  1JZW A;  1TRU A;  1GTB A;  4CY6 A;  4HDE A;  4MF7 A;  4GSS A;  2IWT A;  1JFU A;  2R0P A;  4K1F A;  2C0E A;  3LW9 A;  4H86 A;  4FYB A;  1WRY A;  1M2A A;  4NAX A;  1G6Y A;  3D22 A;  2FUG 2;  1S3A A;  2V32 A;  1TRS A;  1PN0 A;  1GTA A;  2HYX A;  5JCW A;  1SJI A;  2H0I A;  3IK7 A;  1TXX A;  3BOA A;  3LYK A;  2XPE A;  2E2M A;  2VAF A;  4TR1 B;  2M72 A;  4ZBD A;  1ON4 A;  3IV4 A;  1ERT A;  12GS A;  1A2L A;  3GKN A;  2HT9 A;  3GKX A;  3GMF A;  4TR4 A;  2OBK A;  2H6X A;  4PQI A;  3TRX A;  1EWX A;  1SEN A;  3TGZ A;  1IYH A;  3FK8 A;  5GST A;  2GS3 A;  4L5L A;  2GST A;  4X4J A;  3CSH A;  2ON7 A;  2WRT A;  2G0F A;  1Z6N A;  3LFL A;  2GSR A;  2HZE A;  1XWG A;  4WBR D;  3CTG A;  2X99 A;  3KZQ A;  3LJR A;  4TOP A;  4LL1 B;  4JR4 A;  2MZC A;  4WKW A;  1F3B A;  4KW6 A;  3TJK A;  1J0F A;  2GZZ A;  3M9K A;  4YKG A;  5KN0 A;  4TXO B;  2BTO T;  2DJ3 A;  3MDK A;  2NBS A;  2RII A;  3SBC A;  3TRQ A;  3QAG A;  2C0G A;  4PNG A;  4PGT A;  4KSM A;  1EOH A;  1JZR A;  1OKD A;  4BVY A;  2BJX A;  4X43 A;  1XG8 A;  2K6V A;  2GT6 A;  1GH2 A;  3BCK A;  3O3T A;  3P7X A;  5AIX A;  2C0D A;  4HUA A;  4NMU A;  5ENU A;  1WPI A;  2WZ9 A;  1G6W A;  3HZ4 A;  1KEB A;  2PVQ A;  2R0C A;  1C72 A;  1TP9 A;  1XCC A;  5H5R A;  2O87 A;  3KEB A;  1TRW A;  3IE3 A;  5HR2 A;  4IP1 A;  1CQH A;  4IS0 A;  2H71 A;  2FWH A;  5D93 A;  3F4R A;  1TU7 A;  2PWJ A;  3F6D A;  2F51 A;  3DIE A;  3G7Y A;  2JSZ A;  1OC9 B;  4I5Q A;  3I43 A;  3ZIV A;  1GTU A;  2LQO A;  3H79 A;  18GS A;  3GH9 A;  2VCX A;  2GZY A;  1V2A A;  4BWS A;  5EL8 A;  3AY8 A;  4V2L A;  3UEM A;  1B8X A;  4POM A;  1EOG A;  1GL8 A;  3U6V A;  3DVW A;  5FHI A;  3EYT A;  2EIR A;  2OE3 A;  1YZX A;  3UMA A;  1QGV A;  4EO3 A;  4F2I A;  4MF6 A;  5HFK A;  4ULX A;  2B1K A;  3ZRE A;  1Z7R A;  2V1M A;  1XWC A;  1FVK A;  2DKI A;  3O6T A;  3UVT A;  5KN2 A;  4YAV A;  1T7P B;  2VCV A;  3R3E A;  1AW9 A;  4A5P A;  1AQV A;  3GNJ A;  5CNW A;  1AXD A;  3GHA A;  4OFN A;  4JR6 A;  4BA7 A;  3PH9 A;  1WJK A;  4FYU A;  4YQM A;  1X0R A;  4ZBA A;  2YNX A;  1NSW A;  2HSH A;  1O7U A;  1G7E A;  2I1U A;  3DVX A;  5C00 A;  4FYC A;  1T00 A;  2PN8 A;  3M8N A;  1X5C A;  2PUK C;  3N9J A;  1K0B A;  2FGX A;  1F3A A;  1PD2 1;  5ECH B;  5G1K A;  1I5G A;  1OE8 A;  1A2M A;  3ZYW A;  2JSY A;  2YN1 A;  1SD9 A;  3FZA A;  