1BJXA

Human protein disulfide isomerase, nmr, 24 structures
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
110
structure length
110
Chain Sequence
AATTLPDGAAAESLVESSEVAVIGFFKDVESDSAKQFLQAAEAIDDIPFGITSNSDVFSKYQLDKDGVVLFKKFDEGRNNFEGEVTKENLLDFIKHNQLPLVIEFTEQTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROTEIN DISULFIDE ISOMERASE
publication title The structure in solution of the b domain of protein disulfide isomerase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Electron transport
total genus 19
structure length 110
sequence length 110
ec nomenclature ec 5.3.4.1: Protein disulfide-isomerase.
pdb deposition date 1998-06-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1bjxA00
2GSQA 4MJCA 2LS5A 4L5OA 1EOHA 2H75A 2VM2A 1GSEA 2CA8A 2WS2A 1THOA 4ZBBA 3I9V2 3TDGA 2EIRA 4HUAA 1YY7A 3CBUA 5GSSA 4PURA 3M0FA 4IVFA 3GKXA 4ZL8A 4G10A 1ZL9A 3RDWA 2ZNMA 2DSAA 3KD0A 1PGTA 2VCVA 3VI7A 4V2LA 1MDKA 5JWRB 3MNGA 3TCOA 1G6WA 1T00A 5H5QA 4HU9A 2P31A 2M46A 5ECMB 4L8EA 5G1KA 3O3TA 2GVPA 1YEXA 2X99A 1FW1A 1TW9A 3UMAA 1K0NA 5LD0A 4GCIA 1SYRA 5JCUA 1K0OA 2MMAA 3F3QA 1ERTA 1FVJA 5IIZA 3ZVJD 4EXJA 3IHQA 2AJQB 4KSOA 2C3NA 3ZMLA 4WEYA 3ZLPA 2DJJA 4YH2A 4NXIA 2YCDA 2B6MA 4ZBDA 2GLRA 1RK4A 2HSYA 5J4UA 3HDCA 1O8WA 1U3AA 4QQ7A 3IOSA 2WCIA 1ZOFA 5J9BA 3GV1A 1A2MA 3F6FA 4N0ZA 1FVKA 18GSA 2VAFA 4ZXGA 4RQRA 4GSTA 1PL1A 1WWJA 3IA1A 1DE2A 4YQMA 6GSXA 2H19A 3U5RE 1QQ2A 2F9SA 5ABRA 2DJKA 3UL3A 1KBNA 12GSA 1PX7A 3GRXA 3TKPA 4AJ6A 4MABA 2H6ZA 1YKAA 5DDLA 3M9JA 3UBLA 4BWQA 2LJRA 1AW9A 2HRFA 2Z9SA 1GNEA 3ZMKA 2YWMA 4MDCA 5KEJA 2RLIA 3ZITA 3KIJA 3VWXA 2N5BA 1PN9A 4NV2A 3U6VA 4HZ4A 1FOVA 1VF3A 4RI7A 3WGDA 5J41A 1ERVA 1TU8A 2LRTA 3ERGA 5DQYA 2FD3A 3L9VA 5JWQB 4DSQA 2VD1A 5AN1A 2MYGA 1SJZA 3O76A 4XIHA 2HE3A 3I69A 2HZEB 4F9ZA 3DEXA 3SWLA 2MBTA 4POLA 4GXZA 2VCXA 1OYJA 4KE3A 1MDJA 1F2EA 17GSA 2NTOA 2H1DA 1TU7A 4RUVA 1BAYA 4GLTA 4K8MA 8GSSA 2YP6A 3GKKA 3KMOA 3HZ4A 3D4TA 4MPFA 4JRRA 5J3RA 3CXGA 5ECRB 6GSVA 2GSTA 3G7YA 1A2LA 3TUEA 5HR2A 1IYHA 3IK9A 2HNLA 2C1YA 1HD2A 3BD2A 3D21A 2HT9A 2VLTA 1G7EA 1N8JA 3ZFBA 4ZIJA 4ECCA 2CVKA 5J9CA 3F9UA 2B3SA 2C0GA 2L4QA 3CTGA 4X43A 1LU4A 2R5GA 3AY8A 3A2XA 3C71A 1WOUA 2FUG2 2OE1A 1GLPA 4ML6A 1KTEA 2DMMA 1WJKA 2YWOA 4IQ1A 13GSA 4D73B 5ECPB 3MWHA 4K9ZA 2FWEA 1E6BA 3FRCA 1KNGA 4K2DA 2MMOA 2GZZA 1XFLA 3A3TA 3K8NA 4IBPA 3PR8A 1EWXA 1PMTA 3BJ5A 3D0ZA 2GZYA 2FWHA 2VL2A 4QL7A 1SJIA 1SKRB 4XRDA 4IN0A 2I4AA 3RBTA 1EEJA 3US3A 2XBIA 4AJ7A 1GNWA 4J2FA 3G7IA 4EC0A 2VLVA 3GN3A 4EL1A 2L5LA 5IQYA 1EP8A 4KH7A 1THXA 1OVNA 3GURA 2O85A 1XWBA 1O85A 1C72A 1F3AA 2WB9A 2AUVA 5CO3A 5LNKe 2HZEA 2GSRA 4PGTA 3WGXA 2JZTA 19GSA 1EV9A 3D5JA 3PH9A 1JZDA 1ILOA 1M2BA 1OKDA 1A8LA 5F06A 2C80A 1H75A 2RUFA 2CZ3A 5EPFA 2R3XA 5G2ZA 2GTUA 2FGXA 3KTBA 4YAPA 1TXXA 3FR3A 2HXKA 2O89A 3DWVA 3KMNA 5COHA 1GUHA 2F51A 5DQSA 5A4VA 4MP4A 4IP6A 1DSBA 5GAPD 5A4UA 1FO5A 5H5SA 3L4NA 1GSFA 2RUEA 2AB6A 2LNSA 2V32A 1J9BA 1WPIA 2H8LA 2OJLA 3P90A 3LWAA 1U3IA 1MEKA 3IBHA 2C3QA 4MF7A 4OWYA 2NBSA 1F37A 2CX3A 1QXHA 3KJYA 1F6MC 1PRXA 3TRQA 5JCGA 3KP9A 3PGTA 1GLQA 2VUPA 3JCML 2LKUA 1OE8A 3UARA 4D73A 1AIUA 1Z7RA 2DIYA 1V57A 20GSA 1A0RP 2WJUA 1SYXA 4X0XA 1DE1A 1GSYA 4PQIA 1QFNA 3J7Yk 4EF0A 6GSWA 4ULXA 2IMDA 3TJJA 2ZUPA 4GQFA 5D9VA 2CAQA 1ON4A 2JZSA 1V58A 2DC5A 3TKQA 1Q98A 2LEGA 4ZL9A 4POKA 5IMAA 5G5EA 4ZILA 3ZRDA 3KGKA 1GTBA 3PINA 4CW9A 4K0GA 1JZRA 5HR1A 3FEUA 2WZ9A 1AQWA 3L78A 1I9DA 1TI3A 1T4YA 5D9TA 5CRDA 3C8EA 3EWLA 2QC7A 3Q74A 2LSTA 3HVSA 10GSA 5C00A 3F3RA 3P7XA 4PUAA 4K7OA 5D9XA 1XPVA 2L6CA 3SBCA 11GSA 4TW5A 3WGEA 2H70A 2J23A 3ZZXA 2DLXA 3F0IA 2MMZA 2ON7A 5CP1A 3DVWA 2OBKA 1VF4A 1JLWA 4BVYA 2YV7A 1XOAA 3DVXA 2CX4A 2YNXA 3BCKA 1Z7PA 3E9JB 4EDZA 2TRCP 1YQ1A 3EURA 1XWCA 5KN3A 4YQUA 4OD7A 3LFLA 5ECNB 22GSA 4KCEA 3TGZA 2X8CA 3ZIVA 5KN1A 3R2QA 3LQ7A 4TN8A 3TJBA 1TP9A 2PWJA 2GT6A 3DRNA 5EY6A 2V6KA 3N5OA 5GSTA 1OC3A 4KX4A 1TK8B 3IR4A 1Z5YE 5KN2A 1M0UA 3UBKA 1A24A 3M9KA 4I6XA 3P8WA 5FHIA 2LRNA 2FNOA 2DJ1A 1SK2A 4AF2A 5INYA 2J9HA 2NVLA 2A2RA 5CNWA 1MD4A 4MK3A 3ZTLA 3M8NA 1X9WB 1EZKA 3V1WA 2L59A 3DGQA 5G30A 2JADA 1TI1A 2B7KA 2AV4A 3EMXA 3A5WA 4HI7A 1BX9A 5ECLB 5ECOB 4IJIA 5ECHB 5F05A 5GAND 3FHKA 2K9FA 3Q18A 5HR0A 1HQOA 1TRUA 2H0GA 4OCEA 3HCZA 4LMVA 1ZZYA 1SL2B 2L57A 2RIIA 1GSQA 1Q4JA 3QAVA 4Q5FA 2YOIA 2QGVA 1YF1A 3GX0A 3UVHA 4KW6A 3VWWA 1NW2A 1M9BA 1GRXA 1HNBA 3CRUA 4EE0A 3FKFA 4LMWA 1XOBA 3ZVJA 2VIMA 3GL5A 4F03A 1GL8A 3UIWA 1SENA 4F0CA 2CZ2A 4DSSA 1AC1A 2MMNA 2H01A 3WYWA 1GSSA 2I1UA 1A2JA 5AIXA 1IYIA 4MZCA 4JBBA 4WETA 2OACA 2FWFA 1O81A 3Q6OA 5L71A 1YDKA 4FIWA 4CDOA 5F07A 1XW5A 3MSZA 4FO5A 3FR6A 2XPEA 3DMLA 2H66A 5AISA 1X5DA 3H93A 5E59A 3GMFA 4FYCA 3IE3A 4P3YB 1FAAA 2I9HA 1K3OA 5IPHA 3FYGA 2G0FA 2YN1A 1U88A 3GKMA 2H30A 5G5FA 2M72A 4LL1B 4MLYA 4KDYA 3CTFA 4JEDA 1TTZA 2PERA 3FY7A 1GULA 3TKRA 4HJMA 4ECIA 4J56E 2E2MA 4ECBA 1JLVA 6GSYA 3MAKA 3GFKA 1TOFA 4KDUA 2AAWA 1QK8A 4F0BA 2CVDA 2B5EA 2O7KA 1T8EB 3VPQA 3CMIA 3IAM2 1PKZA 5HQPA 1HYUA 4V2NA 3HD5A 1QMVA 2F8AA 4K7NA 3KP8A 1TDIA 3IXRA 3QMXA 3APQA 2AYTA 4MF5A 4FH8A 1SKSB 1K0AA 2HZFA 2H74A 5ECQB 1X0RA 2C0FA 2DIZA 2XHFA 2B1KA 2DBCA 2AHEA 4GTUA 2VL2C 4I8BA 4V1Ag 3LYPA 4H86A 1DBYA 3FR9A 4N10A 6GSSA 2QKEA 1O73A 4K0NA 4HEA2 2C4JA 4MZWA 1R5AA 2RM5A 4MMMA 1M9AA 4XS4B 1Y25A 5CRGA 3WT1A 3LXTA 3ZFLA 3TJFA 5IM9A 1GH2A 2P5QA 3GSSA 1F9MA 2GGTA 1EGRA 2DJ2A 2IJYA 4V1Ap 1HNCA 5A5KA 1N2AA 3ERFA 4IJ3A 1PSQA 4OFTA 7GSSA 4KDXA 3D4MA 3DIEA 1S3CA 3QFAC 4PX1A 4WBJA 1B9XC 2B5XA 4KB3A 1R26A 3EYTA 2EIOA 3ZYWA 2H1BA 1RQMA 3KEBA 2OE0A 4BWSA 2IMFA 2P0GA 4MJBA 3S9FA 2C0EA 2LUSA 2X8GA 3ZL5A 2TRXA 2V41A 3ME8A 1AQXA 2PN8A 5B8AA 1YJ6A 1W4VA 3ERWA 1XWAA 4Q5NA 4TR3A 4I97A 1U87A 4TRXA 1RW1A 1NHYA 3KM6A 4IGJA 1Z6MA 3LGCA 3EMPA 3EVIA 1U6TA 4E8EA 5D9WA 4TR1A 4K7IA 4HJ2A 3LG6A 1R7HA 4GSSA 1PX6A 2OBIA 1AQVA 4KGIA 3TKSA 3LEFA 4WF5A 3QR6A 2O87A 4BA7A 2HLSA 2R4VA 4PNFA 4JR4A 1MD3A 4G9HA 1ERWA 1V98A 4NHZA 2B5YA 3I43A 2VL3A 2HSHA 1EOGA 1M99A 4MH3A 1XVQA 5HR3A 5DALA 1UN2A 4O5RA 3L9SA 4JR6A 2HYXA 2KHPA 5JCWA 5IO0A 5E4WA 4JU5A 1WE0A 4O32A 3IK7A 4EUYA 3IPZA 3FW2A 5G31A 5J5NA 1VF1A 3TOTA 1G6YA 2I3YA 4GRFA 1ML6A 2LRCA 3APOA 4PNGA 4XS4A 4NWYA 2YJ7A 5B6MA 5C04A 5B7CA 1T1VA 2H0HA 1B9YC 3WT2A 3VWUA 3G7JA 1B8XA 4NHWA 1WMJA 5B6NA 1FG4A 1B4QA 1EGOA 3HA9A 4MA9A 4XTSA 5IMDA 4KUNA 1FHEA 2FA4A 3GUSA 3F4TA 4K6XA 2NPBA 1T4ZA 2IWTA 2KP1A 3QPMA 2E0QA 2M80A 1XIYA 2PUKC 2R37A 4KAEA 5IMCA 4FYUA 2VD0A 4DVCA 1TK0B 4KSMA 2N5FA 1XBSA 3GTUA 5DJLA 1VGLA 3TJKA 5HFIA 4QL9A 3NZNA 3VPTA 2XPDA 4G19A 3KH9A 1K0MA 4ZB9A 3HHVA 2PMTA 1TJDA 1EEMA 4Q5RA 5ECSA 1URMA 1M7TA 2JSYA 3QFBC 2WGRA 1G7OA 9GSSA 1GP1A 2YZHA 2OA7A 3GKNA 4N30A 1K3YA 3LSZA 1OE7A 5CREA 1SL0B 2XC2A 2IMIA 3D6IA 1PKWA 2F3MA 3GL3A 1R5PA 2IN3A 3HZ8A 3WD6A 3APSA 1XVWA 1OC9B 4MF6A 4DSSB 1J0FA 1E2YA 2YWIA 1SD9A 1M2DA 4HQSA 4AJ8A 1O8XA 5AGYA 5CAXA 3CSIA 4WKWA 3ED3A 3C1RA 3TRPA 1YZXA 2V2GA 1Y6EA 1B4PA 1A8YA 4TOPA 4PQHA 3QD9A 2IMKA 1ZMAA 3LXZA 3C73A 4JE1A 3E3EA 4HS1A 4ZB8A 4GWRA 3GSTA 2HRNA 2FCHA 1UC7A 4WF4A 3P2AA 4LL4B 1W89A 1YEPA 1AUCA 3F63A 3Q19A 4GF0A 2DJ0A 3HJMA 4OO4A 1SJ6A 5JWOB 1JZWA 2A2SA 2B1LA 3DD3A 4ML1A 2YJHA 3VFIA 3H4KA 2LV3A 1AXDA 1M2AA 1ZCPA 2MZCA 1FB6A 2H6YA 3FZAA 1QGVA 2O8VB 3HY2A 2PVQA 3HYPA 1TRWA 1GTAA 1S3DA 1A23A 2VCTA 2YPMA 1YKCA 4EKZA 2K8SA 5B8BA 3GA4A 4MJEA 1V2AA 16GSA 1X9MB 3IV4A 4XRAA 6GSTA 2ON5A 5H5RA 5ID2A 2L6DA 2VLUA 4I2TA 3RPNA 1JZOA 4TXOB 1H4OA 4ILFA 4TKYA 1GTIA 4XCSA 5F8BA 4HU7A 3TB2A 2FA8A 4BVXA 4PQ1A 1PA3A 2IL3A 2TIRA 5G1LA 2GS3A 3ME7A 4WBRD 1WRYA 2C8UA 3W8SA 3IRAA 4Q5QA 1NM3A 2JU5A 4F82A 3TRXA 3C1SA 1CQGA 2VO4A 3IDVA 1OC9A 4MZBA 4YQVA 14GSA 2K6VA 3VK9A 4F2IA 3C7MA 2LNTA 1MTCA 4AGSA 5IO2A 2JL4A 1FB0A 3HJPA 4ZB6A 3RHBA 3W8JA 2CT6A 2DMLA 3EE2A 4WR5A 3MDKA 2H72A 2V1MA 5FT3A 3RHCA 4BPYA 2ALBA 2IMEA 3RAZA 4HDEA 3M1GA 2JACA 3VLNA 1G0TA 2L5OA 5IMFA 4ZL7A 4HQZA 3H1NA 2XBQA 1ZYQB 1SK1A 1LBKA 4J57E 5LCZA 1OC8A 3KXOA 1X9SB 2E7PA 3OR5A 5ECKB 1UA5A 3QCPA 3N9JA 2ES7A 3O6TA 2VCQA 3HJOA 4TR1B 1EV4A 2OADA 2VCZA 5DAKA 5DCGA 4I5QA 1ERUA 4NAXA 4N0VA 4GQCA 1TK5B 1SK0A 2BTOT 2R2JA 2CVBA 2YANA 4IP1A 1OAZA 4TXOA 5DALB 2GZPA 4ID0A 2K18A 1BEDA 2LQOA 2F8FA 4IW9A 3GH6A 4X1UA 4ACSA 4GSNA 2GDRA 2HFDA 3FZ4A 1BJXA 1DUGA 3A2WA 1XWKA 1O7UA 1XCCA 2WRTA 4IS0A 2QSIA 1LJRA 3VURA 1PL2A 3GYKA 3DYRA 3L9UA 4IQAA 5ENUA 1GSDA 3UEMA 5CRHA 1B48A 4XHMA 5CRWA 3CSHA 4TR4A 1WIKA 2B7JA 3BBYA 5DJMA 3HVXA 3TKSC 4YAVA 5FWGA 1SL1B 3FZ5A 4HOJA 4L5LA 4DSRA 2PBJA 4N11A 1PQNA 3HKRA 1GTUA 3GX8A 2OKAA 3UVTA 2EIQA 2D2ZA 4Z7XA 2PGTA 5IOWA 1USBA 3M3MA 3A2VA 3GTUB 4ISDA 3LJRA 4WR4A 2YZUA 1J08A 1SU9A 1GWCA 2A4VA 3CYNA 4IHUA 2IFQB 2X64A 5F0GA 1ST9A 2V6OA 3FZ9A 2C3TA 4WXTA 1Z9HA 3F8UA 4TVEA 5KN0A 1QUWA 3TKSE 1CQHA 5EVOA 1AAZA 1ABAA 4XS6A 5IMVA 4RQXA 2JZRA 3GIXA 2OE3A 4FYBA 1ACVA 1TRSA 1GUKA 5IOXA 2X8HA 4TXVA 1NHOA 2FWGA 2CAIA 2H0IA 1V40A 2IIYA 2G2QA 4LA1A 2R6KA 1BQ7A 1NSWA 1VF2A 4MPGA 1Z3EA 1HNAA 4OFMA 2PVOC 4OMVA 1A0FA 3F6DA 3HXSA 3FK8A 4OCFA 4EVMA 2C0DA 5HFKA 4BL7A 2LTKA 1R4WA 2REMA 3DXBA 2L4CA 3TOUA 3GHAA 2GQMA 1TKDB 1T3BA 2N5AA 3BOAA 2E2GA 3TJGA 1O6JA 4I2UA 3ISOA 5ECIB 2LJAA 3HVVA 3UOMA 4L0WA 6GSUA 2GQLA 2VCWA 1PD21 3D22A 4PXOA 2MBSA 4TR0A 4HZ2A 3QDNA 2YWNA 4LLRA 2I81A 5AIVA 3EC3A 1UVZA 3KCMA 4RI6A 3IAS2 4ECJA 4POBA 2NDOA 2LJKA 1ZGNA 1VRSD 2RM6A 3F4RA 4G2EA 1JFUA 2ZCTA 5D96A 1XW6A 5ELGA 1XW9A 1K0BA 3GNJA 1V9WA 2KOKA 2GQKA 4IKHA 2BJXA 1X5EA 3H79A 1EP7A 3KZQA 1X5CA 5D73A 4JZQA 1ZYEA 4XS1A 1BG5A 4K1FA 4EO3A 3UJ1A 1K0CA 2IFQA 5ID2B 4OFNA 1XWGA 3NIVA 1BYEA 1I5GA 2H1GA 4KNDA 2H76A 3W6GA 2EC4A 4O7HA 3DKSA 2CQ9A 5GZZB 4IELA 4KA0A 1TRVA 1GUMA 3CSJA 4NV5A 3J7Yb 1GSUA 3KH7A 1K0DA 2H1AA 2WDUA 1YF0A 3H8QA 1JHBA 2FHEA 1F3BA 2PPTA 2HI7A 2IPAA 3KTLA 4L0UA 4EDYA 3ZIJA 2FLSA 3RPPA 4O92A 3UAPA 1T7PB 1XXUA 2GSSA 1K3LA 2K8VA 4V2MA 3LORA 4CHSA 3GH9A 1OKTA 5HFGA 3QAWA 4E8HA 2VOCA 3I6AA 4OO5A 3ZREA 3QOUA 2WULA 5D8IA 1S3AA 2JSZA 3EU4A 2H71A 1Z6NA 4PUFC 2KP2A 3EINA 4NPBA 3LYKA 2GT5A 2PU9C 3QAGA 1SKWB 5DVBA 2VL9A 5EL8A 1WP0A 3G9BA 1XZOA 2KUCA 2VM1A 5ELAA 2CV4A 5D93A 1KEBA 4MCUA 4ZBAA 2WFCA 3NOFA 5IMZA 2H6XA 3BCIA 3L0HA 2H73A 3E0UA 2YV9A 1MDIA 4NMUA 3EU3A 1SD8A 2KLXA 3IC4A 4DEJA 5CYYA 2P5RA 3F4SA 4POMA 5IPGA 2BMXA 2DJ3A 3VWVA 5DAKB 4MH2A 3VI5A 5A4WA 4MJAA 5DCHA 2LQQA 2FY6A 4KCAA 5DBQA 3CRTA
