1NW2A

The crystal structure of the mutant r82e of thioredoxin from alicyclobacillus acidocaldarius
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
105
structure length
105
Chain Sequence
ATMTLTDANFQQAIQGDKPVLVDFWAAWCGPCRMMAPVLEEFAEAHADKVTVAKLNVDENPETTSQFGIMSIPTLILFKGGEPVKQLIGYQPKEQLEAQLADVLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords THIOREDOXIN
publication title An integrated structural and computational study of the thermostability of two thioredoxin mutants from Alicyclobacillus acidocaldarius
pubmed doi rcsb
source organism Alicyclobacillus acidocaldarius
total genus 30
structure length 105
sequence length 105
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 2003-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1nw2A00
2GT6A 1SD8A 2NVLA 2HI7A 1IYHA 4I5QA 1XIYA 5IMZA 2OE0A 2C3TA 1PRXA 1LU4A 2GGTA 2FUG2 3LXZA 2MMNA 3FKFA 3P90A 2OE1A 1SK0A 1X5CA 1F3AA 1F9MA 4L0UA 3K8NA 3LFLA 4OD7A 4MF7A 3MAKA 1TI1A 1TRUA 4LLRA 2AYTA 3D4MA 1DBYA 1V2AA 4DSQA 3FZ4A 4G2EA 3FK8A 2V6KA 1SYXA 5D9VA 4EXJA 4V1Ag 2RUFA 2ZUPA 1JHBA 1M9BA 2NTOA 3HHVA 3FHKA 3KTBA 2N5AA 3WT2A 1GSQA 4ZIJA 1AIUA 1MEKA 1AC1A 2F8FA 4XS4A 1ACVA 2QSIA 1ZCPA 1PX6A 1SYRA 3CBUA 4ZL9A 1X5EA 1EGRA 4KDXA 4KE3A 1A24A 2CQ9A 5ECLB 5GZZB 2M72A 1OKTA 5A4VA 3EINA 2BJXA 4JEDA 3G7IA 1JZWA 1A2MA 2LJRA 1SJIA 4XRAA 1V9WA 1FG4A 2JZSA 2H0HA 5DQYA 4X0XA 1BQ7A 4DSRA 1I9DA 5ELGA 5DQSA 2QGVA 1FVJA 3DVXA 3BCKA 2LTKA 3US3A 1A8LA 4O92A 3IXRA 2R6KA 5E59A 3FR9A 4MZBA 1SKRB 3GN3A 2H0IA 1EEMA 4EC0A 2I81A 2JACA 4N30A 3KXOA 2NDOA 1JLWA 2A2SA 3TOUA 5CRDA 2XHFA 4FYBA 1AUCA 5HR2A 4MJEA 3FW2A 1AAZA 4YH2A 4AF2A 4IVFA 4DVCA 3WGEA 3M0FA 6GSUA 2OKAA 2HZEA 2FGXA 1XXUA 4IW9A 3LJRA 5DBQA 2IL3A 1M2DA 2L59A 3D21A 4L5LA 3ERGA 5KN0A 3C71A 3HXSA 3UBKA 3GKMA 1SJZA 1B9YC 4Z7XA 4TVEA 4WEYA 3IR4A 3S9FA 5HR3A 3KIJA 3UOMA 3TB2A 3ERFA 2M46A 2DIZA 2C4JA 2LNSA 1G7OA 1CQGA 3GIXA 2REMA 1XWGA 1NM3A 2P0GA 2X8GA 2RM6A 3KH7A 5ECMB 5IMAA 2AV4A 2WGRA 3D0ZA 5G2ZA 5L71A 1YJ6A 5IMCA 1SKWB 4J57E 2CVKA 4GXZA 3EE2A 3TDGA 2TRCP 2OBIA 4EL1A 2O89A 1JLVA 3ZL5A 5H5QA 3PGTA 4D73A 1T7PB 4ZB6A 1AQWA 4MJBA 4GQCA 2HSYA 3QFAC 5D9TA 4G9HA 2F51A 2IWTA 2C3QA 5CREA 4J56E 4XS4B 5CO3A 1UVZA 2D2ZA 3GTUA 3N9JA 1G0TA 1N8JA 3HZ4A 1EZKA 5CAXA 5IOWA 4JE1A 3GH6A 3EURA 4HJMA 1K3YA 2FWGA 1DSBA 2MYGA 4TXOA 3EVIA 5F05A 4LA1A 4OO5A 2IFQA 1S3CA 1XVQA 3PINA 1TTZA 3GYKA 2LJAA 2DSAA 4CW9A 2DJ3A 2OBKA 2H1BA 4K6XA 1U6TA 4RUVA 1WE0A 4YAVA 3FZ5A 5HR0A 9GSSA 3APSA 3VWWA 4K9ZA 2GSRA 5FHIA 5ID2A 3LQ7A 4MJCA 4K0NA 4BWSA 4ECIA 1LJRA 2VLUA 1OVNA 3P7XA 4ILFA 4V1Ap 3EU3A 4KX4A 5IIZA 11GSA 5F06A 2HZEB 3QAGA 5ECOB 3PR8A 1MDKA 4NHZA 1ERWA 1FHEA 3F8UA 3TKSE 3TKQA 4GCIA 2YWIA 2VCWA 2YP6A 3DVWA 1EGOA 3DXBA 2LKUA 2X8CA 4LL4B 4MZWA 2AHEA 1PMTA 3WGDA 2IJYA 2HXKA 2M80A 2TIRA 4O7HA 2N5FA 1PSQA 1TKDB 1K0AA 5AISA 2ALBA 2A2RA 3ZFBA 1X5DA 2XBIA 2YZHA 3ERWA 1Q98A 1B8XA 3ED3A 1V98A 1RK4A 2GTUA 2ZCTA 3RPNA 2CAQA 3KD0A 2A4VA 4ZBAA 5H5RA 3D6IA 1GRXA 3QAWA 1BX9A 3L78A 3VPTA 4GF0A 1U87A 1GL8A 1K3LA 1N2AA 2JL4A 3GKXA 3Q6OA 1WIKA 3IRAA 5FWGA 4WXTA 3IHQA 4FYCA 1QK8A 3KGKA 3ME8A 2KLXA 1B4QA 4Q5NA 2F3MA 4LMWA 1K0DA 3APOA 2B7JA 2HFDA 2DC5A 1XZOA 1TW9A 5DJLA 3VWVA 6GSSA 3GMFA 2H01A 2HRFA 3CSHA 2PWJA 1XW6A 1XWKA 5ABRA 1F2EA 2CVBA 2YV7A 1R5AA 2FA8A 2V6OA 2IPAA 3L0HA 3M8NA 3IE3A 1X9SB 1YKAA 3M3MA 1AW9A 3EWLA 5CNWA 2VUPA 1FAAA 3KCMA 1URMA 3O6TA 4GRFA 4K0GA 3J7Yk 3O76A 1GTUA 5GSTA 1WPIA 1JZOA 1BYEA 5A4WA 3FEUA 1THOA 2H1DA 1AQVA 2FWEA 6GSTA 4TOPA 4HEA2 1PGTA 1QUWA 5ID2B 2BTOT 4TW5A 6GSXA 2LJKA 4JRRA 2AB6A 1ABAA 1I5GA 2I9HA 2WDUA 2YWMA 3QOUA 3TGZA 4BPYA 2VL3A 2LRTA 2FNOA 4HS1A 1R26A 5DAKA 1A23A 3NZNA 3G7JA 2AJQB 4TR1A 4MK3A 4K8MA 4GTUA 1YY7A 4MH2A 5H5SA 5JWOB 1TU8A 2OADA 4ISDA 4BL7A 3C73A 4K2DA 2KP1A 4PNGA 4POBA 3DRNA 2RIIA 1ZMAA 2HT9A 4Q5FA 5IPGA 1GTBA 5G1LA 1Q4JA 5EY6A 3DYRA 3ZFLA 2B6MA 3HJMA 4XRDA 1VF4A 1TI3A 2L4CA 3APQA 2P5QA 4OO4A 1M99A 2MMAA 4NV5A 4G19A 2VM2A 1YEXA 1EP7A 3D5JA 3UAPA 3L9UA 3TUEA 3O3TA 2LUSA 1XVWA 2XC2A 3KEBA 10GSA 3TKSC 2FA4A 1ZL9A 2H6ZA 2H6YA 2H71A 1XWCA 3QDNA 4IN0A 3BD2A 2CV4A 3TOTA 2XPEA 4IKHA 1EOGA 3G9BA 2IMIA 3L9SA 4DSSA 1EWXA 1JFUA 5F8BA 3D22A 4N0ZA 2GLRA 4ZILA 6GSWA 2LRNA 2E2GA 4BVXA 4F2IA 3RBTA 2L6DA 1V58A 5EL8A 2OJLA 3TRQA 2GSTA 4ML6A 1M2BA 4NXIA 1KBNA 3UJ1A 4PGTA 4QL9A 2LV3A 2DIYA 1A2LA 3IOSA 1SENA 3M9KA 4E8HA 1GUKA 3FYGA 4HUAA 2CA8A 5INYA 1O81A 2PMTA 4ID0A 4KW6A 2F9SA 19GSA 4V2NA 1VF3A 2PUKC 1NHYA 4EO3A 1K0NA 2B5YA 4QL7A 2E0QA 2CVDA 1M0UA 1QFNA 3RAZA 3VFIA 2OA7A 5IO0A 1TP9A 2K18A 4K7IA 2H6XA 1GWCA 1O73A 1OC3A 5IPHA 1PKWA 2JU5A 1ML6A 1SD9A 2C1YA 4JR6A 1TRSA 3Q74A 3LYKA 1Y6EA 2G0FA 1VRSD 2L57A 2JSYA 2WS2A 1PX7A 2VAFA 2IMKA 1YDKA 2HLSA 1U88A 2GZZA 2IMEA 3LYPA 5D9WA 4GSNA 1XBSA 5ECRB 3A2VA 4WR5A 4JU5A 5DCGA 4F0BA 1PA3A 4EE0A 2PBJA 1A0RP 2KHPA 2RUEA 1GTAA 2IMDA 3TJGA 4IS0A 3TKSA 1V57A 4FYUA 20GSA 4ECBA 1GNWA 2X99A 5J3RA 1W4VA 1UN2A 2JZTA 3A5WA 5B8AA 4IP1A 4ZB9A 4EKZA 4HQSA 1BAYA 1ZGNA 3TJKA 2PN8A 5J4UA 3J7Yb 2C0DA 22GSA 5DALA 4JR4A 2XBQA 2LNTA 2B1KA 1GLPA 4AJ6A 3I43A 1UA5A 2BMXA 3I6AA 5DDLA 2YV9A 3ZMKA 12GSA 1ST9A 2V32A 3EYTA 4MPGA 3VURA 3M1GA 1C72A 4KCEA 1VF1A 2H74A 3HVSA 3Q19A 4IGJA 1G6WA 1J0FA 4JBBA 1RW1A 1EP8A 1GNEA 2PGTA 3DD3A 4PX1A 2DJJA 5J41A 2GQLA 1TK8B 3TJFA 1YQ1A 2WRTA 3GV1A 4OFTA 5IMVA 5IOXA 2MBTA 3WT1A 4TR3A 2GSQA 2YJHA 4V2MA 5EVOA 2C8UA 3FR6A 1ZYQB 4OFNA 2V1MA 1HNCA 4XHMA 1T4YA 1YF1A 1T4ZA 2PERA 3FY7A 5C04A 2HRNA 1O7UA 2FLSA 2YWOA 5EPFA 1JZDA 1GTIA 1FO5A 2C3NA 3R2QA 2H76A 2O7KA 4WKWA 2L4QA 4O5RA 1SU9A 1TXXA 3HJPA 2YZUA 3DWVA 2IMFA 4PUFC 1XCCA 