5CO3 A;  5D9X A;  4YKF A;  2TRX A;  3RDW A;  1WMJ A;  3M9J A;  2V2G A;  3L9U A;  3L0H A;  5HR0 A;  2HI7 A;  1GTI A;  5KEJ A;  2B5X A;  5FT3 A;  4ZB6 A;  2EC4 A;  2H76 A;  2RLI A;  2PER A;  2DJ2 A;  3HVN A;  5D9W A;  3KH7 A;  2VM1 A;  4AJ6 A;  4J2F A;  2GQL A;  5IPG A;  3UVH A;  2R3X A;  3E0U A;  3QCP A;  4K5S A;  3CYN A;  4NWY A;  4PQ1 A;  4GTU A;  1ZOF A;  1CQG A;  4KE3 A;  4OWY A;  1JZO A;  5EPF A;  2I81 A;  1GNW A;  5L71 A;  4XCS A;  1IYI A;  4ECB A;  5F07 A;  3TDG A;  2FD3 A;  1X9W B;  1OAZ A;  3KP8 A;  2JU5 A;  1FOV A;  1EEJ A;  2WUL A;  3ISO A;  2LNS A;  3GYK A;  3TUE A;  2H6Y A;  1PX7 A;  4IP6 A;  4TXV A;  4OO5 A;  2FHE A;  4EDZ A;  3GUR A;  4WR5 A;  2GTU A;  5IMZ A;  2OA7 A;  4ZIJ A;  1A8Y A;  4MJA A;  2AAW A;  5CRW A;  3HYP A;  2K8S A;  4TW5 A;  4CDO A;  4GWR A;  2FY6 A;  4XRD A;  5INY A;  1TK0 B;  2QA2 A;  3CTF A;  3Q74 A;  1K3Y A;  2QA1 A;  5G1L A;  4OFM A;  2H72 A;  2IFQ A;  1SL1 B;  4MPG A;  5D73 A;  2K8V A;  2IME A;  4ML1 A;  3H8Q A;  4TVE A;  4Q5R A;  5CRD A;  1Q4J A;  1V58 A;  1F37 A;  22GS A;  4O92 A;  3KTL A;  1U87 A;  1R5P A;  1G0T A;  4XS4 B;  4WF5 A;  1SJ6 A;  3A2W A;  3TKR A;  3C73 A;  2RUF A;  2I4A A;  5BMU A;  4KAE A;  1Z9H A;  3TB2 A;  2FWG A;  3C7M A;  2HRA A;  1AQX A;  1GUL A;  5HQP A;  2CZ3 A;  4NPB A;  5A5K A;  2E2G A;  2Z9S A; 
#chains in the Genus database with same CATH homology
 1PL1 A;  3W8S A;  3OR5 A;  3MYD A;  4PUA A;  2DIZ A;  5GAP D;  3BBY A;  5CRH A;  4KND A;  1WP0 A;  3CSJ A;  4CHS A;  5J5N A;  2FCH A;  2C0F A;  4HJM A;  2H1A A;  1WE0 A;  2K9F A;  4K9Z A;  2X8H A;  5DVB A;  2QSI A;  4G10 A;  4XHM A;  5J9C A;  1PGT A;  3QAW A;  3ZLP A;  4L8E A;  2YV7 A;  4CW9 A;  2WS2 A;  1GWC A;  3EMP A;  4EC0 A;  4NXI A;  6GSV A;  4MAB A;  1LU4 A;  3WT1 A;  3WGX A;  2TRC P;  1TW9 A;  2OAD A;  1GUM A;  3RHB A;  3ZML A;  3Q6O A;  3D5J A;  3P8W A;  2H74 A;  1F6M C;  4RI6 A;  4ZB8 A;  1X5D A;  3RBT A;  1YF1 A;  1GLP A;  2IIY A;  4GSN A;  3HCZ A;  2R2J A;  3FYG A;  5DJM A;  4KCA A;  4AF2 A;  1X5E A;  3BCI A;  4L0W A;  1V40 A;  5LNK e;  7GSS A;  2H66 A;  1EV9 A;  2XHF A;  4LL4 B;  3C71 A;  3R2Q A;  4Z2U A;  17GS A;  1FHE A;  4GCI A;  5G2Z A;  5B7C A;  2YZH A;  2NDO A;  2NVL A;  3ZL5 A;  3CBU A;  3DRN A;  2FA4 A;  2H30 A;  4KA0 A;  2C1Y A;  3GIX A;  2V6O A;  