chains in the Genus database with same CATH superfamily
2GSQA 4MJCA 2LS5A 4L5OA 1EOHA 2H75A 2VM2A 1GSEA 2CA8A 2WS2A 1THOA 4ZBBA 3I9V2 3TDGA 2EIRA 4HUAA 1YY7A 3CBUA 5GSSA 4PURA 3M0FA 4IVFA 3GKXA 4ZL8A 4G10A 1ZL9A 3RDWA 2ZNMA 2DSAA 3KD0A 4PTSA 1PGTA 2VCVA 3VI7A 4V2LA 1MDKA 5JWRB 3MNGA 3TCOA 1G6WA 1T00A 5H5QA 4HU9A 2P31A 2M46A 5ECMB 4L8EA 5G1KA 3O3TA 2GVPA 1YEXA 2X99A 1FW1A 1TW9A 3UMAA 1K0NA 5LD0A 4GCIA 1SYRA 5JCUA 1K0OA 2MMAA 3F3QA 1ERTA 1FVJA 5IIZA 3ZVJD 4EXJA 3IHQA 2AJQB 4KSOA 2C3NA 3ZMLA 4WEYA 3ZLPA 2DJJA 4YH2A 4NXIA 2YCDA 2B6MA 4ZBDA 2GLRA 1RK4A 2HSYA 5J4UA 3HDCA 1O8WA 1U3AA 4QQ7A 3IOSA 2WCIA 1ZOFA 5J9BA 3GV1A 1A2MA 3F6FA 4N0ZA 1FVKA 18GSA 2VAFA 4ZXGA 4RQRA 4GSTA 1PL1A 1WWJA 3IA1A 1DE2A 4YQMA 6GSXA 2H19A 1S3RA 3U5RE 1QQ2A 2F9SA 4HSCX 5ABRA 2DJKA 3UL3A 1KBNA 12GSA 1PX7A 3GRXA 3TKPA 4AJ6A 4MABA 2H6ZA 1YKAA 5DDLA 3M9JA 3UBLA 4BWQA 2DKHA 2LJRA 1AW9A 2HRFA 2Z9SA 1GNEA 3ZMKA 2YWMA 4MDCA 5KEJA 2RLIA 3ZITA 3KIJA 3VWXA 2N5BA 1PN9A 4NV2A 3U6VA 4HZ4A 1FOVA 1VF3A 4RI7A 3WGDA 5J41A 1ERVA 1TU8A 2LRTA 3ERGA 5DQYA 2FD3A 3L9VA 5JWQB 4DSQA 2VD1A 5AN1A 2MYGA 1SJZA 3O76A 4XIHA 2HE3A 3I69A 2HZEB 4F9ZA 3DEXA 3SWLA 2MBTA 4POLA 4GXZA 2VCXA 1OYJA 4KE3A 1MDJA 1F2EA 17GSA 2NTOA 4BL7B 2H1DA 1TU7A 4RUVA 1BAYA 4GLTA 4K8MA 8GSSA 2YP6A 3GKKA 3KMOA 3HZ4A 3D4TA 4MPFA 4JRRA 5J3RA 4YKGA 3CXGA 5ECRB 6GSVA 2GSTA 3G7YA 1A2LA 3TUEA 5HR2A 1IYHA 3IK9A 2HNLA 2C1YA 1HD2A 3BD2A 3D21A 2HT9A 2VLTA 1G7EA 1N8JA 3ZFBA 4ZIJA 4ECCA 2CVKA 5J9CA 3F9UA 2B3SA 2C0GA 2L4QA 3CTGA 4X43A 1LU4A 2R5GA 3AY8A 3A2XA 3C71A 1WOUA 2FUG2 2OE1A 1GLPA 4ML6A 1KTEA 2DMMA 1WJKA 2YWOA 4IQ1A 13GSA 4D73B 5ECPB 3MWHA 4K9ZA 2FWEA 1E6BA 3FRCA 1KNGA 4K2DA 2MMOA 2GZZA 1XFLA 3A3TA 3K8NA 4IBPA 3PR8A 1EWXA 1PMTA 3BJ5A 3D0ZA 3FMWA 2GZYA 2FWHA 2VL2A 4QL7A 1SJIA 1SKRB 4XRDA 4IN0A 2I4AA 3RBTA 1EEJA 3US3A 2XBIA 4AJ7A 1GNWA 4J2FA 3G7IA 4EC0A 2VLVA 3GN3A 4EL1A 2L5LA 5IQYA 1EP8A 4KH7A 1THXA 1OVNA 3GURA 2O85A 1XWBA 1O85A 1C72A 1F3AA 2WB9A 2AUVA 5CO3A 5LNKe 2HZEA 2GSRA 4PGTA 3WGXA 2JZTA 19GSA 1EV9A 3D5JA 3PH9A 1JZDA 1ILOA 1M2BA 1OKDA 1A8LA 5F06A 2C80A 1H75A 2RUFA 2CZ3A 5EPFA 2R3XA 5G2ZA 2GTUA 2FGXA 3MIXA 3KTBA 1FOHA 4YAPA 1TXXA 3FR3A 2HXKA 2O89A 3DWVA 3KMNA 5COHA 5BRTA 1GUHA 2F51A 5DQSA 5A4VA 4MP4A 4IP6A 1DSBA 5GAPD 5A4UA 1FO5A 5H5SA 3L4NA 1GSFA 2RUEA 2AB6A 2LNSA 2V32A 1J9BA 1WPIA 2H8LA 2OJLA 3P90A 3LWAA 1U3IA 1MEKA 3IBHA 2C3QA 4MF7A 4OWYA 2NBSA 1F37A 2CX3A 1QXHA 3KJYA 1F6MC 1PRXA 3TRQA 5JCGA 3KP9A 3PGTA 1GLQA 2VUPA 3JCML 2LKUA 1OE8A 3UARA 4D73A 1AIUA 4CY8A 1Z7RA 2DIYA 1V57A 20GSA 1A0RP 2WJUA 1SYXA 4X0XA 1DE1A 1GSYA 4PQIA 1QFNA 3J7Yk 4MNNA 4EF0A 6GSWA 4ULXA 2IMDA 3TJJA 2ZUPA 2A2PA 4GQFA 5D9VA 2CAQA 1ON4A 2JZSA 1V58A 2DC5A 3TKQA 1Q98A 2LEGA 4ZL9A 4POKA 5IMAA 5G5EA 4ZILA 3ZRDA 3KGKA 1GTBA 3PINA 4CW9A 4K0GA 1JZRA 5HR1A 3FEUA 2WZ9A 1AQWA 3L78A 1I9DA 1TI3A 1T4YA 5D9TA 5CRDA 3C8EA 3EWLA 2QC7A 3Q74A 2LSTA 3HVSA 10GSA 2HSMA 5C00A 3F3RA 3P7XA 4PUAA 4K7OA 5D9XA 1XPVA 2L6CA 3SBCA 11GSA 4TW5A 3WGEA 2H70A 2J23A 3ZZXA 2DLXA 3F0IA 3IC8A 2MMZA 2ON7A 5CP1A 3DVWA 2OBKA 1VF4A 1JLWA 4BVYA 2YV7A 1XOAA 3DVXA 2CX4A 2X4AA 2YNXA 2DKIA 3BCKA 1Z7PA 3E9JB 4EDZA 2TRCP 1PFOA 1YQ1A 3EURA 1XWCA 5KN3A 4YQUA 4OD7A 3LFLA 22GSA 4KCEA 5ECNB 3TGZA 2X8CA 3ZIVA 5BMUA 5KN1A 3R2QA 3LQ7A 4TN8A 3TJBA 1TP9A 2HRKA 2PWJA 2GT6A 3DRNA 5EY6A 2V6KA 3N5OA 5GSTA 1OC3A 4KX4A 1TK8B 3IR4A 1Z5YE 5KN2A 1M0UA 3UBKA 1A24A 3M9KA 4I6XA 3P8WA 5FHIA 2LRNA 2FNOA 2DJ1A 1SK2A 4AF2A 5INYA 2J9HA 2NVLA 2A2RA 5CNWA 1MD4A 4MK3A 3ZTLA 3M8NA 1X9WB 1EZKA 3V1WA 2L59A 4G0KA 3DGQA 5G30A 2JADA 1TI1A 2B7KA 2AV4A 3EMXA 3A5WA 4HI7A 1BX9A 5ECLB 4G0LA 5ECOB 4IJIA 5ECHB 5F05A 5GAND 3FHKA 2K9FA 3Q18A 5HR0A 1HQOA 1TRUA 2H0GA 4OCEA 3HCZA 4LMVA 1ZZYA 1SL2B 2L57A 2RIIA 1GSQA 1Q4JA 3QAVA 4Q5FA 2YOIA 2QGVA 1YF1A 3GX0A 3UVHA 4KW6A 3VWWA 1NW2A 1M9BA 1GRXA 1HNBA 3CRUA 4EE0A 3FKFA 4LMWA 1XOBA 3ZVJA 2VIMA 3GL5A 4F03A 1GL8A 3UIWA 1SENA 4F0CA 2CZ2A 4DSSA 1AC1A 2MMNA 2H01A 3WYWA 1GSSA 2I1UA 1A2JA 5AIXA 1IYIA 4MZCA 4JBBA 4WETA 2OACA 2FWFA 1O81A 3Q6OA 5L71A 1YDKA 4FIWA 4CDOA 5F07A 1XW5A 3MSZA 4FO5A 3FR6A 2XPEA 3DMLA 2H66A 5AISA 1X5DA 3H93A 5E59A 2R0GA 3GMFA 4FYCA 3IE3A 4P3YB 4KF9A 1FAAA 2I9HA 1K3OA 5IPHA 3FYGA 2G0FA 2YN1A 1U88A 3GKMA 2H30A 5G5FA 2M72A 4LL1B 4MLYA 4KDYA 3CTFA 4JEDA 1TTZA 2PERA 3FY7A 1GULA 3TKRA 4HJMA 4ECIA 4J56E 4YKFA 2E2MA 4ECBA 1JLVA 6GSYA 3MAKA 3GFKA 1TOFA 4KDUA 2AAWA 1QK8A 4F0BA 2CVDA 4BIKA 2B5EA 2O7KA 1T8EB 3VPQA 3CMIA 3IAM2 1PKZA 5HQPA 3IHGA 1HYUA 4Z2RA 4V2NA 3HD5A 1QMVA 2F8AA 4K7NA 3KP8A 1TDIA 3IXRA 3QMXA 3APQA 2AYTA 4MF5A 4FH8A 1SKSB 1K0AA 2HZFA 2H74A 5ECQB 5KOWA 1X0RA 2C0FA 2DIZA 2XHFA 2B1KA 2DBCA 2AHEA 4GTUA 2VL2C 4I8BA 4V1Ag 3LYPA 4H86A 1DBYA 3FR9A 3EPTA 4N10A 6GSSA 2QKEA 1O73A 4K0NA 4HEA2 2C4JA 4MZWA 1R5AA 2RM5A 4MMMA 1M9AA 4XS4B 1Y25A 5CRGA 3WT1A 3LXTA 3ZFLA 3TJFA 5IM9A 1GH2A 2P5QA 3GSSA 1F9MA 2GGTA 1EGRA 2DJ2A 2IJYA 4V1Ap 2X49A 1HNCA 5A5KA 1N2AA 3ERFA 4IJ3A 1PSQA 4OFTA 7GSSA 4KDXA 3D4MA 3DIEA 1S3CA 1M3IA 3QFAC 4PX1A 4WBJA 1B9XC 2B5XA 4KB3A 1R26A 3EYTA 2EIOA 3ZYWA 2H1BA 1RQMA 3KEBA 2OE0A 4BWSA 2IMFA 2P0GA 2A4HA 4MJBA 3S9FA 2C0EA 2LUSA 2X8GA 3ZL5A 2TRXA 2V41A 3ME8A 1AQXA 2PN8A 5B8AA 1YJ6A 1W4VA 3ERWA 1XWAA 4Q5NA 4TR3A 4I97A 1U87A 4TRXA 1RW1A 1NHYA 3KM6A 4IGJA 1ZYNA 1Z6MA 3LGCA 3EMPA 1M3JA 3EVIA 1U6TA 4E8EA 5D9WA 4TR1A 4K7IA 4HJ2A 3LG6A 1R7HA 4GSSA 1PX6A 2OBIA 1AQVA 4KGIA 3TKSA 3LEFA 4WF5A 3QR6A 2O87A 4BA7A 2HLSA 2R4VA 4A5PA 4PNFA 4JR4A 1MD3A 4G9HA 1ERWA 1V98A 4NHZA 2B5YA 3I43A 2VL3A 4BVYB 2HSHA 1EOGA 1M99A 4MH3A 1XVQA 5HR3A 5DALA 1UN2A 4O5RA 3L9SA 4EIPA 4JR6A 2HYXA 2KHPA 2HRAA 5JCWA 5IO0A 5E4WA 4JU5A 1WE0A 4O32A 3IK7A 4EUYA 3IPZA 3FW2A 5G31A 5J5NA 1VF1A 1XG8A 3TOTA 1G6YA 2I3YA 4GRFA 1ML6A 2LRCA 3APOA 4PNGA 4XS4A 4NWYA 2YJ7A 5B6MA 5C04A 5B7CA 1T1VA 2H0HA 1B9YC 3WT2A 3VWUA 3G7JA 1B8XA 4NHWA 1WMJA 5B6NA 1FG4A 1B4QA 1EGOA 3HA9A 4MA9A 4XTSA 5IMDA 4KUNA 1FHEA 2FA4A 3GUSA 3F4TA 4K6XA 2NPBA 1T4ZA 2IWTA 2KP1A 3QPMA 2E0QA 2M80A 1XIYA 2PUKC 2R37A 4KAEA 4Z2UA 5IMCA 4FYUA 2VD0A 4DVCA 1TK0B 4KSMA 2N5FA 1XBSA 3GTUA 5DJLA 1VGLA 3TJKA 5HFIA 4QL9A 3NZNA 3VPTA 2XPDA 4G19A 3KH9A 1K0MA 4ZB9A 3HHVA 2PMTA 1TJDA 1EEMA 4Q5RA 4BVXB 5ECSA 1URMA 1M7TA 2JSYA 3QFBC 2WGRA 1G7OA 9GSSA 1GP1A 2YZHA 2OA7A 3GKNA 4N30A 1K3YA 3LSZA 1OE7A 5CREA 1SL0B 2XC2A 2IMIA 3D6IA 1PKWA 2F3MA 3GL3A 1R5PA 2IN3A 3HZ8A 3WD6A 3APSA 1XVWA 1OC9B 4MF6A 4DSSB 1J0FA 1E2YA 2YWIA 1SD9A 4EIQA 1M2DA 4HQSA 4AJ8A 1O8XA 5AGYA 4USSA 5CAXA 3CSIA 4WKWA 3ED3A 3C1RA 3TRPA 1YZXA 2V2GA 1Y6EA 1B4PA 1A8YA 4FQUA 4TOPA 4PQHA 3QD9A 2IMKA 1ZMAA 3LXZA 3R3EA 3C73A 4JE1A 3E3EA 4HS1A 4ZB8A 3PPUA 4GWRA 3GSTA 2HRNA 2FCHA 1UC7A 4WF4A 3P2AA 4LL4B 1W89A 1YEPA 1AUCA 3F63A 3Q19A 4GF0A 2DJ0A 3HJMA 4OO4A 1SJ6A 5JWOB 1JZWA 2A2SA 2B1LA 3DD3A 4ML1A 2YJHA 3VFIA 3H4KA 2LV3A 1AXDA 1M2AA 1ZCPA 2MZCA 1FB6A 2H6YA 3FZAA 1QGVA 2O8VB 3HY2A 2PVQA 3HYPA 1TRWA 1GTAA 1S3DA 1A23A 2VCTA 3HVNA 2YPMA 1YKCA 4EKZA 2K8SA 5B8BA 3GA4A 4MJEA 1V2AA 16GSA 1X9MB 3IV4A 4XRAA 6GSTA 2ON5A 5H5RA 5ID2A 2L6DA 2VLUA 4I2TA 2UZ8A 3RPNA 1JZOA 4TXOB 1H4OA 4ILFA 4TKYA 1GTIA 4XCSA 5F8BA 4HU7A 3TB2A 2FA8A 4BVXA 4PQ1A 1PA3A 2IL3A 2TIRA 5G1LA 2GS3A 3ME7A 4X4JA 4WBRD 1WRYA 2C8UA 3W8SA 4K2XA 3IRAA 4Q5QA 1NM3A 2JU5A 4F82A 3TRXA 3C1SA 1CQGA 2VO4A 3IDVA 1OC9A 4MZBA 4K5RA 4YQVA 14GSA 2K6VA 3VK9A 4F2IA 2R0PA 3C7MA 2LNTA 1MTCA 4AGSA 5IO2A 2JL4A 1FB0A 3HJPA 4ZB6A 3RHBA 3W8JA 2CT6A 2DMLA 3EE2A 4WR5A 3MDKA 2H72A 2V1MA 5FT3A 3RHCA 4BPYA 2ALBA 2IMEA 3RAZA 4HDEA 3M1GA 2JACA 3VLNA 1G0TA 2L5OA 5IMFA 4ZL7A 4HQZA 3H1NA 2XBQA 1ZYQB 1SK1A 1LBKA 4J57E 5LCZA 1OC8A 3KXOA 1X9SB 2E7PA 3OR5A 5ECKB 1UA5A 3QCPA 3N9JA 2ES7A 3O6TA 2VCQA 3HJOA 4TR1B 1EV4A 2OADA 4Z2TA 2VCZA 5DAKA 5DCGA 4I5QA 4O5QA 1ERUA 4NAXA 4N0VA 4GQCA 1TK5B 1SK0A 2BTOT 2R2JA 2CVBA 2YANA 4IP1A 1OAZA 3MYDA 4TXOA 5DALB 2GZPA 4ID0A 2K18A 1BEDA 2LQOA 2F8FA 4IW9A 3GH6A 4X1UA 4ACSA 2QA2A 4GSNA 1PN0A 2GDRA 2HFDA 3FZ4A 1BJXA 1DUGA 3A2WA 1XWKA 1O7UA 1XCCA 2WRTA 4IS0A 2QSIA 1LJRA 3VURA 1PL2A 3GYKA 3DYRA 3L9UA 4IQAA 5ENUA 1GSDA 3UEMA 5CRHA 1B48A 4XHMA 5CRWA 3CSHA 4TR4A 1WIKA 2B7JA 3BBYA 5DJMA 3HVXA 3TKSC 4YAVA 5FWGA 1SL1B 3FZ5A 4HOJA 4L5LA 4DSRA 2PBJA 4N11A 1PQNA 3HKRA 1GTUA 3GX8A 2OKAA 3UVTA 2EIQA 2D2ZA 4Z7XA 2PGTA 5IOWA 1USBA 3M3MA 3A2VA 3GTUB 4ISDA 3LJRA 4WR4A 2YZUA 1J08A 1SU9A 1GWCA 2A4VA 3CYNA 4IHUA 2IFQB 2X64A 3LW9A 5F0GA 1ST9A 2V6OA 3FZ9A 2C3TA 4WXTA 1Z9HA 3F8UA 4TVEA 5KN0A 