3WYWA 3F3RA 1PD21 4FH8A 1H4OA 3LORA 1K3OA 3ZIVA 2DJ0A 8GSSA 1T1VA 1HYUA 2H75A 4KAEA 2VL9A 1WP0A 1ZZYA 7GSSA 3QFBC 1AXDA 3VWUA 3H93A 2P31A 3ZYWA 2I4AA 5ECPB 2KP2A 2CZ3A 3HY2A 2DBCA 5F0GA 4MA9A 4KDUA 1M7TA 2R37A 4GWRA 5DCHA 2GQMA 1X9MB 4Q5RA 2YN1A 3IAM2 4ZL7A 3BCIA 4ACSA 2ES7A 3GKKA 3E3EA 3HCZA 1OC8A 2DMLA 4LMVA 1AQXA 4HJ2A 3M9JA 3OR5A 4CHSA 3DEXA 2VCQA 3GHAA 5LD0A 3ZLPA 1VGLA 3CRTA 4I2UA 1K0CA 1OC9A 3CXGA 2YANA 1THXA 2R4VA 5AGYA 1ERUA 3IK7A 1SJ6A 3EMXA 2WZ9A 4LL1B 2GQKA 1ON4A 4IHUA 4XIHA 3VWXA 1T00A 2LEGA 3UBLA 4FIWA 5J5NA 1A0FA 4D73B 2N5BA 3CYNA 3FZAA 2H66A 2J23A 5G31A 3TKRA 3GL3A 4YAPA 1O85A 1XFLA 1SL1B 1YEPA 4MF5A 1K0OA 1GSYA 1F6MC 1LBKA 2KUCA 1OE7A 3GTUB 1OE8A 3C8EA 1EOHA 4EDYA 3ZIJA 2L5LA 2H1AA 5IQYA 1IYIA 2MMOA 1GP1A 3CTFA 3GUSA 3GH9A 2VD1A 4Q5QA 4TXOB 1KNGA 3UARA 3QR6A 2VLTA 4KH7A 2IFQB 3U6VA 5KN2A 3A3TA 1XPVA 5ENUA 1OKDA 4HDEA 4GQFA 4ECJA 4PNFA 4IBPA 4POLA 4KUNA 1XW9A 2Z9SA 5B6MA 1HQOA 1ERTA 2VM1A 1TRWA 4KGIA 3P8WA 1OAZA 4PXOA 1WMJA 2VL2C 5IMFA 1TU7A 1VF2A 4F82A 1DE1A 3HYPA 2LSTA 4KSMA 2P5RA 6GSYA 4ZB8A 3SBCA 1PL1A 2J9HA 5G1KA 2CT6A 2WFCA 3KP9A 4MZCA 4ULXA 5JCGA 1GULA 1R4WA 4KNDA 2HZFA 5ECSA 3HZ8A 4FO5A 3IK9A 3PH9A 4X1UA 3TJBA 3W8SA 3H8QA 2H19A 5KN3A 4BA7A 5HFKA 3F9UA 2H72A 3P2AA 3DKSA 2C0FA 1F3BA 2OE3A 4EUYA 17GSA 2JZRA 4WBJA 1GH2A 3IV4A 2FWHA 3W6GA 3ZREA 2VO4A 5JCWA 2EIQA 4NV2A 3BOAA 6GSVA 5GAND 1Y25A 1WJKA 3ME7A 4XCSA 4TR4A 3VLNA 3EU4A 1OC9B 3D4TA 3ZITA 3ZRDA 5JCUA 2B5XA 1B48A 1TJDA 2GDRA 4OMVA 3C1RA 4V2LA 3KMOA 4G10A 3BBYA 1Z7RA 2ON7A 5HR1A 5HFIA 1KTEA 3F6DA 4IJ3A 3HD5A 5D73A 2EIRA 3C1SA 3UVTA 2DJKA 5ELAA 4I8BA 1QQ2A 2MMZA 5IM9A 1U3AA 2GT5A 1YZXA 2K6VA 4WBRD 4JZQA 1NW2A 4NAXA 4OCEA 1NSWA 2VOCA 4PQIA 5ECQB 1ZYEA 4RQRA 2VLVA 3HJOA 5COHA 3L9VA 4KCAA 2VL2A 1GSSA 2MZCA 1TOFA 3IA1A 4MDCA 2B1LA 4EF0A 2R5GA 4MP4A 2FD3A 1A8YA 3GSTA 2GZPA 3UMAA 5FT3A 5B7CA 5G5FA 2PU9C 1QGVA 4F0CA 4NPBA 5CP1A 1XW5A 2XPDA 4XTSA 3TJJA 2F8AA 4MF6A 2E7PA 2IN3A 4MABA 4HQZA 1Z6MA 4AJ7A 2GZYA 3GURA 3TKPA 3TRXA 5AIXA 3VPQA 3H1NA 1WOUA 1GLQA 2FCHA 3IDVA 1BEDA 1QMVA 4KSOA 4H86A 3UEMA 2G2QA 4ZBBA 3KMNA 4XS6A 3SWLA 4I2TA 2FWFA 2JSZA 2HE3A 2H70A 3F63A 4MMMA 5DAKB 2K8SA 3MDKA 3QCPA 3ZVJD 2VCTA 1FVKA 2C80A 4E8EA 5B8BA 3EC3A 4TR1B 5ECKB 3WGXA 2FHEA 3RHBA 1PKZA 2B7KA 2X64A 4HOJA 3TCOA 1X0RA 2WJUA 4IQAA 1U3IA 3KH9A 1H75A 1S3AA 3F4SA 1K0MA 2R3XA 4TKYA 5KN1A 5IO2A 1O8WA 3DMLA 4TR0A 2EIOA 2GVPA 1MD4A 1O8XA 3FR3A 3RPPA 4WF5A 3IPZA 3KJYA 1SK1A 3EMPA 2LS5A 3TRPA 2R2JA 2VCVA 4KA0A 4OCFA 5B6NA 1F37A 3QMXA 3UL3A 3CRUA 1FB0A 1ZOFA 5AIVA 1O6JA 3GSSA 3NIVA 4IJIA 4ZXGA 1TK0B 4L8EA 1MTCA 3HA9A 3LWAA 2HSHA 2AUVA 3IAS2 1TDIA 4CDOA 4YQVA 1Z5YE 3JCML 1HNAA 4MJAA 1ERVA 1QXHA 3C7MA 5LCZA 4DSSB 1PN9A 4WF4A 2H30A 4OWYA 2E2MA 1MDIA 2WULA 3LGCA 3ZZXA 1E6BA 2YNXA 4J2FA 1RQMA 1XOBA 4X43A 5HFGA 5CRGA 4IELA 2YCDA 4EDZA 3W8JA 3NOFA 1S3DA 3MNGA 1EEJA 3UVHA 1HD2A 1TRVA 3GL5A 2MBSA 1HNBA 5KEJA 1FB6A 2LQQA 4I97A 1EV9A 3BJ5A 3MWHA 1X9WB 2LRCA 2H1GA 1USBA 4NMUA 5JWQB 4PQ1A 1YKCA 4K7NA 2HYXA 4F9ZA 1W89A 3CSJA 4RI6A 2PPTA 4XS1A 3LSZA 5ECHB 2EC4A 1DE2A 4BVYA 5CYYA 1GUMA 2DJ2A 2YPMA 5CRWA 1PL2A 4PURA 2FY6A 1R5PA 3KTLA 3CSIA 2H73A 4QQ7A 3ZMLA 2K9FA 4MLYA 2CX4A 3DGQA 2VD0A 1K0BA 18GSA 5IMDA 2X8HA 4L0WA 1J08A 1JZRA 2LQOA 2IIYA 4ZBDA 1KEBA 5D8IA 3ZVJA 4ZL8A 1TK5B 4TN8A 3VI7A 2V41A 1OYJA 3I69A 3U5RE 4K7OA 5A5KA 1EV4A 4HZ4A 1V40A 4HU7A 2QKEA 3DIEA 2B3SA 3ISOA 3L4NA 2JADA 2CZ2A 1MD3A 4YQUA 2WB9A 3RDWA 1M9AA 5AN1A 1J9BA 4YQMA 5ECNB 1ILOA 4POKA 5G5EA 3GX0A 3KM6A 3KZQA 5A4UA 3IC4A 3A2WA 1WRYA 4O32A 3F3QA 4GSTA 2O8VB 4ECCA 3GKNA 3ZTLA 4PQHA 5D93A 3E9JB 2GSSA 2O87A 2DMMA 2RLIA 3LG6A 1B4PA 4BWQA 5HQPA 4OFMA 4GLTA 1YF0A 1E2YA 1XOAA 4EVMA 1DUGA 1M2AA 2ON5A 2CAIA 3GX8A 5DJMA 2K8VA 4TXVA 5DALB 1NHOA 3GNJA 2DLXA 1T3BA 3F4RA 4RI7A 3LEFA 4I6XA 2KOKA 1T8EB 1FW1A 3A2XA 1GSEA 3QAVA 4IP6A 3F4TA 4WR4A 1FOVA 3CTGA 2I1UA 2YJ7A 1Z3EA 4PUAA 3HKRA 2L5OA 3GFKA 2V2GA 3H79A 2HNLA 1G6YA 2GS3A 2WCIA 1PQNA 16GSA 3QPMA 4ML1A 5F07A 3WD6A 5LNKe 2VCXA 3IBHA 2DJ1A 3CMIA 3F0IA 2VIMA 3G7YA 1G7EA 4HU9A 2CX3A 1GUHA 4POMA 2NBSA 3HVVA 5C00A 1UC7A 1Z9HA 1SL0B 5ECIB 4KDYA 5D9XA 2YOIA 1Z6NA 2AAWA 13GSA 1XWBA 2PVQA 14GSA 3I9V2 3Q18A 3AY8A 4KB3A 3QD9A 5J9CA 2QC7A 4AJ8A 4K1FA 1WWJA 4NHWA 3LXTA 1Z7PA 1A2JA 4MH3A 1GSFA 4NWYA 3HVXA 5GAPD 5CRHA 3E0UA 4AGSA 3F6FA 3FZ9A 2B5EA 4GSSA 2C0GA 4HI7A 3VK9A 1SL2B 3FRCA 3HDCA 2H8LA 5G30A 3GRXA 3RHCA 2VCZA 1SKSB 5D96A 4F03A 2NPBA 5J9BA 1MDJA 1B9XC 4HZ2A 1SK2A 4L5OA 4MPFA 4RQXA 4WETA 5GSSA 2ZNMA 4P3YB 2RM5A 1BJXA 1GSUA 2PVOC 3KP8A 1CQHA 4DEJA 2H0GA 2O85A 3H4KA 3VI5A 1GSDA 3V1WA 1R7HA 1BG5A 4N10A 2OACA 4N0VA 4TRXA 4N11A 1XWAA 2C0EA 2I3YA 3MSZA 5E4WA 3N5OA 3UIWA 4IQ1A 4MCUA 3GA4A 5DVBA 2TRXA 2L6CA 5JWRB 2YWNA
chains in the Genus database with same CATH superfamily