2IPA A;  1B4P A;  3CRU A;  1T4Y A;  2LNT A;  2CT6 A;  4RUV A;  1GRX A;  3UBL A;  2QC7 A;  4K2D A;  5AGY A;  4ZL8 A;  1RW1 A;  1K0A A;  3IC8 A;  4FH8 A;  4EF0 A;  2XBQ A;  2H70 A;  4N10 A;  1E2Y A;  4JE1 A;  1R5A A;  1YJ6 A;  2DJ0 A;  1NW2 A;  4RI7 A;  4HZ2 A;  4EIQ A;  2H6Z A;  2VLT A;  3F4T A;  3DD3 A;  5D9T A;  2IJY A;  3FZ9 A;  5J3R A;  3VI7 A;  1PRX A;  3IR4 A;  3UIW A;  3GX0 A;  2CAI A;  3FKF A;  2DJK A;  2D2Z A;  2C4J A;  3RHC A;  1SL2 B;  2LJK A;  4TXO A;  4V2M A;  1M2B A;  2GQM A;  2N5F A;  2ZNM A;  3WGE A;  1I9D A;  1OKT A;  5LCZ A;  4PUR A;  2VL9 A;  2B3S A;  4POK A;  3VWU A;  3CMI A;  2MBS A;  2UZ8 A;  3CXG A;  2MMN A;  1SD8 A;  1U88 A;  3I9V 2;  3PIN A;  1FB0 A;  2LKU A;  4DVC A;  5IO2 A;  2RUE A;  3ERG A;  4NV5 A;  8GSS A;  2V41 A;  3JCM L;  1UC7 A;  3EUR A;  3FR6 A;  3KMO A;  1LJR A;  3H93 A;  1X9S B;  2YWM A;  4I8B A;  2P5Q A;  1THX A;  4IJI A;  5IOW A;  3G9B A;  5D96 A;  2X8C A;  2H01 A;  4MCU A;  4XIH A;  3IXR A;  1A8L A;  4IKH A;  4MZC A;  4NV2 A;  4EKZ A;  4MJC A;  5IPH A;  2H0G A;  1TU8 A;  1K0D A;  4IBP A;  5J4U A;  1A0F A;  1MDJ A;  3D4M A;  2DSA A;  3KD0 A;  1PSQ A;  1B48 A;  2WCI A;  2WGR A;  3LXZ A;  2PVO C;  3TJJ A;  3IRA A;  2PMT A;  1OC9 A;  1XFL A;  1TK5 B;  2GZP A;  3GL3 A;  4F82 A;  4ECJ A;  5ELG A;  2TIR A;  3VUR A;  1KNG A;  3KIJ A;  1QUW A;  3J7Y b;  4ICY A;  3M1G A;  1MDK A;  1XWA A;  2P31 A;  5JCG A;  1UVZ A;  3ZVJ A;  1PN9 A;  1GSQ A;  5JCU A;  2ON5 A;  3F63 A;  1XW5 A;  3ERF A;  5A4V A;  1GUK A;  1PA3 A;  5IIZ A;  1N8J A;  4HOJ A;  1W4V A;  4MH2 A;  4RQX A;  5G5F A;  1LBK A;  1FAA A;  4LMW A;  1Z3E A;  5ELA A;  1ZMA A;  3IAM 2;  3TKS C;  3HKR A;  3KP9 A;  4GST A;  2OJL A;  1QQ2 A;  4D73 B;  3C8E A;  3IC4 A;  3GH6 A;  4WET A;  6GSX A;  4BPY A;  3TJG A;  3TKP A;  1OE7 A;  2L59 A;  3DKS A;  3L9S A;  5CP1 A;  6GSS A;  5IMV A;  1TI3 A;  2H75 A;  2XPD A;  1ERV A;  3GUS A;  4XS6 A;  3H4K A;  3PR8 A;  2X49 A;  2YPM A;  1GP1 A;  4Z2T A;  2GVP A;  3D21 A;  14GS A;  1XXU A;  4IGJ A;  4BVX B;  2H8L A;  4LA1 A;  6GSY A;  2PBJ A;  3A2V A;  20GS A;  2PU9 C;  2C8U A;  2YV9 A;  5B8B A;  3Q19 A;  4MNN A;  10GS A;  5D8I A;  13GS A;  2YJH A;  3K8N A;  1ZYE A;  4K2X A;  2KUC A;  4MJB A;  1QK8 A;  5IO0 A;  5B6N A;  1ZGN A;  4K7O A;  5C04 A;  1M9B A;  3A2X A;  