1NW2A

The crystal structure of the mutant r82e of thioredoxin from alicyclobacillus acidocaldarius
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
105
structure length
105
Chain Sequence
ATMTLTDANFQQAIQGDKPVLVDFWAAWCGPCRMMAPVLEEFAEAHADKVTVAKLNVDENPETTSQFGIMSIPTLILFKGGEPVKQLIGYQPKEQLEAQLADVLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THIOREDOXIN
publication title An integrated structural and computational study of the thermostability of two thioredoxin mutants from Alicyclobacillus acidocaldarius
pubmed doi rcsb
source organism Alicyclobacillus acidocaldarius
molecule tags Electron transport
total genus 30
structure length 105
sequence length 105
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 2003-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1nw2A00
2C3QA 3Q6OA 1XFLA 1HNAA 5CP1A 2NBSA 1W89A 3EWLA 3RPPA 4KA0A 1FOVA 5DAKB 2ZNMA 1GUKA 1H4OA 1QK8A 4TVEA 2DJ0A 3VWWA 1R5PA 2WJUA 1TI1A 1XOAA 1WP0A 2JSYA 4MH3A 2BMXA 3A2WA 5IMVA 2DSAA 3UBKA 2IMEA 2B7KA 5ECIB 6GSWA 1SJ6A 3CSIA 3LSZA 2FCHA 3RHBA 2IMIA 3HZ4A 2V2GA 3F0IA 1AUCA 4JZQA 1X9SB 1YF0A 1Z7PA 3VI5A 4PUAA 3EC3A 4X43A 1A8LA 3WD6A 4V2NA 1SD9A 1QMVA 1BJXA 5JWRB 1H75A 1GSUA 1A0FA 4HZ2A 1Z9HA 2MBSA 2EIRA 1MDKA 1MD3A 3G9BA 4GSTA 3CMIA 2YCDA 2N5AA 1PD21 4X1UA 1ILOA 3IK9A 4OFTA 3IC4A 3GL5A 4K1FA 2MBTA 4FYUA 3HJMA 1SKWB 1XBSA 5DDLA 3TGZA 1U3IA 2N5BA 4NXIA 2H1GA 4KNDA 3IXRA 5GSSA 3PH9A 2HSYA 5AIVA 1FAAA 2HE3A 4N11A 4POMA 1FHEA 4IKHA 3VPTA 5ENUA 5L71A 2MMZA 4FIWA 1XCCA 6GSTA 1F6MC 1B9XC 4O5RA 4LL1B 3CSJA 4DSQA 3UEMA 2GQLA 1UC7A 4WKWA 4MPFA 3KCMA 4PGTA 3LORA 1V40A 2C0GA 5B8BA 1JHBA 2YV9A 3GKKA 3UL3A 1NW2A 4MCUA 1ZYQB 5HR2A 4XS4B 3U6VA 5GSTA 4H86A 1O8XA 1G6YA 1ZYEA 3A5WA 4HQZA 2GQKA 1YKCA 3QAGA 1AC1A 3E9JB 1YY7A 2DIZA 4GQFA 1SJZA 19GSA 3KZQA 1KNGA 5IOWA 1O8WA 1R26A 2H6XA 4JEDA 2H30A 2REMA 4HZ4A 4BA7A 4BVXA 2L5LA 1GTUA 1TTZA 5G30A 1Z3EA 1EOGA 2H76A 3KM6A 1EP8A 5H5QA 3GH6A 1SL1B 3WGEA 2IMKA 2VLUA 3I69A 4MF7A 3ISOA 3KGKA 1E2YA 3KD0A 5E59A 2LKUA 1AIUA 2OE3A 3N5OA 3FKFA 3ZRDA 4PNFA 1HNBA 2VUPA 1U6TA 3VWVA 4MMMA 3OR5A 5GAND 3LFLA 3MWHA 3H8QA 1TDIA 5F07A 2L6CA 3QD9A 5HR1A 3D21A 2GSTA 3WGDA 4PQHA 4QL7A 3TRXA 3KXOA 3UOMA 2A2RA 3HDCA 1IYIA 3M1GA 1EWXA 4WR5A 5CNWA 4XS1A 2C0DA 18GSA 3QMXA 4HJ2A 5G5EA 2E2GA 1I9DA 3H79A 3PINA 1JZDA 5A4WA 1ZZYA 4J57E 1XW6A 1RW1A 5COHA 1GTBA 1FW1A 2GVPA 4AJ7A 1WPIA 4TXOA 1ML6A 5ELAA 1PL2A 1T3BA 2GSSA 2PMTA 3DMLA 1SK1A 5LD0A 2RIIA 4XRDA 5CREA 3LXTA 3ERWA 16GSA 4DSRA 2O7KA 5ECOB 1M99A 2V6OA 5ECPB 3J7Yb 4KE3A 1TW9A 2ON7A 2QSIA 4KUNA 4RQXA 2IWTA 2P5QA 3FZAA 1XVWA 3IV4A 5D9TA 1OYJA 4IVFA 5DAKA 2EIQA 3F3RA 1QQ2A 2H6ZA 1ABAA 1ST9A 4ZXGA 3CBUA 4Q5RA 1QFNA 3EMPA 3C71A 3TRPA 2F8AA 4IN0A 2CX4A 3ERGA 4TR1A 2OE1A 3IE3A 1X5DA 3ZLPA 4AGSA 3FEUA 1SKRB 2HRFA 3GSTA 5KN1A 5KN3A 5ECMB 1JFUA 4CW9A 2DC5A 2YV7A 3BCIA 2CVKA 4DEJA 3C73A 3P2AA 3TB2A 1I5GA 2WB9A 3HZ8A 4ML1A 1NSWA 3N9JA 3QOUA 3GL3A 5JWQB 3TJKA 4O7HA 2C8UA 5CAXA 2D2ZA 2WZ9A 3IBHA 1XWAA 2C80A 1S3CA 1TRUA 2KOKA 2AAWA 4ZL7A 2MMAA 4BPYA 3GSSA 1BG5A 1EGOA 1DBYA 2LEGA 2KP1A 1V2AA 4MA9A 4IS0A 2IFQA 1Q98A 2VLTA 3KP9A 3W8SA 4EKZA 3GKMA 2OBIA 4GCIA 2VM1A 1Z6MA 4MJAA 2HXKA 1ZOFA 2HI7A 2X64A 4KCEA 4TXVA 2A2SA 3BBYA 5C04A 1KEBA 2FLSA 1PMTA 1M2DA 3TKQA 14GSA 4MZCA 2KHPA 2GT6A 2OACA 4NMUA 2I3YA 1GL8A 1K3LA 3D6IA 2IIYA 2TRXA 2MMNA 4N0VA 5FHIA 1GH2A 5KEJA 3DIEA 3MNGA 2A4VA 2DJ1A 3BOAA 3IAM2 1BAYA 3EINA 4EXJA 3KH7A 5EY6A 3P7XA 5DALA 2M80A 2OADA 3TCOA 1XVQA 1R5AA 5D9VA 3KTLA 2IN3A 3IR4A 4F82A 2BTOT 2LV3A 2H8LA 4Z7XA 3DVXA 1FB6A 5IO2A 4IP1A 2LSTA 1JLWA 2FWFA 2H0HA 4WF4A 1YJ6A 4XRAA 1GULA 2JACA 3E0UA 3I43A 1X5EA 4ZILA 2B1KA 2BJXA 4QL9A 2C0EA 3VWUA 3F8UA 2DBCA 1LU4A 5E4WA 1T1VA 5IQYA 4OFNA 4FH8A 4I2UA 2AYTA 3DD3A 1YQ1A 2VM2A 2GSRA 1ZL9A 2J23A 3UARA 3KTBA 5G5FA 5ID2B 5CRDA 2NVLA 2P0GA 1Z5YE 2CQ9A 4KAEA 2FY6A 3FK8A 3GX8A 3GIXA 1AQVA 2JZRA 1B4QA 2LQQA 2H1BA 3HVXA 3DKSA 3F4SA 1TK8B 5GZZB 2LNTA 5J4UA 4GLTA 5FWGA 2X8GA 3M3MA 3GN3A 1A2JA 1QUWA 2YN1A 5DJLA 2L59A 3LYPA 4D73B 2YJ7A 2EIOA 2B7JA 4K0GA 1TI3A 3GA4A 4DVCA 5ECHB 3APSA 4DSSB 3J7Yk 1EGRA 4KCAA 4L0WA 2FA4A 2KP2A 3JCML 3L4NA 2H01A 3VWXA 2OA7A 2K6VA 3FZ9A 3HKRA 4EUYA 5A5KA 2H0IA 3FR3A 1G7EA 2R2JA 2QKEA 1K3OA 1EP7A 3W6GA 4TN8A 2G0FA 2JZTA 6GSUA 2NDOA 1OC9A 3GTUA 3GX0A 2ON5A 2PGTA 2WULA 4IJ3A 5JWOB 1OAZA 3GNJA 1SD8A 4GF0A 1V58A 2K8SA 5CRGA 3EVIA 2ALBA 1TK5B 3ZTLA 4F03A 4K8MA 3HA9A 2CVDA 2X8HA 4OO4A 2B3SA 3KEBA 1ERUA 1TJDA 1HNCA 2FHEA 1EZKA 5D93A 3C1SA 5B6MA 4EDYA 1GP1A 1F9MA 4F0CA 5HFGA 1XW9A 11GSA 2XHFA 3BCKA 4OO5A 2VCTA 2MMOA 1X5CA 1IYHA 3F63A 1BX9A 1WJKA 3VURA 3Q18A 2PN8A 4CDOA 2H72A 4YQVA 2AB6A 4YQUA 3HJPA 5CO3A 4G2EA 4MH2A 3EYTA 5F05A 1OVNA 3C1RA 4HJMA 3KJYA 3NOFA 3ZL5A 4ECCA 1CQHA 5D8IA 3FRCA 3DVWA 5G2ZA 5IPGA 4KGIA 1EEJA 3BJ5A 1J0FA 2J9HA 4ZL9A 1SYRA 2H75A 4EO3A 2DJKA 3TOTA 4ZBDA 2H74A 1O7UA 2AJQB 1XOBA 2B6MA 1VRSD 4AJ6A 2E2MA 4LMWA 5JCUA 1A24A 2K18A 2RUFA 5HR3A 2LJKA 1XPVA 1HD2A 1XZOA 2CT6A 1M9BA 4LLRA 1VF2A 3QFBC 3GKXA 4V1Ap 5IPHA 4IELA 2YZUA 3MSZA 4XCSA 5B8AA 4NWYA 3TOUA 4OD7A 1DE2A 5IOXA 2R4VA 4I6XA 5ECRB 1N2AA 3HYPA 1K0AA 3GUSA 1TRWA 1UA5A 4RI6A 3L78A 1N8JA 1VF1A 2F51A 3GRXA 2GTUA 5EPFA 4NV5A 5G31A 4F0BA 2PU9C 3A3TA 2RLIA 3G7JA 1F3AA 2VD0A 3O6TA 1V57A 3HY2A 1F37A 4L5OA 5DQYA 3ME7A 1YKAA 2YNXA 1OKTA 1T4YA 1THOA 1PX7A 4FO5A 1K0CA 1A0RP 3HJOA 5KN0A 4EE0A 3F4TA 5B7CA 3TRQA 4AJ8A 1OE7A 3L9UA 1PKWA 3D22A 3IPZA 4J56E 3FYGA 4IJIA 4RQRA 1K0NA 2B5EA 4ML6A 4YH2A 1AW9A 4ILFA 4D73A 2PPTA 3LYKA 5G1KA 4E8EA 3F6DA 3CXGA 2VCVA 2XPDA 1PQNA 1JZWA 2H73A 3KMNA 3DWVA 4N10A 1EV9A 4DSSA 2FD3A 1ZGNA 1F3BA 4ECJA 3QAWA 1B8XA 3H93A 3GFKA 5DCGA 4ISDA 2HZFA 1O6JA 1FG4A 1B48A 1GLPA 3PR8A 2WRTA 1M2BA 3F4RA 5ECLB 1MEKA 3ZIJA 4O92A 3HD5A 2X99A 4I2TA 4Q5NA 2JU5A 3F9UA 5AIXA 4MP4A 4FYBA 4J2FA 4NAXA 3AY8A 3M0FA 2AHEA 4K7IA 1SJIA 1SENA 5CRHA 1PA3A 3US3A 2NTOA 2QC7A 2P5RA 3GHAA 4IQAA 4ACSA 3CYNA 3LEFA 3ZFLA 3ZREA 4ZIJA 3HHVA 2YWOA 1AXDA 3K8NA 1DUGA 1K0OA 3EU4A 4GQCA 3GV1A 4NV2A 1YF1A 1WOUA 2GZYA 3ZVJD 1GSFA 1PL1A 5INYA 5AGYA 1URMA 3HVVA 3E3EA 2AV4A 2ZUPA 2YJHA 4KW6A 3KP8A 4K9ZA 2M46A 1Y25A 3RPNA 1M2AA 4I8BA 4LL4B 1G0TA 2H19A 3M9KA 4TR3A 3UIWA 1HYUA 4V1Ag 4G9HA 2CAIA 5HQPA 2VCXA 4FYCA 1WRYA 2YZHA 3KMOA 4HQSA 1MTCA 5HR0A 2H1DA 5ABRA 2GSQA 2JZSA 3CTGA 4MABA 4EVMA 1OE8A 4OCEA 4JBBA 5DBQA 1CQGA 4MJBA 3I6AA 4MDCA 4I5QA 5G1LA 4K6XA 3P90A 2C3NA 3ME8A 3SWLA 2HYXA 3APQA 2R3XA 5ECQB 3S9FA 5JCWA 1R4WA 2G2QA 4XHMA 1ZMAA 4XS4A 1GTAA 4EF0A 3IRAA 4L0UA 1GUMA 1OC3A 5J9CA 5J5NA 1T00A 5DVBA 4K7OA 5EL8A 2LNSA 2ES7A 3GKNA 4KX4A 5F0GA 1SL0B 3BD2A 3M9JA 5IMFA 1SK0A 2AUVA 1WMJA 4MPGA 3UMAA 1W4VA 3CRUA 3NZNA 1UN2A 2VL2A 3H1NA 2OKAA 2VAFA 3QPMA 5AISA 1XIYA 4HEA2 5IMCA 4TW5A 9GSSA 2FWEA 2VOCA 1KTEA 1K0DA 1SL2B 2MYGA 3FW2A 1J08A 2E0QA 2LJRA 3APOA 4YAVA 5FT3A 3F3QA 2PVQA 3U5RE 3FR6A 2XBIA 3EURA 3LJRA 1OKDA 3QFAC 2VCZA 2GLRA 3RAZA 3V1WA 12GSA 2GZPA 4IBPA 4O32A 4OFMA 3TKSA 3VPQA 4MJCA 2FUG2 1YEPA 1NHOA 2TIRA 4JRRA 1GSSA 1WWJA 4L5LA 4KSMA 2YANA 3TJBA 4N0ZA 4XS6A 3VFIA 2OJLA 1U87A 2JADA 3TKSC 1K0BA 3ZMLA 1ERVA 3D4MA 1K0MA 2V32A 4K7NA 5IO0A 1XWKA 2O87A 1PKZA 4GTUA 1R7HA 2KUCA 2FWHA 3ZFBA 1OC8A 1S3AA 1BQ7A 2CV4A 3ZZXA 1K3YA 3HVSA 1ON4A 4KDYA 5D9WA 1BEDA 1LJRA 3ZIVA 5JCGA 4TRXA 1RQMA 2X8CA 1NHYA 2B5XA 2LQOA 2WGRA 3TKRA 1U3AA 4LA1A 1S3DA 4RI7A 2H1AA 4TR1B 5H5SA 1DSBA 3IA1A 5J9BA 6GSYA 1AQWA 4NPBA 3TJGA 3MDKA 4G19A 4X0XA 5J41A 20GSA 4E8HA 2P31A 4PUFC 2CZ3A 2LTKA 1XXUA 1TRVA 3IK7A 4PQIA 1T4ZA 2LUSA 4HU7A 1PRXA 5LCZA 2TRCP 4BWQA 1JZOA 1PX6A 1YDKA 2IJYA 4EL1A 1XWBA 3LWAA 4MK3A 5H5RA 4HDEA 4TR4A 3FZ5A 4PXOA 2I4AA 4F9ZA 2Z9SA 5C00A 1C72A 2FA8A 3RBTA 2L4CA 4EC0A 3F6FA 2IPAA 1T8EB 1UVZA 1JLVA 3G7IA 2CZ2A 4GRFA 2IFQB 3FZ4A 2VL9A 1V9WA 2DJ3A 1SKSB 3EMXA 3I9V2 3DEXA 2XC2A 4MJEA 1TU7A 3UAPA 1J9BA 1GWCA 3DYRA 2B1LA 2VD1A 2DMLA 5IMDA 1MD4A 4WETA 2WDUA 4BL7A 4NHZA 3UBLA 3D5JA 2IMDA 2CVBA 3H4KA 4HS1A 2N5FA 4KDUA 3SBCA 4IP6A 3LXZA 3PGTA 1VF3A 4HU9A 13GSA 4L8EA 1X9WB 5DALB 5ELGA 6GSVA 2PWJA 1ERWA 3L9VA 2CAQA 4YAPA 2I81A 2YPMA 1XWGA 4TOPA 3GURA 4CHSA 5J3RA 1YEXA 2DMMA 4N30A 1XWCA 3CRTA 4ZB9A 5DQSA 3P8WA 5HFKA 2F8FA 2CX3A 2HLSA 2M72A 4WF5A 7GSSA 2DLXA 4HI7A 5HFIA 3Q19A 2KLXA 2R5GA 2IL3A 4IGJA 1QGVA 3CSHA 2F3MA 2C3TA 1X0RA 2H71A 2VL3A 3L9SA 2LRNA 1A23A 3C7MA 2GT5A 3FHKA 3DXBA 2V6KA 3GYKA 4XIHA 5A4VA 2RM5A 4YQMA 3QDNA 1TRSA 2PBJA 4MZWA 3O76A 4ECIA 1SU9A 3KIJA 5ID2A 2HRNA 4F2IA 1WIKA 3VK9A 2O8VB 5DCHA 2WFCA 4PURA 3LG6A 4ZB8A 2HSHA 1SYXA 1DE1A 3UVTA 5LNKe 1O81A 3TUEA 2JL4A 1GSQA 4IQ1A 3IOSA 3KH9A 1F2EA 2K9FA 1O73A 3GH9A 2O85A 4POLA 3CTFA 4WBJA 2R6KA 3DRNA 2PERA 4P3YB 4RUVA 5D73A 2HZEB 3FY7A 3TJJA 1GNEA 4POKA 2C1YA 1Y6EA 4IW9A 2H6YA 4KDXA 4PQ1A 3W8JA 2RM6A 1G6WA 4HOJA 2DJ2A 3WT2A 1GTIA 4OWYA 4ID0A 3A2VA 2YOIA 2OBKA 1ACVA 2CA8A 1GSYA 1XW5A 3R2QA 5D96A 4ECBA 1V98A 5AN1A 3EU3A 5ECNB 2DJJA 2LRCA 1GUHA 1GLQA 3EE2A 3ZYWA 1MDIA 1BYEA 3QR6A 5ECSA 1TK0B 2VCWA 6GSSA 5F8BA 2ZCTA 2OE0A 1E6BA 1OC9B 2F9SA 2R37A 3GTUB 3WT1A 4JU5A 4BWSA 5IM9A 2V1MA 5IMAA 1B9YC 2YWNA 4KH7A 4ZB6A 5F06A 3ZMKA 4OMVA 1FVJA 1PGTA 4OCFA 1PN9A 3HXSA 1NM3A 1Z7RA 3M8NA 3G7YA 10GSA 1Z6NA 3IHQA 5GAPD 4WXTA 1WE0A 5DJMA 2HNLA 2O89A 3VI7A 4TKYA 4TR0A 2PUKC 3QAVA 2VCQA 2RUEA 4LMVA 3ZVJA 2GQMA 2H70A 4Q5FA 2VO4A 4MF5A 2L6DA 1TU8A 2C4JA 5IIZA 1FO5A 1AAZA 1EEMA 4GWRA 3RDWA 1A2MA 1ERTA 4XTSA 3GMFA 4K2DA 2E7PA 5D9XA 2NPBA 3FR9A 3C8EA 3DGQA 1GRXA 1YZXA 1M0UA 1EOHA 3D0ZA 8GSSA 2L57A 5B6NA 1B4PA 2FGXA 1ZCPA 3A2XA 1TP9A 4QQ7A 1THXA 2QGVA 4EDZA 4V2MA 4NHWA 2IMFA 2DIYA 2JSZA 2GS3A 2L4QA 1A8YA 2VLVA 4AF2A 2FNOA 4G10A 4KSOA 1TXXA 4K0NA 1G7OA 3TKPA 1MDJA 2GGTA 4JE1A 2HFDA 2LJAA 1GSDA 2L5OA 1JZRA 2VIMA 2HT9A 1EV4A 1PSQA 5A4UA 4ULXA 3IDVA 4GSSA 4GXZA 3IAS2 1FVKA 2FWGA 4MZBA 2B5YA 2GZZA 1Q4JA 1HQOA 4HUAA 1GNWA 1TKDB 2WCIA 2GDRA 22GSA 3ZITA 3RHCA 4JR4A 5CYYA 2H66A 2I1UA 2XPEA 4KB3A 3VLNA 3HCZA 1RK4A 5CRWA 3TJFA 1LBKA 2WS2A 2EC4A 4POBA 2YWMA 2PVOC 4ZBAA 1QXHA 1AQXA 2XBQA 3TKSE 4MF6A 3ED3A 1M9AA 1M7TA 2MZCA 1VGLA 3L0HA 2VL2C 2V41A 4ZL8A 4I97A 5ECKB 1A2LA 1SK2A 1U88A 1GSEA 3TDGA 4PNGA 6GSXA 4WR4A 2I9HA 3WYWA 4GSNA 4WBRD 4JR6A 1O85A 1X9MB 3MAKA 5EVOA 2LRTA 1USBA 4ZBBA 2C0FA 1TOFA 1KBNA 3Q74A 3ERFA 4MLYA 1VF4A 4WEYA 3LGCA 2LS5A 4BVYA 4V2LA 2YWIA 4TXOB 3UJ1A 1T7PB 3QCPA 3LQ7A 4IHUA 3UVHA 3WGXA 3O3TA 4PX1A 2H0GA 1FB0A 2YP6A 3NIVA 5IMZA 2K8VA 5KN2A 17GSA 4Q5QA 3D4TA 2HZEA