2GT6A 1SD8A 2NVLA 2HI7A 1IYHA 4I5QA 1XIYA 5IMZA 2OE0A 2C3TA 1PRXA 1LU4A 2GGTA 2FUG2 3LXZA 2MMNA 3FKFA 3P90A 2OE1A 1SK0A 1X5CA 1F3AA 1F9MA 4L0UA 3K8NA 3LFLA 4OD7A 4MF7A 3MAKA 1TI1A 1TRUA 4LLRA 3HVNA 2AYTA 3D4MA 1DBYA 1V2AA 4DSQA 3FZ4A 4G2EA 3FK8A 2V6KA 1SYXA 5D9VA 4EXJA 4V1Ag 2RUFA 2ZUPA 3R3EA 1JHBA 1M9BA 2NTOA 3HHVA 3FHKA 3KTBA 2N5AA 2QA1A 3WT2A 1GSQA 4ZIJA 1AIUA 1MEKA 2HRKA 1AC1A 2F8FA 4BIKA 4XS4A 1ACVA 2QSIA 1ZCPA 1PX6A 1SYRA 3CBUA 4ZL9A 1X5EA 1EGRA 4KDXA 4KE3A 1A24A 2CQ9A 5ECLB 5GZZB 2M72A 1OKTA 5A4VA 3EINA 2BJXA 4JEDA 4A5PA 3G7IA 1JZWA 1A2MA 2LJRA 1SJIA 4XRAA 1V9WA 1FG4A 2JZSA 2H0HA 5DQYA 4X0XA 1BQ7A 4DSRA 1I9DA 5ELGA 3EPTA 5DQSA 2QGVA 1FVJA 3DVXA 3BCKA 2LTKA 3US3A 1A8LA 4O92A 3IXRA 2R6KA 5E59A 3FR9A 4MZBA 1SKRB 3GN3A 2H0IA 1EEMA 4EC0A 2I81A 2JACA 4N30A 3KXOA 2X4AA 2NDOA 1JLWA 2A2SA 3TOUA 5CRDA 2XHFA 4FYBA 1AUCA 5HR2A 4MJEA 3FW2A 1AAZA 4YH2A 4AF2A 4IVFA 4DVCA 3WGEA 3M0FA 6GSUA 2OKAA 2HZEA 2FGXA 1XXUA 5KOXA 4IW9A 3LJRA 5DBQA 2IL3A 1M2DA 2L59A 3D21A 4L5LA 3ERGA 5KN0A 3C71A 3HXSA 3UBKA 3GKMA 1SJZA 1B9YC 4Z7XA 4TVEA 4WEYA 3IR4A 3S9FA 5HR3A 3KIJA 3UOMA 3TB2A 3ERFA 2M46A 2DIZA 2R0GA 2C4JA 2LNSA 1G7OA 1CQGA 3GIXA 2REMA 1XWGA 1NM3A 2P0GA 2X8GA 2RM6A 3KH7A 5ECMB 5IMAA 2AV4A 2WGRA 3D0ZA 5G2ZA 5L71A 1YJ6A 5IMCA 1SKWB 4J57E 2CVKA 4GXZA 5BMUA 3EE2A 3TDGA 2TRCP 2OBIA 4EL1A 2O89A 1JLVA 3ZL5A 5H5QA 3PGTA 4D73A 1T7PB 4ZB6A 1AQWA 4MJBA 4GQCA 2HSYA 3QFAC 5D9TA 4G9HA 2F51A 2IWTA 2C3QA 5CREA 4J56E 4XS4B 5CO3A 1UVZA 2D2ZA 3GTUA 3N9JA 1G0TA 1N8JA 3HZ4A 1EZKA 5CAXA 5IOWA 4JE1A 3GH6A 3EURA 4HJMA 1K3YA 2FWGA 1DSBA 2MYGA 4TXOA 3EVIA 5F05A 4LA1A 4OO5A 2IFQA 1S3CA 1XVQA 3PINA 1TTZA 3GYKA 2LJAA 2DSAA 4CW9A 2DJ3A 2HRAA 2OBKA 2H1BA 4K6XA 1U6TA 4RUVA 1WE0A 4YAVA 3FZ5A 5HR0A 9GSSA 3APSA 3VWWA 4K9ZA 2GSRA 5FHIA 5ID2A 3LQ7A 4MJCA 4K0NA 4BWSA 4ECIA 1LJRA 2VLUA 4YKFA 1OVNA 3P7XA 4ILFA 4V1Ap 3EU3A 4KX4A 5IIZA 11GSA 5F06A 2HZEB 3QAGA 5ECOB 3PR8A 1MDKA 4NHZA 1ERWA 1FHEA 3F8UA 4MNNA 3TKSE 3TKQA 4GCIA 2YWIA 2VCWA 2YP6A 3DVWA 1EGOA 3DXBA 2LKUA 2X8CA 4LL4B 4MZWA 2AHEA 1PMTA 3WGDA 2IJYA 2HXKA 2M80A 2TIRA 4O7HA 2N5FA 1PSQA 1TKDB 1K0AA 5AISA 2ALBA 2A2RA 3ZFBA 1X5DA 2XBIA 2YZHA 3ERWA 1Q98A 3A5IA 1B8XA 3ED3A 1V98A 1RK4A 2GTUA 2ZCTA 3RPNA 2CAQA 3KD0A 2A4VA 4ZBAA 5H5RA 3D6IA 1GRXA 3QAWA 1BX9A 3L78A 3VPTA 4GF0A 1U87A 1GL8A 1K3LA 1N2AA 2JL4A 4Z2RA 3GKXA 3Q6OA 1WIKA 3IRAA 5FWGA 4WXTA 3IHQA 4FYCA 1QK8A 3KGKA 3ME8A 2KLXA 1B4QA 4Q5NA 2F3MA 4LMWA 1K0DA 3APOA 2B7JA 2HFDA 2DC5A 1XZOA 1TW9A 2X49A 5DJLA 2DKIA 3VWVA 6GSSA 3GMFA 2H01A 2HRFA 3CSHA 2PWJA 1XW6A 1XWKA 5ABRA 1F2EA 2CVBA 2YV7A 1R5AA 2FA8A 2V6OA 2IPAA 4BVYB 3L0HA 3M8NA 3IE3A 1X9SB 1YKAA 3M3MA 1AW9A 3EWLA 5CNWA 2VUPA 1FAAA 3KCMA 1URMA 3O6TA 4GRFA 4K0GA 3J7Yk 3O76A 1GTUA 5GSTA 1WPIA 1JZOA 1BYEA 5A4WA 3FEUA 1THOA 2H1DA 1AQVA 2FWEA 6GSTA 4TOPA 4HEA2 1PGTA 1QUWA 5ID2B 2BTOT 4TW5A 6GSXA 2LJKA 4JRRA 2AB6A 1ABAA 1I5GA 2I9HA 2WDUA 2YWMA 3QOUA 3TGZA 4BPYA 2VL3A 2LRTA 2FNOA 4HS1A 1R26A 5DAKA 1A23A 3NZNA 3G7JA 2AJQB 4TR1A 4MK3A 4K8MA 4GTUA 1YY7A 4MH2A 5H5SA 5JWOB 1TU8A 2OADA 4ISDA 4BL7A 3C73A 4K2DA 2KP1A 4PNGA 4POBA 3DRNA 2RIIA 1ZMAA 2HT9A 4Q5FA 5IPGA 1GTBA 5G1LA 1Q4JA 5EY6A 3DYRA 3ZFLA 2B6MA 3HJMA 4XRDA 1VF4A 1TI3A 2L4CA 3APQA 2P5QA 4OO4A 1M99A 2MMAA 4NV5A 4G19A 2VM2A 1YEXA 1EP7A 3D5JA 3UAPA 3L9UA 3TUEA 3O3TA 2LUSA 1XVWA 2XC2A 3KEBA 10GSA 3TKSC 2FA4A 1ZL9A 2H6ZA 1M3IA 2H6YA 2H71A 1XWCA 3QDNA 4IN0A 3BD2A 2CV4A 3TOTA 2XPEA 4IKHA 1EOGA 3G9BA 2IMIA 3L9SA 4DSSA 1EWXA 1JFUA 5F8BA 3D22A 4N0ZA 2GLRA 4ZILA 6GSWA 2LRNA 2E2GA 4BVXA 4F2IA 3RBTA 2L6DA 1V58A 5EL8A 2OJLA 3TRQA 2GSTA 4ML6A 4YKGA 1M2BA 4NXIA 1KBNA 3UJ1A 4PGTA 4QL9A 2LV3A 2DIYA 1A2LA 3IOSA 1SENA 3M9KA 4E8HA 1GUKA 3FYGA 4HUAA 2CA8A 5INYA 1O81A 2PMTA 4ID0A 4KW6A 2F9SA 4CY6A 19GSA 4V2NA 1VF3A 2PUKC 1NHYA 4EO3A 1K0NA 2B5YA 4QL7A 2E0QA 2CVDA 1M0UA 1QFNA 3RAZA 3IC8A 3VFIA 2OA7A 5IO0A 1TP9A 2K18A 4K7IA 2H6XA 1GWCA 1O73A 1OC3A 5IPHA 1PKWA 2JU5A 1ML6A 1SD9A 2C1YA 4JR6A 1TRSA 3Q74A 3LYKA 1Y6EA 2G0FA 1VRSD 4EIQA 2L57A 2JSYA 2WS2A 1PX7A 2VAFA 2IMKA 1YDKA 2HLSA 1U88A 2GZZA 2IMEA 3LYPA 5D9WA 4GSNA 1XBSA 5ECRB 3A2VA 4WR5A 4JU5A 5DCGA 4F0BA 1PA3A 4EE0A 2PBJA 1A0RP 2KHPA 2RUEA 1GTAA 2IMDA 3TJGA 4IS0A 3TKSA 1V57A 4FYUA 20GSA 4ECBA 1GNWA 2X99A 5J3RA 1W4VA 1UN2A 2JZTA 3A5WA 5B8AA 4IP1A 4ZB9A 4EKZA 4HQSA 1BAYA 1ZGNA 3TJKA 2PN8A 5J4UA 3J7Yb 2C0DA 22GSA 5DALA 4JR4A 2XBQA 2LNTA 2B1KA 1GLPA 4AJ6A 3I43A 1UA5A 2BMXA 3I6AA 5DDLA 2YV9A 3ZMKA 12GSA 1ST9A 2V32A 3EYTA 4MPGA 3VURA 3M1GA 1C72A 4KCEA 1VF1A 2H74A 3HVSA 3Q19A 4IGJA 1G6WA 1J0FA 4JBBA 1RW1A 1EP8A 1GNEA 4BVXB 2PGTA 3DD3A 4PX1A 2DJJA 5J41A 2GQLA 1TK8B 3TJFA 1YQ1A 2WRTA 3GV1A 4OFTA 5IMVA 5IOXA 2MBTA 3WT1A 4TR3A 2GSQA 2YJHA 4V2MA 2C8UA 5EVOA 3FR6A 1ZYQB 4OFNA 2V1MA 1HNCA 4XHMA 1T4YA 1YF1A 1T4ZA 2PERA 3FY7A 5C04A 2HRNA 1O7UA 2FLSA 2YWOA 5EPFA 1JZDA 1GTIA 1FO5A 2C3NA 3R2QA 2H76A 2O7KA 4WKWA 2L4QA 4O5RA 1SU9A 1TXXA 3HJPA 2YZUA 3DWVA 2IMFA 4PUFC 1XCCA 3WYWA 3F3RA 1PD21 4FH8A 1H4OA 3LORA 1K3OA 3ZIVA 2DJ0A 8GSSA 1T1VA 1HYUA 2H75A 4KAEA 2VL9A 1WP0A 1ZZYA 7GSSA 1S3RA 3QFBC 1AXDA 3VWUA 3IHGA 3H93A 2P31A 3ZYWA 2I4AA 5ECPB 2KP2A 2CZ3A 3HY2A 2DBCA 5F0GA 4MA9A 4KDUA 1M7TA 2R37A 4GWRA 5DCHA 2GQMA 1X9MB 4Q5RA 2YN1A 3IAM2 4ZL7A 3BCIA 4ACSA 2ES7A 3GKKA 3E3EA 3HCZA 1OC8A 2DMLA 4LMVA 1AQXA 4HJ2A 3M9JA 3OR5A 4CHSA 3DEXA 2VCQA 3GHAA 5LD0A 3ZLPA 1VGLA 3CRTA 4I2UA 1K0CA 1OC9A 3CXGA 2YANA 1THXA 2R4VA 5AGYA 1ERUA 3IK7A 1SJ6A 3EMXA 2WZ9A 4LL1B 2GQKA 1ON4A 4IHUA 4XIHA 3VWXA 1T00A 2LEGA 3UBLA 4FIWA 5J5NA 1A0FA 4D73B 2N5BA 3CYNA 3FZAA 2H66A 2J23A 5G31A 3TKRA 1FOHA 3GL3A 4YAPA 1O85A 1XFLA 1SL1B 1YEPA 4MF5A 1K0OA 1GSYA 1F6MC 1LBKA 2KUCA 1OE7A 2QA2A 3MYDA 3GTUB 1OE8A 3C8EA 1EOHA 4EDYA 3ZIJA 2L5LA 2H1AA 5IQYA 1IYIA 2MMOA 1GP1A 3CTFA 3GUSA 3GH9A 2VD1A 4Q5QA 4TXOB 1KNGA 3UARA 3QR6A 2VLTA 4KH7A 2IFQB 3U6VA 5KN2A 3A3TA 1XPVA 5ENUA 1OKDA 4HDEA 4GQFA 4ECJA 4PNFA 4IBPA 3PPUA 4POLA 4KUNA 1XW9A 2Z9SA 5B6MA 1HQOA 1ERTA 2VM1A 1TRWA 4KGIA 3P8WA 1OAZA 4PXOA 1WMJA 2VL2C 5IMFA 1TU7A 1VF2A 4F82A 1DE1A 3HYPA 2LSTA 4KSMA 2P5RA 6GSYA 4ZB8A 3SBCA 4Z2TA 1PL1A 2J9HA 5G1KA 2CT6A 2WFCA 3KP9A 4MZCA 4ULXA 5JCGA 1GULA 1R4WA 4KNDA 2HZFA 5ECSA 3HZ8A 4FO5A 3IK9A 3PH9A 4X1UA 3TJBA 3W8SA 2UZ8A 3H8QA 2H19A 5KN3A 4BA7A 5HFKA 4Z2UA 3F9UA 2H72A 3P2AA 3DKSA 2C0FA 1F3BA 2OE3A 4EUYA 17GSA 2JZRA 3CQFA 4WBJA 1GH2A 3IV4A 2FWHA 3W6GA 3ZREA 4G0LA 4G0KA 2VO4A 5JCWA 2EIQA 