1BJXA

Human protein disulfide isomerase, nmr, 24 structures
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
110
structure length
110
Chain Sequence
AATTLPDGAAAESLVESSEVAVIGFFKDVESDSAKQFLQAAEAIDDIPFGITSNSDVFSKYQLDKDGVVLFKKFDEGRNNFEGEVTKENLLDFIKHNQLPLVIEFTEQTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROTEIN DISULFIDE ISOMERASE
publication title The structure in solution of the b domain of protein disulfide isomerase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Electron transport
total genus 19
structure length 110
sequence length 110
ec nomenclature ec 5.3.4.1: Protein disulfide-isomerase.
pdb deposition date 1998-06-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1bjxA00
2LEGA 1MD4A 3HDCA 1FHEA 4LL4B 2C3TA 2B6MA 3TKSC 5ECSA 3DKSA 2HZFA 5ECMB 3H93A 1Y6EA 4KDXA 2E7PA 2DMMA 2AYTA 3RAZA 1B9XC 4XIHA 1AC1A 1ZZYA 1EWXA 2GQLA 2LJKA 2H01A 1O85A 1JZWA 2GZPA 2WS2A 1B4QA 5AISA 4K7NA 1B9YC 5G1LA 1PL2A 2P5QA 2B5YA 2LV3A 4FYCA 2VD0A 1T8EB 2IMEA 5ECNB 4GWRA 2K6VA 2BJXA 1V57A 4K9ZA 5CO3A 4KAEA 5A4VA 2VUPA 1XCCA 2H0HA 1DBYA 4MZBA 3CSHA 5HFIA 1TJDA 3GKXA 2ALBA 1XIYA 2XPEA 2DIZA 1VF2A 2L57A 2REMA 4IP1A 3AY8A 1DE1A 5FHIA 1ON4A 3QCPA 2TRXA 1JZOA 3GKMA 2FGXA 4MZCA 3J7Yk 2MMOA 4WXTA 4EF0A 3F0IA 3FZ4A 3GKKA 1ZMAA 2JZRA 2CAIA 3UVHA 4FYUA 3US3A 3LXTA 4MP4A 2OBIA 5G31A 1QUWA 1MDJA 3IBHA 5DCHA 1HNAA 1SJZA 4DSRA 1GUHA 3GL5A 2JADA 4EC0A 1NHYA 5D9XA 3HHVA 2V41A 2VCWA 1YJ6A 1N2AA 1AQWA 4MCUA 3PGTA 2TIRA 1Z3EA 2VD1A 4K2DA 3IHQA 3RHBA 18GSA 2FNOA 4POLA 2YWMA 3CSJA 2FHEA 4TR3A 1EV4A 4V2NA 4L5LA 1MDKA 2VM1A 3ME8A 2OACA 2AUVA 3TKSE 2C4JA 1GSSA 3C1RA 3FW2A 2JU5A 1YF1A 4IBPA 2DJ2A 5JWOB 2RLIA 1XWKA 1F3BA 4MF7A 1WWJA 1ZCPA 2PWJA 3ZIVA 1AQVA 1PGTA 1AW9A 1OC9B 3GN3A 5A4WA 2KP2A 3BD2A 1DSBA 4TR0A 2WB9A 4J2FA 1A23A 2CT6A 1TXXA 1XZOA 2K8VA 3KMOA 4N30A 1ZYQB 2XHFA 2YWIA 3QOUA 3QR6A 5J41A 2BTOT 3WGEA 2R37A 2RM5A 2H8LA 5B6MA 3D5JA 1FG4A 1FVJA 2NPBA 3D4TA 4E8HA 1GLQA 4ZB9A 4DSQA 4TKYA 2F8AA 3NOFA 1OC9A 2WDUA 3CXGA 1IYHA 5B7CA 3VFIA 2P31A 4OCFA 1KTEA 3MNGA 1SYXA 3KH9A 2DMLA 3ZFLA 4V1Ag 2PN8A 1T7PB 4ZBAA 5F05A 2ON7A 2QSIA 3KZQA 4CHSA 3IK9A 5HFKA 2C80A 1S3DA 4PNFA 5J3RA 4YQVA 2GS3A 1V2AA 3TRXA 4K0GA 2MBTA 4ML6A 3E9JB 3GKNA 3M9KA 4X0XA 2GZZA 2LUSA 2KP1A 5LD0A 2HXKA 2QGVA 3A2WA 1TDIA 2DIYA 1OKDA 4BVXA 3QPMA 1EOGA 1F2EA 3DD3A 2GDRA 4TVEA 1WE0A 4FYBA 1XWCA 5F8BA 1X9WB 3EU4A 2FA4A 2O85A 2ZCTA 3LGCA 2O7KA 2B5XA 2RUFA 2F9SA 2HFDA 4YH2A 1KNGA 2CX3A 2LRCA 4CW9A 3O76A 1F37A 4K0NA 2A2SA 2OJLA 1PX7A 4Q5NA 5D9VA 5IIZA 1M2DA 5C00A 1H4OA 2R3XA 5DJLA 3EINA 4WBRD 5ABRA 4OCEA 2H66A 1XXUA 4PUFC 1A8LA 2VCVA 3QAWA 4QQ7A 5A4UA 3IDVA 3TB2A 3KJYA 5IMDA 2LTKA 1SKSB 2O89A 1FW1A 4PUAA 4F2IA 1GP1A 3ISOA 1T1VA 2OADA 1XW6A 2ZUPA 2PUKC 3ED3A 4EE0A 4I2TA 5CRHA 5IMFA 5GAPD 3LWAA 1GRXA 1R7HA 1Y25A 4WR4A 5HR2A 3L0HA 2IMIA 3MAKA 5ECKB 1LJRA 4J57E 4MH2A 5B8AA 5CRDA 1NM3A 4GQFA 3TKRA 3L78A 5ECOB 3BCKA 1B4PA 2H70A 1QFNA 4ECCA 3ZREA 3LEFA 4K8MA 1PKWA 1R5AA 3CBUA 4G9HA 1OKTA 5CRGA 4F03A 1EP7A 4MJAA 2E2GA 3PH9A 4HUAA 4OFTA 2X64A 1J0FA 1NSWA 4IP6A 3L9VA 2IL3A 3ZITA 4ECBA 2E0QA 4MLYA 1PA3A 2K8SA 1ZOFA 4E8EA 4XS4B 5D93A 3MSZA 2H6YA 2R6KA 5HQPA 3U6VA 5DJMA 1URMA 4LMVA 2XBQA 4O92A 4XS1A 1TI3A 3H79A 3EC3A 4WKWA 1DE2A 5GSTA 2HRFA 4GSNA 8GSSA 2H1AA 1VF4A 2GSSA 3APOA 3HYPA 1OE7A 3H4KA 4BWQA 2O87A 1MDIA 2C0EA 1U6TA 2CAQA 5H5QA 3UARA 3FHKA 1BEDA 3DVWA 3C7MA 4YAVA 3ERFA 1A2LA 1O7UA 1SD8A 2YP6A 3VURA 3F3RA 1B48A 1K0MA 3KD0A 5HR0A 3P7XA 4NHWA 3W8SA 4XS4A 6GSWA 4HU7A 1U88A 4IS0A 2LQQA 4LMWA 2HZEB 3KTLA 3GRXA 3EE2A 3M8NA 3RHCA 3LG6A 2CZ2A 2H6XA 4D73B 3ME7A 4KSMA 3KCMA 2IFQB 2DC5A 1B8XA 1FAAA 4IQAA 3ZFBA 1AQXA 1PL1A 2G0FA 1LBKA 4N0ZA 1N8JA 4JZQA 2LS5A 1JFUA 4GCIA 2PMTA 5C04A 2A4VA 2VOCA 5DDLA 3TKPA 5D73A 4KCAA 1JZDA 5ID2B 3I9V2 3M9JA 1GSQA 2HZEA 3DWVA 1M0UA 3VWWA 1BX9A 3HKRA 4ZL9A 1R5PA 1GNEA 3QAVA 1GSYA 1CQHA 4POMA 4D73A 3HVXA 2IFQA 2JACA 2I4AA 3BBYA 3CMIA 2PU9C 4AJ7A 2AHEA 2NBSA 4WF4A 1NHOA 2YZHA 4I6XA 1EGRA 5GSSA 2PVOC 1V98A 1MD3A 3ERWA 3RPPA 4PX1A 3I43A 3TRPA 2ON5A 4TXOB 6GSYA 1VGLA 1FO5A 2JZSA 2NDOA 4PQ1A 4OMVA 1GH2A 4TR1B 3V1WA 5ID2A 2LJRA 1SKWB 22GSA 5DAKB 3IR4A 4MDCA 5JWRB 1SJIA 5G5FA 5LNKe 4RUVA 3GX8A 4JR4A 1K0CA 3FZ9A 3TJBA 3VPQA 2KOKA 4EUYA 1USBA 4HU9A 3TOTA 1RQMA 2XBIA 5ECQB 5CP1A 2YJ7A 4IGJA 1XVWA 3ZVJA 1FVKA 2OE1A 2H19A 4TXOA 3F8UA 3DIEA 2I81A 2C1YA 2L4CA 3EVIA 4IELA 4XTSA 2MYGA 4TR1A 3BJ5A 4DSSB 2M72A 3CTFA 3KP9A 3E3EA 5DAKA 4PURA 1GSFA 4POKA 2OE3A 4AGSA 2X99A 3ZTLA 3D22A 3HJOA 2IJYA 1K0DA 3VPTA 4ID0A 4I8BA 2CVDA 2YOIA 1UVZA 2HNLA 2MBSA 1FOVA 3TGZA 3IA1A 2GSTA 3ZZXA 1UA5A 2X8GA 2L5OA 4I97A 2FY6A 2PVQA 5COHA 3GSTA 1ZGNA 2VL2C 5J5NA 3Q18A 1FB6A 4DSSA 1A2MA 4DEJA 5INYA 3KTBA 1PRXA 5D96A 5EVOA 5G5EA 1EEJA 4ZB8A 2DJ0A 3KMNA 2DJJA 1XOAA 3LORA 2FCHA 3IE3A 3FRCA 4ECIA 2V2GA 3F4TA 1G0TA 3HJPA 1TKDB 3N9JA 2FWGA 4P3YB 2L4QA 4XCSA 5HR1A 2CZ3A 2XC2A 1F3AA 2WRTA 1YQ1A 2OBKA 3GMFA 2YZUA 2L5LA 2VLUA 3LYKA 4NV2A 3H1NA 1XWGA 5IM9A 3GNJA 4H86A 1XFLA 2IPAA 2VCXA 4HI7A 3VK9A 1NW2A 3NIVA 5JCGA 1QQ2A 2D2ZA 3LYPA 5J9BA 4OO5A 3OR5A 2YV9A 1J9BA 4ECJA 3W8JA 3HZ8A 3SBCA 3IXRA 3UVTA 3Q74A 1YY7A 4KSOA 2FLSA 4NHZA 3R2QA 3IK7A 2A2RA 2IN3A 2VCTA 2G2QA 3L9SA 4JEDA 4ZIJA 3HVSA 1C72A 5ECLB 3G7JA 1T3BA 4LL1B 5AN1A 3K8NA 4IJ3A 1QGVA 5IO2A 1J08A 5DQSA 3KP8A 3TJGA 2WULA 5EY6A 3L9UA 2R2JA 3KM6A 1QXHA 3TCOA 3ZMKA 2GVPA 4KX4A 2AV4A 2X8HA 14GSA 5D9WA 1V9WA 3CTGA 3F9UA 3HY2A 1AAZA 2DSAA 3IC4A 1TW9A 1W4VA 2GQMA 2OE0A 2IMKA 4TXVA 4N0VA 16GSA 4IQ1A 1K0NA 5DBQA 4PNGA 5B6NA 4NWYA 4HJ2A 3P90A 5EL8A 4X1UA 2GGTA 1XVQA 2LSTA 3GURA 1M2BA 3FR6A 2YWNA 4GTUA 2L6CA 3M3MA 6GSXA 2N5AA 1SU9A 1WPIA 3FK8A 3DYRA 5G2ZA 4MJEA 4PQIA 5D8IA 3VI7A 4IN0A 1WMJA 4ZXGA 1PX6A 4ZBDA 5EPFA 1X0RA 2TRCP 4MF5A 3GX0A 2EC4A 1M7TA 3PR8A 3KEBA 4DVCA 3DXBA 2JL4A 2H30A 1KBNA 2QKEA 4N10A 2B7JA 3A5WA 1T4ZA 5J9CA 3GV1A 3EURA 5GZZB 4GQCA 4WBJA 3WGXA 3TKSA 4XHMA 1YKAA 1OC8A 2HRNA 1ML6A 1PSQA 6GSTA 1BYEA 2AAWA 4K6XA 3O6TA 2VM2A 4MJBA 3D6IA 3H8QA 1A0RP 4ACSA 4LA1A 5HR3A 4OO4A 4GXZA 4L0UA 2N5FA 3EYTA 4GLTA 5AIVA 9GSSA 4RI7A 5DALB 2H6ZA 5L71A 4NAXA 1ACVA 3A2XA 2H0GA 3O3TA 4F82A 3UJ1A 3E0UA 5KN3A 1Z7PA 3GIXA 1ZL9A 2H75A 1G6WA 1G7OA 1BJXA 1M99A 5AGYA 5IMZA 1O6JA 4WF5A 4HZ4A 1OYJA 1S3AA 1SL2B 1VF3A 3VWVA 2VCQA 3EWLA 2GZYA 1YZXA 4JR6A 3RBTA 3FYGA 3GTUB 1SK1A 2WCIA 1KEBA 1K0OA 3C8EA 5DALA 5IMCA 1I5GA 5ELGA 4Z7XA 4HDEA 1ABAA 3S9FA 5KEJA 1X9MB 1JZRA 1HNBA 3TJFA 1IYIA 4K1FA 3CSIA 1TRUA 3ZYWA 4FO5A 2LKUA 4NPBA 4TOPA 1M9BA 3F4RA 5IMVA 4HQZA 1TK8B 3KXOA 1Z7RA 2VAFA 4BA7A 5ECHB 5ECRB 2IMDA 2FWEA 2Z9SA 3W6GA 5HFGA 4L8EA 4IJIA 6GSVA 1GTBA 3N5OA 2YWOA 3MDKA 2HE3A 3TKQA 1SENA 2C8UA 2F51A 1TP9A 3JCML 3M1GA 1E2YA 1WRYA 3GTUA 2VLTA 2H76A 3FZAA 5H5SA 4MH3A 5JWQB 5CNWA 4MF6A 4O7HA 2MMNA 2OKAA 3WD6A 1TOFA 1GNWA 3C73A 3G9BA 2PGTA 3ZRDA 1WP0A 3ZLPA 2DJ1A 2FWFA 4TW5A 2J9HA 4Q5RA 3BCIA 4KDYA 2YCDA 1K0AA 2R4VA 5G1KA 1GL8A 3D21A 2EIOA 1UN2A 2AJQB 2GSQA 3UBLA 1H75A 5CRWA 3DGQA 4XRAA 1A24A 4KGIA 2B3SA 4TRXA 3UBKA 4Q5QA 4V1Ap 2C0GA 5IO0A 5F07A 4HS1A 4OD7A 2CVBA 3F3QA 2K9FA 1HQOA 1SL1B 4AJ8A 2ZNMA 5FWGA 3FEUA 2I9HA 1SKRB 5IPGA 1Z5YE 1THOA 1JLWA 1OC3A 4XS6A 1YKCA 1I9DA 1SK0A 3CYNA 1TU7A 2VIMA 3LSZA 3WT1A 1GSDA 4FIWA 4MPGA 1QMVA 1O8WA 4EVMA 1HYUA 2RUEA 3HVVA 2JSZA 4ILFA 3BOAA 3WT2A 1Q98A 2XPDA 17GSA 2VO4A 3FKFA 1GTAA 1TRVA 2I1UA 4OFMA 5F0GA 2HYXA 3EU3A 3QFAC 1XOBA 4F9ZA 2LQOA 4MABA 2C0DA 1M9AA 3TJKA 2MMAA 3IPZA 4MPFA 1TRWA 3RPNA 5J4UA 1SK2A 3GUSA 2DLXA 4K7OA 4WETA 5JCWA 4JE1A 1G7EA 3IAM2 5CYYA 3GFKA 2N5BA 4GSSA 6GSSA 1U3AA 1VRSD 2GLRA 3APSA 1OVNA 4IW9A 4ULXA 2RIIA 4EKZA 2RM6A 2V6KA 1SYRA 2FD3A 3RDWA 4OWYA 2WFCA 1SL0B 4HQSA 3J7Yb 1R4WA 6GSUA 4KB3A 4MJCA 1AUCA 1PN9A 2GTUA 4FH8A 2HSHA 4OFNA 2M46A 3A3TA 2QC7A 1A8YA 2PERA 1GSEA 2J23A 3GH9A 4IKHA 4V2LA 1R26A 2NTOA 1O81A 4HEA2 1YF0A 3IAS2 1PQNA 4G2EA 3VWXA 1TK5B 1GUKA 2K18A 7GSSA 2H1BA 2OA7A 2LNSA 1XWBA 2GQKA 1EV9A 4KDUA 4EDZA 2IWTA 4L0WA 2H0IA 5ECIB 1THXA 3UEMA 3P8WA 4YQUA 2B1KA 1WIKA 1X5CA 1TRSA 3SWLA 4MMMA 4TR4A 2O8VB 4I2UA 1HNCA 5DQYA 1T00A 1PMTA 2FWHA 10GSA 5KN1A 1YDKA 4CDOA 3ERGA 1CQGA 4F0BA 20GSA 5ENUA 3MWHA 4ISDA 2YV7A 1E6BA 2C0FA 3KH7A 3FZ5A 2GT5A 4GF0A 2YNXA 1BAYA 3FY7A 3Q6OA 4HZ2A 3VLNA 4EDYA 2L6DA 2YANA 1S3CA 2LJAA 4POBA 2HSYA 2NVLA 1MEKA 4V2MA 1LU4A 1XBSA 4LLRA 3QFBC 3UOMA 1K3LA 1ST9A 2VL9A 1Z6MA 3NZNA 4AF2A 3F63A 4PGTA 1MTCA 1ERWA 2M80A 12GSA 3FR3A 5B8BA 3DMLA 4F0CA 4RI6A 3GH6A 4NMUA 2L59A 1T4YA 4EL1A 5IMAA 5E4WA 2YN1A 4ML1A 4IHUA 1BG5A 1XW9A 1F6MC 3QMXA 3EMXA 1A2JA 4ZL8A 1EOHA 5AIXA 3LXZA 3UIWA 2P5RA 3VI5A 3DRNA 1ERTA 3IOSA 5F06A 13GSA 1O73A 1GTIA 5GAND 3GL3A 2VCZA 1X5DA 2CVKA 3UL3A 2H1DA 4MZWA 5IOXA 1OE8A 4MK3A 2HLSA 3ZL5A 2YJHA 2HI7A 2YPMA 4QL9A 3F4SA 1AXDA 5CAXA 3WGDA 1V58A 4ZILA 3DVXA 2MMZA 1AIUA 1Z6NA 5CREA 4BPYA 3WYWA 3GA4A 3TJJA 2P0GA 1QK8A 2WJUA 3ZVJD 2H1GA 3FR9A 4X43A 3C71A 3HCZA 2LRNA 4IVFA 2B5EA 3QD9A 4J56E 5ELAA 3TDGA 3DEXA 4EXJA 1ZYEA 4KNDA 2HT9A 2KUCA 1TK0B 3LJRA 1X5EA 3A2VA 5D9TA 19GSA 2VL3A 1FB0A 1XW5A 3HD5A 4HOJA 3HXSA 1GULA 2H73A 3C1SA 4O5RA 5H5RA 5KN0A 4RQXA 4BL7A 3L4NA 3Q19A 3PINA 1EGOA 2F3MA 2WGRA 2BMXA 1TTZA 2FUG2 4NV5A 3QAGA 1YEPA 4WEYA 2V32A 3LFLA 4JRRA 4O32A 5LCZA 1W89A 3HZ4A 2CX4A 4ZBBA 1XPVA 4AJ6A 1GTUA 4G10A 3I6AA 2MZCA 4XRDA 1ILOA 3TOUA 2JZTA 2DJ3A 1RK4A 1SD9A 1PKZA 1G6YA 1GLPA 4KH7A 1GUMA 4JU5A 2JSYA 1WJKA 1Z9HA 3ZIJA 3TUEA 2E2MA 3G7IA 3APQA 2CQ9A 2PBJA 1EEMA 3QDNA 2B7KA 3I69A 3IV4A 2H74A 1Q4JA 2I3YA 4KA0A 4ZB6A 3LQ7A 3U5RE 4KE3A 1U3IA 1U87A 4EO3A 1X9SB 1PD21 1K3YA 1M2AA 4WR5A 3CRTA 3TRQA 5ECPB 1DUGA 2DBCA 2PPTA 3EMPA 4I5QA 1JLVA 3KGKA 2WZ9A 3UAPA 1TI1A 1VF1A 5DVBA 4BWSA 4HJMA 4Q5FA 2V1MA 4NXIA 1UC7A 1K3OA 1BQ7A 1EP8A 2AB6A 4YQMA 2R5GA 3GSSA 4GSTA 2IIYA 5FT3A 2CV4A 3HJMA 2VL2A 4QL7A 2DJKA 4G19A 1V40A 3D4MA 2H71A 3G7YA 5JCUA 1GSUA 2IMFA 4K7IA 1EZKA 3HA9A 4GRFA 4N11A 4RQRA 1JHBA 2LRTA 2GT6A 3GYKA 5IPHA 2V6OA 2X8CA 4KCEA 2FA8A 2C3NA 4L5OA 4YAPA 3P2AA 1K0BA 4MA9A 3KIJA 1ERUA 3UMAA 4BVYA 2LNTA 4ZL7A 3GHAA 5KN2A 4PQHA 1XWAA 3CRUA 1O8XA 1GWCA 4PXOA 1TU8A 3F6FA 2EIRA 1A0FA 4JBBA 3M0FA 1ERVA 1OAZA 2KHPA 3D0ZA 3ZMLA 2ES7A 1RW1A 3VWUA 1SJ6A 3F6DA 2C3QA 2VLVA 5IOWA 2H72A 3IRAA 1F9MA 5G30A 2F8FA 2EIQA 2KLXA 4KW6A 1HD2A 2CA8A 11GSA 5E59A 2B1LA 5IQYA 4TN8A 1WOUA 5A5KA 4KUNA 1YEXA 2GSRA 5DCGA