chains in the Genus database with same CATH superfamily
2C3QA 3Q6OA 1XFLA 1HNAA 5CP1A 2NBSA 1W89A 3EWLA 3RPPA 4KA0A 1FOVA 5DAKB 4K5RA 2ZNMA 1GUKA 1H4OA 1QK8A 4TVEA 2DJ0A 3VWWA 1R5PA 2WJUA 1TI1A 1XOAA 1WP0A 2JSYA 3MYDA 4MH3A 2BMXA 3A2WA 5IMVA 2DSAA 3UBKA 2IMEA 2B7KA 5ECIB 6GSWA 1SJ6A 3CSIA 3LSZA 2FCHA 3RHBA 2IMIA 3HZ4A 2V2GA 3F0IA 1AUCA 4JZQA 4K5SA 1X9SB 1YF0A 1Z7PA 3VI5A 4PUAA 3EC3A 4X43A 1A8LA 3WD6A 4V2NA 1SD9A 1QMVA 1BJXA 5JWRB 1H75A 2HRAA 1GSUA 1A0FA 4HZ2A 1Z9HA 2MBSA 2EIRA 1MDKA 1MD3A 3G9BA 4GSTA 3CMIA 2YCDA 2N5AA 1PD21 4X1UA 1ILOA 3IK9A 4OFTA 3IC4A 3GL5A 4K1FA 2MBTA 4FYUA 3HJMA 1SKWB 1XBSA 5DDLA 3TGZA 1U3IA 2N5BA 4NXIA 2H1GA 4KNDA 3IXRA 5GSSA 3PH9A 2HSYA 5AIVA 1FAAA 2HE3A 2HSMA 4N11A 4POMA 1FHEA 4IKHA 3VPTA 5ENUA 5L71A 2MMZA 4FIWA 1XCCA 6GSTA 1F6MC 1B9XC 4O5RA 4LL1B 3CSJA 4DSQA 3UEMA 2GQLA 1UC7A 4WKWA 4MPFA 3KCMA 4PGTA 3LORA 1V40A 2C0GA 5B8BA 1JHBA 2YV9A 3GKKA 3UL3A 1NW2A 4MCUA 1ZYQB 5HR2A 4XS4B 3U6VA 5GSTA 2DKIA 4H86A 1O8XA 1PFOA 1G6YA 1ZYEA 3A5WA 4HQZA 2GQKA 1YKCA 3QAGA 1AC1A 3E9JB 1YY7A 2DIZA 4GQFA 1SJZA 19GSA 3KZQA 1KNGA 4EIPA 1O8WA 5IOWA 1R26A 2H6XA 4JEDA 2H30A 2REMA 4HZ4A 4BA7A 4BVXA 2L5LA 3PPUA 1GTUA 1TTZA 5G30A 1PN0A 1Z3EA 1EOGA 2H76A 3KM6A 1EP8A 5H5QA 3GH6A 1SL1B 3WGEA 2IMKA 2VLUA 3I69A 4MF7A 3ISOA 3KGKA 4EIQA 1E2YA 3KD0A 5E59A 2LKUA 1AIUA 2OE3A 3A5IA 3N5OA 3FKFA 3ZRDA 4PNFA 4O5QA 1HNBA 2VUPA 1U6TA 3VWVA 4MMMA 3OR5A 5GAND 3LFLA 3MWHA 3H8QA 1TDIA 5F07A 2L6CA 3QD9A 5HR1A 3D21A 2GSTA 3WGDA 5BMUA 4PQHA 4QL7A 3TRXA 4G0IA 3KXOA 3UOMA 2A2RA 3HDCA 1IYIA 3M1GA 1EWXA 4WR5A 5CNWA 4XS1A 2C0DA 18GSA 3QMXA 4HJ2A 5G5EA 2E2GA 1I9DA 3H79A 3PINA 1JZDA 5A4WA 1ZZYA 4J57E 1XW6A 1RW1A 5COHA 1GTBA 1FW1A 2GVPA 4AJ7A 1WPIA 4TXOA 1ML6A 5ELAA 1PL2A 1T3BA 2GSSA 2PMTA 3DMLA 1SK1A 5LD0A 2RIIA 4XRDA 5CREA 3LXTA 3ERWA 2HRKA 16GSA 4DSRA 2O7KA 5ECOB 1M99A 2V6OA 5ECPB 3J7Yb 4KE3A 1TW9A 2ON7A 2QSIA 4KUNA 4RQXA 2IWTA 2P5QA 3FZAA 1XVWA 3IV4A 5D9TA 2X49A 1OYJA 4IVFA 5DAKA 2EIQA 3F3RA 1QQ2A 2H6ZA 1ABAA 1ST9A 4ZXGA 3CBUA 4Q5RA 1QFNA 3EMPA 3C71A 3TRPA 2F8AA 4IN0A 2CX4A 3ERGA 4TR1A 2OE1A 3IE3A 1X5DA 2UZ8A 3ZLPA 4AGSA 3FEUA 1SKRB 2HRFA 3R3EA 3GSTA 5KN1A 5KN3A 5ECMB 1JFUA 4CW9A 2DC5A 2YV7A 3BCIA 2CVKA 4DEJA 3C73A 3P2AA 3TB2A 1I5GA 2WB9A 3HZ8A 4ML1A 1NSWA 3N9JA 4FQUA 3QOUA 3GL3A 5JWQB 3TJKA 4O7HA 2C8UA 5CAXA 2D2ZA 2WZ9A 3IBHA 1XWAA 2C80A 1S3CA 1TRUA 2KOKA 2AAWA 4ZL7A 2MMAA 4BPYA 3IHGA 3GSSA 1BG5A 1EGOA 1DBYA 2LEGA 2KP1A 1V2AA 4MA9A 4IS0A 2IFQA 1Q98A 2VLTA 3KP9A 3W8SA 4EKZA 3GKMA 2OBIA 4GCIA 2VM1A 1Z6MA 4MJAA 1ZYPA 1ZOFA 2HI7A 2HXKA 2X64A 4KCEA 4TXVA 2A2SA 3BBYA 5C04A 1KEBA 2FLSA 1PMTA 1M2DA 3TKQA 14GSA 4MZCA 2KHPA 2GT6A 2OACA 4NMUA 2I3YA 1GL8A 1K3LA 3D6IA 2IIYA 2TRXA 2MMNA 4N0VA 5FHIA 1GH2A 5KEJA 3DIEA 3MNGA 2A4VA 2DJ1A 3BOAA 2R0GA 3IAM2 1BAYA 3EINA 4EXJA 3KH7A 5EY6A 3P7XA 5DALA 2M80A 2OADA 3TCOA 1XVQA 1R5AA 5D9VA 3KTLA 2IN3A 3IR4A 4F82A 2BTOT 2LV3A 2H8LA 4Z7XA 3DVXA 1FB6A 5IO2A 4IP1A 2LSTA 1JLWA 2FWFA 2H0HA 4WF4A 1YJ6A 4XRAA 1GULA 2JACA 3E0UA 3I43A 1X5EA 4ZILA 2B1KA 2BJXA 4QL9A 2C0EA 4YKFA 3VWUA 3F8UA 2DBCA 1LU4A 5E4WA 1T1VA 5IQYA 4OFNA 4FH8A 4I2UA 2AYTA 3DD3A 1YQ1A 2VM2A 2GSRA 1ZL9A 2J23A 3UARA 3KTBA 5G5FA 5ID2B 5CRDA 2NVLA 2P0GA 1Z5YE 2CQ9A 4KAEA 2FY6A 2DKHA 3FK8A 3GX8A 3GIXA 1AQVA 2JZRA 1B4QA 2LQQA 2H1BA 3HVXA 3DKSA 3F4SA 1TK8B 5GZZB 2LNTA 5J4UA 4GLTA 5FWGA 2X8GA 3M3MA 3GN3A 1A2JA 1QUWA 2YN1A 5DJLA 2L59A 3LYPA 4D73B 2YJ7A 2EIOA 2B7JA 4K0GA 1TI3A 3GA4A 4DVCA 5ECHB 3APSA 4DSSB 3J7Yk 1EGRA 4KCAA 4L0WA 2FA4A 2KP2A 3JCML 3L4NA 2H01A 3VWXA 2OA7A 2K6VA 3FZ9A 3HKRA 4EUYA 5A5KA 2H0IA 3FR3A 1G7EA 2R2JA 2QKEA 1K3OA 1EP7A 3W6GA 4TN8A 2G0FA 2JZTA 6GSUA 2NDOA 1OC9A 3GTUA 3GX0A 2ON5A 2PGTA 2WULA 4IJ3A 5JWOB 1OAZA 3GNJA 1SD8A 4GF0A 1V58A 2K8SA 5CRGA 3EVIA 2ALBA 1TK5B 3ZTLA 4F03A 4K8MA 3HA9A 2CVDA 2X8HA 4OO4A 2B3SA 3KEBA 1ERUA 1TJDA 1HNCA 4Z2TA 2FHEA 1EZKA 5D93A 3C1SA 5B6MA 4EDYA 1GP1A 1F9MA 4F0CA 5HFGA 1XW9A 11GSA 2XHFA 3BCKA 4OO5A 4A5PA 2VCTA 2MMOA 1X5CA 1IYHA 3F63A 1BX9A 1WJKA 3VURA 3Q18A 2PN8A 4CDOA 2H72A 4YQVA 2AB6A 4YQUA 3HJPA 5CO3A 4G2EA 4MH2A 3EYTA 5F05A 1OVNA 4CY6A 3C1RA 4HJMA 3KJYA 3NOFA 3ZL5A 4ECCA 1CQHA 5D8IA 3FRCA 3DVWA 5G2ZA 5IPGA 4KGIA 1EEJA 3BJ5A 1J0FA 2J9HA 4Z2UA 4ZL9A 1SYRA 2H75A 4EO3A 2DJKA 3TOTA 4ZBDA 2H74A 1O7UA 2AJQB 1XOBA 2B6MA 1VRSD 4AJ6A 2E2MA 4LMWA 5JCUA 1A24A 2K18A 2RUFA 5HR3A 2LJKA 1XPVA 1HD2A 1XZOA 2CT6A 1M9BA 4LLRA 1VF2A 3QFBC 3GKXA 4PTSA 4V1Ap 5IPHA 4IELA 2YZUA 3MSZA 4XCSA 5B8AA 4NWYA 3TOUA 4OD7A 1DE2A 5IOXA 2R4VA 4I6XA 5ECRB 1N2AA 3HYPA 2A2PA 1K0AA 3GUSA 1TRWA 1UA5A 4RI6A 3L78A 1N8JA 1VF1A 2F51A 3GRXA 2GTUA 5EPFA 4NV5A 5G31A 4F0BA 2PU9C 3A3TA 2RLIA 3G7JA 1F3AA 2VD0A 3O6TA 1V57A 3HY2A 1F37A 4L5OA 5DQYA 3ME7A 1YKAA 2YNXA 1OKTA 1T4YA 1THOA 1PX7A 4FO5A 1K0CA 1A0RP 3HJOA 5KN0A 4EE0A 3F4TA 5B7CA 5KOWA 3TRQA 4AJ8A 1OE7A 3L9UA 1PKWA 3D22A 3IPZA 4J56E 3FYGA 4IJIA 4RQRA 1K0NA 2B5EA 4ML6A 4YH2A 1AW9A 4ILFA 4D73A 2PPTA 3LYKA 5G1KA 4E8EA 3F6DA 3CXGA 2VCVA 2XPDA 1PQNA 1JZWA 2H73A 3KMNA 3DWVA 4N10A 1EV9A 4DSSA 2FD3A 1ZGNA 1F3BA 4ECJA 3QAWA 1B8XA 3H93A 3GFKA 5DCGA 4ISDA 2HZFA 1O6JA 1FG4A 1B48A 1GLPA 3PR8A 2WRTA 1M2BA 3F4RA 5ECLB 1MEKA 3ZIJA 4O92A 3HD5A 2X99A 4I2TA 4Q5NA 2JU5A 3F9UA 5AIXA 4MP4A 4FYBA 4J2FA 4NAXA 3AY8A 3M0FA 2AHEA 4K7IA 1SJIA 1SENA 5CRHA 1PA3A 3US3A 2NTOA 2QC7A 2P5RA 3GHAA 4IQAA 4ACSA 3CYNA 3LEFA 3ZFLA 3ZREA 4ZIJA 3HHVA 2YWOA 1AXDA 3K8NA 1DUGA 1K0OA 3EU4A 4GQCA 3GV1A 4NV2A 2QA1A 1YF1A 1WOUA 2GZYA 3ZVJD 1GSFA 3HVNA 1PL1A 5INYA 5AGYA 1URMA 3HVVA 3E3EA 2AV4A 2ZUPA 2YJHA 4KW6A 3KP8A 4K9ZA 2M46A 1Y25A 3RPNA 1M2AA 4I8BA 4LL4B 1G0TA 4K2XA 2H19A 3M9KA 4TR3A 3UIWA 1HYUA 4V1Ag 1M3JA 4ICYA 4G9HA 2CAIA 5HQPA 2VCXA 4FYCA 1WRYA 2YZHA 3KMOA 4HQSA 1MTCA 5HR0A 2H1DA 5ABRA 2GSQA 2JZSA 3CTGA 4MABA 4EVMA 1OE8A 4OCEA 4JBBA 5DBQA 1CQGA 4MJBA 3I6AA 4MDCA 4I5QA 5G1LA 4K6XA 3P90A 2C3NA 3ME8A 3SWLA 4BL7B 2HYXA 3APQA 2R3XA 5ECQB 3S9FA 5JCWA 1R4WA 2G2QA 4XHMA 1ZMAA 4XS4A 1GTAA 4EF0A 3IRAA 4L0UA 1GUMA 4O5UA 1OC3A 5J9CA 5J5NA 1T00A 5DVBA 4K7OA 5EL8A 2LNSA 2ES7A 3GKNA 4KX4A 5F0GA 1SL0B 2A4HA 3BD2A 3M9JA 5IMFA 1SK0A 2AUVA 1WMJA 4MPGA 3UMAA 4BVXB 1W4VA 3CRUA 3NZNA 1UN2A 2VL2A 3H1NA 2OKAA 2VAFA 3QPMA 5AISA 1XIYA 4HEA2 5IMCA 4TW5A 9GSSA 2FWEA 2VOCA 1KTEA 1K0DA 1SL2B 2MYGA 3FW2A 1J08A 2E0QA 2LJRA 3APOA 4YAVA 5FT3A 3F3QA 2PVQA 3U5RE 3FR6A 2XBIA 3EURA 3LJRA 1OKDA 3QFAC 2VCZA 2GLRA 3RAZA 3V1WA 12GSA 2GZPA 4IBPA 4O32A 4OFMA 5BRTA 1XG8A 3TKSA 3VPQA 4MJCA 2FUG2 1YEPA 1NHOA 2TIRA 4JRRA 1GSSA 1WWJA 4L5LA 4KSMA 2YANA 3TJBA 4N0ZA 4XS6A 3VFIA 2OJLA 1U87A 2JADA 3TKSC 1K0BA 3ZMLA 1ERVA 3D4MA 1K0MA 2V32A 4K7NA 5IO0A 1XWKA 2O87A 1PKZA 4GTUA 1R7HA 4USSA 2KUCA 2FWHA 3ZFBA 1OC8A 1S3AA 1BQ7A 2CV4A 3ZZXA 1K3YA 3HVSA 1ON4A 4KDYA 5D9WA 1BEDA 1LJRA 3ZIVA 5JCGA 4TRXA 1RQMA 2X8CA 1NHYA 2B5XA 2LQOA 2WGRA 3TKRA 1U3AA 4LA1A 1S3DA 4RI7A 2H1AA 4TR1B 5H5SA 1DSBA 3IA1A 5J9BA 6GSYA 1AQWA 4NPBA 3TJGA 3MDKA 4G19A 4X0XA 5J41A 20GSA 4E8HA 2P31A 4PUFC 3FMWA 2CZ3A 2LTKA 1XXUA 1TRVA 3IK7A 4PQIA 1T4ZA 2LUSA 4HU7A 1PRXA 5LCZA 2TRCP 4BWQA 1JZOA 1PX6A 1YDKA 2IJYA 4EL1A 1XWBA 4G0KA 3LWAA 4MK3A 5H5RA 4HDEA 4TR4A 3FZ5A 4PXOA 2I4AA 4F9ZA 2Z9SA 5C00A 1C72A 2FA8A 3RBTA 2L4CA 4EC0A 3F6FA 2IPAA 1T8EB 1UVZA 1JLVA 3G7IA 2CZ2A 4GRFA 2IFQB 3FZ4A 2VL9A 1V9WA 2DJ3A 1SKSB 3EMXA 3I9V2 3DEXA 2XC2A 4MJEA 2X4AA 1TU7A 3UAPA 1J9BA 1GWCA 3DYRA 2QA2A 2B1LA 2VD1A 2DMLA 5IMDA 1MD4A 4WETA 2WDUA 4BL7A 4NHZA 3UBLA 3D5JA 2IMDA 2CVBA 3H4KA 4HS1A 1M3IA 2N5FA 4KDUA 3SBCA 4IP6A 3LXZA 3PGTA 1VF3A 4HU9A 13GSA 4L8EA 1X9WB 5DALB 5ELGA 6GSVA 2PWJA 1ERWA 3L9VA 2CAQA 4YAPA 2I81A 2YPMA 1XWGA 4TOPA 3GURA 3EPTA 4CHSA 5J3RA 1YEXA 2DMMA 4N30A 1XWCA 3CRTA 4ZB9A 5DQSA 3P8WA 5HFKA 2F8FA 2CX3A 2HLSA 2M72A 4WF5A 7GSSA 2DLXA 4HI7A 5HFIA 3Q19A 2KLXA 2R5GA 2IL3A 4IGJA 1QGVA 3CSHA 2F3MA 2C3TA 1X0RA 2H71A 2VL3A 3L9SA 2LRNA 1A23A 3C7MA 2GT5A 3FHKA 3DXBA 2V6KA 3GYKA 4XIHA 5A4VA 2RM5A 4YQMA 3QDNA 1TRSA 2PBJA 4MZWA 3O76A 4ECIA 1SU9A 3KIJA 5ID2A 2HRNA 4F2IA 1WIKA 3VK9A 2O8VB 5DCHA 2WFCA 4PURA 3LG6A 4ZB8A 2HSHA 4BVYB 1SYXA 1DE1A 3UVTA 5LNKe 1O81A 3TUEA 2JL4A 1GSQA 4IQ1A 3IOSA 3KH9A 1F2EA 2K9FA 1O73A 3GH9A 2O85A 4POLA 3CTFA 4WBJA 2R6KA 4X4JA 3DRNA 2PERA 4P3YB 1FOHA 4RUVA 5D73A 2HZEB 3FY7A 3TJJA 1GNEA 4POKA 2C1YA 1Y6EA 4IW9A 2H6YA 4KDXA 4PQ1A 3CQFA 3W8JA 2RM6A 1G6WA 4HOJA 2DJ2A 3WT2A 1GTIA 4OWYA 4ID0A 