1TI1 A;  4WF4 A;  1SJZ A;  4ID0 A;  4OCE A;  4IQA A;  4N0Z A;  1UA5 A;  1FB6 A;  4TKY A;  5G30 A;  1U3I A;  4ILF A;  3ED3 A;  3HZ8 A;  4JU5 A;  1M2D A;  4K6X A;  3A3T A;  4G0K A;  1FW1 A;  5B6M A;  1FOH A;  19GS A;  2DBC A;  2AJQ B;  1HNB A;  2ES7 A;  4YQU A;  4XTS A;  2PGT A;  2HRK A;  2VIM A;  1AQW A;  1M0U A;  4MH3 A;  3QAV A;  2QKE A;  2WFC A;  2OE1 A;  2KOK A;  3FEU A;  4ACS A;  2X64 A;  4ZXG A;  3WD6 A;  1A23 A;  2RM6 A;  1EGO A;  4RQR A;  2P5R A;  1A0R P;  1ERW A;  2BMX A;  1Y6E A;  3UL3 A;  4YH2 A;  3VFI A;  4IW9 A;  2KLX A;  1SYR A;  4I2T A;  2EIO A;  4KSO A;  5EVO A;  2L6D A;  4GQF A;  5EY6 A;  1TJD A;  2AYT A;  3UOM A;  2JAD A;  2HZF A;  1YKA A;  2DJJ A;  4PUF C;  1VF3 A;  1XVW A;  5JWQ B;  5B8A A;  1ACV A;  3UJ1 A;  3P2A A;  5DCG A;  4KDX A;  3GST A;  5CRE A;  2MYG A;  3TJF A;  2L5O A;  2HFD A;  3WT2 A;  4V2N A;  3FMW A;  3KMN A;  3HD5 A;  3TCO A;  1URM A;  1KBN A;  9GSS A;  1FO5 A;  2FNO A;  1O8W A;  4WR4 A;  3S9F A;  4XS4 A;  4AJ8 A;  2VL2 C;  5A4U A;  3BJ5 A;  4ZBB A;  2K18 A;  1BYE A;  3MIX A;  4Q5Q A;  5JWO B;  3TKQ A;  1NHO A;  3F4S A;  2LS5 A;  1YQ1 A;  5H5Q A;  2LRC A;  5F8B A;  3F0I A;  1HNA A;  5F06 A;  1DBY A;  2OAC A;  4GLT A;  3GKK A;  2DKH A;  2JZR A;  4N11 A;  5DJL A;  3ZVJ D;  3VWV A;  5DQY A;  2H19 A;  5KOW A;  5GSS A;  2F8F A;  4USS A;  4DSS A;  3F8U A;  3MWH A;  4GXZ A;  4WBJ A;  2VO4 A;  1X9M B;  5G31 A;  2O89 A;  4IJ3 A;  3LQ7 A;  2L4Q A;  2B6M A;  2N5A A;  1MDI A;  2CV4 A;  3TOU A;  2IL3 A;  2I9H A;  2MMZ A;  5J9B A;  1DSB A;  2YZU A;  5BRT A;  5F05 A;  2VL2 A;  3EU3 A;  4Z2R A;  4EE0 A;  3EWL A;  1GSS A;  1YY7 A;  1K3O A;  4F0C A;  4X0X A;  4JRR A;  1VGL A;  4YQV A;  1XVQ A;  5A4W A;  2C3Q A;  4POB A;  4TR0 A;  2E0Q A;  5IMF A;  3GFK A;  11GS A;  1ZL9 A;  2A2P A;  3KCM A;  3EE2 A;  4HQS A;  4IVF A;  3TKS E;  5GZZ B;  2DJ1 A;  1H75 A;  1WWJ A;  2B5E A;  5DAK B;  1ERU A;  4DEJ A;  2WB9 A;  4DSS B;  3I69 A;  3QR6 A;  5DDL A;  1NM3 A;  1Y25 A;  1YDK A;  4HEA 2;  1O6J A;  2HSM A;  4MP4 A;  3DML A;  2LRN A;  16GS A;  2L5L A;  4IQ1 A;  4O32 A;  3J7Y k;  3VPT A;  2YP6 A;  4MK3 A;  2MMO A;  1R26 A;  2HRF A;  4GRF A;  3IPZ A;  3NIV A;  4ECC A;  2AV4 A;  3FR9 A;  4G19 A;  4GQC A;  1PKW A;  2VCW A;  1TRV A;  4Z7X A;  4AGS A;  2LEG A;  1M99 A;  4KUN A;  