1BJXA

Human protein disulfide isomerase, nmr, 24 structures
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
110
structure length
110
Chain Sequence
AATTLPDGAAAESLVESSEVAVIGFFKDVESDSAKQFLQAAEAIDDIPFGITSNSDVFSKYQLDKDGVVLFKKFDEGRNNFEGEVTKENLLDFIKHNQLPLVIEFTEQTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Electron transport
molecule keywords PROTEIN DISULFIDE ISOMERASE
publication title The structure in solution of the b domain of protein disulfide isomerase.
pubmed doi rcsb
source organism Homo sapiens
total genus 19
structure length 110
sequence length 110
ec nomenclature ec 5.3.4.1: Protein disulfide-isomerase.
pdb deposition date 1998-06-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1bjxA00
4BWSA 1K3YA 3IRAA 1K0BA 5IQYA 2JL4A 3KZQA 1B48A 3L9SA 3LWAA 1SD8A 2VCZA 4HI7A 1A0RP 1JZDA 1EGRA 2HRNA 5DBQA 1YKCA 4GCIA 4OO5A 1OE8A 3ZITA 5B7CA 3M9JA 3TKPA 1MDJA 3EVIA 4ECCA 1GTUA 4EC0A 4LMWA 2CX3A 2C0DA 5HR0A 1SKWB 3DKSA 2FWHA 2R6KA 4XHMA 5FT3A 4ML6A 3KEBA 2CX4A 2PPTA 1Y6EA 1O7UA 4MZBA 2DLXA 1THOA 1R26A 1B9XC 2IFQB 1KEBA 1OE7A 5IMVA 1FOVA 1OC9B 5DCGA 3DD3A 3Q18A 2PMTA 2QC7A 1A24A 2JSZA 5EVOA 5G1LA 3HJOA 4QQ7A 3HJMA 3KTBA 4MA9A 3KM6A 3LXZA 5EL8A 4AGSA 2PUKC 1ZOFA 3OR5A 3MWHA 1F2EA 3KP9A 3UMAA 2B7JA 5D96A 3A2WA 4RQRA 2LSTA 3F6DA 5E59A 2WGRA 1AXDA 2QGVA 4ZBDA 4I97A 2YWIA 1VF1A 1GP1A 3TUEA 3J7Yk 4EL1A 3BBYA 2RUEA 2RUFA 3FHKA 2B1KA 2GQMA 4KCAA 1BYEA 4BWQA 3TCOA 3C7MA 2YWMA 3GSSA 2H1AA 4X0XA 2O89A 1XWAA 2VO4A 4GSTA 3HYPA 3LEFA 4RQXA 3GTUB 4ACSA 5HR3A 4DEJA 2LQQA 4HEA2 3FEUA 4MF7A 2H01A 3UVTA 1XCCA 4CHSA 3PINA 1MTCA 4H86A 5HQPA 1GH2A 2H6ZA 4BL7A 5IM9A 2NBSA 2GS3A 1KTEA 2A2SA 4IW9A 3ZLPA 1TOFA 4V2NA 4POBA 2FA8A 4ZXGA 3GKKA 3UAPA 3M0FA 2HSYA 1M0UA 1F3BA 1J9BA 3CSJA 2JZTA 3UBLA 4FIWA 2X8CA 1T3BA 3HXSA 1TRWA 5ECMB 2YNXA 2V41A 2L6DA 4TXOA 2MMOA 3DIEA 4QL9A 2YWNA 4MJCA 1N2AA 2K9FA 5AIVA 1M9BA 2YJ7A 4HDEA 5CRDA 4LLRA 4KDXA 2B5XA 2LKUA 2YPMA 5DCHA 5JWQB 1ABAA 2B7KA 4ZBBA 1GSFA 1PKWA 1QFNA 3EWLA 4G10A 2MMNA 2EC4A 3DWVA 3IBHA 5G5EA 3UARA 4ZIJA 2TIRA 3F3QA 4ZB8A 4F82A 1TRUA 4DSSB 5AN1A 1YEPA 1XWKA 13GSA 3VI5A 3WGXA 2VD0A 4IVFA 2L5OA 4I6XA 5EPFA 1ACVA 1U3IA 2O8VB 3FZAA 1DUGA 5ECQB 3V1WA 5G1KA 1GSQA 1GTIA 5HFIA 2C0FA 2LEGA 3ERFA 3DGQA 2XC2A 4KA0A 1FAAA 1DE2A 1AAZA 1A0FA 1OKDA 1MDIA 1RK4A 2L4QA 1EP8A 1WIKA 3BD2A 1J0FA 1K0NA 2L59A 1G6WA 5GAPD 1GNEA 2K6VA 3L9UA 1FO5A 3VWXA 1QMVA 3G7IA 2H6XA 4X1UA 1AQXA 5J5NA 3IPZA 4XRAA 5L71A 3A5WA 2PVOC 3HVVA 4K8MA 4F0CA 2FNOA 2HSHA 1TK5B 5DVBA 1C72A 3F4RA 4ZB6A 1TK0B 1PMTA 1NW2A 3HZ4A 2LRNA 2YCDA 3GKMA 5A4UA 2ON5A 2IL3A 1QXHA 1SJZA 4DVCA 2TRXA 2HXKA 2GSRA 4N0ZA 4ZILA 3RDWA 4J56E 5ECOB 4KDYA 2IFQA 2H6YA 1OC9A 2CVKA 2WRTA 4AF2A 5B6NA 1XW6A 4WETA 2IMEA 1H75A 4GRFA 1SYRA 2EIQA 3QCPA 1WWJA 2DIZA 2I1UA 2HT9A 2I3YA 4G2EA 5J3RA 11GSA 2C8UA 1WRYA 2I81A 4MK3A 4HOJA 3RPPA 2IJYA 1NM3A 2BMXA 1AC1A 2FWEA 2ZCTA 1EEJA 1SK0A 6GSTA 5IOXA 4EDYA 4RI6A 4ZL7A 3GUSA 1JFUA 5ECKB 5IO2A 3VWUA 4K0NA 1BEDA 2CA8A 2KP1A 5C00A 4D73A 4WKWA 5IMZA 1EV4A 1V9WA 2OKAA 4EO3A 2MZCA 4MH3A 4GXZA 1WE0A 2D2ZA 3E0UA 3C73A 4GQFA 1TXXA 3IA1A 1FG4A 4G9HA 4N11A 1X0RA 3LYKA 3IHQA 5IPHA 1I9DA 2IMFA 2AJQB 3KJYA 2F8AA 2C0GA 4PX1A 1JHBA 2B5YA 2AB6A 3CBUA 2DSAA 4PUFC 1TRSA 1AIUA 1MD3A 2LQOA 4O32A 4NAXA 3M9KA 4O7HA 1HNBA 1WPIA 3TJKA 1G7OA 1V2AA 3A2XA 5HR1A 4MJEA 2F51A 1XVQA 4HJ2A 1GUKA 3ERWA 3F6FA 2P0GA 1WJKA 2IIYA 2QKEA 3CSHA 3WD6A 4EF0A 3EYTA 2NTOA 4G19A 6GSYA 4TR3A 4E8HA 2F8FA 3LSZA 1M7TA 2DBCA 1GL8A 2I4AA 3HA9A 3VWWA 4NMUA 5CO3A 3SBCA 3ME7A 3IDVA 2VCTA 2FWGA 3L78A 4E8EA 2GTUA 4HS1A 1XPVA 5AGYA 6GSSA 3K8NA 1VF2A 1T4ZA 4HQZA 4EE0A 4XTSA 4ZL8A 2PERA 3ZREA 5D9VA 2DJ2A 1E6BA 2OE1A 4N30A 3CRTA 1ZGNA 4TVEA 5J41A 1GNWA 3MNGA 5DQYA 1OAZA 2OBKA 3D22A 3HCZA 2PBJA 3ME8A 3ZMKA 2H1GA 3IOSA 2CAIA 5ECLB 1YY7A 3F9UA 1JZWA 3HHVA 1NHOA 3HVSA 3LG6A 4L5OA 4MABA 1A2MA 1YEXA 3MDKA 2DIYA 4AJ8A 3KTLA 1EZKA 2PGTA 3H4KA 4MF6A 3TRQA 1ERUA 1M99A 5LCZA 2B3SA 1ZMAA 2HLSA 1TP9A 1UVZA 2L4CA 1S3DA 1A2JA 2GT6A 4MJBA 3D4MA 4ID0A 4POMA 2JU5A 3GURA 5CNWA 4IP6A 2V6OA 4N0VA 5JWRB 1HD2A 1USBA 4F0BA 2X99A 1Z9HA 1ZZYA 4HU9A 1ERTA 3I9V2 2V6KA 5F06A 5ABRA 1Y25A 2JADA 4MJAA 2C3QA 3Q6OA 3APSA 3IK7A 2NDOA 3KMNA 3TDGA 1ZL9A 2O87A 1EOHA 2R5GA 2HNLA 3ZIVA 4V2MA 3KH7A 1VGLA 3GFKA 4WF4A 4YAPA 4J57E 1NHYA 5D73A 4OFNA 3ZZXA 3A2VA 1WOUA 4RUVA 4KX4A 1GSYA 2C80A 1PGTA 5G30A 5IMDA 2RLIA 1V58A 2GQKA 3ZVJA 1K0AA 2E2GA 2AYTA 4KNDA 2WJUA 4L8EA 3GX8A 2H8LA 2PVQA 4TXVA 3P7XA 2H1BA 1ON4A 5JCWA 3APOA 2WZ9A 4HZ2A 4KUNA 1TJDA 1BAYA 5GSTA 1OYJA 4XCSA 3TKQA 3DEXA 3H1NA 2P5RA 3GMFA 1X5EA 1QK8A 3HJPA 2E7PA 5INYA 5DALB 2ALBA 3UL3A 2DJJA 2H74A 4MP4A 1ERWA 3G7YA 3MSZA 4D73B 3ZYWA 5GSSA 1Z7PA 5J4UA 4Q5QA 3F4TA 2OACA 3NZNA 2MBSA 3VFIA 3TJJA 3FR9A 4P3YB 2C3NA 4EVMA 3PH9A 4K2DA 1DE1A 5DQSA 4ECBA 3RHBA 2GVPA 3UOMA 4NV5A 2R3XA 4Z7XA 1O85A 3KXOA 4YQMA 2VUPA 1GSUA 4MZWA 4PQ1A 3ZMLA 1HNCA 4KB3A 2N5AA 1ST9A 3M1GA 2DJ0A 2XHFA 3QDNA 1SKSB 17GSA 1F37A 2AV4A 1M2AA 4MF5A 2VOCA 3HY2A 3O6TA 1TRVA 4O92A 3CMIA 2JSYA 3KD0A 1EP7A 4NXIA 4AJ7A 1Z6MA 1NSWA 4WXTA 4JU5A 3TKSC 1N8JA 1X5CA 5F0GA 5LD0A 1Q98A 1O8XA 3TKRA 5DJLA 4ISDA 4POLA 2H1DA 2J23A 1V98A 2P5QA 3FR3A 5ECPB 1G0TA 2C4JA 3GA4A 3WGDA 2QSIA 1DBYA 4WR5A 4PXOA 2YOIA 5DDLA 1ILOA 1YQ1A 2DC5A 5DJMA 1K3LA 2F3MA 1SENA 1T1VA 1TI1A 3UVHA 3KCMA 3N9JA 4XS4A 1GSDA 1Z6NA 1T7PB 3HD5A 1YF1A 2H76A 4NHZA 1LU4A 1X5DA 2GT5A 2JZRA 3GH6A 2A4VA 3TOUA 1GULA 4LA1A 5D8IA 3WYWA 2N5BA 4XIHA 4IELA 4WBJA 5B8BA 3F3RA 5IOWA 3H8QA 4J2FA 3EC3A 2K18A 4CW9A 5FHIA 3L9VA 2P31A 1WMJA 3FR6A 4TR0A 1AQWA 4FO5A 4YAVA 1SKRB 4KH7A 4KDUA 3H93A 4KCEA 1AW9A 2LJAA 3IAM2 2VM2A 1PQNA 3L0HA 4L0UA 1ZYEA 3D21A 1R4WA 3FY7A 2LV3A 3F4SA 4MCUA 3TOTA 3BJ5A 1AQVA 1XW5A 2E2MA 1W89A 1SU9A 5F07A 9GSSA 1BQ7A 4GTUA 3D6IA 3IC4A 5C04A 5ECNB 4OMVA 4DSQA 1URMA 8GSSA 5ELAA 3VK9A 1PL1A 2VIMA 4JR6A 2G0FA 2L6CA 1HYUA 3ED3A 4MH2A 1OKTA 2GSTA 4OFMA 1DSBA 3ISOA 2FY6A 5G31A 1SK1A 2YP6A 1GTBA 3ERGA 2HRFA 4PQHA 5CRWA 4L5LA 3JCML 2OE0A 1A8YA 2FHEA 3GHAA 1PN9A 4IHUA 1YF0A 4OFTA 3Q74A 3TKSE 1Z7RA 4FYCA 10GSA 3GX0A 1LBKA 2HZEB 2H75A 4IQ1A 3TB2A 5DALA 1OC8A 3Q19A 2LJRA 1SD9A 2HFDA 2WCIA 1X9SB 1JZOA 5F05A 2GZYA 4WF5A 3DRNA 4I2TA 4Q5RA 1ZYQB 2YANA 4F9ZA 2KP2A 3M3MA 3LXTA 2BJXA 2YZHA 4WBRD 1XWCA 4LL4B 1G7EA 2X8GA 3QR6A 2R4VA 2IMKA 1SJIA 2H66A 3QPMA 1CQHA 1FB6A 5HFGA 2GSSA 2XPEA 1FW1A 1B8XA 2XBQA 2N5FA 1G6YA 5KN1A 1BJXA 4POKA 1ZCPA 3C1SA 2VD1A 1BX9A 1LJRA 2ON7A 5IMCA 2DMMA 4JE1A 4PNGA 1O8WA 2KOKA 2CVBA 5D9XA 5B8AA 4PNFA 1K0MA 4XS6A 2M72A 3CRUA 1MD4A 3D0ZA 3S9FA 4YQVA 4AJ6A 3WT2A 3ZFLA 3KIJA 5CP1A 4MMMA 4ECJA 1EGOA 2LS5A 3SWLA 1K0OA 3KP8A 4OWYA 2FUG2 3W8SA 5ECIB 2YJHA 3IV4A 2MMZA 4KSOA 1R7HA 1EWXA 2LNTA 6GSVA 1ML6A 2RM6A 3UEMA 3C8EA 2H70A 1FVJA 2H30A 2H71A 5IMFA 4PQIA 2ZNMA 4XS4B 1MDKA 2C3TA 4MPFA 2CZ3A 3TGZA 4IBPA 1F6MC 2WS2A 3J7Yb 2X64A 1TU7A 3CYNA 2YZUA 2FD3A 3A3TA 4IQAA 4PUAA 3FRCA 2NPBA 3RPNA 3HVXA 4HUAA 5ID2A 3G9BA 1CQGA 3VPTA 1JZRA 5H5QA 2AHEA 1FVKA 1XOBA 2JACA 4JRRA 5CRHA 1GLPA 5COHA 3GV1A 3GRXA 3QAVA 1QGVA 4K1FA 3C1RA 5ECHB 1PA3A 3PR8A 2VLUA 2B6MA 5JCUA 3ZVJD 3KH9A 5GZZB 4TW5A 20GSA 2LNSA 1O73A 1EOGA 2PWJA 3WGEA 4HZ4A 3ZIJA 1GLQA 3TRXA 4TOPA 1B9YC 1M2DA 2YV9A 5JCGA 2OE3A 3HDCA 3CXGA 3HKRA 4WR4A 4V1Ag 1SL0B 1O6JA 4NHWA 3GSTA 5EY6A 5A5KA 4HJMA 5G5FA 3EURA 4I5QA 3NIVA 5J9CA 5CYYA 2TRCP 2GZPA 2LRTA 4IJ3A 4GSNA 4TR4A 1RQMA 1GUMA 1XXUA 5KN0A 3IXRA 3DYRA 3DVXA 1B4QA 3I6AA 4OCEA 4EUYA 2PU9C 2CQ9A 2YV7A 3RBTA 1FB0A 2R2JA 4I8BA 4MLYA 3NOFA 2B5EA 2HYXA 4WEYA 1UA5A 2VLTA 1XW9A 4NWYA 7GSSA 3EU4A 2GSQA 2JZSA 4K7NA 5A4VA 5JWOB 1EEMA 3LYPA 2HZEA 3TKSA 4PURA 3FK8A 3FKFA 3IAS2 5D9TA 2IMDA 5ECRB 4OCFA 1T00A 4ILFA 3IE3A 2DJ1A 1U6TA 3M8NA 4IN0A 1EV9A 4TN8A 4K7IA 2CT6A 3H79A 4MZCA 1H4OA 4K7OA 4IGJA 1S3AA 3ZL5A 3LJRA 4EDZA 2H72A 5E4WA 1VF4A 6GSWA 3CTGA 1X9MB 1PKZA 2IN3A 3IK9A 2FGXA 1XWBA 3FZ5A 4BPYA 3L4NA 5G2ZA 1M9AA 3E9JB 2VCXA 2HZFA 3LORA 3UJ1A 3ZTLA 2FCHA 2GGTA 2X8HA 1T8EB 1KNGA 3W6GA 1XWGA 2VL2A 2H19A 5DAKB 14GSA 1XZOA 2LRCA 3F8UA 3EU3A 4MDCA 3LGCA 1PX7A 2V1MA 6GSUA 4V1Ap 2IPAA 2GQLA 1R5PA 1A23A 2B1LA 5GAND 3GL3A 4Q5NA 5ENUA 1U87A 4IS0A 3TJGA 4F03A 1PD21 1Q4JA 2KHPA 5A4WA 2C1YA 1HNAA 1BG5A 2GDRA 1XVWA 1TK8B 2H0GA 4KW6A 3VLNA 5CREA 2RM5A 3RAZA 1OVNA 2MYGA 1TI3A 1UN2A 4ZB9A 3DMLA 5IO0A 2KLXA 3QOUA 1X9WB 1GTAA 3IR4A 4BVYA 3WT1A 3EE2A 5AISA 4QL7A 4JZQA 2L57A 4Q5FA 1JLVA 1V40A 3EMPA 1VF3A 2Z9SA 1IYIA 1M2BA 3QFAC 4JBBA 3BCKA 5KN2A 4X43A 4YQUA 4TR1A 1PX6A 1UC7A 2VL2C 2PN8A 2YWOA 4EKZA 4GLTA 1E2YA 5IPGA 3ZRDA 3VURA 5ID2B 4ML1A 3KMOA 4FYBA 1Z3EA 4L0WA 1THXA 4KAEA 3RHCA 1GSEA 3QMXA 4IKHA 1XOAA 3U5RE 1R5AA 3O76A 4PGTA 4FH8A 1XIYA 4YH2A 5J9BA 4LL1B 3CTFA 1OC3A 2R37A 4K6XA 2O7KA 5B6MA 3EMXA 2RIIA 3QAGA 4EXJA 1F3AA 1GSSA 2LUSA 2L5LA 4JR4A 4KE3A 1KBNA 1U88A 5F8BA 1GWCA 4F2IA 3VWVA 4JEDA 1V57A 5ELGA 2FLSA 5CAXA 2EIRA 1JLWA 1A8LA 4KSMA 2VCQA 18GSA 1PL2A 1AUCA 4GQCA 1F9MA 5AIXA 1K0DA 4V2LA 3GL5A 2WDUA 4IJIA 1IYHA 2M46A 2WFCA 5IMAA 3VI7A 2C0EA 2VL9A 3FZ4A 1TDIA 3BCIA 1TTZA 2VAFA 2K8VA 1XFLA 3GYKA 5FWGA 2GLRA 4HU7A 1SL2B 3P8WA 4FYUA 3ZFBA 2EIOA 2CV4A 1YZXA 2H73A 3AY8A 2DMLA 2MMAA 2F9SA 2GZZA 1RW1A 2REMA 4MPGA 5KN3A 2M80A 5D93A 4K9ZA 4GF0A 5LNKe 16GSA 1SYXA 3I43A 3GKXA 1YKAA 4ZBAA 3GNJA 3U6VA 5KEJA 3N5OA 4RI7A 3QAWA 1GRXA 2WB9A 4OO4A 2HI7A 2CZ2A 2VM1A 1SK2A 1YDKA 4ECIA 3R2QA 2KUCA 6GSXA 3APQA 4IP1A 4K0GA 1ERVA 2J9HA 3CSIA 2AUVA 4OD7A 3VPQA 3W8JA 5D9WA 3EINA 3HZ8A 5HR2A 3GTUA 3LQ7A 2H0HA 4NPBA 2DJ3A 1K3OA 1WP0A 4GWRA 5DAKA 5IIZA 3GIXA 2CAQA 1B4PA 1TU8A 2LJKA 4N10A 3DVWA 4LMVA 12GSA 2FWFA 2LTKA 3TRPA 2XBIA 1U3AA 2OBIA 4ZL9A 4I2UA 3KGKA 2V32A 5H5SA 3F0IA 1XBSA 3TJFA 4BA7A 4TKYA 1GUHA 2CVDA 4XS1A 2VL3A 1TW9A 2FA4A 2E0QA 1SJ6A 3D5JA 2H0IA 2WULA 2AAWA 1SL1B 3PGTA 4ULXA 4O5RA 3D4TA 4GSSA 2A2RA 3P2AA 3US3A 1YJ6A 2OADA 2IWTA 1O81A 3MAKA 22GSA 2ZUPA 2OA7A 1HQOA 4BVXA 3FYGA 2I9HA 2YN1A 3GN3A 3TJBA 1I5GA 1W4VA 3UIWA 2G2QA 3GKNA 5HFKA 1J08A 4TRXA 1TKDB 3DXBA 3G7JA 3I69A 3FW2A 3P90A 3GH9A 1QUWA 4TXOB 2BTOT 4HQSA 3O3TA 4DSRA 19GSA 2K8SA 2VLVA 5ECSA 5CRGA 2DJKA 2ES7A 2XPDA 3FZ9A 2OJLA 4CDOA 1FHEA 4TR1B 1S3CA 2V2GA 4NV2A 1MEKA 2IMIA 3C71A 1QQ2A 2VCWA 2NVLA 2HE3A 1PRXA 2MBTA 3E3EA 4KGIA 3UBKA 3F63A 4XRDA 4DSSA 3LFLA 1A2LA 1Z5YE 3BOAA 2O85A 3QFBC 1PSQA 1VRSD 1T4YA 2VCVA 3QD9A 1K0CA 5H5RA