3A2VA 2YOIA 2OBKA 1ACVA 2CA8A 4BIKA 1GSYA 1XW5A 3R2QA 5D96A 4ECBA 1V98A 5AN1A 3EU3A 5ECNB 2DJJA 2LRCA 1GUHA 1GLQA 3EE2A 3ZYWA 1MDIA 1BYEA 3QR6A 3IC8A 5ECSA 1S3RA 2R0CA 1TK0B 2VCWA 6GSSA 5F8BA 2R0PA 2ZCTA 5KOXA 2OE0A 1E6BA 1OC9B 2F9SA 2R37A 3GTUB 4MNNA 3WT1A 4JU5A 4BWSA 5IM9A 1ZYNA 2V1MA 5IMAA 1B9YC 2YWNA 4KH7A 4CY8A 4ZB6A 5F06A 3ZMKA 4OMVA 1FVJA 1PGTA 4OCFA 1PN9A 3HXSA 1NM3A 1Z7RA 3M8NA 3G7YA 10GSA 1Z6NA 3IHQA 5GAPD 4WXTA 1WE0A 5DJMA 2HNLA 2O89A 3VI7A 4TKYA 4TR0A 2PUKC 3QAVA 2VCQA 2RUEA 4LMVA 3ZVJA 2GQMA 2H70A 4Q5FA 2VO4A 4MF5A 2L6DA 1TU8A 2C4JA 5IIZA 1FO5A 1AAZA 1EEMA 4GWRA 3RDWA 1A2MA 1ERTA 4XTSA 3GMFA 4K2DA 2E7PA 4G0LA 5D9XA 2NPBA 3FR9A 3C8EA 3DGQA 1GRXA 1YZXA 1M0UA 1EOHA 3D0ZA 8GSSA 2L57A 5B6NA 1B4PA 2FGXA 1ZCPA 3A2XA 1TP9A 4QQ7A 1THXA 2QGVA 4EDZA 4V2MA 4NHWA 2IMFA 2DIYA 2JSZA 2GS3A 2L4QA 1A8YA 2VLVA 4HSCX 4AF2A 2FNOA 4G10A 4KSOA 1TXXA 4K0NA 1G7OA 3TKPA 1MDJA 2GGTA 4JE1A 2HFDA 2LJAA 1GSDA 2L5OA 1JZRA 2VIMA 2HT9A 1EV4A 1PSQA 5A4UA 4ULXA 3IDVA 4GSSA 4GXZA 3IAS2 1FVKA 2FWGA 4MZBA 2B5YA 2GZZA 1Q4JA 1HQOA 4HUAA 1GNWA 1TKDB 2WCIA 2GDRA 22GSA 3ZITA 3RHCA 4JR4A 5CYYA 2H66A 2I1UA 2XPEA 4KB3A 3VLNA 3HCZA 1RK4A 5CRWA 3TJFA 1LBKA 2WS2A 2EC4A 4POBA 2YWMA 2PVOC 4ZBAA 3LW9A 1QXHA 1AQXA 2XBQA 3TKSE 4MF6A 3ED3A 1M9AA 1M7TA 2MZCA 1VGLA 3L0HA 2VL2C 2V41A 4ZL8A 4I97A 5ECKB 1A2LA 1SK2A 1U88A 1GSEA 3TDGA 4PNGA 6GSXA 4WR4A 2I9HA 3WYWA 4GSNA 4WBRD 4JR6A 1O85A 1X9MB 3MAKA 5EVOA 4YKGA 2LRTA 1USBA 4ZBBA 2C0FA 1TOFA 1KBNA 3Q74A 3ERFA 4MLYA 1VF4A 4WEYA 3LGCA 2LS5A 4BVYA 4V2LA 2YWIA 4TXOB 3UJ1A 1T7PB 4KF9A 3QCPA 3LQ7A 4IHUA 3UVHA 3MIXA 3WGXA 4Z2RA 3O3TA 4PX1A 2H0GA 1FB0A 2YP6A 3NIVA 5IMZA 2K8VA 5KN2A 17GSA 4Q5QA 3D4TA 2HZEA
chains in the Genus database with same CATH topology
2C3QA 3Q6OA 1XFLA 1HNAA 5CP1A 2NBSA 1W89A 3EWLA 3RPPA 4KA0A 1FOVA 5DAKB 4K5RA 2ZNMA 1GUKA 1H4OA 1QK8A 4TVEA 2DJ0A 3VWWA 1R5PA 2WJUA 1TI1A 1XOAA 1WP0A 2JSYA 3MYDA 4MH3A 2BMXA 3A2WA 5IMVA 2DSAA 3UBKA 2IMEA 2B7KA 5ECIB 6GSWA 1SJ6A 3CSIA 3LSZA 2FCHA 3RHBA 2IMIA 3HZ4A 2V2GA 3F0IA 1AUCA 4JZQA 4K5SA 1X9SB 1YF0A 1Z7PA 3VI5A 4PUAA 3EC3A 4X43A 1A8LA 3WD6A 4V2NA 1SD9A 1QMVA 1BJXA 5JWRB 1H75A 2HRAA 1GSUA 1A0FA 4HZ2A 1Z9HA 2MBSA 2EIRA 1MDKA 1MD3A 3G9BA 4GSTA 3CMIA 2YCDA 2N5AA 1PD21 4X1UA 1ILOA 3IK9A 4OFTA 3IC4A 3GL5A 4K1FA 2MBTA 4FYUA 3HJMA 1SKWB 1XBSA 5DDLA 3TGZA 1U3IA 2N5BA 4NXIA 2H1GA 4KNDA 3IXRA 5GSSA 3PH9A 2HSYA 5AIVA 1FAAA 2HE3A 2HSMA 4N11A 4POMA 1FHEA 4IKHA 3VPTA 5ENUA 5L71A 2MMZA 4FIWA 1XCCA 6GSTA 1F6MC 1B9XC 4O5RA 4LL1B 3CSJA 4DSQA 3UEMA 2GQLA 1UC7A 4WKWA 4MPFA 3KCMA 4PGTA 3LORA 1V40A 2C0GA 5B8BA 1JHBA 2YV9A 3GKKA 3UL3A 1NW2A 4MCUA 1ZYQB 5HR2A 4XS4B 3U6VA 5GSTA 2DKIA 4H86A 1O8XA 1G6YA 1ZYEA 3A5WA 4HQZA 2GQKA 1YKCA 3QAGA 1AC1A 3E9JB 1YY7A 2DIZA 4GQFA 1SJZA 19GSA 3KZQA 1KNGA 4EIPA 1O8WA 5IOWA 1R26A 2H6XA 4JEDA 2H30A 2REMA 4HZ4A 4BA7A 4BVXA 2L5LA 3PPUA 1GTUA 1TTZA 5G30A 1PN0A 1Z3EA 1EOGA 2H76A 3KM6A 1EP8A 5H5QA 3GH6A 1SL1B 3WGEA 2IMKA 2VLUA 3I69A 4MF7A 3ISOA 3KGKA 4EIQA 1E2YA 3KD0A 5E59A 2LKUA 1AIUA 2OE3A 3A5IA 3N5OA 3FKFA 3ZRDA 4PNFA 4O5QA 1HNBA 2VUPA 1U6TA 3VWVA 4MMMA 3OR5A 5GAND 3LFLA 3MWHA 3H8QA 1TDIA 5F07A 2L6CA 3QD9A 5HR1A 3D21A 2GSTA 3WGDA 5BMUA 4PQHA 4QL7A 3TRXA 4G0IA 3KXOA 3UOMA 2A2RA 3HDCA 1IYIA 3M1GA 1EWXA 4WR5A 5CNWA 4XS1A 2C0DA 18GSA 3QMXA 4HJ2A 5G5EA 2E2GA 1I9DA 3H79A 3PINA 1JZDA 5A4WA 1ZZYA 4J57E 1XW6A 1RW1A 5COHA 1GTBA 1FW1A 2GVPA 4AJ7A 1WPIA 4TXOA 1ML6A 5ELAA 1PL2A 1T3BA 2GSSA 2PMTA 3DMLA 1SK1A 5LD0A 2RIIA 4XRDA 5CREA 3LXTA 3ERWA 2HRKA 16GSA 4DSRA 2O7KA 5ECOB 1M99A 2V6OA 5ECPB 3J7Yb 4KE3A 1TW9A 2ON7A 2QSIA 4KUNA 4RQXA 2IWTA 2P5QA 3FZAA 1XVWA 3IV4A 5D9TA 2X49A 1OYJA 4IVFA 5DAKA 2EIQA 3F3RA 1QQ2A 2H6ZA 1ABAA 1ST9A 4ZXGA 3CBUA 4Q5RA 1QFNA 3EMPA 3C71A 3TRPA 2F8AA 4IN0A 2CX4A 3ERGA 4TR1A 2OE1A 3IE3A 1X5DA 2UZ8A 3ZLPA 4AGSA 3FEUA 1SKRB 2HRFA 3R3EA 3GSTA 5KN1A 5KN3A 5ECMB 1JFUA 4CW9A 2DC5A 2YV7A 3BCIA 2CVKA 4DEJA 3C73A 3P2AA 3TB2A 1I5GA 2WB9A 3HZ8A 4ML1A 1NSWA 3N9JA 4FQUA 3QOUA 3GL3A 5JWQB 3TJKA 4O7HA 2C8UA 5CAXA 2D2ZA 2WZ9A 3IBHA 1XWAA 2C80A 1S3CA 1TRUA 2KOKA 2AAWA 4ZL7A 2MMAA 4BPYA 3IHGA 3GSSA 1BG5A 1EGOA 1DBYA 2LEGA 2KP1A 1V2AA 4MA9A 4IS0A 2IFQA 1Q98A 2VLTA 3KP9A 3W8SA 4EKZA 3GKMA 2OBIA 4GCIA 2VM1A 1Z6MA 4MJAA 1ZYPA 1ZOFA 2HI7A 2HXKA 2X64A 4KCEA 4TXVA 2A2SA 3BBYA 5C04A 1KEBA 2FLSA 1PMTA 1M2DA 3TKQA 14GSA 4MZCA 2KHPA 2GT6A 2OACA 4NMUA 2I3YA 1GL8A 1K3LA 3D6IA 2IIYA 2TRXA 2MMNA 4N0VA 5FHIA 1GH2A 5KEJA 3DIEA 3MNGA 2A4VA 2DJ1A 3BOAA 2R0GA 3IAM2 1BAYA 3EINA 4EXJA 3KH7A 5EY6A 3P7XA 5DALA 2M80A 2OADA 3TCOA 1XVQA 1R5AA 5D9VA 3KTLA 2IN3A 3IR4A 4F82A 2BTOT 2LV3A 2H8LA 4Z7XA 3DVXA 1FB6A 5IO2A 4IP1A 2LSTA 1JLWA 2FWFA 2H0HA 4WF4A 1YJ6A 4XRAA 1GULA 2JACA 3E0UA 3I43A 1X5EA 4ZILA 2B1KA 2BJXA 4QL9A 2C0EA 4YKFA 3VWUA 3F8UA 2DBCA 1LU4A 5E4WA 1T1VA 5IQYA 4OFNA 4FH8A 4I2UA 2AYTA 3DD3A 1YQ1A 2VM2A 2GSRA 1ZL9A 2J23A 3UARA 3KTBA 5G5FA 5ID2B 5CRDA 2NVLA 2P0GA 1Z5YE 2CQ9A 4KAEA 2FY6A 2DKHA 3FK8A 3GX8A 3GIXA 1AQVA 2JZRA 1B4QA 2LQQA 2H1BA 3HVXA 3DKSA 3F4SA 1TK8B 5GZZB 2LNTA 5J4UA 4GLTA 5FWGA 2X8GA 3M3MA 3GN3A 1A2JA 1QUWA 2YN1A 5DJLA 2L59A 3LYPA 4D73B 2YJ7A 2EIOA 2B7JA 4K0GA 1TI3A 3GA4A 4DVCA 5ECHB 3APSA 4DSSB 3J7Yk 1EGRA 4KCAA 4L0WA 2FA4A 2KP2A 3JCML 3L4NA 2H01A 3VWXA 2OA7A 2K6VA 3FZ9A 3HKRA 4EUYA 5A5KA 2H0IA 3FR3A 1G7EA 2R2JA 2QKEA 1K3OA 1EP7A 3W6GA 4TN8A 2G0FA 2JZTA 6GSUA 2NDOA 1OC9A 3GTUA 3GX0A 2ON5A 2PGTA 2WULA 4IJ3A 5JWOB 1OAZA 3GNJA 1SD8A 4GF0A 1V58A 2K8SA 5CRGA 3EVIA 2ALBA 1TK5B 3ZTLA 4F03A 4K8MA 3HA9A 2CVDA 2X8HA 4OO4A 2B3SA 3KEBA 1ERUA 1TJDA 1HNCA 4Z2TA 2FHEA 1EZKA 5D93A 3C1SA 5B6MA 4EDYA 1GP1A 1F9MA 4F0CA 5HFGA 1XW9A 11GSA 2XHFA 3BCKA 4OO5A 4A5PA 2VCTA 2MMOA 1X5CA 1IYHA 3F63A 1BX9A 1WJKA 3VURA 3Q18A 2PN8A 4CDOA 2H72A 4YQVA 2AB6A 4YQUA 3HJPA 5CO3A 4G2EA 4MH2A 3EYTA 5F05A 1OVNA 4CY6A 3C1RA 4HJMA 3KJYA 3NOFA 3ZL5A 4ECCA 1CQHA 5D8IA 3FRCA 3DVWA 5G2ZA 5IPGA 4KGIA 1EEJA 3BJ5A 1J0FA 2J9HA 4Z2UA 4ZL9A 1SYRA 2H75A 4EO3A 2DJKA 3TOTA 4ZBDA 2H74A 1O7UA 2AJQB 1XOBA 2B6MA 1VRSD 4AJ6A 2E2MA 4LMWA 5JCUA 1A24A 2K18A 2RUFA 5HR3A 2LJKA 1XPVA 1HD2A 1XZOA 2CT6A 1M9BA 4LLRA 1VF2A 3QFBC 3GKXA 4PTSA 4V1Ap 5IPHA 4IELA 2YZUA 3MSZA 4XCSA 5B8AA 4NWYA 3TOUA 4OD7A 1DE2A 5IOXA 2R4VA 4I6XA 5ECRB 1N2AA 3HYPA 2A2PA 1K0AA 3GUSA 1TRWA 1UA5A 4RI6A 3L78A 1N8JA 1VF1A 2F51A 3GRXA 2GTUA 5EPFA 4NV5A 5G31A 4F0BA 2PU9C 3A3TA 2RLIA 3G7JA 1F3AA 2VD0A 3O6TA 1V57A 3HY2A 1F37A 4L5OA 5DQYA 3ME7A 1YKAA 2YNXA 1OKTA 1T4YA 1THOA 1PX7A 4FO5A 1K0CA 1A0RP 3HJOA 5KN0A 4EE0A 3F4TA 5B7CA 5KOWA 3TRQA 4AJ8A 1OE7A 3L9UA 1PKWA 3D22A 3IPZA 4J56E 3FYGA 4IJIA 4RQRA 1K0NA 2B5EA 4ML6A 4YH2A 1AW9A 4ILFA 4D73A 2PPTA 3LYKA 5G1KA 4E8EA 3F6DA 3CXGA 2VCVA 2XPDA 1PQNA 1JZWA 2H73A 3KMNA 3DWVA 4N10A 1EV9A 4DSSA 2FD3A 1ZGNA 1F3BA 4ECJA 3QAWA 1B8XA 3H93A 3GFKA 5DCGA 4ISDA 2HZFA 1O6JA 1FG4A 1B48A 1GLPA 3PR8A 2WRTA 1M2BA 3F4RA 5ECLB 1MEKA 3ZIJA 4O92A 3HD5A 2X99A 4I2TA 4Q5NA 2JU5A 3F9UA 5AIXA 4MP4A 4FYBA 4J2FA 4NAXA 3AY8A 3M0FA 2AHEA 4K7IA 1SJIA 1SENA 5CRHA 1PA3A 3US3A 2NTOA 2QC7A 2P5RA 3GHAA 4IQAA 4ACSA 3CYNA 3LEFA 3ZFLA 3ZREA 4ZIJA 3HHVA 2YWOA 1AXDA 3K8NA 1DUGA 1K0OA 3EU4A 4GQCA 3GV1A 4NV2A 2QA1A 1YF1A 1WOUA 2GZYA 3ZVJD 1GSFA 1PL1A 5INYA 5AGYA 1URMA 3HVVA 3E3EA 2AV4A 2ZUPA 2YJHA 4KW6A 3KP8A 4K9ZA 2M46A 1Y25A 3RPNA 1M2AA 4I8BA 4LL4B 1G0TA 4K2XA 2H19A 3M9KA 4TR3A 3UIWA 1HYUA 4V1Ag 4ICYA 4G9HA 2CAIA 5HQPA 2VCXA 4FYCA 1WRYA 2YZHA 3KMOA 4HQSA 1MTCA 5HR0A 2H1DA 5ABRA 2GSQA 2JZSA 3CTGA 4MABA 4EVMA 1OE8A 4OCEA 4JBBA 5DBQA 1CQGA 4MJBA 3I6AA 4MDCA 4I5QA 5G1LA 4K6XA 3P90A 2C3NA 3ME8A 3SWLA 4BL7B 2HYXA 3APQA 2R3XA 5ECQB 3S9FA 5JCWA 1R4WA 2G2QA 4XHMA 1ZMAA 4XS4A 1GTAA 4EF0A 3IRAA 4L0UA 1GUMA 4O5UA 1OC3A 5J9CA 5J5NA 1T00A 5DVBA 4K7OA 5EL8A 2LNSA 2ES7A 3GKNA 4KX4A 5F0GA 1SL0B 2A4HA 3BD2A 3M9JA 5IMFA 1SK0A 2AUVA 1WMJA 4MPGA 3UMAA 4BVXB 1W4VA 3CRUA 3NZNA 1UN2A 2VL2A 3H1NA 2OKAA 2VAFA 3QPMA 5AISA 1XIYA 4HEA2 5IMCA 4TW5A 9GSSA 2FWEA 2VOCA 1KTEA 1K0DA 1SL2B 2MYGA 3FW2A 1J08A 2E0QA 2LJRA 3APOA 4YAVA 5FT3A 3F3QA 2PVQA 3U5RE 3FR6A 2XBIA 3EURA 3LJRA 1OKDA 3QFAC 2VCZA 2GLRA 3RAZA 3V1WA 12GSA 2GZPA 4IBPA 4O32A 4OFMA 5BRTA 3TKSA 3VPQA 4MJCA 2FUG2 1YEPA 1NHOA 2TIRA 4JRRA 1GSSA 1WWJA 4L5LA 4KSMA 2YANA 3TJBA 4N0ZA 4XS6A 3VFIA 2OJLA 1U87A 2JADA 3TKSC 1K0BA 3ZMLA 1ERVA 3D4MA 1K0MA 2V32A 4K7NA 5IO0A 1XWKA 2O87A 1PKZA 4GTUA 1R7HA 4USSA 2KUCA 2FWHA 3ZFBA 1OC8A 1S3AA 1BQ7A 2CV4A 3ZZXA 1K3YA 3HVSA 1ON4A 4KDYA 5D9WA 1BEDA 1LJRA 3ZIVA 5JCGA 4TRXA 1RQMA 2X8CA 1NHYA 2B5XA 2LQOA 2WGRA 3TKRA 1U3AA 4LA1A 1S3DA 4RI7A 2H1AA 4TR1B 5H5SA 1DSBA 3IA1A 5J9BA 6GSYA 1AQWA 4NPBA 3TJGA 3MDKA 4G19A 4X0XA 5J41A 20GSA 4E8HA 2P31A 4PUFC 3FMWA 2CZ3A 2LTKA 1XXUA 1TRVA 3IK7A 4PQIA 1T4ZA 2LUSA 4HU7A 1PRXA 5LCZA 2TRCP 4BWQA 1JZOA 1PX6A 1YDKA 2IJYA 4EL1A 1XWBA 4G0KA 3LWAA 4MK3A 5H5RA 4HDEA 4TR4A 3FZ5A 4PXOA 2I4AA 4F9ZA 2Z9SA 5C00A 1C72A 2FA8A 3RBTA 2L4CA 4EC0A 3F6FA 2IPAA 1T8EB 1UVZA 1JLVA 3G7IA 2CZ2A 4GRFA 2IFQB 3FZ4A 2VL9A 1V9WA 2DJ3A 1SKSB 3EMXA 3I9V2 3DEXA 2XC2A 4MJEA 2X4AA 1TU7A 3UAPA 1J9BA 1GWCA 3DYRA 2QA2A 2B1LA 2VD1A 2DMLA 5IMDA 1MD4A 4WETA 2WDUA 4BL7A 4NHZA 3UBLA 3D5JA 2IMDA 2CVBA 3H4KA 4HS1A 2N5FA 4KDUA 3SBCA 4IP6A 3LXZA 3PGTA 1VF3A 4HU9A 13GSA 4L8EA 1X9WB 5DALB 5ELGA 6GSVA 2PWJA 1ERWA 3L9VA 2CAQA 4YAPA 2I81A 2YPMA 1XWGA 4TOPA 3GURA 3EPTA 4CHSA 5J3RA 1YEXA 2DMMA 4N30A 1XWCA 3CRTA 4ZB9A 5DQSA 3P8WA 