4NV2A 3BOAA 6GSVA 5GAND 1Y25A 1WJKA 4K2XA 3ME7A 4XCSA 1PFOA 4TR4A 3VLNA 3EU4A 1OC9B 3D4TA 3ZITA 3ZRDA 5JCUA 2B5XA 1B48A 1TJDA 2GDRA 4OMVA 3C1RA 4USSA 4V2LA 3KMOA 4G10A 3BBYA 1Z7RA 2ON7A 5HR1A 2R0CA 5HFIA 1KTEA 3F6DA 4IJ3A 3HD5A 5D73A 2EIRA 3C1SA 3UVTA 2DJKA 5ELAA 4I8BA 1QQ2A 2MMZA 5IM9A 2DKHA 1U3AA 2GT5A 1YZXA 2K6VA 4WBRD 4JZQA 1NW2A 4NAXA 4OCEA 1NSWA 2VOCA 4PQIA 5ECQB 1ZYEA 4RQRA 2VLVA 3HJOA 5COHA 3L9VA 2A2PA 4KCAA 2VL2A 1GSSA 2MZCA 1TOFA 3IA1A 4MDCA 2B1LA 4EF0A 2R5GA 4MP4A 2FD3A 1A8YA 3GSTA 2GZPA 3UMAA 5FT3A 5B7CA 5G5FA 2PU9C 1QGVA 4F0CA 4NPBA 5CP1A 1XW5A 2XPDA 4XTSA 3TJJA 2F8AA 4MF6A 2E7PA 2IN3A 4MABA 4HQZA 1Z6MA 4AJ7A 2GZYA 3GURA 3TKPA 3TRXA 5AIXA 3VPQA 3H1NA 1WOUA 1GLQA 2FCHA 3IDVA 1BEDA 1QMVA 4KSOA 4H86A 3UEMA 2G2QA 4ZBBA 3KMNA 4XS6A 3SWLA 4I2TA 2FWFA 2JSZA 5KOWA 2HE3A 2H70A 3F63A 4MMMA 5DAKB 1ZYNA 2K8SA 3MDKA 3QCPA 3ZVJD 4KF9A 2VCTA 1FVKA 2C80A 4E8EA 5B8BA 3EC3A 4TR1B 5ECKB 5BRTA 3WGXA 2FHEA 3RHBA 1PKZA 4BL7B 2B7KA 2X64A 4HOJA 3TCOA 1X0RA 2WJUA 4IQAA 1U3IA 3KH9A 1H75A 1S3AA 3F4SA 1K0MA 2A4HA 2R3XA 4TKYA 5KN1A 5IO2A 3FMWA 1O8WA 3DMLA 4TR0A 2EIOA 2GVPA 1MD4A 1O8XA 3FR3A 3RPPA 4WF5A 3IPZA 4CY8A 3KJYA 1SK1A 3EMPA 2LS5A 3TRPA 2R2JA 2VCVA 4KA0A 4OCFA 5B6NA 1F37A 3QMXA 3UL3A 3CRUA 1FB0A 1ZOFA 5AIVA 1O6JA 3GSSA 3NIVA 4IJIA 4ZXGA 1TK0B 4L8EA 1MTCA 3HA9A 3LWAA 2HSHA 2AUVA 3IAS2 1TDIA 4CDOA 4YQVA 1Z5YE 3JCML 2HSMA 1HNAA 4MJAA 1ERVA 1QXHA 3C7MA 5LCZA 4DSSB 1PN9A 4WF4A 2H30A 4OWYA 2E2MA 1MDIA 2WULA 3LGCA 3ZZXA 1E6BA 2YNXA 4J2FA 1RQMA 1XOBA 4X43A 5HFGA 5CRGA 4IELA 2YCDA 4EDZA 3W8JA 3NOFA 2R0PA 1S3DA 3MNGA 1EEJA 3UVHA 1HD2A 1TRVA 3GL5A 2MBSA 1HNBA 5KEJA 1FB6A 2LQQA 4I97A 1EV9A 3BJ5A 3MWHA 1X9WB 2LRCA 2H1GA 1USBA 4NMUA 4O5QA 5JWQB 4HSCX 4PTSA 4PQ1A 1YKCA 4K7NA 2HYXA 4F9ZA 1W89A 3CSJA 4RI6A 2PPTA 4XS1A 3LSZA 5ECHB 2EC4A 1DE2A 4BVYA 5CYYA 1GUMA 2DJ2A 2YPMA 5CRWA 1PL2A 4PURA 2FY6A 1R5PA 3KTLA 3CSIA 4G0IA 1XG8A 2H73A 4QQ7A 3ZMLA 2K9FA 4MLYA 2CX4A 3DGQA 2VD0A 1K0BA 18GSA 5IMDA 2X8HA 4L0WA 1J08A 1JZRA 2LQOA 2IIYA 4ZBDA 1KEBA 5D8IA 3ZVJA 4ZL8A 1TK5B 4TN8A 3VI7A 2V41A 1OYJA 3I69A 3U5RE 4K7OA 5A5KA 1EV4A 4HZ4A 1V40A 4HU7A 2QKEA 3DIEA 2B3SA 3ISOA 3L4NA 2JADA 2CZ2A 1MD3A 4YQUA 2WB9A 3RDWA 1M9AA 5AN1A 1J9BA 4YQMA 5ECNB 1ILOA 4POKA 5G5EA 3GX0A 3KM6A 3KZQA 5A4UA 3IC4A 3A2WA 1WRYA 4O32A 3F3QA 4GSTA 2O8VB 4ECCA 3GKNA 3ZTLA 4PQHA 5D93A 3E9JB 4O5UA 2GSSA 2O87A 2DMMA 2RLIA 3LG6A 1B4PA 4BWQA 5HQPA 4OFMA 4GLTA 1YF0A 1E2YA 1XOAA 4EVMA 1DUGA 1M2AA 2ON5A 2CAIA 3GX8A 4X4JA 2K8VA 5DJMA 4TXVA 5DALB 1NHOA 3LW9A 3GNJA 2DLXA 1T3BA 3F4RA 4RI7A 3LEFA 4EIPA 4I6XA 2KOKA 1T8EB 1FW1A 3A2XA 1GSEA 3QAVA 4IP6A 3F4TA 4WR4A 1FOVA 3CTGA 4ICYA 2I1UA 2YJ7A 1Z3EA 4PUAA 3HKRA 2L5OA 3GFKA 2V2GA 3H79A 2HNLA 1G6YA 2GS3A 2WCIA 1PQNA 16GSA 3QPMA 4ML1A 5F07A 3WD6A 5LNKe 2VCXA 3IBHA 2DJ1A 3CMIA 3F0IA 2VIMA 3G7YA 1G7EA 4K5RA 4HU9A 2CX3A 1GUHA 4POMA 2NBSA 3HVVA 5C00A 1UC7A 1Z9HA 1SL0B 5ECIB 4KDYA 5D9XA 2YOIA 1Z6NA 2AAWA 13GSA 1XWBA 2PVQA 14GSA 3I9V2 3Q18A 3AY8A 1M3JA 4KB3A 3QD9A 5J9CA 1PN0A 2QC7A 4AJ8A 4K1FA 1WWJA 4NHWA 3LXTA 1Z7PA 1A2JA 4MH3A 1GSFA 4NWYA 3HVXA 5GAPD 5CRHA 3E0UA 4AGSA 3F6FA 3FZ9A 2B5EA 4GSSA 2C0GA 4HI7A 3VK9A 1SL2B 3FRCA 3HDCA 2H8LA 5G30A 3GRXA 3RHCA 2VCZA 1SKSB 5D96A 4F03A 2NPBA 5J9BA 1MDJA 1B9XC 4HZ2A 1SK2A 4L5OA 4MPFA 4RQXA 4WETA 4K5SA 5GSSA 2ZNMA 4P3YB 2RM5A 1BJXA 1GSUA 2PVOC 3KP8A 1CQHA 4DEJA 2H0GA 2O85A 3H4KA 3VI5A 1GSDA 3V1WA 1R7HA 1BG5A 4N10A 2OACA 4N0VA 4TRXA 4N11A 1XWAA 2C0EA 2I3YA 3MSZA 5E4WA 3N5OA 3UIWA 4IQ1A 4MCUA 3GA4A 5DVBA 4FQUA 1ZYPA 2TRXA 2L6CA 3MIXA 5JWRB 2YWNA
chains in the Genus database with same CATH topology
2GT6A 1SD8A 2NVLA 2HI7A 1IYHA 4I5QA 1XIYA 5IMZA 2OE0A 2C3TA 1PRXA 1LU4A 2GGTA 2FUG2 3LXZA 2MMNA 3FKFA 3P90A 2OE1A 1SK0A 1X5CA 1F3AA 1F9MA 4L0UA 3K8NA 3LFLA 4OD7A 4MF7A 3MAKA 1TI1A 1TRUA 4LLRA 2AYTA 3D4MA 1DBYA 1V2AA 4DSQA 3FZ4A 4G2EA 3FK8A 2V6KA 1SYXA 5D9VA 4EXJA 4V1Ag 2RUFA 2ZUPA 3R3EA 1JHBA 1M9BA 2NTOA 3HHVA 3FHKA 3KTBA 2N5AA 2QA1A 3WT2A 1GSQA 4ZIJA 1AIUA 1MEKA 2HRKA 1AC1A 2F8FA 4XS4A 1ACVA 2QSIA 1ZCPA 1PX6A 1SYRA 3CBUA 4ZL9A 1X5EA 1EGRA 4KDXA 4KE3A 1A24A 2CQ9A 5ECLB 5GZZB 2M72A 1OKTA 5A4VA 3EINA 2BJXA 4JEDA 4A5PA 3G7IA 1JZWA 1A2MA 2LJRA 1SJIA 4XRAA 1V9WA 1FG4A 2JZSA 2H0HA 5DQYA 4X0XA 1BQ7A 4DSRA 1I9DA 5ELGA 3EPTA 5DQSA 2QGVA 1FVJA 3DVXA 3BCKA 2LTKA 3US3A 1A8LA 4O92A 3IXRA 2R6KA 5E59A 3FR9A 4MZBA 1SKRB 3GN3A 2H0IA 1EEMA 4EC0A 2I81A 2JACA 4N30A 3KXOA 2X4AA 2NDOA 1JLWA 2A2SA 3TOUA 5CRDA 2XHFA 4FYBA 1AUCA 5HR2A 4MJEA 3FW2A 1AAZA 4YH2A 4AF2A 4IVFA 4DVCA 3WGEA 3M0FA 6GSUA 2OKAA 2HZEA 2FGXA 1XXUA 5KOXA 4IW9A 3LJRA 5DBQA 2IL3A 1M2DA 2L59A 3D21A 4L5LA 3ERGA 5KN0A 3C71A 3HXSA 3UBKA 3GKMA 1SJZA 1B9YC 4Z7XA 4TVEA 4WEYA 3IR4A 3S9FA 5HR3A 3KIJA 3UOMA 3TB2A 3ERFA 2M46A 2DIZA 2R0GA 2C4JA 2LNSA 1G7OA 1CQGA 3GIXA 2REMA 1XWGA 1NM3A 2P0GA 2X8GA 2RM6A 3KH7A 5ECMB 5IMAA 2AV4A 2WGRA 3D0ZA 5G2ZA 5L71A 1YJ6A 5IMCA 1SKWB 4J57E 2CVKA 4GXZA 5BMUA 3EE2A 3TDGA 2TRCP 2OBIA 4EL1A 2O89A 1JLVA 3ZL5A 5H5QA 3PGTA 4D73A 1T7PB 4ZB6A 1AQWA 4MJBA 4GQCA 2HSYA 3QFAC 5D9TA 4G9HA 2F51A 2IWTA 2C3QA 5CREA 4J56E 4XS4B 5CO3A 1UVZA 2D2ZA 3GTUA 3N9JA 1G0TA 1N8JA 3HZ4A 1EZKA 5CAXA 5IOWA 4JE1A 3GH6A 3EURA 4HJMA 1K3YA 2FWGA 1DSBA 2MYGA 4TXOA 3EVIA 5F05A 4LA1A 4OO5A 2IFQA 1S3CA 1XVQA 3PINA 1TTZA 3GYKA 2LJAA 2DSAA 4CW9A 2DJ3A 2HRAA 2OBKA 2H1BA 4K6XA 1U6TA 4RUVA 1WE0A 4YAVA 3FZ5A 5HR0A 9GSSA 3APSA 3VWWA 4K9ZA 2GSRA 5FHIA 5ID2A 3LQ7A 4MJCA 4K0NA 4BWSA 4ECIA 1LJRA 2VLUA 4YKFA 1OVNA 3P7XA 4ILFA 4V1Ap 3EU3A 4KX4A 5IIZA 11GSA 5F06A 2HZEB 3QAGA 5ECOB 3PR8A 1MDKA 4NHZA 1ERWA 1FHEA 3F8UA 