chains in the Genus database with same CATH superfamily
4BWSA 1K3YA 3IRAA 1K0BA 5IQYA 2JL4A 3KZQA 1B48A 3L9SA 3LWAA 1SD8A 2VCZA 4HI7A 1A0RP 1JZDA 1EGRA 2HRNA 4HSCX 5DBQA 1YKCA 4GCIA 4OO5A 1OE8A 3ZITA 5B7CA 3M9JA 3TKPA 1MDJA 3EVIA 4ECCA 4PTSA 1GTUA 4EC0A 4LMWA 2CX3A 2C0DA 5HR0A 1SKWB 3DKSA 2FWHA 2HRKA 2R6KA 4XHMA 5FT3A 4ML6A 3KEBA 2CX4A 2PPTA 1Y6EA 1O7UA 4MZBA 2DLXA 1THOA 1R26A 1B9XC 2IFQB 1KEBA 1OE7A 5IMVA 1FOVA 1OC9B 5DCGA 3DD3A 3Q18A 2PMTA 2QC7A 1A24A 2JSZA 5EVOA 5G1LA 3HJOA 4QQ7A 3HJMA 3KTBA 4MA9A 3KM6A 3LXZA 5EL8A 4AGSA 2PUKC 1ZOFA 3OR5A 3MWHA 4G0KA 1F2EA 3KP9A 3UMAA 2B7JA 5D96A 3A2WA 4RQRA 2LSTA 3F6DA 5E59A 2WGRA 1AXDA 2QGVA 4ZBDA 4I97A 2YWIA 1VF1A 1GP1A 3TUEA 3J7Yk 4EL1A 3BBYA 2RUEA 2RUFA 3FHKA 2B1KA 2GQMA 4KCAA 1BYEA 4BWQA 3TCOA 3C7MA 2YWMA 3GSSA 2H1AA 4X0XA 2O89A 1XWAA 2VO4A 4GSTA 3HYPA 3LEFA 2DKIA 4RQXA 3GTUB 4ACSA 5HR3A 4DEJA 2LQQA 4HEA2 3FEUA 4MF7A 2H01A 3UVTA 1XCCA 4CHSA 3PINA 1MTCA 4H86A 5HQPA 1GH2A 2H6ZA 4BL7A 5IM9A 2NBSA 2GS3A 1KTEA 2A2SA 4IW9A 3ZLPA 1TOFA 4V2NA 4POBA 2FA8A 4ZXGA 3GKKA 3UAPA 3M0FA 2HSYA 1M0UA 1F3BA 1J9BA 3CSJA 2JZTA 3UBLA 4FIWA 2X8CA 1T3BA 3HXSA 1TRWA 5ECMB 2YNXA 2V41A 2L6DA 4TXOA 2MMOA 4Z2UA 3DIEA 4QL9A 2YWNA 4MJCA 1N2AA 2K9FA 5AIVA 1M9BA 2YJ7A 4HDEA 5CRDA 4LLRA 4KDXA 2B5XA 2LKUA 2YPMA 5DCHA 4EIPA 5JWQB 1ABAA 2B7KA 4ZBBA 1GSFA 1PKWA 1QFNA 3EWLA 4G10A 3MIXA 2MMNA 2EC4A 3DWVA 3IBHA 5G5EA 3UARA 4ZIJA 2TIRA 3F3QA 4ZB8A 4F82A 1TRUA 4DSSB 5AN1A 1YEPA 1XWKA 13GSA 3VI5A 3WGXA 2VD0A 4IVFA 2L5OA 4I6XA 5EPFA 1ACVA 1U3IA 2O8VB 3FZAA 1DUGA 5ECQB 3V1WA 5G1KA 1GSQA 1GTIA 5HFIA 2C0FA 2LEGA 3ERFA 3DGQA 2XC2A 4KA0A 1FAAA 1DE2A 1AAZA 1A0FA 1OKDA 1MDIA 1RK4A 2L4QA 1EP8A 1WIKA 3BD2A 1J0FA 1K0NA 2L59A 1G6WA 5GAPD 1GNEA 2K6VA 3L9UA 1FO5A 3VWXA 1QMVA 3G7IA 2H6XA 4X1UA 1AQXA 5J5NA 3IPZA 4XRAA 5L71A 3A5WA 2PVOC 3HVVA 4K8MA 4F0CA 2FNOA 2HSHA 1TK5B 5DVBA 1C72A 1FOHA 3F4RA 4ZB6A 1TK0B 1PMTA 1NW2A 3HZ4A 2LRNA 2YCDA 3GKMA 5A4UA 2ON5A 2IL3A 1QXHA 1SJZA 4DVCA 2TRXA 2HXKA 2GSRA 4N0ZA 4ZILA 3RDWA 4J56E 5ECOB 4KDYA 2IFQA 2H6YA 1OC9A 2CVKA 2WRTA 4AF2A 5B6NA 1XW6A 4WETA 2IMEA 1H75A 4GRFA 1SYRA 2EIQA 3QCPA 1WWJA 2DIZA 2I1UA 2HT9A 2I3YA 4G2EA 5J3RA 11GSA 2C8UA 1WRYA 2I81A 4MK3A 4HOJA 3RPPA 2IJYA 1NM3A 2BMXA 1AC1A 2FWEA 2ZCTA 1EEJA 1SK0A 2R0CA 4EIQA 6GSTA 5IOXA 4EDYA 4YKGA 4RI6A 4ZL7A 3GUSA 1JFUA 5ECKB 5IO2A 3VWUA 4K0NA 1BEDA 2CA8A 2KP1A 5C00A 4D73A 4WKWA 5IMZA 4G0IA 1EV4A 1V9WA 2OKAA 4EO3A 2MZCA 4MH3A 4GXZA 1WE0A 2D2ZA 3E0UA 3C73A 4GQFA 1TXXA 3IA1A 1FG4A 4G9HA 4N11A 1X0RA 3LYKA 3IHQA 5IPHA 1I9DA 2IMFA 2AJQB 1ZYPA 3KJYA 2F8AA 2C0GA 4PX1A 1JHBA 2B5YA 2AB6A 3CBUA 2DSAA 4PUFC 1TRSA 1AIUA 1MD3A 2LQOA 4O32A 4NAXA 3M9KA 4O7HA 1HNBA 1WPIA 3TJKA 1G7OA 1V2AA 3A2XA 5HR1A 2R0GA 2F51A 4MJEA 1M3IA 4G0LA 1XVQA 4HJ2A 1GUKA 3ERWA 3F6FA 2P0GA 1WJKA 3FMWA 2IIYA 2QKEA 3CSHA 3WD6A 4EF0A 3EYTA 2NTOA 4G19A 2HRAA 6GSYA 4TR3A 4E8HA 2F8FA 3LSZA 1M7TA 2DBCA 1GL8A 2I4AA 3HA9A 3VWWA 4NMUA 5CO3A 3SBCA 3ME7A 3IDVA 2VCTA 2FWGA 3L78A 4E8EA 2GTUA 4HS1A 1XPVA 5AGYA 6GSSA 3K8NA 1VF2A 1T4ZA 4HQZA 4EE0A 4XTSA 4ZL8A 2PERA 3ZREA 5D9VA 2DJ2A 1E6BA 2OE1A 4N30A 3CRTA 1ZGNA 4TVEA 5J41A 1GNWA 3MNGA 5DQYA 1OAZA 2OBKA 3D22A 3HCZA 2PBJA 3ME8A 3ZMKA 2H1GA 3IOSA 2CAIA 5ECLB 1YY7A 3F9UA 1JZWA 3HHVA 1NHOA 3HVSA 3LG6A 4L5OA 4MABA 1A2MA 1YEXA 3MDKA 2DIYA 4AJ8A 3KTLA 1EZKA 2PGTA 3H4KA 3HVNA 4MF6A 3TRQA 1ERUA 1M99A 5LCZA 2B3SA 1ZMAA 2HLSA 1TP9A 1UVZA 2L4CA 1S3DA 1A2JA 2GT6A 4MJBA 3D4MA 4ID0A 4POMA 2JU5A 3GURA 5CNWA 4IP6A 2V6OA 4N0VA 5JWRB 1HD2A 1USBA 4F0BA 2X99A 1Z9HA 1ZZYA 4HU9A 1ERTA 3I9V2 2V6KA 5F06A 5ABRA 1Y25A 2JADA 4MJAA 4A5PA 2C3QA 3Q6OA 3APSA 3IK7A 2NDOA 3KMNA 3TDGA 1ZL9A 2O87A 1EOHA 2R5GA 2HNLA 3ZIVA 4V2MA 3KH7A 1VGLA 3GFKA 4WF4A 4YAPA 4J57E 1NHYA 5D73A 4OFNA 3ZZXA 3A2VA 1WOUA 4RUVA 4KX4A 1GSYA 2C80A 1PGTA 5G30A 5IMDA 2QA1A 2RLIA 1V58A 2GQKA 3ZVJA 1K0AA 2E2GA 2AYTA 4KNDA 2WJUA 3IC8A 4L8EA 3GX8A 2H8LA 2PVQA 4TXVA 3P7XA 2H1BA 1ON4A 5JCWA 3APOA 2WZ9A 4HZ2A 4KUNA 1TJDA 4Z2RA 1BAYA 5GSTA 1OYJA 4XCSA 3TKQA 3DEXA 3H1NA 2P5RA 3GMFA 1X5EA 1QK8A 3HJPA 2E7PA 5INYA 5DALB 4K5SA 2ALBA 3UL3A 2DJJA 2H74A 4MP4A 1ERWA 3G7YA 3MSZA 4D73B 3ZYWA 5GSSA 1Z7PA 5J4UA 4Q5QA 3F4TA 2OACA 3NZNA 2MBSA 3VFIA 3TJJA 3FR9A 4P3YB 2C3NA 5KOWA 4EVMA 3PH9A 4K2DA 1DE1A 5DQSA 4ECBA 3RHBA 2GVPA 3UOMA 4NV5A 4YKFA 2R3XA 4Z7XA 1O85A 3KXOA 4YQMA 2VUPA 1GSUA 4MZWA 4PQ1A 3ZMLA 1HNCA 4KB3A 2N5AA 2UZ8A 1ST9A 3M1GA 2DJ0A 2XHFA 3QDNA 1SKSB 17GSA 1F37A 2AV4A 1M2AA 4MF5A 2VOCA 3HY2A 3O6TA 1TRVA 4O92A 3CMIA 5KOXA 2JSYA 3KD0A 1EP7A 4NXIA 4AJ7A 1Z6MA 1NSWA 4WXTA 4JU5A 3TKSC 1N8JA 1X5CA 5F0GA 5LD0A 1Q98A 3EPTA 1O8XA 3TKRA 5DJLA 4ISDA 4POLA 2H1DA 2J23A 1V98A 2P5QA 3FR3A 5ECPB 1G0TA 2C4JA 3GA4A 3WGDA 2QSIA 1DBYA 4WR5A 4PXOA 2A2PA 2YOIA 5DDLA 1ILOA 1YQ1A 3PPUA 2DC5A 5DJMA 1K3LA 2F3MA 1PFOA 1SENA 1T1VA 1TI1A 3UVHA 3KCMA 3N9JA 4XS4A 1GSDA 1Z6NA 1T7PB 3HD5A 1YF1A 2H76A 4NHZA 1LU4A 1X5DA 2GT5A 2JZRA 3GH6A 2A4VA 3TOUA 1GULA 4LA1A 5D8IA 3WYWA 2N5BA 4XIHA 4ICYA 4IELA 4WBJA 5B8BA 3F3RA 5IOWA 3H8QA 4J2FA 3EC3A 2K18A 4CW9A 5FHIA 3L9VA 2P31A 1WMJA 3FR6A 4TR0A 1AQWA 4FO5A 4YAVA 1SKRB 4KH7A 4KDUA 3H93A 4KCEA 1AW9A 2LJAA 3IAM2 2VM2A 1PQNA 3L0HA 4L0UA 5BMUA 1ZYEA 3D21A 1R4WA 3FY7A 2LV3A 3F4SA 4MCUA 3TOTA 3BJ5A 1AQVA 1XW5A 2E2MA 1W89A 1SU9A 5F07A 9GSSA 1BQ7A 4GTUA 3D6IA 3IC4A 5C04A 5ECNB 4OMVA 4DSQA 1URMA 8GSSA 5ELAA 3VK9A 1PL1A 2VIMA 4JR6A 2G0FA 2L6CA 1HYUA 3ED3A 4MH2A 1OKTA 2GSTA 4OFMA 1DSBA 3ISOA 4CY8A 2FY6A 5G31A 1SK1A 2YP6A 1GTBA 3ERGA 2HRFA 4PQHA 5CRWA 4L5LA 3JCML 2OE0A 1A8YA 2FHEA 3GHAA 1PN9A 2DKHA 1S3RA 4IHUA 1YF0A 4OFTA 3Q74A 3TKSE 1Z7RA 4FYCA 10GSA 3GX0A 1LBKA 2HZEB 2H75A 4IQ1A 3TB2A 5DALA 1OC8A 2R0PA 3Q19A 2LJRA 1SD9A 2HFDA 3LW9A 2WCIA 1X9SB 1JZOA 5F05A 2GZYA 4WF5A 3DRNA 4I2TA 4Q5RA 1ZYQB 2YANA 4F9ZA 2KP2A 3M3MA 3LXTA 2BJXA 2YZHA 4WBRD 1XWCA 4LL4B 1G7EA 2X8GA 3QR6A 2R4VA 2IMKA 1SJIA 2H66A 3QPMA 1CQHA 1FB6A 5HFGA 2GSSA 2XPEA 1FW1A 1B8XA 2XBQA 2N5FA 1G6YA 5KN1A 1BJXA 4POKA 1ZCPA 3C1SA 2VD1A 1BX9A 1LJRA 2ON7A 5IMCA 2DMMA 4JE1A 4PNGA 1O8WA 2KOKA 2CVBA 5D9XA 5B8AA 4PNFA 4O5QA 1K0MA 4XS6A 2M72A 3CRUA 1MD4A 3D0ZA 3S9FA 4YQVA 4AJ6A 3WT2A 3ZFLA 3KIJA 5CP1A 4MMMA 4ECJA 1EGOA 2LS5A 3SWLA 1K0OA 3KP8A 4OWYA 2FUG2 3W8SA 5ECIB 2YJHA 3IV4A 2MMZA 4KSOA 1R7HA 1EWXA 2LNTA 6GSVA 1ML6A 2RM6A 3UEMA 4BVYB 3C8EA 4X4JA 2H70A 1FVJA 2H30A 2H71A 5IMFA 2A4HA 4PQIA 2ZNMA 3A5IA 4XS4B 1MDKA 2C3TA 4MPFA 2CZ3A 3TGZA 4IBPA 1F6MC 2WS2A 3J7Yb 2X64A 1TU7A 3CYNA 2YZUA 2FD3A 3A3TA 4IQAA 4Z2TA 4PUAA 3FRCA 3R3EA 2NPBA 3RPNA 3HVXA 4HUAA 5ID2A 3G9BA 4K2XA 1CQGA 3VPTA 1JZRA 5H5QA 2AHEA 1FVKA 1XOBA 2JACA 4JRRA 5CRHA 1GLPA 5COHA 3GV1A 3GRXA 3QAVA 1QGVA 4K1FA 3C1RA 5ECHB 1PA3A 3PR8A 2VLUA 2B6MA 5JCUA 3ZVJD 3KH9A 5GZZB 4TW5A 20GSA 2LNSA 1O73A 1EOGA 2PWJA 3WGEA 4HZ4A 3ZIJA 1GLQA 3TRXA 4TOPA 1B9YC 1M2DA 2YV9A 5JCGA 2OE3A 3HDCA 3CXGA 3HKRA 4WR4A 4V1Ag 1SL0B 1O6JA 4NHWA 3GSTA 5EY6A 5A5KA 4HJMA 5G5FA 3EURA 4I5QA 3NIVA 5J9CA 5CYYA 2TRCP 2GZPA 2LRTA 4IJ3A 4GSNA 4TR4A 1RQMA 1GUMA 1XXUA 5KN0A 3IXRA 3DYRA 3DVXA 2QA2A 1B4QA 3I6AA 4OCEA 4EUYA 2PU9C 2CQ9A 2YV7A 3RBTA 1FB0A 2R2JA 4I8BA 4MLYA 3NOFA 2B5EA 2HYXA 4WEYA 1UA5A 2VLTA 4O5UA 1XW9A 4NWYA 7GSSA 3EU4A 2GSQA 2JZSA 4K7NA 5A4VA 5JWOB 2X49A 1EEMA 3LYPA 2HZEA 3TKSA 4PURA 2X4AA 3FK8A 3IHGA 3FKFA 3IAS2 5D9TA 2IMDA 5ECRB 4OCFA 1T00A 4ILFA 3IE3A 2DJ1A 1U6TA 3M8NA 4IN0A 1EV9A 4TN8A 4K7IA 2CT6A 3H79A 4MZCA 1H4OA 4K7OA 4IGJA 1S3AA 3ZL5A 3LJRA 4EDZA 2H72A 5E4WA 1VF4A 6GSWA 3CTGA 1X9MB 1PKZA 2IN3A 3IK9A 2FGXA 1XWBA 3FZ5A 4BPYA 3L4NA 5G2ZA 1M9AA 3E9JB 2VCXA 2HZFA 3LORA 3UJ1A 3ZTLA 2FCHA 2GGTA 2X8HA 1T8EB 1KNGA 3W6GA 1XWGA 2VL2A 2H19A 5DAKB 14GSA 1XZOA 2LRCA 3F8UA 3EU3A 4MDCA 3LGCA 1PX7A 2V1MA 6GSUA 4V1Ap 2IPAA 2GQLA 1R5PA 1A23A 2B1LA 5GAND 3GL3A 4Q5NA 5ENUA 1U87A 4IS0A 3TJGA 4F03A 1PD21 1Q4JA 2KHPA 5A4WA 2C1YA 1HNAA 1BG5A 2GDRA 1XVWA 1TK8B 2H0GA 4KW6A 3VLNA 4USSA 5CREA 2RM5A 4BVXB 3RAZA 1OVNA 2MYGA 1TI3A 1UN2A 4ZB9A 3DMLA 5IO0A 2KLXA 3QOUA 1X9WB 1GTAA 3IR4A 4BVYA 3WT1A 3EE2A 5AISA 4QL7A 4JZQA 2L57A 4Q5FA 1JLVA 1V40A 3EMPA 1VF3A 2Z9SA 1IYIA 1M2BA 3QFAC 4JBBA 3BCKA 5KN2A 4X43A 4YQUA 2HSMA 4TR1A 1PX6A 1UC7A 2VL2C 2PN8A 2YWOA 4EKZA 4GLTA 1E2YA 5IPGA 3ZRDA 3VURA 5ID2B 4ML1A 3KMOA 4FYBA 1Z3EA 4L0WA 1THXA 4KAEA 3RHCA 1GSEA 3QMXA 4IKHA 1XOAA 3U5RE 1R5AA 3O76A 4PGTA 4FH8A 1XIYA 4YH2A 5J9BA 4LL1B 3CTFA 1OC3A 2R37A 4K6XA 2O7KA 5B6MA 3EMXA 2RIIA 