5HFKA 2F8FA 2CX3A 2HLSA 2M72A 4WF5A 7GSSA 2DLXA 4HI7A 5HFIA 3Q19A 2KLXA 2R5GA 2IL3A 4IGJA 1QGVA 3CSHA 2F3MA 2C3TA 1X0RA 2H71A 2VL3A 3L9SA 2LRNA 1A23A 3C7MA 2GT5A 3FHKA 3DXBA 2V6KA 3GYKA 4XIHA 5A4VA 2RM5A 4YQMA 3QDNA 1TRSA 2PBJA 4MZWA 3O76A 4ECIA 1SU9A 3KIJA 5ID2A 2HRNA 4F2IA 1WIKA 3VK9A 2O8VB 5DCHA 2WFCA 4PURA 3LG6A 4ZB8A 2HSHA 4BVYB 1SYXA 1DE1A 3UVTA 5LNKe 1O81A 3TUEA 2JL4A 1GSQA 4IQ1A 3IOSA 3KH9A 1F2EA 2K9FA 1O73A 3GH9A 2O85A 4POLA 3CTFA 4WBJA 2R6KA 4X4JA 3DRNA 2PERA 4P3YB 1FOHA 4RUVA 5D73A 2HZEB 3FY7A 3TJJA 1GNEA 4POKA 2C1YA 1Y6EA 4IW9A 2H6YA 4KDXA 4PQ1A 3W8JA 2RM6A 1G6WA 4HOJA 2DJ2A 3WT2A 1GTIA 4OWYA 4ID0A 3A2VA 2YOIA 2OBKA 1ACVA 2CA8A 1GSYA 1XW5A 3R2QA 5D96A 4ECBA 1V98A 5AN1A 3EU3A 5ECNB 2DJJA 2LRCA 1GUHA 1GLQA 3EE2A 3ZYWA 1MDIA 1BYEA 3QR6A 3IC8A 5ECSA 1TK0B 2R0CA 2VCWA 6GSSA 5F8BA 2R0PA 2ZCTA 5KOXA 2OE0A 1E6BA 1OC9B 2F9SA 2R37A 3GTUB 4MNNA 3WT1A 4JU5A 4BWSA 5IM9A 1ZYNA 2V1MA 5IMAA 1B9YC 2YWNA 4KH7A 4CY8A 4ZB6A 5F06A 3ZMKA 4OMVA 1FVJA 1PGTA 4OCFA 1PN9A 3HXSA 1NM3A 1Z7RA 3M8NA 3G7YA 10GSA 1Z6NA 3IHQA 5GAPD 4WXTA 1WE0A 5DJMA 2HNLA 2O89A 3VI7A 4TKYA 4TR0A 2PUKC 3QAVA 2VCQA 2RUEA 4LMVA 3ZVJA 2GQMA 2H70A 4Q5FA 2VO4A 4MF5A 2L6DA 1TU8A 2C4JA 5IIZA 1FO5A 1AAZA 1EEMA 4GWRA 3RDWA 1A2MA 1ERTA 4XTSA 3GMFA 4K2DA 2E7PA 4G0LA 5D9XA 2NPBA 3FR9A 3C8EA 3DGQA 1GRXA 1YZXA 1M0UA 1EOHA 3D0ZA 8GSSA 2L57A 5B6NA 1B4PA 2FGXA 1ZCPA 3A2XA 1TP9A 4QQ7A 1THXA 2QGVA 4EDZA 4V2MA 4NHWA 2IMFA 2DIYA 2JSZA 2GS3A 2L4QA 1A8YA 2VLVA 4AF2A 2FNOA 4G10A 4KSOA 1TXXA 4K0NA 1G7OA 3TKPA 1MDJA 2GGTA 4JE1A 2HFDA 2LJAA 1GSDA 2L5OA 1JZRA 2VIMA 2HT9A 1EV4A 1PSQA 5A4UA 4ULXA 3IDVA 4GSSA 4GXZA 3IAS2 1FVKA 2FWGA 4MZBA 2B5YA 2GZZA 1Q4JA 1HQOA 4HUAA 1GNWA 1TKDB 2WCIA 2GDRA 22GSA 3ZITA 3RHCA 4JR4A 5CYYA 2H66A 2I1UA 2XPEA 4KB3A 3VLNA 3HCZA 1RK4A 5CRWA 3TJFA 1LBKA 2WS2A 2EC4A 4POBA 2YWMA 2PVOC 4ZBAA 3LW9A 1QXHA 1AQXA 2XBQA 3TKSE 4MF6A 3ED3A 1M9AA 1M7TA 2MZCA 1VGLA 3L0HA 2VL2C 2V41A 4ZL8A 4I97A 5ECKB 1A2LA 1SK2A 1U88A 1GSEA 3TDGA 4PNGA 6GSXA 4WR4A 2I9HA 3WYWA 4GSNA 4WBRD 4JR6A 1O85A 1X9MB 3MAKA 5EVOA 4YKGA 2LRTA 1USBA 4ZBBA 2C0FA 1TOFA 1KBNA 3Q74A 3ERFA 4MLYA 1VF4A 4WEYA 3LGCA 2LS5A 4BVYA 4V2LA 2YWIA 4TXOB 3UJ1A 1T7PB 4KF9A 3QCPA 3LQ7A 4IHUA 3UVHA 3MIXA 3WGXA 4Z2RA 3O3TA 4PX1A 2H0GA 1FB0A 2YP6A 3NIVA 5IMZA 2K8VA 5KN2A 17GSA 4Q5QA 3D4TA 2HZEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C3Q A;  3Q6O A;  1XFL A;  1HNA A;  5CP1 A;  2NBS A;  1W89 A;  3EWL A;  3RPP A;  4KA0 A;  1FOV A;  5DAK B;  2ZNM A;  1GUK A;  1H4O A;  1QK8 A;  4TVE A;  2DJ0 A;  3VWW A;  1R5P A;  2WJU A;  1TI1 A;  1XOA A;  1WP0 A;  2JSY A;  4MH3 A;  2BMX A;  3A2W A;  5IMV A;  2DSA A;  3UBK A;  2IME A;  2B7K A;  5ECI B;  6GSW A;  1SJ6 A;  3CSI A;  3LSZ A;  2FCH A;  3RHB A;  2IMI A;  3HZ4 A;  2V2G A;  3F0I A;  1AUC A;  4JZQ A;  1X9S B;  1YF0 A;  1Z7P A;  3VI5 A;  4PUA A;  3EC3 A;  4X43 A;  1A8L A;  3WD6 A;  4V2N A;  1SD9 A;  1QMV A;  1BJX A;  5JWR B;  1H75 A;  1GSU A;  1A0F A;  4HZ2 A;  1Z9H A;  2MBS A;  2EIR A;  1MDK A;  1MD3 A;  3G9B A;  4GST A;  3CMI A;  2YCD A;  2N5A A;  1PD2 1;  4X1U A;  1ILO A;  3IK9 A;  4OFT A;  3IC4 A;  3GL5 A;  4K1F A;  2MBT A;  4FYU A;  3HJM A;  1SKW B;  1XBS A;  5DDL A;  3TGZ A;  1U3I A;  2N5B A;  4NXI A;  2H1G A;  4KND A;  3IXR A;  5GSS A;  3PH9 A;  2HSY A;  5AIV A;  1FAA A;  2HE3 A;  4N11 A;  4POM A;  1FHE A;  4IKH A;  3VPT A;  5ENU A;  5L71 A;  2MMZ A;  4FIW A;  1XCC A;  6GST A;  1F6M C;  1B9X C;  4O5R A;  4LL1 B;  3CSJ A;  4DSQ A;  3UEM A;  2GQL A;  1UC7 A;  4WKW A;  4MPF A;  3KCM A;  4PGT A;  3LOR A;  1V40 A;  2C0G A;  5B8B A;  1JHB A;  2YV9 A;  3GKK A;  3UL3 A;  1NW2 A;  4MCU A;  1ZYQ B;  5HR2 A;  4XS4 B;  3U6V A;  5GST A;  4H86 A;  1O8X A;  1G6Y A;  1ZYE A;  3A5W A;  4HQZ A;  2GQK A;  1YKC A;  3QAG A;  1AC1 A;  3E9J B;  1YY7 A;  2DIZ A;  4GQF A;  1SJZ A;  19GS A;  3KZQ A;  1KNG A;  5IOW A;  1O8W A;  1R26 A;  2H6X A;  4JED A;  2H30 A;  2REM A;  4HZ4 A;  4BA7 A;  4BVX A;  2L5L A;  1GTU A;  1TTZ A;  5G30 A;  1Z3E A;  1EOG A;  2H76 A;  3KM6 A;  1EP8 A;  5H5Q A;  3GH6 A;  1SL1 B;  3WGE A;  2IMK A;  2VLU A;  3I69 A;  4MF7 A;  3ISO A;  3KGK A;  1E2Y A;  3KD0 A;  5E59 A;  2LKU A;  1AIU A;  2OE3 A;  3N5O A;  3FKF A;  3ZRD A;  4PNF A;  1HNB A;  2VUP A;  1U6T A;  3VWV A;  4MMM A;  3OR5 A;  5GAN D;  3LFL A;  3MWH A;  3H8Q A;  1TDI A;  5F07 A;  2L6C A;  3QD9 A;  5HR1 A;  3D21 A;  2GST A;  3WGD A;  4PQH A;  4QL7 A;  3TRX A;  3KXO A;  3UOM A;  2A2R A;  3HDC A;  1IYI A;  3M1G A;  1EWX A;  4WR5 A;  5CNW A;  4XS1 A;  2C0D A;  18GS A;  3QMX A;  4HJ2 A;  5G5E A;  2E2G A;  1I9D A;  3H79 A;  3PIN A;  1JZD A;  5A4W A;  1ZZY A;  4J57 E;  1XW6 A;  1RW1 A;  5COH A;  1GTB A;  1FW1 A;  2GVP A;  4AJ7 A;  1WPI A;  4TXO A;  1ML6 A;  5ELA A;  1PL2 A;  1T3B A;  2GSS A;  2PMT A;  3DML A;  1SK1 A;  5LD0 A;  2RII A;  4XRD A;  5CRE A;  3LXT A;  3ERW A;  16GS A;  4DSR A;  2O7K A;  5ECO B;  1M99 A;  2V6O A;  5ECP B;  3J7Y b;  4KE3 A;  1TW9 A;  2ON7 A;  2QSI A;  4KUN A;  4RQX A;  2IWT A;  2P5Q A;  3FZA A;  1XVW A;  3IV4 A;  5D9T A;  1OYJ A;  4IVF A;  5DAK A;  2EIQ A;  3F3R A;  1QQ2 A;  2H6Z A;  1ABA A;  1ST9 A;  4ZXG A;  3CBU A;  4Q5R A;  1QFN A;  3EMP A;  3C71 A;  3TRP A;  2F8A A;  4IN0 A;  2CX4 A;  3ERG A;  4TR1 A;  2OE1 A;  3IE3 A;  1X5D A;  3ZLP A;  4AGS A;  3FEU A;  1SKR B;  2HRF A;  3GST A;  5KN1 A;  5KN3 A;  5ECM B;  1JFU A;  4CW9 A;  2DC5 A;  2YV7 A;  3BCI A;  2CVK A;  4DEJ A;  3C73 A;  3P2A A;  3TB2 A;  1I5G A;  2WB9 A;  3HZ8 A;  4ML1 A;  1NSW A;  3N9J A;  3QOU A;  3GL3 A;  5JWQ B;  3TJK A;  4O7H A;  2C8U A;  5CAX A;  2D2Z A;  2WZ9 A;  3IBH A;  1XWA A;  2C80 A;  1S3C A;  1TRU A;  2KOK A;  2AAW A;  4ZL7 A;  2MMA A;  4BPY A;  3GSS A;  1BG5 A;  1EGO A;  1DBY A;  2LEG A;  2KP1 A;  1V2A A;  4MA9 A;  4IS0 A;  2IFQ A;  1Q98 A;  2VLT A;  3KP9 A;  3W8S A;  4EKZ A;  3GKM A;  2OBI A;  4GCI A;  2VM1 A;  1Z6M A;  4MJA A;  2HXK A;  1ZOF A;  2HI7 A;  2X64 A;  4KCE A;  4TXV A;  2A2S A;  3BBY A;  5C04 A;  1KEB A;  2FLS A;  1PMT A;  1M2D A;  3TKQ A;  14GS A;  4MZC A;  2KHP A;  2GT6 A;  2OAC A;  4NMU A;  2I3Y A;  1GL8 A;  1K3L A;  3D6I A;  2IIY A;  2TRX A;  2MMN A;  4N0V A;  5FHI A;  1GH2 A;  5KEJ A;  3DIE A;  3MNG A;  2A4V A;  2DJ1 A;  3BOA A;  3IAM 2;  1BAY A;  3EIN A;  4EXJ A;  3KH7 A;  5EY6 A;  3P7X A;  5DAL A;  2M80 A;  2OAD A;  3TCO A;  1XVQ A;  1R5A A;  5D9V A;  3KTL A;  2IN3 A;  3IR4 A;  4F82 A;  2BTO T;  2LV3 A;  2H8L A;  4Z7X A;  3DVX A;  1FB6 A;  5IO2 A;  4IP1 A;  2LST A;  1JLW A;  2FWF A;  2H0H A;  4WF4 A;  1YJ6 A;  4XRA A;  1GUL A;  2JAC A;  3E0U A;  3I43 A;  1X5E A;  4ZIL A;  2B1K A;  2BJX A;  4QL9 A;  2C0E A;  3VWU A;  3F8U A;  2DBC A;  1LU4 A;  5E4W A;  1T1V A;  5IQY A;  4OFN A;  4FH8 A;  4I2U A;  2AYT A;  3DD3 A;  1YQ1 A;  2VM2 A;  2GSR A;  1ZL9 A;  2J23 A;  3UAR A;  3KTB A;  5G5F A;  5ID2 B;  5CRD A;  2NVL A;  2P0G A;  1Z5Y E;  2CQ9 A;  4KAE A;  2FY6 A;  3FK8 A;  3GX8 A;  3GIX A;  1AQV A;  2JZR A;  1B4Q A;  2LQQ A;  2H1B A;  3HVX A;  3DKS A;  3F4S A;  1TK8 B;  5GZZ B;  2LNT A;  5J4U A;  4GLT A;  5FWG A;  2X8G A;  3M3M A;  3GN3 A;  1A2J A;  1QUW A;  2YN1 A;  5DJL A;  2L59 A;  3LYP A;  4D73 B;  2YJ7 A;  2EIO A;  2B7J A;  4K0G A;  1TI3 A;  3GA4 A;  4DVC A;  5ECH B;  3APS A;  4DSS B;  3J7Y k;  1EGR A;  4KCA A;  4L0W A;  2FA4 A;  2KP2 A;  3JCM L;  3L4N A;  2H01 A;  3VWX A;  2OA7 A;  2K6V A;  3FZ9 A;  3HKR A;  4EUY A;  5A5K A;  2H0I A;  3FR3 A;  1G7E A;  2R2J A;  2QKE A;  1K3O A;  1EP7 A;  3W6G A;  4TN8 A;  2G0F A;  2JZT A;  6GSU A;  2NDO A;  1OC9 A;  3GTU A;  3GX0 A;  2ON5 A;  2PGT A;  2WUL A;  4IJ3 A;  5JWO B;  1OAZ A;  3GNJ A;  1SD8 A;  4GF0 A;  1V58 A;  2K8S A;  5CRG A;  3EVI A;  2ALB A;  1TK5 B;  3ZTL A;  4F03 A;  4K8M A;  3HA9 A;  2CVD A;  2X8H A;  4OO4 A;  2B3S A;  3KEB A;  1ERU A;  1TJD A;  1HNC A;  2FHE A;  1EZK A;  5D93 A;  3C1S A;  5B6M A;  4EDY A;  1GP1 A;  1F9M A;  4F0C A;  5HFG A;  1XW9 A;  11GS A;  2XHF A;  3BCK A;  4OO5 A;  2VCT A;  2MMO A;  1X5C A;  1IYH A;  3F63 A;  1BX9 A;  1WJK A;  3VUR A;  3Q18 A;  2PN8 A;  4CDO A;  2H72 A;  4YQV A;  2AB6 A;  4YQU A;  3HJP A;  5CO3 A;  4G2E A;  4MH2 A;  3EYT A;  5F05 A;  1OVN A;  3C1R A;  4HJM A;  3KJY A;  3NOF A;  3ZL5 A;  4ECC A;  1CQH A;  5D8I A;  3FRC A;  3DVW A;  5G2Z A;  5IPG A;  4KGI A;  1EEJ A;  3BJ5 A;  1J0F A;  2J9H A;  4ZL9 A;  1SYR A;  2H75 A;  4EO3 A;  2DJK A;  3TOT A;  4ZBD A;  2H74 A;  1O7U A;  2AJQ B;  1XOB A;  2B6M A;  1VRS D;  4AJ6 A;  2E2M A;  4LMW A;  5JCU A;  1A24 A;  2K18 A;  2RUF A;  5HR3 A;  2LJK A;  1XPV A;  1HD2 A;  1XZO A;  2CT6 A;  1M9B A;  4LLR A;  1VF2 A;  3QFB C;  3GKX A;  4V1A p;  5IPH A;  4IEL A;  2YZU A;  3MSZ A;  4XCS A;  5B8A A;  4NWY A;  3TOU A;  4OD7 A;  1DE2 A;  5IOX A;  2R4V A;  4I6X A;  5ECR B;  1N2A A;  3HYP A;  1K0A A;  3GUS A;  1TRW A;  1UA5 A;  4RI6 A;  3L78 A;  1N8J A;  1VF1 A;  2F51 A;  3GRX A;  2GTU A;  5EPF A;  4NV5 A;  5G31 A;  4F0B A;  2PU9 C;  3A3T A;  2RLI A;  3G7J A;  1F3A A;  2VD0 A;  3O6T A;  1V57 A;  3HY2 A;  1F37 A;  4L5O A;  5DQY A;  3ME7 A;  1YKA A;  2YNX A;  1OKT A;  1T4Y A;  1THO A;  1PX7 A;  4FO5 A;  1K0C A;  1A0R P;  3HJO A;  5KN0 A;  4EE0 A;  3F4T A;  5B7C A;  3TRQ A;  4AJ8 A;  1OE7 A;  3L9U A;  1PKW A;  3D22 A;  3IPZ A;  4J56 E;  3FYG A;  4IJI A;  4RQR A;  1K0N A;  