4MNNA 3TKSE 3TKQA 4GCIA 2YWIA 2VCWA 2YP6A 3DVWA 1EGOA 3DXBA 2LKUA 2X8CA 4LL4B 4MZWA 2AHEA 1PMTA 3WGDA 2IJYA 2HXKA 2M80A 2TIRA 4O7HA 2N5FA 1PSQA 1TKDB 1K0AA 5AISA 2ALBA 2A2RA 3ZFBA 1X5DA 2XBIA 2YZHA 3ERWA 1Q98A 3A5IA 1B8XA 3ED3A 1V98A 1RK4A 2GTUA 2ZCTA 3RPNA 2CAQA 3KD0A 2A4VA 4ZBAA 5H5RA 3D6IA 1GRXA 3QAWA 1BX9A 3L78A 3VPTA 4GF0A 1U87A 1GL8A 1K3LA 1N2AA 2JL4A 4Z2RA 3GKXA 3Q6OA 1WIKA 3IRAA 5FWGA 4WXTA 3IHQA 4FYCA 1QK8A 3KGKA 3ME8A 2KLXA 1B4QA 4Q5NA 2F3MA 4LMWA 1K0DA 3APOA 2B7JA 2HFDA 2DC5A 1XZOA 1TW9A 2X49A 5DJLA 2DKIA 3VWVA 6GSSA 3GMFA 2H01A 2HRFA 3CSHA 2PWJA 1XW6A 1XWKA 5ABRA 1F2EA 2CVBA 2YV7A 1R5AA 2FA8A 2V6OA 2IPAA 4BVYB 3L0HA 3M8NA 3IE3A 1X9SB 1YKAA 3M3MA 1AW9A 3EWLA 5CNWA 2VUPA 1FAAA 3KCMA 1URMA 3O6TA 4GRFA 4K0GA 3J7Yk 3O76A 1GTUA 5GSTA 1WPIA 1JZOA 1BYEA 5A4WA 3FEUA 1THOA 2H1DA 1AQVA 2FWEA 6GSTA 4TOPA 4HEA2 1PGTA 1QUWA 5ID2B 2BTOT 4TW5A 6GSXA 2LJKA 4JRRA 2AB6A 1ABAA 1I5GA 2I9HA 2WDUA 2YWMA 3QOUA 3TGZA 4BPYA 2VL3A 2LRTA 2FNOA 4HS1A 1R26A 5DAKA 1A23A 3NZNA 3G7JA 2AJQB 4TR1A 4MK3A 4K8MA 4GTUA 1YY7A 4MH2A 5H5SA 5JWOB 1TU8A 2OADA 4ISDA 4BL7A 3C73A 4K2DA 2KP1A 4PNGA 4POBA 3DRNA 2RIIA 1ZMAA 2HT9A 4Q5FA 5IPGA 1GTBA 5G1LA 1Q4JA 5EY6A 3DYRA 3ZFLA 2B6MA 3HJMA 4XRDA 1VF4A 1TI3A 2L4CA 3APQA 2P5QA 4OO4A 1M99A 2MMAA 4NV5A 4G19A 2VM2A 1YEXA 1EP7A 3D5JA 3UAPA 3L9UA 3TUEA 3O3TA 2LUSA 1XVWA 2XC2A 3KEBA 10GSA 3TKSC 2FA4A 1ZL9A 2H6ZA 2H6YA 2H71A 1XWCA 3QDNA 4IN0A 3BD2A 2CV4A 3TOTA 2XPEA 4IKHA 1EOGA 3G9BA 2IMIA 3L9SA 4DSSA 1EWXA 1JFUA 5F8BA 3D22A 4N0ZA 2GLRA 4ZILA 6GSWA 2LRNA 2E2GA 4BVXA 4F2IA 3RBTA 2L6DA 1V58A 5EL8A 2OJLA 3TRQA 2GSTA 4ML6A 4YKGA 1M2BA 4NXIA 1KBNA 3UJ1A 4PGTA 4QL9A 2LV3A 2DIYA 1A2LA 3IOSA 1SENA 3M9KA 4E8HA 1GUKA 3FYGA 4HUAA 2CA8A 5INYA 1O81A 2PMTA 4ID0A 4KW6A 2F9SA 4CY6A 19GSA 4V2NA 1VF3A 2PUKC 1NHYA 4EO3A 1K0NA 2B5YA 4QL7A 2E0QA 2CVDA 1M0UA 1QFNA 3RAZA 3IC8A 3VFIA 2OA7A 5IO0A 1TP9A 2K18A 4K7IA 2H6XA 1GWCA 1O73A 1OC3A 5IPHA 1PKWA 2JU5A 1ML6A 1SD9A 2C1YA 4JR6A 1TRSA 3Q74A 3LYKA 1Y6EA 2G0FA 1VRSD 4EIQA 2L57A 2JSYA 2WS2A 1PX7A 2VAFA 2IMKA 1YDKA 2HLSA 1U88A 2GZZA 2IMEA 3LYPA 5D9WA 4GSNA 1XBSA 5ECRB 3A2VA 4WR5A 4JU5A 5DCGA 4F0BA 1PA3A 4EE0A 2PBJA 1A0RP 2KHPA 2RUEA 1GTAA 2IMDA 3TJGA 4IS0A 3TKSA 1V57A 4FYUA 20GSA 4ECBA 1GNWA 2X99A 5J3RA 1W4VA 1UN2A 2JZTA 3A5WA 5B8AA 4IP1A 4ZB9A 4EKZA 4HQSA 1BAYA 1ZGNA 3TJKA 2PN8A 5J4UA 3J7Yb 2C0DA 22GSA 5DALA 4JR4A 2XBQA 2LNTA 2B1KA 1GLPA 4AJ6A 3I43A 1UA5A 2BMXA 3I6AA 5DDLA 2YV9A 3ZMKA 12GSA 1ST9A 2V32A 3EYTA 4MPGA 3VURA 3M1GA 1C72A 4KCEA 1VF1A 2H74A 3HVSA 3Q19A 4IGJA 1G6WA 1J0FA 4JBBA 1RW1A 1EP8A 1GNEA 4BVXB 2PGTA 3DD3A 4PX1A 2DJJA 5J41A 2GQLA 1TK8B 3TJFA 1YQ1A 2WRTA 3GV1A 4OFTA 5IMVA 5IOXA 2MBTA 3WT1A 4TR3A 2GSQA 2YJHA 4V2MA 2C8UA 5EVOA 3FR6A 1ZYQB 4OFNA 2V1MA 1HNCA 4XHMA 1T4YA 1YF1A 1T4ZA 2PERA 3FY7A 5C04A 2HRNA 1O7UA 2FLSA 2YWOA 5EPFA 1JZDA 1GTIA 1FO5A 2C3NA 3R2QA 2H76A 2O7KA 4WKWA 2L4QA 4O5RA 1SU9A 1TXXA 3HJPA 2YZUA 3DWVA 2IMFA 4PUFC 1XCCA 3WYWA 3F3RA 1PD21 4FH8A 1H4OA 3LORA 1K3OA 3ZIVA 2DJ0A 8GSSA 1T1VA 1HYUA 2H75A 4KAEA 2VL9A 1WP0A 1ZZYA 7GSSA 3QFBC 1AXDA 3VWUA 3IHGA 3H93A 2P31A 3ZYWA 2I4AA 5ECPB 2KP2A 2CZ3A 3HY2A 2DBCA 5F0GA 4MA9A 4KDUA 1M7TA 2R37A 4GWRA 5DCHA 2GQMA 1X9MB 4Q5RA 2YN1A 3IAM2 4ZL7A 3BCIA 4ACSA 2ES7A 3GKKA 3E3EA 3HCZA 1OC8A 2DMLA 4LMVA 1AQXA 4HJ2A 3M9JA 3OR5A 4CHSA 3DEXA 2VCQA 3GHAA 5LD0A 3ZLPA 1VGLA 3CRTA 4I2UA 1K0CA 1OC9A 3CXGA 2YANA 1THXA 2R4VA 5AGYA 1ERUA 3IK7A 1SJ6A 3EMXA 2WZ9A 4LL1B 2GQKA 1ON4A 4IHUA 4XIHA 3VWXA 1T00A 2LEGA 3UBLA 4FIWA 5J5NA 1A0FA 4D73B 2N5BA 3CYNA 3FZAA 2H66A 2J23A 5G31A 3TKRA 1FOHA 3GL3A 4YAPA 1O85A 1XFLA 1SL1B 1YEPA 4MF5A 1K0OA 1GSYA 1F6MC 1LBKA 2KUCA 1OE7A 2QA2A 3MYDA 3GTUB 1OE8A 3C8EA 1EOHA 4EDYA 3ZIJA 2L5LA 2H1AA 5IQYA 1IYIA 2MMOA 1GP1A 3CTFA 3GUSA 3GH9A 2VD1A 4Q5QA 4TXOB 1KNGA 3UARA 3QR6A 2VLTA 4KH7A 2IFQB 3U6VA 5KN2A 3A3TA 1XPVA 5ENUA 1OKDA 4HDEA 4GQFA 4ECJA 4PNFA 4IBPA 3PPUA 4POLA 4KUNA 1XW9A 2Z9SA 5B6MA 1HQOA 1ERTA 2VM1A 1TRWA 4KGIA 3P8WA 1OAZA 4PXOA 1WMJA 2VL2C 5IMFA 1TU7A 1VF2A 4F82A 1DE1A 3HYPA 2LSTA 4KSMA 2P5RA 6GSYA 4ZB8A 3SBCA 4Z2TA 1PL1A 2J9HA 5G1KA 2CT6A 2WFCA 3KP9A 4MZCA 4ULXA 5JCGA 1GULA 1R4WA 4KNDA 2HZFA 5ECSA 3HZ8A 4FO5A 3IK9A 3PH9A 4X1UA 3TJBA 3W8SA 2UZ8A 3H8QA 2H19A 5KN3A 4BA7A 5HFKA 4Z2UA 3F9UA 2H72A 3P2AA 3DKSA 2C0FA 1F3BA 2OE3A 4EUYA 17GSA 2JZRA 4WBJA 1GH2A 3IV4A 2FWHA 3W6GA 3ZREA 4G0LA 4G0KA 2VO4A 5JCWA 2EIQA 4NV2A 3BOAA 6GSVA 5GAND 1Y25A 1WJKA 4K2XA 3ME7A 4XCSA 4TR4A 3VLNA 3EU4A 1OC9B 3D4TA 3ZITA 3ZRDA 5JCUA 2B5XA 1B48A 1TJDA 2GDRA 4OMVA 3C1RA 4USSA 4V2LA 3KMOA 4G10A 3BBYA 1Z7RA 2ON7A 5HR1A 2R0CA 5HFIA 1KTEA 3F6DA 4IJ3A 3HD5A 5D73A 2EIRA 3C1SA 3UVTA 2DJKA 5ELAA 4I8BA 1QQ2A 2MMZA 5IM9A 2DKHA 1U3AA 2GT5A 1YZXA 2K6VA 4WBRD 4JZQA 1NW2A 4NAXA 4OCEA 1NSWA 2VOCA 4PQIA 5ECQB 1ZYEA 4RQRA 2VLVA 3HJOA 5COHA 3L9VA 2A2PA 4KCAA 2VL2A 1GSSA 2MZCA 1TOFA 3IA1A 4MDCA 2B1LA 4EF0A 2R5GA 4MP4A 2FD3A 1A8YA 3GSTA 2GZPA 3UMAA 5FT3A 5B7CA 5G5FA 2PU9C 1QGVA 4F0CA 4NPBA 5CP1A 1XW5A 2XPDA 4XTSA 3TJJA 2F8AA 4MF6A 2E7PA 2IN3A 4MABA 4HQZA 1Z6MA 4AJ7A 2GZYA 3GURA 3TKPA 3TRXA 5AIXA 3VPQA 3H1NA 1WOUA 1GLQA 2FCHA 3IDVA 1BEDA 1QMVA 4KSOA 4H86A 3UEMA 2G2QA 4ZBBA 3KMNA 4XS6A 3SWLA 4I2TA 2FWFA 2JSZA 5KOWA 2HE3A 2H70A 3F63A 4MMMA 5DAKB 1ZYNA 2K8SA 3MDKA 3QCPA 3ZVJD 4KF9A 2VCTA 1FVKA 2C80A 4E8EA 5B8BA 3EC3A 4TR1B 5ECKB 5BRTA 3WGXA 2FHEA 3RHBA 1PKZA 4BL7B 2B7KA 2X64A 4HOJA 3TCOA 1X0RA 2WJUA 4IQAA 1U3IA 3KH9A 1H75A 1S3AA 3F4SA 1K0MA 2A4HA 2R3XA 4TKYA 5KN1A 5IO2A 3FMWA 1O8WA 3DMLA 4TR0A 2EIOA 2GVPA 1MD4A 1O8XA 3FR3A 3RPPA 4WF5A 3IPZA 4CY8A 3KJYA 1SK1A 3EMPA 2LS5A 