3W8J A;  3G7I A;  2DMM A;  3HY2 A;  1RQM A;  3LWA A;  5ECO B;  5ID2 B;  3KGK A;  1XW9 A;  3ZZX A;  5IOX A;  2VCQ A;  2R4V A;  1ZYP A;  3DGQ A;  3IOS A;  4O7H A;  3EU4 A;  1SK1 A;  2FLS A;  2CZ2 A;  2JL4 A;  3IDV A;  1YEP A;  2OE0 A;  2J9H A;  1K0O A;  2P0G A;  1TKD B;  1GSU A;  1EEM A;  2B5Y A;  5E4W A;  2LRT A;  1T8E B;  1BQ7 A;  4NHZ A;  4OCF A;  1RK4 A;  4PX1 A;  2R0G A;  3ME8 A;  1JLW A;  3APS A;  2GDR A;  4DSQ A;  5DQS A;  3KH9 A;  4O5R A;  1SKS B;  5JWR B;  3LYP A;  1K0C A;  2KP2 A;  1WOU A;  1EP7 A;  2LST A;  3ZMK A;  4K7I A;  3IHQ A;  1SK0 A;  3DYR A;  2LTK A;  4FQU A;  1XOA A;  4FO5 A;  2H1G A;  4L5O A;  5CRG A;  3E3E A;  3DWV A;  1ABA A;  3GRX A;  2B1L A;  3C1S A;  2QGV A;  5ECL B;  2OBI A;  4DSR A;  1BED A;  1J9B A;  1BAY A;  3P90 A;  2O8V B;  4GF0 A;  4ZL9 A;  4Q5F A;  1AAZ A;  2VD1 A;  1ZZY A;  2C3T A;  3FW2 A;  4I2U A;  2L57 A;  2B7J A;  3APO A;  3FR3 A;  4N30 A;  1XZO A;  3ERW A;  4IHU A;  4HQZ A;  1ST9 A;  2F8A A;  4F9Z A;  5ABR A;  2AUV A;  1V57 A;  1QXH A;  2LQQ A;  2WJU A;  1O8X A;  4PQH A;  5AIS A;  4EL1 A;  1XW6 A;  2PPT A;  1XWK A;  1MEK A;  3IHG A;  2CX4 A;  3QFA C;  4J57 E;  2YWN A;  3U5R E;  3LOR A;  2A4H A;  4PNF A;  1USB A;  3ZFB A;  3HVX A;  3KXO A;  3WYW A;  1TDI A;  2DC5 A;  1T4Z A;  5DCH A;  4MZW A;  1VF2 A;  4D73 A;  1AUC A;  3D6I A;  1PMT A;  2YCD A;  2MMA A;  4HS1 A;  2O85 A;  2IMK A;  2H1D A;  3FZ4 A;  2J23 A;  2ZUP A;  3HJM A;  1S3D A;  1XWB A;  4WXT A;  4G2E A;  4ZL7 A;  2KP1 A;  3HDC A;  4TRX A;  4BVX A;  1Z5Y E;  4QL7 A;  1SYX A;  4XRA A;  2G2Q A;  2R5G A;  3PGT A;  4MA9 A;  3WGD A;  2DIY A;  4KX4 A;  1JZD A;  2L6C A;  1QMV A;  1ZCP A;  1R7H A;  1A24 A;  3DEX A;  4MZB A;  4K7N A;  1V9W A;  2LUS A;  4HZ4 A;  4MF5 A;  1SKW B;  5HR3 A;  2KHP A;  5J41 A;  1N2A A;  3F3Q A;  2B7K A;  4KGI A;  4MLY A;  3HVV A;  2OKA A;  4OD7 A;  1EV4 A;  3BD2 A;  1NHY A;  2XC2 A;  2O7K A;  4HU7 A;  3VWX A;  1M7T A;  4PTS A;  2REM A;  1MD3 A;  1TOF A;  1T1V A;  3EPT A;  3UAP A;  4LLR A;  1YEX A;  1PL2 A;  1U6T A;  4JED A;  2DLX A;  5ECI B;  2HZE B;  1BG5 A;  4MMM A;  2ALB A;  1A2J A;  4K0N A;  4WEY A;  5IMA A;  4TN8 A;  1ML6 A;  3GTU A;  4F03 A;  3CSI A;  4OMV A;  5DAL A;  1JHB A;  1PX6 A;  1B9Y C;  3VWW A;  5LD0 A;  5ECQ B;  5IQY A;  4V1A g;  3LG6 A;  1THO A;  2FWF