2B5E A;  4ML6 A;  4YH2 A;  1AW9 A;  4ILF A;  4D73 A;  2PPT A;  3LYK A;  5G1K A;  4E8E A;  3F6D A;  3CXG A;  2VCV A;  2XPD A;  1PQN A;  1JZW A;  2H73 A;  3KMN A;  3DWV A;  4N10 A;  1EV9 A;  4DSS A;  2FD3 A;  1ZGN A;  1F3B A;  4ECJ A;  3QAW A;  1B8X A;  3H93 A;  3GFK A;  5DCG A;  4ISD A;  2HZF A;  1O6J A;  1FG4 A;  1B48 A;  1GLP A;  3PR8 A;  2WRT A;  1M2B A;  3F4R A;  5ECL B;  1MEK A;  3ZIJ A;  4O92 A;  3HD5 A;  2X99 A;  4I2T A;  4Q5N A;  2JU5 A;  3F9U A;  5AIX A;  4MP4 A;  4FYB A;  4J2F A;  4NAX A;  3AY8 A;  3M0F A;  2AHE A;  4K7I A;  1SJI A;  1SEN A;  5CRH A;  1PA3 A;  3US3 A;  2NTO A;  2QC7 A;  2P5R A;  3GHA A;  4IQA A;  4ACS A;  3CYN A;  3LEF A;  3ZFL A;  3ZRE A;  4ZIJ A;  3HHV A;  2YWO A;  1AXD A;  3K8N A;  1DUG A;  1K0O A;  3EU4 A;  4GQC A;  3GV1 A;  4NV2 A;  1YF1 A;  1WOU A;  2GZY A;  3ZVJ D;  1GSF A;  1PL1 A;  5INY A;  5AGY A;  1URM A;  3HVV A;  3E3E A;  2AV4 A;  2ZUP A;  2YJH A;  4KW6 A;  3KP8 A;  4K9Z A;  2M46 A;  1Y25 A;  3RPN A;  1M2A A;  4I8B A;  4LL4 B;  1G0T A;  2H19 A;  3M9K A;  4TR3 A;  3UIW A;  1HYU A;  4V1A g;  4G9H A;  2CAI A;  5HQP A;  2VCX A;  4FYC A;  1WRY A;  2YZH A;  3KMO A;  4HQS A;  1MTC A;  5HR0 A;  2H1D A;  5ABR A;  2GSQ A;  2JZS A;  3CTG A;  4MAB A;  4EVM A;  1OE8 A;  4OCE A;  4JBB A;  5DBQ A;  1CQG A;  4MJB A;  3I6A A;  4MDC A;  4I5Q A;  5G1L A;  4K6X A;  3P90 A;  2C3N A;  3ME8 A;  3SWL A;  2HYX A;  3APQ A;  2R3X A;  5ECQ B;  3S9F A;  5JCW A;  1R4W A;  2G2Q A;  4XHM A;  1ZMA A;  4XS4 A;  1GTA A;  4EF0 A;  3IRA A;  4L0U A;  1GUM A;  1OC3 A;  5J9C A;  5J5N A;  1T00 A;  5DVB A;  4K7O A;  5EL8 A;  2LNS A;  2ES7 A;  3GKN A;  4KX4 A;  5F0G A;  1SL0 B;  3BD2 A;  3M9J A;  5IMF A;  1SK0 A;  2AUV A;  1WMJ A;  4MPG A;  3UMA A;  1W4V A;  3CRU A;  3NZN A;  1UN2 A;  2VL2 A;  3H1N A;  2OKA A;  2VAF A;  3QPM A;  5AIS A;  1XIY A;  4HEA 2;  5IMC A;  4TW5 A;  9GSS A;  2FWE A;  2VOC A;  1KTE A;  1K0D A;  1SL2 B;  2MYG A;  3FW2 A;  1J08 A;  2E0Q A;  2LJR A;  3APO A;  4YAV A;  5FT3 A;  3F3Q A;  2PVQ A;  3U5R E;  3FR6 A;  2XBI A;  3EUR A;  3LJR A;  1OKD A;  3QFA C;  2VCZ A;  2GLR A;  3RAZ A;  3V1W A;  12GS A;  2GZP A;  4IBP A;  4O32 A;  4OFM A;  3TKS A;  3VPQ A;  4MJC A;  2FUG 2;  1YEP A;  1NHO A;  2TIR A;  4JRR A;  1GSS A;  1WWJ A;  4L5L A;  4KSM A;  2YAN A;  3TJB A;  4N0Z A;  4XS6 A;  3VFI A;  2OJL A;  1U87 A;  2JAD A;  3TKS C;  1K0B A;  3ZML A;  1ERV A;  3D4M A;  1K0M A;  2V32 A;  4K7N A;  5IO0 A;  1XWK A;  2O87 A;  1PKZ A;  4GTU A;  1R7H A;  2KUC A;  2FWH A;  3ZFB A;  1OC8 A;  1S3A A;  1BQ7 A;  2CV4 A;  3ZZX A;  1K3Y A;  3HVS A;  1ON4 A;  4KDY A;  5D9W A;  1BED A;  1LJR A;  3ZIV A;  5JCG A;  4TRX A;  1RQM A;  2X8C A;  1NHY A;  2B5X A;  2LQO A;  2WGR A;  3TKR A;  1U3A A;  4LA1 A;  1S3D A;  4RI7 A;  2H1A A;  4TR1 B;  5H5S A;  1DSB A;  3IA1 A;  5J9B A;  6GSY A;  1AQW A;  4NPB A;  3TJG A;  3MDK A;  4G19 A;  4X0X A;  5J41 A;  20GS A;  4E8H A;  2P31 A;  4PUF C;  2CZ3 A;  2LTK A;  1XXU A;  1TRV A;  3IK7 A;  4PQI A;  1T4Z A;  2LUS A;  4HU7 A;  1PRX A;  5LCZ A;  2TRC P;  4BWQ A;  1JZO A;  1PX6 A;  1YDK A;  2IJY A;  4EL1 A;  1XWB A;  3LWA A;  4MK3 A;  5H5R A;  4HDE A;  4TR4 A;  3FZ5 A;  4PXO A;  2I4A A;  4F9Z A;  2Z9S A;  5C00 A;  1C72 A;  2FA8 A;  3RBT A;  2L4C A;  4EC0 A;  3F6F A;  2IPA A;  1T8E B;  1UVZ A;  1JLV A;  3G7I A;  2CZ2 A;  4GRF A;  2IFQ B;  3FZ4 A;  2VL9 A;  1V9W A;  2DJ3 A;  1SKS B;  3EMX A;  3I9V 2;  3DEX A;  2XC2 A;  4MJE A;  1TU7 A;  3UAP A;  1J9B A;  1GWC A;  3DYR A;  2B1L A;  2VD1 A;  2DML A;  5IMD A;  1MD4 A;  4WET A;  2WDU A;  4BL7 A;  4NHZ A;  3UBL A;  3D5J A;  2IMD A;  2CVB A;  3H4K A;  4HS1 A;  2N5F A;  4KDU A;  3SBC A;  4IP6 A;  3LXZ A;  3PGT A;  1VF3 A;  4HU9 A;  13GS A;  4L8E A;  1X9W B;  5DAL B;  5ELG A;  6GSV A;  2PWJ A;  1ERW A;  3L9V A;  2CAQ A;  4YAP A;  2I81 A;  2YPM A;  1XWG A;  4TOP A;  3GUR A;  4CHS A;  5J3R A;  1YEX A;  2DMM A;  4N30 A;  1XWC A;  3CRT A;  4ZB9 A;  5DQS A;  3P8W A;  5HFK A;  2F8F A;  2CX3 A;  2HLS A;  2M72 A;  4WF5 A;  7GSS A;  2DLX A;  4HI7 A;  5HFI A;  3Q19 A;  2KLX A;  2R5G A;  2IL3 A;  4IGJ A;  1QGV A;  3CSH A;  2F3M A;  2C3T A;  1X0R A;  2H71 A;  2VL3 A;  3L9S A;  2LRN A;  1A23 A;  3C7M A;  2GT5 A;  3FHK A;  3DXB A;  2V6K A;  3GYK A;  4XIH A;  5A4V A;  2RM5 A;  4YQM A;  3QDN A;  1TRS A;  2PBJ A;  4MZW A;  3O76 A;  4ECI A;  1SU9 A;  3KIJ A;  5ID2 A;  2HRN A;  4F2I A;  1WIK A;  3VK9 A;  2O8V B;  5DCH A;  2WFC A;  4PUR A;  3LG6 A;  4ZB8 A;  2HSH A;  1SYX A;  1DE1 A;  3UVT A;  5LNK e;  1O81 A;  3TUE A;  2JL4 A;  1GSQ A;  4IQ1 A;  3IOS A;  3KH9 A;  1F2E A;  2K9F A;  1O73 A;  3GH9 A;  2O85 A;  4POL A;  3CTF A;  4WBJ A;  2R6K A;  3DRN A;  2PER A;  4P3Y B;  4RUV A;  5D73 A;  2HZE B;  3FY7 A;  3TJJ A;  1GNE A;  4POK A;  2C1Y A;  1Y6E A;  4IW9 A;  2H6Y A;  4KDX A;  4PQ1 A;  3W8J A;  2RM6 A;  1G6W A;  4HOJ A;  2DJ2 A;  3WT2 A;  1GTI A;  4OWY A;  4ID0 A;  3A2V A;  2YOI A;  2OBK A;  1ACV A;  2CA8 A;  1GSY A;  1XW5 A;  3R2Q A;  5D96 A;  4ECB A;  1V98 A;  5AN1 A;  3EU3 A;  5ECN B;  2DJJ A;  2LRC A;  1GUH A;  1GLQ A;  3EE2 A;  3ZYW A;  1MDI A;  1BYE A;  3QR6 A;  5ECS A;  1TK0 B;  2VCW A;  6GSS A;  5F8B A;  2ZCT A;  2OE0 A;  1E6B A;  1OC9 B;  2F9S A;  2R37 A;  3GTU B;  3WT1 A;  4JU5 A;  4BWS A;  5IM9 A;  2V1M A;  5IMA A;  1B9Y C;  2YWN A;  4KH7 A;  4ZB6 A;  5F06 A;  3ZMK A;  4OMV A;  1FVJ A;  1PGT A;  4OCF A;  1PN9 A;  3HXS A;  1NM3 A;  1Z7R A;  3M8N A;  3G7Y A;  10GS A;  1Z6N A;  3IHQ A;  5GAP D;  4WXT A;  1WE0 A;  5DJM A;  2HNL A;  2O89 A;  3VI7 A;  4TKY A;  4TR0 A;  2PUK C;  3QAV A;  2VCQ A;  2RUE A;  4LMV A;  3ZVJ A;  2GQM A;  2H70 A;  4Q5F A;  2VO4 A;  4MF5 A;  2L6D A;  1TU8 A;  2C4J A;  5IIZ A;  1FO5 A;  1AAZ A;  1EEM A;  4GWR A;  3RDW A;  1A2M A;  1ERT A;  4XTS A;  3GMF A;  4K2D A;  2E7P A;  5D9X A;  2NPB A;  3FR9 A;  3C8E A;  3DGQ A;  1GRX A;  1YZX A;  1M0U A;  1EOH A;  3D0Z A;  8GSS A;  2L57 A;  5B6N A;  1B4P A;  2FGX A;  1ZCP A;  3A2X A;  1TP9 A;  4QQ7 A;  1THX A;  2QGV A;  4EDZ A;  4V2M A;  4NHW A;  2IMF A;  2DIY A;  2JSZ A;  2GS3 A;  2L4Q A;  1A8Y A;  2VLV A;  4AF2 A;  2FNO A;  4G10 A;  4KSO A;  1TXX A;  4K0N A;  1G7O A;  3TKP A;  1MDJ A;  2GGT A;  4JE1 A;  2HFD A;  2LJA A;  1GSD A;  2L5O A;  1JZR A;  2VIM A;  2HT9 A;  1EV4 A;  1PSQ A;  5A4U A;  4ULX A;  3IDV A;  4GSS A;  4GXZ A;  3IAS 2;  1FVK A;  2FWG A;  4MZB A;  2B5Y A;  2GZZ A;  1Q4J A;  1HQO A;  4HUA A;  1GNW A;  1TKD B;  2WCI A;  2GDR A;  22GS A;  3ZIT A;  3RHC A;  4JR4 A;  5CYY A;  2H66 A;  2I1U A;  2XPE A;  4KB3 A;  3VLN A;  3HCZ A;  1RK4 A;  5CRW A;  3TJF A;  1LBK A;  2WS2 A;  2EC4 A;  4POB A;  2YWM A;  2PVO C;  4ZBA A;  1QXH A;  1AQX A;  2XBQ A;  3TKS E;  4MF6 A;  3ED3 A;  1M9A A;  1M7T A;  2MZC A;  1VGL A;  3L0H A;  2VL2 C;  2V41 A;  4ZL8 A;  4I97 A;  5ECK B;  1A2L A;  1SK2 A;  1U88 A;  1GSE A;  3TDG A;  4PNG A;  6GSX A;  4WR4 A;  2I9H A;  3WYW A;  4GSN A;  4WBR D;  4JR6 A;  1O85 A;  1X9M B;  3MAK A;  5EVO A;  2LRT A;  1USB A;  4ZBB A;  2C0F A;  1TOF A;  1KBN A;  3Q74 A;  3ERF A;  4MLY A;  1VF4 A;  4WEY A;  3LGC A;  2LS5 A;  4BVY A;  4V2L A;  2YWI A;  4TXO B;  3UJ1 A;  1T7P B;  3QCP A;  3LQ7 A;  4IHU A;  3UVH A;  3WGX A;  3O3T A;  4PX1 A;  2H0G A;  1FB0 A;  2YP6 A;  3NIV A;  5IMZ A;  2K8V A;  5KN2 A;  17GS A;  4Q5Q A;  3D4T A;  2HZE A; 
#chains in the Genus database with same CATH topology
 2C3Q A;  3Q6O A;  1XFL A;  1HNA A;  5CP1 A;  2NBS A;  1W89 A;  3EWL A;  3RPP A;  4KA0 A;  1FOV A;  5DAK B;  4K5R A;  2ZNM A;  1GUK A;  1H4O A;  1QK8 A;  4TVE A;  2DJ0 A;  3VWW A;  1R5P A;  2WJU A;  1TI1 A;  1XOA A;  1WP0 A;  2JSY A;  3MYD A;  4MH3 A;  2BMX A;  3A2W A;  5IMV A;  2DSA A;  3UBK A;  2IME A;  2B7K A;  5ECI B;  6GSW A;  1SJ6 A;  3CSI A;  3LSZ A;  2FCH A;  3RHB A;  2IMI A;  3HZ4 A;  2V2G A;  3F0I A;  1AUC A;  4JZQ A;  4K5S A;  1X9S B;  1YF0 A;  1Z7P A;  3VI5 A;  4PUA A;  3EC3 A;  4X43 A;  1A8L A;  3WD6 A;  4V2N A;  1SD9 A;  1QMV A;  1BJX A;  5JWR B;  1H75 A;  2HRA A;  1GSU A;  1A0F A;  4HZ2 A;  1Z9H A;  2MBS A;  2EIR A;  1MDK A;  1MD3 A;  3G9B A;  4GST A;  3CMI A;  2YCD A;  2N5A A;  1PD2 1;  4X1U A;  1ILO A;  3IK9 A;  4OFT A;  3IC4 A;  3GL5 A;  4K1F A;  2MBT A;  4FYU A;  3HJM A;  1SKW B;  1XBS A;  5DDL A;  3TGZ A;  1U3I A;  2N5B A;  4NXI A;  2H1G A;  4KND A;  3IXR A;  5GSS A;  3PH9 A;  2HSY A;  5AIV A;  1FAA A;  2HE3 A;  2HSM A;  4N11 A;  4POM A;  1FHE A;  4IKH A;  3VPT A;  5ENU A;  5L71 A;  2MMZ A;  4FIW A;  1XCC A;  6GST A;  1F6M C;  1B9X C;  4O5R A;  4LL1 B;  3CSJ A;  4DSQ A;  3UEM A;  2GQL A;  1UC7 A;  4WKW A;  4MPF A;  3KCM A;  4PGT A;  3LOR A;  1V40 A;  2C0G A;  5B8B A;  1JHB A;  2YV9 A;  3GKK A;  3UL3 A;  1NW2 A;  4MCU A;  1ZYQ B;  5HR2 A;  4XS4 B;  3U6V A;  5GST A;  2DKI A;  4H86 A;  1O8X A;  1PFO A;  1G6Y A;  1ZYE A;  3A5W A;  4HQZ A;  2GQK A;  1YKC A;  3QAG A;  1AC1 A;  3E9J B;  1YY7 A;  2DIZ A;  4GQF A;  1SJZ A;  19GS A;  3KZQ A;  1KNG A;  4EIP A;  1O8W A;  5IOW A;  1R26 A;  2H6X A;  4JED A;  2H30 A;  2REM A;  4HZ4 A;  4BA7 A;  4BVX A;  2L5L A;  3PPU A;  1GTU A;  1TTZ A;  5G30 A;  1PN0 A;  1Z3E A;  1EOG A;  2H76 A;  3KM6 A;  1EP8 A;  5H5Q A;  3GH6 A;  1SL1 B;  3WGE A;  2IMK A;  2VLU A;  3I69 A;  4MF7 A;  3ISO A;  3KGK A;  4EIQ A;  1E2Y A;  3KD0 A;  5E59 A;  2LKU A;  1AIU A;  