chains in the Genus database with same CATH superfamily
2LEGA 1MD4A 3HDCA 1FHEA 4LL4B 2C3TA 2B6MA 3TKSC 5ECSA 3DKSA 2HZFA 5ECMB 3H93A 1Y6EA 4KDXA 2E7PA 2DMMA 2AYTA 3RAZA 1B9XC 4XIHA 1AC1A 1ZZYA 3R3EA 1EWXA 2GQLA 2LJKA 2H01A 1O85A 4EIPA 1JZWA 2GZPA 2WS2A 1B4QA 5AISA 4K7NA 1B9YC 4Z2RA 2QA2A 5G1LA 1PL2A 2P5QA 2B5YA 2LV3A 4FYCA 2VD0A 1T8EB 2QA1A 2IMEA 5ECNB 4GWRA 2K6VA 2BJXA 1V57A 4K9ZA 5CO3A 4KAEA 5A4VA 2VUPA 1XCCA 2H0HA 1DBYA 4MZBA 3CSHA 5HFIA 1TJDA 3GKXA 2ALBA 1XIYA 2XPEA 2DIZA 1VF2A 2L57A 2REMA 4IP1A 3AY8A 1DE1A 5FHIA 1ON4A 3QCPA 2TRXA 1JZOA 3GKMA 2FGXA 4MZCA 3J7Yk 2MMOA 4WXTA 4EF0A 3F0IA 3FZ4A 3GKKA 1ZMAA 2JZRA 2CAIA 3UVHA 4FYUA 3US3A 1ZYNA 3LXTA 4MP4A 4CY6A 2OBIA 5G31A 1QUWA 1MDJA 3IBHA 5DCHA 1HNAA 1SJZA 4DSRA 1GUHA 3GL5A 2JADA 4EC0A 1NHYA 5D9XA 3HHVA 2V41A 2VCWA 1YJ6A 1N2AA 1AQWA 4MCUA 3PGTA 2TIRA 1Z3EA 2VD1A 4K2DA 3LW9A 3IHQA 3RHBA 18GSA 2FNOA 4POLA 2UZ8A 2YWMA 2FHEA 3CSJA 4TR3A 1EV4A 4V2NA 4L5LA 1MDKA 2VM1A 3ME8A 2OACA 2AUVA 3TKSE 2C4JA 1GSSA 3C1RA 3FW2A 2JU5A 1YF1A 4IBPA 2DJ2A 5JWOB 2RLIA 1XWKA 1F3BA 4MF7A 2HSMA 1WWJA 1ZCPA 2PWJA 3ZIVA 1AQVA 1PGTA 1AW9A 1OC9B 3GN3A 5A4WA 2KP2A 3BD2A 1DSBA 4TR0A 2WB9A 4J2FA 1A23A 2CT6A 1TXXA 1XZOA 2K8VA 3KMOA 4N30A 1ZYQB 2XHFA 2YWIA 3QOUA 3QR6A 5J41A 2BTOT 3WGEA 2R37A 2RM5A 2H8LA 5B6MA 3D5JA 1FG4A 1FVJA 3MIXA 2NPBA 3D4TA 4E8HA 1GLQA 4ZB9A 4DSQA 4TKYA 4BVXB 2F8AA 3NOFA 1OC9A 2WDUA 3CXGA 1IYHA 5B7CA 3VFIA 2P31A 4OCFA 1KTEA 3MNGA 1SYXA 3KH9A 2DMLA 3ZFLA 4V1Ag 2PN8A 1T7PB 4ZBAA 5F05A 2ON7A 2QSIA 3KZQA 4CHSA 3IK9A 5HFKA 2C80A 1S3DA 4PNFA 5J3RA 4YQVA 2GS3A 1V2AA 3TRXA 4K0GA 2MBTA 4ML6A 3E9JB 3GKNA 3M9KA 4X0XA 2GZZA 2LUSA 2KP1A 5LD0A 2HXKA 2QGVA 3A2WA 1TDIA 2DIYA 1OKDA 4BVXA 3QPMA 4PTSA 1EOGA 1F2EA 3DD3A 2GDRA 4TVEA 1WE0A 4FYBA 1XWCA 5F8BA 1X9WB 3EU4A 2FA4A 4FQUA 2O85A 2ZCTA 3LGCA 2O7KA 2B5XA 2RUFA 2F9SA 2HFDA 4YH2A 1KNGA 2CX3A 2LRCA 4CW9A 3O76A 1F37A 4K0NA 2A2SA 2OJLA 1M3JA 1PX7A 4Q5NA 5D9VA 5IIZA 1M2DA 5C00A 1H4OA 2R3XA 5DJLA 3EINA 4WBRD 5ABRA 4OCEA 2H66A 1XXUA 4PUFC 1A8LA 2VCVA 3QAWA 4QQ7A 5A4UA 3IDVA 3TB2A 3KJYA 5IMDA 2LTKA 1SKSB 2O89A 1FW1A 4PUAA 4F2IA 1GP1A 3ISOA 1T1VA 2OADA 1XW6A 2ZUPA 2PUKC 3ED3A 4EE0A 4I2TA 5CRHA 5IMFA 5GAPD 3LWAA 1GRXA 1R7HA 1Y25A 4WR4A 5HR2A 3L0HA 2IMIA 3MAKA 5ECKB 4BIKA 1LJRA 4J57E 4MH2A 5B8AA 5CRDA 1NM3A 4GQFA 3TKRA 3L78A 5ECOB 3BCKA 1B4PA 2H70A 1QFNA 4ECCA 3ZREA 3LEFA 4K8MA 1PKWA 1R5AA 3CBUA 4G9HA 1OKTA 5CRGA 4F03A 1EP7A 4MJAA 2E2GA 3PH9A 4HUAA 4OFTA 2X64A 1J0FA 1NSWA 4IP6A 3L9VA 2IL3A 3ZITA 4ECBA 2E0QA 4MLYA 1PA3A 2K8SA 1ZOFA 4E8EA 4XS4B 5D93A 3MSZA 2H6YA 2R6KA 5HQPA 3U6VA 1URMA 5DJMA 4LMVA 2XBQA 4O92A 4XS1A 1TI3A 3H79A 3EC3A 4WKWA 1DE2A 5GSTA 2HRFA 4GSNA 8GSSA 2H1AA 1VF4A 2GSSA 3APOA 3HYPA 1OE7A 3H4KA 4BWQA 2O87A 1MDIA 2C0EA 1U6TA 2CAQA 5H5QA 3UARA 3FHKA 1BEDA 3DVWA 3C7MA 4YAVA 3ERFA 1A2LA 1O7UA 1SD8A 2YP6A 3VURA 3F3RA 1B48A 1K0MA 3KD0A 5HR0A 3P7XA 4NHWA 3W8SA 4XS4A 6GSWA 4HU7A 1U88A 4IS0A 2LQQA 4LMWA 2HZEB 3KTLA 3GRXA 3EE2A 3M8NA 3RHCA 3LG6A 2CZ2A 2H6XA 4D73B 3ME7A 4KSMA 3KCMA 2IFQB 2DC5A 1B8XA 1FAAA 4IQAA 3ZFBA 1AQXA 1PL1A 2G0FA 1LBKA 2HRAA 4N0ZA 1N8JA 4JZQA 2LS5A 1JFUA 4GCIA 2PMTA 5C04A 2A4VA 2VOCA 5DDLA 3TKPA 5D73A 4KCAA 1JZDA 5ID2B 3I9V2 3M9JA 1GSQA 2HZEA 3DWVA 1M0UA 3VWWA 1BX9A 3HKRA 4ZL9A 1R5PA 1GNEA 3QAVA 1GSYA 1CQHA 4POMA 4D73A 3HVXA 2IFQA 2JACA 2I4AA 3BBYA 3CMIA 2PU9C 4AJ7A 2AHEA 2NBSA 4WF4A 1NHOA 4O5UA 2YZHA 4I6XA 1EGRA 5GSSA 2PVOC 1V98A 1MD3A 3ERWA 3RPPA 4PX1A 3I43A 3TRPA 2ON5A 4TXOB 6GSYA 1VGLA 1FO5A 2JZSA 2NDOA 4PQ1A 4OMVA 1GH2A 4TR1B 3V1WA 5ID2A 2LJRA 1SKWB 22GSA 4HSCX 5DAKB 3IR4A 4MDCA 5JWRB 1SJIA 5G5FA 5LNKe 4RUVA 3GX8A 4JR4A 1K0CA 3FZ9A 3TJBA 3VPQA 2KOKA 4EUYA 1USBA 4HU9A 3TOTA 1RQMA 2XBIA 5ECQB 5CP1A 2YJ7A 4IGJA 1XVWA 3ZVJA 1FVKA 2DKIA 2OE1A 2H19A 4TXOA 3F8UA 3DIEA 2I81A 2C1YA 2X4AA 2L4CA 3EVIA 4IELA 4XTSA 2MYGA 4TR1A 3BJ5A 4DSSB 2M72A 3CTFA 3KP9A 3E3EA 5DAKA 4PURA 1GSFA 4POKA 2OE3A 4AGSA 2X99A 3ZTLA 3D22A 3HJOA 2IJYA 1K0DA 3VPTA 4ID0A 4I8BA 2CVDA 2YOIA 1UVZA 2HNLA 2MBSA 1FOVA 3TGZA 3IA1A 2GSTA 3ZZXA 1UA5A 2X8GA 2L5OA 4I97A 2FY6A 2PVQA 5COHA 3GSTA 1ZGNA 2VL2C 5J5NA 3Q18A 1FB6A 4DSSA 1A2MA 4DEJA 5INYA 3KTBA 1FOHA 1PRXA 5D96A 5EVOA 5G5EA 1EEJA 4ZB8A 4Z2TA 2DJ0A 3KMNA 2DJJA 1XOAA 3LORA 2FCHA 3IE3A 3FRCA 4ECIA 2V2GA 3F4TA 1G0TA 3HJPA 1TKDB 3N9JA 4K2XA 2FWGA 4P3YB 2L4QA 4XCSA 5HR1A 2CZ3A 2XC2A 1F3AA 2WRTA 1YQ1A 2OBKA 3GMFA 2YZUA 4K5SA 2L5LA 2VLUA 3LYKA 4NV2A 3H1NA 1XWGA 5IM9A 3GNJA 4H86A 1XFLA 2IPAA 2VCXA 4HI7A 3VK9A 1NW2A 3NIVA 5JCGA 1QQ2A 2D2ZA 3LYPA 5J9BA 4OO5A 3OR5A 2YV9A 1J9BA 4ECJA 3W8JA 3HZ8A 3SBCA 3IXRA 3UVTA 3Q74A 1YY7A 4KSOA 2FLSA 4NHZA 3R2QA 3IK7A 2A2RA 4MNNA 3PPUA 2IN3A 2VCTA 2G2QA 3L9SA 4JEDA 1ZYPA 4ZIJA 3HVSA 1C72A 5ECLB 3G7JA 1T3BA 4LL1B 5AN1A 3K8NA 4IJ3A 1QGVA 5IO2A 1J08A 5DQSA 3KP8A 3TJGA 2WULA 5EY6A 3L9UA 2R2JA 3KM6A 1QXHA 3TCOA 3ZMKA 2GVPA 4KX4A 2AV4A 2X8HA 14GSA 5D9WA 1V9WA 3CTGA 3F9UA 3HY2A 1AAZA 2DSAA 3IC4A 1TW9A 1W4VA 2GQMA 2OE0A 2IMKA 4TXVA 4N0VA 16GSA 4CY8A 4IQ1A 1K0NA 5DBQA 2X49A 4PNGA 5B6NA 4NWYA 4HJ2A 3P90A 5EL8A 4X1UA 2GGTA 1XVQA 2LSTA 3GURA 1M2BA 3FR6A 2YWNA 4GTUA 2L6CA 3M3MA 6GSXA 2N5AA 1SU9A 1WPIA 3FK8A 3DYRA 5G2ZA 4MJEA 4PQIA 5D8IA 3VI7A 4KF9A 4IN0A 1WMJA 4ZXGA 1PX6A 4ZBDA 5EPFA 1X0RA 2TRCP 4BL7B 4MF5A 3GX0A 2EC4A 1M7TA 3PR8A 3KEBA 4DVCA 3DXBA 2JL4A 2H30A 1KBNA 4G0IA 2QKEA 1S3RA 4N10A 2B7JA 3A5WA 1T4ZA 5J9CA 3GV1A 3EURA 5GZZB 4GQCA 4WBJA 3WGXA 3TKSA 4XHMA 1YKAA 1OC8A 2HRNA 1ML6A 1PSQA 6GSTA 1BYEA 2AAWA 4K6XA 3O6TA 2VM2A 4MJBA 3D6IA 3H8QA 1A0RP 4ACSA 4LA1A 5HR3A 4OO4A 4GXZA 4L0UA 2N5FA 3EYTA 4GLTA 5AIVA 9GSSA 4RI7A 5DALB 2H6ZA 5L71A 4NAXA 1ACVA 3A2XA 2H0GA 3EPTA 3O3TA 4F82A 3UJ1A 3E0UA 5KN3A 1Z7PA 3GIXA 1ZL9A 2H75A 1G6WA 1G7OA 1BJXA 1M99A 5AGYA 5IMZA 1O6JA 4WF5A 4HZ4A 1OYJA 1S3AA 1SL2B 1VF3A 3VWVA 2VCQA 3EWLA 2GZYA 1YZXA 4JR6A 3RBTA 3FYGA 3GTUB 1SK1A 2WCIA 1KEBA 1K0OA 3C8EA 5DALA 5IMCA 1I5GA 5ELGA 4Z7XA 4HDEA 4X4JA 1ABAA 3S9FA 5KEJA 1X9MB 1JZRA 1HNBA 3TJFA 1IYIA 4K1FA 3CSIA 1TRUA 3ZYWA 4FO5A 2LKUA 4NPBA 4TOPA 1M9BA 3F4RA 5IMVA 4HQZA 1TK8B 3KXOA 1Z7RA 2VAFA 4BA7A 5ECHB 5ECRB 2IMDA 2FWEA 2Z9SA 3W6GA 5HFGA 4L8EA 4IJIA 6GSVA 1GTBA 3N5OA 2YWOA 3MDKA 2HE3A 3TKQA 1SENA 2C8UA 2F51A 1TP9A 3JCML 3M1GA 1E2YA 1WRYA 3GTUA 2VLTA 2H76A 3FZAA 4YKFA 5H5SA 4MH3A 5BMUA 5JWQB 2R0CA 5CNWA 4MF6A 4O7HA 2MMNA 2OKAA 3WD6A 1TOFA 1GNWA 3C73A 3G9BA 2PGTA 3ZRDA 1WP0A 3ZLPA 2DJ1A 2FWFA 4TW5A 2J9HA 4Q5RA 3BCIA 4KDYA 2YCDA 1K0AA 2R4VA 5G1KA 1GL8A 3D21A 2EIOA 1UN2A 2AJQB 2GSQA 3UBLA 1H75A 5CRWA 3DGQA 4XRAA 1A24A 4KGIA 2B3SA 4TRXA 3UBKA 4Q5QA 4V1Ap 2C0GA 5IO0A 5F07A 3IHGA 4HS1A 4OD7A 2CVBA 3F3QA 2K9FA 1HQOA 1SL1B 5BRTA 4AJ8A 2ZNMA 5FWGA 3FEUA 2I9HA 1SKRB 5IPGA 1Z5YE 3FMWA 1THOA 1JLWA 1OC3A 4XS6A 1YKCA 1I9DA 1SK0A 3CYNA 1TU7A 2VIMA 3LSZA 3WT1A 1GSDA 4FIWA 4MPGA 1QMVA 1O8WA 4EVMA 1HYUA 2RUEA 3HVVA 2JSZA 4ILFA 3BOAA 3WT2A 4YKGA 1Q98A 2XPDA 17GSA 2VO4A 4G0KA 3FKFA 1GTAA 1TRVA 2I1UA 4OFMA 5F0GA 2HYXA 3EU3A 3QFAC 1XOBA 4F9ZA 2LQOA 4MABA 2C0DA 1M9AA 3TJKA 2MMAA 3IPZA 4MPFA 1TRWA 3RPNA 5J4UA 1SK2A 3GUSA 2DLXA 4K7OA 4WETA 5JCWA 4JE1A 1G7EA 3IAM2 5CYYA 3GFKA 2N5BA 4GSSA 6GSSA 1U3AA 1VRSD 2GLRA 3APSA 1OVNA 4IW9A 4ULXA 2RIIA 4EKZA 2RM6A 2V6KA 1SYRA 2FD3A 3RDWA 4OWYA 2WFCA 1SL0B 4HQSA 3J7Yb 1R4WA 6GSUA 4KB3A 4MJCA 1AUCA 1PN9A 2GTUA 4FH8A 2HSHA 4OFNA 2M46A 3A3TA 2QC7A 1A8YA 2PERA 1GSEA 2J23A 3GH9A 4IKHA 4V2LA 1R26A 2NTOA 1O81A 4HEA2 1YF0A 3IAS2 1PQNA 4G2EA 3VWXA 1TK5B 1GUKA 2K18A 7GSSA 2H1BA 2OA7A 2LNSA 1XWBA 2GQKA 1EV9A 4KDUA 4EDZA 2IWTA 4L0WA 2H0IA 4K5RA 5ECIB 1THXA 3UEMA 3P8WA 4YQUA 4ICYA 2B1KA 1WIKA 1X5CA 1TRSA 3SWLA 4MMMA 4TR4A 2O8VB 4I2UA 1HNCA 5DQYA 1T00A 1PMTA 2FWHA 10GSA 5KN1A 1YDKA 4CDOA 3ERGA 1CQGA 4F0BA 20GSA 5ENUA 3MWHA 4ISDA 2YV7A 1E6BA 5KOWA 2C0FA 2DKHA 3KH7A 3FZ5A 2GT5A 4GF0A 2YNXA 1BAYA 3FY7A 3Q6OA 4HZ2A 3VLNA 4EDYA 2L6DA 2YANA 1S3CA 2LJAA 4POBA 2HSYA 2NVLA 1MEKA 4V2MA 1LU4A 1XBSA 3CQFA 4LLRA 3QFBC 3UOMA 1K3LA 1ST9A 2VL9A 1Z6MA 1XG8A 3NZNA 4AF2A 3F63A 4PGTA 1MTCA 1ERWA 4USSA 2M80A 12GSA 3FR3A 4O5QA 5B8BA 3DMLA 4F0CA 4RI6A 3GH6A 4NMUA 2L59A 1T4YA 4EL1A 5IMAA 5E4WA 2YN1A 4ML1A 4IHUA 1BG5A 1XW9A 1F6MC 3QMXA 3EMXA 1A2JA 4ZL8A 1EOHA 5AIXA 3LXZA 3UIWA 2P5RA 3VI5A 3DRNA 1ERTA 3IOSA 5F06A 13GSA 1O73A 1GTIA 5GAND 3GL3A 2VCZA 1X5DA 2CVKA 3UL3A 2H1DA 4MZWA 5IOXA 1OE8A 4MK3A 2HLSA 3ZL5A 2YJHA 2HI7A 2YPMA 4QL9A 3F4SA 1AXDA 5CAXA 3WGDA 1V58A 