3QAGA 4EXJA 1F3AA 1GSSA 2LUSA 2L5LA 4JR4A 4KE3A 1KBNA 1U88A 5F8BA 1GWCA 4F2IA 3VWVA 4JEDA 1V57A 5ELGA 2FLSA 5CAXA 2EIRA 1JLWA 1XG8A 1A8LA 4K5RA 4KSMA 2VCQA 18GSA 1PL2A 1AUCA 4GQCA 1F9MA 5AIXA 1K0DA 4V2LA 3GL5A 2WDUA 4IJIA 1IYHA 2M46A 2WFCA 5IMAA 3VI7A 2C0EA 2VL9A 3FZ4A 1TDIA 3BCIA 1TTZA 2VAFA 2K8VA 1XFLA 3GYKA 5FWGA 1PN0A 2GLRA 4HU7A 1SL2B 3P8WA 4FYUA 3ZFBA 2EIOA 2CV4A 1YZXA 2H73A 3AY8A 2DMLA 2MMAA 2F9SA 2GZZA 1RW1A 2REMA 4MPGA 5KN3A 2M80A 5D93A 4K9ZA 4GF0A 5LNKe 16GSA 1SYXA 3I43A 3GKXA 1YKAA 4ZBAA 3GNJA 3U6VA 5KEJA 3N5OA 4RI7A 3QAWA 1GRXA 2WB9A 4OO4A 2HI7A 2CZ2A 2VM1A 1SK2A 1YDKA 4ECIA 3R2QA 2KUCA 6GSXA 3APQA 4IP1A 4K0GA 1ERVA 2J9HA 3CSIA 2AUVA 4OD7A 3VPQA 3W8JA 5D9WA 3EINA 3HZ8A 5HR2A 3GTUA 3LQ7A 2H0HA 4NPBA 2DJ3A 1K3OA 1WP0A 4GWRA 5DAKA 5IIZA 3GIXA 2CAQA 1B4PA 1TU8A 2LJKA 4N10A 3DVWA 4LMVA 12GSA 2FWFA 2LTKA 3TRPA 2XBIA 1U3AA 2OBIA 4ZL9A 4I2UA 3KGKA 4FQUA 2V32A 5H5SA 3F0IA 1XBSA 3TJFA 4BA7A 4TKYA 1GUHA 2CVDA 3CQFA 4XS1A 2VL3A 4BL7B 1TW9A 2FA4A 2E0QA 1SJ6A 3D5JA 2H0IA 2WULA 2AAWA 4BIKA 1SL1B 4MNNA 3PGTA 4ULXA 4O5RA 3D4TA 4GSSA 2A2RA 3P2AA 1ZYNA 3US3A 1YJ6A 2OADA 2IWTA 1O81A 3MAKA 22GSA 2ZUPA 2OA7A 1HQOA 4BVXA 3FYGA 2I9HA 2YN1A 3GN3A 3TJBA 1I5GA 1W4VA 3UIWA 2G2QA 3GKNA 5HFKA 1J08A 4TRXA 1TKDB 3DXBA 3G7JA 3I69A 3FW2A 3P90A 3GH9A 1QUWA 4TXOB 2BTOT 4HQSA 3O3TA 4DSRA 19GSA 2K8SA 2VLVA 5ECSA 5CRGA 2DJKA 2ES7A 2XPDA 3FZ9A 2OJLA 4CDOA 1FHEA 4CY6A 4TR1B 5BRTA 1S3CA 2V2GA 4NV2A 1MEKA 2IMIA 3C71A 1QQ2A 2VCWA 2NVLA 2HE3A 1PRXA 2MBTA 1M3JA 3E3EA 4KGIA 3UBKA 3F63A 4KF9A 4XRDA 4DSSA 3LFLA 1A2LA 1Z5YE 3BOAA 2O85A 3QFBC 1PSQA 1VRSD 1T4YA 2VCVA 3QD9A 1K0CA 3MYDA 5H5RA
chains in the Genus database with same CATH topology
4BWSA 1K3YA 3IRAA 1K0BA 5IQYA 2JL4A 3KZQA 1B48A 3L9SA 3LWAA 1SD8A 2VCZA 4HI7A 1A0RP 1JZDA 1EGRA 2HRNA 5DBQA 1YKCA 4GCIA 4OO5A 1OE8A 3ZITA 5B7CA 3M9JA 3TKPA 1MDJA 3EVIA 4ECCA 4PTSA 1GTUA 4EC0A 4LMWA 2CX3A 2C0DA 5HR0A 1SKWB 3DKSA 2FWHA 2HRKA 2R6KA 4XHMA 5FT3A 4ML6A 3KEBA 2CX4A 2PPTA 1Y6EA 1O7UA 4MZBA 2DLXA 1THOA 1R26A 1B9XC 2IFQB 1KEBA 1OE7A 5IMVA 1FOVA 1OC9B 5DCGA 3DD3A 3Q18A 2PMTA 2QC7A 1A24A 2JSZA 5EVOA 5G1LA 3HJOA 4QQ7A 3HJMA 3KTBA 4MA9A 3KM6A 3LXZA 5EL8A 4AGSA 2PUKC 1ZOFA 3OR5A 3MWHA 4G0KA 1F2EA 3KP9A 3UMAA 2B7JA 5D96A 3A2WA 4RQRA 2LSTA 3F6DA 5E59A 2WGRA 1AXDA 2QGVA 4ZBDA 4I97A 2YWIA 1VF1A 1GP1A 3TUEA 3J7Yk 4EL1A 3BBYA 2RUEA 2RUFA 3FHKA 2B1KA 2GQMA 4KCAA 1BYEA 4BWQA 3TCOA 3C7MA 2YWMA 3GSSA 2H1AA 4X0XA 2O89A 1XWAA 2VO4A 4GSTA 3HYPA 3LEFA 2DKIA 4RQXA 3GTUB 4ACSA 5HR3A 4DEJA 2LQQA 4HEA2 3FEUA 4MF7A 2H01A 3UVTA 1XCCA 4CHSA 3PINA 1MTCA 4H86A 5HQPA 1GH2A 2H6ZA 4BL7A 5IM9A 2NBSA 2GS3A 1KTEA 2A2SA 4IW9A 3ZLPA 1TOFA 4V2NA 4POBA 2FA8A 4ZXGA 3GKKA 3UAPA 3M0FA 2HSYA 1M0UA 1F3BA 1J9BA 3CSJA 2JZTA 3UBLA 4FIWA 2X8CA 1T3BA 3HXSA 1TRWA 5ECMB 2YNXA 2V41A 2L6DA 4TXOA 2MMOA 4Z2UA 3DIEA 4QL9A 2YWNA 4MJCA 1N2AA 2K9FA 5AIVA 1M9BA 2YJ7A 4HDEA 5CRDA 4LLRA 4KDXA 2B5XA 2LKUA 2YPMA 5DCHA 4EIPA 5JWQB 1ABAA 2B7KA 4ZBBA 1GSFA 1PKWA 1QFNA 3EWLA 4G10A 3MIXA 2MMNA 2EC4A 3DWVA 3IBHA 5G5EA 3UARA 4ZIJA 2TIRA 3F3QA 4ZB8A 4F82A 1TRUA 4DSSB 5AN1A 1YEPA 1XWKA 13GSA 3VI5A 3WGXA 2VD0A 4IVFA 2L5OA 4I6XA 5EPFA 1ACVA 1U3IA 2O8VB 3FZAA 1DUGA 5ECQB 3V1WA 5G1KA 1GSQA 1GTIA 5HFIA 2C0FA 2LEGA 3ERFA 3DGQA 2XC2A 4KA0A 1FAAA 1DE2A 1AAZA 1A0FA 1OKDA 1MDIA 1RK4A 2L4QA 1EP8A 1WIKA 3BD2A 1J0FA 1K0NA 2L59A 1G6WA 5GAPD 1GNEA 2K6VA 3L9UA 1FO5A 3VWXA 1QMVA 3G7IA 2H6XA 4X1UA 1AQXA 5J5NA 3IPZA 4XRAA 5L71A 3A5WA 2PVOC 3HVVA 4K8MA 4F0CA 2FNOA 2HSHA 1TK5B 5DVBA 1C72A 1FOHA 3F4RA 4ZB6A 1TK0B 1PMTA 1NW2A 3HZ4A 2LRNA 2YCDA 3GKMA 5A4UA 2ON5A 2IL3A 1QXHA 1SJZA 4DVCA 2TRXA 2HXKA 2GSRA 4N0ZA 4ZILA 3RDWA 4J56E 5ECOB 4KDYA 2IFQA 2H6YA 1OC9A 2CVKA 2WRTA 4AF2A 5B6NA 1XW6A 4WETA 2IMEA 1H75A 4GRFA 1SYRA 2EIQA 3QCPA 1WWJA 2DIZA 2I1UA 2HT9A 2I3YA 4G2EA 5J3RA 11GSA 2C8UA 1WRYA 2I81A 4MK3A 4HOJA 3RPPA 2IJYA 1NM3A 2BMXA 1AC1A 2FWEA 2ZCTA 1EEJA 1SK0A 2R0CA 4EIQA 6GSTA 5IOXA 4EDYA 4YKGA 4RI6A 4ZL7A 3GUSA 1JFUA 5ECKB 5IO2A 3VWUA 4K0NA 1BEDA 2CA8A 2KP1A 5C00A 4D73A 4WKWA 5IMZA 4G0IA 1EV4A 1V9WA 2OKAA 4EO3A 2MZCA 4MH3A 4GXZA 1WE0A 2D2ZA 3E0UA 3C73A 4GQFA 1TXXA 3IA1A 1FG4A 4G9HA 4N11A 1X0RA 3LYKA 3IHQA 5IPHA 1I9DA 2IMFA 2AJQB 1ZYPA 3KJYA 2F8AA 2C0GA 4PX1A 1JHBA 2B5YA 2AB6A 3CBUA 2DSAA 4PUFC 1TRSA 1AIUA 1MD3A 2LQOA 4O32A 4NAXA 3M9KA 4O7HA 1HNBA 1WPIA 3TJKA 1G7OA 1V2AA 3A2XA 5HR1A 2R0GA 2F51A 4MJEA 4G0LA 1XVQA 4HJ2A 1GUKA 3ERWA 3F6FA 2P0GA 1WJKA 3FMWA 2IIYA 2QKEA 3CSHA 3WD6A 4EF0A 3EYTA 2NTOA 4G19A 2HRAA 6GSYA 4TR3A 4E8HA 2F8FA 3LSZA 1M7TA 2DBCA 1GL8A 2I4AA 3HA9A 3VWWA 4NMUA 5CO3A 3SBCA 3ME7A 3IDVA 2VCTA 2FWGA 3L78A 4E8EA 2GTUA 4HS1A 1XPVA 5AGYA 6GSSA 3K8NA 1VF2A 1T4ZA 4HQZA 4EE0A 4XTSA 4ZL8A 2PERA 3ZREA 5D9VA 2DJ2A 1E6BA 2OE1A 4N30A 3CRTA 1ZGNA 4TVEA 5J41A 1GNWA 3MNGA 5DQYA 1OAZA 2OBKA 3D22A 3HCZA 2PBJA 3ME8A 3ZMKA 2H1GA 3IOSA 2CAIA 5ECLB 1YY7A 3F9UA 1JZWA 3HHVA 1NHOA 3HVSA 3LG6A 4L5OA 4MABA 1A2MA 1YEXA 3MDKA 2DIYA 4AJ8A 3KTLA 1EZKA 2PGTA 3H4KA 4MF6A 3TRQA 1ERUA 1M99A 5LCZA 2B3SA 1ZMAA 2HLSA 1TP9A 1UVZA 2L4CA 1S3DA 1A2JA 2GT6A 4MJBA 3D4MA 4ID0A 4POMA 2JU5A 3GURA 5CNWA 4IP6A 2V6OA 4N0VA 5JWRB 1HD2A 1USBA 4F0BA 2X99A 1Z9HA 1ZZYA 4HU9A 1ERTA 3I9V2 2V6KA 5F06A 5ABRA 1Y25A 2JADA 4MJAA 4A5PA 2C3QA 3Q6OA 3APSA 3IK7A 2NDOA 3KMNA 3TDGA 1ZL9A 2O87A 1EOHA 2R5GA 2HNLA 3ZIVA 4V2MA 3KH7A 1VGLA 3GFKA 4WF4A 4YAPA 4J57E 1NHYA 5D73A 4OFNA 3ZZXA 3A2VA 1WOUA 4RUVA 4KX4A 1GSYA 2C80A 1PGTA 5G30A 5IMDA 2QA1A 2RLIA 1V58A 2GQKA 3ZVJA 1K0AA 2E2GA 2AYTA 4KNDA 2WJUA 3IC8A 4L8EA 3GX8A 2H8LA 2PVQA 4TXVA 3P7XA 2H1BA 1ON4A 5JCWA 3APOA 2WZ9A 4HZ2A 4KUNA 1TJDA 4Z2RA 1BAYA 5GSTA 1OYJA 4XCSA 3TKQA 3DEXA 3H1NA 2P5RA 3GMFA 1X5EA 1QK8A 3HJPA 2E7PA 5INYA 5DALB 4K5SA 2ALBA 3UL3A 2DJJA 2H74A 4MP4A 1ERWA 3G7YA 3MSZA 4D73B 3ZYWA 5GSSA 1Z7PA 5J4UA 4Q5QA 3F4TA 2OACA 3NZNA 2MBSA 3VFIA 3TJJA 3FR9A 4P3YB 2C3NA 5KOWA 4EVMA 3PH9A 4K2DA 1DE1A 5DQSA 4ECBA 3RHBA 2GVPA 3UOMA 4NV5A 4YKFA 2R3XA 4Z7XA 1O85A 3KXOA 4YQMA 2VUPA 1GSUA 4MZWA 4PQ1A 3ZMLA 1HNCA 4KB3A 2N5AA 2UZ8A 1ST9A 3M1GA 2DJ0A 2XHFA 3QDNA 1SKSB 17GSA 1F37A 2AV4A 1M2AA 4MF5A 2VOCA 3HY2A 3O6TA 1TRVA 4O92A 3CMIA 5KOXA 2JSYA 3KD0A 1EP7A 4NXIA 4AJ7A 1Z6MA 1NSWA 4WXTA 4JU5A 3TKSC 1N8JA 1X5CA 5F0GA 5LD0A 1Q98A 3EPTA 1O8XA 3TKRA 5DJLA 4ISDA 4POLA 2H1DA 2J23A 1V98A 2P5QA 3FR3A 5ECPB 1G0TA 2C4JA 3GA4A 3WGDA 2QSIA 1DBYA 4WR5A 4PXOA 2A2PA 2YOIA 5DDLA 1ILOA 1YQ1A 3PPUA 2DC5A 5DJMA 1K3LA 2F3MA 1SENA 1T1VA 1TI1A 3UVHA 3KCMA 3N9JA 4XS4A 1GSDA 1Z6NA 1T7PB 3HD5A 1YF1A 2H76A 4NHZA 1LU4A 1X5DA 2GT5A 2JZRA 3GH6A 2A4VA 3TOUA 1GULA 4LA1A 5D8IA 3WYWA 2N5BA 4XIHA 4ICYA 4IELA 4WBJA 5B8BA 3F3RA 5IOWA 3H8QA 4J2FA 3EC3A 2K18A 4CW9A 5FHIA 3L9VA 2P31A 1WMJA 3FR6A 4TR0A 1AQWA 4FO5A 4YAVA 1SKRB 4KH7A 4KDUA 3H93A 4KCEA 1AW9A 2LJAA 3IAM2 2VM2A 1PQNA 3L0HA 4L0UA 5BMUA 1ZYEA 3D21A 1R4WA 3FY7A 2LV3A 3F4SA 4MCUA 3TOTA 3BJ5A 1AQVA 1XW5A 2E2MA 1W89A 1SU9A 5F07A 9GSSA 1BQ7A 4GTUA 3D6IA 3IC4A 5C04A 5ECNB 4OMVA 4DSQA 1URMA 8GSSA 5ELAA 3VK9A 1PL1A 2VIMA 4JR6A 2G0FA 2L6CA 1HYUA 3ED3A 4MH2A 1OKTA 2GSTA 4OFMA 1DSBA 3ISOA 4CY8A 2FY6A 5G31A 1SK1A 2YP6A 1GTBA 3ERGA 2HRFA 4PQHA 5CRWA 4L5LA 3JCML 2OE0A 1A8YA 2FHEA 3GHAA 1PN9A 2DKHA 4IHUA 1YF0A 4OFTA 3Q74A 3TKSE 1Z7RA 4FYCA 10GSA 3GX0A 1LBKA 2HZEB 2H75A 4IQ1A 3TB2A 5DALA 1OC8A 2R0PA 3Q19A 2LJRA 1SD9A 2HFDA 3LW9A 2WCIA 1X9SB 1JZOA 5F05A 2GZYA 4WF5A 3DRNA 4I2TA 4Q5RA 1ZYQB 2YANA 4F9ZA 2KP2A 3M3MA 3LXTA 2BJXA 2YZHA 4WBRD 1XWCA 4LL4B 1G7EA 2X8GA 3QR6A 2R4VA 2IMKA 1SJIA 2H66A 3QPMA 1CQHA 1FB6A 5HFGA 2GSSA 2XPEA 1FW1A 1B8XA 2XBQA 2N5FA 1G6YA 5KN1A 1BJXA 4POKA 1ZCPA 3C1SA 2VD1A 1BX9A 1LJRA 2ON7A 5IMCA 2DMMA 4JE1A 4PNGA 1O8WA 2KOKA 2CVBA 5D9XA 5B8AA 4PNFA 4O5QA 1K0MA 4XS6A 2M72A 3CRUA 1MD4A 3D0ZA 3S9FA 4YQVA 4AJ6A 3WT2A 3ZFLA 3KIJA 5CP1A 4MMMA 4ECJA 1EGOA 2LS5A 3SWLA 1K0OA 3KP8A 4OWYA 2FUG2 3W8SA 5ECIB 2YJHA 3IV4A 2MMZA 4KSOA 1R7HA 1EWXA 2LNTA 6GSVA 1ML6A 2RM6A 3UEMA 4BVYB 3C8EA 4X4JA 2H70A 1FVJA 2H30A 2H71A 5IMFA 2A4HA 4PQIA 2ZNMA 3A5IA 4XS4B 1MDKA 2C3TA 4MPFA 2CZ3A 3TGZA 4IBPA 1F6MC 2WS2A 3J7Yb 2X64A 1TU7A 3CYNA 2YZUA 2FD3A 3A3TA 4IQAA 4Z2TA 4PUAA 3FRCA 3R3EA 2NPBA 3RPNA 3HVXA 4HUAA 5ID2A 3G9BA 4K2XA 1CQGA 3VPTA 1JZRA 5H5QA 2AHEA 1FVKA 1XOBA 2JACA 4JRRA 5CRHA 1GLPA 5COHA 3GV1A 3GRXA 3QAVA 1QGVA 4K1FA 3C1RA 5ECHB 1PA3A 3PR8A 2VLUA 2B6MA 5JCUA 3ZVJD 3KH9A 5GZZB 4TW5A 20GSA 2LNSA 1O73A 1EOGA 2PWJA 3WGEA 4HZ4A 3ZIJA 1GLQA 3TRXA 4TOPA 1B9YC 1M2DA 2YV9A 5JCGA 2OE3A 3HDCA 3CXGA 3HKRA 4WR4A 4V1Ag 1SL0B 1O6JA 4NHWA 3GSTA 5EY6A 5A5KA 4HJMA 5G5FA 3EURA 4I5QA 3NIVA 5J9CA 5CYYA 2TRCP 2GZPA 2LRTA 4IJ3A 4GSNA 4TR4A 1RQMA 1GUMA 1XXUA 5KN0A 3IXRA 3DYRA 3DVXA 2QA2A 1B4QA 3I6AA 4OCEA 4EUYA 2PU9C 2CQ9A 2YV7A 3RBTA 1FB0A 2R2JA 4I8BA 4MLYA 3NOFA 2B5EA 2HYXA 4WEYA 1UA5A 2VLTA 4O5UA 1XW9A 4NWYA 7GSSA 3EU4A 2GSQA 2JZSA 4K7NA 5A4VA 5JWOB 2X49A 1EEMA 3LYPA 2HZEA 3TKSA 4PURA 2X4AA 3FK8A 3IHGA 3FKFA 3IAS2 5D9TA 2IMDA 5ECRB 4OCFA 1T00A 4ILFA 3IE3A 2DJ1A 1U6TA 3M8NA 4IN0A 1EV9A 4TN8A 4K7IA 2CT6A 3H79A 4MZCA 1H4OA 4K7OA 4IGJA 1S3AA 3ZL5A 3LJRA 4EDZA 2H72A 5E4WA 1VF4A 6GSWA 3CTGA 1X9MB 1PKZA 2IN3A 3IK9A 2FGXA 1XWBA 3FZ5A 4BPYA 3L4NA 5G2ZA 1M9AA 3E9JB 2VCXA 2HZFA 3LORA 3UJ1A 3ZTLA 2FCHA 2GGTA 2X8HA 1T8EB 1KNGA 3W6GA 1XWGA 2VL2A 2H19A 5DAKB 14GSA 1XZOA 2LRCA 3F8UA 3EU3A 4MDCA 3LGCA 1PX7A 2V1MA 6GSUA 4V1Ap 2IPAA 2GQLA 