2OE3 A;  3A5I A;  3N5O A;  3FKF A;  3ZRD A;  4PNF A;  4O5Q A;  1HNB A;  2VUP A;  1U6T A;  3VWV A;  4MMM A;  3OR5 A;  5GAN D;  3LFL A;  3MWH A;  3H8Q A;  1TDI A;  5F07 A;  2L6C A;  3QD9 A;  5HR1 A;  3D21 A;  2GST A;  3WGD A;  5BMU A;  4PQH A;  4QL7 A;  3TRX A;  4G0I A;  3KXO A;  3UOM A;  2A2R A;  3HDC A;  1IYI A;  3M1G A;  1EWX A;  4WR5 A;  5CNW A;  4XS1 A;  2C0D A;  18GS A;  3QMX A;  4HJ2 A;  5G5E A;  2E2G A;  1I9D A;  3H79 A;  3PIN A;  1JZD A;  5A4W A;  1ZZY A;  4J57 E;  1XW6 A;  1RW1 A;  5COH A;  1GTB A;  1FW1 A;  2GVP A;  4AJ7 A;  1WPI A;  4TXO A;  1ML6 A;  5ELA A;  1PL2 A;  1T3B A;  2GSS A;  2PMT A;  3DML A;  1SK1 A;  5LD0 A;  2RII A;  4XRD A;  5CRE A;  3LXT A;  3ERW A;  2HRK A;  16GS A;  4DSR A;  2O7K A;  5ECO B;  1M99 A;  2V6O A;  5ECP B;  3J7Y b;  4KE3 A;  1TW9 A;  2ON7 A;  2QSI A;  4KUN A;  4RQX A;  2IWT A;  2P5Q A;  3FZA A;  1XVW A;  3IV4 A;  5D9T A;  2X49 A;  1OYJ A;  4IVF A;  5DAK A;  2EIQ A;  3F3R A;  1QQ2 A;  2H6Z A;  1ABA A;  1ST9 A;  4ZXG A;  3CBU A;  4Q5R A;  1QFN A;  3EMP A;  3C71 A;  3TRP A;  2F8A A;  4IN0 A;  2CX4 A;  3ERG A;  4TR1 A;  2OE1 A;  3IE3 A;  1X5D A;  2UZ8 A;  3ZLP A;  4AGS A;  3FEU A;  1SKR B;  2HRF A;  3R3E A;  3GST A;  5KN1 A;  5KN3 A;  5ECM B;  1JFU A;  4CW9 A;  2DC5 A;  2YV7 A;  3BCI A;  2CVK A;  4DEJ A;  3C73 A;  3P2A A;  3TB2 A;  1I5G A;  2WB9 A;  3HZ8 A;  4ML1 A;  1NSW A;  3N9J A;  4FQU A;  3QOU A;  3GL3 A;  5JWQ B;  3TJK A;  4O7H A;  2C8U A;  5CAX A;  2D2Z A;  2WZ9 A;  3IBH A;  1XWA A;  2C80 A;  1S3C A;  1TRU A;  2KOK A;  2AAW A;  4ZL7 A;  2MMA A;  4BPY A;  3IHG A;  3GSS A;  1BG5 A;  1EGO A;  1DBY A;  2LEG A;  2KP1 A;  1V2A A;  4MA9 A;  4IS0 A;  2IFQ A;  1Q98 A;  2VLT A;  3KP9 A;  3W8S A;  4EKZ A;  3GKM A;  2OBI A;  4GCI A;  2VM1 A;  1Z6M A;  4MJA A;  1ZYP A;  1ZOF A;  2HI7 A;  2HXK A;  2X64 A;  4KCE A;  4TXV A;  2A2S A;  3BBY A;  5C04 A;  1KEB A;  2FLS A;  1PMT A;  1M2D A;  3TKQ A;  14GS A;  4MZC A;  2KHP A;  2GT6 A;  2OAC A;  4NMU A;  2I3Y A;  1GL8 A;  1K3L A;  3D6I A;  2IIY A;  2TRX A;  2MMN A;  4N0V A;  5FHI A;  1GH2 A;  5KEJ A;  3DIE A;  3MNG A;  2A4V A;  2DJ1 A;  3BOA A;  2R0G A;  3IAM 2;  1BAY A;  3EIN A;  4EXJ A;  3KH7 A;  5EY6 A;  3P7X A;  5DAL A;  2M80 A;  2OAD A;  3TCO A;  1XVQ A;  1R5A A;  5D9V A;  3KTL A;  2IN3 A;  3IR4 A;  4F82 A;  2BTO T;  2LV3 A;  2H8L A;  4Z7X A;  3DVX A;  1FB6 A;  5IO2 A;  4IP1 A;  2LST A;  1JLW A;  2FWF A;  2H0H A;  4WF4 A;  1YJ6 A;  4XRA A;  1GUL A;  2JAC A;  3E0U A;  3I43 A;  1X5E A;  4ZIL A;  2B1K A;  2BJX A;  4QL9 A;  2C0E A;  4YKF A;  3VWU A;  3F8U A;  2DBC A;  1LU4 A;  5E4W A;  1T1V A;  5IQY A;  4OFN A;  4FH8 A;  4I2U A;  2AYT A;  3DD3 A;  1YQ1 A;  2VM2 A;  2GSR A;  1ZL9 A;  2J23 A;  3UAR A;  3KTB A;  5G5F A;  5ID2 B;  5CRD A;  2NVL A;  2P0G A;  1Z5Y E;  2CQ9 A;  4KAE A;  2FY6 A;  2DKH A;  3FK8 A;  3GX8 A;  3GIX A;  1AQV A;  2JZR A;  1B4Q A;  2LQQ A;  2H1B A;  3HVX A;  3DKS A;  3F4S A;  1TK8 B;  5GZZ B;  2LNT A;  5J4U A;  4GLT A;  5FWG A;  2X8G A;  3M3M A;  3GN3 A;  1A2J A;  1QUW A;  2YN1 A;  5DJL A;  2L59 A;  3LYP A;  4D73 B;  2YJ7 A;  2EIO A;  2B7J A;  4K0G A;  1TI3 A;  3GA4 A;  4DVC A;  5ECH B;  3APS A;  4DSS B;  3J7Y k;  1EGR A;  4KCA A;  4L0W A;  2FA4 A;  2KP2 A;  3JCM L;  3L4N A;  2H01 A;  3VWX A;  2OA7 A;  2K6V A;  3FZ9 A;  3HKR A;  4EUY A;  5A5K A;  2H0I A;  3FR3 A;  1G7E A;  2R2J A;  2QKE A;  1K3O A;  1EP7 A;  3W6G A;  4TN8 A;  2G0F A;  2JZT A;  6GSU A;  2NDO A;  1OC9 A;  3GTU A;  3GX0 A;  2ON5 A;  2PGT A;  2WUL A;  4IJ3 A;  5JWO B;  1OAZ A;  3GNJ A;  1SD8 A;  4GF0 A;  1V58 A;  2K8S A;  5CRG A;  3EVI A;  2ALB A;  1TK5 B;  3ZTL A;  4F03 A;  4K8M A;  3HA9 A;  2CVD A;  2X8H A;  4OO4 A;  2B3S A;  3KEB A;  1ERU A;  1TJD A;  1HNC A;  4Z2T A;  2FHE A;  1EZK A;  5D93 A;  3C1S A;  5B6M A;  4EDY A;  1GP1 A;  1F9M A;  4F0C A;  5HFG A;  1XW9 A;  11GS A;  2XHF A;  3BCK A;  4OO5 A;  4A5P A;  2VCT A;  2MMO A;  1X5C A;  1IYH A;  3F63 A;  1BX9 A;  1WJK A;  3VUR A;  3Q18 A;  2PN8 A;  4CDO A;  2H72 A;  4YQV A;  2AB6 A;  4YQU A;  3HJP A;  5CO3 A;  4G2E A;  4MH2 A;  3EYT A;  5F05 A;  1OVN A;  4CY6 A;  3C1R A;  4HJM A;  3KJY A;  3NOF A;  3ZL5 A;  4ECC A;  1CQH A;  5D8I A;  3FRC A;  3DVW A;  5G2Z A;  5IPG A;  4KGI A;  1EEJ A;  3BJ5 A;  1J0F A;  2J9H A;  4Z2U A;  4ZL9 A;  1SYR A;  2H75 A;  4EO3 A;  2DJK A;  3TOT A;  4ZBD A;  2H74 A;  1O7U A;  2AJQ B;  1XOB A;  2B6M A;  1VRS D;  4AJ6 A;  2E2M A;  4LMW A;  5JCU A;  1A24 A;  2K18 A;  2RUF A;  5HR3 A;  2LJK A;  1XPV A;  1HD2 A;  1XZO A;  2CT6 A;  1M9B A;  4LLR A;  1VF2 A;  3QFB C;  3GKX A;  4PTS A;  4V1A p;  5IPH A;  4IEL A;  2YZU A;  3MSZ A;  4XCS A;  5B8A A;  4NWY A;  3TOU A;  4OD7 A;  1DE2 A;  5IOX A;  2R4V A;  4I6X A;  5ECR B;  1N2A A;  3HYP A;  2A2P A;  1K0A A;  3GUS A;  1TRW A;  1UA5 A;  4RI6 A;  3L78 A;  1N8J A;  1VF1 A;  2F51 A;  3GRX A;  2GTU A;  5EPF A;  4NV5 A;  5G31 A;  4F0B A;  2PU9 C;  3A3T A;  2RLI A;  3G7J A;  1F3A A;  2VD0 A;  3O6T A;  1V57 A;  3HY2 A;  1F37 A;  4L5O A;  5DQY A;  3ME7 A;  1YKA A;  2YNX A;  1OKT A;  1T4Y A;  1THO A;  1PX7 A;  4FO5 A;  1K0C A;  1A0R P;  3HJO A;  5KN0 A;  4EE0 A;  3F4T A;  5B7C A;  5KOW A;  3TRQ A;  4AJ8 A;  1OE7 A;  3L9U A;  1PKW A;  3D22 A;  3IPZ A;  4J56 E;  3FYG A;  4IJI A;  4RQR A;  1K0N A;  2B5E A;  4ML6 A;  4YH2 A;  1AW9 A;  4ILF A;  4D73 A;  2PPT A;  3LYK A;  5G1K A;  4E8E A;  3F6D A;  3CXG A;  2VCV A;  2XPD A;  1PQN A;  1JZW A;  2H73 A;  3KMN A;  3DWV A;  4N10 A;  1EV9 A;  4DSS A;  2FD3 A;  1ZGN A;  1F3B A;  4ECJ A;  3QAW A;  1B8X A;  3H93 A;  3GFK A;  5DCG A;  4ISD A;  2HZF A;  1O6J A;  1FG4 A;  1B48 A;  1GLP A;  3PR8 A;  2WRT A;  1M2B A;  3F4R A;  5ECL B;  1MEK A;  3ZIJ A;  4O92 A;  3HD5 A;  2X99 A;  4I2T A;  4Q5N A;  2JU5 A;  3F9U A;  5AIX A;  4MP4 A;  4FYB A;  4J2F A;  4NAX A;  3AY8 A;  3M0F A;  2AHE A;  4K7I A;  1SJI A;  1SEN A;  5CRH A;  1PA3 A;  3US3 A;  2NTO A;  2QC7 A;  2P5R A;  3GHA A;  4IQA A;  4ACS A;  3CYN A;  3LEF A;  3ZFL A;  3ZRE A;  4ZIJ A;  3HHV A;  2YWO A;  1AXD A;  3K8N A;  1DUG A;  1K0O A;  3EU4 A;  4GQC A;  3GV1 A;  4NV2 A;  2QA1 A;  1YF1 A;  1WOU A;  2GZY A;  3ZVJ D;  1GSF A;  3HVN A;  1PL1 A;  5INY A;  5AGY A;  1URM A;  3HVV A;  3E3E A;  2AV4 A;  2ZUP A;  2YJH A;  4KW6 A;  3KP8 A;  4K9Z A;  2M46 A;  1Y25 A;  3RPN A;  1M2A A;  4I8B A;  4LL4 B;  1G0T A;  4K2X A;  2H19 A;  3M9K A;  4TR3 A;  3UIW A;  1HYU A;  4V1A g;  1M3J A;  4ICY A;  4G9H A;  2CAI A;  5HQP A;  2VCX A;  4FYC A;  1WRY A;  2YZH A;  3KMO A;  4HQS A;  1MTC A;  5HR0 A;  2H1D A;  5ABR A;  2GSQ A;  2JZS A;  3CTG A;  4MAB A;  4EVM A;  1OE8 A;  4OCE A;  4JBB A;  5DBQ A;  1CQG A;  4MJB A;  3I6A A;  4MDC A;  4I5Q A;  5G1L A;  4K6X A;  3P90 A;  2C3N A;  3ME8 A;  3SWL A;  4BL7 B;  2HYX A;  3APQ A;  2R3X A;  5ECQ B;  3S9F A;  5JCW A;  1R4W A;  2G2Q A;  4XHM A;  1ZMA A;  4XS4 A;  1GTA A;  4EF0 A;  3IRA A;  4L0U A;  1GUM A;  4O5U A;  1OC3 A;  5J9C A;  5J5N A;  1T00 A;  5DVB A;  4K7O A;  5EL8 A;  2LNS A;  2ES7 A;  3GKN A;  4KX4 A;  5F0G A;  1SL0 B;  2A4H A;  3BD2 A;  3M9J A;  5IMF A;  1SK0 A;  2AUV A;  1WMJ A;  4MPG A;  3UMA A;  4BVX B;  1W4V A;  3CRU A;  3NZN A;  1UN2 A;  2VL2 A;  3H1N A;  2OKA A;  2VAF A;  3QPM A;  5AIS A;  1XIY A;  4HEA 2;  5IMC A;  4TW5 A;  9GSS A;  2FWE A;  2VOC A;  1KTE A;  1K0D A;  1SL2 B;  2MYG A;  3FW2 A;  1J08 A;  2E0Q A;  2LJR A;  3APO A;  4YAV A;  5FT3 A;  3F3Q A;  2PVQ A;  3U5R E;  3FR6 A;  2XBI A;  3EUR A;  3LJR A;  1OKD A;  3QFA C;  2VCZ A;  2GLR A;  3RAZ A;  3V1W A;  12GS A;  2GZP A;  4IBP A;  4O32 A;  4OFM A;  5BRT A;  1XG8 A;  3TKS A;  3VPQ A;  4MJC A;  2FUG 2;  1YEP A;  1NHO A;  2TIR A;  4JRR A;  1GSS A;  1WWJ A;  4L5L A;  4KSM A;  2YAN A;  3TJB A;  4N0Z A;  4XS6 A;  3VFI A;  2OJL A;  1U87 A;  2JAD A;  3TKS C;  1K0B A;  3ZML A;  1ERV A;  3D4M A;  1K0M A;  2V32 A;  4K7N A;  5IO0 A;  1XWK A;  2O87 A;  1PKZ A;  4GTU A;  1R7H A;  4USS A;  2KUC A;  2FWH A;  3ZFB A;  1OC8 A;  1S3A A;  1BQ7 A;  2CV4 A;  3ZZX A;  1K3Y A;  3HVS A;  1ON4 A;  4KDY A;  5D9W A;  1BED A;  1LJR A;  3ZIV A;  5JCG A;  4TRX A;  1RQM A;  2X8C A;  1NHY A;  2B5X A;  2LQO A;  2WGR A;  3TKR A;  1U3A A;  4LA1 A;  1S3D A;  4RI7 A;  2H1A A;  4TR1 B;  5H5S A;  1DSB A;  3IA1 A;  5J9B A;  6GSY A;  1AQW A;  4NPB A;  3TJG A;  3MDK A;  4G19 A;  4X0X A;  5J41 A;  20GS A;  4E8H A;  2P31 A;  4PUF C;  3FMW A;  2CZ3 A;  2LTK A;  1XXU A;  1TRV A;  3IK7 A;  4PQI A;  1T4Z A;  2LUS A;  4HU7 A;  1PRX A;  5LCZ A;  2TRC P;  4BWQ A;  1JZO A;  1PX6 A;  1YDK A;  2IJY A;  4EL1 A;  1XWB A;  4G0K A;  3LWA A;  4MK3 A;  5H5R A;  4HDE A;  4TR4 A;  3FZ5 A;  4PXO A;  2I4A A;  4F9Z A;  2Z9S A;  5C00 A;  1C72 A;  2FA8 A;  3RBT A;  2L4C A;  4EC0 A;  3F6F A;  2IPA A;  1T8E B;  1UVZ A;  1JLV A;  3G7I A;  2CZ2 A;  4GRF A;  2IFQ B;  3FZ4 A;  2VL9 A;  1V9W A;  2DJ3 A;  1SKS B;  3EMX A;  3I9V 2;  3DEX A;  2XC2 A;  4MJE A;  2X4A A;  1TU7 A;  3UAP A;  1J9B A;  1GWC A;  3DYR A;  2QA2 A;  2B1L A;  2VD1 A;  2DML A;  5IMD A;  1MD4 A;  4WET A;  2WDU A;  4BL7 A;  4NHZ A;  3UBL A;  3D5J A;  2IMD A;  2CVB A;  3H4K A;  4HS1 A;  1M3I A;  2N5F A;  4KDU A;  3SBC A;  4IP6 A;  3LXZ A;  3PGT A;  1VF3 A;  4HU9 A;  13GS A;  4L8E A;  1X9W B;  5DAL B;  5ELG A;  6GSV A;  2PWJ A;  1ERW A;  3L9V A;  2CAQ A;  4YAP A;  2I81 A;  2YPM