1QUWA 3TKSE 1CQHA 1AAZA 1ABAA 4XS6A 5EVOA 5IMVA 4RQXA 2JZRA 3GIXA 2OE3A 4FYBA 1ACVA 1TRSA 1GUKA 5IOXA 2X8HA 4TXVA 1NHOA 2FWGA 2CAIA 2H0IA 1V40A 2IIYA 2G2QA 4LA1A 2R6KA 1BQ7A 1NSWA 1VF2A 4MPGA 1Z3EA 1HNAA 4OFMA 2PVOC 4OMVA 2R0CA 1A0FA 3F6DA 3HXSA 3FK8A 4OCFA 4EVMA 2C0DA 5HFKA 4BL7A 2LTKA 1R4WA 2REMA 3DXBA 2L4CA 3TOUA 3GHAA 2GQMA 1TKDB 1T3BA 2N5AA 3BOAA 2E2GA 3TJGA 1O6JA 4I2UA 3ISOA 5ECIB 2LJAA 3HVVA 3UOMA 4L0WA 6GSUA 2GQLA 2VCWA 1PD21 3D22A 4PXOA 2MBSA 4TR0A 4HZ2A 3QDNA 2YWNA 4LLRA 2I81A 5AIVA 3EC3A 1UVZA 3KCMA 4RI6A 3IAS2 4ECJA 4POBA 2NDOA 2LJKA 1ZGNA 1VRSD 2RM6A 3F4RA 4G2EA 1JFUA 2ZCTA 5D96A 1XW6A 5ELGA 1XW9A 1K0BA 3GNJA 1V9WA 2KOKA 2GQKA 4IKHA 2BJXA 1X5EA 3H79A 1EP7A 3KZQA 1X5CA 5D73A 4JZQA 1ZYEA 4XS1A 1BG5A 4K1FA 4EO3A 3UJ1A 1K0CA 3A5IA 2IFQA 5ID2B 4OFNA 1XWGA 3NIVA 1BYEA 1I5GA 2H1GA 4KNDA 2H76A 3W6GA 2EC4A 4O7HA 3DKSA 2CQ9A 5GZZB 4ICYA 4IELA 4KA0A 1TRVA 1GUMA 4O5UA 3CSJA 4NV5A 3J7Yb 1GSUA 3KH7A 1K0DA 2H1AA 2WDUA 1YF0A 3H8QA 1JHBA 2FHEA 1F3BA 2PPTA 2HI7A 2IPAA 4CY6A 4K5SA 3KTLA 4L0UA 4EDYA 3ZIJA 2FLSA 3RPPA 4O92A 3UAPA 1T7PB 1XXUA 2GSSA 1K3LA 2K8VA 4V2MA 3LORA 4CHSA 3GH9A 1OKTA 5HFGA 3QAWA 4E8HA 2VOCA 1ZYPA 4G0IA 3I6AA 4OO5A 3ZREA 3QOUA 2WULA 5D8IA 1S3AA 2JSZA 3EU4A 2H71A 1Z6NA 4PUFC 2KP2A 5KOXA 3EINA 4NPBA 3LYKA 2GT5A 2PU9C 3QAGA 1SKWB 5DVBA 2VL9A 5EL8A 1WP0A 3G9BA 1XZOA 2KUCA 2VM1A 2CV4A 5ELAA 5D93A 1KEBA 4MCUA 4ZBAA 2WFCA 3NOFA 5IMZA 2H6XA 3BCIA 3L0HA 2H73A 3E0UA 2YV9A 3CQFA 1MDIA 4NMUA 3EU3A 1SD8A 2KLXA 3IC4A 4DEJA 5CYYA 2P5RA 3F4SA 4POMA 5IPGA 2BMXA 2DJ3A 3VWVA 5DAKB 4MH2A 3VI5A 5A4WA 2QA1A 4MJAA 5DCHA 2LQQA 2FY6A 4KCAA 5DBQA 3CRTA
chains in the Genus database with same CATH topology
2GSQA 4MJCA 2LS5A 4L5OA 1EOHA 2H75A 2VM2A 1GSEA 2CA8A 2WS2A 1THOA 4ZBBA 3I9V2 3TDGA 2EIRA 4HUAA 1YY7A 3CBUA 5GSSA 4PURA 3M0FA 4IVFA 3GKXA 4ZL8A 4G10A 1ZL9A 3RDWA 2ZNMA 2DSAA 3KD0A 4PTSA 1PGTA 2VCVA 3VI7A 4V2LA 1MDKA 5JWRB 3MNGA 3TCOA 1G6WA 1T00A 5H5QA 4HU9A 2P31A 2M46A 5ECMB 4L8EA 5G1KA 3O3TA 2GVPA 1YEXA 2X99A 1FW1A 1TW9A 3UMAA 1K0NA 5LD0A 4GCIA 1SYRA 5JCUA 1K0OA 2MMAA 3F3QA 1ERTA 1FVJA 5IIZA 3ZVJD 4EXJA 3IHQA 2AJQB 4KSOA 2C3NA 3ZMLA 4WEYA 3ZLPA 2DJJA 4YH2A 4NXIA 2YCDA 2B6MA 4ZBDA 2GLRA 1RK4A 2HSYA 5J4UA 3HDCA 1O8WA 1U3AA 4QQ7A 3IOSA 2WCIA 1ZOFA 5J9BA 3GV1A 1A2MA 3F6FA 4N0ZA 1FVKA 18GSA 2VAFA 4ZXGA 4RQRA 4GSTA 1PL1A 1WWJA 3IA1A 1DE2A 4YQMA 6GSXA 2H19A 3U5RE 1QQ2A 2F9SA 5ABRA 2DJKA 3UL3A 1KBNA 12GSA 1PX7A 3GRXA 3TKPA 4AJ6A 4MABA 2H6ZA 1YKAA 5DDLA 3M9JA 3UBLA 4BWQA 2DKHA 2LJRA 1AW9A 2HRFA 2Z9SA 1GNEA 3ZMKA 2YWMA 4MDCA 5KEJA 2RLIA 3ZITA 3KIJA 3VWXA 2N5BA 1PN9A 4NV2A 3U6VA 4HZ4A 1FOVA 1VF3A 4RI7A 3WGDA 5J41A 1ERVA 1TU8A 2LRTA 3ERGA 5DQYA 2FD3A 3L9VA 5JWQB 4DSQA 2VD1A 5AN1A 2MYGA 1SJZA 3O76A 4XIHA 2HE3A 3I69A 2HZEB 4F9ZA 3DEXA 3SWLA 2MBTA 4POLA 4GXZA 2VCXA 1OYJA 4KE3A 1MDJA 1F2EA 17GSA 2NTOA 4BL7B 2H1DA 1TU7A 4RUVA 1BAYA 4GLTA 4K8MA 8GSSA 2YP6A 3GKKA 3KMOA 3HZ4A 3D4TA 4MPFA 4JRRA 5J3RA 4YKGA 3CXGA 5ECRB 6GSVA 2GSTA 3G7YA 1A2LA 3TUEA 5HR2A 1IYHA 3IK9A 2HNLA 2C1YA 1HD2A 3BD2A 3D21A 2HT9A 2VLTA 1G7EA 1N8JA 3ZFBA 4ZIJA 4ECCA 2CVKA 5J9CA 3F9UA 2B3SA 2C0GA 2L4QA 3CTGA 4X43A 1LU4A 2R5GA 3AY8A 3A2XA 3C71A 1WOUA 2FUG2 2OE1A 1GLPA 4ML6A 1KTEA 2DMMA 1WJKA 2YWOA 4IQ1A 13GSA 4D73B 5ECPB 3MWHA 4K9ZA 2FWEA 1E6BA 3FRCA 1KNGA 4K2DA 2MMOA 2GZZA 1XFLA 3A3TA 3K8NA 4IBPA 3PR8A 1EWXA 1PMTA 3BJ5A 3D0ZA 3FMWA 2GZYA 2FWHA 2VL2A 4QL7A 1SJIA 1SKRB 4XRDA 4IN0A 2I4AA 3RBTA 1EEJA 3US3A 2XBIA 4AJ7A 1GNWA 4J2FA 3G7IA 4EC0A 2VLVA 3GN3A 4EL1A 2L5LA 5IQYA 1EP8A 4KH7A 1THXA 1OVNA 3GURA 2O85A 1XWBA 1O85A 1C72A 1F3AA 2WB9A 2AUVA 5CO3A 5LNKe 2HZEA 2GSRA 4PGTA 3WGXA 2JZTA 19GSA 1EV9A 3D5JA 3PH9A 1JZDA 1ILOA 1M2BA 1OKDA 1A8LA 5F06A 2C80A 1H75A 2RUFA 2CZ3A 5EPFA 2R3XA 5G2ZA 2GTUA 2FGXA 3MIXA 3KTBA 1FOHA 4YAPA 1TXXA 3FR3A 2HXKA 2O89A 3DWVA 3KMNA 5COHA 5BRTA 1GUHA 2F51A 5DQSA 5A4VA 4MP4A 4IP6A 1DSBA 5GAPD 5A4UA 1FO5A 5H5SA 3L4NA 1GSFA 2RUEA 2AB6A 2LNSA 2V32A 1J9BA 1WPIA 2H8LA 2OJLA 3P90A 3LWAA 1U3IA 1MEKA 3IBHA 2C3QA 4MF7A 4OWYA 2NBSA 1F37A 2CX3A 1QXHA 3KJYA 1F6MC 1PRXA 3TRQA 5JCGA 3KP9A 3PGTA 1GLQA 2VUPA 3JCML 2LKUA 1OE8A 3UARA 4D73A 1AIUA 4CY8A 1Z7RA 2DIYA 1V57A 20GSA 1A0RP 2WJUA 1SYXA 4X0XA 1DE1A 1GSYA 4PQIA 1QFNA 3J7Yk 4MNNA 4EF0A 6GSWA 4ULXA 2IMDA 3TJJA 2ZUPA 2A2PA 4GQFA 5D9VA 2CAQA 1ON4A 2JZSA 1V58A 2DC5A 3TKQA 1Q98A 2LEGA 4ZL9A 4POKA 5IMAA 5G5EA 4ZILA 3ZRDA 3KGKA 1GTBA 3PINA 4CW9A 4K0GA 1JZRA 5HR1A 3FEUA 2WZ9A 1AQWA 3L78A 1I9DA 1TI3A 1T4YA 5D9TA 5CRDA 3C8EA 3EWLA 2QC7A 3Q74A 2LSTA 3HVSA 10GSA 2HSMA 5C00A 3F3RA 3P7XA 4PUAA 4K7OA 5D9XA 1XPVA 2L6CA 3SBCA 11GSA 4TW5A 3WGEA 2H70A 2J23A 3ZZXA 2DLXA 3F0IA 3IC8A 2MMZA 2ON7A 5CP1A 3DVWA 2OBKA 1VF4A 1JLWA 4BVYA 2YV7A 1XOAA 3DVXA 2CX4A 2X4AA 2YNXA 2DKIA 3BCKA 1Z7PA 3E9JB 4EDZA 2TRCP 1YQ1A 3EURA 1XWCA 5KN3A 4YQUA 4OD7A 3LFLA 22GSA 4KCEA 5ECNB 3TGZA 2X8CA 3ZIVA 5BMUA 5KN1A 3R2QA 3LQ7A 4TN8A 3TJBA 1TP9A 2HRKA 2PWJA 2GT6A 3DRNA 5EY6A 2V6KA 3N5OA 5GSTA 1OC3A 4KX4A 1TK8B 3IR4A 1Z5YE 5KN2A 1M0UA 3UBKA 1A24A 3M9KA 4I6XA 3P8WA 5FHIA 2LRNA 2FNOA 2DJ1A 1SK2A 4AF2A 5INYA 2J9HA 2NVLA 2A2RA 5CNWA 1MD4A 4MK3A 3ZTLA 3M8NA 1X9WB 1EZKA 3V1WA 2L59A 4G0KA 3DGQA 5G30A 2JADA 1TI1A 2B7KA 2AV4A 3EMXA 3A5WA 4HI7A 1BX9A 5ECLB 4G0LA 5ECOB 4IJIA 5ECHB 5F05A 5GAND 3FHKA 2K9FA 3Q18A 5HR0A 1HQOA 1TRUA 2H0GA 4OCEA 3HCZA 4LMVA 1ZZYA 1SL2B 2L57A 2RIIA 1GSQA 1Q4JA 3QAVA 4Q5FA 2YOIA 2QGVA 1YF1A 3GX0A 3UVHA 4KW6A 3VWWA 1NW2A 1M9BA 1GRXA 1HNBA 3CRUA 4EE0A 3FKFA 4LMWA 1XOBA 3ZVJA 2VIMA 3GL5A 4F03A 1GL8A 3UIWA 1SENA 4F0CA 2CZ2A 4DSSA 1AC1A 2MMNA 2H01A 3WYWA 1GSSA 2I1UA 1A2JA 5AIXA 1IYIA 4MZCA 4JBBA 4WETA 2OACA 2FWFA 1O81A 3Q6OA 5L71A 1YDKA 4FIWA 4CDOA 5F07A 1XW5A 3MSZA 4FO5A 3FR6A 2XPEA 3DMLA 2H66A 5AISA 1X5DA 3H93A 5E59A 2R0GA 3GMFA 4FYCA 3IE3A 4P3YB 4KF9A 1FAAA 2I9HA 1K3OA 5IPHA 3FYGA 2G0FA 2YN1A 1U88A 3GKMA 2H30A 5G5FA 2M72A 4LL1B 4MLYA 4KDYA 3CTFA 4JEDA 1TTZA 2PERA 3FY7A 1GULA 3TKRA 4HJMA 4ECIA 4J56E 4YKFA 2E2MA 4ECBA 1JLVA 6GSYA 3MAKA 3GFKA 1TOFA 4KDUA 2AAWA 1QK8A 4F0BA 2CVDA 2B5EA 2O7KA 1T8EB 3VPQA 3CMIA 3IAM2 1PKZA 5HQPA 3IHGA 1HYUA 4Z2RA 4V2NA 3HD5A 1QMVA 2F8AA 4K7NA 3KP8A 1TDIA 3IXRA 3QMXA 3APQA 2AYTA 4MF5A 4FH8A 1SKSB 1K0AA 2HZFA 2H74A 5ECQB 5KOWA 1X0RA 2C0FA 2DIZA 2XHFA 2B1KA 2DBCA 2AHEA 4GTUA 2VL2C 4I8BA 4V1Ag 3LYPA 4H86A 1DBYA 3FR9A 3EPTA 4N10A 6GSSA 2QKEA 1O73A 4K0NA 4HEA2 2C4JA 4MZWA 1R5AA 2RM5A 4MMMA 1M9AA 4XS4B 1Y25A 5CRGA 3WT1A 3LXTA 3ZFLA 3TJFA 5IM9A 1GH2A 2P5QA 3GSSA 1F9MA 2GGTA 1EGRA 2DJ2A 2IJYA 4V1Ap 2X49A 1HNCA 5A5KA 1N2AA 3ERFA 4IJ3A 1PSQA 4OFTA 7GSSA 4KDXA 3D4MA 3DIEA 1S3CA 3QFAC 4PX1A 4WBJA 1B9XC 2B5XA 4KB3A 1R26A 3EYTA 2EIOA 3ZYWA 2H1BA 1RQMA 3KEBA 2OE0A 4BWSA 2IMFA 2P0GA 2A4HA 4MJBA 3S9FA 2C0EA 2LUSA 2X8GA 3ZL5A 2TRXA 2V41A 3ME8A 1AQXA 2PN8A 5B8AA 1YJ6A 1W4VA 3ERWA 1XWAA 4Q5NA 4TR3A 4I97A 1U87A 4TRXA 1RW1A 1NHYA 3KM6A 4IGJA 1ZYNA 1Z6MA 3LGCA 3EMPA 3EVIA 1U6TA 4E8EA 5D9WA 4TR1A 4K7IA 4HJ2A 3LG6A 1R7HA 4GSSA 1PX6A 2OBIA 1AQVA 4KGIA 3TKSA 3LEFA 4WF5A 3QR6A 2O87A 4BA7A 2HLSA 2R4VA 4A5PA 4PNFA 4JR4A 1MD3A 4G9HA 1ERWA 1V98A 4NHZA 2B5YA 3I43A 2VL3A 4BVYB 2HSHA 1EOGA 1M99A 4MH3A 1XVQA 5HR3A 5DALA 1UN2A 4O5RA 3L9SA 4EIPA 4JR6A 2HYXA 2KHPA 2HRAA 5JCWA 5IO0A 5E4WA 4JU5A 1WE0A 4O32A 3IK7A 4EUYA 3IPZA 3FW2A 5G31A 5J5NA 1VF1A 3TOTA 1G6YA 2I3YA 4GRFA 1ML6A 2LRCA 3APOA 4PNGA 4XS4A 4NWYA 2YJ7A 5B6MA 5C04A 5B7CA 1T1VA 2H0HA 1B9YC 3WT2A 3VWUA 3G7JA 1B8XA 4NHWA 1WMJA 5B6NA 1FG4A 1B4QA 1EGOA 3HA9A 4MA9A 4XTSA 5IMDA 4KUNA 1FHEA 2FA4A 3GUSA 3F4TA 4K6XA 2NPBA 1T4ZA 2IWTA 2KP1A 3QPMA 2E0QA 2M80A 1XIYA 2PUKC 2R37A 4KAEA 4Z2UA 5IMCA 4FYUA 2VD0A 4DVCA 1TK0B 4KSMA 2N5FA 1XBSA 3GTUA 5DJLA 1VGLA 3TJKA 5HFIA 4QL9A 3NZNA 3VPTA 2XPDA 4G19A 3KH9A 1K0MA 4ZB9A 3HHVA 2PMTA 1TJDA 1EEMA 4Q5RA 4BVXB 5ECSA 1URMA 1M7TA 2JSYA 3QFBC 2WGRA 1G7OA 9GSSA 1GP1A 2YZHA 2OA7A 3GKNA 4N30A 1K3YA 3LSZA 1OE7A 5CREA 1SL0B 2XC2A 2IMIA 3D6IA 1PKWA 2F3MA 3GL3A 1R5PA 2IN3A 3HZ8A 3WD6A 3APSA 1XVWA 1OC9B 4MF6A 4DSSB 1J0FA 1E2YA 2YWIA 1SD9A 4EIQA 1M2DA 4HQSA 4AJ8A 1O8XA 5AGYA 4USSA 5CAXA 3CSIA 4WKWA 3ED3A 3C1RA 3TRPA 1YZXA 2V2GA 1Y6EA 1B4PA 1A8YA 4FQUA 4TOPA 4PQHA 3QD9A 2IMKA 1ZMAA 3LXZA 3R3EA 3C73A 4JE1A 3E3EA 4HS1A 4ZB8A 3PPUA 4GWRA 3GSTA 2HRNA 2FCHA 1UC7A 4WF4A 3P2AA 4LL4B 1W89A 1YEPA 1AUCA 3F63A 3Q19A 4GF0A 2DJ0A 3HJMA 4OO4A 1SJ6A 5JWOB 1JZWA 2A2SA 2B1LA 3DD3A 4ML1A 2YJHA 3VFIA 3H4KA 2LV3A 1AXDA 1M2AA 1ZCPA 2MZCA 1FB6A 2H6YA 3FZAA 1QGVA 2O8VB 3HY2A 2PVQA 3HYPA 1TRWA 1GTAA 1S3DA 1A23A 2VCTA 2YPMA 1YKCA 4EKZA 2K8SA 5B8BA 3GA4A 4MJEA 1V2AA 16GSA 1X9MB 3IV4A 4XRAA 6GSTA 2ON5A 5H5RA 5ID2A 2L6DA 2VLUA 4I2TA 2UZ8A 3RPNA 1JZOA 4TXOB 1H4OA 4ILFA 4TKYA 1GTIA 4XCSA 5F8BA 4HU7A 3TB2A 2FA8A 4BVXA 4PQ1A 1PA3A 2IL3A 2TIRA 5G1LA 2GS3A 3ME7A 4X4JA 4WBRD 1WRYA 2C8UA 3W8SA 4K2XA 3IRAA 4Q5QA 1NM3A 2JU5A 4F82A 3TRXA 3C1SA 1CQGA 2VO4A 3IDVA 1OC9A 4MZBA 4K5RA 4YQVA 14GSA 2K6VA 3VK9A 4F2IA 2R0PA 3C7MA 2LNTA 1MTCA 4AGSA 5IO2A 2JL4A 1FB0A 3HJPA 4ZB6A 3RHBA 3W8JA 2CT6A 2DMLA 3EE2A 4WR5A 3MDKA 2H72A 2V1MA 5FT3A 3RHCA 4BPYA 2ALBA 2IMEA 3RAZA 4HDEA 3M1GA 2JACA 3VLNA 1G0TA 2L5OA 5IMFA 4ZL7A 4HQZA 3H1NA 2XBQA 1ZYQB 1SK1A 1LBKA 4J57E 5LCZA 1OC8A 3KXOA 1X9SB 2E7PA 3OR5A 5ECKB 1UA5A 3QCPA 3N9JA 2ES7A 3O6TA 2VCQA 3HJOA 4TR1B 1EV4A 2OADA 4Z2TA 2VCZA 5DAKA 5DCGA 4I5QA 4O5QA 1ERUA 4NAXA 4N0VA 4GQCA 1TK5B 1SK0A 