4ZILA 3DVXA 2MMZA 1AIUA 1Z6NA 5CREA 4BPYA 3WYWA 3GA4A 3TJJA 2P0GA 1QK8A 2WJUA 3ZVJD 2H1GA 3FR9A 4X43A 3C71A 3HCZA 2LRNA 4IVFA 2B5EA 3QD9A 4J56E 5ELAA 3TDGA 3DEXA 2A2PA 4EXJA 1ZYEA 4KNDA 2HT9A 2KUCA 1TK0B 3LJRA 1X5EA 3A2VA 5D9TA 5KOXA 19GSA 2VL3A 1FB0A 1XW5A 2A4HA 3HD5A 4HOJA 3HXSA 1GULA 2H73A 3C1SA 4O5RA 5H5RA 5KN0A 4RQXA 4BL7A 3L4NA 3Q19A 3PINA 1EGOA 2F3MA 2R0GA 2WGRA 2BMXA 1TTZA 2FUG2 4NV5A 3QAGA 1YEPA 4WEYA 3IC8A 2V32A 3LFLA 4JRRA 4O32A 5LCZA 1W89A 3HZ4A 1PFOA 2CX4A 4G0LA 4ZBBA 1XPVA 4AJ6A 1GTUA 4G10A 3I6AA 2MZCA 4XRDA 1ILOA 3TOUA 2JZTA 2DJ3A 1RK4A 1SD9A 1PKZA 1G6YA 1GLPA 3HVNA 4KH7A 1GUMA 4JU5A 2JSYA 1WJKA 1Z9HA 3ZIJA 3TUEA 2E2MA 3G7IA 3APQA 2CQ9A 2PBJA 1EEMA 3QDNA 2B7KA 3I69A 3IV4A 4A5PA 3A5IA 2H74A 1Q4JA 2I3YA 4KA0A 4ZB6A 3LQ7A 3U5RE 3MYDA 4KE3A 1U3IA 1U87A 4EO3A 1X9SB 1PD21 1K3YA 1M2AA 4WR5A 3CRTA 3TRQA 1DUGA 2DBCA 2PPTA 3EMPA 4I5QA 5ECPB 1JLVA 3KGKA 2WZ9A 3UAPA 1TI1A 1VF1A 4EIQA 5DVBA 4BWSA 4HJMA 4Q5FA 2V1MA 4BVYB 4NXIA 1UC7A 1K3OA 2R0PA 1BQ7A 1EP8A 2AB6A 4YQMA 2R5GA 3GSSA 4GSTA 2IIYA 5FT3A 2CV4A 3HJMA 2VL2A 4QL7A 2DJKA 4G19A 1V40A 3D4MA 2H71A 3G7YA 5JCUA 1GSUA 2IMFA 4K7IA 1EZKA 3HA9A 4GRFA 4N11A 4RQRA 1JHBA 2LRTA 4Z2UA 2GT6A 3GYKA 5IPHA 2V6OA 2X8CA 4KCEA 2FA8A 2C3NA 4L5OA 4YAPA 4MA9A 3P2AA 1K0BA 3KIJA 1ERUA 3UMAA 4BVYA 2LNTA 4ZL7A 3GHAA 5KN2A 4PQHA 1XWAA 3CRUA 1O8XA 1GWCA 4PXOA 1TU8A 3F6FA 2EIRA 1A0FA 4JBBA 3M0FA 1ERVA 1OAZA 2KHPA 3D0ZA 3ZMLA 2ES7A 1RW1A 3VWUA 1SJ6A 3F6DA 2C3QA 2VLVA 5IOWA 2HRKA 1PN0A 2H72A 3IRAA 1F9MA 1M3IA 5G30A 2F8FA 2EIQA 2KLXA 4KW6A 1HD2A 2CA8A 11GSA 5E59A 2B1LA 5IQYA 4TN8A 1WOUA 5A5KA 4KUNA 1YEXA 2GSRA 5DCGA
chains in the Genus database with same CATH topology
2LEGA 1MD4A 3HDCA 1FHEA 4LL4B 2C3TA 2B6MA 3TKSC 5ECSA 3DKSA 2HZFA 5ECMB 3H93A 1Y6EA 4KDXA 2E7PA 2DMMA 2AYTA 3RAZA 1B9XC 4XIHA 1AC1A 1ZZYA 3R3EA 1EWXA 2GQLA 2LJKA 2H01A 1O85A 4EIPA 1JZWA 2GZPA 2WS2A 1B4QA 5AISA 4K7NA 1B9YC 4Z2RA 2QA2A 5G1LA 1PL2A 2P5QA 2B5YA 2LV3A 4FYCA 2VD0A 1T8EB 2QA1A 2IMEA 5ECNB 4GWRA 2K6VA 2BJXA 1V57A 4K9ZA 5CO3A 4KAEA 5A4VA 2VUPA 1XCCA 2H0HA 1DBYA 4MZBA 3CSHA 5HFIA 1TJDA 3GKXA 2ALBA 1XIYA 2XPEA 2DIZA 1VF2A 2L57A 2REMA 4IP1A 3AY8A 1DE1A 5FHIA 1ON4A 3QCPA 2TRXA 1JZOA 3GKMA 2FGXA 4MZCA 3J7Yk 2MMOA 4WXTA 4EF0A 3F0IA 3FZ4A 3GKKA 1ZMAA 2JZRA 2CAIA 3UVHA 4FYUA 3US3A 1ZYNA 3LXTA 4MP4A 4CY6A 2OBIA 5G31A 1QUWA 1MDJA 3IBHA 5DCHA 1HNAA 1SJZA 4DSRA 1GUHA 3GL5A 2JADA 4EC0A 1NHYA 5D9XA 3HHVA 2V41A 2VCWA 1YJ6A 1N2AA 1AQWA 4MCUA 3PGTA 2TIRA 1Z3EA 2VD1A 4K2DA 3LW9A 3IHQA 3RHBA 18GSA 2FNOA 4POLA 2UZ8A 2YWMA 2FHEA 3CSJA 4TR3A 1EV4A 4V2NA 4L5LA 1MDKA 2VM1A 3ME8A 2OACA 2AUVA 3TKSE 2C4JA 1GSSA 3C1RA 3FW2A 2JU5A 1YF1A 4IBPA 2DJ2A 5JWOB 2RLIA 1XWKA 1F3BA 4MF7A 2HSMA 1WWJA 1ZCPA 2PWJA 3ZIVA 1AQVA 1PGTA 1AW9A 1OC9B 3GN3A 5A4WA 2KP2A 3BD2A 1DSBA 4TR0A 2WB9A 4J2FA 1A23A 2CT6A 1TXXA 1XZOA 2K8VA 3KMOA 4N30A 1ZYQB 2XHFA 2YWIA 3QOUA 3QR6A 5J41A 2BTOT 3WGEA 2R37A 2RM5A 2H8LA 5B6MA 3D5JA 1FG4A 1FVJA 3MIXA 2NPBA 3D4TA 4E8HA 1GLQA 4ZB9A 4DSQA 4TKYA 4BVXB 2F8AA 3NOFA 1OC9A 2WDUA 3CXGA 1IYHA 5B7CA 3VFIA 2P31A 4OCFA 1KTEA 3MNGA 1SYXA 3KH9A 2DMLA 3ZFLA 4V1Ag 2PN8A 1T7PB 4ZBAA 5F05A 2ON7A 2QSIA 3KZQA 4CHSA 3IK9A 5HFKA 2C80A 1S3DA 4PNFA 5J3RA 4YQVA 2GS3A 1V2AA 3TRXA 4K0GA 2MBTA 4ML6A 3E9JB 3GKNA 3M9KA 4X0XA 2GZZA 2LUSA 2KP1A 5LD0A 2HXKA 2QGVA 3A2WA 1TDIA 2DIYA 1OKDA 4BVXA 3QPMA 4PTSA 1EOGA 1F2EA 3DD3A 2GDRA 4TVEA 1WE0A 4FYBA 1XWCA 5F8BA 1X9WB 3EU4A 2FA4A 4FQUA 2O85A 2ZCTA 3LGCA 2O7KA 2B5XA 2RUFA 2F9SA 2HFDA 4YH2A 1KNGA 2CX3A 2LRCA 4CW9A 3O76A 1F37A 4K0NA 2A2SA 2OJLA 1PX7A 4Q5NA 5D9VA 5IIZA 1M2DA 5C00A 1H4OA 2R3XA 5DJLA 3EINA 4WBRD 5ABRA 4OCEA 2H66A 1XXUA 4PUFC 1A8LA 2VCVA 3QAWA 4QQ7A 5A4UA 3IDVA 3TB2A 3KJYA 5IMDA 2LTKA 1SKSB 2O89A 1FW1A 4PUAA 4F2IA 1GP1A 3ISOA 1T1VA 2OADA 1XW6A 2ZUPA 2PUKC 3ED3A 4EE0A 4I2TA 5CRHA 5IMFA 5GAPD 3LWAA 1GRXA 1R7HA 1Y25A 4WR4A 5HR2A 3L0HA 2IMIA 3MAKA 5ECKB 1LJRA 4J57E 4MH2A 5B8AA 5CRDA 1NM3A 4GQFA 3TKRA 3L78A 5ECOB 3BCKA 1B4PA 2H70A 1QFNA 4ECCA 3ZREA 3LEFA 4K8MA 1PKWA 1R5AA 3CBUA 4G9HA 1OKTA 5CRGA 4F03A 1EP7A 4MJAA 2E2GA 3PH9A 4HUAA 4OFTA 2X64A 1J0FA 1NSWA 4IP6A 3L9VA 2IL3A 3ZITA 4ECBA 2E0QA 4MLYA 1PA3A 2K8SA 1ZOFA 4E8EA 4XS4B 5D93A 3MSZA 2H6YA 2R6KA 5HQPA 3U6VA 1URMA 5DJMA 4LMVA 2XBQA 4O92A 4XS1A 1TI3A 3H79A 3EC3A 4WKWA 1DE2A 5GSTA 2HRFA 4GSNA 8GSSA 2H1AA 1VF4A 2GSSA 3APOA 3HYPA 1OE7A 3H4KA 4BWQA 2O87A 1MDIA 2C0EA 1U6TA 2CAQA 5H5QA 3UARA 3FHKA 1BEDA 3DVWA 3C7MA 4YAVA 3ERFA 1A2LA 1O7UA 1SD8A 2YP6A 3VURA 3F3RA 1B48A 1K0MA 3KD0A 5HR0A 3P7XA 4NHWA 3W8SA 4XS4A 6GSWA 4HU7A 1U88A 4IS0A 2LQQA 4LMWA 2HZEB 3KTLA 3GRXA 3EE2A 3M8NA 3RHCA 3LG6A 2CZ2A 2H6XA 4D73B 3ME7A 4KSMA 3KCMA 2IFQB 2DC5A 1B8XA 1FAAA 4IQAA 3ZFBA 1AQXA 1PL1A 2G0FA 1LBKA 2HRAA 4N0ZA 1N8JA 4JZQA 2LS5A 1JFUA 4GCIA 2PMTA 5C04A 2A4VA 2VOCA 5DDLA 3TKPA 5D73A 4KCAA 1JZDA 5ID2B 3I9V2 3M9JA 1GSQA 2HZEA 3DWVA 1M0UA 3VWWA 1BX9A 3HKRA 4ZL9A 1R5PA 1GNEA 3QAVA 1GSYA 1CQHA 4POMA 4D73A 3HVXA 2IFQA 2JACA 2I4AA 3BBYA 3CMIA 2PU9C 4AJ7A 2AHEA 2NBSA 4WF4A 1NHOA 4O5UA 2YZHA 4I6XA 1EGRA 5GSSA 2PVOC 1V98A 1MD3A 3ERWA 3RPPA 4PX1A 3I43A 3TRPA 2ON5A 4TXOB 6GSYA 1VGLA 1FO5A 2JZSA 2NDOA 4PQ1A 4OMVA 1GH2A 4TR1B 3V1WA 5ID2A 2LJRA 1SKWB 22GSA 5DAKB 3IR4A 4MDCA 5JWRB 1SJIA 5G5FA 5LNKe 4RUVA 3GX8A 4JR4A 1K0CA 3FZ9A 3TJBA 3VPQA 2KOKA 4EUYA 1USBA 4HU9A 3TOTA 1RQMA 2XBIA 5ECQB 5CP1A 2YJ7A 4IGJA 1XVWA 3ZVJA 1FVKA 2DKIA 2OE1A 2H19A 4TXOA 3F8UA 3DIEA 2I81A 2C1YA 2X4AA 2L4CA 3EVIA 4IELA 4XTSA 2MYGA 4TR1A 3BJ5A 4DSSB 2M72A 3CTFA 3KP9A 3E3EA 5DAKA 4PURA 1GSFA 4POKA 2OE3A 4AGSA 2X99A 3ZTLA 3D22A 3HJOA 2IJYA 1K0DA 3VPTA 4ID0A 4I8BA 2CVDA 2YOIA 1UVZA 2HNLA 2MBSA 1FOVA 3TGZA 3IA1A 2GSTA 3ZZXA 1UA5A 2X8GA 2L5OA 4I97A 2FY6A 2PVQA 5COHA 3GSTA 1ZGNA 2VL2C 5J5NA 3Q18A 1FB6A 4DSSA 1A2MA 4DEJA 5INYA 3KTBA 1FOHA 1PRXA 5D96A 5EVOA 5G5EA 1EEJA 4ZB8A 4Z2TA 2DJ0A 3KMNA 2DJJA 1XOAA 3LORA 2FCHA 3IE3A 3FRCA 4ECIA 2V2GA 3F4TA 1G0TA 3HJPA 1TKDB 3N9JA 4K2XA 2FWGA 4P3YB 2L4QA 4XCSA 5HR1A 2CZ3A 2XC2A 1F3AA 2WRTA 1YQ1A 2OBKA 3GMFA 2YZUA 4K5SA 2L5LA 2VLUA 3LYKA 4NV2A 3H1NA 1XWGA 5IM9A 3GNJA 4H86A 1XFLA 2IPAA 2VCXA 4HI7A 3VK9A 1NW2A 3NIVA 5JCGA 1QQ2A 2D2ZA 3LYPA 5J9BA 4OO5A 3OR5A 2YV9A 1J9BA 4ECJA 3W8JA 3HZ8A 3SBCA 3IXRA 3UVTA 3Q74A 1YY7A 4KSOA 2FLSA 4NHZA 3R2QA 3IK7A 2A2RA 4MNNA 3PPUA 2IN3A 2VCTA 2G2QA 3L9SA 4JEDA 1ZYPA 4ZIJA 3HVSA 1C72A 5ECLB 3G7JA 1T3BA 4LL1B 5AN1A 3K8NA 4IJ3A 1QGVA 5IO2A 1J08A 5DQSA 3KP8A 3TJGA 2WULA 5EY6A 3L9UA 2R2JA 3KM6A 1QXHA 3TCOA 3ZMKA 2GVPA 4KX4A 2AV4A 2X8HA 14GSA 5D9WA 1V9WA 3CTGA 3F9UA 3HY2A 1AAZA 2DSAA 3IC4A 1TW9A 1W4VA 2GQMA 2OE0A 2IMKA 4TXVA 4N0VA 16GSA 4CY8A 4IQ1A 1K0NA 5DBQA 2X49A 4PNGA 5B6NA 4NWYA 4HJ2A 3P90A 5EL8A 4X1UA 2GGTA 1XVQA 2LSTA 3GURA 1M2BA 3FR6A 2YWNA 4GTUA 2L6CA 3M3MA 6GSXA 2N5AA 1SU9A 1WPIA 3FK8A 3DYRA 5G2ZA 4MJEA 4PQIA 5D8IA 3VI7A 4KF9A 4IN0A 1WMJA 4ZXGA 1PX6A 4ZBDA 5EPFA 1X0RA 2TRCP 4BL7B 4MF5A 3GX0A 2EC4A 1M7TA 3PR8A 3KEBA 4DVCA 3DXBA 2JL4A 2H30A 1KBNA 4G0IA 2QKEA 4N10A 2B7JA 3A5WA 1T4ZA 5J9CA 3GV1A 3EURA 5GZZB 4GQCA 4WBJA 3WGXA 3TKSA 4XHMA 1YKAA 1OC8A 2HRNA 1ML6A 1PSQA 6GSTA 1BYEA 2AAWA 4K6XA 3O6TA 2VM2A 4MJBA 3D6IA 3H8QA 1A0RP 4ACSA 4LA1A 5HR3A 4OO4A 4GXZA 4L0UA 2N5FA 3EYTA 4GLTA 5AIVA 9GSSA 4RI7A 5DALB 2H6ZA 5L71A 4NAXA 1ACVA 3A2XA 2H0GA 3EPTA 3O3TA 4F82A 3UJ1A 3E0UA 5KN3A 1Z7PA 3GIXA 1ZL9A 2H75A 1G6WA 1G7OA 1BJXA 1M99A 5AGYA 5IMZA 1O6JA 4WF5A 4HZ4A 1OYJA 1S3AA 1SL2B 1VF3A 3VWVA 2VCQA 3EWLA 2GZYA 1YZXA 4JR6A 3RBTA 3FYGA 3GTUB 1SK1A 2WCIA 1KEBA 1K0OA 3C8EA 5DALA 5IMCA 1I5GA 5ELGA 4Z7XA 4HDEA 4X4JA 1ABAA 3S9FA 5KEJA 1X9MB 1JZRA 1HNBA 3TJFA 1IYIA 4K1FA 3CSIA 1TRUA 3ZYWA 4FO5A 2LKUA 4NPBA 4TOPA 1M9BA 3F4RA 5IMVA 4HQZA 1TK8B 3KXOA 1Z7RA 2VAFA 4BA7A 5ECHB 5ECRB 2IMDA 2FWEA 2Z9SA 3W6GA 5HFGA 4L8EA 4IJIA 6GSVA 1GTBA 3N5OA 2YWOA 3MDKA 2HE3A 3TKQA 1SENA 2C8UA 2F51A 1TP9A 3JCML 3M1GA 1E2YA 1WRYA 3GTUA 2VLTA 2H76A 3FZAA 4YKFA 5H5SA 4MH3A 5BMUA 5JWQB 2R0CA 5CNWA 4MF6A 4O7HA 2MMNA 2OKAA 3WD6A 1TOFA 1GNWA 3C73A 3G9BA 2PGTA 3ZRDA 1WP0A 3ZLPA 2DJ1A 2FWFA 4TW5A 2J9HA 4Q5RA 3BCIA 4KDYA 2YCDA 1K0AA 2R4VA 5G1KA 1GL8A 3D21A 2EIOA 1UN2A 2AJQB 2GSQA 3UBLA 1H75A 5CRWA 3DGQA 4XRAA 1A24A 4KGIA 2B3SA 4TRXA 3UBKA 4Q5QA 4V1Ap 2C0GA 5IO0A 5F07A 3IHGA 4HS1A 4OD7A 2CVBA 3F3QA 2K9FA 1HQOA 1SL1B 5BRTA 4AJ8A 2ZNMA 5FWGA 3FEUA 2I9HA 1SKRB 5IPGA 1Z5YE 3FMWA 1THOA 1JLWA 1OC3A 4XS6A 1YKCA 1I9DA 1SK0A 3CYNA 1TU7A 2VIMA 3LSZA 3WT1A 1GSDA 4FIWA 4MPGA 1QMVA 1O8WA 4EVMA 1HYUA 2RUEA 3HVVA 2JSZA 4ILFA 3BOAA 3WT2A 4YKGA 1Q98A 2XPDA 17GSA 2VO4A 4G0KA 3FKFA 1GTAA 1TRVA 2I1UA 4OFMA 5F0GA 2HYXA 3EU3A 3QFAC 1XOBA 4F9ZA 2LQOA 4MABA 2C0DA 1M9AA 3TJKA 2MMAA 3IPZA 4MPFA 1TRWA 3RPNA 5J4UA 1SK2A 3GUSA 2DLXA 4K7OA 4WETA 5JCWA 4JE1A 1G7EA 3IAM2 5CYYA 3GFKA 2N5BA 4GSSA 6GSSA 1U3AA 1VRSD 2GLRA 3APSA 1OVNA 4IW9A 4ULXA 2RIIA 4EKZA 2RM6A 2V6KA 1SYRA 2FD3A 3RDWA 4OWYA 2WFCA 1SL0B 4HQSA 3J7Yb 1R4WA 6GSUA 4KB3A 4MJCA 1AUCA 1PN9A 2GTUA 4FH8A 2HSHA 4OFNA 2M46A 3A3TA 2QC7A 1A8YA 2PERA 1GSEA 2J23A 3GH9A 4IKHA 4V2LA 1R26A 2NTOA 1O81A 4HEA2 1YF0A 3IAS2 1PQNA 4G2EA 3VWXA 1TK5B 1GUKA 2K18A 7GSSA 2H1BA 2OA7A 2LNSA 1XWBA 2GQKA 1EV9A 4KDUA 4EDZA 2IWTA 4L0WA 2H0IA 4K5RA 5ECIB 1THXA 3UEMA 3P8WA 4YQUA 4ICYA 2B1KA 1WIKA 1X5CA 1TRSA 3SWLA 4MMMA 4TR4A 2O8VB 4I2UA 1HNCA 5DQYA 1T00A 1PMTA 2FWHA 10GSA 5KN1A 1YDKA 4CDOA 3ERGA 1CQGA 4F0BA 