A;  1XWG A;  4TOP A;  3GUR A;  3EPT A;  4CHS A;  5J3R A;  1YEX A;  2DMM A;  4N30 A;  1XWC A;  3CRT A;  4ZB9 A;  5DQS A;  3P8W A;  5HFK A;  2F8F A;  2CX3 A;  2HLS A;  2M72 A;  4WF5 A;  7GSS A;  2DLX A;  4HI7 A;  5HFI A;  3Q19 A;  2KLX A;  2R5G A;  2IL3 A;  4IGJ A;  1QGV A;  3CSH A;  2F3M A;  2C3T A;  1X0R A;  2H71 A;  2VL3 A;  3L9S A;  2LRN A;  1A23 A;  3C7M A;  2GT5 A;  3FHK A;  3DXB A;  2V6K A;  3GYK A;  4XIH A;  5A4V A;  2RM5 A;  4YQM A;  3QDN A;  1TRS A;  2PBJ A;  4MZW A;  3O76 A;  4ECI A;  1SU9 A;  3KIJ A;  5ID2 A;  2HRN A;  4F2I A;  1WIK A;  3VK9 A;  2O8V B;  5DCH A;  2WFC A;  4PUR A;  3LG6 A;  4ZB8 A;  2HSH A;  4BVY B;  1SYX A;  1DE1 A;  3UVT A;  5LNK e;  1O81 A;  3TUE A;  2JL4 A;  1GSQ A;  4IQ1 A;  3IOS A;  3KH9 A;  1F2E A;  2K9F A;  1O73 A;  3GH9 A;  2O85 A;  4POL A;  3CTF A;  4WBJ A;  2R6K A;  4X4J A;  3DRN A;  2PER A;  4P3Y B;  1FOH A;  4RUV A;  5D73 A;  2HZE B;  3FY7 A;  3TJJ A;  1GNE A;  4POK A;  2C1Y A;  1Y6E A;  4IW9 A;  2H6Y A;  4KDX A;  4PQ1 A;  3CQF A;  3W8J A;  2RM6 A;  1G6W A;  4HOJ A;  2DJ2 A;  3WT2 A;  1GTI A;  4OWY A;  4ID0 A;  3A2V A;  2YOI A;  2OBK A;  1ACV A;  2CA8 A;  4BIK A;  1GSY A;  1XW5 A;  3R2Q A;  5D96 A;  4ECB A;  1V98 A;  5AN1 A;  3EU3 A;  5ECN B;  2DJJ A;  2LRC A;  1GUH A;  1GLQ A;  3EE2 A;  3ZYW A;  1MDI A;  1BYE A;  3QR6 A;  3IC8 A;  5ECS A;  1S3R A;  2R0C A;  1TK0 B;  2VCW A;  6GSS A;  5F8B A;  2R0P A;  2ZCT A;  5KOX A;  2OE0 A;  1E6B A;  1OC9 B;  2F9S A;  2R37 A;  3GTU B;  4MNN A;  3WT1 A;  4JU5 A;  4BWS A;  5IM9 A;  1ZYN A;  2V1M A;  5IMA A;  1B9Y C;  2YWN A;  4KH7 A;  4CY8 A;  4ZB6 A;  5F06 A;  3ZMK A;  4OMV A;  1FVJ A;  1PGT A;  4OCF A;  1PN9 A;  3HXS A;  1NM3 A;  1Z7R A;  3M8N A;  3G7Y A;  10GS A;  1Z6N A;  3IHQ A;  5GAP D;  4WXT A;  1WE0 A;  5DJM A;  2HNL A;  2O89 A;  3VI7 A;  4TKY A;  4TR0 A;  2PUK C;  3QAV A;  2VCQ A;  2RUE A;  4LMV A;  3ZVJ A;  2GQM A;  2H70 A;  4Q5F A;  2VO4 A;  4MF5 A;  2L6D A;  1TU8 A;  2C4J A;  5IIZ A;  1FO5 A;  1AAZ A;  1EEM A;  4GWR A;  3RDW A;  1A2M A;  1ERT A;  4XTS A;  3GMF A;  4K2D A;  2E7P A;  4G0L A;  5D9X A;  2NPB A;  3FR9 A;  3C8E A;  3DGQ A;  1GRX A;  1YZX A;  1M0U A;  1EOH A;  3D0Z A;  8GSS A;  2L57 A;  5B6N A;  1B4P A;  2FGX A;  1ZCP A;  3A2X A;  1TP9 A;  4QQ7 A;  1THX A;  2QGV A;  4EDZ A;  4V2M A;  4NHW A;  2IMF A;  2DIY A;  2JSZ A;  2GS3 A;  2L4Q A;  1A8Y A;  2VLV A;  4HSC X;  4AF2 A;  2FNO A;  4G10 A;  4KSO A;  1TXX A;  4K0N A;  1G7O A;  3TKP A;  1MDJ A;  2GGT A;  4JE1 A;  2HFD A;  2LJA A;  1GSD A;  2L5O A;  1JZR A;  2VIM A;  2HT9 A;  1EV4 A;  1PSQ A;  5A4U A;  4ULX A;  3IDV A;  4GSS A;  4GXZ A;  3IAS 2;  1FVK A;  2FWG A;  4MZB A;  2B5Y A;  2GZZ A;  1Q4J A;  1HQO A;  4HUA A;  1GNW A;  1TKD B;  2WCI A;  2GDR A;  22GS A;  3ZIT A;  3RHC A;  4JR4 A;  5CYY A;  2H66 A;  2I1U A;  2XPE A;  4KB3 A;  3VLN A;  3HCZ A;  1RK4 A;  5CRW A;  3TJF A;  1LBK A;  2WS2 A;  2EC4 A;  4POB A;  2YWM A;  2PVO C;  4ZBA A;  3LW9 A;  1QXH A;  1AQX A;  2XBQ A;  3TKS E;  4MF6 A;  3ED3 A;  1M9A A;  1M7T A;  2MZC A;  1VGL A;  3L0H A;  2VL2 C;  2V41 A;  4ZL8 A;  4I97 A;  5ECK B;  1A2L A;  1SK2 A;  1U88 A;  1GSE A;  3TDG A;  4PNG A;  6GSX A;  4WR4 A;  2I9H A;  3WYW A;  4GSN A;  4WBR D;  4JR6 A;  1O85 A;  1X9M B;  3MAK A;  5EVO A;  4YKG A;  2LRT A;  1USB A;  4ZBB A;  2C0F A;  1TOF A;  1KBN A;  3Q74 A;  3ERF A;  4MLY A;  1VF4 A;  4WEY A;  3LGC A;  2LS5 A;  4BVY A;  4V2L A;  2YWI A;  4TXO B;  3UJ1 A;  1T7P B;  4KF9 A;  3QCP A;  3LQ7 A;  4IHU A;  3UVH A;  3MIX A;  3WGX A;  4Z2R A;  3O3T A;  4PX1 A;  2H0G A;  1FB0 A;  2YP6 A;  3NIV A;  5IMZ A;  2K8V A;  5KN2 A;  17GS A;  4Q5Q A;  3D4T A;  2HZE A; 
#chains in the Genus database with same CATH homology
 2C3Q A;  3Q6O A;  1XFL A;  1HNA A;  5CP1 A;  2NBS A;  1W89 A;  3EWL A;  3RPP A;  4KA0 A;  1FOV A;  5DAK B;  4K5R A;  2ZNM A;  1GUK A;  1H4O A;  1QK8 A;  4TVE A;  2DJ0 A;  3VWW A;  1R5P A;  2WJU A;  1TI1 A;  1XOA A;  1WP0 A;  2JSY A;  3MYD A;  4MH3 A;  2BMX A;  3A2W A;  5IMV A;  2DSA A;  3UBK A;  2IME A;  2B7K A;  5ECI B;  6GSW A;  1SJ6 A;  3CSI A;  3LSZ A;  2FCH A;  3RHB A;  2IMI A;  3HZ4 A;  2V2G A;  3F0I A;  1AUC A;  4JZQ A;  4K5S A;  1X9S B;  1YF0 A;  1Z7P A;  3VI5 A;  4PUA A;  3EC3 A;  4X43 A;  1A8L A;  3WD6 A;  4V2N A;  1SD9 A;  1QMV A;  1BJX A;  5JWR B;  1H75 A;  2HRA A;  1GSU A;  1A0F A;  4HZ2 A;  1Z9H A;  2MBS A;  2EIR A;  1MDK A;  1MD3 A;  3G9B A;  4GST A;  3CMI A;  2YCD A;  2N5A A;  1PD2 1;  4X1U A;  1ILO A;  3IK9 A;  4OFT A;  3IC4 A;  3GL5 A;  4K1F A;  2MBT A;  4FYU A;  3HJM A;  1SKW B;  1XBS A;  5DDL A;  3TGZ A;  1U3I A;  2N5B A;  4NXI A;  2H1G A;  4KND A;  3IXR A;  5GSS A;  3PH9 A;  2HSY A;  5AIV A;  1FAA A;  2HE3 A;  2HSM A;  4N11 A;  4POM A;  1FHE A;  4IKH A;  3VPT A;  5ENU A;  5L71 A;  2MMZ A;  4FIW A;  1XCC A;  6GST A;  1F6M C;  1B9X C;  4O5R A;  4LL1 B;  3CSJ A;  4DSQ A;  3UEM A;  2GQL A;  1UC7 A;  4WKW A;  4MPF A;  3KCM A;  4PGT A;  3LOR A;  1V40 A;  2C0G A;  5B8B A;  1JHB A;  2YV9 A;  3GKK A;  3UL3 A;  1NW2 A;  4MCU A;  1ZYQ B;  5HR2 A;  4XS4 B;  3U6V A;  5GST A;  2DKI A;  4H86 A;  1O8X A;  1G6Y A;  1ZYE A;  3A5W A;  4HQZ A;  2GQK A;  1YKC A;  3QAG A;  1AC1 A;  3E9J B;  1YY7 A;  2DIZ A;  4GQF A;  1SJZ A;  19GS A;  3KZQ A;  1KNG A;  4EIP A;  1O8W A;  5IOW A;  1R26 A;  2H6X A;  4JED A;  2H30 A;  2REM A;  4HZ4 A;  4BA7 A;  4BVX A;  2L5L A;  3PPU A;  1GTU A;  1TTZ A;  5G30 A;  1PN0 A;  1Z3E A;  1EOG A;  2H76 A;  3KM6 A;  1EP8 A;  5H5Q A;  3GH6 A;  1SL1 B;  3WGE A;  2IMK A;  2VLU A;  3I69 A;  4MF7 A;  3ISO A;  3KGK A;  4EIQ A;  1E2Y A;  3KD0 A;  5E59 A;  2LKU A;  1AIU A;  2OE3 A;  3A5I A;  3N5O A;  3FKF A;  3ZRD A;  4PNF A;  4O5Q A;  1HNB A;  2VUP A;  1U6T A;  3VWV A;  4MMM A;  3OR5 A;  5GAN D;  3LFL A;  3MWH A;  3H8Q A;  1TDI A;  5F07 A;  2L6C A;  3QD9 A;  5HR1 A;  3D21 A;  2GST A;  3WGD A;  5BMU A;  4PQH A;  4QL7 A;  3TRX A;  4G0I A;  3KXO A;  3UOM A;  2A2R A;  3HDC A;  1IYI A;  3M1G A;  1EWX A;  4WR5 A;  5CNW A;  4XS1 A;  2C0D A;  18GS A;  3QMX A;  4HJ2 A;  5G5E A;  2E2G A;  1I9D A;  3H79 A;  3PIN A;  1JZD A;  5A4W A;  1ZZY A;  4J57 E;  1XW6 A;  1RW1 A;  5COH A;  1GTB A;  1FW1 A;  2GVP A;  4AJ7 A;  1WPI A;  4TXO A;  1ML6 A;  5ELA A;  1PL2 A;  1T3B A;  2GSS A;  2PMT A;  3DML A;  1SK1 A;  5LD0 A;  2RII A;  4XRD A;  5CRE A;  3LXT A;  3ERW A;  2HRK A;  16GS A;  4DSR A;  2O7K A;  5ECO B;  1M99 A;  2V6O A;  5ECP B;  3J7Y b;  4KE3 A;  1TW9 A;  2ON7 A;  2QSI A;  4KUN A;  4RQX A;  2IWT A;  2P5Q A;  3FZA A;  1XVW A;  3IV4 A;  5D9T A;  2X49 A;  1OYJ A;  4IVF A;  5DAK A;  2EIQ A;  3F3R A;  1QQ2 A;  2H6Z A;  1ABA A;  1ST9 A;  4ZXG A;  3CBU A;  4Q5R A;  1QFN A;  3EMP A;  3C71 A;  3TRP A;  2F8A A;  4IN0 A;  2CX4 A;  3ERG A;  4TR1 A;  2OE1 A;  3IE3 A;  1X5D A;  2UZ8 A;  3ZLP A;  4AGS A;  3FEU A;  1SKR B;  2HRF A;  3R3E A;  3GST A;  5KN1 A;  5KN3 A;  5ECM B;  1JFU A;  4CW9 A;  2DC5 A;  2YV7 A;  3BCI A;  2CVK A;  4DEJ A;  3C73 A;  3P2A A;  3TB2 A;  1I5G A;  2WB9 A;  3HZ8 A;  4ML1 A;  1NSW A;  3N9J A;  4FQU A;  3QOU A;  3GL3 A;  5JWQ B;  3TJK A;  4O7H A;  2C8U A;  5CAX A;  2D2Z A;  2WZ9 A;  3IBH A;  1XWA A;  2C80 A;  1S3C A;  1TRU A;  2KOK A;  2AAW A;  4ZL7 A;  2MMA A;  4BPY A;  3IHG A;  3GSS A;  1BG5 A;  1EGO A;  1DBY A;  2LEG A;  2KP1 A;  1V2A A;  4MA9 A;  4IS0 A;  2IFQ A;  1Q98 A;  2VLT A;  3KP9 A;  3W8S A;  4EKZ A;  3GKM A;  2OBI A;  4GCI A;  2VM1 A;  1Z6M A;  4MJA A;  1ZYP A;  1ZOF A;  2HI7 A;  2HXK A;  2X64 A;  4KCE A;  4TXV A;  2A2S A;  3BBY A;  5C04 A;  1KEB A;  2FLS A;  1PMT A;  1M2D A;  3TKQ A;  14GS A;  4MZC A;  2KHP A;  2GT6 A;  2OAC A;  4NMU A;  2I3Y A;  1GL8 A;  1K3L A;  3D6I A;  2IIY A;  2TRX A;  2MMN A;  4N0V A;  5FHI A;  1GH2 A;  5KEJ A;  3DIE A;  3MNG A;  2A4V A;  2DJ1 A;  3BOA A;  2R0G A;  3IAM 2;  1BAY A;  3EIN A;  4EXJ A;  3KH7 A;  5EY6 A;  3P7X A;  5DAL A;  2M80 A;  2OAD A;  3TCO A;  1XVQ A;  1R5A A;  5D9V A;  3KTL A;  2IN3 A;  3IR4 A;  4F82 A;  2BTO T;  2LV3 A;  2H8L A;  4Z7X A;  3DVX A;  1FB6 A;  5IO2 A;  4IP1 A;  2LST A;  1JLW A;  2FWF A;  2H0H A;  4WF4 A;  1YJ6 A;  4XRA A;  1GUL A;  2JAC A;  3E0U A;  3I43 A;  1X5E A;  4ZIL A;  2B1K A;  2BJX A;  4QL9 A;  2C0E A;  4YKF A;  3VWU A;  3F8U A;  2DBC A;  1LU4 A;  5E4W A;  1T1V A;  5IQY A;  4OFN A;  4FH8 A;  4I2U A;  2AYT A;  3DD3 A;  1YQ1 A;  2VM2 A;  2GSR A;  1ZL9 A;  2J23 A;  3UAR A;  3KTB A;  5G5F A;  5ID2 B;  5CRD A;  2NVL A;  2P0G A;  1Z5Y E;  2CQ9 A;  4KAE A;  2FY6 A;  2DKH A;  3FK8 A;  3GX8 A;  3GIX A;  1AQV A;  2JZR A;  1B4Q A;  2LQQ A;  2H1B A;  3HVX A;  3DKS A;  3F4S A;  1TK8 B;  5GZZ B;  2LNT A;  5J4U A;  4GLT A;  5FWG A;  2X8G A;  3M3M A;  3GN3 A;  1A2J A;  1QUW A;  2YN1 A;  5DJL A;  2L59 A;  3LYP A;  4D73 B;  2YJ7 A;  2EIO A;  2B7J A;  4K0G A;  1TI3 A;  3GA4 A;  4DVC A;  5ECH B;  3APS A;  4DSS B;  3J7Y k;  1EGR A;  4KCA A;  4L0W A;  2FA4 A;  2KP2 A;  3JCM L;  3L4N A;  2H01 A;  3VWX A;  2OA7 A;  2K6V A;  3FZ9 A;  3HKR A;  4EUY A;  5A5K A;  2H0I A;  3FR3 A;  1G7E A;  2R2J A;  2QKE A;  1K3O A;  1EP7 A;  3W6G A;  4TN8 A;  2G0F A;  2JZT A;  6GSU A;  2NDO A;  1OC9 A;  3GTU A;  3GX0 A;  2ON5 A;  2PGT A;  2WUL A;  4IJ3 A;  5JWO B;  1OAZ A;  3GNJ A;  1SD8 A;  4GF0 A;  1V58 A;  2K8S A;  5CRG A;  3EVI A;  2ALB A;  1TK5 B;  3ZTL A;  4F03 