1R5PA 1A23A 2B1LA 5GAND 3GL3A 4Q5NA 5ENUA 1U87A 4IS0A 3TJGA 4F03A 1PD21 1Q4JA 2KHPA 5A4WA 2C1YA 1HNAA 1BG5A 2GDRA 1XVWA 1TK8B 2H0GA 4KW6A 3VLNA 4USSA 5CREA 2RM5A 4BVXB 3RAZA 1OVNA 2MYGA 1TI3A 1UN2A 4ZB9A 3DMLA 5IO0A 2KLXA 3QOUA 1X9WB 1GTAA 3IR4A 4BVYA 3WT1A 3EE2A 5AISA 4QL7A 4JZQA 2L57A 4Q5FA 1JLVA 1V40A 3EMPA 1VF3A 2Z9SA 1IYIA 1M2BA 3QFAC 4JBBA 3BCKA 5KN2A 4X43A 4YQUA 2HSMA 4TR1A 1PX6A 1UC7A 2VL2C 2PN8A 2YWOA 4EKZA 4GLTA 1E2YA 5IPGA 3ZRDA 3VURA 5ID2B 4ML1A 3KMOA 4FYBA 1Z3EA 4L0WA 1THXA 4KAEA 3RHCA 1GSEA 3QMXA 4IKHA 1XOAA 3U5RE 1R5AA 3O76A 4PGTA 4FH8A 1XIYA 4YH2A 5J9BA 4LL1B 3CTFA 1OC3A 2R37A 4K6XA 2O7KA 5B6MA 3EMXA 2RIIA 3QAGA 4EXJA 1F3AA 1GSSA 2LUSA 2L5LA 4JR4A 4KE3A 1KBNA 1U88A 5F8BA 1GWCA 4F2IA 3VWVA 4JEDA 1V57A 5ELGA 2FLSA 5CAXA 2EIRA 1JLWA 1A8LA 4K5RA 4KSMA 2VCQA 18GSA 1PL2A 1AUCA 4GQCA 1F9MA 5AIXA 1K0DA 4V2LA 3GL5A 2WDUA 4IJIA 1IYHA 2M46A 2WFCA 5IMAA 3VI7A 2C0EA 2VL9A 3FZ4A 1TDIA 3BCIA 1TTZA 2VAFA 2K8VA 1XFLA 3GYKA 5FWGA 1PN0A 2GLRA 4HU7A 1SL2B 3P8WA 4FYUA 3ZFBA 2EIOA 2CV4A 1YZXA 2H73A 3AY8A 2DMLA 2MMAA 2F9SA 2GZZA 1RW1A 2REMA 4MPGA 5KN3A 2M80A 5D93A 4K9ZA 4GF0A 5LNKe 16GSA 1SYXA 3I43A 3GKXA 1YKAA 4ZBAA 3GNJA 3U6VA 5KEJA 3N5OA 4RI7A 3QAWA 1GRXA 2WB9A 4OO4A 2HI7A 2CZ2A 2VM1A 1SK2A 1YDKA 4ECIA 3R2QA 2KUCA 6GSXA 3APQA 4IP1A 4K0GA 1ERVA 2J9HA 3CSIA 2AUVA 4OD7A 3VPQA 3W8JA 5D9WA 3EINA 3HZ8A 5HR2A 3GTUA 3LQ7A 2H0HA 4NPBA 2DJ3A 1K3OA 1WP0A 4GWRA 5DAKA 5IIZA 3GIXA 2CAQA 1B4PA 1TU8A 2LJKA 4N10A 3DVWA 4LMVA 12GSA 2FWFA 2LTKA 3TRPA 2XBIA 1U3AA 2OBIA 4ZL9A 4I2UA 3KGKA 4FQUA 2V32A 5H5SA 3F0IA 1XBSA 3TJFA 4BA7A 4TKYA 1GUHA 2CVDA 4XS1A 2VL3A 4BL7B 1TW9A 2FA4A 2E0QA 1SJ6A 3D5JA 2H0IA 2WULA 2AAWA 1SL1B 4MNNA 3PGTA 4ULXA 4O5RA 3D4TA 4GSSA 2A2RA 3P2AA 1ZYNA 3US3A 1YJ6A 2OADA 2IWTA 1O81A 3MAKA 22GSA 2ZUPA 2OA7A 1HQOA 4BVXA 3FYGA 2I9HA 2YN1A 3GN3A 3TJBA 1I5GA 1W4VA 3UIWA 2G2QA 3GKNA 5HFKA 1J08A 4TRXA 1TKDB 3DXBA 3G7JA 3I69A 3FW2A 3P90A 3GH9A 1QUWA 4TXOB 2BTOT 4HQSA 3O3TA 4DSRA 19GSA 2K8SA 2VLVA 5ECSA 5CRGA 2DJKA 2ES7A 2XPDA 3FZ9A 2OJLA 4CDOA 1FHEA 4CY6A 4TR1B 5BRTA 1S3CA 2V2GA 4NV2A 1MEKA 2IMIA 3C71A 1QQ2A 2VCWA 2NVLA 2HE3A 1PRXA 2MBTA 3E3EA 4KGIA 3UBKA 3F63A 4KF9A 4XRDA 4DSSA 3LFLA 1A2LA 1Z5YE 3BOAA 2O85A 3QFBC 1PSQA 1VRSD 1T4YA 2VCVA 3QD9A 1K0CA 3MYDA 5H5RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BWS A;  1K3Y A;  3IRA A;  1K0B A;  5IQY A;  2JL4 A;  3KZQ A;  1B48 A;  3L9S A;  3LWA A;  1SD8 A;  2VCZ A;  4HI7 A;  1A0R P;  1JZD A;  1EGR A;  2HRN A;  5DBQ A;  1YKC A;  4GCI A;  4OO5 A;  1OE8 A;  3ZIT A;  5B7C A;  3M9J A;  3TKP A;  1MDJ A;  3EVI A;  4ECC A;  1GTU A;  4EC0 A;  4LMW A;  2CX3 A;  2C0D A;  5HR0 A;  1SKW B;  3DKS A;  2FWH A;  2R6K A;  4XHM A;  5FT3 A;  4ML6 A;  3KEB A;  2CX4 A;  2PPT A;  1Y6E A;  1O7U A;  4MZB A;  2DLX A;  1THO A;  1R26 A;  1B9X C;  2IFQ B;  1KEB A;  1OE7 A;  5IMV A;  1FOV A;  1OC9 B;  5DCG A;  3DD3 A;  3Q18 A;  2PMT A;  2QC7 A;  1A24 A;  2JSZ A;  5EVO A;  5G1L A;  3HJO A;  4QQ7 A;  3HJM A;  3KTB A;  4MA9 A;  3KM6 A;  3LXZ A;  5EL8 A;  4AGS A;  2PUK C;  1ZOF A;  3OR5 A;  3MWH A;  1F2E A;  3KP9 A;  3UMA A;  2B7J A;  5D96 A;  3A2W A;  4RQR A;  2LST A;  3F6D A;  5E59 A;  2WGR A;  1AXD A;  2QGV A;  4ZBD A;  4I97 A;  2YWI A;  1VF1 A;  1GP1 A;  3TUE A;  3J7Y k;  4EL1 A;  3BBY A;  2RUE A;  2RUF A;  3FHK A;  2B1K A;  2GQM A;  4KCA A;  1BYE A;  4BWQ A;  3TCO A;  3C7M A;  2YWM A;  3GSS A;  2H1A A;  4X0X A;  2O89 A;  1XWA A;  2VO4 A;  4GST A;  3HYP A;  3LEF A;  4RQX A;  3GTU B;  4ACS A;  5HR3 A;  4DEJ A;  2LQQ A;  4HEA 2;  3FEU A;  4MF7 A;  2H01 A;  3UVT A;  1XCC A;  4CHS A;  3PIN A;  1MTC A;  4H86 A;  5HQP A;  1GH2 A;  2H6Z A;  4BL7 A;  5IM9 A;  2NBS A;  2GS3 A;  1KTE A;  2A2S A;  4IW9 A;  3ZLP A;  1TOF A;  4V2N A;  4POB A;  2FA8 A;  4ZXG A;  3GKK A;  3UAP A;  3M0F A;  2HSY A;  1M0U A;  1F3B A;  1J9B A;  3CSJ A;  2JZT A;  3UBL A;  4FIW A;  2X8C A;  1T3B A;  3HXS A;  1TRW A;  5ECM B;  2YNX A;  2V41 A;  2L6D A;  4TXO A;  2MMO A;  3DIE A;  4QL9 A;  2YWN A;  4MJC A;  1N2A A;  2K9F A;  5AIV A;  1M9B A;  2YJ7 A;  4HDE A;  5CRD A;  4LLR A;  4KDX A;  2B5X A;  2LKU A;  2YPM A;  5DCH A;  5JWQ B;  1ABA A;  2B7K A;  4ZBB A;  1GSF A;  1PKW A;  1QFN A;  3EWL A;  4G10 A;  2MMN A;  2EC4 A;  3DWV A;  3IBH A;  5G5E A;  3UAR A;  4ZIJ A;  2TIR A;  3F3Q A;  4ZB8 A;  4F82 A;  1TRU A;  4DSS B;  5AN1 A;  1YEP A;  1XWK A;  13GS A;  3VI5 A;  3WGX A;  2VD0 A;  4IVF A;  2L5O A;  4I6X A;  5EPF A;  1ACV A;  1U3I A;  2O8V B;  3FZA A;  1DUG A;  5ECQ B;  3V1W A;  5G1K A;  1GSQ A;  1GTI A;  5HFI A;  2C0F A;  2LEG A;  3ERF A;  3DGQ A;  2XC2 A;  4KA0 A;  1FAA A;  1DE2 A;  1AAZ A;  1A0F A;  1OKD A;  1MDI A;  1RK4 A;  2L4Q A;  1EP8 A;  1WIK A;  3BD2 A;  1J0F A;  1K0N A;  2L59 A;  1G6W A;  5GAP D;  1GNE A;  2K6V A;  3L9U A;  1FO5 A;  3VWX A;  1QMV A;  3G7I A;  2H6X A;  4X1U A;  1AQX A;  5J5N A;  3IPZ A;  4XRA A;  5L71 A;  3A5W A;  2PVO C;  3HVV A;  4K8M A;  4F0C A;  2FNO A;  2HSH A;  1TK5 B;  5DVB A;  1C72 A;  3F4R A;  4ZB6 A;  1TK0 B;  1PMT A;  1NW2 A;  3HZ4 A;  2LRN A;  2YCD A;  3GKM A;  5A4U A;  2ON5 A;  2IL3 A;  1QXH A;  1SJZ A;  4DVC A;  2TRX A;  2HXK A;  2GSR A;  4N0Z A;  4ZIL A;  3RDW A;  4J56 E;  5ECO B;  4KDY A;  2IFQ A;  2H6Y A;  1OC9 A;  2CVK A;  2WRT A;  4AF2 A;  5B6N A;  1XW6 A;  4WET A;  2IME A;  1H75 A;  4GRF A;  1SYR A;  2EIQ A;  3QCP A;  1WWJ A;  2DIZ A;  2I1U A;  2HT9 A;  2I3Y A;  4G2E A;  5J3R A;  11GS A;  2C8U A;  1WRY A;  2I81 A;  4MK3 A;  4HOJ A;  3RPP A;  2IJY A;  1NM3 A;  2BMX A;  1AC1 A;  2FWE A;  2ZCT A;  1EEJ A;  1SK0 A;  6GST A;  5IOX A;  4EDY A;  4RI6 A;  4ZL7 A;  3GUS A;  1JFU A;  5ECK B;  5IO2 A;  3VWU A;  4K0N A;  1BED A;  2CA8 A;  2KP1 A;  5C00 A;  4D73 A;  4WKW A;  5IMZ A;  1EV4 A;  1V9W A;  2OKA A;  4EO3 A;  2MZC A;  4MH3 A;  4GXZ A;  1WE0 A;  2D2Z A;  3E0U A;  3C73 A;  4GQF A;  1TXX A;  3IA1 A;  1FG4 A;  4G9H A;  4N11 A;  1X0R A;  3LYK A;  3IHQ A;  5IPH A;  1I9D A;  2IMF A;  2AJQ B;  3KJY A;  2F8A A;  2C0G A;  4PX1 A;  1JHB A;  2B5Y A;  2AB6 A;  3CBU A;  2DSA A;  4PUF C;  1TRS A;  1AIU A;  1MD3 A;  2LQO A;  4O32 A;  4NAX A;  3M9K A;  4O7H A;  1HNB A;  1WPI A;  3TJK A;  1G7O A;  1V2A A;  3A2X A;  5HR1 A;  4MJE A;  2F51 A;  1XVQ A;  4HJ2 A;  1GUK A;  3ERW A;  3F6F A;  2P0G A;  1WJK A;  2IIY A;  2QKE A;  3CSH A;  3WD6 A;  4EF0 A;  3EYT A;  2NTO A;  4G19 A;  6GSY A;  4TR3 A;  4E8H A;  2F8F A;  3LSZ A;  1M7T A;  2DBC A;  1GL8 A;  2I4A A;  3HA9 A;  3VWW A;  4NMU A;  5CO3 A;  3SBC A;  3ME7 A;  3IDV A;  2VCT A;  2FWG A;  3L78 A;  4E8E A;  2GTU A;  4HS1 A;  1XPV A;  5AGY A;  6GSS A;  3K8N A;  1VF2 A;  1T4Z A;  4HQZ A;  4EE0 A;  4XTS A;  4ZL8 A;  2PER A;  3ZRE A;  5D9V A;  2DJ2 A;  1E6B A;  2OE1 A;  4N30 A;  3CRT A;  1ZGN A;  4TVE A;  5J41 A;  1GNW A;  3MNG A;  5DQY A;  1OAZ A;  2OBK A;  3D22 A;  3HCZ A;  2PBJ A;  3ME8 A;  3ZMK A;  2H1G A;  3IOS A;  2CAI A;  5ECL B;  1YY7 A;  3F9U A;  1JZW A;  3HHV A;  1NHO A;  3HVS A;  3LG6 A;  4L5O A;  4MAB A;  1A2M A;  1YEX A;  3MDK A;  2DIY A;  4AJ8 A;  3KTL A;  1EZK A;  2PGT A;  3H4K A;  4MF6 A;  3TRQ A;  1ERU A;  1M99 A;  5LCZ A;  2B3S A;  1ZMA A;  2HLS A;  1TP9 A;  1UVZ A;  2L4C A;  1S3D A;  1A2J A;  2GT6 A;  4MJB A;  3D4M A;  4ID0 A;  4POM A;  2JU5 A;  3GUR A;  5CNW A;  4IP6 A;  2V6O A;  4N0V A;  5JWR B;  1HD2 A;  1USB A;  4F0B A;  2X99 A;  1Z9H A;  1ZZY A;  4HU9 A;  1ERT A;  3I9V 2;  2V6K A;  5F06 A;  5ABR A;  1Y25 A;  2JAD A;  4MJA A;  2C3Q A;  3Q6O A;  3APS A;  3IK7 A;  2NDO A;  3KMN A;  3TDG A;  1ZL9 A;  2O87 A;  1EOH A;  2R5G A;  2HNL A;  3ZIV A;  4V2M A;  3KH7 A;  1VGL A;  3GFK A;  4WF4 A;  4YAP A;  4J57 E;  1NHY A;  5D73 A;  4OFN A;  3ZZX A;  3A2V A;  1WOU A;  4RUV A;  4KX4 A;  1GSY A;  2C80 A;  1PGT A;  5G30 A;  5IMD A;  2RLI A;  1V58 A;  2GQK A;  3ZVJ A;  1K0A A;  2E2G A;  2AYT A;  4KND A;  2WJU A;  4L8E A;  3GX8 A;  2H8L A;  2PVQ A;  4TXV A;  3P7X A;  2H1B A;  1ON4 A;  5JCW A;  3APO A;  2WZ9 A;  4HZ2 A;  4KUN A;  1TJD A;  1BAY A;  5GST A;  1OYJ A;  4XCS A;  3TKQ A;  3DEX A;  3H1N A;  2P5R A;  3GMF A;  1X5E A;  1QK8 A;  3HJP A;  2E7P A;  5INY A;  5DAL B;  2ALB A;  3UL3 A;  2DJJ A;  2H74 A;  4MP4 A;  1ERW A;  3G7Y A;  3MSZ A;  4D73 B;  3ZYW A;  5GSS A;  1Z7P A;  5J4U A;  4Q5Q A;  3F4T A;  2OAC A;  3NZN A;  2MBS A;  3VFI A;  3TJJ A;  3FR9 A;  4P3Y B;  2C3N A;  4EVM A;  3PH9 A;  4K2D A;  1DE1 A;  5DQS A;  4ECB A;  3RHB A;  2GVP A;  3UOM A;  4NV5 A;  2R3X A;  4Z7X A;  1O85 A;  3KXO A;  4YQM A;  2VUP A;  1GSU A;  4MZW A;  4PQ1 A;  3ZML A;  1HNC A;  4KB3 A;  2N5A A;  1ST9 A;  3M1G A;  2DJ0 A;  2XHF A;  3QDN A;  1SKS B;  17GS A;  1F37 A;  2AV4 A;  1M2A A;  4MF5 A;  2VOC A;  3HY2 A;  3O6T A;  1TRV A;  4O92 A;  3CMI A;  2JSY A;  3KD0 A;  1EP7 A;  4NXI A;  4AJ7 A;  1Z6M A;  1NSW A;  4WXT A;  4JU5 A;  3TKS C;  1N8J A;  1X5C A;  5F0G A;  5LD0 A;  1Q98 A;  1O8X A;  3TKR A;  5DJL A;  4ISD A;  4POL A;  2H1D A;  2J23 A;  1V98 A;  2P5Q A;  3FR3 A;  5ECP B;  1G0T A;  2C4J A;  3GA4 A;  3WGD A;  2QSI A;  1DBY A;  4WR5 A;  4PXO A;  2YOI A;  5DDL A;  1ILO A;  1YQ1 A;  2DC5 A;  5DJM A;  1K3L A;  2F3M A;  1SEN A;  1T1V A;  1TI1 A;  3UVH A;  3KCM A;  3N9J A;  4XS4 A;  1GSD A;  1Z6N A;  1T7P B;  3HD5 A;  1YF1 A;  2H76 A;  4NHZ A;  1LU4 A;  1X5D A;  2GT5 A;  2JZR A;  