20GSA 5ENUA 3MWHA 4ISDA 2YV7A 1E6BA 5KOWA 2C0FA 2DKHA 3KH7A 3FZ5A 2GT5A 4GF0A 2YNXA 1BAYA 3FY7A 3Q6OA 4HZ2A 3VLNA 4EDYA 2L6DA 2YANA 1S3CA 2LJAA 4POBA 2HSYA 2NVLA 1MEKA 4V2MA 1LU4A 1XBSA 4LLRA 3QFBC 3UOMA 1K3LA 1ST9A 2VL9A 1Z6MA 3NZNA 4AF2A 3F63A 4PGTA 1MTCA 1ERWA 4USSA 2M80A 12GSA 3FR3A 4O5QA 5B8BA 3DMLA 4F0CA 4RI6A 3GH6A 4NMUA 2L59A 1T4YA 4EL1A 5IMAA 5E4WA 2YN1A 4ML1A 4IHUA 1BG5A 1XW9A 1F6MC 3QMXA 3EMXA 1A2JA 4ZL8A 1EOHA 5AIXA 3LXZA 3UIWA 2P5RA 3VI5A 3DRNA 1ERTA 3IOSA 5F06A 13GSA 1O73A 1GTIA 5GAND 3GL3A 2VCZA 1X5DA 2CVKA 3UL3A 2H1DA 4MZWA 5IOXA 1OE8A 4MK3A 2HLSA 3ZL5A 2YJHA 2HI7A 2YPMA 4QL9A 3F4SA 1AXDA 5CAXA 3WGDA 1V58A 4ZILA 3DVXA 2MMZA 1AIUA 1Z6NA 5CREA 4BPYA 3WYWA 3GA4A 3TJJA 2P0GA 1QK8A 2WJUA 3ZVJD 2H1GA 3FR9A 4X43A 3C71A 3HCZA 2LRNA 4IVFA 2B5EA 3QD9A 4J56E 5ELAA 3TDGA 3DEXA 2A2PA 4EXJA 1ZYEA 4KNDA 2HT9A 2KUCA 1TK0B 3LJRA 1X5EA 3A2VA 5D9TA 5KOXA 19GSA 2VL3A 1FB0A 1XW5A 2A4HA 3HD5A 4HOJA 3HXSA 1GULA 2H73A 3C1SA 4O5RA 5H5RA 5KN0A 4RQXA 4BL7A 3L4NA 3Q19A 3PINA 1EGOA 2F3MA 2R0GA 2WGRA 2BMXA 1TTZA 2FUG2 4NV5A 3QAGA 1YEPA 4WEYA 3IC8A 2V32A 3LFLA 4JRRA 4O32A 5LCZA 1W89A 3HZ4A 2CX4A 4G0LA 4ZBBA 1XPVA 4AJ6A 1GTUA 4G10A 3I6AA 2MZCA 4XRDA 1ILOA 3TOUA 2JZTA 2DJ3A 1RK4A 1SD9A 1PKZA 1G6YA 1GLPA 4KH7A 1GUMA 4JU5A 2JSYA 1WJKA 1Z9HA 3ZIJA 3TUEA 2E2MA 3G7IA 3APQA 2CQ9A 2PBJA 1EEMA 3QDNA 2B7KA 3I69A 3IV4A 4A5PA 3A5IA 2H74A 1Q4JA 2I3YA 4KA0A 4ZB6A 3LQ7A 3U5RE 3MYDA 4KE3A 1U3IA 1U87A 4EO3A 1X9SB 1PD21 1K3YA 1M2AA 4WR5A 3CRTA 3TRQA 1DUGA 2DBCA 2PPTA 3EMPA 4I5QA 5ECPB 1JLVA 3KGKA 2WZ9A 3UAPA 1TI1A 1VF1A 4EIQA 5DVBA 4BWSA 4HJMA 4Q5FA 2V1MA 4BVYB 4NXIA 1UC7A 1K3OA 2R0PA 1BQ7A 1EP8A 2AB6A 4YQMA 2R5GA 3GSSA 4GSTA 2IIYA 5FT3A 2CV4A 3HJMA 2VL2A 4QL7A 2DJKA 4G19A 1V40A 3D4MA 2H71A 3G7YA 5JCUA 1GSUA 2IMFA 4K7IA 1EZKA 3HA9A 4GRFA 4N11A 4RQRA 1JHBA 2LRTA 4Z2UA 2GT6A 3GYKA 5IPHA 2V6OA 2X8CA 4KCEA 2FA8A 2C3NA 4L5OA 4YAPA 4MA9A 3P2AA 1K0BA 3KIJA 1ERUA 3UMAA 4BVYA 2LNTA 4ZL7A 3GHAA 5KN2A 4PQHA 1XWAA 3CRUA 1O8XA 1GWCA 4PXOA 1TU8A 3F6FA 2EIRA 1A0FA 4JBBA 3M0FA 1ERVA 1OAZA 2KHPA 3D0ZA 3ZMLA 2ES7A 1RW1A 3VWUA 1SJ6A 3F6DA 2C3QA 2VLVA 5IOWA 2HRKA 1PN0A 2H72A 3IRAA 1F9MA 5G30A 2F8FA 2EIQA 2KLXA 4KW6A 1HD2A 2CA8A 11GSA 5E59A 2B1LA 5IQYA 4TN8A 1WOUA 5A5KA 4KUNA 1YEXA 2GSRA 5DCGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LEG A;  1MD4 A;  3HDC A;  1FHE A;  4LL4 B;  2C3T A;  2B6M A;  3TKS C;  5ECS A;  3DKS A;  2HZF A;  5ECM B;  3H93 A;  1Y6E A;  4KDX A;  2E7P A;  2DMM A;  2AYT A;  3RAZ A;  1B9X C;  4XIH A;  1AC1 A;  1ZZY A;  1EWX A;  2GQL A;  2LJK A;  2H01 A;  1O85 A;  1JZW A;  2GZP A;  2WS2 A;  1B4Q A;  5AIS A;  4K7N A;  1B9Y C;  5G1L A;  1PL2 A;  2P5Q A;  2B5Y A;  2LV3 A;  4FYC A;  2VD0 A;  1T8E B;  2IME A;  5ECN B;  4GWR A;  2K6V A;  2BJX A;  1V57 A;  4K9Z A;  5CO3 A;  4KAE A;  5A4V A;  2VUP A;  1XCC A;  2H0H A;  1DBY A;  4MZB A;  3CSH A;  5HFI A;  1TJD A;  3GKX A;  2ALB A;  1XIY A;  2XPE A;  2DIZ A;  1VF2 A;  2L57 A;  2REM A;  4IP1 A;  3AY8 A;  1DE1 A;  5FHI A;  1ON4 A;  3QCP A;  2TRX A;  1JZO A;  3GKM A;  2FGX A;  4MZC A;  3J7Y k;  2MMO A;  4WXT A;  4EF0 A;  3F0I A;  3FZ4 A;  3GKK A;  1ZMA A;  2JZR A;  2CAI A;  3UVH A;  4FYU A;  3US3 A;  3LXT A;  4MP4 A;  2OBI A;  5G31 A;  1QUW A;  1MDJ A;  3IBH A;  5DCH A;  1HNA A;  1SJZ A;  4DSR A;  1GUH A;  3GL5 A;  2JAD A;  4EC0 A;  1NHY A;  5D9X A;  3HHV A;  2V41 A;  2VCW A;  1YJ6 A;  1N2A A;  1AQW A;  4MCU A;  3PGT A;  2TIR A;  1Z3E A;  2VD1 A;  4K2D A;  3IHQ A;  3RHB A;  18GS A;  2FNO A;  4POL A;  2YWM A;  3CSJ A;  2FHE A;  4TR3 A;  1EV4 A;  4V2N A;  4L5L A;  1MDK A;  2VM1 A;  3ME8 A;  2OAC A;  2AUV A;  3TKS E;  2C4J A;  1GSS A;  3C1R A;  3FW2 A;  2JU5 A;  1YF1 A;  4IBP A;  2DJ2 A;  5JWO B;  2RLI A;  1XWK A;  1F3B A;  4MF7 A;  1WWJ A;  1ZCP A;  2PWJ A;  3ZIV A;  1AQV A;  1PGT A;  1AW9 A;  1OC9 B;  3GN3 A;  5A4W A;  2KP2 A;  3BD2 A;  1DSB A;  4TR0 A;  2WB9 A;  4J2F A;  1A23 A;  2CT6 A;  1TXX A;  1XZO A;  2K8V A;  3KMO A;  4N30 A;  1ZYQ B;  2XHF A;  2YWI A;  3QOU A;  3QR6 A;  5J41 A;  2BTO T;  3WGE A;  2R37 A;  2RM5 A;  2H8L A;  5B6M A;  3D5J A;  1FG4 A;  1FVJ A;  2NPB A;  3D4T A;  4E8H A;  1GLQ A;  4ZB9 A;  4DSQ A;  4TKY A;  2F8A A;  3NOF A;  1OC9 A;  2WDU A;  3CXG A;  1IYH A;  5B7C A;  3VFI A;  2P31 A;  4OCF A;  1KTE A;  3MNG A;  1SYX A;  3KH9 A;  2DML A;  3ZFL A;  4V1A g;  2PN8 A;  1T7P B;  4ZBA A;  5F05 A;  2ON7 A;  2QSI A;  3KZQ A;  4CHS A;  3IK9 A;  5HFK A;  2C80 A;  1S3D A;  4PNF A;  5J3R A;  4YQV A;  2GS3 A;  1V2A A;  3TRX A;  4K0G A;  2MBT A;  4ML6 A;  3E9J B;  3GKN A;  3M9K A;  4X0X A;  2GZZ A;  2LUS A;  2KP1 A;  5LD0 A;  2HXK A;  2QGV A;  3A2W A;  1TDI A;  2DIY A;  1OKD A;  4BVX A;  3QPM A;  1EOG A;  1F2E A;  3DD3 A;  2GDR A;  4TVE A;  1WE0 A;  4FYB A;  1XWC A;  5F8B A;  1X9W B;  3EU4 A;  2FA4 A;  2O85 A;  2ZCT A;  3LGC A;  2O7K A;  2B5X A;  2RUF A;  2F9S A;  2HFD A;  4YH2 A;  1KNG A;  2CX3 A;  2LRC A;  4CW9 A;  3O76 A;  1F37 A;  4K0N A;  2A2S A;  2OJL A;  1PX7 A;  4Q5N A;  5D9V A;  5IIZ A;  1M2D A;  5C00 A;  1H4O A;  2R3X A;  5DJL A;  3EIN A;  4WBR D;  5ABR A;  4OCE A;  2H66 A;  1XXU A;  4PUF C;  1A8L A;  2VCV A;  3QAW A;  4QQ7 A;  5A4U A;  3IDV A;  3TB2 A;  3KJY A;  5IMD A;  2LTK A;  1SKS B;  2O89 A;  1FW1 A;  4PUA A;  4F2I A;  1GP1 A;  3ISO A;  1T1V A;  2OAD A;  1XW6 A;  2ZUP A;  2PUK C;  3ED3 A;  4EE0 A;  4I2T A;  5CRH A;  5IMF A;  5GAP D;  3LWA A;  1GRX A;  1R7H A;  1Y25 A;  4WR4 A;  5HR2 A;  3L0H A;  2IMI A;  3MAK A;  5ECK B;  1LJR A;  4J57 E;  4MH2 A;  5B8A A;  5CRD A;  1NM3 A;  4GQF A;  3TKR A;  3L78 A;  5ECO B;  3BCK A;  1B4P A;  2H70 A;  1QFN A;  4ECC A;  3ZRE A;  3LEF A;  4K8M A;  1PKW A;  1R5A A;  3CBU A;  4G9H A;  1OKT A;  5CRG A;  4F03 A;  1EP7 A;  4MJA A;  2E2G A;  3PH9 A;  4HUA A;  4OFT A;  2X64 A;  1J0F A;  1NSW A;  4IP6 A;  3L9V A;  2IL3 A;  3ZIT A;  4ECB A;  2E0Q A;  4MLY A;  1PA3 A;  2K8S A;  1ZOF A;  4E8E A;  4XS4 B;  5D93 A;  3MSZ A;  2H6Y A;  2R6K A;  5HQP A;  3U6V A;  5DJM A;  1URM A;  4LMV A;  2XBQ A;  4O92 A;  4XS1 A;  1TI3 A;  3H79 A;  3EC3 A;  4WKW A;  1DE2 A;  5GST A;  2HRF A;  4GSN A;  8GSS A;  2H1A A;  1VF4 A;  2GSS A;  3APO A;  3HYP A;  1OE7 A;  3H4K A;  4BWQ A;  2O87 A;  1MDI A;  2C0E A;  1U6T A;  2CAQ A;  5H5Q A;  3UAR A;  3FHK A;  1BED A;  3DVW A;  3C7M A;  4YAV A;  3ERF A;  1A2L A;  1O7U A;  1SD8 A;  2YP6 A;  3VUR A;  3F3R A;  1B48 A;  1K0M A;  3KD0 A;  5HR0 A;  3P7X A;  4NHW A;  3W8S A;  4XS4 A;  6GSW A;  4HU7 A;  1U88 A;  4IS0 A;  2LQQ A;  4LMW A;  2HZE B;  3KTL A;  3GRX A;  3EE2 A;  3M8N A;  3RHC A;  3LG6 A;  2CZ2 A;  2H6X A;  4D73 B;  3ME7 A;  4KSM A;  3KCM A;  2IFQ B;  2DC5 A;  1B8X A;  1FAA A;  4IQA A;  3ZFB A;  1AQX A;  1PL1 A;  2G0F A;  1LBK A;  4N0Z A;  1N8J A;  4JZQ A;  2LS5 A;  1JFU A;  4GCI A;  2PMT A;  5C04 A;  2A4V A;  2VOC A;  5DDL A;  3TKP A;  5D73 A;  4KCA A;  1JZD A;  5ID2 B;  3I9V 2;  3M9J A;  1GSQ A;  2HZE A;  3DWV A;  1M0U A;  3VWW A;  1BX9 A;  3HKR A;  4ZL9 A;  1R5P A;  1GNE A;  3QAV A;  1GSY A;  1CQH A;  4POM A;  4D73 A;  3HVX A;  2IFQ A;  2JAC A;  2I4A A;  3BBY A;  3CMI A;  2PU9 C;  4AJ7 A;  2AHE A;  2NBS A;  4WF4 A;  1NHO A;  2YZH A;  4I6X A;  1EGR A;  5GSS A;  2PVO C;  1V98 A;  1MD3 A;  3ERW A;  3RPP A;  4PX1 A;  3I43 A;  3TRP A;  2ON5 A;  4TXO B;  6GSY A;  1VGL A;  1FO5 A;  2JZS A;  2NDO A;  4PQ1 A;  4OMV A;  1GH2 A;  4TR1 B;  3V1W A;  5ID2 A;  2LJR A;  1SKW B;  22GS A;  5DAK B;  3IR4 A;  4MDC A;  5JWR B;  1SJI A;  5G5F A;  5LNK e;  4RUV A;  3GX8 A;  4JR4 A;  1K0C A;  3FZ9 A;  3TJB A;  3VPQ A;  2KOK A;  4EUY A;  1USB A;  4HU9 A;  3TOT A;  1RQM A;  2XBI A;  5ECQ B;  5CP1 A;  2YJ7 A;  4IGJ A;  1XVW A;  3ZVJ A;  1FVK A;  2OE1 A;  2H19 A;  4TXO A;  3F8U A;  3DIE A;  2I81 A;  2C1Y A;  2L4C A;  3EVI A;  4IEL A;  4XTS A;  2MYG A;  4TR1 A;  3BJ5 A;  4DSS B;  2M72 A;  3CTF A;  3KP9 A;  3E3E A;  5DAK A;  4PUR A;  1GSF A;  4POK A;  2OE3 A;  4AGS A;  2X99 A;  3ZTL A;  3D22 A;  3HJO A;  2IJY A;  1K0D A;  3VPT A;  4ID0 A;  4I8B A;  2CVD A;  2YOI A;  1UVZ A;  2HNL A;  2MBS A;  1FOV A;  3TGZ A;  3IA1 A;  2GST A;  3ZZX A;  1UA5 A;  2X8G A;  2L5O A;  4I97 A;  2FY6 A;  2PVQ A;  5COH A;  3GST A;  1ZGN A;  2VL2 C;  5J5N A;  3Q18 A;  1FB6 A;  4DSS A;  1A2M A;  4DEJ A;  5INY A;  3KTB A;  1PRX A;  5D96 A;  5EVO A;  5G5E A;  1EEJ A;  4ZB8 A;  2DJ0 A;  3KMN A;  2DJJ A;  1XOA A;  3LOR A;  2FCH A;  3IE3 A;  3FRC A;  4ECI A;  2V2G A;  3F4T A;  1G0T A;  3HJP A;  1TKD B;  3N9J A;  2FWG A;  4P3Y B;  2L4Q A;  4XCS A;  5HR1 A;  2CZ3 A;  2XC2 A;  1F3A A;  2WRT A;  1YQ1 A;  2OBK A;  3GMF A;  2YZU A;  2L5L A;  2VLU A;  3LYK A;  4NV2 A;  3H1N A;  1XWG A;  5IM9 A;  3GNJ A;  4H86 A;  1XFL A;  2IPA A;  2VCX A;  4HI7 A;  3VK9 A;  1NW2 A;  3NIV A;  5JCG A;  1QQ2 A;  2D2Z A;  3LYP A;  5J9B A;  4OO5 A;  3OR5 A;  2YV9 A;  1J9B A;  4ECJ A;  3W8J A;  3HZ8 A;  3SBC A;  3IXR A;  3UVT A;  3Q74 A;  1YY7 A;  4KSO A;  2FLS A;  4NHZ A;  3R2Q A;  3IK7 A;  2A2R A;  2IN3 A;  2VCT A;  2G2Q A;  3L9S A;  4JED A;  4ZIJ A;  3HVS A;  1C72 A;  5ECL B;  3G7J A;  1T3B A;  4LL1 B;  5AN1 A;  3K8N A;  4IJ3 A;  1QGV A;  5IO2 A;  1J08 A;  5DQS A;  3KP8 A;  3TJG A;  2WUL A;  5EY6 A;  3L9U A;  2R2J A;  3KM6 A;  1QXH A;  3TCO A;  3ZMK A;  2GVP A;  4KX4 A;  2AV4 A;  2X8H A;  14GS