2BTOT 2R2JA 2CVBA 2YANA 4IP1A 1OAZA 3MYDA 4TXOA 5DALB 2GZPA 4ID0A 2K18A 1BEDA 2LQOA 2F8FA 4IW9A 3GH6A 4X1UA 4ACSA 2QA2A 4GSNA 1PN0A 2GDRA 2HFDA 3FZ4A 1BJXA 1DUGA 3A2WA 1XWKA 1O7UA 1XCCA 2WRTA 4IS0A 2QSIA 1LJRA 3VURA 1PL2A 3GYKA 3DYRA 3L9UA 4IQAA 5ENUA 1GSDA 3UEMA 5CRHA 1B48A 4XHMA 5CRWA 3CSHA 4TR4A 1WIKA 2B7JA 3BBYA 5DJMA 3HVXA 3TKSC 4YAVA 5FWGA 1SL1B 3FZ5A 4HOJA 4L5LA 4DSRA 2PBJA 4N11A 1PQNA 3HKRA 1GTUA 3GX8A 2OKAA 3UVTA 2EIQA 2D2ZA 4Z7XA 2PGTA 5IOWA 1USBA 3M3MA 3A2VA 3GTUB 4ISDA 3LJRA 4WR4A 2YZUA 1J08A 1SU9A 1GWCA 2A4VA 3CYNA 4IHUA 2IFQB 2X64A 3LW9A 5F0GA 1ST9A 2V6OA 3FZ9A 2C3TA 4WXTA 1Z9HA 3F8UA 4TVEA 5KN0A 1QUWA 3TKSE 1CQHA 1AAZA 1ABAA 4XS6A 5EVOA 5IMVA 4RQXA 2JZRA 3GIXA 2OE3A 4FYBA 1ACVA 1TRSA 1GUKA 5IOXA 2X8HA 4TXVA 1NHOA 2FWGA 2CAIA 2H0IA 1V40A 2IIYA 2G2QA 4LA1A 2R6KA 1BQ7A 1NSWA 1VF2A 4MPGA 1Z3EA 1HNAA 4OFMA 2PVOC 4OMVA 2R0CA 1A0FA 3F6DA 3HXSA 3FK8A 4OCFA 4EVMA 2C0DA 5HFKA 4BL7A 2LTKA 1R4WA 2REMA 3DXBA 2L4CA 3TOUA 3GHAA 2GQMA 1TKDB 1T3BA 2N5AA 3BOAA 2E2GA 3TJGA 1O6JA 4I2UA 3ISOA 5ECIB 2LJAA 3HVVA 3UOMA 4L0WA 6GSUA 2GQLA 2VCWA 1PD21 3D22A 4PXOA 2MBSA 4TR0A 4HZ2A 3QDNA 2YWNA 4LLRA 2I81A 5AIVA 3EC3A 1UVZA 3KCMA 4RI6A 3IAS2 4ECJA 4POBA 2NDOA 2LJKA 1ZGNA 1VRSD 2RM6A 3F4RA 4G2EA 1JFUA 2ZCTA 5D96A 1XW6A 5ELGA 1XW9A 1K0BA 3GNJA 1V9WA 2KOKA 2GQKA 4IKHA 2BJXA 1X5EA 3H79A 1EP7A 3KZQA 1X5CA 5D73A 4JZQA 1ZYEA 4XS1A 1BG5A 4K1FA 4EO3A 3UJ1A 1K0CA 3A5IA 2IFQA 5ID2B 4OFNA 1XWGA 3NIVA 1BYEA 1I5GA 2H1GA 4KNDA 2H76A 3W6GA 2EC4A 4O7HA 3DKSA 2CQ9A 5GZZB 4ICYA 4IELA 4KA0A 1TRVA 1GUMA 4O5UA 3CSJA 4NV5A 3J7Yb 1GSUA 3KH7A 1K0DA 2H1AA 2WDUA 1YF0A 3H8QA 1JHBA 2FHEA 1F3BA 2PPTA 2HI7A 2IPAA 4CY6A 4K5SA 3KTLA 4L0UA 4EDYA 3ZIJA 2FLSA 3RPPA 4O92A 3UAPA 1T7PB 1XXUA 2GSSA 1K3LA 2K8VA 4V2MA 3LORA 4CHSA 3GH9A 1OKTA 5HFGA 3QAWA 4E8HA 2VOCA 1ZYPA 4G0IA 3I6AA 4OO5A 3ZREA 3QOUA 2WULA 5D8IA 1S3AA 2JSZA 3EU4A 2H71A 1Z6NA 4PUFC 2KP2A 5KOXA 3EINA 4NPBA 3LYKA 2GT5A 2PU9C 3QAGA 1SKWB 5DVBA 2VL9A 5EL8A 1WP0A 3G9BA 1XZOA 2KUCA 2VM1A 2CV4A 5ELAA 5D93A 1KEBA 4MCUA 4ZBAA 2WFCA 3NOFA 5IMZA 2H6XA 3BCIA 3L0HA 2H73A 3E0UA 2YV9A 1MDIA 4NMUA 3EU3A 1SD8A 2KLXA 3IC4A 4DEJA 5CYYA 2P5RA 3F4SA 4POMA 5IPGA 2BMXA 2DJ3A 3VWVA 5DAKB 4MH2A 3VI5A 5A4WA 2QA1A 4MJAA 5DCHA 2LQQA 2FY6A 4KCAA 5DBQA 3CRTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GSQ A;  4MJC A;  2LS5 A;  4L5O A;  1EOH A;  2H75 A;  2VM2 A;  1GSE A;  2CA8 A;  2WS2 A;  1THO A;  4ZBB A;  3I9V 2;  3TDG A;  2EIR A;  4HUA A;  1YY7 A;  3CBU A;  5GSS A;  4PUR A;  3M0F A;  4IVF A;  3GKX A;  4ZL8 A;  4G10 A;  1ZL9 A;  3RDW A;  2ZNM A;  2DSA A;  3KD0 A;  1PGT A;  2VCV A;  3VI7 A;  4V2L A;  1MDK A;  5JWR B;  3MNG A;  3TCO A;  1G6W A;  1T00 A;  5H5Q A;  4HU9 A;  2P31 A;  2M46 A;  5ECM B;  4L8E A;  5G1K A;  3O3T A;  2GVP A;  1YEX A;  2X99 A;  1FW1 A;  1TW9 A;  3UMA A;  1K0N A;  5LD0 A;  4GCI A;  1SYR A;  5JCU A;  1K0O A;  2MMA A;  3F3Q A;  1ERT A;  1FVJ A;  5IIZ A;  3ZVJ D;  4EXJ A;  3IHQ A;  2AJQ B;  4KSO A;  2C3N A;  3ZML A;  4WEY A;  3ZLP A;  2DJJ A;  4YH2 A;  4NXI A;  2YCD A;  2B6M A;  4ZBD A;  2GLR A;  1RK4 A;  2HSY A;  5J4U A;  3HDC A;  1O8W A;  1U3A A;  4QQ7 A;  3IOS A;  2WCI A;  1ZOF A;  5J9B A;  3GV1 A;  1A2M A;  3F6F A;  4N0Z A;  1FVK A;  18GS A;  2VAF A;  4ZXG A;  4RQR A;  4GST A;  1PL1 A;  1WWJ A;  3IA1 A;  1DE2 A;  4YQM A;  6GSX A;  2H19 A;  3U5R E;  1QQ2 A;  2F9S A;  5ABR A;  2DJK A;  3UL3 A;  1KBN A;  12GS A;  1PX7 A;  3GRX A;  3TKP A;  4AJ6 A;  4MAB A;  2H6Z A;  1YKA A;  5DDL A;  3M9J A;  3UBL A;  4BWQ A;  2LJR A;  1AW9 A;  2HRF A;  2Z9S A;  1GNE A;  3ZMK A;  2YWM A;  4MDC A;  5KEJ A;  2RLI A;  3ZIT A;  3KIJ A;  3VWX A;  2N5B A;  1PN9 A;  4NV2 A;  3U6V A;  4HZ4 A;  1FOV A;  1VF3 A;  4RI7 A;  3WGD A;  5J41 A;  1ERV A;  1TU8 A;  2LRT A;  3ERG A;  5DQY A;  2FD3 A;  3L9V A;  5JWQ B;  4DSQ A;  2VD1 A;  5AN1 A;  2MYG A;  1SJZ A;  3O76 A;  4XIH A;  2HE3 A;  3I69 A;  2HZE B;  4F9Z A;  3DEX A;  3SWL A;  2MBT A;  4POL A;  4GXZ A;  2VCX A;  1OYJ A;  4KE3 A;  1MDJ A;  1F2E A;  17GS A;  2NTO A;  2H1D A;  1TU7 A;  4RUV A;  1BAY A;  4GLT A;  4K8M A;  8GSS A;  2YP6 A;  3GKK A;  3KMO A;  3HZ4 A;  3D4T A;  4MPF A;  4JRR A;  5J3R A;  3CXG A;  5ECR B;  6GSV A;  2GST A;  3G7Y A;  1A2L A;  3TUE A;  5HR2 A;  1IYH A;  3IK9 A;  2HNL A;  2C1Y A;  1HD2 A;  3BD2 A;  3D21 A;  2HT9 A;  2VLT A;  1G7E A;  1N8J A;  3ZFB A;  4ZIJ A;  4ECC A;  2CVK A;  5J9C A;  3F9U A;  2B3S A;  2C0G A;  2L4Q A;  3CTG A;  4X43 A;  1LU4 A;  2R5G A;  3AY8 A;  3A2X A;  3C71 A;  1WOU A;  2FUG 2;  2OE1 A;  1GLP A;  4ML6 A;  1KTE A;  2DMM A;  1WJK A;  2YWO A;  4IQ1 A;  13GS A;  4D73 B;  5ECP B;  3MWH A;  4K9Z A;  2FWE A;  1E6B A;  3FRC A;  1KNG A;  4K2D A;  2MMO A;  2GZZ A;  1XFL A;  3A3T A;  3K8N A;  4IBP A;  3PR8 A;  1EWX A;  1PMT A;  3BJ5 A;  3D0Z A;  2GZY A;  2FWH A;  2VL2 A;  4QL7 A;  1SJI A;  1SKR B;  4XRD A;  4IN0 A;  2I4A A;  3RBT A;  1EEJ A;  3US3 A;  2XBI A;  4AJ7 A;  1GNW A;  4J2F A;  3G7I A;  4EC0 A;  2VLV A;  3GN3 A;  4EL1 A;  2L5L A;  5IQY A;  1EP8 A;  4KH7 A;  1THX A;  1OVN A;  3GUR A;  2O85 A;  1XWB A;  1O85 A;  1C72 A;  1F3A A;  2WB9 A;  2AUV A;  5CO3 A;  5LNK e;  2HZE A;  2GSR A;  4PGT A;  3WGX A;  2JZT A;  19GS A;  1EV9 A;  3D5J A;  3PH9 A;  1JZD A;  1ILO A;  1M2B A;  1OKD A;  1A8L A;  5F06 A;  2C80 A;  1H75 A;  2RUF A;  2CZ3 A;  5EPF A;  2R3X A;  5G2Z A;  2GTU A;  2FGX A;  3KTB A;  4YAP A;  1TXX A;  3FR3 A;  2HXK A;  2O89 A;  3DWV A;  3KMN A;  5COH A;  1GUH A;  2F51 A;  5DQS A;  5A4V A;  4MP4 A;  4IP6 A;  1DSB A;  5GAP D;  5A4U A;  1FO5 A;  5H5S A;  3L4N A;  1GSF A;  2RUE A;  2AB6 A;  2LNS A;  2V32 A;  1J9B A;  1WPI A;  2H8L A;  2OJL A;  3P90 A;  3LWA A;  1U3I A;  1MEK A;  3IBH A;  2C3Q A;  4MF7 A;  4OWY A;  2NBS A;  1F37 A;  2CX3 A;  1QXH A;  3KJY A;  1F6M C;  1PRX A;  3TRQ A;  5JCG A;  3KP9 A;  3PGT A;  1GLQ A;  2VUP A;  3JCM L;  2LKU A;  1OE8 A;  3UAR A;  4D73 A;  1AIU A;  1Z7R A;  2DIY A;  1V57 A;  20GS A;  1A0R P;  2WJU A;  1SYX A;  4X0X A;  1DE1 A;  1GSY A;  4PQI A;  1QFN A;  3J7Y k;  4EF0 A;  6GSW A;  4ULX A;  2IMD A;  3TJJ A;  2ZUP A;  4GQF A;  5D9V A;  2CAQ A;  1ON4 A;  2JZS A;  1V58 A;  2DC5 A;  3TKQ A;  1Q98 A;  2LEG A;  4ZL9 A;  4POK A;  5IMA A;  5G5E A;  4ZIL A;  3ZRD A;  3KGK A;  1GTB A;  3PIN A;  4CW9 A;  4K0G A;  1JZR A;  5HR1 A;  3FEU A;  2WZ9 A;  1AQW A;  3L78 A;  1I9D A;  1TI3 A;  1T4Y A;  5D9T A;  5CRD A;  3C8E A;  3EWL A;  2QC7 A;  3Q74 A;  2LST A;  3HVS A;  10GS A;  5C00 A;  3F3R A;  3P7X A;  4PUA A;  4K7O A;  5D9X A;  1XPV A;  2L6C A;  3SBC A;  11GS A;  4TW5 A;  3WGE A;  2H70 A;  2J23 A;  3ZZX A;  2DLX A;  3F0I A;  2MMZ A;  2ON7 A;  5CP1 A;  3DVW A;  2OBK A;  1VF4 A;  1JLW A;  4BVY A;  2YV7 A;  1XOA A;  3DVX A;  2CX4 A;  2YNX A;  3BCK A;  1Z7P A;  3E9J B;  4EDZ A;  2TRC P;  1YQ1 A;  3EUR A;  1XWC A;  5KN3 A;  4YQU A;  4OD7 A;  3LFL A;  5ECN B;  22GS A;  4KCE A;  3TGZ A;  2X8C A;  3ZIV A;  5KN1 A;  3R2Q A;  3LQ7 A;  4TN8 A;  3TJB A;  1TP9 A;  2PWJ A;  2GT6 A;  3DRN A;  5EY6 A;  2V6K A;  3N5O A;  5GST A;  1OC3 A;  4KX4 A;  1TK8 B;  3IR4 A;  1Z5Y E;  5KN2 A;  1M0U A;  3UBK A;  1A24 A;  3M9K A;  4I6X A;  3P8W A;  5FHI A;  2LRN A;  2FNO A;  2DJ1 A;  1SK2 A;  4AF2 A;  5INY A;  2J9H A;  2NVL A;  2A2R A;  5CNW A;  1MD4 A;  4MK3 A;  3ZTL A;  3M8N A;  1X9W B;  1EZK A;  3V1W A;  2L59 A;  3DGQ A;  5G30 A;  2JAD A;  1TI1 A;  2B7K A;  2AV4 A;  3EMX A;  3A5W A;  4HI7 A;  1BX9 A;  5ECL B;  5ECO B;  4IJI A;  5ECH B;  5F05 A;  5GAN D;  3FHK A;  2K9F A;  3Q18 A;  5HR0 A;  1HQO A;  1TRU A;  2H0G A;  4OCE A;  3HCZ A;  4LMV A;  1ZZY A;  1SL2 B;  2L57 A;  2RII A;  1GSQ A;  1Q4J A;  3QAV A;  4Q5F A;  2YOI A;  2QGV A;  1YF1 A;  3GX0 A;  3UVH A;  4KW6 A;  3VWW A;  1NW2 A;  1M9B A;  1GRX A;  1HNB A;  3CRU A;  4EE0 A;  3FKF A;  4LMW A;  1XOB A;  3ZVJ A;  2VIM A;  3GL5 A;  4F03 A;  1GL8 A;  3UIW A;  1SEN A;  4F0C A;  2CZ2 A;  4DSS A;  1AC1 A;  2MMN A;  2H01 A;  3WYW A;  1GSS A;  2I1U A;  1A2J A;  5AIX A;  1IYI A;  4MZC A;  4JBB A;  4WET A;  2OAC A;  2FWF A;  1O81 A;  3Q6O A;  5L71 A;  1YDK A;  4FIW A;  4CDO A;  5F07 A;  1XW5 A;  3MSZ A;  4FO5 A;  3FR6 A;  2XPE A;  3DML A;  2H66 A;  5AIS A;  1X5D A;  3H93 A;  5E59 A;  3GMF A;  4FYC A;  3IE3 A;  4P3Y B;  1FAA A;  2I9H A;  1K3O A;  5IPH A;  3FYG A;  2G0F A;  2YN1 A;  1U88 A;  3GKM A;  2H30 A;  5G5F A;  2M72 A;  4LL1 B;  4MLY A;  4KDY A;  3CTF A;  4JED A;  1TTZ A;  2PER A;  3FY7 A;  1GUL A;  3TKR A;  4HJM A;  4ECI A;  4J56 E;  2E2M A;  4ECB A;  1JLV A;  6GSY A;  3MAK A;  3GFK A;  1TOF A;  4KDU A;  2AAW A;  1QK8 A;  4F0B A;  2CVD A;  2B5E A;  2O7K A;  1T8E B;  3VPQ A;  3CMI A;  3IAM 2;  1PKZ A;  5HQP A;  1HYU A;  4V2N A;  3HD5 A;  1QMV A;  2F8A A;  4K7N A;  3KP8 A;  1TDI A;  3IXR A;  3QMX A;  3APQ A;  2AYT A;  4MF5 A;  4FH8 A;  1SKS B;  1K0A A;  2HZF A;  2H74 A;  5ECQ B;  1X0R A;  2C0F A;  2DIZ A;  2XHF A;  2B1K A;  2DBC A;  2AHE A;  4GTU A;  2VL2 C;  4I8B A;  4V1A g;  3LYP A;  4H86 A;  1DBY A;  3FR9 A;  4N10 A;  6GSS A;  2QKE A;  1O73 A;  4K0N A;  4HEA 2;  2C4J A;  4MZW A;  1R5A A;  2RM5 A;  4MMM A;  1M9A A;  4XS4 B;  1Y25 A;  5CRG A;  3WT1 A;  3LXT A;  3ZFL A;  3TJF A;  5IM9 A;  1GH2 A;  2P5Q A;  3GSS A;  1F9M A;  2GGT A;  1EGR A;  2DJ2 A;  2IJY A;  4V1A p;  1HNC A;  5A5K