A;  1XOB A;  5KOX A;  3VPQ A;  3RPP A;  3GA4 A;  5E59 A;  1OC8 A;  2F9S A;  1MD4 A;  3LXT A;  1F2E A;  4XS1 A;  5CYY A;  2VM2 A;  4BVY B;  2VCT A;  2A2S A;  3GX8 A;  2GT5 A;  4MDC A;  5D9V A;  2CVB A;  3A5W A;  5AIV A;  1S3C A;  4POL A;  2NTO A;  3TKS A;  4YAP A;  5H5S A;  3GL5 A;  5GAN D;  2GLR A;  3FRC A;  3H1N A;  1OYJ A;  3EVI A;  2R37 A;  5CAX A;  2JAC A;  1GSE A;  4L0U A;  4ECI A;  3GTU B;  2H0H A;  5DAL B;  4ML6 A;  4K0G A;  1ZYN A;  1E6B A;  1GLQ A;  1DUG A;  4KH7 A;  3PPU A;  3IBH A;  6GST A;  1UN2 A;  3GN3 A;  4ZB9 A;  2N5B A;  2HNL A;  3TRP A;  4QL9 A;  4HU9 A;  1KTE A;  3D0Z A;  1GUH A;  4KB3 A;  5IMD A;  3F6F A;  1M9A A;  5AN1 A;  3IAS 2;  4E8H A;  4J56 E;  4Q5N A;  2L4C A;  4KDU A;  1GSY A;  3KM6 A;  3HVS A;  2HXK A;  1K3L A;  3TJB A;  4HI7 A;  3HJP A;  3KJY A;  4K8M A;  3RPN A;  2HE3 A;  1O81 A;  2VUP A;  1HD2 A;  1XBS A;  3UAR A;  2A4V A;  3QDN A;  5ECN B;  3W6G A;  6GSW A;  2M80 A;  1WIK A;  5G5E A;  3EIN A;  1SKR B;  5DBQ A;  3N5O A;  1B4Q A;  4ZIL A;  3LSZ A;  1VF4 A;  1PKZ A;  6GSU A;  3HA9 A;  2VCZ A;  3O76 A;  5HFI A;  2X8G A;  4EXJ A;  1FVJ A;  2HRN A;  3EC3 A;  3ZIT A;  3VLN A;  3ME7 A;  4JZQ A;  4EIP A;  2XBI A;  4HJ2 A;  3QFB C;  3ZTL A;  4KF9 A;  2VL3 A;  4QQ7 A;  3LGC A;  4KCE A;  1QFN A;  1AIU A;  2GSS A;  2WDU A;  2H73 A;  2M46 A;  2LJA A;  4P3Y B;  3VK9 A;  2R6K A;  4MJE A;  2NPB A;  3FY7 A;  1SL0 B;  2AHE A;  3GSS A;  5DAK A;  3MNG A;  4OFT A;  4NHW A;  3NZN A;  1K0N A;  4V1A p;  3IK9 A;  1VF1 A;  5IM9 A;  1V98 A;  4MPF A;  5HR1 A;  4F0B A;  1OVN A;  1O85 A;  3TOT A;  2H1B A;  1SK2 A;  1MTC A;  2V6K A;  1TTZ A;  2MBT A;  1XIY A;  2C80 A;  3ZIJ A;  2CA8 A;  1Z7P A;  4E8E A;  2A2R A;  1H4O A;  1J08 A;  1BX9 A;  2YOI A;  2GQK A;  1GSF A;  1TK8 B;  3GV1 A;  2ZCT A;  1DE1 A;  3ZFL A;  2C3N A;  4EUY A;  3SWL A;  1AC1 A;  1O73 A;  2IMD A;  5ECS A;  2VOC A;  5HFG A;  4AJ7 A;  2VLV A;  4BWQ A;  1T3B A;  1F9M A;  5ID2 A;  1Q98 A;  3QOU A;  3EMX A;  3F3R A;  3F9U A;  3QD9 A;  4O5U A;  1DE2 A;  2IMI A;  2E7P A;  3C1R A;  1B9X C;  1U3A A;  2GSQ A;  3UBK A;  1YKC A;  3M0F A;  3APQ A;  4N0V A;  4IN0 A;  1PQN A;  5ECR B;  5IMC A;  2YWI A;  3FHK A;  4EVM A;  4JBB A;  3KTB A;  5KN3 A;  4G0I A;  5ECM B;  3Q18 A;  2RM5 A;  2X4A A;  2AB6 A;  5ECP B;  5F0G A;  4CY8 