A;  5D9W A;  1V9W A;  3CTG A;  3F9U A;  3HY2 A;  1AAZ A;  2DSA A;  3IC4 A;  1TW9 A;  1W4V A;  2GQM A;  2OE0 A;  2IMK A;  4TXV A;  4N0V A;  16GS A;  4IQ1 A;  1K0N A;  5DBQ A;  4PNG A;  5B6N A;  4NWY A;  4HJ2 A;  3P90 A;  5EL8 A;  4X1U A;  2GGT A;  1XVQ A;  2LST A;  3GUR A;  1M2B A;  3FR6 A;  2YWN A;  4GTU A;  2L6C A;  3M3M A;  6GSX A;  2N5A A;  1SU9 A;  1WPI A;  3FK8 A;  3DYR A;  5G2Z A;  4MJE A;  4PQI A;  5D8I A;  3VI7 A;  4IN0 A;  1WMJ A;  4ZXG A;  1PX6 A;  4ZBD A;  5EPF A;  1X0R A;  2TRC P;  4MF5 A;  3GX0 A;  2EC4 A;  1M7T A;  3PR8 A;  3KEB A;  4DVC A;  3DXB A;  2JL4 A;  2H30 A;  1KBN A;  2QKE A;  4N10 A;  2B7J A;  3A5W A;  1T4Z A;  5J9C A;  3GV1 A;  3EUR A;  5GZZ B;  4GQC A;  4WBJ A;  3WGX A;  3TKS A;  4XHM A;  1YKA A;  1OC8 A;  2HRN A;  1ML6 A;  1PSQ A;  6GST A;  1BYE A;  2AAW A;  4K6X A;  3O6T A;  2VM2 A;  4MJB A;  3D6I A;  3H8Q A;  1A0R P;  4ACS A;  4LA1 A;  5HR3 A;  4OO4 A;  4GXZ A;  4L0U A;  2N5F A;  3EYT A;  4GLT A;  5AIV A;  9GSS A;  4RI7 A;  5DAL B;  2H6Z A;  5L71 A;  4NAX A;  1ACV A;  3A2X A;  2H0G A;  3O3T A;  4F82 A;  3UJ1 A;  3E0U A;  5KN3 A;  1Z7P A;  3GIX A;  1ZL9 A;  2H75 A;  1G6W A;  1G7O A;  1BJX A;  1M99 A;  5AGY A;  5IMZ A;  1O6J A;  4WF5 A;  4HZ4 A;  1OYJ A;  1S3A A;  1SL2 B;  1VF3 A;  3VWV A;  2VCQ A;  3EWL A;  2GZY A;  1YZX A;  4JR6 A;  3RBT A;  3FYG A;  3GTU B;  1SK1 A;  2WCI A;  1KEB A;  1K0O A;  3C8E A;  5DAL A;  5IMC A;  1I5G A;  5ELG A;  4Z7X A;  4HDE A;  1ABA A;  3S9F A;  5KEJ A;  1X9M B;  1JZR A;  1HNB A;  3TJF A;  1IYI A;  4K1F A;  3CSI A;  1TRU A;  3ZYW A;  4FO5 A;  2LKU A;  4NPB A;  4TOP A;  1M9B A;  3F4R A;  5IMV A;  4HQZ A;  1TK8 B;  3KXO A;  1Z7R A;  2VAF A;  4BA7 A;  5ECH B;  5ECR B;  2IMD A;  2FWE A;  2Z9S A;  3W6G A;  5HFG A;  4L8E A;  4IJI A;  6GSV A;  1GTB A;  3N5O A;  2YWO A;  3MDK A;  2HE3 A;  3TKQ A;  1SEN A;  2C8U A;  2F51 A;  1TP9 A;  3JCM L;  3M1G A;  1E2Y A;  1WRY A;  3GTU A;  2VLT A;  2H76 A;  3FZA A;  5H5S A;  4MH3 A;  5JWQ B;  5CNW A;  4MF6 A;  4O7H A;  2MMN A;  2OKA A;  3WD6 A;  1TOF A;  1GNW A;  3C73 A;  3G9B A;  2PGT A;  3ZRD A;  1WP0 A;  3ZLP A;  2DJ1 A;  2FWF A;  4TW5 A;  2J9H A;  4Q5R A;  3BCI A;  4KDY A;  2YCD A;  1K0A A;  2R4V A;  5G1K A;  1GL8 A;  3D21 A;  2EIO A;  1UN2 A;  2AJQ B;  2GSQ A;  3UBL A;  1H75 A;  5CRW A;  3DGQ A;  4XRA A;  1A24 A;  4KGI A;  2B3S A;  4TRX A;  3UBK A;  4Q5Q A;  4V1A p;  2C0G A;  5IO0 A;  5F07 A;  4HS1 A;  4OD7 A;  2CVB A;  3F3Q A;  2K9F A;  1HQO A;  1SL1 B;  4AJ8 A;  2ZNM A;  5FWG A;  3FEU A;  2I9H A;  1SKR B;  5IPG A;  1Z5Y E;  1THO A;  1JLW A;  1OC3 A;  4XS6 A;  1YKC A;  1I9D A;  1SK0 A;  3CYN A;  1TU7 A;  2VIM A;  3LSZ A;  3WT1 A;  1GSD A;  4FIW A;  4MPG A;  1QMV A;  1O8W A;  4EVM A;  1HYU A;  2RUE A;  3HVV A;  2JSZ A;  4ILF A;  3BOA A;  3WT2 A;  1Q98 A;  2XPD A;  17GS A;  2VO4 A;  3FKF A;  1GTA A;  1TRV A;  2I1U A;  4OFM A;  5F0G A;  2HYX A;  3EU3 A;  3QFA C;  1XOB A;  4F9Z A;  2LQO A;  4MAB A;  2C0D A;  1M9A A;  3TJK A;  2MMA A;  3IPZ A;  4MPF A;  1TRW A;  3RPN A;  5J4U A;  1SK2 A;  3GUS A;  2DLX A;  4K7O A;  4WET A;  5JCW A;  4JE1 A;  1G7E A;  3IAM 2;  5CYY A;  3GFK A;  2N5B A;  4GSS A;  6GSS A;  1U3A A;  1VRS D;  2GLR A;  3APS A;  1OVN A;  4IW9 A;  4ULX A;  2RII A;  4EKZ A;  2RM6 A;  2V6K A;  1SYR A;  2FD3 A;  3RDW A;  4OWY A;  2WFC A;  1SL0 B;  4HQS A;  3J7Y b;  1R4W A;  6GSU A;  4KB3 A;  4MJC A;  1AUC A;  1PN9 A;  2GTU A;  4FH8 A;  2HSH A;  4OFN A;  2M46 A;  3A3T A;  2QC7 A;  1A8Y A;  2PER A;  1GSE A;  2J23 A;  3GH9 A;  4IKH A;  4V2L A;  1R26 A;  2NTO A;  1O81 A;  4HEA 2;  1YF0 A;  3IAS 2;  1PQN A;  4G2E A;  3VWX A;  1TK5 B;  1GUK A;  2K18 A;  7GSS A;  2H1B A;  2OA7 A;  2LNS A;  1XWB A;  2GQK A;  1EV9 A;  4KDU A;  4EDZ A;  2IWT A;  4L0W A;  2H0I A;  5ECI B;  1THX A;  3UEM A;  3P8W A;  4YQU A;  2B1K A;  1WIK A;  1X5C A;  1TRS A;  3SWL A;  4MMM A;  4TR4 A;  2O8V B;  4I2U A;  1HNC A;  5DQY A;  1T00 A;  1PMT A;  2FWH A;  10GS A;  5KN1 A;  1YDK A;  4CDO A;  3ERG A;  1CQG A;  4F0B A;  20GS A;  5ENU A;  3MWH A;  4ISD A;  2YV7 A;  1E6B A;  2C0F A;  3KH7 A;  3FZ5 A;  2GT5 A;  4GF0 A;  2YNX A;  1BAY A;  3FY7 A;  3Q6O A;  4HZ2 A;  3VLN A;  4EDY A;  2L6D A;  2YAN A;  1S3C A;  2LJA A;  4POB A;  2HSY A;  2NVL A;  1MEK A;  4V2M A;  1LU4 A;  1XBS A;  4LLR A;  3QFB C;  3UOM A;  1K3L A;  1ST9 A;  2VL9 A;  1Z6M A;  3NZN A;  4AF2 A;  3F63 A;  4PGT A;  1MTC A;  1ERW A;  2M80 A;  12GS A;  3FR3 A;  5B8B A;  3DML A;  4F0C A;  4RI6 A;  3GH6 A;  4NMU A;  2L59 A;  1T4Y A;  4EL1 A;  5IMA A;  5E4W A;  2YN1 A;  4ML1 A;  4IHU A;  1BG5 A;  1XW9 A;  1F6M C;  3QMX A;  3EMX A;  1A2J A;  4ZL8 A;  1EOH A;  5AIX A;  3LXZ A;  3UIW A;  2P5R A;  3VI5 A;  3DRN A;  1ERT A;  3IOS A;  5F06 A;  13GS A;  1O73 A;  1GTI A;  5GAN D;  3GL3 A;  2VCZ A;  1X5D A;  2CVK A;  3UL3 A;  2H1D A;  4MZW A;  5IOX A;  1OE8 A;  4MK3 A;  2HLS A;  3ZL5 A;  2YJH A;  2HI7 A;  2YPM A;  4QL9 A;  3F4S A;  1AXD A;  5CAX A;  3WGD A;  1V58 A;  4ZIL A;  3DVX A;  2MMZ A;  1AIU A;  1Z6N A;  5CRE A;  4BPY A;  3WYW A;  3GA4 A;  3TJJ A;  2P0G A;  1QK8 A;  2WJU A;  3ZVJ D;  2H1G A;  3FR9 A;  4X43 A;  3C71 A;  3HCZ A;  2LRN A;  4IVF A;  2B5E A;  3QD9 A;  4J56 E;  5ELA A;  3TDG A;  3DEX A;  4EXJ A;  1ZYE A;  4KND A;  2HT9 A;  2KUC A;  1TK0 B;  3LJR A;  1X5E A;  3A2V A;  5D9T A;  19GS A;  2VL3 A;  1FB0 A;  1XW5 A;  3HD5 A;  4HOJ A;  3HXS A;  1GUL A;  2H73 A;  3C1S A;  4O5R A;  5H5R A;  5KN0 A;  4RQX A;  4BL7 A;  3L4N A;  3Q19 A;  3PIN A;  1EGO A;  2F3M A;  2WGR A;  2BMX A;  1TTZ A;  2FUG 2;  4NV5 A;  3QAG A;  1YEP A;  4WEY A;  2V32 A;  3LFL A;  4JRR A;  4O32 A;  5LCZ A;  1W89 A;  3HZ4 A;  2CX4 A;  4ZBB A;  1XPV A;  4AJ6 A;  1GTU A;  4G10 A;  3I6A A;  2MZC A;  4XRD A;  1ILO A;  3TOU A;  2JZT A;  2DJ3 A;  1RK4 A;  1SD9 A;  1PKZ A;  1G6Y A;  1GLP A;  4KH7 A;  1GUM A;  4JU5 A;  2JSY A;  1WJK A;  1Z9H A;  3ZIJ A;  3TUE A;  2E2M A;  3G7I A;  3APQ A;  2CQ9 A;  2PBJ A;  1EEM A;  3QDN A;  2B7K A;  3I69 A;  3IV4 A;  2H74 A;  1Q4J A;  2I3Y A;  4KA0 A;  4ZB6 A;  3LQ7 A;  3U5R E;  4KE3 A;  1U3I A;  1U87 A;  4EO3 A;  1X9S B;  1PD2 1;  1K3Y A;  1M2A A;  4WR5 A;  3CRT A;  3TRQ A;  5ECP B;  1DUG A;  2DBC A;  2PPT A;  3EMP A;  4I5Q A;  1JLV A;  3KGK A;  2WZ9 A;  3UAP A;  1TI1 A;  1VF1 A;  5DVB A;  4BWS A;  4HJM A;  4Q5F A;  2V1M A;  4NXI A;  1UC7 A;  1K3O A;  1BQ7 A;  1EP8 A;  2AB6 A;  4YQM A;  2R5G A;  3GSS A;  4GST A;  2IIY A;  5FT3 A;  2CV4 A;  3HJM A;  2VL2 A;  4QL7 A;  2DJK A;  4G19 A;  1V40 A;  3D4M A;  2H71 A;  3G7Y A;  5JCU A;  1GSU A;  2IMF A;  4K7I A;  1EZK A;  3HA9 A;  4GRF A;  4N11 A;  4RQR A;  1JHB A;  2LRT A;  2GT6 A;  3GYK A;  5IPH A;  2V6O A;  2X8C A;  4KCE A;  2FA8 A;  2C3N A;  4L5O A;  4YAP A;  3P2A A;  1K0B A;  4MA9 A;  3KIJ A;  1ERU A;  3UMA A;  4BVY A;  2LNT A;  4ZL7 A;  3GHA A;  5KN2 A;  4PQH A;  1XWA A;  3CRU A;  1O8X A;  1GWC A;  4PXO A;  1TU8 A;  3F6F A;  2EIR A;  1A0F A;  4JBB A;  3M0F A;  1ERV A;  1OAZ A;  2KHP A;  3D0Z A;  3ZML A;  2ES7 A;  1RW1 A;  3VWU A;  1SJ6 A;  3F6D A;  2C3Q A;  2VLV A;  5IOW A;  2H72 A;  3IRA A;  1F9M A;  5G30 A;  2F8F A;  2EIQ A;  2KLX A;  4KW6 A;  1HD2 A;  2CA8 A;  11GS A;  5E59 A;  2B1L A;  5IQY A;  4TN8 A;  1WOU A;  5A5K A;  4KUN A;  1YEX A;  2GSR A;  5DCG A; 
#chains in the Genus database with same CATH topology
 2LEG A;  1MD4 A;  3HDC A;  1FHE A;  4LL4 B;  2C3T A;  2B6M A;  3TKS C;  5ECS A;  3DKS A;  2HZF A;  5ECM B;  3H93 A;  1Y6E A;  4KDX A;  2E7P A;  2DMM A;  2AYT A;  3RAZ A;  1B9X C;  4XIH A;  1AC1 A;  1ZZY A;  3R3E A;  1EWX A;  2GQL A;  2LJK A;  2H01 A;  1O85 A;  4EIP A;  1JZW A;  2GZP A;  2WS2 A;  1B4Q A;  5AIS A;  4K7N A;  1B9Y C;  4Z2R A;  2QA2 A;  5G1L A;  1PL2 A;  2P5Q A;  2B5Y A;  2LV3 A;  4FYC A;  2VD0 A;  1T8E B;  2QA1 A;  2IME A;  5ECN B;  4GWR A;  2K6V A;  2BJX A;  1V57 A;  4K9Z A;  5CO3 A;  4KAE A;  5A4V A;  2VUP A;  1XCC A;  2H0H A;  1DBY A;  4MZB A;  3CSH A;  5HFI A;  1TJD A;  3GKX A;  2ALB A;  1XIY A;  2XPE A;  2DIZ A;  1VF2 A;  2L57 A;  2REM A;  4IP1 A;  3AY8 A;  1DE1 A;  5FHI A;  1ON4 A;  3QCP A;  2TRX A;  1JZO A;  3GKM A;  2FGX A;  4MZC A;  3J7Y k;  2MMO A;  4WXT A;  4EF0 A;  3F0I A;  3FZ4 A;  3GKK A;  1ZMA A;  2JZR A;  2CAI A;  3UVH A;  4FYU A;  3US3 A;  1ZYN A;  3LXT A;  4MP4 A;  4CY6 A;  2OBI A;  5G31 A;  1QUW A;  1MDJ A;  3IBH A;  5DCH A;  1HNA A;  1SJZ A;  4DSR A;  1GUH A;  3GL5 A;  2JAD A;  4EC0 A;  1NHY A;  5D9X A;  3HHV A;  2V41 A;  2VCW A;  1YJ6 A;  1N2A A;  1AQW A;  4MCU A;  3PGT A;  2TIR A;  1Z3E A;  2VD1 A;  4K2D A;  3LW9 A;  3IHQ A;  3RHB A;  18GS A;  2FNO A;  4POL A;  2UZ8 A;  2YWM A;  2FHE A;  3CSJ A;  4TR3 A;  1EV4 A;  4V2N A;  4L5L A;  1MDK A;  2VM1 A;  3ME8 A;  2OAC A;  2AUV A;  3TKS E;  2C4J A;  1GSS A;  3C1R A;  3FW2 A;  2JU5 A;  1YF1 A;  4IBP A;  2DJ2 A;  5JWO B;  2RLI A;  1XWK A;  1F3B A;  4MF7 A;  2HSM A;  1WWJ A;  1ZCP A;  2PWJ A;  3ZIV A;  1AQV A;  1PGT A;  1AW9 A;  1OC9 B;  3GN3 A;  5A4W A;  2KP2 A;  3BD2 A;  1DSB A;  4TR0 A;  2WB9 A;  4J2F A;  1A23 A;  2CT6 A;  1TXX A;  1XZO A;  2K8V A;  3KMO A;  4N30 A;  1ZYQ B;  2XHF A;  2YWI A;  3QOU A;  3QR6 A;  5J41 A;  2BTO T;  3WGE A;  2R37 A;  2RM5 A;  2H8L A;  5B6M A;  3D5J A;  1FG4 A;  1FVJ A;  3MIX A;  2NPB A;  3D4T A;  4E8H A;  1GLQ A;  4ZB9 