3GH6 A;  2A4V A;  3TOU A;  1GUL A;  4LA1 A;  5D8I A;  3WYW A;  2N5B A;  4XIH A;  4IEL A;  4WBJ A;  5B8B A;  3F3R A;  5IOW A;  3H8Q A;  4J2F A;  3EC3 A;  2K18 A;  4CW9 A;  5FHI A;  3L9V A;  2P31 A;  1WMJ A;  3FR6 A;  4TR0 A;  1AQW A;  4FO5 A;  4YAV A;  1SKR B;  4KH7 A;  4KDU A;  3H93 A;  4KCE A;  1AW9 A;  2LJA A;  3IAM 2;  2VM2 A;  1PQN A;  3L0H A;  4L0U A;  1ZYE A;  3D21 A;  1R4W A;  3FY7 A;  2LV3 A;  3F4S A;  4MCU A;  3TOT A;  3BJ5 A;  1AQV A;  1XW5 A;  2E2M A;  1W89 A;  1SU9 A;  5F07 A;  9GSS A;  1BQ7 A;  4GTU A;  3D6I A;  3IC4 A;  5C04 A;  5ECN B;  4OMV A;  4DSQ A;  1URM A;  8GSS A;  5ELA A;  3VK9 A;  1PL1 A;  2VIM A;  4JR6 A;  2G0F A;  2L6C A;  1HYU A;  3ED3 A;  4MH2 A;  1OKT A;  2GST A;  4OFM A;  1DSB A;  3ISO A;  2FY6 A;  5G31 A;  1SK1 A;  2YP6 A;  1GTB A;  3ERG A;  2HRF A;  4PQH A;  5CRW A;  4L5L A;  3JCM L;  2OE0 A;  1A8Y A;  2FHE A;  3GHA A;  1PN9 A;  4IHU A;  1YF0 A;  4OFT A;  3Q74 A;  3TKS E;  1Z7R A;  4FYC A;  10GS A;  3GX0 A;  1LBK A;  2HZE B;  2H75 A;  4IQ1 A;  3TB2 A;  5DAL A;  1OC8 A;  3Q19 A;  2LJR A;  1SD9 A;  2HFD A;  2WCI A;  1X9S B;  1JZO A;  5F05 A;  2GZY A;  4WF5 A;  3DRN A;  4I2T A;  4Q5R A;  1ZYQ B;  2YAN A;  4F9Z A;  2KP2 A;  3M3M A;  3LXT A;  2BJX A;  2YZH A;  4WBR D;  1XWC A;  4LL4 B;  1G7E A;  2X8G A;  3QR6 A;  2R4V A;  2IMK A;  1SJI A;  2H66 A;  3QPM A;  1CQH A;  1FB6 A;  5HFG A;  2GSS A;  2XPE A;  1FW1 A;  1B8X A;  2XBQ A;  2N5F A;  1G6Y A;  5KN1 A;  1BJX A;  4POK A;  1ZCP A;  3C1S A;  2VD1 A;  1BX9 A;  1LJR A;  2ON7 A;  5IMC A;  2DMM A;  4JE1 A;  4PNG A;  1O8W A;  2KOK A;  2CVB A;  5D9X A;  5B8A A;  4PNF A;  1K0M A;  4XS6 A;  2M72 A;  3CRU A;  1MD4 A;  3D0Z A;  3S9F A;  4YQV A;  4AJ6 A;  3WT2 A;  3ZFL A;  3KIJ A;  5CP1 A;  4MMM A;  4ECJ A;  1EGO A;  2LS5 A;  3SWL A;  1K0O A;  3KP8 A;  4OWY A;  2FUG 2;  3W8S A;  5ECI B;  2YJH A;  3IV4 A;  2MMZ A;  4KSO A;  1R7H A;  1EWX A;  2LNT A;  6GSV A;  1ML6 A;  2RM6 A;  3UEM A;  3C8E A;  2H70 A;  1FVJ A;  2H30 A;  2H71 A;  5IMF A;  4PQI A;  2ZNM A;  4XS4 B;  1MDK A;  2C3T A;  4MPF A;  2CZ3 A;  3TGZ A;  4IBP A;  1F6M C;  2WS2 A;  3J7Y b;  2X64 A;  1TU7 A;  3CYN A;  2YZU A;  2FD3 A;  3A3T A;  4IQA A;  4PUA A;  3FRC A;  2NPB A;  3RPN A;  3HVX A;  4HUA A;  5ID2 A;  3G9B A;  1CQG A;  3VPT A;  1JZR A;  5H5Q A;  2AHE A;  1FVK A;  1XOB A;  2JAC A;  4JRR A;  5CRH A;  1GLP A;  5COH A;  3GV1 A;  3GRX A;  3QAV A;  1QGV A;  4K1F A;  3C1R A;  5ECH B;  1PA3 A;  3PR8 A;  2VLU A;  2B6M A;  5JCU A;  3ZVJ D;  3KH9 A;  5GZZ B;  4TW5 A;  20GS A;  2LNS A;  1O73 A;  1EOG A;  2PWJ A;  3WGE A;  4HZ4 A;  3ZIJ A;  1GLQ A;  3TRX A;  4TOP A;  1B9Y C;  1M2D A;  2YV9 A;  5JCG A;  2OE3 A;  3HDC A;  3CXG A;  3HKR A;  4WR4 A;  4V1A g;  1SL0 B;  1O6J A;  4NHW A;  3GST A;  5EY6 A;  5A5K A;  4HJM A;  5G5F A;  3EUR A;  4I5Q A;  3NIV A;  5J9C A;  5CYY A;  2TRC P;  2GZP A;  2LRT A;  4IJ3 A;  4GSN A;  4TR4 A;  1RQM A;  1GUM A;  1XXU A;  5KN0 A;  3IXR A;  3DYR A;  3DVX A;  1B4Q A;  3I6A A;  4OCE A;  4EUY A;  2PU9 C;  2CQ9 A;  2YV7 A;  3RBT A;  1FB0 A;  2R2J A;  4I8B A;  4MLY A;  3NOF A;  2B5E A;  2HYX A;  4WEY A;  1UA5 A;  2VLT A;  1XW9 A;  4NWY A;  7GSS A;  3EU4 A;  2GSQ A;  2JZS A;  4K7N A;  5A4V A;  5JWO B;  1EEM A;  3LYP A;  2HZE A;  3TKS A;  4PUR A;  3FK8 A;  3FKF A;  3IAS 2;  5D9T A;  2IMD A;  5ECR B;  4OCF A;  1T00 A;  4ILF A;  3IE3 A;  2DJ1 A;  1U6T A;  3M8N A;  4IN0 A;  1EV9 A;  4TN8 A;  4K7I A;  2CT6 A;  3H79 A;  4MZC A;  1H4O A;  4K7O A;  4IGJ A;  1S3A A;  3ZL5 A;  3LJR A;  4EDZ A;  2H72 A;  5E4W A;  1VF4 A;  6GSW A;  3CTG A;  1X9M B;  1PKZ A;  2IN3 A;  3IK9 A;  2FGX A;  1XWB A;  3FZ5 A;  4BPY A;  3L4N A;  5G2Z A;  1M9A A;  3E9J B;  2VCX A;  2HZF A;  3LOR A;  3UJ1 A;  3ZTL A;  2FCH A;  2GGT A;  2X8H A;  1T8E B;  1KNG A;  3W6G A;  1XWG A;  2VL2 A;  2H19 A;  5DAK B;  14GS A;  1XZO A;  2LRC A;  3F8U A;  3EU3 A;  4MDC A;  3LGC A;  1PX7 A;  2V1M A;  6GSU A;  4V1A p;  2IPA A;  2GQL A;  1R5P A;  1A23 A;  2B1L A;  5GAN D;  3GL3 A;  4Q5N A;  5ENU A;  1U87 A;  4IS0 A;  3TJG A;  4F03 A;  1PD2 1;  1Q4J A;  2KHP A;  5A4W A;  2C1Y A;  1HNA A;  1BG5 A;  2GDR A;  1XVW A;  1TK8 B;  2H0G A;  4KW6 A;  3VLN A;  5CRE A;  2RM5 A;  3RAZ A;  1OVN A;  2MYG A;  1TI3 A;  1UN2 A;  4ZB9 A;  3DML A;  5IO0 A;  2KLX A;  3QOU A;  1X9W B;  1GTA A;  3IR4 A;  4BVY A;  3WT1 A;  3EE2 A;  5AIS A;  4QL7 A;  4JZQ A;  2L57 A;  4Q5F A;  1JLV A;  1V40 A;  3EMP A;  1VF3 A;  2Z9S A;  1IYI A;  1M2B A;  3QFA C;  4JBB A;  3BCK A;  5KN2 A;  4X43 A;  4YQU A;  4TR1 A;  1PX6 A;  1UC7 A;  2VL2 C;  2PN8 A;  2YWO A;  4EKZ A;  4GLT A;  1E2Y A;  5IPG A;  3ZRD A;  3VUR A;  5ID2 B;  4ML1 A;  3KMO A;  4FYB A;  1Z3E A;  4L0W A;  1THX A;  4KAE A;  3RHC A;  1GSE A;  3QMX A;  4IKH A;  1XOA A;  3U5R E;  1R5A A;  3O76 A;  4PGT A;  4FH8 A;  1XIY A;  4YH2 A;  5J9B A;  4LL1 B;  3CTF A;  1OC3 A;  2R37 A;  4K6X A;  2O7K A;  5B6M A;  3EMX A;  2RII A;  3QAG A;  4EXJ A;  1F3A A;  1GSS A;  2LUS A;  2L5L A;  4JR4 A;  4KE3 A;  1KBN A;  1U88 A;  5F8B A;  1GWC A;  4F2I A;  3VWV A;  4JED A;  1V57 A;  5ELG A;  2FLS A;  5CAX A;  2EIR A;  1JLW A;  1A8L A;  4KSM A;  2VCQ A;  18GS A;  1PL2 A;  1AUC A;  4GQC A;  1F9M A;  5AIX A;  1K0D A;  4V2L A;  3GL5 A;  2WDU A;  4IJI A;  1IYH A;  2M46 A;  2WFC A;  5IMA A;  3VI7 A;  2C0E A;  2VL9 A;  3FZ4 A;  1TDI A;  3BCI A;  1TTZ A;  2VAF A;  2K8V A;  1XFL A;  3GYK A;  5FWG A;  2GLR A;  4HU7 A;  1SL2 B;  3P8W A;  4FYU A;  3ZFB A;  2EIO A;  2CV4 A;  1YZX A;  2H73 A;  3AY8 A;  2DML A;  2MMA A;  2F9S A;  2GZZ A;  1RW1 A;  2REM A;  4MPG A;  5KN3 A;  2M80 A;  5D93 A;  4K9Z A;  4GF0 A;  5LNK e;  16GS A;  1SYX A;  3I43 A;  3GKX A;  1YKA A;  4ZBA A;  3GNJ A;  3U6V A;  5KEJ A;  3N5O A;  4RI7 A;  3QAW A;  1GRX A;  2WB9 A;  4OO4 A;  2HI7 A;  2CZ2 A;  2VM1 A;  1SK2 A;  1YDK A;  4ECI A;  3R2Q A;  2KUC A;  6GSX A;  3APQ A;  4IP1 A;  4K0G A;  1ERV A;  2J9H A;  3CSI A;  2AUV A;  4OD7 A;  3VPQ A;  3W8J A;  5D9W A;  3EIN A;  3HZ8 A;  5HR2 A;  3GTU A;  3LQ7 A;  2H0H A;  4NPB A;  2DJ3 A;  1K3O A;  1WP0 A;  4GWR A;  5DAK A;  5IIZ A;  3GIX A;  2CAQ A;  1B4P A;  1TU8 A;  2LJK A;  4N10 A;  3DVW A;  4LMV A;  12GS A;  2FWF A;  2LTK A;  3TRP A;  2XBI A;  1U3A A;  2OBI A;  4ZL9 A;  4I2U A;  3KGK A;  2V32 A;  5H5S A;  3F0I A;  1XBS A;  3TJF A;  4BA7 A;  4TKY A;  1GUH A;  2CVD A;  4XS1 A;  2VL3 A;  1TW9 A;  2FA4 A;  2E0Q A;  1SJ6 A;  3D5J A;  2H0I A;  2WUL A;  2AAW A;  1SL1 B;  3PGT A;  4ULX A;  4O5R A;  3D4T A;  4GSS A;  2A2R A;  3P2A A;  3US3 A;  1YJ6 A;  2OAD A;  2IWT A;  1O81 A;  3MAK A;  22GS A;  2ZUP A;  2OA7 A;  1HQO A;  4BVX A;  3FYG A;  2I9H A;  2YN1 A;  3GN3 A;  3TJB A;  1I5G A;  1W4V A;  3UIW A;  2G2Q A;  3GKN A;  5HFK A;  1J08 A;  4TRX A;  1TKD B;  3DXB A;  3G7J A;  3I69 A;  3FW2 A;  3P90 A;  3GH9 A;  1QUW A;  4TXO B;  2BTO T;  4HQS A;  3O3T A;  4DSR A;  19GS A;  2K8S A;  2VLV A;  5ECS A;  5CRG A;  2DJK A;  2ES7 A;  2XPD A;  3FZ9 A;  2OJL A;  4CDO A;  1FHE A;  4TR1 B;  1S3C A;  2V2G A;  4NV2 A;  1MEK A;  2IMI A;  3C71 A;  1QQ2 A;  2VCW A;  2NVL A;  2HE3 A;  1PRX A;  2MBT A;  3E3E A;  4KGI A;  3UBK A;  3F63 A;  4XRD A;  4DSS A;  3LFL A;  1A2L A;  1Z5Y E;  3BOA A;  2O85 A;  3QFB C;  1PSQ A;  1VRS D;  1T4Y A;  2VCV A;  3QD9 A;  1K0C A;  5H5R A; 
#chains in the Genus database with same CATH topology
 4BWS A;  1K3Y A;  3IRA A;  1K0B A;  5IQY A;  2JL4 A;  3KZQ A;  1B48 A;  3L9S A;  3LWA A;  1SD8 A;  2VCZ A;  4HI7 A;  1A0R P;  1JZD A;  1EGR A;  2HRN A;  4HSC X;  5DBQ A;  1YKC A;  4GCI A;  4OO5 A;  1OE8 A;  3ZIT A;  5B7C A;  3M9J A;  3TKP A;  1MDJ A;  3EVI A;  4ECC A;  4PTS A;  1GTU A;  4EC0 A;  4LMW A;  2CX3 A;  2C0D A;  5HR0 A;  1SKW B;  3DKS A;  2FWH A;  2HRK A;  2R6K A;  4XHM A;  5FT3 A;  4ML6 A;  3KEB A;  2CX4 A;  2PPT A;  1Y6E A;  1O7U A;  4MZB A;  2DLX A;  1THO A;  1R26 A;  1B9X C;  2IFQ B;  1KEB A;  1OE7 A;  5IMV A;  1FOV A;  1OC9 B;  5DCG A;  3DD3 A;  3Q18 A;  2PMT A;  2QC7 A;  1A24 A;  2JSZ A;  5EVO A;  5G1L A;  3HJO A;  4QQ7 A;  3HJM A;  3KTB A;  4MA9 A;  3KM6 A;  3LXZ A;  5EL8 A;  4AGS A;  2PUK C;  1ZOF A;  3OR5 A;  3MWH A;  4G0K A;  1F2E A;  3KP9 A;  3UMA A;  2B7J A;  5D96 A;  3A2W A;  4RQR A;  2LST A;  3F6D A;  5E59 A;  2WGR A;  1AXD A;  2QGV A;  4ZBD A;  4I97 A;  2YWI A;  1VF1 A;  1GP1 A;  3TUE A;  3J7Y k;  4EL1 A;  3BBY A;  2RUE A;  2RUF A;  3FHK A;  2B1K A;  2GQM A;  4KCA A;  1BYE A;  4BWQ A;  3TCO A;  3C7M A;  2YWM A;  3GSS A;  2H1A A;  4X0X A;  2O89 A;  1XWA A;  2VO4 A;  4GST A;  3HYP A;  3LEF A;  2DKI A;  4RQX A;  3GTU B;  4ACS A;  5HR3 A;  4DEJ A;  2LQQ A;  4HEA 2;  3FEU A;  4MF7 A;  2H01 A;  3UVT A;  1XCC A;  4CHS A;  3PIN A;  1MTC A;  4H86 A;  5HQP A;  1GH2 A;  2H6Z A;  4BL7 A;  5IM9 A;  2NBS A;  2GS3 A;  1KTE A;  2A2S A;  4IW9 A;  3ZLP A;  1TOF A;  4V2N A;  4POB A;  2FA8 A;  4ZXG A;  3GKK A;  3UAP A;  3M0F A;  2HSY A;  1M0U A;  1F3B A;  1J9B A;  3CSJ A;  2JZT A;  3UBL A;  4FIW A;  2X8C A;  1T3B A;  3HXS A;  1TRW A;  5ECM B;  2YNX A;  2V41 A;  2L6D A;  4TXO A;  2MMO A;  4Z2U A;  3DIE A;  4QL9 A;  2YWN A;  4MJC A;  1N2A A;  2K9F A;  5AIV A;  1M9B A;  2YJ7 A;  4HDE A;  5CRD A;  4LLR A;  4KDX A;  2B5X A;  2LKU A;  2YPM A;  5DCH A;  4EIP A;  5JWQ B;  1ABA A;  2B7K A;  4ZBB A;  1GSF A;  1PKW A;  1QFN A;  