3TRPA 2R2JA 2VCVA 4KA0A 4OCFA 5B6NA 1F37A 3QMXA 3UL3A 3CRUA 1FB0A 1ZOFA 5AIVA 1O6JA 3GSSA 3NIVA 4IJIA 4ZXGA 1TK0B 4L8EA 1MTCA 3HA9A 3LWAA 2HSHA 2AUVA 3IAS2 1TDIA 4CDOA 4YQVA 1Z5YE 3JCML 2HSMA 1HNAA 4MJAA 1ERVA 1QXHA 3C7MA 5LCZA 4DSSB 1PN9A 4WF4A 2H30A 4OWYA 2E2MA 1MDIA 2WULA 3LGCA 3ZZXA 1E6BA 2YNXA 4J2FA 1RQMA 1XOBA 4X43A 5HFGA 5CRGA 4IELA 2YCDA 4EDZA 3W8JA 3NOFA 2R0PA 1S3DA 3MNGA 1EEJA 3UVHA 1HD2A 1TRVA 3GL5A 2MBSA 1HNBA 5KEJA 1FB6A 2LQQA 4I97A 1EV9A 3BJ5A 3MWHA 1X9WB 2LRCA 2H1GA 1USBA 4NMUA 4O5QA 5JWQB 4PTSA 4PQ1A 1YKCA 4K7NA 2HYXA 4F9ZA 1W89A 3CSJA 4RI6A 2PPTA 4XS1A 3LSZA 5ECHB 2EC4A 1DE2A 4BVYA 5CYYA 1GUMA 2DJ2A 2YPMA 5CRWA 1PL2A 4PURA 2FY6A 1R5PA 3KTLA 3CSIA 4G0IA 2H73A 4QQ7A 3ZMLA 2K9FA 4MLYA 2CX4A 3DGQA 2VD0A 1K0BA 18GSA 5IMDA 2X8HA 4L0WA 1J08A 1JZRA 2LQOA 2IIYA 4ZBDA 1KEBA 5D8IA 3ZVJA 4ZL8A 1TK5B 4TN8A 3VI7A 2V41A 1OYJA 3I69A 3U5RE 4K7OA 5A5KA 1EV4A 4HZ4A 1V40A 4HU7A 2QKEA 3DIEA 2B3SA 3ISOA 3L4NA 2JADA 2CZ2A 1MD3A 4YQUA 2WB9A 3RDWA 1M9AA 5AN1A 1J9BA 4YQMA 5ECNB 1ILOA 4POKA 5G5EA 3GX0A 3KM6A 3KZQA 5A4UA 3IC4A 3A2WA 1WRYA 4O32A 3F3QA 4GSTA 2O8VB 4ECCA 3GKNA 3ZTLA 4PQHA 5D93A 3E9JB 4O5UA 2GSSA 2O87A 2DMMA 2RLIA 3LG6A 1B4PA 4BWQA 5HQPA 4OFMA 4GLTA 1YF0A 1E2YA 1XOAA 4EVMA 1DUGA 1M2AA 2ON5A 2CAIA 3GX8A 4X4JA 2K8VA 5DJMA 4TXVA 5DALB 1NHOA 3LW9A 3GNJA 2DLXA 1T3BA 3F4RA 4RI7A 3LEFA 4EIPA 4I6XA 2KOKA 1T8EB 1FW1A 3A2XA 1GSEA 3QAVA 4IP6A 3F4TA 4WR4A 1FOVA 3CTGA 4ICYA 2I1UA 2YJ7A 1Z3EA 4PUAA 3HKRA 2L5OA 3GFKA 2V2GA 3H79A 2HNLA 1G6YA 2GS3A 2WCIA 1PQNA 16GSA 3QPMA 4ML1A 5F07A 3WD6A 5LNKe 2VCXA 3IBHA 2DJ1A 3CMIA 3F0IA 2VIMA 3G7YA 1G7EA 4K5RA 4HU9A 2CX3A 1GUHA 4POMA 2NBSA 3HVVA 5C00A 1UC7A 1Z9HA 1SL0B 5ECIB 4KDYA 5D9XA 2YOIA 1Z6NA 2AAWA 13GSA 1XWBA 2PVQA 14GSA 3I9V2 3Q18A 3AY8A 4KB3A 3QD9A 5J9CA 1PN0A 2QC7A 4AJ8A 4K1FA 1WWJA 4NHWA 3LXTA 1Z7PA 1A2JA 4MH3A 1GSFA 4NWYA 3HVXA 5GAPD 5CRHA 3E0UA 4AGSA 3F6FA 3FZ9A 2B5EA 4GSSA 2C0GA 4HI7A 3VK9A 1SL2B 3FRCA 3HDCA 2H8LA 5G30A 3GRXA 3RHCA 2VCZA 1SKSB 5D96A 4F03A 2NPBA 5J9BA 1MDJA 1B9XC 4HZ2A 1SK2A 4L5OA 4MPFA 4RQXA 4WETA 4K5SA 5GSSA 2ZNMA 4P3YB 2RM5A 1BJXA 1GSUA 2PVOC 3KP8A 1CQHA 4DEJA 2H0GA 2O85A 3H4KA 3VI5A 1GSDA 3V1WA 1R7HA 1BG5A 4N10A 2OACA 4N0VA 4TRXA 4N11A 1XWAA 2C0EA 2I3YA 3MSZA 5E4WA 3N5OA 3UIWA 4IQ1A 4MCUA 3GA4A 5DVBA 4FQUA 1ZYPA 2TRXA 2L6CA 3MIXA 5JWRB 2YWNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GT6 A;  1SD8 A;  2NVL A;  2HI7 A;  1IYH A;  4I5Q A;  1XIY A;  5IMZ A;  2OE0 A;  2C3T A;  1PRX A;  1LU4 A;  2GGT A;  2FUG 2;  3LXZ A;  2MMN A;  3FKF A;  3P90 A;  2OE1 A;  1SK0 A;  1X5C A;  1F3A A;  1F9M A;  4L0U A;  3K8N A;  3LFL A;  4OD7 A;  4MF7 A;  3MAK A;  1TI1 A;  1TRU A;  4LLR A;  2AYT A;  3D4M A;  1DBY A;  1V2A A;  4DSQ A;  3FZ4 A;  4G2E A;  3FK8 A;  2V6K A;  1SYX A;  5D9V A;  4EXJ A;  4V1A g;  2RUF A;  2ZUP A;  1JHB A;  1M9B A;  2NTO A;  3HHV A;  3FHK A;  3KTB A;  2N5A A;  3WT2 A;  1GSQ A;  4ZIJ A;  1AIU A;  1MEK A;  1AC1 A;  2F8F A;  4XS4 A;  1ACV A;  2QSI A;  1ZCP A;  1PX6 A;  1SYR A;  3CBU A;  4ZL9 A;  1X5E A;  1EGR A;  4KDX A;  4KE3 A;  1A24 A;  2CQ9 A;  5ECL B;  5GZZ B;  2M72 A;  1OKT A;  5A4V A;  3EIN A;  2BJX A;  4JED A;  3G7I A;  1JZW A;  1A2M A;  2LJR A;  1SJI A;  4XRA A;  1V9W A;  1FG4 A;  2JZS A;  2H0H A;  5DQY A;  4X0X A;  1BQ7 A;  4DSR A;  1I9D A;  5ELG A;  5DQS A;  2QGV A;  1FVJ A;  3DVX A;  3BCK A;  2LTK A;  3US3 A;  1A8L A;  4O92 A;  3IXR A;  2R6K A;  5E59 A;  3FR9 A;  4MZB A;  1SKR B;  3GN3 A;  2H0I A;  1EEM A;  4EC0 A;  2I81 A;  2JAC A;  4N30 A;  3KXO A;  2NDO A;  1JLW A;  2A2S A;  3TOU A;  5CRD A;  2XHF A;  4FYB A;  1AUC A;  5HR2 A;  4MJE A;  3FW2 A;  1AAZ A;  4YH2 A;  4AF2 A;  4IVF A;  4DVC A;  3WGE A;  3M0F A;  6GSU A;  2OKA A;  2HZE A;  2FGX A;  1XXU A;  4IW9 A;  3LJR A;  5DBQ A;  2IL3 A;  1M2D A;  2L59 A;  3D21 A;  4L5L A;  3ERG A;  5KN0 A;  3C71 A;  3HXS A;  3UBK A;  3GKM A;  1SJZ A;  1B9Y C;  4Z7X A;  4TVE A;  4WEY A;  3IR4 A;  3S9F A;  5HR3 A;  3KIJ A;  3UOM A;  3TB2 A;  3ERF A;  2M46 A;  2DIZ A;  2C4J A;  2LNS A;  1G7O A;  1CQG A;  3GIX A;  2REM A;  1XWG A;  1NM3 A;  2P0G A;  2X8G A;  2RM6 A;  3KH7 A;  5ECM B;  5IMA A;  2AV4 A;  2WGR A;  3D0Z A;  5G2Z A;  5L71 A;  1YJ6 A;  5IMC A;  1SKW B;  4J57 E;  2CVK A;  4GXZ A;  3EE2 A;  3TDG A;  2TRC P;  2OBI A;  4EL1 A;  2O89 A;  1JLV A;  3ZL5 A;  5H5Q A;  3PGT A;  4D73 A;  1T7P B;  4ZB6 A;  1AQW A;  4MJB A;  4GQC A;  2HSY A;  3QFA C;  5D9T A;  4G9H A;  2F51 A;  2IWT A;  2C3Q A;  5CRE A;  4J56 E;  4XS4 B;  5CO3 A;  1UVZ A;  2D2Z A;  3GTU A;  3N9J A;  1G0T A;  1N8J A;  3HZ4 A;  1EZK A;  5CAX A;  5IOW A;  4JE1 A;  3GH6 A;  3EUR A;  4HJM A;  1K3Y A;  2FWG A;  1DSB A;  2MYG A;  4TXO A;  3EVI A;  5F05 A;  4LA1 A;  4OO5 A;  2IFQ A;  1S3C A;  1XVQ A;  3PIN A;  1TTZ A;  3GYK A;  2LJA A;  2DSA A;  4CW9 A;  2DJ3 A;  2OBK A;  2H1B A;  4K6X A;  1U6T A;  4RUV A;  1WE0 A;  4YAV A;  3FZ5 A;  5HR0 A;  9GSS A;  3APS A;  3VWW A;  4K9Z A;  2GSR A;  5FHI A;  5ID2 A;  3LQ7 A;  4MJC A;  4K0N A;  4BWS A;  4ECI A;  1LJR A;  2VLU A;  1OVN A;  3P7X A;  4ILF A;  4V1A p;  3EU3 A;  4KX4 A;  5IIZ A;  11GS A;  5F06 A;  2HZE B;  3QAG A;  5ECO B;  3PR8 A;  1MDK A;  4NHZ A;  1ERW A;  1FHE A;  3F8U A;  3TKS E;  3TKQ A;  4GCI A;  2YWI A;  2VCW A;  2YP6 A;  3DVW A;  1EGO A;  3DXB A;  2LKU A;  2X8C A;  4LL4 B;  4MZW A;  2AHE A;  1PMT A;  3WGD A;  2IJY A;  2HXK A;  2M80 A;  2TIR A;  4O7H A;  2N5F A;  1PSQ A;  1TKD B;  1K0A A;  5AIS A;  2ALB A;  2A2R A;  3ZFB A;  1X5D A;  2XBI A;  2YZH A;  3ERW A;  1Q98 A;  1B8X A;  3ED3 A;  1V98 A;  