A;  4DSQ A;  4TKY A;  4BVX B;  2F8A A;  3NOF A;  1OC9 A;  2WDU A;  3CXG A;  1IYH A;  5B7C A;  3VFI A;  2P31 A;  4OCF A;  1KTE A;  3MNG A;  1SYX A;  3KH9 A;  2DML A;  3ZFL A;  4V1A g;  2PN8 A;  1T7P B;  4ZBA A;  5F05 A;  2ON7 A;  2QSI A;  3KZQ A;  4CHS A;  3IK9 A;  5HFK A;  2C80 A;  1S3D A;  4PNF A;  5J3R A;  4YQV A;  2GS3 A;  1V2A A;  3TRX A;  4K0G A;  2MBT A;  4ML6 A;  3E9J B;  3GKN A;  3M9K A;  4X0X A;  2GZZ A;  2LUS A;  2KP1 A;  5LD0 A;  2HXK A;  2QGV A;  3A2W A;  1TDI A;  2DIY A;  1OKD A;  4BVX A;  3QPM A;  4PTS A;  1EOG A;  1F2E A;  3DD3 A;  2GDR A;  4TVE A;  1WE0 A;  4FYB A;  1XWC A;  5F8B A;  1X9W B;  3EU4 A;  2FA4 A;  4FQU A;  2O85 A;  2ZCT A;  3LGC A;  2O7K A;  2B5X A;  2RUF A;  2F9S A;  2HFD A;  4YH2 A;  1KNG A;  2CX3 A;  2LRC A;  4CW9 A;  3O76 A;  1F37 A;  4K0N A;  2A2S A;  2OJL A;  1M3J A;  1PX7 A;  4Q5N A;  5D9V A;  5IIZ A;  1M2D A;  5C00 A;  1H4O A;  2R3X A;  5DJL A;  3EIN A;  4WBR D;  5ABR A;  4OCE A;  2H66 A;  1XXU A;  4PUF C;  1A8L A;  2VCV A;  3QAW A;  4QQ7 A;  5A4U A;  3IDV A;  3TB2 A;  3KJY A;  5IMD A;  2LTK A;  1SKS B;  2O89 A;  1FW1 A;  4PUA A;  4F2I A;  1GP1 A;  3ISO A;  1T1V A;  2OAD A;  1XW6 A;  2ZUP A;  2PUK C;  3ED3 A;  4EE0 A;  4I2T A;  5CRH A;  5IMF A;  5GAP D;  3LWA A;  1GRX A;  1R7H A;  1Y25 A;  4WR4 A;  5HR2 A;  3L0H A;  2IMI A;  3MAK A;  5ECK B;  4BIK A;  1LJR A;  4J57 E;  4MH2 A;  5B8A A;  5CRD A;  1NM3 A;  4GQF A;  3TKR A;  3L78 A;  5ECO B;  3BCK A;  1B4P A;  2H70 A;  1QFN A;  4ECC A;  3ZRE A;  3LEF A;  4K8M A;  1PKW A;  1R5A A;  3CBU A;  4G9H A;  1OKT A;  5CRG A;  4F03 A;  1EP7 A;  4MJA A;  2E2G A;  3PH9 A;  4HUA A;  4OFT A;  2X64 A;  1J0F A;  1NSW A;  4IP6 A;  3L9V A;  2IL3 A;  3ZIT A;  4ECB A;  2E0Q A;  4MLY A;  1PA3 A;  2K8S A;  1ZOF A;  4E8E A;  4XS4 B;  5D93 A;  3MSZ A;  2H6Y A;  2R6K A;  5HQP A;  3U6V A;  1URM A;  5DJM A;  4LMV A;  2XBQ A;  4O92 A;  4XS1 A;  1TI3 A;  3H79 A;  3EC3 A;  4WKW A;  1DE2 A;  5GST A;  2HRF A;  4GSN A;  8GSS A;  2H1A A;  1VF4 A;  2GSS A;  3APO A;  3HYP A;  1OE7 A;  3H4K A;  4BWQ A;  2O87 A;  1MDI A;  2C0E A;  1U6T A;  2CAQ A;  5H5Q A;  3UAR A;  3FHK A;  1BED A;  3DVW A;  3C7M A;  4YAV A;  3ERF A;  1A2L A;  1O7U A;  1SD8 A;  2YP6 A;  3VUR A;  3F3R A;  1B48 A;  1K0M A;  3KD0 A;  5HR0 A;  3P7X A;  4NHW A;  3W8S A;  4XS4 A;  6GSW A;  4HU7 A;  1U88 A;  4IS0 A;  2LQQ A;  4LMW A;  2HZE B;  3KTL A;  3GRX A;  3EE2 A;  3M8N A;  3RHC A;  3LG6 A;  2CZ2 A;  2H6X A;  4D73 B;  3ME7 A;  4KSM A;  3KCM A;  2IFQ B;  2DC5 A;  1B8X A;  1FAA A;  4IQA A;  3ZFB A;  1AQX A;  1PL1 A;  2G0F A;  1LBK A;  2HRA A;  4N0Z A;  1N8J A;  4JZQ A;  2LS5 A;  1JFU A;  4GCI A;  2PMT A;  5C04 A;  2A4V A;  2VOC A;  5DDL A;  3TKP A;  5D73 A;  4KCA A;  1JZD A;  5ID2 B;  3I9V 2;  3M9J A;  1GSQ A;  2HZE A;  3DWV A;  1M0U A;  3VWW A;  1BX9 A;  3HKR A;  4ZL9 A;  1R5P A;  1GNE A;  3QAV A;  1GSY A;  1CQH A;  4POM A;  4D73 A;  3HVX A;  2IFQ A;  2JAC A;  2I4A A;  3BBY A;  3CMI A;  2PU9 C;  4AJ7 A;  2AHE A;  2NBS A;  4WF4 A;  1NHO A;  4O5U A;  2YZH A;  4I6X A;  1EGR A;  5GSS A;  2PVO C;  1V98 A;  1MD3 A;  3ERW A;  3RPP A;  4PX1 A;  3I43 A;  3TRP A;  2ON5 A;  4TXO B;  6GSY A;  1VGL A;  1FO5 A;  2JZS A;  2NDO A;  4PQ1 A;  4OMV A;  1GH2 A;  4TR1 B;  3V1W A;  5ID2 A;  2LJR A;  1SKW B;  22GS A;  4HSC X;  5DAK B;  3IR4 A;  4MDC A;  5JWR B;  1SJI A;  5G5F A;  5LNK e;  4RUV A;  3GX8 A;  4JR4 A;  1K0C A;  3FZ9 A;  3TJB A;  3VPQ A;  2KOK A;  4EUY A;  1USB A;  4HU9 A;  3TOT A;  1RQM A;  2XBI A;  5ECQ B;  5CP1 A;  2YJ7 A;  4IGJ A;  1XVW A;  3ZVJ A;  1FVK A;  2DKI A;  2OE1 A;  2H19 A;  4TXO A;  3F8U A;  3DIE A;  2I81 A;  2C1Y A;  2X4A A;  2L4C A;  3EVI A;  4IEL A;  4XTS A;  2MYG A;  4TR1 A;  3BJ5 A;  4DSS B;  2M72 A;  3CTF A;  3KP9 A;  3E3E A;  5DAK A;  4PUR A;  1GSF A;  4POK A;  2OE3 A;  4AGS A;  2X99 A;  3ZTL A;  3D22 A;  3HJO A;  2IJY A;  1K0D A;  3VPT A;  4ID0 A;  4I8B A;  2CVD A;  2YOI A;  1UVZ A;  2HNL A;  2MBS A;  1FOV A;  3TGZ A;  3IA1 A;  2GST A;  3ZZX A;  1UA5 A;  2X8G A;  2L5O A;  4I97 A;  2FY6 A;  2PVQ A;  5COH A;  3GST A;  1ZGN A;  2VL2 C;  5J5N A;  3Q18 A;  1FB6 A;  4DSS A;  1A2M A;  4DEJ A;  5INY A;  3KTB A;  1FOH A;  1PRX A;  5D96 A;  5EVO A;  5G5E A;  1EEJ A;  4ZB8 A;  4Z2T A;  2DJ0 A;  3KMN A;  2DJJ A;  1XOA A;  3LOR A;  2FCH A;  3IE3 A;  3FRC A;  4ECI A;  2V2G A;  3F4T A;  1G0T A;  3HJP A;  1TKD B;  3N9J A;  4K2X A;  2FWG A;  4P3Y B;  2L4Q A;  4XCS A;  5HR1 A;  2CZ3 A;  2XC2 A;  1F3A A;  2WRT A;  1YQ1 A;  2OBK A;  3GMF A;  2YZU A;  4K5S A;  2L5L A;  2VLU A;  3LYK A;  4NV2 A;  3H1N A;  1XWG A;  5IM9 A;  3GNJ A;  4H86 A;  1XFL A;  2IPA A;  2VCX A;  4HI7 A;  3VK9 A;  1NW2 A;  3NIV A;  5JCG A;  1QQ2 A;  2D2Z A;  3LYP A;  5J9B A;  4OO5 A;  3OR5 A;  2YV9 A;  1J9B A;  4ECJ A;  3W8J A;  3HZ8 A;  3SBC A;  3IXR A;  3UVT A;  3Q74 A;  1YY7 A;  4KSO A;  2FLS A;  4NHZ A;  3R2Q A;  3IK7 A;  2A2R A;  4MNN A;  3PPU A;  2IN3 A;  2VCT A;  2G2Q A;  3L9S A;  4JED A;  1ZYP A;  4ZIJ A;  3HVS A;  1C72 A;  5ECL B;  3G7J A;  1T3B A;  4LL1 B;  5AN1 A;  3K8N A;  4IJ3 A;  1QGV A;  5IO2 A;  1J08 A;  5DQS A;  3KP8 A;  3TJG A;  2WUL A;  5EY6 A;  3L9U A;  2R2J A;  3KM6 A;  1QXH A;  3TCO A;  3ZMK A;  2GVP A;  4KX4 A;  2AV4 A;  2X8H A;  14GS A;  5D9W A;  1V9W A;  3CTG A;  3F9U A;  3HY2 A;  1AAZ A;  2DSA A;  3IC4 A;  1TW9 A;  1W4V A;  2GQM A;  2OE0 A;  2IMK A;  4TXV A;  4N0V A;  16GS A;  4CY8 A;  4IQ1 A;  1K0N A;  5DBQ A;  2X49 A;  4PNG A;  5B6N A;  4NWY A;  4HJ2 A;  3P90 A;  5EL8 A;  4X1U A;  2GGT A;  1XVQ A;  2LST A;  3GUR A;  1M2B A;  3FR6 A;  2YWN A;  4GTU A;  2L6C A;  3M3M A;  6GSX A;  2N5A A;  1SU9 A;  1WPI A;  3FK8 A;  3DYR A;  5G2Z A;  4MJE A;  4PQI A;  5D8I A;  3VI7 A;  4KF9 A;  4IN0 A;  1WMJ A;  4ZXG A;  1PX6 A;  4ZBD A;  5EPF A;  1X0R A;  2TRC P;  4BL7 B;  4MF5 A;  3GX0 A;  2EC4 A;  1M7T A;  3PR8 A;  3KEB A;  4DVC A;  3DXB A;  2JL4 A;  2H30 A;  1KBN A;  4G0I A;  2QKE A;  1S3R A;  4N10 A;  2B7J A;  3A5W A;  1T4Z A;  5J9C A;  3GV1 A;  3EUR A;  5GZZ B;  4GQC A;  4WBJ A;  3WGX A;  3TKS A;  4XHM A;  1YKA A;  1OC8 A;  2HRN A;  1ML6 A;  1PSQ A;  6GST A;  1BYE A;  2AAW A;  4K6X A;  3O6T A;  2VM2 A;  4MJB A;  3D6I A;  3H8Q A;  1A0R P;  4ACS A;  4LA1 A;  5HR3 A;  4OO4 A;  4GXZ A;  4L0U A;  2N5F A;  3EYT A;  4GLT A;  5AIV A;  9GSS A;  4RI7 A;  5DAL B;  2H6Z A;  5L71 A;  4NAX A;  1ACV A;  3A2X A;  2H0G A;  3EPT A;  3O3T A;  4F82 A;  3UJ1 A;  3E0U A;  5KN3 A;  1Z7P A;  3GIX A;  1ZL9 A;  2H75 A;  1G6W A;  1G7O A;  1BJX A;  1M99 A;  5AGY A;  5IMZ A;  1O6J A;  4WF5 A;  4HZ4 A;  1OYJ A;  1S3A A;  1SL2 B;  1VF3 A;  3VWV A;  2VCQ A;  3EWL A;  2GZY A;  1YZX A;  4JR6 A;  3RBT A;  3FYG A;  3GTU B;  1SK1 A;  2WCI A;  1KEB A;  1K0O A;  3C8E A;  5DAL A;  5IMC A;  1I5G A;  5ELG A;  4Z7X A;  4HDE A;  4X4J A;  1ABA A;  3S9F A;  5KEJ A;  1X9M B;  1JZR A;  1HNB A;  3TJF A;  1IYI A;  4K1F A;  3CSI A;  1TRU A;  3ZYW A;  4FO5 A;  2LKU A;  4NPB A;  4TOP A;  1M9B A;  3F4R A;  5IMV A;  4HQZ A;  1TK8 B;  3KXO A;  1Z7R A;  2VAF A;  4BA7 A;  5ECH B;  5ECR B;  2IMD A;  2FWE A;  2Z9S A;  3W6G A;  5HFG A;  4L8E A;  4IJI A;  6GSV A;  1GTB A;  3N5O A;  2YWO A;  3MDK A;  2HE3 A;  3TKQ A;  1SEN A;  2C8U A;  2F51 A;  1TP9 A;  3JCM L;  3M1G A;  1E2Y A;  1WRY A;  3GTU A;  2VLT A;  2H76 A;  3FZA A;  4YKF A;  5H5S A;  4MH3 A;  5BMU A;  5JWQ B;  2R0C A;  5CNW A;  4MF6 A;  4O7H A;  2MMN A;  2OKA A;  3WD6 A;  1TOF A;  1GNW A;  3C73 A;  3G9B A;  2PGT A;  3ZRD A;  1WP0 A;  3ZLP A;  2DJ1 A;  2FWF A;  4TW5 A;  2J9H A;  4Q5R A;  3BCI A;  4KDY A;  2YCD A;  1K0A A;  2R4V A;  5G1K A;  1GL8 A;  3D21 A;  2EIO A;  1UN2 A;  2AJQ B;  2GSQ A;  3UBL A;  1H75 A;  5CRW A;  3DGQ A;  4XRA A;  1A24 A;  4KGI A;  2B3S A;  4TRX A;  3UBK A;  4Q5Q A;  4V1A p;  2C0G A;  5IO0 A;  5F07 A;  3IHG A;  4HS1 A;  4OD7 A;  2CVB A;  3F3Q A;  2K9F A;  1HQO A;  1SL1 B;  5BRT A;  4AJ8 A;  2ZNM A;  5FWG A;  3FEU A;  2I9H A;  1SKR B;  5IPG A;  1Z5Y E;  3FMW A;  1THO A;  1JLW A;  1OC3 A;  4XS6 A;  1YKC A;  1I9D A;  1SK0 A;  3CYN A;  1TU7 A;  2VIM A;  3LSZ A;  3WT1 A;  1GSD A;  4FIW A;  4MPG A;  1QMV A;  1O8W A;  4EVM A;  1HYU A;  2RUE A;  3HVV A;  2JSZ A;  4ILF A;  3BOA A;  3WT2 A;  4YKG A;  1Q98 A;  2XPD A;  17GS A;  2VO4 A;  4G0K A;  3FKF A;  1GTA A;  1TRV A;  2I1U A;  4OFM A;  5F0G A;  2HYX A;  3EU3 A;  3QFA C;  1XOB A;  4F9Z A;  2LQO A;  4MAB A;  2C0D A;  1M9A A;  3TJK A;  2MMA A;  3IPZ A;  4MPF A;  1TRW A;  3RPN A;  5J4U A;  1SK2 A;  3GUS A;  2DLX A;  4K7O A;  4WET A;  5JCW A;  4JE1 A;  1G7E A;  3IAM 2;  5CYY A;  3GFK A;  2N5B A;  4GSS A;  6GSS A;  1U3A A;  1VRS D;  2GLR A;  3APS A;  1OVN A;  4IW9 A;  4ULX A;  2RII A;  4EKZ A;  2RM6 A;  2V6K A;  1SYR A;  2FD3 A;  3RDW A;  4OWY A;  2WFC A;  1SL0 B;  4HQS A;  3J7Y b;  1R4W A;  6GSU A;  4KB3 A;  4MJC A;  1AUC A;  1PN9 A;  2GTU A;  4FH8 A;  2HSH A;  4OFN A;  2M46 A;  3A3T A;  2QC7 A;  1A8Y A;  2PER A;  1GSE A;  2J23 A;  3GH9 A;  4IKH A;  4V2L A;  1R26 A;  2NTO A;  1O81 A;  4HEA 2;  1YF0 A;  3IAS 2;  1PQN A;  4G2E A;  3VWX A;  1TK5 B;  1GUK A;  2K18 A;  7GSS A;  2H1B A;  2OA7 A;  2LNS A;  1XWB A;  2GQK A;  1EV9 A;  4KDU A;  4EDZ A;  2IWT A;  4L0W A;  2H0I A;  4K5R A;  5ECI B;  1THX A;  3UEM A;  3P8W A;  4YQU A;  4ICY A;  2B1K A;  1WIK