A;  1N2A A;  3ERF A;  4IJ3 A;  1PSQ A;  4OFT A;  7GSS A;  4KDX A;  3D4M A;  3DIE A;  1S3C A;  3QFA C;  4PX1 A;  4WBJ A;  1B9X C;  2B5X A;  4KB3 A;  1R26 A;  3EYT A;  2EIO A;  3ZYW A;  2H1B A;  1RQM A;  3KEB A;  2OE0 A;  4BWS A;  2IMF A;  2P0G A;  4MJB A;  3S9F A;  2C0E A;  2LUS A;  2X8G A;  3ZL5 A;  2TRX A;  2V41 A;  3ME8 A;  1AQX A;  2PN8 A;  5B8A A;  1YJ6 A;  1W4V A;  3ERW A;  1XWA A;  4Q5N A;  4TR3 A;  4I97 A;  1U87 A;  4TRX A;  1RW1 A;  1NHY A;  3KM6 A;  4IGJ A;  1Z6M A;  3LGC A;  3EMP A;  3EVI A;  1U6T A;  4E8E A;  5D9W A;  4TR1 A;  4K7I A;  4HJ2 A;  3LG6 A;  1R7H A;  4GSS A;  1PX6 A;  2OBI A;  1AQV A;  4KGI A;  3TKS A;  3LEF A;  4WF5 A;  3QR6 A;  2O87 A;  4BA7 A;  2HLS A;  2R4V A;  4PNF A;  4JR4 A;  1MD3 A;  4G9H A;  1ERW A;  1V98 A;  4NHZ A;  2B5Y A;  3I43 A;  2VL3 A;  2HSH A;  1EOG A;  1M99 A;  4MH3 A;  1XVQ A;  5HR3 A;  5DAL A;  1UN2 A;  4O5R A;  3L9S A;  4JR6 A;  2HYX A;  2KHP A;  5JCW A;  5IO0 A;  5E4W A;  4JU5 A;  1WE0 A;  4O32 A;  3IK7 A;  4EUY A;  3IPZ A;  3FW2 A;  5G31 A;  5J5N A;  1VF1 A;  3TOT A;  1G6Y A;  2I3Y A;  4GRF A;  1ML6 A;  2LRC A;  3APO A;  4PNG A;  4XS4 A;  4NWY A;  2YJ7 A;  5B6M A;  5C04 A;  5B7C A;  1T1V A;  2H0H A;  1B9Y C;  3WT2 A;  3VWU A;  3G7J A;  1B8X A;  4NHW A;  1WMJ A;  5B6N A;  1FG4 A;  1B4Q A;  1EGO A;  3HA9 A;  4MA9 A;  4XTS A;  5IMD A;  4KUN A;  1FHE A;  2FA4 A;  3GUS A;  3F4T A;  4K6X A;  2NPB A;  1T4Z A;  2IWT A;  2KP1 A;  3QPM A;  2E0Q A;  2M80 A;  1XIY A;  2PUK C;  2R37 A;  4KAE A;  5IMC A;  4FYU A;  2VD0 A;  4DVC A;  1TK0 B;  4KSM A;  2N5F A;  1XBS A;  3GTU A;  5DJL A;  1VGL A;  3TJK A;  5HFI A;  4QL9 A;  3NZN A;  3VPT A;  2XPD A;  4G19 A;  3KH9 A;  1K0M A;  4ZB9 A;  3HHV A;  2PMT A;  1TJD A;  1EEM A;  4Q5R A;  5ECS A;  1URM A;  1M7T A;  2JSY A;  3QFB C;  2WGR A;  1G7O A;  9GSS A;  1GP1 A;  2YZH A;  2OA7 A;  3GKN A;  4N30 A;  1K3Y A;  3LSZ A;  1OE7 A;  5CRE A;  1SL0 B;  2XC2 A;  2IMI A;  3D6I A;  1PKW A;  2F3M A;  3GL3 A;  1R5P A;  2IN3 A;  3HZ8 A;  3WD6 A;  3APS A;  1XVW A;  1OC9 B;  4MF6 A;  4DSS B;  1J0F A;  1E2Y A;  2YWI A;  1SD9 A;  1M2D A;  4HQS A;  4AJ8 A;  1O8X A;  5AGY A;  5CAX A;  3CSI A;  4WKW A;  3ED3 A;  3C1R A;  3TRP A;  1YZX A;  2V2G A;  1Y6E A;  1B4P A;  1A8Y A;  4TOP A;  4PQH A;  3QD9 A;  2IMK A;  1ZMA A;  3LXZ A;  3C73 A;  4JE1 A;  3E3E A;  4HS1 A;  4ZB8 A;  4GWR A;  3GST A;  2HRN A;  2FCH A;  1UC7 A;  4WF4 A;  3P2A A;  4LL4 B;  1W89 A;  1YEP A;  1AUC A;  3F63 A;  3Q19 A;  4GF0 A;  2DJ0 A;  3HJM A;  4OO4 A;  1SJ6 A;  5JWO B;  1JZW A;  2A2S A;  2B1L A;  3DD3 A;  4ML1 A;  2YJH A;  3VFI A;  3H4K A;  2LV3 A;  1AXD A;  1M2A A;  1ZCP A;  2MZC A;  1FB6 A;  2H6Y A;  3FZA A;  1QGV A;  2O8V B;  3HY2 A;  2PVQ A;  3HYP A;  1TRW A;  1GTA A;  1S3D A;  1A23 A;  2VCT A;  2YPM A;  1YKC A;  4EKZ A;  2K8S A;  5B8B A;  3GA4 A;  4MJE A;  1V2A A;  16GS A;  1X9M B;  3IV4 A;  4XRA A;  6GST A;  2ON5 A;  5H5R A;  5ID2 A;  2L6D A;  2VLU A;  4I2T A;  3RPN A;  1JZO A;  4TXO B;  1H4O A;  4ILF A;  4TKY A;  1GTI A;  4XCS A;  5F8B A;  4HU7 A;  3TB2 A;  2FA8 A;  4BVX A;  4PQ1 A;  1PA3 A;  2IL3 A;  2TIR A;  5G1L A;  2GS3 A;  3ME7 A;  4WBR D;  1WRY A;  2C8U A;  3W8S A;  3IRA A;  4Q5Q A;  1NM3 A;  2JU5 A;  4F82 A;  3TRX A;  3C1S A;  1CQG A;  2VO4 A;  3IDV A;  1OC9 A;  4MZB A;  4YQV A;  14GS A;  2K6V A;  3VK9 A;  4F2I A;  3C7M A;  2LNT A;  1MTC A;  4AGS A;  5IO2 A;  2JL4 A;  1FB0 A;  3HJP A;  4ZB6 A;  3RHB A;  3W8J A;  2CT6 A;  2DML A;  3EE2 A;  4WR5 A;  3MDK A;  2H72 A;  2V1M A;  5FT3 A;  3RHC A;  4BPY A;  2ALB A;  2IME A;  3RAZ A;  4HDE A;  3M1G A;  2JAC A;  3VLN A;  1G0T A;  2L5O A;  5IMF A;  4ZL7 A;  4HQZ A;  3H1N A;  2XBQ A;  1ZYQ B;  1SK1 A;  1LBK A;  4J57 E;  5LCZ A;  1OC8 A;  3KXO A;  1X9S B;  2E7P A;  3OR5 A;  5ECK B;  1UA5 A;  3QCP A;  3N9J A;  2ES7 A;  3O6T A;  2VCQ A;  3HJO A;  4TR1 B;  1EV4 A;  2OAD A;  2VCZ A;  5DAK A;  5DCG A;  4I5Q A;  1ERU A;  4NAX A;  4N0V A;  4GQC A;  1TK5 B;  1SK0 A;  2BTO T;  2R2J A;  2CVB A;  2YAN A;  4IP1 A;  1OAZ A;  4TXO A;  5DAL B;  2GZP A;  4ID0 A;  2K18 A;  1BED A;  2LQO A;  2F8F A;  4IW9 A;  3GH6 A;  4X1U A;  4ACS A;  4GSN A;  2GDR A;  2HFD A;  3FZ4 A;  1BJX A;  1DUG A;  3A2W A;  1XWK A;  1O7U A;  1XCC A;  2WRT A;  4IS0 A;  2QSI A;  1LJR A;  3VUR A;  1PL2 A;  3GYK A;  3DYR A;  3L9U A;  4IQA A;  5ENU A;  1GSD A;  3UEM A;  5CRH A;  1B48 A;  4XHM A;  5CRW A;  3CSH A;  4TR4 A;  1WIK A;  2B7J A;  3BBY A;  5DJM A;  3HVX A;  3TKS C;  4YAV A;  5FWG A;  1SL1 B;  3FZ5 A;  4HOJ A;  4L5L A;  4DSR A;  2PBJ A;  4N11 A;  1PQN A;  3HKR A;  1GTU A;  3GX8 A;  2OKA A;  3UVT A;  2EIQ A;  2D2Z A;  4Z7X A;  2PGT A;  5IOW A;  1USB A;  3M3M A;  3A2V A;  3GTU B;  4ISD A;  3LJR A;  4WR4 A;  2YZU A;  1J08 A;  1SU9 A;  1GWC A;  2A4V A;  3CYN A;  4IHU A;  2IFQ B;  2X64 A;  5F0G A;  1ST9 A;  2V6O A;  3FZ9 A;  2C3T A;  4WXT A;  1Z9H A;  3F8U A;  4TVE A;  5KN0 A;  1QUW A;  3TKS E;  1CQH A;  5EVO A;  1AAZ A;  1ABA A;  4XS6 A;  5IMV A;  4RQX A;  2JZR A;  3GIX A;  2OE3 A;  4FYB A;  1ACV A;  1TRS A;  1GUK A;  5IOX A;  2X8H A;  4TXV A;  1NHO A;  2FWG A;  2CAI A;  2H0I A;  1V40 A;  2IIY A;  2G2Q A;  4LA1 A;  2R6K A;  1BQ7 A;  1NSW A;  1VF2 A;  4MPG A;  1Z3E A;  1HNA A;  4OFM A;  2PVO C;  4OMV A;  1A0F A;  3F6D A;  3HXS A;  3FK8 A;  4OCF A;  4EVM A;  2C0D A;  5HFK A;  4BL7 A;  2LTK A;  1R4W A;  2REM A;  3DXB A;  2L4C A;  3TOU A;  3GHA A;  2GQM A;  1TKD B;  1T3B A;  2N5A A;  3BOA A;  2E2G A;  3TJG A;  1O6J A;  4I2U A;  3ISO A;  5ECI B;  2LJA A;  3HVV A;  3UOM A;  4L0W A;  6GSU A;  2GQL A;  2VCW A;  1PD2 1;  3D22 A;  4PXO A;  2MBS A;  4TR0 A;  4HZ2 A;  3QDN A;  2YWN A;  4LLR A;  2I81 A;  5AIV A;  3EC3 A;  1UVZ A;  3KCM A;  4RI6 A;  3IAS 2;  4ECJ A;  4POB A;  2NDO A;  2LJK A;  1ZGN A;  1VRS D;  2RM6 A;  3F4R A;  4G2E A;  1JFU A;  2ZCT A;  5D96 A;  1XW6 A;  5ELG A;  1XW9 A;  1K0B A;  3GNJ A;  1V9W A;  2KOK A;  2GQK A;  4IKH A;  2BJX A;  1X5E A;  3H79 A;  1EP7 A;  3KZQ A;  1X5C A;  5D73 A;  4JZQ A;  1ZYE A;  4XS1 A;  1BG5 A;  4K1F A;  4EO3 A;  3UJ1 A;  1K0C A;  2IFQ A;  5ID2 B;  4OFN A;  1XWG A;  3NIV A;  1BYE A;  1I5G A;  2H1G A;  4KND A;  2H76 A;  3W6G A;  2EC4 A;  4O7H A;  3DKS A;  2CQ9 A;  5GZZ B;  4IEL A;  4KA0 A;  1TRV A;  1GUM A;  3CSJ A;  4NV5 A;  3J7Y b;  1GSU A;  3KH7 A;  1K0D A;  2H1A A;  2WDU A;  1YF0 A;  3H8Q A;  1JHB A;  2FHE A;  1F3B A;  2PPT A;  2HI7 A;  2IPA A;  3KTL A;  4L0U A;  4EDY A;  3ZIJ A;  2FLS A;  3RPP A;  4O92 A;  3UAP A;  1T7P B;  1XXU A;  2GSS A;  1K3L A;  2K8V A;  4V2M A;  3LOR A;  4CHS A;  3GH9 A;  1OKT A;  5HFG A;  3QAW A;  4E8H A;  2VOC A;  3I6A A;  4OO5 A;  3ZRE A;  3QOU A;  2WUL A;  5D8I A;  1S3A A;  2JSZ A;  3EU4 A;  2H71 A;  1Z6N A;  4PUF C;  2KP2 A;  3EIN A;  4NPB A;  3LYK A;  2GT5 A;  2PU9 C;  3QAG A;  1SKW B;  5DVB A;  2VL9 A;  5EL8 A;  1WP0 A;  3G9B A;  1XZO A;  2KUC A;  2VM1 A;  5ELA A;  2CV4 A;  5D93 A;  1KEB A;  4MCU A;  4ZBA A;  2WFC A;  3NOF A;  5IMZ A;  2H6X A;  3BCI A;  3L0H A;  2H73 A;  3E0U A;  2YV9 A;  1MDI A;  4NMU A;  3EU3 A;  1SD8 A;  2KLX A;  3IC4 A;  4DEJ A;  5CYY A;  2P5R A;  3F4S A;  4POM A;  5IPG A;  2BMX A;  2DJ3 A;  3VWV A;  5DAK B;  4MH2 A;  3VI5 A;  5A4W A;  4MJA A;  5DCH A;  2LQQ A;  2FY6 A;  4KCA A;  5DBQ A;  3CRT A; 
#chains in the Genus database with same CATH topology
 2GSQ A;  4MJC A;  2LS5 A;  4L5O A;  1EOH A;  2H75 A;  2VM2 A;  1GSE A;  2CA8 A;  2WS2 A;  1THO A;  4ZBB A;  3I9V 2;  3TDG A;  2EIR A;  4HUA A;  1YY7 A;  3CBU A;  5GSS A;  4PUR A;  3M0F A;  4IVF A;  3GKX A;  4ZL8 A;  4G10 A;  1ZL9 A;  3RDW A;  2ZNM A;  2DSA A;  3KD0 A;  4PTS A;  1PGT A;  2VCV A;  3VI7 A;  4V2L A;  1MDK A;  5JWR B;  3MNG A;  3TCO A;  1G6W A;  1T00 A;  5H5Q A;  4HU9 A;  2P31 A;  2M46 A;  5ECM B;  4L8E A;  5G1K A;  3O3T A;  2GVP A;  1YEX A;  2X99 A;  1FW1 A;  1TW9 A;  3UMA A;  1K0N A;  5LD0 A;  4GCI A;  1SYR A;  5JCU A;  1K0O A;  2MMA A;  3F3Q A;  1ERT A;  1FVJ A;  5IIZ A;  3ZVJ D;  4EXJ A;  3IHQ A;  2AJQ B;  4KSO A;  2C3N A;  3ZML A;  4WEY A;  3ZLP A;  2DJJ A;  4YH2 A;  4NXI A;  2YCD A;  2B6M A;  4ZBD A;  2GLR A;  1RK4 A;  2HSY A;  5J4U A;  3HDC A;  1O8W A;  1U3A A;  4QQ7 A;  3IOS A;  2WCI A;  1ZOF A;  5J9B A;  3GV1 A;  1A2M A;  3F6F A;  4N0Z A;  1FVK A;  18GS A;  2VAF A;  4ZXG A;  4RQR A;  4GST A;  1PL1 A;  1WWJ A;  3IA1 A;  1DE2 A;  4YQM A;  6GSX A;  2H19 A;  1S3R A;  3U5R E;  1QQ2 A;  2F9S A;  4HSC X;  5ABR A;  2DJK A;  3UL3 A;  1KBN A;  12GS A;  1PX7 A;  3GRX A;  3TKP A;  4AJ6 A;  4MAB A;  2H6Z A;  1YKA A;  5DDL A;  3M9J A;  3UBL A;  4BWQ A;  2DKH A;  2LJR A;  1AW9 A;  2HRF A;  2Z9S A;  1GNE A;  3ZMK A;  2YWM A;  4MDC A;  5KEJ A;  2RLI A;  3ZIT A;  3KIJ A;  3VWX A;  2N5B A;  1PN9 A;  4NV2 A;  3U6V A;  4HZ4 A;  1FOV A;  1VF3 A;  4RI7 A;  3WGD A;  5J41 A;  1ERV A;  1TU8 A;  2LRT A;  3ERG A;  5DQY A;  2FD3 A;  3L9V A;  5JWQ B;  4DSQ A;  2VD1 A;  5AN1 A;  2MYG A;  1SJZ A;  3O76 A;  4XIH A;  2HE3 A;  3I69 A;  2HZE B;  4F9Z A;  3DEX A;  3SWL A;  2MBT A;  4POL A;  4GXZ A;  2VCX A;  1OYJ A;  4KE3 A;  1MDJ A;  1F2E A;  17GS A;  2NTO A;  4BL7 B;  2H1D A;  1TU7 A;  4RUV A;  1BAY A;  4GLT A;  4K8M A;  8GSS A;  2YP6 A;  3GKK A;  3KMO A;  3HZ4 A;  3D4T A;  4MPF A;  4JRR A;  5J3R A;  4YKG A;  3CXG A;  5ECR B;  6GSV A;  2GST A;  3G7Y A;  1A2L A;  3TUE A;  5HR2 A;  1IYH A;  3IK9 A;  2HNL A;  2C1Y A;  1HD2 A;  3BD2 A;  3D21 A;  2HT9 A;  2VLT A;  1G7E A;  1N8J A;  3ZFB A;  4ZIJ A;  4ECC A;  2CVK A;  5J9C A;  3F9U A;  2B3S A;  2C0G A;  2L4Q A;  3CTG A;  4X43 A;  1LU4 A;  2R5G A;  3AY8 A;  3A2X A;  3C71 A;  1WOU A;  2FUG 2;  2OE1 A;  1GLP A;  4ML6 A;  1KTE A;  2DMM A;  1WJK A;  2YWO A;  4IQ1 A;  13GS A;  4D73 B;  5ECP B;  3MWH A;  4K9Z A;  2FWE A;  1E6B A;  3FRC A;  1KNG A;  4K2D A;  2MMO A;  2GZZ A;  1XFL A;  3A3T A;  3K8N A;  4IBP A;  3PR8 A;  1EWX A;  1PMT A;  3BJ5 A;  3D0Z A;  3FMW A;  2GZY A;  2FWH A;  2VL2 A;  4QL7 A;  1SJI A;  1SKR B;  4XRD A;  4IN0 A;  2I4A A;  3RBT A;  1EEJ A;  3US3 A;  2XBI A;  4AJ7 A;  1GNW A;  4J2F A;  3G7I A;  4EC0 A;  2VLV A;  3GN3 A;  4EL1 A;  2L5L A;  5IQY A;  1EP8 A;  4KH7 A;  1THX A;  1OVN A;  3GUR A;  2O85 A;  1XWB A;  1O85 A;  1C72 A;  1F3A A;  2WB9 A;  2AUV A;  5CO3 A;  5LNK e;  2HZE A;  2GSR A;  4PGT A;  3WGX A;  2JZT A;  19GS A;  1EV9 A;  3D5J A;  3PH9 A;  1JZD A;  1ILO A;  1M2B A;  1OKD A;  1A8L A;  5F06 A;  2C80 A;  1H75 A;  2RUF A;  2CZ3 A;  5EPF A;  2R3X A;  5G2Z A;  2GTU A;  2FGX A;  3MIX A;  3KTB A;  1FOH A;  4YAP A;  1TXX A;  3FR3 A;  2HXK A;  2O89 A;  3DWV A;  3KMN A;  5COH A;  5BRT A;  1GUH A;  2F51 A;  5DQS A;  5A4V A;  4MP4 A;  4IP6 A;  1DSB A;  5GAP D;  5A4U A;  1FO5 A;  5H5S A;  3L4N A;  1GSF A;  2RUE A;  2AB6 A;  2LNS A;  2V32 A;  1J9B A;  1WPI A;  2H8L A;  2OJL A;  3P90 A;  3LWA A;  1U3I A;  1MEK A;  3IBH A;  2C3Q A;  4MF7 A;  4OWY A;  2NBS A;  1F37 A;  2CX3 A;  1QXH A;  3KJY A;  1F6M C;  1PRX A;  3TRQ A;  5JCG A;  3KP9 A;  3PGT A;  1GLQ A;  2VUP A;  3JCM L;  2LKU A;  1OE8 A;  3UAR A;  4D73 A;  1AIU A;  4CY8 A;  1Z7R A;  2DIY A;  1V57 A;  20GS A;  1A0R P;  2WJU A;  1SYX A;  4X0X A;  1DE1 A;  1GSY A;  4PQI A;  1QFN A;  3J7Y k;  4MNN A;  4EF0 A;  6GSW A;  4ULX A;  2IMD A;  3TJJ A;  2ZUP A;  2A2P A;  4GQF A;  5D9V A;  2CAQ A;  1ON4 A;  2JZS A;  1V58 A;  2DC5 A;  3TKQ A;  1Q98 A;  2LEG A;  4ZL9 A;  4POK A;  5IMA A;  5G5E A;  4ZIL A;  3ZRD A;  3KGK A;  1GTB A;  3PIN A;  4CW9 A;  4K0G A;  1JZR A;  5HR1 A;  3FEU A;  2WZ9 A;  1AQW A;  3L78 A;  1I9D A;  1TI3 A;  1T4Y A;  5D9T A;  5CRD A;  3C8E A;  3EWL A;  2QC7 A;  3Q74 A;  2LST A;  3HVS A;  10GS A;  2HSM A;  5C00 A;  3F3R A;  3P7X A;  4PUA A;  4K7O A;  5D9X A;  1XPV A;  2L6C A;  3SBC A;  11GS A;  4TW5 A;  3WGE A;  2H70 A;  2J23 A;  3ZZX A;  2DLX A;  3F0I A;  3IC8 A;  2MMZ A;  2ON7 A;  5CP1 A;  3DVW A;  2OBK A;  1VF4 A;  1JLW A;  4BVY A;  2YV7 A;  1XOA A;  3DVX A;  2CX4 A;  2X4A A;  2YNX A;  2DKI A;  3BCK A;  1Z7P A;  3E9J B;  4EDZ A;  2TRC P;  1PFO A;  1YQ1 A;  3EUR A;  1XWC A;  5KN3 A;  4YQU A;  4OD7 A;  3LFL A;  22GS A;  4KCE A;  5ECN B;  3TGZ A;  2X8C A;  3ZIV A;  5BMU A;  5KN1 A;  3R2Q A;  3LQ7 A;  4TN8 A;  3TJB A;  1TP9 A;  2HRK A;  2PWJ A;  2GT6 A;  3DRN A;  5EY6 A;  2V6K A;  3N5O A;  5GST A;  1OC3 A;  4KX4 A;  1TK8 B;  3IR4 A;  1Z5Y E;  5KN2 A;  1M0U A;  3UBK A;  1A24 A;  3M9K A;  4I6X A;  3P8W A;  5FHI A;  2LRN A;  2FNO A;  2DJ1 A;  1SK2 A;  4AF2 A;  5INY A;  2J9H A;  2NVL A;  2A2R A;  5CNW A;  1MD4 A;  4MK3 A;  3ZTL A;  3M8N A;  1X9W B;  1EZK A;  3V1W A;  2L59 A;  4G0K A;  3DGQ A;  5G30 A;  2JAD A;  1TI1 A;  2B7K A;  2AV4 A;  3EMX A;  3A5W A;  4HI7 A;  1BX9 A;  5ECL B;  4G0L A;  5ECO B;  4IJI A;  5ECH B;  5F05 A;  5GAN D;  3FHK A;  2K9F A;  3Q18 A;  5HR0 A;  1HQO A;  1TRU A;  2H0G A;  4OCE A;  3HCZ A;  4LMV A;  1ZZY A;  1SL2 B;  2L57 A;  2RII A;  1GSQ A;  1Q4J A;  3QAV A;  4Q5F A;  2YOI A;  2QGV A;  1YF1 A;  3GX0 A;  3UVH A;  4KW6 A;  3VWW A;  1NW2 A;  1M9B A;  1GRX A;  1HNB A;  3CRU A;  4EE0 A;  3FKF A;  4LMW A;  1XOB A;  3ZVJ A;  2VIM A;  3GL5 A;  4F03 A;  1GL8 A;  3UIW A;  1SEN A;  4F0C A;  2CZ2 A;  4DSS A;  1AC1 A;  2MMN A;  2H01 A;  3WYW A;  1GSS A;  2I1U A;  1A2J A;  5AIX A;  1IYI A;  4MZC A;  4JBB A;  4WET A;  2OAC A;  2FWF A;  1O81 A;  3Q6O A;  5L71 A;  1YDK A;  4FIW A;  4CDO A;  5F07 A;  1XW5 A;  3MSZ A;  4FO5 A;  3FR6 A;  2XPE A;  3DML A;  2H66 A;  5AIS A;  1X5D A;  3H93 A;  5E59 A;  2R0G A;  3GMF A;  4FYC A;  3IE3 A;  4P3Y B;  4KF9 A;  1FAA A;  2I9H A;  1K3O A;  5IPH A;  3FYG A;  2G0F A;  2YN1 A;  1U88 A;  3GKM A;  2H30 A;  5G5F A;  2M72 A;  4LL1 B;  4MLY A;  4KDY A;  3CTF A;  4JED A;  1TTZ A;  2PER A;  3FY7 A;  1GUL A;  3TKR A;  4HJM A;  4ECI A;  4J56 E;  4YKF A;  2E2M A;  4ECB A;  1JLV A;  6GSY A;  3MAK A;  3GFK A;  1TOF A;  4KDU A;  2AAW A;  1QK8 A;  4F0B A;  2CVD A;  4BIK A;  2B5E A;  2O7K A;  1T8E B;  3VPQ A;  3CMI A;  3IAM 2;  1PKZ A;  5HQP A;  3IHG A;  1HYU A;  4Z2R A;  4V2N A;  3HD5 A;  1QMV A;  2F8A A;  4K7N A;  3KP8 A;  1TDI A;  3IXR A;  3QMX A;  3APQ A;  2AYT A;  4MF5 A;  4FH8 A;  1SKS B;  1K0A A;  2HZF A;  2H74 A;  5ECQ B;  5KOW A;  1X0R A;  2C0F A;  2DIZ A;  2XHF A;  2B1K A;  2DBC A;  2AHE A;  4GTU A;  2VL2 C;  4I8B A;  4V1A g;  3LYP A;  4H86 A;  1DBY A;  3FR9 A;  3EPT A;  4N10 A;  6GSS A;  2QKE A;  1O73 A;  4K0N A;  4HEA 2;  2C4J A;  4MZW A;  1R5A A;  2RM5 A;  4MMM A;  1M9A A;  4XS4 B;  1Y25 A;  5CRG A;  3WT1 A;  3LXT A;  3ZFL A;  3TJF A;  5IM9 A;  1GH2 A;  2P5Q A;  3GSS A;  1F9M A;  2GGT A;  1EGR A;  2DJ2 A;  2IJY A;  4V1A p;  2X49 A;  1HNC A;  5A5K A;  1N2A A;  3ERF A;  4IJ3 A;  1PSQ A;  4OFT A;  7GSS A;  4KDX A;  3D4M A;  3DIE A;  1S3C A;  1M3I A;  3QFA C;  4PX1 A;  4WBJ A;  1B9X C;  2B5X A;  4KB3 A;  1R26 A;  3EYT A;  2EIO A;  3ZYW A;  2H1B A;  1RQM A;  3KEB A;  2OE0 A;  4BWS A;  2IMF A;  2P0G A;  2A4H A;  4MJB A;  3S9F A;  2C0E A;  2LUS A;  2X8G A;  3ZL5 A;  2TRX A;  2V41 A;  3ME8 A;  1AQX A;  2PN8 A;  5B8A A;  1YJ6 A;  1W4V A;  3ERW A;  1XWA A;  4Q5N A;  4TR3 A;  4I97 A;  1U87 A;  4TRX A;  1RW1 A;  1NHY A;  3KM6 A;  4IGJ A;  1ZYN A;  1Z6M A;  3LGC A;  3EMP A;  1M3J A;  3EVI A;  1U6T A;  4E8E A;  5D9W A;  4TR1 A;  4K7I A;  4HJ2 A;  3LG6 A;  1R7H A;  4GSS A;  1PX6 A;  2OBI A;  1AQV A;  4KGI A;  3TKS A;  3LEF A;  4WF5 A;  3QR6 A;  2O87 A;  4BA7 A;  2HLS A;  2R4V A;  4A5P A;  4PNF A;  4JR4 A;  1MD3 A;  4G9H A;  1ERW A;  1V98 A;  4NHZ A;  2B5Y A;  3I43 A;  2VL3 A;  4BVY B;  2HSH A;  1EOG A;  1M99 A;  4MH3 A;  1XVQ A;  5HR3 A;  5DAL A;  1UN2 A;  4O5R A;  3L9S A;  4EIP A;  4JR6 A;  2HYX A;  2KHP A;  2HRA A;  5JCW A;  5IO0 A;  5E4W A;  4JU5 A;  1WE0 A;  4O32 A;  3IK7 A;  4EUY A;  3IPZ A;  3FW2 A;  5G31 A;  5J5N A;  1VF1 A;  1XG8 A;  3TOT A;  1G6Y A;  2I3Y A;  4GRF A;  1ML6 A;  2LRC A;  3APO A;  4PNG A;  4XS4 A;  4NWY A;  2YJ7 A;  5B6M A;  5C04 A;  5B7C A;  1T1V A;  2H0H A;  1B9Y C;  3WT2 A;  3VWU A;  3G7J A;  1B8X A;  4NHW A;  1WMJ A;  5B6N A;  1FG4 A;  1B4Q A;  1EGO A;  3HA9 A;  4MA9 A;  4XTS A;  5IMD A;  4KUN A;  1FHE A;  2FA4 A;  3GUS A;  3F4T A;  4K6X A;  2NPB A;  1T4Z A;  2IWT A;  2KP1 A;  3QPM A;  2E0Q A;  2M80 A;  1XIY A;  2PUK C;  2R37 A;  4KAE A;  4Z2U A;  5IMC A;  4FYU A;  2VD0 A;  4DVC A;  1TK0 B;  4KSM A;  2N5F A;  1XBS A;  3GTU A;  5DJL A;  1VGL A;  3TJK A;  5HFI A;  4QL9 A;  3NZN A;  3VPT A;  2XPD A;  4G19 A;  3KH9 A;  1K0M A;  4ZB9 A;  3HHV A;  2PMT A;  1TJD A;  1EEM A;  4Q5R A;  4BVX B;  5ECS A;  1URM A;  1M7T A;  2JSY A;  3QFB C;  2WGR A;  1G7O A;  9GSS A;  1GP1 A;  2YZH A;  2OA7 A;  3GKN A;  4N30 A;  1K3Y A;  3LSZ A;  1OE7 A;  5CRE A;  1SL0 B;  2XC2 A;  2IMI A;  3D6I A;  1PKW A;  2F3M A;  3GL3 A;  1R5P A;  2IN3 A;  3HZ8 A;  3WD6 A;  3APS A;  1XVW A;  1OC9 B;  4MF6 A;  4DSS B;  1J0F A;  1E2Y A;  2YWI A;  1SD9 A;  4EIQ A;  1M2D A;  4HQS A;  4AJ8 A;  1O8X A;  5AGY A;  4USS A;  5CAX A;  3CSI A;  4WKW A;  3ED3 A;  3C1R A;  3TRP A;  1YZX A;  2V2G A;  1Y6E A;  1B4P A;  1A8Y A;  4FQU A;  4TOP A;  4PQH A;  3QD9 A;  2IMK A;  1ZMA A;  3LXZ A;  3R3E A;  3C73 A;  4JE1 A;  3E3E A;  4HS1 A;  4ZB8 A;  3PPU A;  4GWR A;  3GST A;  2HRN A;  2FCH A;  1UC7 A;  4WF4 A;  3P2A A;  4LL4 B;  1W89 A;  1YEP A;  1AUC A;  3F63 A;  3Q19 A;  4GF0 A;  2DJ0 A;  3HJM A;  4OO4 A;  1SJ6 A;  5JWO B;  1JZW A;  2A2S A;  2B1L A;  3DD3 A;  4ML1 A;  2YJH A;  3VFI A;  3H4K A;  2LV3 A;  1AXD A;  1M2A A;  1ZCP A;  2MZC A;  1FB6 A;  2H6Y A;  3FZA A;  1QGV A;  2O8V B;  3HY2 A;  2PVQ A;  3HYP A;  1TRW A;  1GTA A;  1S3D A;  1A23 A;  2VCT A;  3HVN A;  2YPM A;  1YKC A;  4EKZ A;  2K8S A;  5B8B A;  3GA4 A;  4MJE A;  1V2A A;  16GS A;  1X9M B;  3IV4 A;  4XRA A;  6GST A;  2ON5 A;  5H5R A;  5ID2 A;  2L6D A;  2VLU A;  4I2T A;  2UZ8 A;  3RPN A;  1JZO A;  4TXO B;  1H4O A;  4ILF A;  4TKY A;  1GTI A;  4XCS A;  5F8B A;  4HU7 A;  3TB2 A;  2FA8 A;  4BVX A;  4PQ1 A;  1PA3 A;  2IL3 A;  2TIR A;  5G1L A;  2GS3 A;  3ME7 A;  4X4J A;  4WBR D;  1WRY A;  2C8U A;  3W8S A;  4K2X A;  3IRA A;  4Q5Q A;  1NM3 A;  2JU5 A;  4F82 A;  3TRX A;  3C1S A;  1CQG A;  2VO4 A;  3IDV A;  1OC9 A;  4MZB A;  4K5R A;  4YQV A;  14GS A;  2K6V A;  3VK9 A;  4F2I A;  2R0P A;  3C7M A;  2LNT A;  1MTC A;  4AGS A;  5IO2 A;  2JL4 A;  1FB0 A;  3HJP A;  4ZB6 A;  3RHB A;  3W8J A;  2CT6 A;  2DML A;  3EE2 A;  4WR5 A;  3MDK A;  2H72 A;  2V1M A;  5FT3 A;  3RHC A;  4BPY A;  2ALB A;  2IME A;  3RAZ A;  4HDE A;  3M1G A;  2JAC A;  3VLN A;  1G0T A;  2L5O A;  5IMF A;  4ZL7 A;  4HQZ A;  3H1N A;  2XBQ A;  1ZYQ B;  1SK1 A;  1LBK A;  4J57 E;  5LCZ A;  1OC8 A;  3KXO A;  1X9S B;  2E7P A;  3OR5 