A;  4K8M A;  3HA9 A;  2CVD A;  2X8H A;  4OO4 A;  2B3S A;  3KEB A;  1ERU A;  1TJD A;  1HNC A;  4Z2T A;  2FHE A;  1EZK A;  5D93 A;  3C1S A;  5B6M A;  4EDY A;  1GP1 A;  1F9M A;  4F0C A;  5HFG A;  1XW9 A;  11GS A;  2XHF A;  3BCK A;  4OO5 A;  4A5P A;  2VCT A;  2MMO A;  1X5C A;  1IYH A;  3F63 A;  1BX9 A;  1WJK A;  3VUR A;  3Q18 A;  2PN8 A;  4CDO A;  2H72 A;  4YQV A;  2AB6 A;  4YQU A;  3HJP A;  5CO3 A;  4G2E A;  4MH2 A;  3EYT A;  5F05 A;  1OVN A;  4CY6 A;  3C1R A;  4HJM A;  3KJY A;  3NOF A;  3ZL5 A;  4ECC A;  1CQH A;  5D8I A;  3FRC A;  3DVW A;  5G2Z A;  5IPG A;  4KGI A;  1EEJ A;  3BJ5 A;  1J0F A;  2J9H A;  4Z2U A;  4ZL9 A;  1SYR A;  2H75 A;  4EO3 A;  2DJK A;  3TOT A;  4ZBD A;  2H74 A;  1O7U A;  2AJQ B;  1XOB A;  2B6M A;  1VRS D;  4AJ6 A;  2E2M A;  4LMW A;  5JCU A;  1A24 A;  2K18 A;  2RUF A;  5HR3 A;  2LJK A;  1XPV A;  1HD2 A;  1XZO A;  2CT6 A;  1M9B A;  4LLR A;  1VF2 A;  3QFB C;  3GKX A;  4PTS A;  4V1A p;  5IPH A;  4IEL A;  2YZU A;  3MSZ A;  4XCS A;  5B8A A;  4NWY A;  3TOU A;  4OD7 A;  1DE2 A;  5IOX A;  2R4V A;  4I6X A;  5ECR B;  1N2A A;  3HYP A;  2A2P A;  1K0A A;  3GUS A;  1TRW A;  1UA5 A;  4RI6 A;  3L78 A;  1N8J A;  1VF1 A;  2F51 A;  3GRX A;  2GTU A;  5EPF A;  4NV5 A;  5G31 A;  4F0B A;  2PU9 C;  3A3T A;  2RLI A;  3G7J A;  1F3A A;  2VD0 A;  3O6T A;  1V57 A;  3HY2 A;  1F37 A;  4L5O A;  5DQY A;  3ME7 A;  1YKA A;  2YNX A;  1OKT A;  1T4Y A;  1THO A;  1PX7 A;  4FO5 A;  1K0C A;  1A0R P;  3HJO A;  5KN0 A;  4EE0 A;  3F4T A;  5B7C A;  5KOW A;  3TRQ A;  4AJ8 A;  1OE7 A;  3L9U A;  1PKW A;  3D22 A;  3IPZ A;  4J56 E;  3FYG A;  4IJI A;  4RQR A;  1K0N A;  2B5E A;  4ML6 A;  4YH2 A;  1AW9 A;  4ILF A;  4D73 A;  2PPT A;  3LYK A;  5G1K A;  4E8E A;  3F6D A;  3CXG A;  2VCV A;  2XPD A;  1PQN A;  1JZW A;  2H73 A;  3KMN A;  3DWV A;  4N10 A;  1EV9 A;  4DSS A;  2FD3 A;  1ZGN A;  1F3B A;  4ECJ A;  3QAW A;  1B8X A;  3H93 A;  3GFK A;  5DCG A;  4ISD A;  2HZF A;  1O6J A;  1FG4 A;  1B48 A;  1GLP A;  3PR8 A;  2WRT A;  1M2B A;  3F4R A;  5ECL B;  1MEK A;  3ZIJ A;  4O92 A;  3HD5 A;  2X99 A;  4I2T A;  4Q5N A;  2JU5 A;  3F9U A;  5AIX A;  4MP4 A;  4FYB A;  4J2F A;  4NAX A;  3AY8 A;  3M0F A;  2AHE A;  4K7I A;  1SJI A;  1SEN A;  5CRH A;  1PA3 A;  3US3 A;  2NTO A;  2QC7 A;  2P5R A;  3GHA A;  4IQA A;  4ACS A;  3CYN A;  3LEF A;  3ZFL A;  3ZRE A;  4ZIJ A;  3HHV A;  2YWO A;  1AXD A;  3K8N A;  1DUG A;  1K0O A;  3EU4 A;  4GQC A;  3GV1 A;  4NV2 A;  2QA1 A;  1YF1 A;  1WOU A;  2GZY A;  3ZVJ D;  1GSF A;  1PL1 A;  5INY A;  5AGY A;  1URM A;  3HVV A;  3E3E A;  2AV4 A;  2ZUP A;  2YJH A;  4KW6 A;  3KP8 A;  4K9Z A;  2M46 A;  1Y25 A;  3RPN A;  1M2A A;  4I8B A;  4LL4 B;  1G0T A;  4K2X A;  2H19 A;  3M9K A;  4TR3 A;  3UIW A;  1HYU A;  4V1A g;  4ICY A;  4G9H A;  2CAI A;  5HQP A;  2VCX A;  4FYC A;  1WRY A;  2YZH A;  3KMO A;  4HQS A;  1MTC A;  5HR0 A;  2H1D A;  5ABR A;  2GSQ A;  2JZS A;  3CTG A;  4MAB A;  4EVM A;  1OE8 A;  4OCE A;  4JBB A;  5DBQ A;  1CQG A;  4MJB A;  3I6A A;  4MDC A;  4I5Q A;  5G1L A;  4K6X A;  3P90 A;  2C3N A;  3ME8 A;  3SWL A;  4BL7 B;  2HYX A;  3APQ A;  2R3X A;  5ECQ B;  3S9F A;  5JCW A;  1R4W A;  2G2Q A;  4XHM A;  1ZMA A;  4XS4 A;  1GTA A;  4EF0 A;  3IRA A;  4L0U A;  1GUM A;  4O5U A;  1OC3 A;  5J9C A;  5J5N A;  1T00 A;  5DVB A;  4K7O A;  5EL8 A;  2LNS A;  2ES7 A;  3GKN A;  4KX4 A;  5F0G A;  1SL0 B;  2A4H A;  3BD2 A;  3M9J A;  5IMF A;  1SK0 A;  2AUV A;  1WMJ A;  4MPG A;  3UMA A;  4BVX B;  1W4V A;  3CRU A;  3NZN A;  1UN2 A;  2VL2 A;  3H1N A;  2OKA A;  2VAF A;  3QPM A;  5AIS A;  1XIY A;  4HEA 2;  5IMC A;  4TW5 A;  9GSS A;  2FWE A;  2VOC A;  1KTE A;  1K0D A;  1SL2 B;  2MYG A;  3FW2 A;  1J08 A;  2E0Q A;  2LJR A;  3APO A;  4YAV A;  5FT3 A;  3F3Q A;  2PVQ A;  3U5R E;  3FR6 A;  2XBI A;  3EUR A;  3LJR A;  1OKD A;  3QFA C;  2VCZ A;  2GLR A;  3RAZ A;  3V1W A;  12GS A;  2GZP A;  4IBP A;  4O32 A;  4OFM A;  5BRT A;  3TKS A;  3VPQ A;  4MJC A;  2FUG 2;  1YEP A;  1NHO A;  2TIR A;  4JRR A;  1GSS A;  1WWJ A;  4L5L A;  4KSM A;  2YAN A;  3TJB A;  4N0Z A;  4XS6 A;  3VFI A;  2OJL A;  1U87 A;  2JAD A;  3TKS C;  1K0B A;  3ZML A;  1ERV A;  3D4M A;  1K0M A;  2V32 A;  4K7N A;  5IO0 A;  1XWK A;  2O87 A;  1PKZ A;  4GTU A;  1R7H A;  4USS A;  2KUC A;  2FWH A;  3ZFB A;  1OC8 A;  1S3A A;  1BQ7 A;  2CV4 A;  3ZZX A;  1K3Y A;  3HVS A;  1ON4 A;  4KDY A;  5D9W A;  1BED A;  1LJR A;  3ZIV A;  5JCG A;  4TRX A;  1RQM A;  2X8C A;  1NHY A;  2B5X A;  2LQO A;  2WGR A;  3TKR A;  1U3A A;  4LA1 A;  1S3D A;  4RI7 A;  2H1A A;  4TR1 B;  5H5S A;  1DSB A;  3IA1 A;  5J9B A;  6GSY A;  1AQW A;  4NPB A;  3TJG A;  3MDK A;  4G19 A;  4X0X A;  5J41 A;  20GS A;  4E8H A;  2P31 A;  4PUF C;  3FMW A;  2CZ3 A;  2LTK A;  1XXU A;  1TRV A;  3IK7 A;  4PQI A;  1T4Z A;  2LUS A;  4HU7 A;  1PRX A;  5LCZ A;  2TRC P;  4BWQ A;  1JZO A;  1PX6 A;  1YDK A;  2IJY A;  4EL1 A;  1XWB A;  4G0K A;  3LWA A;  4MK3 A;  5H5R A;  4HDE A;  4TR4 A;  3FZ5 A;  4PXO A;  2I4A A;  4F9Z A;  2Z9S A;  5C00 A;  1C72 A;  2FA8 A;  3RBT A;  2L4C A;  4EC0 A;  3F6F A;  2IPA A;  1T8E B;  1UVZ A;  1JLV A;  3G7I A;  2CZ2 A;  4GRF A;  2IFQ B;  3FZ4 A;  2VL9 A;  1V9W A;  2DJ3 A;  1SKS B;  3EMX A;  3I9V 2;  3DEX A;  2XC2 A;  4MJE A;  2X4A A;  1TU7 A;  3UAP A;  1J9B A;  1GWC A;  3DYR A;  2QA2 A;  2B1L A;  2VD1 A;  2DML A;  5IMD A;  1MD4 A;  4WET A;  2WDU A;  4BL7 A;  4NHZ A;  3UBL A;  3D5J A;  2IMD A;  2CVB A;  3H4K A;  4HS1 A;  2N5F A;  4KDU A;  3SBC A;  4IP6 A;  3LXZ A;  3PGT A;  1VF3 A;  4HU9 A;  13GS A;  4L8E A;  1X9W B;  5DAL B;  5ELG A;  6GSV A;  2PWJ A;  1ERW A;  3L9V A;  2CAQ A;  4YAP A;  2I81 A;  2YPM A;  1XWG A;  4TOP A;  3GUR A;  3EPT A;  4CHS A;  5J3R A;  1YEX A;  2DMM A;  4N30 A;  1XWC A;  3CRT A;  4ZB9 A;  5DQS A;  3P8W A;  5HFK A;  2F8F A;  2CX3 A;  2HLS A;  2M72 A;  4WF5 A;  7GSS A;  2DLX A;  4HI7 A;  5HFI A;  3Q19 A;  2KLX A;  2R5G A;  2IL3 A;  4IGJ A;  1QGV A;  3CSH A;  2F3M A;  2C3T A;  1X0R A;  2H71 A;  2VL3 A;  3L9S A;  2LRN A;  1A23 A;  3C7M A;  2GT5 A;  3FHK A;  3DXB A;  2V6K A;  3GYK A;  4XIH A;  5A4V A;  2RM5 A;  4YQM A;  3QDN A;  1TRS A;  2PBJ A;  4MZW A;  3O76 A;  4ECI A;  1SU9 A;  3KIJ A;  5ID2 A;  2HRN A;  4F2I A;  1WIK A;  3VK9 A;  2O8V B;  5DCH A;  2WFC A;  4PUR A;  3LG6 A;  4ZB8 A;  2HSH A;  4BVY B;  1SYX A;  1DE1 A;  3UVT A;  5LNK e;  1O81 A;  3TUE A;  2JL4 A;  1GSQ A;  4IQ1 A;  3IOS A;  3KH9 A;  1F2E A;  2K9F A;  1O73 A;  3GH9 A;  2O85 A;  4POL A;  3CTF A;  4WBJ A;  2R6K A;  4X4J A;  3DRN A;  2PER A;  4P3Y B;  1FOH A;  4RUV A;  5D73 A;  2HZE B;  3FY7 A;  3TJJ A;  1GNE A;  4POK A;  2C1Y A;  1Y6E A;  4IW9 A;  2H6Y A;  4KDX A;  4PQ1 A;  3W8J A;  2RM6 A;  1G6W A;  4HOJ A;  2DJ2 A;  3WT2 A;  1GTI A;  4OWY A;  4ID0 A;  3A2V A;  2YOI A;  2OBK A;  1ACV A;  2CA8 A;  1GSY A;  1XW5 A;  3R2Q A;  5D96 A;  4ECB A;  1V98 A;  5AN1 A;  3EU3 A;  5ECN B;  2DJJ A;  2LRC A;  1GUH A;  1GLQ A;  3EE2 A;  3ZYW A;  1MDI A;  1BYE A;  3QR6 A;  3IC8 A;  5ECS A;  1TK0 B;  2R0C A;  2VCW A;  6GSS A;  5F8B A;  2R0P A;  2ZCT A;  5KOX A;  2OE0 A;  1E6B A;  1OC9 B;  2F9S A;  2R37 A;  3GTU B;  4MNN A;  3WT1 A;  4JU5 A;  4BWS A;  5IM9 A;  1ZYN A;  2V1M A;  5IMA A;  1B9Y C;  2YWN A;  4KH7 A;  4CY8 A;  4ZB6 A;  5F06 A;  3ZMK A;  4OMV A;  1FVJ A;  1PGT A;  4OCF A;  1PN9 A;  3HXS A;  1NM3 A;  1Z7R A;  3M8N A;  3G7Y A;  10GS A;  1Z6N A;  3IHQ A;  5GAP D;  4WXT A;  1WE0 A;  5DJM A;  2HNL A;  2O89 A;  3VI7 A;  4TKY A;  4TR0 A;  2PUK C;  3QAV A;  2VCQ A;  2RUE A;  4LMV A;  3ZVJ A;  2GQM A;  2H70 A;  4Q5F A;  2VO4 A;  4MF5 A;  2L6D A;  1TU8 A;  2C4J A;  5IIZ A;  1FO5 A;  1AAZ A;  1EEM A;  4GWR A;  3RDW A;  1A2M A;  1ERT A;  4XTS A;  3GMF A;  4K2D A;  2E7P A;  4G0L A;  5D9X A;  2NPB A;  3FR9 A;  3C8E A;  3DGQ A;  1GRX A;  1YZX A;  1M0U A;  1EOH A;  3D0Z A;  8GSS A;  2L57 A;  5B6N A;  1B4P A;  2FGX A;  1ZCP A;  3A2X A;  1TP9 A;  4QQ7 A;  1THX A;  2QGV A;  4EDZ A;  4V2M A;  4NHW A;  2IMF A;  2DIY A;  2JSZ A;  2GS3 A;  2L4Q A;  1A8Y A;  2VLV A;  4AF2 A;  2FNO A;  4G10 A;  4KSO A;  1TXX A;  4K0N A;  1G7O A;  3TKP A;  1MDJ A;  2GGT A;  4JE1 A;  2HFD A;  2LJA A;  1GSD A;  2L5O A;  1JZR A;  2VIM A;  2HT9 A;  1EV4 A;  1PSQ A;  5A4U A;  4ULX A;  3IDV A;  4GSS A;  4GXZ A;  3IAS 2;  1FVK A;  2FWG A;  4MZB A;  2B5Y A;  2GZZ A;  1Q4J A;  1HQO A;  4HUA A;  1GNW A;  1TKD B;  2WCI A;  2GDR A;  22GS A;  3ZIT A;  3RHC A;  4JR4 A;  5CYY A;  2H66 A;  2I1U A;  2XPE A;  4KB3 A;  3VLN A;  3HCZ A;  1RK4 A;  5CRW A;  3TJF A;  1LBK A;  2WS2 A;  2EC4 A;  4POB A;  2YWM A;  2PVO C;  4ZBA A;  3LW9 A;  1QXH A;  1AQX A;  2XBQ A;  3TKS E;  4MF6 A;  3ED3 A;  1M9A A;  1M7T A;  2MZC A;  1VGL A;  3L0H A;  2VL2 C;  2V41 A;  4ZL8 A;  4I97 A;  5ECK B;  1A2L A;  1SK2 A;  1U88 A;  1GSE A;  3TDG A;  4PNG A;  6GSX A;  4WR4 A;  2I9H A;  3WYW A;  4GSN A;  4WBR D;  4JR6 A;  1O85 A;  1X9M B;  3MAK A;  5EVO A;  4YKG A;  2LRT A;  1USB A;  4ZBB A;  2C0F A;  1TOF A;  1KBN A;  3Q74 A;  3ERF A;  4MLY A;  1VF4 A;  4WEY A;  3LGC A;  2LS5 A;  4BVY A;  4V2L A;  2YWI A;  4TXO B;  3UJ1 A;  1T7P B;  4KF9 A;  3QCP A;  3LQ7 A;  4IHU A;  3UVH A;  3MIX A;  3WGX A;  4Z2R A;  3O3T A;  4PX1 A;  2H0G A;  1FB0 A;  2YP6 A;  3NIV A;  5IMZ A;  2K8V A;  5KN2 A;  17GS A;  4Q5Q A;  3D4T A;  2HZE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...