A;  1X5C A;  1TRS A;  3SWL A;  4MMM A;  4TR4 A;  2O8V B;  4I2U A;  1HNC A;  5DQY A;  1T00 A;  1PMT A;  2FWH A;  10GS A;  5KN1 A;  1YDK A;  4CDO A;  3ERG A;  1CQG A;  4F0B A;  20GS A;  5ENU A;  3MWH A;  4ISD A;  2YV7 A;  1E6B A;  5KOW A;  2C0F A;  2DKH A;  3KH7 A;  3FZ5 A;  2GT5 A;  4GF0 A;  2YNX A;  1BAY A;  3FY7 A;  3Q6O A;  4HZ2 A;  3VLN A;  4EDY A;  2L6D A;  2YAN A;  1S3C A;  2LJA A;  4POB A;  2HSY A;  2NVL A;  1MEK A;  4V2M A;  1LU4 A;  1XBS A;  3CQF A;  4LLR A;  3QFB C;  3UOM A;  1K3L A;  1ST9 A;  2VL9 A;  1Z6M A;  1XG8 A;  3NZN A;  4AF2 A;  3F63 A;  4PGT A;  1MTC A;  1ERW A;  4USS A;  2M80 A;  12GS A;  3FR3 A;  4O5Q A;  5B8B A;  3DML A;  4F0C A;  4RI6 A;  3GH6 A;  4NMU A;  2L59 A;  1T4Y A;  4EL1 A;  5IMA A;  5E4W A;  2YN1 A;  4ML1 A;  4IHU A;  1BG5 A;  1XW9 A;  1F6M C;  3QMX A;  3EMX A;  1A2J A;  4ZL8 A;  1EOH A;  5AIX A;  3LXZ A;  3UIW A;  2P5R A;  3VI5 A;  3DRN A;  1ERT A;  3IOS A;  5F06 A;  13GS A;  1O73 A;  1GTI A;  5GAN D;  3GL3 A;  2VCZ A;  1X5D A;  2CVK A;  3UL3 A;  2H1D A;  4MZW A;  5IOX A;  1OE8 A;  4MK3 A;  2HLS A;  3ZL5 A;  2YJH A;  2HI7 A;  2YPM A;  4QL9 A;  3F4S A;  1AXD A;  5CAX A;  3WGD A;  1V58 A;  4ZIL A;  3DVX A;  2MMZ A;  1AIU A;  1Z6N A;  5CRE A;  4BPY A;  3WYW A;  3GA4 A;  3TJJ A;  2P0G A;  1QK8 A;  2WJU A;  3ZVJ D;  2H1G A;  3FR9 A;  4X43 A;  3C71 A;  3HCZ A;  2LRN A;  4IVF A;  2B5E A;  3QD9 A;  4J56 E;  5ELA A;  3TDG A;  3DEX A;  2A2P A;  4EXJ A;  1ZYE A;  4KND A;  2HT9 A;  2KUC A;  1TK0 B;  3LJR A;  1X5E A;  3A2V A;  5D9T A;  5KOX A;  19GS A;  2VL3 A;  1FB0 A;  1XW5 A;  2A4H A;  3HD5 A;  4HOJ A;  3HXS A;  1GUL A;  2H73 A;  3C1S A;  4O5R A;  5H5R A;  5KN0 A;  4RQX A;  4BL7 A;  3L4N A;  3Q19 A;  3PIN A;  1EGO A;  2F3M A;  2R0G A;  2WGR A;  2BMX A;  1TTZ A;  2FUG 2;  4NV5 A;  3QAG A;  1YEP A;  4WEY A;  3IC8 A;  2V32 A;  3LFL A;  4JRR A;  4O32 A;  5LCZ A;  1W89 A;  3HZ4 A;  1PFO A;  2CX4 A;  4G0L A;  4ZBB A;  1XPV A;  4AJ6 A;  1GTU A;  4G10 A;  3I6A A;  2MZC A;  4XRD A;  1ILO A;  3TOU A;  2JZT A;  2DJ3 A;  1RK4 A;  1SD9 A;  1PKZ A;  1G6Y A;  1GLP A;  3HVN A;  4KH7 A;  1GUM A;  4JU5 A;  2JSY A;  1WJK A;  1Z9H A;  3ZIJ A;  3TUE A;  2E2M A;  3G7I A;  3APQ A;  2CQ9 A;  2PBJ A;  1EEM A;  3QDN A;  2B7K A;  3I69 A;  3IV4 A;  4A5P A;  3A5I A;  2H74 A;  1Q4J A;  2I3Y A;  4KA0 A;  4ZB6 A;  3LQ7 A;  3U5R E;  3MYD A;  4KE3 A;  1U3I A;  1U87 A;  4EO3 A;  1X9S B;  1PD2 1;  1K3Y A;  1M2A A;  4WR5 A;  3CRT A;  3TRQ A;  1DUG A;  2DBC A;  2PPT A;  3EMP A;  4I5Q A;  5ECP B;  1JLV A;  3KGK A;  2WZ9 A;  3UAP A;  1TI1 A;  1VF1 A;  4EIQ A;  5DVB A;  4BWS A;  4HJM A;  4Q5F A;  2V1M A;  4BVY B;  4NXI A;  1UC7 A;  1K3O A;  2R0P A;  1BQ7 A;  1EP8 A;  2AB6 A;  4YQM A;  2R5G A;  3GSS A;  4GST A;  2IIY A;  5FT3 A;  2CV4 A;  3HJM A;  2VL2 A;  4QL7 A;  2DJK A;  4G19 A;  1V40 A;  3D4M A;  2H71 A;  3G7Y A;  5JCU A;  1GSU A;  2IMF A;  4K7I A;  1EZK A;  3HA9 A;  4GRF A;  4N11 A;  4RQR A;  1JHB A;  2LRT A;  4Z2U A;  2GT6 A;  3GYK A;  5IPH A;  2V6O A;  2X8C A;  4KCE A;  2FA8 A;  2C3N A;  4L5O A;  4YAP A;  4MA9 A;  3P2A A;  1K0B A;  3KIJ A;  1ERU A;  3UMA A;  4BVY A;  2LNT A;  4ZL7 A;  3GHA A;  5KN2 A;  4PQH A;  1XWA A;  3CRU A;  1O8X A;  1GWC A;  4PXO A;  1TU8 A;  3F6F A;  2EIR A;  1A0F A;  4JBB A;  3M0F A;  1ERV A;  1OAZ A;  2KHP A;  3D0Z A;  3ZML A;  2ES7 A;  1RW1 A;  3VWU A;  1SJ6 A;  3F6D A;  2C3Q A;  2VLV A;  5IOW A;  2HRK A;  1PN0 A;  2H72 A;  3IRA A;  1F9M A;  1M3I A;  5G30 A;  2F8F A;  2EIQ A;  2KLX A;  4KW6 A;  1HD2 A;  2CA8 A;  11GS A;  5E59 A;  2B1L A;  5IQY A;  4TN8 A;  1WOU A;  5A5K A;  4KUN A;  1YEX A;  2GSR A;  5DCG A; 
#chains in the Genus database with same CATH homology
 2LEG A;  1MD4 A;  3HDC A;  1FHE A;  4LL4 B;  2C3T A;  2B6M A;  3TKS C;  5ECS A;  3DKS A;  2HZF A;  5ECM B;  3H93 A;  1Y6E A;  4KDX A;  2E7P A;  2DMM A;  2AYT A;  3RAZ A;  1B9X C;  4XIH A;  1AC1 A;  1ZZY A;  3R3E A;  1EWX A;  2GQL A;  2LJK A;  2H01 A;  1O85 A;  4EIP A;  1JZW A;  2GZP A;  2WS2 A;  1B4Q A;  5AIS A;  4K7N A;  1B9Y C;  4Z2R A;  2QA2 A;  5G1L A;  1PL2 A;  2P5Q A;  2B5Y A;  2LV3 A;  4FYC A;  2VD0 A;  1T8E B;  2QA1 A;  2IME A;  5ECN B;  4GWR A;  2K6V A;  2BJX A;  1V57 A;  4K9Z A;  5CO3 A;  4KAE A;  5A4V A;  2VUP A;  1XCC A;  2H0H A;  1DBY A;  4MZB A;  3CSH A;  5HFI A;  1TJD A;  3GKX A;  2ALB A;  1XIY A;  2XPE A;  2DIZ A;  1VF2 A;  2L57 A;  2REM A;  4IP1 A;  3AY8 A;  1DE1 A;  5FHI A;  1ON4 A;  3QCP A;  2TRX A;  1JZO A;  3GKM A;  2FGX A;  4MZC A;  3J7Y k;  2MMO A;  4WXT A;  4EF0 A;  3F0I A;  3FZ4 A;  3GKK A;  1ZMA A;  2JZR A;  2CAI A;  3UVH A;  4FYU A;  3US3 A;  1ZYN A;  3LXT A;  4MP4 A;  4CY6 A;  2OBI A;  5G31 A;  1QUW A;  1MDJ A;  3IBH A;  5DCH A;  1HNA A;  1SJZ A;  4DSR A;  1GUH A;  3GL5 A;  2JAD A;  4EC0 A;  1NHY A;  5D9X A;  3HHV A;  2V41 A;  2VCW A;  1YJ6 A;  1N2A A;  1AQW A;  4MCU A;  3PGT A;  2TIR A;  1Z3E A;  2VD1 A;  4K2D A;  3LW9 A;  3IHQ A;  3RHB A;  18GS A;  2FNO A;  4POL A;  2UZ8 A;  2YWM A;  2FHE A;  3CSJ A;  4TR3 A;  1EV4 A;  4V2N A;  4L5L A;  1MDK A;  2VM1 A;  3ME8 A;  2OAC A;  2AUV A;  3TKS E;  2C4J A;  1GSS A;  3C1R A;  3FW2 A;  2JU5 A;  1YF1 A;  4IBP A;  2DJ2 A;  5JWO B;  2RLI A;  1XWK A;  1F3B A;  4MF7 A;  2HSM A;  1WWJ A;  1ZCP A;  2PWJ A;  3ZIV A;  1AQV A;  1PGT A;  1AW9 A;  1OC9 B;  3GN3 A;  5A4W A;  2KP2 A;  3BD2 A;  1DSB A;  4TR0 A;  2WB9 A;  4J2F A;  1A23 A;  2CT6 A;  1TXX A;  1XZO A;  2K8V A;  3KMO A;  4N30 A;  1ZYQ B;  2XHF A;  2YWI A;  3QOU A;  3QR6 A;  5J41 A;  2BTO T;  3WGE A;  2R37 A;  2RM5 A;  2H8L A;  5B6M A;  3D5J A;  1FG4 A;  1FVJ A;  3MIX A;  2NPB A;  3D4T A;  4E8H A;  1GLQ A;  4ZB9 A;  4DSQ A;  4TKY A;  4BVX B;  2F8A A;  3NOF A;  1OC9 A;  2WDU A;  3CXG A;  1IYH A;  5B7C A;  3VFI A;  2P31 A;  4OCF A;  1KTE A;  3MNG A;  1SYX A;  3KH9 A;  2DML A;  3ZFL A;  4V1A g;  2PN8 A;  1T7P B;  4ZBA A;  5F05 A;  2ON7 A;  2QSI A;  3KZQ A;  4CHS A;  3IK9 A;  5HFK A;  2C80 A;  1S3D A;  4PNF A;  5J3R A;  4YQV A;  2GS3 A;  1V2A A;  3TRX A;  4K0G A;  2MBT A;  4ML6 A;  3E9J B;  3GKN A;  3M9K A;  4X0X A;  2GZZ A;  2LUS A;  2KP1 A;  5LD0 A;  2HXK A;  2QGV A;  3A2W A;  1TDI A;  2DIY A;  1OKD A;  4BVX A;  3QPM A;  4PTS A;  1EOG A;  1F2E A;  3DD3 A;  2GDR A;  4TVE A;  1WE0 A;  4FYB A;  1XWC A;  5F8B A;  1X9W B;  3EU4 A;  2FA4 A;  4FQU A;  2O85 A;  2ZCT A;  3LGC A;  2O7K A;  2B5X A;  2RUF A;  2F9S A;  2HFD A;  4YH2 A;  1KNG A;  2CX3 A;  2LRC A;  4CW9 A;  3O76 A;  1F37 A;  4K0N A;  2A2S A;  2OJL A;  1PX7 A;  4Q5N A;  5D9V A;  5IIZ A;  1M2D A;  5C00 A;  1H4O A;  2R3X A;  5DJL A;  3EIN A;  4WBR D;  5ABR A;  4OCE A;  2H66 A;  1XXU A;  4PUF C;  1A8L A;  2VCV A;  3QAW A;  4QQ7 A;  5A4U A;  3IDV A;  3TB2 A;  3KJY A;  5IMD A;  2LTK A;  1SKS B;  2O89 A;  1FW1 A;  4PUA A;  4F2I A;  1GP1 A;  3ISO A;  1T1V A;  2OAD A;  1XW6 A;  2ZUP A;  2PUK C;  3ED3 A;  4EE0 A;  4I2T A;  5CRH A;  5IMF A;  5GAP D;  3LWA A;  1GRX A;  1R7H A;  1Y25 A;  4WR4 A;  5HR2 A;  3L0H A;  2IMI A;  3MAK A;  5ECK B;  1LJR A;  4J57 E;  4MH2 A;  5B8A A;  5CRD A;  1NM3 A;  4GQF A;  3TKR A;  3L78 A;  5ECO B;  3BCK A;  1B4P A;  2H70 A;  1QFN A;  4ECC A;  3ZRE A;  3LEF A;  4K8M A;  1PKW A;  1R5A A;  3CBU A;  4G9H A;  1OKT A;  5CRG A;  4F03 A;  1EP7 A;  4MJA A;  2E2G A;  3PH9 A;  4HUA A;  4OFT A;  2X64 A;  1J0F A;  1NSW A;  4IP6 A;  3L9V A;  2IL3 A;  3ZIT A;  4ECB A;  2E0Q A;  4MLY A;  1PA3 A;  2K8S A;  1ZOF A;  4E8E A;  4XS4 B;  5D93 A;  3MSZ A;  2H6Y A;  2R6K A;  5HQP A;  3U6V A;  1URM A;  5DJM A;  4LMV A;  2XBQ A;  4O92 A;  4XS1 A;  1TI3 A;  3H79 A;  3EC3 A;  4WKW A;  1DE2 A;  5GST A;  2HRF A;  4GSN A;  8GSS A;  2H1A A;  1VF4 A;  2GSS A;  3APO A;  3HYP A;  1OE7 A;  3H4K A;  4BWQ A;  2O87 A;  1MDI A;  2C0E A;  1U6T A;  2CAQ A;  5H5Q A;  3UAR A;  3FHK A;  1BED A;  3DVW A;  3C7M A;  4YAV A;  3ERF A;  1A2L A;  1O7U A;  1SD8 A;  2YP6 A;  3VUR A;  3F3R A;  1B48 A;  1K0M A;  3KD0 A;  5HR0 A;  3P7X A;  4NHW A;  3W8S A;  4XS4 A;  6GSW A;  4HU7 A;  1U88 A;  4IS0 A;  2LQQ A;  4LMW A;  2HZE B;  3KTL A;  3GRX A;  3EE2 A;  3M8N A;  3RHC A;  3LG6 A;  2CZ2 A;  2H6X A;  4D73 B;  3ME7 A;  4KSM A;  3KCM A;  2IFQ B;  2DC5 A;  1B8X A;  1FAA A;  4IQA A;  3ZFB A;  1AQX A;  1PL1 A;  2G0F A;  1LBK A;  2HRA A;  4N0Z A;  1N8J A;  4JZQ A;  2LS5 A;  1JFU A;  4GCI A;  2PMT A;  5C04 A;  2A4V A;  2VOC A;  5DDL A;  3TKP A;  5D73 A;  4KCA A;  1JZD A;  5ID2 B;  3I9V 2;  3M9J A;  1GSQ A;  2HZE A;  3DWV A;  1M0U A;  3VWW A;  1BX9 A;  3HKR A;  4ZL9 A;  1R5P A;  1GNE A;  3QAV A;  1GSY A;  1CQH A;  4POM A;  4D73 A;  3HVX A;  2IFQ A;  2JAC A;  2I4A A;  3BBY A;  3CMI A;  2PU9 C;  4AJ7 A;  2AHE A;  2NBS A;  4WF4 A;  1NHO A;  4O5U A;  2YZH A;  4I6X A;  1EGR A;  5GSS A;  2PVO C;  1V98 A;  1MD3 A;  3ERW A;  3RPP A;  4PX1 A;  3I43 A;  3TRP A;  2ON5 A;  4TXO B;  6GSY A;  1VGL A;  1FO5 A;  2JZS A;  2NDO A;  4PQ1 A;  4OMV A;  1GH2 A;  4TR1 B;  3V1W A;  5ID2 A;  2LJR A;  1SKW B;  22GS A;  5DAK B;  3IR4 A;  4MDC A;  5JWR B;  1SJI A;  5G5F A;  5LNK e;  4RUV A;  3GX8 A;  4JR4 A;  1K0C A;  3FZ9 A;  3TJB A;  3VPQ A;  2KOK A;  4EUY A;  1USB A;  4HU9 A;  3TOT A;  1RQM A;  2XBI A;  5ECQ B;  5CP1 A;  2YJ7 A;  4IGJ A;  1XVW A;  3ZVJ A;  1FVK A;  2DKI A;  2OE1 A;  2H19 A;  4TXO A;  3F8U A;  3DIE A;  2I81 