A;  5ECK B;  1UA5 A;  3QCP A;  3N9J A;  2ES7 A;  3O6T A;  2VCQ A;  3HJO A;  4TR1 B;  1EV4 A;  2OAD A;  4Z2T A;  2VCZ A;  5DAK A;  5DCG A;  4I5Q A;  4O5Q A;  1ERU A;  4NAX A;  4N0V A;  4GQC A;  1TK5 B;  1SK0 A;  2BTO T;  2R2J A;  2CVB A;  2YAN A;  4IP1 A;  1OAZ A;  3MYD A;  4TXO A;  5DAL B;  2GZP A;  4ID0 A;  2K18 A;  1BED A;  2LQO A;  2F8F A;  4IW9 A;  3GH6 A;  4X1U A;  4ACS A;  2QA2 A;  4GSN A;  1PN0 A;  2GDR A;  2HFD A;  3FZ4 A;  1BJX A;  1DUG A;  3A2W A;  1XWK A;  1O7U A;  1XCC A;  2WRT A;  4IS0 A;  2QSI A;  1LJR A;  3VUR A;  1PL2 A;  3GYK A;  3DYR A;  3L9U A;  4IQA A;  5ENU A;  1GSD A;  3UEM A;  5CRH A;  1B48 A;  4XHM A;  5CRW A;  3CSH A;  4TR4 A;  1WIK A;  2B7J A;  3BBY A;  5DJM A;  3HVX A;  3TKS C;  4YAV A;  5FWG A;  1SL1 B;  3FZ5 A;  4HOJ A;  4L5L A;  4DSR A;  2PBJ A;  4N11 A;  1PQN A;  3HKR A;  1GTU A;  3GX8 A;  2OKA A;  3UVT A;  2EIQ A;  2D2Z A;  4Z7X A;  2PGT A;  5IOW A;  1USB A;  3M3M A;  3A2V A;  3GTU B;  4ISD A;  3LJR A;  4WR4 A;  2YZU A;  1J08 A;  1SU9 A;  1GWC A;  2A4V A;  3CYN A;  4IHU A;  2IFQ B;  2X64 A;  3LW9 A;  5F0G A;  1ST9 A;  2V6O A;  3FZ9 A;  2C3T A;  4WXT A;  1Z9H A;  3F8U A;  4TVE A;  5KN0 A;  1QUW A;  3TKS E;  1CQH A;  1AAZ A;  1ABA A;  4XS6 A;  5EVO A;  5IMV A;  4RQX A;  2JZR A;  3GIX A;  2OE3 A;  4FYB A;  1ACV A;  1TRS A;  1GUK A;  5IOX A;  2X8H A;  4TXV A;  1NHO A;  2FWG A;  2CAI A;  2H0I A;  1V40 A;  2IIY A;  2G2Q A;  4LA1 A;  2R6K A;  1BQ7 A;  1NSW A;  1VF2 A;  4MPG A;  1Z3E A;  1HNA A;  4OFM A;  2PVO C;  4OMV A;  2R0C A;  1A0F A;  3F6D A;  3HXS A;  3FK8 A;  4OCF A;  4EVM A;  2C0D A;  5HFK A;  4BL7 A;  2LTK A;  1R4W A;  2REM A;  3DXB A;  2L4C A;  3TOU A;  3GHA A;  2GQM A;  1TKD B;  1T3B A;  2N5A A;  3BOA A;  2E2G A;  3TJG A;  1O6J A;  4I2U A;  3ISO A;  5ECI B;  2LJA A;  3HVV A;  3UOM A;  4L0W A;  6GSU A;  2GQL A;  2VCW A;  1PD2 1;  3D22 A;  4PXO A;  2MBS A;  4TR0 A;  4HZ2 A;  3QDN A;  2YWN A;  4LLR A;  2I81 A;  5AIV A;  3EC3 A;  1UVZ A;  3KCM A;  4RI6 A;  3IAS 2;  4ECJ A;  4POB A;  2NDO A;  2LJK A;  1ZGN A;  1VRS D;  2RM6 A;  3F4R A;  4G2E A;  1JFU A;  2ZCT A;  5D96 A;  1XW6 A;  5ELG A;  1XW9 A;  1K0B A;  3GNJ A;  1V9W A;  2KOK A;  2GQK A;  4IKH A;  2BJX A;  1X5E A;  3H79 A;  1EP7 A;  3KZQ A;  1X5C A;  5D73 A;  4JZQ A;  1ZYE A;  4XS1 A;  1BG5 A;  4K1F A;  4EO3 A;  3UJ1 A;  1K0C A;  3A5I A;  2IFQ A;  5ID2 B;  4OFN A;  1XWG A;  3NIV A;  1BYE A;  1I5G A;  2H1G A;  4KND A;  2H76 A;  3W6G A;  2EC4 A;  4O7H A;  3DKS A;  2CQ9 A;  5GZZ B;  4ICY A;  4IEL A;  4KA0 A;  1TRV A;  1GUM A;  4O5U A;  3CSJ A;  4NV5 A;  3J7Y b;  1GSU A;  3KH7 A;  1K0D A;  2H1A A;  2WDU A;  1YF0 A;  3H8Q A;  1JHB A;  2FHE A;  1F3B A;  2PPT A;  2HI7 A;  2IPA A;  4CY6 A;  4K5S A;  3KTL A;  4L0U A;  4EDY A;  3ZIJ A;  2FLS A;  3RPP A;  4O92 A;  3UAP A;  1T7P B;  1XXU A;  2GSS A;  1K3L A;  2K8V A;  4V2M A;  3LOR A;  4CHS A;  3GH9 A;  1OKT A;  5HFG A;  3QAW A;  4E8H A;  2VOC A;  1ZYP A;  4G0I A;  3I6A A;  4OO5 A;  3ZRE A;  3QOU A;  2WUL A;  5D8I A;  1S3A A;  2JSZ A;  3EU4 A;  2H71 A;  1Z6N A;  4PUF C;  2KP2 A;  5KOX A;  3EIN A;  4NPB A;  3LYK A;  2GT5 A;  2PU9 C;  3QAG A;  1SKW B;  5DVB A;  2VL9 A;  5EL8 A;  1WP0 A;  3G9B A;  1XZO A;  2KUC A;  2VM1 A;  2CV4 A;  5ELA A;  5D93 A;  1KEB A;  4MCU A;  4ZBA A;  2WFC A;  3NOF A;  5IMZ A;  2H6X A;  3BCI A;  3L0H A;  2H73 A;  3E0U A;  2YV9 A;  3CQF A;  1MDI A;  4NMU A;  3EU3 A;  1SD8 A;  2KLX A;  3IC4 A;  4DEJ A;  5CYY A;  2P5R A;  3F4S A;  4POM A;  5IPG A;  2BMX A;  2DJ3 A;  3VWV A;  5DAK B;  4MH2 A;  3VI5 A;  5A4W A;  2QA1 A;  4MJA A;  5DCH A;  2LQQ A;  2FY6 A;  4KCA A;  5DBQ A;  3CRT A; 
#chains in the Genus database with same CATH homology
 2GSQ A;  4MJC A;  2LS5 A;  4L5O A;  1EOH A;  2H75 A;  2VM2 A;  1GSE A;  2CA8 A;  2WS2 A;  1THO A;  4ZBB A;  3I9V 2;  3TDG A;  2EIR A;  4HUA A;  1YY7 A;  3CBU A;  5GSS A;  4PUR A;  3M0F A;  4IVF A;  3GKX A;  4ZL8 A;  4G10 A;  1ZL9 A;  3RDW A;  2ZNM A;  2DSA A;  3KD0 A;  4PTS A;  1PGT A;  2VCV A;  3VI7 A;  4V2L A;  1MDK A;  5JWR B;  3MNG A;  3TCO A;  1G6W A;  1T00 A;  5H5Q A;  4HU9 A;  2P31 A;  2M46 A;  5ECM B;  4L8E A;  5G1K A;  3O3T A;  2GVP A;  1YEX A;  2X99 A;  1FW1 A;  1TW9 A;  3UMA A;  1K0N A;  5LD0 A;  4GCI A;  1SYR A;  5JCU A;  1K0O A;  2MMA A;  3F3Q A;  1ERT A;  1FVJ A;  5IIZ A;  3ZVJ D;  4EXJ A;  3IHQ A;  2AJQ B;  4KSO A;  2C3N A;  3ZML A;  4WEY A;  3ZLP A;  2DJJ A;  4YH2 A;  4NXI A;  2YCD A;  2B6M A;  4ZBD A;  2GLR A;  1RK4 A;  2HSY A;  5J4U A;  3HDC A;  1O8W A;  1U3A A;  4QQ7 A;  3IOS A;  2WCI A;  1ZOF A;  5J9B A;  3GV1 A;  1A2M A;  3F6F A;  4N0Z A;  1FVK A;  18GS A;  2VAF A;  4ZXG A;  4RQR A;  4GST A;  1PL1 A;  1WWJ A;  3IA1 A;  1DE2 A;  4YQM A;  6GSX A;  2H19 A;  3U5R E;  1QQ2 A;  2F9S A;  5ABR A;  2DJK A;  3UL3 A;  1KBN A;  12GS A;  1PX7 A;  3GRX A;  3TKP A;  4AJ6 A;  4MAB A;  2H6Z A;  1YKA A;  5DDL A;  3M9J A;  3UBL A;  4BWQ A;  2DKH A;  2LJR A;  1AW9 A;  2HRF A;  2Z9S A;  1GNE A;  3ZMK A;  2YWM A;  4MDC A;  5KEJ A;  2RLI A;  3ZIT A;  3KIJ A;  3VWX A;  2N5B A;  1PN9 A;  4NV2 A;  3U6V A;  4HZ4 A;  1FOV A;  1VF3 A;  4RI7 A;  3WGD A;  5J41 A;  1ERV A;  1TU8 A;  2LRT A;  3ERG A;  5DQY A;  2FD3 A;  3L9V A;  5JWQ B;  4DSQ A;  2VD1 A;  5AN1 A;  2MYG A;  1SJZ A;  3O76 A;  4XIH A;  2HE3 A;  3I69 A;  2HZE B;  4F9Z A;  3DEX A;  3SWL A;  2MBT A;  4POL A;  4GXZ A;  2VCX A;  1OYJ A;  4KE3 A;  1MDJ A;  1F2E A;  17GS A;  2NTO A;  4BL7 B;  2H1D A;  1TU7 A;  4RUV A;  1BAY A;  4GLT A;  4K8M A;  8GSS A;  2YP6 A;  3GKK A;  3KMO A;  3HZ4 A;  3D4T A;  4MPF A;  4JRR A;  5J3R A;  4YKG A;  3CXG A;  5ECR B;  6GSV A;  2GST A;  3G7Y A;  1A2L A;  3TUE A;  5HR2 A;  1IYH A;  3IK9 A;  2HNL A;  2C1Y A;  1HD2 A;  3BD2 A;  3D21 A;  2HT9 A;  2VLT A;  1G7E A;  1N8J A;  3ZFB A;  4ZIJ A;  4ECC A;  2CVK A;  5J9C A;  3F9U A;  2B3S A;  2C0G A;  2L4Q A;  3CTG A;  4X43 A;  1LU4 A;  2R5G A;  3AY8 A;  3A2X A;  3C71 A;  1WOU A;  2FUG 2;  2OE1 A;  1GLP A;  4ML6 A;  1KTE A;  2DMM A;  1WJK A;  2YWO A;  4IQ1 A;  13GS A;  4D73 B;  5ECP B;  3MWH A;  4K9Z A;  2FWE A;  1E6B A;  3FRC A;  1KNG A;  4K2D A;  2MMO A;  2GZZ A;  1XFL A;  3A3T A;  3K8N A;  4IBP A;  3PR8 A;  1EWX A;  1PMT A;  3BJ5 A;  3D0Z A;  3FMW A;  2GZY A;  2FWH A;  2VL2 A;  4QL7 A;  1SJI A;  1SKR B;  4XRD A;  4IN0 A;  2I4A A;  3RBT A;  1EEJ A;  3US3 A;  2XBI A;  4AJ7 A;  1GNW A;  4J2F A;  3G7I A;  4EC0 A;  2VLV A;  3GN3 A;  4EL1 A;  2L5L A;  5IQY A;  1EP8 A;  4KH7 A;  1THX A;  1OVN A;  3GUR A;  2O85 A;  1XWB A;  1O85 A;  1C72 A;  1F3A A;  2WB9 A;  2AUV A;  5CO3 A;  5LNK e;  2HZE A;  2GSR A;  4PGT A;  3WGX A;  2JZT A;  19GS A;  1EV9 A;  3D5J A;  3PH9 A;  1JZD A;  1ILO A;  1M2B A;  1OKD A;  1A8L A;  5F06 A;  2C80 A;  1H75 A;  2RUF A;  2CZ3 A;  5EPF A;  2R3X A;  5G2Z A;  2GTU A;  2FGX A;  3MIX A;  3KTB A;  1FOH A;  4YAP A;  1TXX A;  3FR3 A;  2HXK A;  2O89 A;  3DWV A;  3KMN A;  5COH A;  5BRT A;  1GUH A;  2F51 A;  5DQS A;  5A4V A;  4MP4 A;  4IP6 A;  1DSB A;  5GAP D;  5A4U A;  1FO5 A;  5H5S A;  3L4N A;  1GSF A;  2RUE A;  2AB6 A;  2LNS A;  2V32 A;  1J9B A;  1WPI A;  2H8L A;  2OJL A;  3P90 A;  3LWA A;  1U3I A;  1MEK A;  3IBH A;  2C3Q A;  4MF7 A;  4OWY A;  2NBS A;  1F37 A;  2CX3 A;  1QXH A;  3KJY A;  1F6M C;  1PRX A;  3TRQ A;  5JCG A;  3KP9 A;  3PGT A;  1GLQ A;  2VUP A;  3JCM L;  2LKU A;  1OE8 A;  3UAR A;  4D73 A;  1AIU A;  4CY8 A;  1Z7R A;  2DIY A;  1V57 A;  20GS A;  1A0R P;  2WJU A;  1SYX A;  4X0X A;  1DE1 A;  1GSY A;  4PQI A;  1QFN A;  3J7Y k;  4MNN A;  4EF0 A;  6GSW A;  4ULX A;  2IMD A;  3TJJ A;  2ZUP A;  2A2P A;  4GQF A;  5D9V A;  2CAQ A;  1ON4 A;  2JZS A;  1V58 A;  2DC5 A;  3TKQ A;  1Q98 A;  2LEG A;  4ZL9 A;  4POK A;  5IMA A;  5G5E A;  4ZIL A;  3ZRD A;  3KGK A;  1GTB A;  3PIN A;  4CW9 A;  4K0G A;  1JZR A;  5HR1 A;  3FEU A;  2WZ9 A;  1AQW A;  3L78 A;  1I9D A;  1TI3 A;  1T4Y A;  5D9T A;  5CRD A;  3C8E A;  3EWL A;  2QC7 A;  3Q74 A;  2LST A;  3HVS A;  10GS A;  2HSM A;  5C00 A;  3F3R A;  3P7X A;  4PUA A;  4K7O A;  5D9X A;  1XPV A;  2L6C A;  3SBC A;  11GS A;  4TW5 A;  3WGE A;  2H70 A;  2J23 A;  3ZZX A;  2DLX A;  3F0I A;  3IC8 A;  2MMZ A;  2ON7 A;  5CP1 A;  3DVW A;  2OBK A;  1VF4 A;  1JLW A;  4BVY A;  2YV7 A;  1XOA A;  3DVX A;  2CX4 A;  2X4A A;  2YNX A;  2DKI A;  3BCK A;  1Z7P A;  3E9J B;  4EDZ A;  2TRC P;  1YQ1 A;  3EUR A;  1XWC A;  5KN3 A;  4YQU A;  4OD7 A;  3LFL A;  22GS A;  4KCE A;  5ECN B;  3TGZ A;  2X8C A;  3ZIV A;  5BMU A;  5KN1 A;  3R2Q A;  3LQ7 A;  4TN8 A;  3TJB A;  1TP9 A;  2HRK A;  2PWJ A;  2GT6 A;  3DRN A;  5EY6 A;  2V6K A;  3N5O A;  5GST A;  1OC3 A;  4KX4 A;  1TK8 B;  3IR4 A;  1Z5Y E;  5KN2 A;  1M0U A;  3UBK A;  1A24 A;  3M9K A;  4I6X A;  3P8W A;  5FHI A;  2LRN A;  2FNO A;  2DJ1 A;  1SK2 A;  4AF2 A;  5INY A;  2J9H A;  2NVL A;  2A2R A;  5CNW A;  1MD4 A;  4MK3 A;  3ZTL A;  3M8N A;  1X9W B;  1EZK A;  3V1W A;  2L59 A;  4G0K A;  3DGQ A;  5G30 A;  2JAD A;  1TI1 A;  2B7K A;  2AV4 A;  3EMX A;  3A5W A;  4HI7 A;  1BX9 A;  5ECL B;  4G0L A;  5ECO B;  4IJI A;  5ECH B;  5F05 A;  5GAN D;  3FHK A;  2K9F A;  3Q18 A;  5HR0 A;  1HQO A;  1TRU A;  2H0G A;  4OCE A;  3HCZ A;  4LMV A;  1ZZY A;  1SL2 B;  2L57 A;  2RII A;  1GSQ A;  1Q4J A;  3QAV A;  4Q5F A;  2YOI A;  2QGV A;  1YF1 A;  3GX0 A;  3UVH A;  4KW6 A;  3VWW