1RK4 A;  2GTU A;  2ZCT A;  3RPN A;  2CAQ A;  3KD0 A;  2A4V A;  4ZBA A;  5H5R A;  3D6I A;  1GRX A;  3QAW A;  1BX9 A;  3L78 A;  3VPT A;  4GF0 A;  1U87 A;  1GL8 A;  1K3L A;  1N2A A;  2JL4 A;  3GKX A;  3Q6O A;  1WIK A;  3IRA A;  5FWG A;  4WXT A;  3IHQ A;  4FYC A;  1QK8 A;  3KGK A;  3ME8 A;  2KLX A;  1B4Q A;  4Q5N A;  2F3M A;  4LMW A;  1K0D A;  3APO A;  2B7J A;  2HFD A;  2DC5 A;  1XZO A;  1TW9 A;  5DJL A;  3VWV A;  6GSS A;  3GMF A;  2H01 A;  2HRF A;  3CSH A;  2PWJ A;  1XW6 A;  1XWK A;  5ABR A;  1F2E A;  2CVB A;  2YV7 A;  1R5A A;  2FA8 A;  2V6O A;  2IPA A;  3L0H A;  3M8N A;  3IE3 A;  1X9S B;  1YKA A;  3M3M A;  1AW9 A;  3EWL A;  5CNW A;  2VUP A;  1FAA A;  3KCM A;  1URM A;  3O6T A;  4GRF A;  4K0G A;  3J7Y k;  3O76 A;  1GTU A;  5GST A;  1WPI A;  1JZO A;  1BYE A;  5A4W A;  3FEU A;  1THO A;  2H1D A;  1AQV A;  2FWE A;  6GST A;  4TOP A;  4HEA 2;  1PGT A;  1QUW A;  5ID2 B;  2BTO T;  4TW5 A;  6GSX A;  2LJK A;  4JRR A;  2AB6 A;  1ABA A;  1I5G A;  2I9H A;  2WDU A;  2YWM A;  3QOU A;  3TGZ A;  4BPY A;  2VL3 A;  2LRT A;  2FNO A;  4HS1 A;  1R26 A;  5DAK A;  1A23 A;  3NZN A;  3G7J A;  2AJQ B;  4TR1 A;  4MK3 A;  4K8M A;  4GTU A;  1YY7 A;  4MH2 A;  5H5S A;  5JWO B;  1TU8 A;  2OAD A;  4ISD A;  4BL7 A;  3C73 A;  4K2D A;  2KP1 A;  4PNG A;  4POB A;  3DRN A;  2RII A;  1ZMA A;  2HT9 A;  4Q5F A;  5IPG A;  1GTB A;  5G1L A;  1Q4J A;  5EY6 A;  3DYR A;  3ZFL A;  2B6M A;  3HJM A;  4XRD A;  1VF4 A;  1TI3 A;  2L4C A;  3APQ A;  2P5Q A;  4OO4 A;  1M99 A;  2MMA A;  4NV5 A;  4G19 A;  2VM2 A;  1YEX A;  1EP7 A;  3D5J A;  3UAP A;  3L9U A;  3TUE A;  3O3T A;  2LUS A;  1XVW A;  2XC2 A;  3KEB A;  10GS A;  3TKS C;  2FA4 A;  1ZL9 A;  2H6Z A;  2H6Y A;  2H71 A;  1XWC A;  3QDN A;  4IN0 A;  3BD2 A;  2CV4 A;  3TOT A;  2XPE A;  4IKH A;  1EOG A;  3G9B A;  2IMI A;  3L9S A;  4DSS A;  1EWX A;  1JFU A;  5F8B A;  3D22 A;  4N0Z A;  2GLR A;  4ZIL A;  6GSW A;  2LRN A;  2E2G A;  4BVX A;  4F2I A;  3RBT A;  2L6D A;  1V58 A;  5EL8 A;  2OJL A;  3TRQ A;  2GST A;  4ML6 A;  1M2B A;  4NXI A;  1KBN A;  3UJ1 A;  4PGT A;  4QL9 A;  2LV3 A;  2DIY A;  1A2L A;  3IOS A;  1SEN A;  3M9K A;  4E8H A;  1GUK A;  3FYG A;  4HUA A;  2CA8 A;  5INY A;  1O81 A;  2PMT A;  4ID0 A;  4KW6 A;  2F9S A;  19GS A;  4V2N A;  1VF3 A;  2PUK C;  1NHY A;  4EO3 A;  1K0N A;  2B5Y A;  4QL7 A;  2E0Q A;  2CVD A;  1M0U A;  1QFN A;  3RAZ A;  3VFI A;  2OA7 A;  5IO0 A;  1TP9 A;  2K18 A;  4K7I A;  2H6X A;  1GWC A;  1O73 A;  1OC3 A;  5IPH A;  1PKW A;  2JU5 A;  1ML6 A;  1SD9 A;  2C1Y A;  4JR6 A;  1TRS A;  3Q74 A;  3LYK A;  1Y6E A;  2G0F A;  1VRS D;  2L57 A;  2JSY A;  2WS2 A;  1PX7 A;  2VAF A;  2IMK A;  1YDK A;  2HLS A;  1U88 A;  2GZZ A;  2IME A;  3LYP A;  5D9W A;  4GSN A;  1XBS A;  5ECR B;  3A2V A;  4WR5 A;  4JU5 A;  5DCG A;  4F0B A;  1PA3 A;  4EE0 A;  2PBJ A;  1A0R P;  2KHP A;  2RUE A;  1GTA A;  2IMD A;  3TJG A;  4IS0 A;  3TKS A;  1V57 A;  4FYU A;  20GS A;  4ECB A;  1GNW A;  2X99 A;  5J3R A;  1W4V A;  1UN2 A;  2JZT A;  3A5W A;  5B8A A;  4IP1 A;  4ZB9 A;  4EKZ A;  4HQS A;  1BAY A;  1ZGN A;  3TJK A;  2PN8 A;  5J4U A;  3J7Y b;  2C0D A;  22GS A;  5DAL A;  4JR4 A;  2XBQ A;  2LNT A;  2B1K A;  1GLP A;  4AJ6 A;  3I43 A;  1UA5 A;  2BMX A;  3I6A A;  5DDL A;  2YV9 A;  3ZMK A;  12GS A;  1ST9 A;  2V32 A;  3EYT A;  4MPG A;  3VUR A;  3M1G A;  1C72 A;  4KCE A;  1VF1 A;  2H74 A;  3HVS A;  3Q19 A;  4IGJ A;  1G6W A;  1J0F A;  4JBB A;  1RW1 A;  1EP8 A;  1GNE A;  2PGT A;  3DD3 A;  4PX1 A;  2DJJ A;  5J41 A;  2GQL A;  1TK8 B;  3TJF A;  1YQ1 A;  2WRT A;  3GV1 A;  4OFT A;  5IMV A;  5IOX A;  2MBT A;  3WT1 A;  4TR3 A;  2GSQ A;  2YJH A;  4V2M A;  5EVO A;  2C8U A;  3FR6 A;  1ZYQ B;  4OFN A;  2V1M A;  1HNC A;  4XHM A;  1T4Y A;  1YF1 A;  1T4Z A;  2PER A;  3FY7 A;  5C04 A;  2HRN A;  1O7U A;  2FLS A;  2YWO A;  5EPF A;  1JZD A;  1GTI A;  1FO5 A;  2C3N A;  3R2Q A;  2H76 A;  2O7K A;  4WKW A;  2L4Q A;  4O5R A;  1SU9 A;  1TXX A;  3HJP A;  2YZU A;  3DWV A;  2IMF A;  4PUF C;  1XCC A;  3WYW A;  3F3R A;  1PD2 1;  4FH8 A;  1H4O A;  3LOR A;  1K3O A;  3ZIV A;  2DJ0 A;  8GSS A;  1T1V A;  1HYU A;  2H75 A;  4KAE A;  2VL9 A;  1WP0 A;  1ZZY A;  7GSS A;  3QFB C;  1AXD A;  3VWU A;  3H93 A;  2P31 A;  3ZYW A;  2I4A A;  5ECP B;  2KP2 A;  2CZ3 A;  3HY2 A;  2DBC A;  5F0G A;  4MA9 A;  4KDU A;  1M7T A;  2R37 A;  4GWR A;  5DCH A;  2GQM A;  1X9M B;  4Q5R A;  2YN1 A;  3IAM 2;  4ZL7 A;  3BCI A;  4ACS A;  2ES7 A;  3GKK A;  3E3E A;  3HCZ A;  1OC8 A;  2DML A;  4LMV A;  1AQX A;  4HJ2 A;  3M9J A;  3OR5 A;  4CHS A;  3DEX A;  2VCQ A;  3GHA A;  5LD0 A;  3ZLP A;  1VGL A;  3CRT A;  4I2U A;  1K0C A;  1OC9 A;  3CXG A;  2YAN A;  1THX A;  2R4V A;  5AGY A;  1ERU A;  3IK7 A;  1SJ6 A;  3EMX A;  2WZ9 A;  4LL1 B;  2GQK A;  1ON4 A;  4IHU A;  4XIH A;  3VWX A;  1T00 A;  2LEG A;  3UBL A;  4FIW A;  5J5N A;  1A0F A;  4D73 B;  2N5B A;  3CYN A;  3FZA A;  2H66 A;  2J23 A;  5G31 A;  3TKR A;  3GL3 A;  4YAP A;  1O85 A;  1XFL A;  1SL1 B;  1YEP A;  4MF5 A;  1K0O A;  1GSY A;  1F6M C;  1LBK A;  2KUC A;  1OE7 A;  3GTU B;  1OE8 A;  3C8E A;  1EOH A;  4EDY A;  3ZIJ A;  2L5L A;  2H1A A;  5IQY A;  1IYI A;  2MMO A;  1GP1 A;  3CTF A;  3GUS A;  3GH9 A;  2VD1 A;  4Q5Q A;  4TXO B;  1KNG A;  3UAR A;  3QR6 A;  2VLT A;  4KH7 A;  2IFQ B;  3U6V A;  5KN2 A;  3A3T A;  1XPV A;  5ENU A;  1OKD A;  4HDE A;  4GQF A;  4ECJ A;  4PNF A;  4IBP A;  4POL A;  4KUN A;  1XW9 A;  2Z9S A;  5B6M A;  1HQO A;  1ERT A;  2VM1 A;  1TRW A;  4KGI A;  3P8W A;  1OAZ A;  4PXO A;  1WMJ A;  2VL2 C;  5IMF A;  1TU7 A;  1VF2 A;  4F82 A;  1DE1 A;  3HYP A;  2LST A;  4KSM A;  