A;  2C1Y A;  2X4A A;  2L4C A;  3EVI A;  4IEL A;  4XTS A;  2MYG A;  4TR1 A;  3BJ5 A;  4DSS B;  2M72 A;  3CTF A;  3KP9 A;  3E3E A;  5DAK A;  4PUR A;  1GSF A;  4POK A;  2OE3 A;  4AGS A;  2X99 A;  3ZTL A;  3D22 A;  3HJO A;  2IJY A;  1K0D A;  3VPT A;  4ID0 A;  4I8B A;  2CVD A;  2YOI A;  1UVZ A;  2HNL A;  2MBS A;  1FOV A;  3TGZ A;  3IA1 A;  2GST A;  3ZZX A;  1UA5 A;  2X8G A;  2L5O A;  4I97 A;  2FY6 A;  2PVQ A;  5COH A;  3GST A;  1ZGN A;  2VL2 C;  5J5N A;  3Q18 A;  1FB6 A;  4DSS A;  1A2M A;  4DEJ A;  5INY A;  3KTB A;  1FOH A;  1PRX A;  5D96 A;  5EVO A;  5G5E A;  1EEJ A;  4ZB8 A;  4Z2T A;  2DJ0 A;  3KMN A;  2DJJ A;  1XOA A;  3LOR A;  2FCH A;  3IE3 A;  3FRC A;  4ECI A;  2V2G A;  3F4T A;  1G0T A;  3HJP A;  1TKD B;  3N9J A;  4K2X A;  2FWG A;  4P3Y B;  2L4Q A;  4XCS A;  5HR1 A;  2CZ3 A;  2XC2 A;  1F3A A;  2WRT A;  1YQ1 A;  2OBK A;  3GMF A;  2YZU A;  4K5S A;  2L5L A;  2VLU A;  3LYK A;  4NV2 A;  3H1N A;  1XWG A;  5IM9 A;  3GNJ A;  4H86 A;  1XFL A;  2IPA A;  2VCX A;  4HI7 A;  3VK9 A;  1NW2 A;  3NIV A;  5JCG A;  1QQ2 A;  2D2Z A;  3LYP A;  5J9B A;  4OO5 A;  3OR5 A;  2YV9 A;  1J9B A;  4ECJ A;  3W8J A;  3HZ8 A;  3SBC A;  3IXR A;  3UVT A;  3Q74 A;  1YY7 A;  4KSO A;  2FLS A;  4NHZ A;  3R2Q A;  3IK7 A;  2A2R A;  4MNN A;  3PPU A;  2IN3 A;  2VCT A;  2G2Q A;  3L9S A;  4JED A;  1ZYP A;  4ZIJ A;  3HVS A;  1C72 A;  5ECL B;  3G7J A;  1T3B A;  4LL1 B;  5AN1 A;  3K8N A;  4IJ3 A;  1QGV A;  5IO2 A;  1J08 A;  5DQS A;  3KP8 A;  3TJG A;  2WUL A;  5EY6 A;  3L9U A;  2R2J A;  3KM6 A;  1QXH A;  3TCO A;  3ZMK A;  2GVP A;  4KX4 A;  2AV4 A;  2X8H A;  14GS A;  5D9W A;  1V9W A;  3CTG A;  3F9U A;  3HY2 A;  1AAZ A;  2DSA A;  3IC4 A;  1TW9 A;  1W4V A;  2GQM A;  2OE0 A;  2IMK A;  4TXV A;  4N0V A;  16GS A;  4CY8 A;  4IQ1 A;  1K0N A;  5DBQ A;  2X49 A;  4PNG A;  5B6N A;  4NWY A;  4HJ2 A;  3P90 A;  5EL8 A;  4X1U A;  2GGT A;  1XVQ A;  2LST A;  3GUR A;  1M2B A;  3FR6 A;  2YWN A;  4GTU A;  2L6C A;  3M3M A;  6GSX A;  2N5A A;  1SU9 A;  1WPI A;  3FK8 A;  3DYR A;  5G2Z A;  4MJE A;  4PQI A;  5D8I A;  3VI7 A;  4KF9 A;  4IN0 A;  1WMJ A;  4ZXG A;  1PX6 A;  4ZBD A;  5EPF A;  1X0R A;  2TRC P;  4BL7 B;  4MF5 A;  3GX0 A;  2EC4 A;  1M7T A;  3PR8 A;  3KEB A;  4DVC A;  3DXB A;  2JL4 A;  2H30 A;  1KBN A;  4G0I A;  2QKE A;  4N10 A;  2B7J A;  3A5W A;  1T4Z A;  5J9C A;  3GV1 A;  3EUR A;  5GZZ B;  4GQC A;  4WBJ A;  3WGX A;  3TKS A;  4XHM A;  1YKA A;  1OC8 A;  2HRN A;  1ML6 A;  1PSQ A;  6GST A;  1BYE A;  2AAW A;  4K6X A;  3O6T A;  2VM2 A;  4MJB A;  3D6I A;  3H8Q A;  1A0R P;  4ACS A;  4LA1 A;  5HR3 A;  4OO4 A;  4GXZ A;  4L0U A;  2N5F A;  3EYT A;  4GLT A;  5AIV A;  9GSS A;  4RI7 A;  5DAL B;  2H6Z A;  5L71 A;  4NAX A;  1ACV A;  3A2X A;  2H0G A;  3EPT A;  3O3T A;  4F82 A;  3UJ1 A;  3E0U A;  5KN3 A;  1Z7P A;  3GIX A;  1ZL9 A;  2H75 A;  1G6W A;  1G7O A;  1BJX A;  1M99 A;  5AGY A;  5IMZ A;  1O6J A;  4WF5 A;  4HZ4 A;  1OYJ A;  1S3A A;  1SL2 B;  1VF3 A;  3VWV A;  2VCQ A;  3EWL A;  2GZY A;  1YZX A;  4JR6 A;  3RBT A;  3FYG A;  3GTU B;  1SK1 A;  2WCI A;  1KEB A;  1K0O A;  3C8E A;  5DAL A;  5IMC A;  1I5G A;  5ELG A;  4Z7X A;  4HDE A;  4X4J A;  1ABA A;  3S9F A;  5KEJ A;  1X9M B;  1JZR A;  1HNB A;  3TJF A;  1IYI A;  4K1F A;  3CSI A;  1TRU A;  3ZYW A;  4FO5 A;  2LKU A;  4NPB A;  4TOP A;  1M9B A;  3F4R A;  5IMV A;  4HQZ A;  1TK8 B;  3KXO A;  1Z7R A;  2VAF A;  4BA7 A;  5ECH B;  5ECR B;  2IMD A;  2FWE A;  2Z9S A;  3W6G A;  5HFG A;  4L8E A;  4IJI A;  6GSV A;  1GTB A;  3N5O A;  2YWO A;  3MDK A;  2HE3 A;  3TKQ A;  1SEN A;  2C8U A;  2F51 A;  1TP9 A;  3JCM L;  3M1G A;  1E2Y A;  1WRY A;  3GTU A;  2VLT A;  2H76 A;  3FZA A;  4YKF A;  5H5S A;  4MH3 A;  5BMU A;  5JWQ B;  2R0C A;  5CNW A;  4MF6 A;  4O7H A;  2MMN A;  2OKA A;  3WD6 A;  1TOF A;  1GNW A;  3C73 A;  3G9B A;  2PGT A;  3ZRD A;  1WP0 A;  3ZLP A;  2DJ1 A;  2FWF A;  4TW5 A;  2J9H A;  4Q5R A;  3BCI A;  4KDY A;  2YCD A;  1K0A A;  2R4V A;  5G1K A;  1GL8 A;  3D21 A;  2EIO A;  1UN2 A;  2AJQ B;  2GSQ A;  3UBL A;  1H75 A;  5CRW A;  3DGQ A;  4XRA A;  1A24 A;  4KGI A;  2B3S A;  4TRX A;  3UBK A;  4Q5Q A;  4V1A p;  2C0G A;  5IO0 A;  5F07 A;  3IHG A;  4HS1 A;  4OD7 A;  2CVB A;  3F3Q A;  2K9F A;  1HQO A;  1SL1 B;  5BRT A;  4AJ8 A;  2ZNM A;  5FWG A;  3FEU A;  2I9H A;  1SKR B;  5IPG A;  1Z5Y E;  3FMW A;  1THO A;  1JLW A;  1OC3 A;  4XS6 A;  1YKC A;  1I9D A;  1SK0 A;  3CYN A;  1TU7 A;  2VIM A;  3LSZ A;  3WT1 A;  1GSD A;  4FIW A;  4MPG A;  1QMV A;  1O8W A;  4EVM A;  1HYU A;  2RUE A;  3HVV A;  2JSZ A;  4ILF A;  3BOA A;  3WT2 A;  4YKG A;  1Q98 A;  2XPD A;  17GS A;  2VO4 A;  4G0K A;  3FKF A;  1GTA A;  1TRV A;  2I1U A;  4OFM A;  5F0G A;  2HYX A;  3EU3 A;  3QFA C;  1XOB A;  4F9Z A;  2LQO A;  4MAB A;  2C0D A;  1M9A A;  3TJK A;  2MMA A;  3IPZ A;  4MPF A;  1TRW A;  3RPN A;  5J4U A;  1SK2 A;  3GUS A;  2DLX A;  4K7O A;  4WET A;  5JCW A;  4JE1 A;  1G7E A;  3IAM 2;  5CYY A;  3GFK A;  2N5B A;  4GSS A;  6GSS A;  1U3A A;  1VRS D;  2GLR A;  3APS A;  1OVN A;  4IW9 A;  4ULX A;  2RII A;  4EKZ A;  2RM6 A;  2V6K A;  1SYR A;  2FD3 A;  3RDW A;  4OWY A;  2WFC A;  1SL0 B;  4HQS A;  3J7Y b;  1R4W A;  6GSU A;  4KB3 A;  4MJC A;  1AUC A;  1PN9 A;  2GTU A;  4FH8 A;  2HSH A;  4OFN A;  2M46 A;  3A3T A;  2QC7 A;  1A8Y A;  2PER A;  1GSE A;  2J23 A;  3GH9 A;  4IKH A;  4V2L A;  1R26 A;  2NTO A;  1O81 A;  4HEA 2;  1YF0 A;  3IAS 2;  1PQN A;  4G2E A;  3VWX A;  1TK5 B;  1GUK A;  2K18 A;  7GSS A;  2H1B A;  2OA7 A;  2LNS A;  1XWB A;  2GQK A;  1EV9 A;  4KDU A;  4EDZ A;  2IWT A;  4L0W A;  2H0I A;  4K5R A;  5ECI B;  1THX A;  3UEM A;  3P8W A;  4YQU A;  4ICY A;  2B1K A;  1WIK A;  1X5C A;  1TRS A;  3SWL A;  4MMM A;  4TR4 A;  2O8V B;  4I2U A;  1HNC A;  5DQY A;  1T00 A;  1PMT A;  2FWH A;  10GS A;  5KN1 A;  1YDK A;  4CDO A;  3ERG A;  1CQG A;  4F0B A;  20GS A;  5ENU A;  3MWH A;  4ISD A;  2YV7 A;  1E6B A;  5KOW A;  2C0F A;  2DKH A;  3KH7 A;  3FZ5 A;  2GT5 A;  4GF0 A;  2YNX A;  1BAY A;  3FY7 A;  3Q6O A;  4HZ2 A;  3VLN A;  4EDY A;  2L6D A;  2YAN A;  1S3C A;  2LJA A;  4POB A;  2HSY A;  2NVL A;  1MEK A;  4V2M A;  1LU4 A;  1XBS A;  4LLR A;  3QFB C;  3UOM A;  1K3L A;  1ST9 A;  2VL9 A;  1Z6M A;  3NZN A;  4AF2 A;  3F63 A;  4PGT A;  1MTC A;  1ERW A;  4USS A;  2M80 A;  12GS A;  3FR3 A;  4O5Q A;  5B8B A;  3DML A;  4F0C A;  4RI6 A;  3GH6 A;  4NMU A;  2L59 A;  1T4Y A;  4EL1 A;  5IMA A;  5E4W A;  2YN1 A;  4ML1 A;  4IHU A;  1BG5 A;  1XW9 A;  1F6M C;  3QMX A;  3EMX A;  1A2J A;  4ZL8 A;  1EOH A;  5AIX A;  3LXZ A;  3UIW A;  2P5R A;  3VI5 A;  3DRN A;  1ERT A;  3IOS A;  5F06 A;  13GS A;  1O73 A;  1GTI A;  5GAN D;  3GL3 A;  2VCZ A;  1X5D A;  2CVK A;  3UL3 A;  2H1D A;  4MZW A;  5IOX A;  1OE8 A;  4MK3 A;  2HLS A;  3ZL5 A;  2YJH A;  2HI7 A;  2YPM A;  4QL9 A;  3F4S A;  1AXD A;  5CAX A;  3WGD A;  1V58 A;  4ZIL A;  3DVX A;  2MMZ A;  1AIU A;  1Z6N A;  5CRE A;  4BPY A;  3WYW A;  3GA4 A;  3TJJ A;  2P0G A;  1QK8 A;  2WJU A;  3ZVJ D;  2H1G A;  3FR9 A;  4X43 A;  3C71 A;  3HCZ A;  2LRN A;  4IVF A;  2B5E A;  3QD9 A;  4J56 E;  5ELA A;  3TDG A;  3DEX A;  2A2P A;  4EXJ A;  1ZYE A;  4KND A;  2HT9 A;  2KUC A;  1TK0 B;  3LJR A;  1X5E A;  3A2V A;  5D9T A;  5KOX A;  19GS A;  2VL3 A;  1FB0 A;  1XW5 A;  2A4H A;  3HD5 A;  4HOJ A;  3HXS A;  1GUL A;  2H73 A;  3C1S A;  4O5R A;  5H5R A;  5KN0 A;  4RQX A;  4BL7 A;  3L4N A;  3Q19 A;  3PIN A;  1EGO A;  2F3M A;  2R0G A;  2WGR A;  2BMX A;  1TTZ A;  2FUG 2;  4NV5 A;  3QAG A;  1YEP A;  4WEY A;  3IC8 A;  2V32 A;  3LFL A;  4JRR A;  4O32 A;  5LCZ A;  1W89 A;  3HZ4 A;  2CX4 A;  4G0L A;  4ZBB A;  1XPV A;  4AJ6 A;  1GTU A;  4G10 A;  3I6A A;  2MZC A;  4XRD A;  1ILO A;  3TOU A;  2JZT A;  2DJ3 A;  1RK4 A;  1SD9 A;  1PKZ A;  1G6Y A;  1GLP A;  4KH7 A;  1GUM A;  4JU5 A;  2JSY A;  1WJK A;  1Z9H A;  3ZIJ A;  3TUE A;  2E2M A;  3G7I A;  3APQ A;  2CQ9 A;  2PBJ A;  1EEM A;  3QDN A;  2B7K A;  3I69 A;  3IV4 A;  4A5P A;  3A5I A;  2H74 A;  1Q4J A;  2I3Y A;  4KA0 A;  4ZB6 A;  3LQ7 A;  3U5R E;  3MYD A;  4KE3 A;  1U3I A;  1U87 A;  4EO3 A;  1X9S B;  1PD2 1;  1K3Y A;  1M2A A;  4WR5 A;  3CRT A;  3TRQ A;  1DUG A;  2DBC A;  2PPT A;  3EMP A;  4I5Q A;  5ECP B;  1JLV A;  3KGK A;  2WZ9 A;  3UAP A;  1TI1 A;  1VF1 A;  4EIQ A;  5DVB A;  4BWS A;  4HJM A;  4Q5F A;  2V1M A;  4BVY B;  4NXI A;  1UC7 A;  1K3O A;  2R0P A;  1BQ7 A;  1EP8 A;  2AB6 A;  4YQM A;  2R5G A;  3GSS A;  4GST A;  2IIY A;  5FT3 A;  2CV4 A;  3HJM A;  2VL2 A;  4QL7 A;  2DJK A;  4G19 A;  1V40 A;  3D4M A;  2H71 A;  3G7Y A;  5JCU A;  1GSU A;  2IMF A;  4K7I A;  1EZK A;  3HA9 A;  4GRF A;  4N11 A;  4RQR A;  1JHB A;  2LRT A;  4Z2U A;  2GT6 A;  3GYK A;  5IPH A;  2V6O A;  2X8C A;  4KCE A;  2FA8 A;  2C3N A;  4L5O A;  4YAP A;  4MA9 A;  3P2A A;  1K0B A;  3KIJ A;  1ERU A;  3UMA A;  4BVY A;  2LNT A;  4ZL7 A;  3GHA A;  5KN2 A;  4PQH A;  1XWA A;  3CRU A;  1O8X A;  1GWC A;  4PXO A;  1TU8 A;  3F6F A;  2EIR A;  1A0F A;  4JBB A;  3M0F A;  1ERV A;  1OAZ A;  2KHP A;  3D0Z A;  3ZML A;  2ES7 A;  1RW1 A;  3VWU A;  1SJ6 A;  3F6D A;  2C3Q A;  2VLV A;  5IOW A;  2HRK A;  1PN0 A;  2H72 A;  3IRA A;  1F9M A;  5G30 A;  2F8F A;  2EIQ A;  2KLX A;  4KW6 A;  1HD2 A;  2CA8 A;  11GS A;  5E59 A;  2B1L A;  5IQY A;  4TN8 A;  1WOU A;  5A5K A;  4KUN A;  1YEX A;  2GSR A;  5DCG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...