3EWL A;  4G10 A;  3MIX A;  2MMN A;  2EC4 A;  3DWV A;  3IBH A;  5G5E A;  3UAR A;  4ZIJ A;  2TIR A;  3F3Q A;  4ZB8 A;  4F82 A;  1TRU A;  4DSS B;  5AN1 A;  1YEP A;  1XWK A;  13GS A;  3VI5 A;  3WGX A;  2VD0 A;  4IVF A;  2L5O A;  4I6X A;  5EPF A;  1ACV A;  1U3I A;  2O8V B;  3FZA A;  1DUG A;  5ECQ B;  3V1W A;  5G1K A;  1GSQ A;  1GTI A;  5HFI A;  2C0F A;  2LEG A;  3ERF A;  3DGQ A;  2XC2 A;  4KA0 A;  1FAA A;  1DE2 A;  1AAZ A;  1A0F A;  1OKD A;  1MDI A;  1RK4 A;  2L4Q A;  1EP8 A;  1WIK A;  3BD2 A;  1J0F A;  1K0N A;  2L59 A;  1G6W A;  5GAP D;  1GNE A;  2K6V A;  3L9U A;  1FO5 A;  3VWX A;  1QMV A;  3G7I A;  2H6X A;  4X1U A;  1AQX A;  5J5N A;  3IPZ A;  4XRA A;  5L71 A;  3A5W A;  2PVO C;  3HVV A;  4K8M A;  4F0C A;  2FNO A;  2HSH A;  1TK5 B;  5DVB A;  1C72 A;  1FOH A;  3F4R A;  4ZB6 A;  1TK0 B;  1PMT A;  1NW2 A;  3HZ4 A;  2LRN A;  2YCD A;  3GKM A;  5A4U A;  2ON5 A;  2IL3 A;  1QXH A;  1SJZ A;  4DVC A;  2TRX A;  2HXK A;  2GSR A;  4N0Z A;  4ZIL A;  3RDW A;  4J56 E;  5ECO B;  4KDY A;  2IFQ A;  2H6Y A;  1OC9 A;  2CVK A;  2WRT A;  4AF2 A;  5B6N A;  1XW6 A;  4WET A;  2IME A;  1H75 A;  4GRF A;  1SYR A;  2EIQ A;  3QCP A;  1WWJ A;  2DIZ A;  2I1U A;  2HT9 A;  2I3Y A;  4G2E A;  5J3R A;  11GS A;  2C8U A;  1WRY A;  2I81 A;  4MK3 A;  4HOJ A;  3RPP A;  2IJY A;  1NM3 A;  2BMX A;  1AC1 A;  2FWE A;  2ZCT A;  1EEJ A;  1SK0 A;  2R0C A;  4EIQ A;  6GST A;  5IOX A;  4EDY A;  4YKG A;  4RI6 A;  4ZL7 A;  3GUS A;  1JFU A;  5ECK B;  5IO2 A;  3VWU A;  4K0N A;  1BED A;  2CA8 A;  2KP1 A;  5C00 A;  4D73 A;  4WKW A;  5IMZ A;  4G0I A;  1EV4 A;  1V9W A;  2OKA A;  4EO3 A;  2MZC A;  4MH3 A;  4GXZ A;  1WE0 A;  2D2Z A;  3E0U A;  3C73 A;  4GQF A;  1TXX A;  3IA1 A;  1FG4 A;  4G9H A;  4N11 A;  1X0R A;  3LYK A;  3IHQ A;  5IPH A;  1I9D A;  2IMF A;  2AJQ B;  1ZYP A;  3KJY A;  2F8A A;  2C0G A;  4PX1 A;  1JHB A;  2B5Y A;  2AB6 A;  3CBU A;  2DSA A;  4PUF C;  1TRS A;  1AIU A;  1MD3 A;  2LQO A;  4O32 A;  4NAX A;  3M9K A;  4O7H A;  1HNB A;  1WPI A;  3TJK A;  1G7O A;  1V2A A;  3A2X A;  5HR1 A;  2R0G A;  2F51 A;  4MJE A;  1M3I A;  4G0L A;  1XVQ A;  4HJ2 A;  1GUK A;  3ERW A;  3F6F A;  2P0G A;  1WJK A;  3FMW A;  2IIY A;  2QKE A;  3CSH A;  3WD6 A;  4EF0 A;  3EYT A;  2NTO A;  4G19 A;  2HRA A;  6GSY A;  4TR3 A;  4E8H A;  2F8F A;  3LSZ A;  1M7T A;  2DBC A;  1GL8 A;  2I4A A;  3HA9 A;  3VWW A;  4NMU A;  5CO3 A;  3SBC A;  3ME7 A;  3IDV A;  2VCT A;  2FWG A;  3L78 A;  4E8E A;  2GTU A;  4HS1 A;  1XPV A;  5AGY A;  6GSS A;  3K8N A;  1VF2 A;  1T4Z A;  4HQZ A;  4EE0 A;  4XTS A;  4ZL8 A;  2PER A;  3ZRE A;  5D9V A;  2DJ2 A;  1E6B A;  2OE1 A;  4N30 A;  3CRT A;  1ZGN A;  4TVE A;  5J41 A;  1GNW A;  3MNG A;  5DQY A;  1OAZ A;  2OBK A;  3D22 A;  3HCZ A;  2PBJ A;  3ME8 A;  3ZMK A;  2H1G A;  3IOS A;  2CAI A;  5ECL B;  1YY7 A;  3F9U A;  1JZW A;  3HHV A;  1NHO A;  3HVS A;  3LG6 A;  4L5O A;  4MAB A;  1A2M A;  1YEX A;  3MDK A;  2DIY A;  4AJ8 A;  3KTL A;  1EZK A;  2PGT A;  3H4K A;  3HVN A;  4MF6 A;  3TRQ A;  1ERU A;  1M99 A;  5LCZ A;  2B3S A;  1ZMA A;  2HLS A;  1TP9 A;  1UVZ A;  2L4C A;  1S3D A;  1A2J A;  2GT6 A;  4MJB A;  3D4M A;  4ID0 A;  4POM A;  2JU5 A;  3GUR A;  5CNW A;  4IP6 A;  2V6O A;  4N0V A;  5JWR B;  1HD2 A;  1USB A;  4F0B A;  2X99 A;  1Z9H A;  1ZZY A;  4HU9 A;  1ERT A;  3I9V 2;  2V6K A;  5F06 A;  5ABR A;  1Y25 A;  2JAD A;  4MJA A;  4A5P A;  2C3Q A;  3Q6O A;  3APS A;  3IK7 A;  2NDO A;  3KMN A;  3TDG A;  1ZL9 A;  2O87 A;  1EOH A;  2R5G A;  2HNL A;  3ZIV A;  4V2M A;  3KH7 A;  1VGL A;  3GFK A;  4WF4 A;  4YAP A;  4J57 E;  1NHY A;  5D73 A;  4OFN A;  3ZZX A;  3A2V A;  1WOU A;  4RUV A;  4KX4 A;  1GSY A;  2C80 A;  1PGT A;  5G30 A;  5IMD A;  2QA1 A;  2RLI A;  1V58 A;  2GQK A;  3ZVJ A;  1K0A A;  2E2G A;  2AYT A;  4KND A;  2WJU A;  3IC8 A;  4L8E A;  3GX8 A;  2H8L A;  2PVQ A;  4TXV A;  3P7X A;  2H1B A;  1ON4 A;  5JCW A;  3APO A;  2WZ9 A;  4HZ2 A;  4KUN A;  1TJD A;  4Z2R A;  1BAY A;  5GST A;  1OYJ A;  4XCS A;  3TKQ A;  3DEX A;  3H1N A;  2P5R A;  3GMF A;  1X5E A;  1QK8 A;  3HJP A;  2E7P A;  5INY A;  5DAL B;  4K5S A;  2ALB A;  3UL3 A;  2DJJ A;  2H74 A;  4MP4 A;  1ERW A;  3G7Y A;  3MSZ A;  4D73 B;  3ZYW A;  5GSS A;  1Z7P A;  5J4U A;  4Q5Q A;  3F4T A;  2OAC A;  3NZN A;  2MBS A;  3VFI A;  3TJJ A;  3FR9 A;  4P3Y B;  2C3N A;  5KOW A;  4EVM A;  3PH9 A;  4K2D A;  1DE1 A;  5DQS A;  4ECB A;  3RHB A;  2GVP A;  3UOM A;  4NV5 A;  4YKF A;  2R3X A;  4Z7X A;  1O85 A;  3KXO A;  4YQM A;  2VUP A;  1GSU A;  4MZW A;  4PQ1 A;  3ZML A;  1HNC A;  4KB3 A;  2N5A A;  2UZ8 A;  1ST9 A;  3M1G A;  2DJ0 A;  2XHF A;  3QDN A;  1SKS B;  17GS A;  1F37 A;  2AV4 A;  1M2A A;  4MF5 A;  2VOC A;  3HY2 A;  3O6T A;  1TRV A;  4O92 A;  3CMI A;  5KOX A;  2JSY A;  3KD0 A;  1EP7 A;  4NXI A;  4AJ7 A;  1Z6M A;  1NSW A;  4WXT A;  4JU5 A;  3TKS C;  1N8J A;  1X5C A;  5F0G A;  5LD0 A;  1Q98 A;  3EPT A;  1O8X A;  3TKR A;  5DJL A;  4ISD A;  4POL A;  2H1D A;  2J23 A;  1V98 A;  2P5Q A;  3FR3 A;  5ECP B;  1G0T A;  2C4J A;  3GA4 A;  3WGD A;  2QSI A;  1DBY A;  4WR5 A;  4PXO A;  2A2P A;  2YOI A;  5DDL A;  1ILO A;  1YQ1 A;  3PPU A;  2DC5 A;  5DJM A;  1K3L A;  2F3M A;  1PFO A;  1SEN A;  1T1V A;  1TI1 A;  3UVH A;  3KCM A;  3N9J A;  4XS4 A;  1GSD A;  1Z6N A;  1T7P B;  3HD5 A;  1YF1 A;  2H76 A;  4NHZ A;  1LU4 A;  1X5D A;  2GT5 A;  2JZR A;  3GH6 A;  2A4V A;  3TOU A;  1GUL A;  4LA1 A;  5D8I A;  3WYW A;  2N5B A;  4XIH A;  4ICY A;  4IEL A;  4WBJ A;  5B8B A;  3F3R A;  5IOW A;  3H8Q A;  4J2F A;  3EC3 A;  2K18 A;  4CW9 A;  5FHI A;  3L9V A;  2P31 A;  1WMJ A;  3FR6 A;  4TR0 A;  1AQW A;  4FO5 A;  4YAV A;  1SKR B;  4KH7 A;  4KDU A;  3H93 A;  4KCE A;  1AW9 A;  2LJA A;  3IAM 2;  2VM2 A;  1PQN A;  3L0H A;  4L0U A;  5BMU A;  1ZYE A;  3D21 A;  1R4W A;  3FY7 A;  2LV3 A;  3F4S A;  4MCU A;  3TOT A;  3BJ5 A;  1AQV A;  1XW5 A;  2E2M A;  1W89 A;  1SU9 A;  5F07 A;  9GSS A;  1BQ7 A;  4GTU A;  3D6I A;  3IC4 A;  5C04 A;  5ECN B;  4OMV A;  4DSQ A;  1URM A;  8GSS A;  5ELA A;  3VK9 A;  1PL1 A;  2VIM A;  4JR6 A;  2G0F A;  2L6C A;  1HYU A;  3ED3 A;  4MH2 A;  1OKT A;  2GST A;  4OFM A;  1DSB A;  3ISO A;  4CY8 A;  2FY6 A;  5G31 A;  1SK1 A;  2YP6 A;  1GTB A;  3ERG A;  2HRF A;  4PQH A;  5CRW A;  4L5L A;  3JCM L;  2OE0 A;  1A8Y A;  2FHE A;  3GHA A;  1PN9 A;  2DKH A;  1S3R A;  4IHU A;  1YF0 A;  4OFT A;  3Q74 A;  3TKS E;  1Z7R A;  4FYC A;  10GS A;  3GX0 A;  1LBK A;  2HZE B;  2H75 A;  4IQ1 A;  3TB2 A;  5DAL A;  1OC8 A;  2R0P A;  3Q19 A;  2LJR A;  1SD9 A;  2HFD A;  3LW9 A;  2WCI A;  1X9S B;  1JZO A;  5F05 A;  2GZY A;  4WF5 A;  3DRN A;  4I2T A;  4Q5R A;  1ZYQ B;  2YAN A;  4F9Z A;  2KP2 A;  3M3M A;  3LXT A;  2BJX A;  2YZH A;  4WBR D;  1XWC A;  4LL4 B;  1G7E A;  2X8G A;  3QR6 A;  2R4V A;  2IMK A;  1SJI A;  2H66 A;  3QPM A;  1CQH A;  1FB6 A;  5HFG A;  2GSS A;  2XPE A;  1FW1 A;  1B8X A;  2XBQ A;  2N5F A;  1G6Y A;  5KN1 A;  1BJX A;  4POK A;  1ZCP A;  3C1S A;  2VD1 A;  1BX9 A;  1LJR A;  2ON7 A;  5IMC A;  2DMM A;  4JE1 A;  4PNG A;  1O8W A;  2KOK A;  2CVB A;  5D9X A;  5B8A A;  4PNF A;  4O5Q A;  1K0M A;  4XS6 A;  2M72 A;  3CRU A;  1MD4 A;  3D0Z A;  3S9F A;  4YQV A;  4AJ6 A;  3WT2 A;  3ZFL A;  3KIJ A;  5CP1 A;  4MMM A;  4ECJ A;  1EGO A;  2LS5 A;  3SWL A;  1K0O A;  3KP8 A;  4OWY A;  2FUG 2;  3W8S A;  5ECI B;  2YJH A;  3IV4 A;  2MMZ A;  4KSO A;  1R7H A;  1EWX A;  2LNT A;  6GSV A;  1ML6 A;  2RM6 A;  3UEM A;  4BVY B;  3C8E A;  4X4J A;  2H70 A;  1FVJ A;  2H30 A;  2H71 A;  5IMF A;  2A4H A;  4PQI A;  2ZNM A;  3A5I A;  4XS4 B;  1MDK A;  2C3T A;  4MPF A;  2CZ3 A;  3TGZ A;  4IBP A;  1F6M C;  2WS2 A;  3J7Y b;  2X64 A;  1TU7 A;  3CYN A;  2YZU A;  2FD3 A;  3A3T A;  4IQA A;  4Z2T A;  4PUA A;  3FRC A;  3R3E A;  2NPB A;  3RPN A;  3HVX A;  4HUA A;  5ID2 A;  3G9B A;  4K2X A;  1CQG A;  3VPT A;  1JZR A;  5H5Q A;  2AHE A;  1FVK A;  1XOB A;  2JAC A;  4JRR A;  5CRH A;  1GLP A;  5COH A;  3GV1 A;  3GRX A;  3QAV A;  1QGV A;  4K1F A;  3C1R A;  5ECH B;  1PA3 A;  3PR8 A;  2VLU A;  2B6M A;  5JCU A;  3ZVJ D;  3KH9 A;  5GZZ B;  4TW5 A;  20GS A;  2LNS A;  1O73 A;  1EOG A;  2PWJ A;  3WGE A;  4HZ4 A;  3ZIJ A;  1GLQ A;  3TRX A;  4TOP A;  1B9Y C;  1M2D A;  2YV9 A;  5JCG A;  2OE3 A;  3HDC A;  3CXG A;  3HKR A;  4WR4 A;  4V1A g;  1SL0 B;  1O6J A;  4NHW A;  3GST A;  5EY6 A;  5A5K A;  4HJM A;  5G5F A;  3EUR A;  4I5Q A;  3NIV A;  5J9C A;  5CYY A;  2TRC P;  2GZP A;  2LRT A;  4IJ3 A;  4GSN A;  4TR4 A;  1RQM A;  1GUM A;  1XXU A;  5KN0 A;  3IXR A;  3DYR A;  3DVX A;  2QA2 A;  1B4Q A;  3I6A A;  4OCE A;  4EUY A;  2PU9 C;  2CQ9 A;  2YV7 A;  3RBT A;  1FB0 A;  2R2J A;  4I8B A;  4MLY A;  3NOF A;  2B5E A;  2HYX A;  4WEY A;  1UA5 A;  2VLT A;  4O5U A;  1XW9 A;  4NWY A;  7GSS A;  3EU4 A;  2GSQ A;  2JZS A;  4K7N A;  5A4V A;  5JWO B;  2X49 A;  1EEM A;  3LYP A;  2HZE A;  3TKS A;  4PUR A;  2X4A A;  3FK8 A;  3IHG A;  3FKF A;  3IAS 2;  5D9T A;  2IMD A;  5ECR B;  4OCF A;  1T00 A;  4ILF A;  3IE3 A;  2DJ1 A;  1U6T A;  3M8N A;  4IN0 A;  1EV9 A;  4TN8 A;  4K7I A;  2CT6 A;  3H79 A;  4MZC A;  1H4O A;  4K7O A;  4IGJ A;  1S3A A;  3ZL5 A;  3LJR A;  4EDZ A;  2H72 A;  5E4W A;  1VF4 A;  6GSW A;  3CTG A;  1X9M B;  1PKZ A;  2IN3 A;  3IK9 A;  2FGX A;  1XWB A;  3FZ5 A;  4BPY A;  3L4N A;  5G2Z A;  1M9A A;  3E9J B;  2VCX A;  2HZF A;  3LOR A;  3UJ1 A;  3ZTL A;  2FCH A;  2GGT A;  2X8H A;  