A;  1NW2 A;  1M9B A;  1GRX A;  1HNB A;  3CRU A;  4EE0 A;  3FKF A;  4LMW A;  1XOB A;  3ZVJ A;  2VIM A;  3GL5 A;  4F03 A;  1GL8 A;  3UIW A;  1SEN A;  4F0C A;  2CZ2 A;  4DSS A;  1AC1 A;  2MMN A;  2H01 A;  3WYW A;  1GSS A;  2I1U A;  1A2J A;  5AIX A;  1IYI A;  4MZC A;  4JBB A;  4WET A;  2OAC A;  2FWF A;  1O81 A;  3Q6O A;  5L71 A;  1YDK A;  4FIW A;  4CDO A;  5F07 A;  1XW5 A;  3MSZ A;  4FO5 A;  3FR6 A;  2XPE A;  3DML A;  2H66 A;  5AIS A;  1X5D A;  3H93 A;  5E59 A;  2R0G A;  3GMF A;  4FYC A;  3IE3 A;  4P3Y B;  4KF9 A;  1FAA A;  2I9H A;  1K3O A;  5IPH A;  3FYG A;  2G0F A;  2YN1 A;  1U88 A;  3GKM A;  2H30 A;  5G5F A;  2M72 A;  4LL1 B;  4MLY A;  4KDY A;  3CTF A;  4JED A;  1TTZ A;  2PER A;  3FY7 A;  1GUL A;  3TKR A;  4HJM A;  4ECI A;  4J56 E;  4YKF A;  2E2M A;  4ECB A;  1JLV A;  6GSY A;  3MAK A;  3GFK A;  1TOF A;  4KDU A;  2AAW A;  1QK8 A;  4F0B A;  2CVD A;  2B5E A;  2O7K A;  1T8E B;  3VPQ A;  3CMI A;  3IAM 2;  1PKZ A;  5HQP A;  3IHG A;  1HYU A;  4Z2R A;  4V2N A;  3HD5 A;  1QMV A;  2F8A A;  4K7N A;  3KP8 A;  1TDI A;  3IXR A;  3QMX A;  3APQ A;  2AYT A;  4MF5 A;  4FH8 A;  1SKS B;  1K0A A;  2HZF A;  2H74 A;  5ECQ B;  5KOW A;  1X0R A;  2C0F A;  2DIZ A;  2XHF A;  2B1K A;  2DBC A;  2AHE A;  4GTU A;  2VL2 C;  4I8B A;  4V1A g;  3LYP A;  4H86 A;  1DBY A;  3FR9 A;  3EPT A;  4N10 A;  6GSS A;  2QKE A;  1O73 A;  4K0N A;  4HEA 2;  2C4J A;  4MZW A;  1R5A A;  2RM5 A;  4MMM A;  1M9A A;  4XS4 B;  1Y25 A;  5CRG A;  3WT1 A;  3LXT A;  3ZFL A;  3TJF A;  5IM9 A;  1GH2 A;  2P5Q A;  3GSS A;  1F9M A;  2GGT A;  1EGR A;  2DJ2 A;  2IJY A;  4V1A p;  2X49 A;  1HNC A;  5A5K A;  1N2A A;  3ERF A;  4IJ3 A;  1PSQ A;  4OFT A;  7GSS A;  4KDX A;  3D4M A;  3DIE A;  1S3C A;  3QFA C;  4PX1 A;  4WBJ A;  1B9X C;  2B5X A;  4KB3 A;  1R26 A;  3EYT A;  2EIO A;  3ZYW A;  2H1B A;  1RQM A;  3KEB A;  2OE0 A;  4BWS A;  2IMF A;  2P0G A;  2A4H A;  4MJB A;  3S9F A;  2C0E A;  2LUS A;  2X8G A;  3ZL5 A;  2TRX A;  2V41 A;  3ME8 A;  1AQX A;  2PN8 A;  5B8A A;  1YJ6 A;  1W4V A;  3ERW A;  1XWA A;  4Q5N A;  4TR3 A;  4I97 A;  1U87 A;  4TRX A;  1RW1 A;  1NHY A;  3KM6 A;  4IGJ A;  1ZYN A;  1Z6M A;  3LGC A;  3EMP A;  3EVI A;  1U6T A;  4E8E A;  5D9W A;  4TR1 A;  4K7I A;  4HJ2 A;  3LG6 A;  1R7H A;  4GSS A;  1PX6 A;  2OBI A;  1AQV A;  4KGI A;  3TKS A;  3LEF A;  4WF5 A;  3QR6 A;  2O87 A;  4BA7 A;  2HLS A;  2R4V A;  4A5P A;  4PNF A;  4JR4 A;  1MD3 A;  4G9H A;  1ERW A;  1V98 A;  4NHZ A;  2B5Y A;  3I43 A;  2VL3 A;  4BVY B;  2HSH A;  1EOG A;  1M99 A;  4MH3 A;  1XVQ A;  5HR3 A;  5DAL A;  1UN2 A;  4O5R A;  3L9S A;  4EIP A;  4JR6 A;  2HYX A;  2KHP A;  2HRA A;  5JCW A;  5IO0 A;  5E4W A;  4JU5 A;  1WE0 A;  4O32 A;  3IK7 A;  4EUY A;  3IPZ A;  3FW2 A;  5G31 A;  5J5N A;  1VF1 A;  3TOT A;  1G6Y A;  2I3Y A;  4GRF A;  1ML6 A;  2LRC A;  3APO A;  4PNG A;  4XS4 A;  4NWY A;  2YJ7 A;  5B6M A;  5C04 A;  5B7C A;  1T1V A;  2H0H A;  1B9Y C;  3WT2 A;  3VWU A;  3G7J A;  1B8X A;  4NHW A;  1WMJ A;  5B6N A;  1FG4 A;  1B4Q A;  1EGO A;  3HA9 A;  4MA9 A;  4XTS A;  5IMD A;  4KUN A;  1FHE A;  2FA4 A;  3GUS A;  3F4T A;  4K6X A;  2NPB A;  1T4Z A;  2IWT A;  2KP1 A;  3QPM A;  2E0Q A;  2M80 A;  1XIY A;  2PUK C;  2R37 A;  4KAE A;  4Z2U A;  5IMC A;  4FYU A;  2VD0 A;  4DVC A;  1TK0 B;  4KSM A;  2N5F A;  1XBS A;  3GTU A;  5DJL A;  1VGL A;  3TJK A;  5HFI A;  4QL9 A;  3NZN A;  3VPT A;  2XPD A;  4G19 A;  3KH9 A;  1K0M A;  4ZB9 A;  3HHV A;  2PMT A;  1TJD A;  1EEM A;  4Q5R A;  4BVX B;  5ECS A;  1URM A;  1M7T A;  2JSY A;  3QFB C;  2WGR A;  1G7O A;  9GSS A;  1GP1 A;  2YZH A;  2OA7 A;  3GKN A;  4N30 A;  1K3Y A;  3LSZ A;  1OE7 A;  5CRE A;  1SL0 B;  2XC2 A;  2IMI A;  3D6I A;  1PKW A;  2F3M A;  3GL3 A;  1R5P A;  2IN3 A;  3HZ8 A;  3WD6 A;  3APS A;  1XVW A;  1OC9 B;  4MF6 A;  4DSS B;  1J0F A;  1E2Y A;  2YWI A;  1SD9 A;  4EIQ A;  1M2D A;  4HQS A;  4AJ8 A;  1O8X A;  5AGY A;  4USS A;  5CAX A;  3CSI A;  4WKW A;  3ED3 A;  3C1R A;  3TRP A;  1YZX A;  2V2G A;  1Y6E A;  1B4P A;  1A8Y A;  4FQU A;  4TOP A;  4PQH A;  3QD9 A;  2IMK A;  1ZMA A;  3LXZ A;  3R3E A;  3C73 A;  4JE1 A;  3E3E A;  4HS1 A;  4ZB8 A;  3PPU A;  4GWR A;  3GST A;  2HRN A;  2FCH A;  1UC7 A;  4WF4 A;  3P2A A;  4LL4 B;  1W89 A;  1YEP A;  1AUC A;  3F63 A;  3Q19 A;  4GF0 A;  2DJ0 A;  3HJM A;  4OO4 A;  1SJ6 A;  5JWO B;  1JZW A;  2A2S A;  2B1L A;  3DD3 A;  4ML1 A;  2YJH A;  3VFI A;  3H4K A;  2LV3 A;  1AXD A;  1M2A A;  1ZCP A;  2MZC A;  1FB6 A;  2H6Y A;  3FZA A;  1QGV A;  2O8V B;  3HY2 A;  2PVQ A;  3HYP A;  1TRW A;  1GTA A;  1S3D A;  1A23 A;  2VCT A;  2YPM A;  1YKC A;  4EKZ A;  2K8S A;  5B8B A;  3GA4 A;  4MJE A;  1V2A A;  16GS A;  1X9M B;  3IV4 A;  4XRA A;  6GST A;  2ON5 A;  5H5R A;  5ID2 A;  2L6D A;  2VLU A;  4I2T A;  2UZ8 A;  3RPN A;  1JZO A;  4TXO B;  1H4O A;  4ILF A;  4TKY A;  1GTI A;  4XCS A;  5F8B A;  4HU7 A;  3TB2 A;  2FA8 A;  4BVX A;  4PQ1 A;  1PA3 A;  2IL3 A;  2TIR A;  5G1L A;  2GS3 A;  3ME7 A;  4X4J A;  4WBR D;  1WRY A;  2C8U A;  3W8S A;  4K2X A;  3IRA A;  4Q5Q A;  1NM3 A;  2JU5 A;  4F82 A;  3TRX A;  3C1S A;  1CQG A;  2VO4 A;  3IDV A;  1OC9 A;  4MZB A;  4K5R A;  4YQV A;  14GS A;  2K6V A;  3VK9 A;  4F2I A;  2R0P A;  3C7M A;  2LNT A;  1MTC A;  4AGS A;  5IO2 A;  2JL4 A;  1FB0 A;  3HJP A;  4ZB6 A;  3RHB A;  3W8J A;  2CT6 A;  2DML A;  3EE2 A;  4WR5 A;  3MDK A;  2H72 A;  2V1M A;  5FT3 A;  3RHC A;  4BPY A;  2ALB A;  2IME A;  3RAZ A;  4HDE A;  3M1G A;  2JAC A;  3VLN A;  1G0T A;  2L5O A;  5IMF A;  4ZL7 A;  4HQZ A;  3H1N A;  2XBQ A;  1ZYQ B;  1SK1 A;  1LBK A;  4J57 E;  5LCZ A;  1OC8 A;  3KXO A;  1X9S B;  2E7P A;  3OR5 A;  5ECK B;  1UA5 A;  3QCP A;  3N9J A;  2ES7 A;  3O6T A;  2VCQ A;  3HJO A;  4TR1 B;  1EV4 A;  2OAD A;  4Z2T A;  2VCZ A;  5DAK A;  5DCG A;  4I5Q A;  4O5Q A;  1ERU A;  4NAX A;  4N0V A;  4GQC A;  1TK5 B;  1SK0 A;  2BTO T;  2R2J A;  2CVB A;  2YAN A;  4IP1 A;  1OAZ A;  3MYD A;  4TXO A;  5DAL B;  2GZP A;  4ID0 A;  2K18 A;  1BED A;  2LQO A;  2F8F A;  4IW9 A;  3GH6 A;  4X1U A;  4ACS A;  2QA2 A;  4GSN A;  1PN0 A;  2GDR A;  2HFD A;  3FZ4 A;  1BJX A;  1DUG A;  3A2W A;  1XWK A;  1O7U A;  1XCC A;  2WRT A;  4IS0 A;  2QSI A;  1LJR A;  3VUR A;  1PL2 A;  3GYK A;  3DYR A;  3L9U A;  4IQA A;  5ENU A;  1GSD A;  3UEM A;  5CRH A;  1B48 A;  4XHM A;  5CRW A;  3CSH A;  4TR4 A;  1WIK A;  2B7J A;  3BBY A;  5DJM A;  3HVX A;  3TKS C;  4YAV A;  5FWG A;  1SL1 B;  3FZ5 A;  4HOJ A;  4L5L A;  4DSR A;  2PBJ A;  4N11 A;  1PQN A;  3HKR A;  1GTU A;  3GX8 A;  2OKA A;  3UVT A;  2EIQ A;  2D2Z A;  4Z7X A;  2PGT A;  5IOW A;  1USB A;  3M3M A;  3A2V A;  3GTU B;  4ISD A;  3LJR A;  4WR4 A;  2YZU A;  1J08 A;  1SU9 A;  1GWC A;  2A4V A;  3CYN A;  4IHU A;  2IFQ B;  2X64 A;  3LW9 A;  5F0G A;  1ST9 A;  2V6O A;  3FZ9 A;  2C3T A;  4WXT A;  1Z9H A;  3F8U A;  4TVE A;  5KN0 A;  1QUW A;  3TKS E;  1CQH A;  1AAZ A;  1ABA A;  4XS6 A;  5EVO A;  5IMV A;  4RQX A;  2JZR A;  3GIX A;  2OE3 A;  4FYB A;  1ACV A;  1TRS A;  1GUK A;  5IOX A;  2X8H A;  4TXV A;  1NHO A;  2FWG A;  2CAI A;  2H0I A;  1V40 A;  2IIY A;  2G2Q A;  4LA1 A;  2R6K A;  1BQ7 A;  1NSW A;  1VF2 A;  4MPG A;  1Z3E A;  1HNA A;  4OFM A;  2PVO C;  4OMV A;  2R0C A;  1A0F A;  3F6D A;  3HXS A;  3FK8 A;  4OCF A;  4EVM A;  2C0D A;  5HFK A;  4BL7 A;  2LTK A;  1R4W A;  2REM A;  3DXB A;  2L4C A;  3TOU A;  3GHA A;  2GQM A;  1TKD B;  1T3B A;  2N5A A;  3BOA A;  2E2G A;  3TJG A;  1O6J A;  4I2U A;  3ISO A;  5ECI B;  2LJA A;  3HVV A;  3UOM A;  4L0W A;  6GSU A;  2GQL A;  2VCW A;  1PD2 1;  3D22 A;  4PXO A;  2MBS A;  4TR0 A;  4HZ2 A;  3QDN A;  2YWN A;  4LLR A;  2I81 A;  5AIV A;  3EC3 A;  1UVZ A;  3KCM A;  4RI6 A;  3IAS 2;  4ECJ A;  4POB A;  2NDO A;  2LJK A;  1ZGN A;  1VRS D;  2RM6 A;  3F4R A;  4G2E A;  1JFU A;  2ZCT A;  5D96 A;  1XW6 A;  5ELG A;  1XW9 A;  1K0B A;  3GNJ A;  1V9W A;  2KOK A;  2GQK A;  4IKH A;  2BJX A;  1X5E A;  3H79 A;  1EP7 A;  3KZQ A;  1X5C A;  5D73 A;  4JZQ A;  1ZYE A;  4XS1 A;  1BG5 A;  4K1F A;  4EO3 A;  3UJ1 A;  1K0C A;  3A5I A;  2IFQ A;  5ID2 B;  4OFN A;  1XWG A;  3NIV A;  1BYE A;  1I5G A;  2H1G A;  4KND A;  2H76 A;  3W6G A;  2EC4 A;  4O7H A;  3DKS A;  2CQ9 A;  5GZZ B;  4ICY A;  4IEL A;  4KA0 A;  1TRV A;  1GUM A;  4O5U A;  3CSJ A;  4NV5 A;  3J7Y b;  1GSU A;  3KH7 A;  1K0D A;  2H1A A;  2WDU A;  1YF0 A;  3H8Q A;  1JHB A;  2FHE A;  1F3B A;  2PPT A;  2HI7 A;  2IPA A;  4CY6 A;  4K5S A;  3KTL A;  4L0U A;  4EDY A;  3ZIJ A;  2FLS A;  3RPP A;  4O92 A;  3UAP A;  1T7P B;  1XXU A;  2GSS A;  1K3L A;  2K8V A;  4V2M A;  3LOR A;  4CHS A;  3GH9 A;  1OKT A;  5HFG A;  3QAW A;  4E8H A;  2VOC A;  1ZYP A;  4G0I A;  3I6A A;  4OO5 A;  3ZRE A;  3QOU A;  2WUL A;  5D8I A;  1S3A A;  2JSZ A;  3EU4 A;  2H71 A;  1Z6N A;  4PUF C;  2KP2 A;  5KOX A;  3EIN A;  4NPB A;  3LYK A;  2GT5 A;  2PU9 C;  3QAG A;  1SKW B;  5DVB A;  2VL9 A;  5EL8 A;  1WP0 A;  3G9B A;  1XZO A;  2KUC A;  2VM1 A;  2CV4 A;  5ELA A;  5D93 A;  1KEB A;  4MCU A;  4ZBA A;  2WFC A;  3NOF A;  5IMZ A;  2H6X A;  3BCI A;  3L0H A;  2H73 A;  3E0U A;  2YV9 A;  1MDI A;  4NMU A;  3EU3 A;  1SD8 A;  2KLX A;  3IC4 A;  4DEJ A;  5CYY A;  2P5R A;  3F4S A;  4POM A;  5IPG A;  2BMX A;  2DJ3 A;  3VWV A;  5DAK B;  4MH2 A;  3VI5 A;  5A4W A;  2QA1 A;  4MJA A;  5DCH A;  2LQQ A;  2FY6 A;  4KCA A;  5DBQ A;  3CRT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...