A;  2YJ7 A;  1YF0 A;  4K5R A;  2LJR A;  4BL7 A;  3US3 A;  2I3Y A;  3A5I A;  3MAK A;  5COH A;  1Z6M A;  5KN1 A;  5ECK B;  2IFQ B;  2YAN A;  4G0L A;  2DML A;  3HXS A;  1EP8 A;  4I97 A;  1G7O A;  3RAZ A;  1HYU A;  2CVD A;  1K0M A;  2F3M A;  2IN3 A;  2JZS A;  1HNC A;  1EZK A;  2EIQ A;  1W89 A;  4O5Q A;  2CX3 A;  2VLU A;  3L4N A;  2JZT A;  4TR3 A;  1GNE A;  4PXO A;  4X1U A;  4G9H A;  4ISD A;  3HJO A;  1JLV A;  5FWG A;  1R4W A;  2IMF A;  3E9J B;  2VD0 A;  3M3M A;  4OO4 A;  2FA8 A;  1OC3 A;  2HLS A;  1SU9 A;  4LMV A;  3QPM A;  4EDY A;  1HQO A;  3VI5 A;  3IA1 A;  2CAQ A;  4FIW A;  3MSZ A;  4IEL A;  2CQ9 A;  2YWO A;  3G7J A;  3LEF A;  2LV3 A;  4KDY A;  1GSD A;  3ZRD A;  1ILO A;  3CRT A;  3GKM A;  3QMX A;  2HSY A;  3DXB A;  3L78 A;  4BL7 B;  1FG4 A;  3I6A A;  3L9V A;  2GGT A;  4TR1 A;  1ZYQ B;  1XPV A;  3FZ5 A;  1VRS D;  3HHV A;  3V1W A;  1EGR A;  3NOF A;  1BJX A;  2FWE A;  3D4T A;  2CVK A;  4I6X A;  1JZW A;  1TRU A;  1GTB A;  4CY6 A;  4HDE A;  4MF7 A;  4GSS A;  2IWT A;  1JFU A;  2R0P A;  4K1F A;  2C0E A;  3LW9 A;  4H86 A;  4FYB A;  1WRY A;  1M2A A;  4NAX A;  1G6Y A;  3D22 A;  2FUG 2;  1S3A A;  2V32 A;  1TRS A;  1PN0 A;  1GTA A;  2HYX A;  5JCW A;  1SJI A;  2H0I A;  3IK7 A;  1TXX A;  3BOA A;  3LYK A;  2XPE A;  2E2M A;  2VAF A;  4TR1 B;  2M72 A;  4ZBD A;  1ON4 A;  3IV4 A;  1ERT A;  12GS A;  1A2L A;  3GKN A;  2HT9 A;  3GKX A;  3GMF A;  4TR4 A;  2OBK A;  2H6X A;  4PQI A;  3TRX A;  1EWX A;  1SEN A;  3TGZ A;  1IYH A;  3FK8 A;  5GST A;  2GS3 A;  4L5L A;  2GST A;  4X4J A;  3CSH A;  2ON7 A;  2WRT A;  2G0F A;  1Z6N A;  3LFL A;  2GSR A;  2HZE A;  1XWG A;  4WBR D;  3CTG A;  2X99 A;  3KZQ A;  3LJR A;  4TOP A;  4LL1 B;  4JR4 A;  2MZC A;  4WKW A;  1F3B A;  4KW6 A;  3TJK A;  1J0F A;  2GZZ A;  3M9K A;  4YKG A;  5KN0 A;  4TXO B;  2BTO T;  2DJ3 A;  3MDK A;  2NBS A;  2RII A;  3SBC A;  3TRQ A;  3QAG A;  2C0G A;  4PNG A;  4PGT A;  4KSM A;  1EOH A;  1JZR A;  1OKD A;  4BVY A;  2BJX A;  4X43 A;  2K6V A;  2GT6 A;  1GH2 A;  3BCK A;  3O3T A;  3P7X A;  5AIX A;  2C0D A;  4HUA A;  4NMU A;  5ENU A;  1WPI A;  2WZ9 A;  1G6W A;  3HZ4 A;  1KEB A;  2PVQ A;  2R0C A;  1C72 A;  1TP9 A;  1XCC A;  5H5R A;  2O87 A;  3KEB A;  1TRW A;  3IE3 A;  5HR2 A;  4IP1 A;  1CQH A;  4IS0 A;  2H71 A;  2FWH A;  5D93 A;  3F4R A;  1TU7 A;  2PWJ A;  3F6D A;  2F51 A;  3DIE A;  3G7Y A;  2JSZ A;  1OC9 B;  4I5Q A;  3I43 A;  3ZIV A;  1GTU A;  2LQO A;  3H79 A;  18GS A;  3GH9 A;  2VCX A;  2GZY A;  1V2A A;  4BWS A;  5EL8 A;  3AY8 A;  4V2L A;  3UEM A;  1B8X A;  4POM A;  1EOG A;  1GL8 A;  3U6V A;  3DVW A;  5FHI A;  3EYT A;  2EIR A;  2OE3 A;  1YZX A;  3UMA A;  1QGV A;  4EO3 A;  4F2I A;  4MF6 A;  5HFK A;  4ULX A;  2B1K A;  3ZRE A;  1Z7R A;  2V1M A;  1XWC A;  1FVK A;  2DKI A;  3O6T A;  3UVT A;  5KN2 A;  4YAV A;  1T7P B;  2VCV A;  3R3E A;  1AW9 A;  4A5P A;  1AQV A;  3GNJ A;  5CNW A;  1AXD A;  3GHA A;  4OFN A;  4JR6 A;  4BA7 A;  3PH9 A;  1WJK A;  4FYU A;  4YQM A;  1X0R A;  4ZBA A;  2YNX A;  1NSW A;  2HSH A;  1O7U A;  1G7E A;  2I1U A;  3DVX A;  5C00 A;  4FYC A;  1T00 A;  2PN8 A;  3M8N A;  1X5C A;  2PUK C;  3N9J A;  1K0B A;  2FGX A;  1F3A A;  1PD2 1;  5ECH B;  5G1K A;  1I5G A;  1OE8 A;  1A2M A;  3ZYW A;  2JSY A;  2YN1 A;  1SD9 A;  3FZA A;  5CO3 A;  5D9X A;  4YKF A;  2TRX A;  3RDW A;  1WMJ A;  3M9J A;  2V2G A;  3L9U A;  3L0H A;  5HR0 A;  2HI7 A;  1GTI A;  5KEJ A;  2B5X A;  5FT3 A;  4ZB6 A;  2EC4 A;  2H76 A;  2RLI A;  2PER A;  2DJ2 A;  5D9W A;  3KH7 A;  2VM1 A;  4AJ6 A;  4J2F A;  2GQL A;  5IPG A;  3UVH A;  2R3X A;  3E0U A;  3QCP A;  4K5S A;  3CYN A;  4NWY A;  4PQ1 A;  4GTU A;  1ZOF A;  1CQG A;  4KE3 A;  4OWY A;  1JZO A;  5EPF A;  2I81 A;  1GNW A;  5L71 A;  4XCS A;  1IYI A;  4ECB A;  5F07 A;  3TDG A;  2FD3 A;  1X9W B;  1OAZ A;  3KP8 A;  2JU5 A;  1FOV A;  1EEJ A;  2WUL A;  3ISO A;  2LNS A;  3GYK A;  3TUE A;  2H6Y A;  1PX7 A;  4IP6 A;  4TXV A;  4OO5 A;  2FHE A;  4EDZ A;  3GUR A;  4WR5 A;  2GTU A;  5IMZ A;  2OA7 A;  4ZIJ A;  1A8Y A;  4MJA A;  2AAW A;  5CRW A;  3HYP A;  2K8S A;  4TW5 A;  4CDO A;  4GWR A;  2FY6 A;  4XRD A;  5INY A;  1TK0 B;  2QA2 A;  3CTF A;  3Q74 A;  1K3Y A;  2QA1 A;  5G1L A;  4OFM A;  2H72 A;  2IFQ A;  1SL1 B;  4MPG A;  5D73 A;  2K8V A;  2IME A;  4ML1 A;  3H8Q A;  4TVE A;  4Q5R A;  5CRD A;  1Q4J A;  1V58 A;  1F37 A;  22GS A;  4O92 A;  3KTL A;  1U87 A;  1R5P A;  1G0T A;  4XS4 B;  4WF5 A;  1SJ6 A;  3A2W A;  3TKR A;  3C73 A;  2RUF A;  2I4A A;  5BMU A;  4KAE A;  1Z9H A;  3TB2 A;  2FWG A;  3C7M A;  2HRA A;  1AQX A;  1GUL A;  5HQP A;  2CZ3 A;  4NPB A;  5A5K A;  2E2G A;  2Z9S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...