1T8E B;  1KNG A;  3W6G A;  1XWG A;  2VL2 A;  2H19 A;  5DAK B;  14GS A;  1XZO A;  2LRC A;  3F8U A;  3EU3 A;  4MDC A;  3LGC A;  1PX7 A;  2V1M A;  6GSU A;  4V1A p;  2IPA A;  2GQL A;  1R5P A;  1A23 A;  2B1L A;  5GAN D;  3GL3 A;  4Q5N A;  5ENU A;  1U87 A;  4IS0 A;  3TJG A;  4F03 A;  1PD2 1;  1Q4J A;  2KHP A;  5A4W A;  2C1Y A;  1HNA A;  1BG5 A;  2GDR A;  1XVW A;  1TK8 B;  2H0G A;  4KW6 A;  3VLN A;  4USS A;  5CRE A;  2RM5 A;  4BVX B;  3RAZ A;  1OVN A;  2MYG A;  1TI3 A;  1UN2 A;  4ZB9 A;  3DML A;  5IO0 A;  2KLX A;  3QOU A;  1X9W B;  1GTA A;  3IR4 A;  4BVY A;  3WT1 A;  3EE2 A;  5AIS A;  4QL7 A;  4JZQ A;  2L57 A;  4Q5F A;  1JLV A;  1V40 A;  3EMP A;  1VF3 A;  2Z9S A;  1IYI A;  1M2B A;  3QFA C;  4JBB A;  3BCK A;  5KN2 A;  4X43 A;  4YQU A;  2HSM A;  4TR1 A;  1PX6 A;  1UC7 A;  2VL2 C;  2PN8 A;  2YWO A;  4EKZ A;  4GLT A;  1E2Y A;  5IPG A;  3ZRD A;  3VUR A;  5ID2 B;  4ML1 A;  3KMO A;  4FYB A;  1Z3E A;  4L0W A;  1THX A;  4KAE A;  3RHC A;  1GSE A;  3QMX A;  4IKH A;  1XOA A;  3U5R E;  1R5A A;  3O76 A;  4PGT A;  4FH8 A;  1XIY A;  4YH2 A;  5J9B A;  4LL1 B;  3CTF A;  1OC3 A;  2R37 A;  4K6X A;  2O7K A;  5B6M A;  3EMX A;  2RII A;  3QAG A;  4EXJ A;  1F3A A;  1GSS A;  2LUS A;  2L5L A;  4JR4 A;  4KE3 A;  1KBN A;  1U88 A;  5F8B A;  1GWC A;  4F2I A;  3VWV A;  4JED A;  1V57 A;  5ELG A;  2FLS A;  5CAX A;  2EIR A;  1JLW A;  1XG8 A;  1A8L A;  4K5R A;  4KSM A;  2VCQ A;  18GS A;  1PL2 A;  1AUC A;  4GQC A;  1F9M A;  5AIX A;  1K0D A;  4V2L A;  3GL5 A;  2WDU A;  4IJI A;  1IYH A;  2M46 A;  2WFC A;  5IMA A;  3VI7 A;  2C0E A;  2VL9 A;  3FZ4 A;  1TDI A;  3BCI A;  1TTZ A;  2VAF A;  2K8V A;  1XFL A;  3GYK A;  5FWG A;  1PN0 A;  2GLR A;  4HU7 A;  1SL2 B;  3P8W A;  4FYU A;  3ZFB A;  2EIO A;  2CV4 A;  1YZX A;  2H73 A;  3AY8 A;  2DML A;  2MMA A;  2F9S A;  2GZZ A;  1RW1 A;  2REM A;  4MPG A;  5KN3 A;  2M80 A;  5D93 A;  4K9Z A;  4GF0 A;  5LNK e;  16GS A;  1SYX A;  3I43 A;  3GKX A;  1YKA A;  4ZBA A;  3GNJ A;  3U6V A;  5KEJ A;  3N5O A;  4RI7 A;  3QAW A;  1GRX A;  2WB9 A;  4OO4 A;  2HI7 A;  2CZ2 A;  2VM1 A;  1SK2 A;  1YDK A;  4ECI A;  3R2Q A;  2KUC A;  6GSX A;  3APQ A;  4IP1 A;  4K0G A;  1ERV A;  2J9H A;  3CSI A;  2AUV A;  4OD7 A;  3VPQ A;  3W8J A;  5D9W A;  3EIN A;  3HZ8 A;  5HR2 A;  3GTU A;  3LQ7 A;  2H0H A;  4NPB A;  2DJ3 A;  1K3O A;  1WP0 A;  4GWR A;  5DAK A;  5IIZ A;  3GIX A;  2CAQ A;  1B4P A;  1TU8 A;  2LJK A;  4N10 A;  3DVW A;  4LMV A;  12GS A;  2FWF A;  2LTK A;  3TRP A;  2XBI A;  1U3A A;  2OBI A;  4ZL9 A;  4I2U A;  3KGK A;  4FQU A;  2V32 A;  5H5S A;  3F0I A;  1XBS A;  3TJF A;  4BA7 A;  4TKY A;  1GUH A;  2CVD A;  3CQF A;  4XS1 A;  2VL3 A;  4BL7 B;  1TW9 A;  2FA4 A;  2E0Q A;  1SJ6 A;  3D5J A;  2H0I A;  2WUL A;  2AAW A;  4BIK A;  1SL1 B;  4MNN A;  3PGT A;  4ULX A;  4O5R A;  3D4T A;  4GSS A;  2A2R A;  3P2A A;  1ZYN A;  3US3 A;  1YJ6 A;  2OAD A;  2IWT A;  1O81 A;  3MAK A;  22GS A;  2ZUP A;  2OA7 A;  1HQO A;  4BVX A;  3FYG A;  2I9H A;  2YN1 A;  3GN3 A;  3TJB A;  1I5G A;  1W4V A;  3UIW A;  2G2Q A;  3GKN A;  5HFK A;  1J08 A;  4TRX A;  1TKD B;  3DXB A;  3G7J A;  3I69 A;  3FW2 A;  3P90 A;  3GH9 A;  1QUW A;  4TXO B;  2BTO T;  4HQS A;  3O3T A;  4DSR A;  19GS A;  2K8S A;  2VLV A;  5ECS A;  5CRG A;  2DJK A;  2ES7 A;  2XPD A;  3FZ9 A;  2OJL A;  4CDO A;  1FHE A;  4CY6 A;  4TR1 B;  5BRT A;  1S3C A;  2V2G A;  4NV2 A;  1MEK A;  2IMI A;  3C71 A;  1QQ2 A;  2VCW A;  2NVL A;  2HE3 A;  1PRX A;  2MBT A;  1M3J A;  3E3E A;  4KGI A;  3UBK A;  3F63 A;  4KF9 A;  4XRD A;  4DSS A;  3LFL A;  1A2L A;  1Z5Y E;  3BOA A;  2O85 A;  3QFB C;  1PSQ A;  1VRS D;  1T4Y A;  2VCV A;  3QD9 A;  1K0C A;  3MYD A;  5H5R A; 
#chains in the Genus database with same CATH homology
 4BWS A;  1K3Y A;  3IRA A;  1K0B A;  5IQY A;  2JL4 A;  3KZQ A;  1B48 A;  3L9S A;  3LWA A;  1SD8 A;  2VCZ A;  4HI7 A;  1A0R P;  1JZD A;  1EGR A;  2HRN A;  5DBQ A;  1YKC A;  4GCI A;  4OO5 A;  1OE8 A;  3ZIT A;  5B7C A;  3M9J A;  3TKP A;  1MDJ A;  3EVI A;  4ECC A;  4PTS A;  1GTU A;  4EC0 A;  4LMW A;  2CX3 A;  2C0D A;  5HR0 A;  1SKW B;  3DKS A;  2FWH A;  2HRK A;  2R6K A;  4XHM A;  5FT3 A;  4ML6 A;  3KEB A;  2CX4 A;  2PPT A;  1Y6E A;  1O7U A;  4MZB A;  2DLX A;  1THO A;  1R26 A;  1B9X C;  2IFQ B;  1KEB A;  1OE7 A;  5IMV A;  1FOV A;  1OC9 B;  5DCG A;  3DD3 A;  3Q18 A;  2PMT A;  2QC7 A;  1A24 A;  2JSZ A;  5EVO A;  5G1L A;  3HJO A;  4QQ7 A;  3HJM A;  3KTB A;  4MA9 A;  3KM6 A;  3LXZ A;  5EL8 A;  4AGS A;  2PUK C;  1ZOF A;  3OR5 A;  3MWH A;  4G0K A;  1F2E A;  3KP9 A;  3UMA A;  2B7J A;  5D96 A;  3A2W A;  4RQR A;  2LST A;  3F6D A;  5E59 A;  2WGR A;  1AXD A;  2QGV A;  4ZBD A;  4I97 A;  2YWI A;  1VF1 A;  1GP1 A;  3TUE A;  3J7Y k;  4EL1 A;  3BBY A;  2RUE A;  2RUF A;  3FHK A;  2B1K A;  2GQM A;  4KCA A;  1BYE A;  4BWQ A;  3TCO A;  3C7M A;  2YWM A;  3GSS A;  2H1A A;  4X0X A;  2O89 A;  1XWA A;  2VO4 A;  4GST A;  3HYP A;  3LEF A;  2DKI A;  4RQX A;  3GTU B;  4ACS A;  5HR3 A;  4DEJ A;  2LQQ A;  4HEA 2;  3FEU A;  4MF7 A;  2H01 A;  3UVT A;  1XCC A;  4CHS A;  3PIN A;  1MTC A;  4H86 A;  5HQP A;  1GH2 A;  2H6Z A;  4BL7 A;  5IM9 A;  2NBS A;  2GS3 A;  1KTE A;  2A2S A;  4IW9 A;  3ZLP A;  1TOF A;  4V2N A;  4POB A;  2FA8 A;  4ZXG A;  3GKK A;  3UAP A;  3M0F A;  2HSY A;  1M0U A;  1F3B A;  1J9B A;  3CSJ A;  2JZT A;  3UBL A;  4FIW A;  2X8C A;  1T3B A;  3HXS A;  1TRW A;  5ECM B;  2YNX A;  2V41 A;  2L6D A;  4TXO A;  2MMO A;  4Z2U A;  3DIE A;  4QL9 A;  2YWN A;  4MJC A;  1N2A A;  2K9F A;  5AIV A;  1M9B A;  2YJ7 A;  4HDE A;  5CRD A;  4LLR A;  4KDX A;  2B5X A;  2LKU A;  2YPM A;  5DCH A;  4EIP A;  5JWQ B;  1ABA A;  2B7K A;  4ZBB A;  1GSF A;  1PKW A;  1QFN A;  3EWL A;  4G10 A;  3MIX A;  2MMN A;  2EC4 A;  3DWV A;  3IBH A;  5G5E A;  3UAR A;  4ZIJ A;  2TIR A;  3F3Q A;  4ZB8 A;  4F82 A;  1TRU A;  4DSS B;  5AN1 A;  1YEP A;  1XWK A;  13GS A;  3VI5 A;  3WGX A;  2VD0 A;  4IVF A;  2L5O A;  4I6X A;  5EPF A;  1ACV A;  1U3I A;  2O8V B;  3FZA A;  1DUG A;  5ECQ B;  3V1W A;  5G1K A;  1GSQ A;  1GTI A;  5HFI A;  2C0F A;  2LEG A;  3ERF A;  3DGQ A;  2XC2 A;  4KA0 A;  1FAA A;  1DE2 A;  1AAZ A;  1A0F A;  1OKD A;  1MDI A;  1RK4 A;  2L4Q A;  1EP8 A;  1WIK A;  3BD2 A;  1J0F A;  1K0N A;  2L59 A;  1G6W A;  5GAP D;  1GNE A;  2K6V A;  3L9U A;  1FO5 A;  3VWX A;  1QMV A;  3G7I A;  2H6X A;  4X1U A;  1AQX A;  5J5N A;  3IPZ A;  4XRA A;  5L71 A;  3A5W A;  2PVO C;  3HVV A;  4K8M A;  4F0C A;  2FNO A;  2HSH A;  1TK5 B;  5DVB A;  1C72 A;  1FOH A;  3F4R A;  4ZB6 A;  1TK0 B;  1PMT A;  1NW2 A;  3HZ4 A;  2LRN A;  2YCD A;  3GKM A;  5A4U A;  2ON5 A;  2IL3 A;  1QXH A;  1SJZ A;  4DVC A;  2TRX A;  2HXK A;  2GSR A;  4N0Z A;  4ZIL A;  3RDW A;  4J56 E;  5ECO B;  4KDY A;  2IFQ A;  2H6Y A;  1OC9 A;  2CVK A;  2WRT A;  4AF2 A;  5B6N A;  1XW6 A;  4WET A;  2IME A;  1H75 A;  4GRF A;  1SYR A;  2EIQ A;  3QCP A;  1WWJ A;  2DIZ A;  2I1U A;  2HT9 A;  2I3Y A;  4G2E A;  5J3R A;  11GS A;  2C8U A;  1WRY A;  2I81 A;  4MK3 A;  4HOJ A;  3RPP A;  2IJY A;  1NM3 A;  2BMX A;  1AC1 A;  2FWE A;  2ZCT A;  1EEJ A;  1SK0 A;  2R0C A;  4EIQ A;  6GST A;  5IOX A;  4EDY A;  4YKG A;  4RI6 A;  4ZL7 A;  3GUS A;  1JFU A;  5ECK B;  5IO2 A;  3VWU A;  4K0N A;  1BED A;  2CA8 A;  2KP1 A;  5C00 A;  4D73 A;  4WKW A;  5IMZ A;  4G0I A;  1EV4 A;  1V9W A;  2OKA A;  4EO3 A;  2MZC A;  4MH3 A;  4GXZ A;  1WE0 A;  2D2Z A;  3E0U A;  3C73 A;  4GQF A;  1TXX A;  3IA1 A;  1FG4 A;  4G9H A;  4N11 A;  1X0R A;  3LYK A;  3IHQ A;  5IPH A;  1I9D A;  2IMF A;  2AJQ B;  1ZYP A;  3KJY A;  2F8A A;  2C0G A;  4PX1 A;  1JHB A;  2B5Y A;  2AB6 A;  3CBU A;  2DSA A;  4PUF C;  1TRS A;  1AIU A;  1MD3 A;  2LQO A;  4O32 A;  4NAX A;  3M9K A;  4O7H A;  1HNB A;  1WPI A;  3TJK A;  1G7O A;  1V2A A;  3A2X A;  5HR1 A;  2R0G A;  2F51 A;  4MJE A;  4G0L A;  1XVQ A;  4HJ2 A;  1GUK A;  3ERW A;  3F6F A;  2P0G A;  1WJK A;  3FMW A;  2IIY A;  2QKE A;  3CSH A;  3WD6 A;  4EF0 A;  3EYT A;  2NTO A;  4G19 A;  2HRA A;  6GSY A;  4TR3 A;  4E8H A;  2F8F A;  3LSZ A;  1M7T A;  2DBC A;  1GL8 A;  2I4A A;  3HA9 A;  3VWW A;  4NMU A;  5CO3 A;  3SBC A;  3ME7 A;  3IDV A;  2VCT A;  2FWG A;  3L78 A;  4E8E A;  2GTU A;  4HS1 A;  1XPV A;  5AGY A;  6GSS A;  3K8N A;  1VF2 A;  1T4Z A;  4HQZ A;  4EE0 A;  4XTS A;  4ZL8 A;  2PER A;  3ZRE A;  5D9V A;  2DJ2 A;  1E6B A;  2OE1 A;  4N30 A;  3CRT A;  1ZGN A;  4TVE A;  5J41 A;  1GNW A;  3MNG A;  5DQY A;  1OAZ A;  2OBK A;  3D22 A;  3HCZ A;  2PBJ A;  3ME8 A;  3ZMK A;  2H1G A;  3IOS A;  2CAI A;  5ECL B;  1YY7 A;  3F9U A;  1JZW A;  3HHV A;  1NHO A;  3HVS A;  3LG6 A;  4L5O A;  4MAB A;  1A2M A;  1YEX A;  3MDK A;  2DIY A;  4AJ8 A;  3KTL A;  1EZK A;  2PGT A;  3H4K A;  4MF6 A;  3TRQ A;  1ERU A;  1M99 A;  5LCZ A;  2B3S A;  1ZMA A;  2HLS A;  1TP9 A;  1UVZ A;  2L4C A;  1S3D A;  1A2J A;  2GT6 A;  4MJB A;  3D4M A;  4ID0 A;  4POM A;  2JU5 A;  3GUR A;  5CNW A;  4IP6 A;  2V6O A;  4N0V A;  5JWR B;  1HD2 A;  1USB A;  4F0B A;  2X99 A;  1Z9H A;  1ZZY A;  4HU9 A;  1ERT A;  3I9V 2;  2V6K A;  5F06 A;  5ABR A;  1Y25 A;  2JAD A;  4MJA A;  4A5P A;  2C3Q A;  3Q6O A;  3APS A;  3IK7 A;  2NDO A;  3KMN A;  3TDG A;  1ZL9 A;  2O87 A;  1EOH A;  2R5G A;  2HNL A;  3ZIV A;  4V2M A;  3KH7 A;  1VGL A;  3GFK A;  4WF4 A;  4YAP A;  4J57 E;  1NHY A;  5D73 A;  4OFN A;  3ZZX A;  3A2V A;  1WOU A;  4RUV A;  4KX4 A;  1GSY A;  2C80 A;  1PGT A;  5G30 A;  5IMD A;  2QA1 A;  2RLI A;  1V58 A;  2GQK A;  3ZVJ A;  1K0A A;  2E2G A;  2AYT A;  4KND A;  2WJU A;  3IC8 A;  4L8E A;  3GX8 A;  2H8L A;  2PVQ A;  4TXV A;  3P7X A;  2H1B A;  1ON4 A;  5JCW A;  3APO A;  2WZ9 A;  4HZ2 A;  4KUN A;  1TJD A;  4Z2R A;  1BAY A;  5GST A;  1OYJ A;  4XCS A;  3TKQ A;  3DEX A;  3H1N A;  2P5R A;  3GMF A;  1X5E A;  1QK8 A;  3HJP A;  2E7P A;  5INY A;  5DAL B;  4K5S A;  2ALB A;  3UL3 A;  2DJJ A;  2H74 A;  4MP4 A;  1ERW A;  3G7Y A;  3MSZ A;  4D73 B;  3ZYW A;  5GSS A;  1Z7P A;  5J4U A;  4Q5Q A;  3F4T A;  2OAC A;  3NZN A;  2MBS A;  3VFI A;  3TJJ A;  3FR9 A;  4P3Y B;  2C3N A;  5KOW A;  4EVM A;  3PH9 A;  4K2D A;  1DE1 A;  5DQS A;  4ECB A;  3RHB A;  2GVP A;  3UOM A;  4NV5 A;  4YKF A;  2R3X A;  4Z7X A;  1O85 A;  3KXO A;  4YQM A;  2VUP A;  1GSU A;  4MZW A;  4PQ1 A;  3ZML A;  1HNC A;  4KB3 A;  2N5A A;  2UZ8 A;  1ST9 A;  3M1G A;  2DJ0 A;  2XHF A;  3QDN A;  1SKS B;  17GS A;  1F37 A;  2AV4 A;  1M2A A;  4MF5 A;  2VOC A;  3HY2 A;  3O6T A;  1TRV A;  4O92 A;  3CMI A;  5KOX A;  2JSY A;  3KD0 A;  1EP7 A;  4NXI A;  4AJ7 A;  1Z6M A;  1NSW A;  4WXT A;  4JU5 A;  3TKS C;  1N8J A;  1X5C A;  5F0G A;  5LD0 A;  1Q98 A;  3EPT A;  1O8X A;  3TKR A;  5DJL A;  4ISD A;  4POL A;  2H1D A;  2J23 A;  1V98 A;  2P5Q A;  3FR3 A;  5ECP B;  1G0T A;  2C4J A;  3GA4 A;  3WGD A;  2QSI A;  1DBY A;  4WR5 A;  4PXO A;  2A2P A;  2YOI A;  5DDL A;  1ILO A;  1YQ1 A;  3PPU A;  2DC5 A;  5DJM A;  1K3L A;  2F3M A;  1SEN A;  1T1V A;  1TI1 A;  3UVH A;  3KCM A;  3N9J A;  4XS4 A;  1GSD A;  1Z6N A;  1T7P B;  3HD5 A;  1YF1 A;  2H76 A;  4NHZ A;  1LU4 A;  1X5D A;  2GT5 A;  2JZR A;  3GH6 A;  2A4V A;  3TOU A;  1GUL A;  4LA1 A;  5D8I A;  3WYW A;  2N5B A;  4XIH A;  4ICY A;  4IEL A;  4WBJ A;  5B8B A;  3F3R A;  5IOW A;  3H8Q A;  4J2F A;  3EC3 A;  2K18 A;  4CW9 A;  5FHI A;  3L9V A;  2P31 A;  1WMJ A;  3FR6 A;  4TR0 A;  1AQW A;  4FO5 A;  4YAV A;  1SKR B;  4KH7 A;  4KDU A;  3H93 A;  4KCE A;  1AW9 A;  2LJA A;  3IAM 2;  2VM2 A;  1PQN A;  3L0H A;  4L0U A;  5BMU A;  1ZYE A;  3D21 A;  1R4W A;  3FY7 A;  2LV3 A;  3F4S A;  4MCU A;  3TOT A;  3BJ5 A;  1AQV A;  1XW5 A;  2E2M A;  1W89 A;  1SU9 A;  5F07 A;  9GSS A;  1BQ7 A;  4GTU A;  3D6I A;  3IC4 A;  5C04 A;  5ECN B;  4OMV A;  4DSQ A;  1URM A;  8GSS A;  5ELA A;  3VK9 A;  1PL1 A;  2VIM A;  4JR6 A;  2G0F A;  2L6C A;  1HYU A;  3ED3 A;  4MH2 A;  1OKT A;  2GST A;  4OFM A;  1DSB A;  3ISO A;  4CY8 A;  2FY6 A;  5G31 A;  1SK1 A;  2YP6 A;  1GTB A;  3ERG A;  2HRF A;  4PQH A;  5CRW A;  4L5L A;  3JCM L;  2OE0 A;  1A8Y A;  2FHE A;  3GHA A;  1PN9 A;  2DKH A;  4IHU A;  1YF0 A;  4OFT A;  3Q74 A;  3TKS E;  1Z7R A;  4FYC A;  10GS A;  3GX0 A;  1LBK A;  2HZE B;  2H75 A;  4IQ1 A;  3TB2 A;  5DAL A;  1OC8 A;  2R0P A;  3Q19 A;  2LJR A;  1SD9 A;  2HFD A;  3LW9 A;  2WCI A;  1X9S B;  1JZO A;  5F05 A;  2GZY A;  4WF5 A;  3DRN A;  4I2T A;  4Q5R A;  1ZYQ B;  2YAN A;  4F9Z A;  2KP2 A;  3M3M A;  3LXT A;  2BJX A;  2YZH A;  4WBR D;  1XWC A;  4LL4 B;  1G7E A;  2X8G A;  3QR6 A;  2R4V A;  2IMK A;  1SJI A;  2H66 A;  3QPM A;  1CQH A;  1FB6 A;  5HFG A;  2GSS A;  2XPE A;  1FW1 A;  1B8X A;  2XBQ A;  2N5F A;  1G6Y A;  5KN1 A;  1BJX A;  4POK A;  1ZCP A;  3C1S A;  2VD1 A;  1BX9 A;  1LJR A;  2ON7 A;  5IMC A;  2DMM A;  4JE1 A;  4PNG A;  1O8W A;  2KOK A;  2CVB A;  5D9X A;  5B8A A;  4PNF A;  4O5Q A;  1K0M A;  4XS6 A;  2M72 A;  3CRU A;  1MD4 A;  3D0Z A;  3S9F A;  4YQV A;  4AJ6 A;  3WT2 A;  3ZFL A;  3KIJ A;  5CP1 A;  4MMM A;  4ECJ A;  1EGO A;  2LS5 A;  3SWL A;  1K0O A;  3KP8 A;  4OWY A;  2FUG 2;  3W8S A;  5ECI B;  2YJH A;  3IV4 A;  2MMZ A;  4KSO A;  1R7H A;  1EWX A;  2LNT A;  6GSV A;  1ML6 A;  2RM6 A;  3UEM A;  4BVY B;  3C8E A;  4X4J A;  2H70 A;  1FVJ A;  2H30 A;  2H71 A;  5IMF A;  2A4H A;  4PQI A;  2ZNM A;  3A5I A;  4XS4 B;  1MDK A;  2C3T A;  4MPF A;  2CZ3 A;  3TGZ A;  4IBP A;  1F6M C;  2WS2 A;  3J7Y b;  2X64 A;  1TU7 A;  3CYN A;  2YZU A;  2FD3 A;  3A3T A;  4IQA A;  4Z2T A;  4PUA A;  3FRC A;  3R3E A;  2NPB A;  3RPN A;  3HVX A;  4HUA A;  5ID2 A;  3G9B A;  4K2X A;  1CQG A;  3VPT A;  1JZR A;  5H5Q A;  2AHE A;  1FVK A;  1XOB A;  2JAC A;  4JRR A;  5CRH A;  1GLP A;  5COH A;  3GV1 A;  3GRX A;  3QAV A;  1QGV A;  4K1F A;  3C1R A;  5ECH B;  1PA3 A;  3PR8 A;  2VLU A;  2B6M A;  5JCU A;  3ZVJ D;  3KH9 A;  5GZZ B;  4TW5 A;  20GS A;  2LNS A;  1O73 A;  1EOG A;  2PWJ A;  3WGE A;  4HZ4 A;  3ZIJ A;  1GLQ A;  3TRX A;  4TOP A;  1B9Y C;  1M2D A;  2YV9 A;  5JCG A;  2OE3 A;  3HDC A;  3CXG A;  3HKR A;  4WR4 A;  4V1A g;  1SL0 B;  1O6J A;  4NHW A;  3GST A;  5EY6 A;  5A5K A;  4HJM A;  5G5F A;  3EUR A;  4I5Q A;  3NIV A;  5J9C A;  5CYY A;  2TRC P;  2GZP A;  2LRT A;  4IJ3 A;  4GSN A;  4TR4 A;  1RQM A;  1GUM A;  1XXU A;  5KN0 A;  3IXR A;  3DYR A;  3DVX A;  2QA2 A;  1B4Q A;  3I6A A;  4OCE A;  4EUY A;  2PU9 C;  2CQ9 A;  2YV7 A;  3RBT A;  1FB0 A;  2R2J A;  4I8B A;  4MLY A;  3NOF A;  2B5E A;  2HYX A;  4WEY A;  1UA5 A;  2VLT A;  4O5U A;  1XW9 A;  4NWY A;  7GSS A;  3EU4 A;  2GSQ A;  2JZS A;  4K7N A;  5A4V A;  5JWO B;  2X49 A;  1EEM A;  3LYP A;  2HZE A;  3TKS A;  4PUR A;  2X4A A;  3FK8 A;  3IHG A;  3FKF A;  3IAS 2;  5D9T A;  2IMD A;  5ECR B;  4OCF A;  1T00 A;  4ILF A;  3IE3 A;  2DJ1 A;  1U6T A;  3M8N A;  4IN0 A;  1EV9 A;  4TN8 A;  4K7I A;  2CT6 A;  3H79 A;  4MZC A;  1H4O A;  4K7O A;  4IGJ A;  1S3A A;  3ZL5 A;  3LJR A;  4EDZ A;  2H72 A;  5E4W A;  1VF4 A;  6GSW A;  3CTG A;  1X9M B;  1PKZ A;  2IN3 A;  3IK9 A;  2FGX A;  1XWB A;  3FZ5 A;  4BPY A;  3L4N A;  5G2Z A;  1M9A A;  3E9J B;  2VCX A;  2HZF A;  3LOR A;  3UJ1 A;  3ZTL A;  2FCH A;  2GGT A;  2X8H A;  1T8E B;  1KNG A;  3W6G A;  1XWG A;  2VL2 A;  2H19 A;  5DAK B;  14GS A;  1XZO A;  2LRC A;  3F8U A;  3EU3 A;  4MDC A;  3LGC A;  1PX7 A;  2V1M A;  6GSU A;  4V1A p;  2IPA A;  2GQL A;  1R5P A;  1A23 A;  2B1L A;  5GAN D;  3GL3 A;  4Q5N A;  5ENU A;  1U87 A;  4IS0 A;  3TJG A;  4F03 A;  1PD2 1;  1Q4J A;  2KHP A;  5A4W A;  2C1Y A;  1HNA A;  1BG5 A;  2GDR A;  1XVW A;  1TK8 B;  2H0G A;  4KW6 A;  3VLN A;  4USS A;  5CRE A;  2RM5 A;  4BVX B;  3RAZ A;  1OVN A;  2MYG A;  1TI3 A;  1UN2 A;  4ZB9 A;  3DML A;  5IO0 A;  2KLX A;  3QOU A;  1X9W B;  1GTA A;  3IR4 A;  4BVY A;  3WT1 A;  3EE2 A;  5AIS A;  4QL7 A;  4JZQ A;  2L57 A;  4Q5F A;  1JLV A;  1V40 A;  3EMP A;  1VF3 A;  2Z9S A;  1IYI A;  1M2B A;  3QFA C;  4JBB A;  3BCK A;  5KN2 A;  4X43 A;  4YQU A;  2HSM A;  4TR1 A;  1PX6 A;  1UC7 A;  2VL2 C;  2PN8 A;  2YWO A;  4EKZ A;  4GLT A;  1E2Y A;  5IPG A;  3ZRD A;  3VUR A;  5ID2 B;  4ML1 A;  3KMO A;  4FYB A;  1Z3E A;  4L0W A;  1THX A;  4KAE A;  3RHC A;  1GSE A;  3QMX A;  4IKH A;  1XOA A;  3U5R E;  1R5A A;  3O76 A;  4PGT A;  4FH8 A;  1XIY A;  4YH2 A;  5J9B A;  4LL1 B;  3CTF A;  1OC3 A;  2R37 A;  4K6X A;  2O7K A;  5B6M A;  3EMX A;  2RII A;  3QAG A;  4EXJ A;  1F3A A;  1GSS A;  2LUS A;  2L5L A;  4JR4 A;  4KE3 A;  1KBN A;  1U88 A;  5F8B A;  1GWC A;  4F2I A;  3VWV A;  4JED A;  1V57 A;  5ELG A;  2FLS A;  5CAX A;  2EIR A;  1JLW A;  1A8L A;  4K5R A;  4KSM A;  2VCQ A;  18GS A;  1PL2 A;  1AUC A;  4GQC A;  1F9M A;  5AIX A;  1K0D A;  4V2L A;  3GL5 A;  2WDU A;  4IJI A;  1IYH A;  2M46 A;  2WFC A;  5IMA A;  3VI7 A;  2C0E A;  2VL9 A;  3FZ4 A;  1TDI A;  3BCI A;  1TTZ A;  2VAF A;  2K8V A;  1XFL A;  3GYK A;  5FWG A;  1PN0 A;  2GLR A;  4HU7 A;  1SL2 B;  3P8W A;  4FYU A;  3ZFB A;  2EIO A;  2CV4 A;  1YZX A;  2H73 A;  3AY8 A;  2DML A;  2MMA A;  2F9S A;  2GZZ A;  1RW1 A;  2REM A;  4MPG A;  5KN3 A;  2M80 A;  5D93 A;  4K9Z A;  4GF0 A;  5LNK e;  16GS A;  1SYX A;  3I43 A;  3GKX A;  1YKA A;  4ZBA A;  3GNJ A;  3U6V A;  5KEJ A;  3N5O A;  4RI7 A;  3QAW A;  1GRX A;  2WB9 A;  4OO4 A;  2HI7 A;  2CZ2 A;  2VM1 A;  1SK2 A;  1YDK A;  4ECI A;  3R2Q A;  2KUC A;  6GSX A;  3APQ A;  4IP1 A;  4K0G A;  1ERV A;  2J9H A;  3CSI A;  2AUV A;  4OD7 A;  3VPQ A;  3W8J A;  5D9W A;  3EIN A;  3HZ8 A;  5HR2 A;  3GTU A;  3LQ7 A;  2H0H A;  4NPB A;  2DJ3 A;  1K3O A;  1WP0 A;  4GWR A;  5DAK A;  5IIZ A;  3GIX A;  2CAQ A;  1B4P A;  1TU8 A;  2LJK A;  4N10 A;  3DVW A;  4LMV A;  12GS A;  2FWF A;  2LTK A;  3TRP A;  2XBI A;  1U3A A;  2OBI A;  4ZL9 A;  4I2U A;  3KGK A;  4FQU A;  2V32 A;  5H5S A;  3F0I A;  1XBS A;  3TJF A;  4BA7 A;  4TKY A;  1GUH A;  2CVD A;  4XS1 A;  2VL3 A;  4BL7 B;  1TW9 A;  2FA4 A;  2E0Q A;  1SJ6 A;  3D5J A;  2H0I A;  2WUL A;  2AAW A;  1SL1 B;  4MNN A;  3PGT A;  4ULX A;  4O5R A;  3D4T A;  4GSS A;  2A2R A;  3P2A A;  1ZYN A;  3US3 A;  1YJ6 A;  2OAD A;  2IWT A;  1O81 A;  3MAK A;  22GS A;  2ZUP A;  2OA7 A;  1HQO A;  4BVX A;  3FYG A;  2I9H A;  2YN1 A;  3GN3 A;  3TJB A;  1I5G A;  1W4V A;  3UIW A;  2G2Q A;  3GKN A;  5HFK A;  1J08 A;  4TRX A;  1TKD B;  3DXB A;  3G7J A;  3I69 A;  3FW2 A;  3P90 A;  3GH9 A;  1QUW A;  4TXO B;  2BTO T;  4HQS A;  3O3T A;  4DSR A;  19GS A;  2K8S A;  2VLV A;  5ECS A;  5CRG A;  2DJK A;  2ES7 A;  2XPD A;  3FZ9 A;  2OJL A;  4CDO A;  1FHE A;  4CY6 A;  4TR1 B;  5BRT A;  1S3C A;  2V2G A;  4NV2 A;  1MEK A;  2IMI A;  3C71 A;  1QQ2 A;  2VCW A;  2NVL A;  2HE3 A;  1PRX A;  2MBT A;  3E3E A;  4KGI A;  3UBK A;  3F63 A;  4KF9 A;  4XRD A;  4DSS A;  3LFL A;  1A2L A;  1Z5Y E;  3BOA A;  2O85 A;  3QFB C;  1PSQ A;  1VRS D;  1T4Y A;  2VCV A;  3QD9 A;  1K0C A;  3MYD A;  5H5R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...