2P5R A;  6GSY A;  4ZB8 A;  3SBC A;  1PL1 A;  2J9H A;  5G1K A;  2CT6 A;  2WFC A;  3KP9 A;  4MZC A;  4ULX A;  5JCG A;  1GUL A;  1R4W A;  4KND A;  2HZF A;  5ECS A;  3HZ8 A;  4FO5 A;  3IK9 A;  3PH9 A;  4X1U A;  3TJB A;  3W8S A;  3H8Q A;  2H19 A;  5KN3 A;  4BA7 A;  5HFK A;  3F9U A;  2H72 A;  3P2A A;  3DKS A;  2C0F A;  1F3B A;  2OE3 A;  4EUY A;  17GS A;  2JZR A;  4WBJ A;  1GH2 A;  3IV4 A;  2FWH A;  3W6G A;  3ZRE A;  2VO4 A;  5JCW A;  2EIQ A;  4NV2 A;  3BOA A;  6GSV A;  5GAN D;  1Y25 A;  1WJK A;  3ME7 A;  4XCS A;  4TR4 A;  3VLN A;  3EU4 A;  1OC9 B;  3D4T A;  3ZIT A;  3ZRD A;  5JCU A;  2B5X A;  1B48 A;  1TJD A;  2GDR A;  4OMV A;  3C1R A;  4V2L A;  3KMO A;  4G10 A;  3BBY A;  1Z7R A;  2ON7 A;  5HR1 A;  5HFI A;  1KTE A;  3F6D A;  4IJ3 A;  3HD5 A;  5D73 A;  2EIR A;  3C1S A;  3UVT A;  2DJK A;  5ELA A;  4I8B A;  1QQ2 A;  2MMZ A;  5IM9 A;  1U3A A;  2GT5 A;  1YZX A;  2K6V A;  4WBR D;  4JZQ A;  1NW2 A;  4NAX A;  4OCE A;  1NSW A;  2VOC A;  4PQI A;  5ECQ B;  1ZYE A;  4RQR A;  2VLV A;  3HJO A;  5COH A;  3L9V A;  4KCA A;  2VL2 A;  1GSS A;  2MZC A;  1TOF A;  3IA1 A;  4MDC A;  2B1L A;  4EF0 A;  2R5G A;  4MP4 A;  2FD3 A;  1A8Y A;  3GST A;  2GZP A;  3UMA A;  5FT3 A;  5B7C A;  5G5F A;  2PU9 C;  1QGV A;  4F0C A;  4NPB A;  5CP1 A;  1XW5 A;  2XPD A;  4XTS A;  3TJJ A;  2F8A A;  4MF6 A;  2E7P A;  2IN3 A;  4MAB A;  4HQZ A;  1Z6M A;  4AJ7 A;  2GZY A;  3GUR A;  3TKP A;  3TRX A;  5AIX A;  3VPQ A;  3H1N A;  1WOU A;  1GLQ A;  2FCH A;  3IDV A;  1BED A;  1QMV A;  4KSO A;  4H86 A;  3UEM A;  2G2Q A;  4ZBB A;  3KMN A;  4XS6 A;  3SWL A;  4I2T A;  2FWF A;  2JSZ A;  2HE3 A;  2H70 A;  3F63 A;  4MMM A;  5DAK B;  2K8S A;  3MDK A;  3QCP A;  3ZVJ D;  2VCT A;  1FVK A;  2C80 A;  4E8E A;  5B8B A;  3EC3 A;  4TR1 B;  5ECK B;  3WGX A;  2FHE A;  3RHB A;  1PKZ A;  2B7K A;  2X64 A;  4HOJ A;  3TCO A;  1X0R A;  2WJU A;  4IQA A;  1U3I A;  3KH9 A;  1H75 A;  1S3A A;  3F4S A;  1K0M A;  2R3X A;  4TKY A;  5KN1 A;  5IO2 A;  1O8W A;  3DML A;  4TR0 A;  2EIO A;  2GVP A;  1MD4 A;  1O8X A;  3FR3 A;  3RPP A;  4WF5 A;  3IPZ A;  3KJY A;  1SK1 A;  3EMP A;  2LS5 A;  3TRP A;  2R2J A;  2VCV A;  4KA0 A;  4OCF A;  5B6N A;  1F37 A;  3QMX A;  3UL3 A;  3CRU A;  1FB0 A;  1ZOF A;  5AIV A;  1O6J A;  3GSS A;  3NIV A;  4IJI A;  4ZXG A;  1TK0 B;  4L8E A;  1MTC A;  3HA9 A;  3LWA A;  2HSH A;  2AUV A;  3IAS 2;  1TDI A;  4CDO A;  4YQV A;  1Z5Y E;  3JCM L;  1HNA A;  4MJA A;  1ERV A;  1QXH A;  3C7M A;  5LCZ A;  4DSS B;  1PN9 A;  4WF4 A;  2H30 A;  4OWY A;  2E2M A;  1MDI A;  2WUL A;  3LGC A;  3ZZX A;  1E6B A;  2YNX A;  4J2F A;  1RQM A;  1XOB A;  4X43 A;  5HFG A;  5CRG A;  4IEL A;  2YCD A;  4EDZ A;  3W8J A;  3NOF A;  1S3D A;  3MNG A;  1EEJ A;  3UVH A;  1HD2 A;  1TRV A;  3GL5 A;  2MBS A;  1HNB A;  5KEJ A;  1FB6 A;  2LQQ A;  4I97 A;  1EV9 A;  3BJ5 A;  3MWH A;  1X9W B;  2LRC A;  2H1G A;  1USB A;  4NMU A;  5JWQ B;  4PQ1 A;  1YKC A;  4K7N A;  2HYX A;  4F9Z A;  1W89 A;  3CSJ A;  4RI6 A;  2PPT A;  4XS1 A;  3LSZ A;  5ECH B;  2EC4 A;  1DE2 A;  4BVY A;  5CYY A;  1GUM A;  2DJ2 A;  2YPM A;  5CRW A;  1PL2 A;  4PUR A;  2FY6 A;  1R5P A;  3KTL A;  3CSI A;  2H73 A;  4QQ7 A;  3ZML A;  2K9F A;  4MLY A;  2CX4 A;  3DGQ A;  2VD0 A;  1K0B A;  18GS A;  5IMD A;  2X8H A;  4L0W A;  1J08 A;  1JZR A;  2LQO A;  2IIY A;  4ZBD A;  1KEB A;  5D8I A;  3ZVJ A;  4ZL8 A;  1TK5 B;  4TN8 A;  3VI7 A;  2V41 A;  1OYJ A;  3I69 A;  3U5R E;  4K7O A;  5A5K A;  1EV4 A;  4HZ4 A;  1V40 A;  4HU7 A;  2QKE A;  3DIE A;  2B3S A;  3ISO A;  3L4N A;  2JAD A;  2CZ2 A;  1MD3 A;  4YQU A;  2WB9 A;  3RDW A;  1M9A A;  5AN1 A;  1J9B A;  4YQM A;  5ECN B;  1ILO A;  4POK A;  5G5E A;  3GX0 A;  3KM6 A;  3KZQ A;  5A4U A;  3IC4 A;  3A2W A;  1WRY A;  4O32 A;  3F3Q A;  4GST A;  2O8V B;  4ECC A;  3GKN A;  3ZTL A;  4PQH A;  5D93 A;  3E9J B;  2GSS A;  2O87 A;  2DMM A;  2RLI A;  3LG6 A;  1B4P A;  4BWQ A;  5HQP A;  4OFM A;  4GLT A;  1YF0 A;  1E2Y A;  1XOA A;  4EVM A;  1DUG A;  1M2A A;  2ON5 A;  2CAI A;  3GX8 A;  5DJM A;  2K8V A;  4TXV A;  5DAL B;  1NHO A;  3GNJ A;  2DLX A;  1T3B A;  3F4R A;  4RI7 A;  3LEF A;  4I6X A;  2KOK A;  1T8E B;  1FW1 A;  3A2X A;  1GSE A;  3QAV A;  4IP6 A;  3F4T A;  4WR4 A;  1FOV A;  3CTG A;  2I1U A;  2YJ7 A;  1Z3E A;  4PUA A;  3HKR A;  2L5O A;  3GFK A;  2V2G A;  3H79 A;  2HNL A;  1G6Y A;  2GS3 A;  2WCI A;  1PQN A;  16GS A;  3QPM A;  4ML1 A;  5F07 A;  3WD6 A;  5LNK e;  2VCX A;  3IBH A;  2DJ1 A;  3CMI A;  3F0I A;  2VIM A;  3G7Y A;  1G7E A;  4HU9 A;  2CX3 A;  1GUH A;  4POM A;  2NBS A;  3HVV A;  5C00 A;  1UC7 A;  1Z9H A;  1SL0 B;  5ECI B;  4KDY A;  5D9X A;  2YOI A;  1Z6N A;  2AAW A;  13GS A;  1XWB A;  2PVQ A;  14GS A;  3I9V 2;  3Q18 A;  3AY8 A;  4KB3 A;  3QD9 A;  5J9C A;  2QC7 A;  4AJ8 A;  4K1F A;  1WWJ A;  4NHW A;  3LXT A;  1Z7P A;  1A2J A;  4MH3 A;  1GSF A;  4NWY A;  3HVX A;  5GAP D;  5CRH A;  3E0U A;  4AGS A;  3F6F A;  3FZ9 A;  2B5E A;  4GSS A;  2C0G A;  4HI7 A;  3VK9 A;  1SL2 B;  3FRC A;  3HDC A;  2H8L A;  5G30 A;  3GRX A;  3RHC A;  2VCZ A;  1SKS B;  5D96 A;  4F03 A;  2NPB A;  5J9B A;  1MDJ A;  1B9X C;  4HZ2 A;  1SK2 A;  4L5O A;  4MPF A;  4RQX A;  4WET A;  5GSS A;  2ZNM A;  4P3Y B;  2RM5 A;  1BJX A;  1GSU A;  2PVO C;  3KP8 A;  1CQH A;  4DEJ A;  2H0G A;  2O85 A;  3H4K A;  3VI5 A;  1GSD A;  3V1W A;  1R7H A;  1BG5 A;  4N10 A;  2OAC A;  4N0V A;  4TRX A;  4N11 A;  1XWA A;  2C0E A;  2I3Y A;  3MSZ A;  5E4W A;  3N5O A;  3UIW A;  4IQ1 A;  4MCU A;  3GA4 A;  5DVB A;  2TRX A;  2L6C A;  5JWR B;  2YWN A; 
#chains in the Genus database with same CATH topology
 2GT6 A;  1SD8 A;  2NVL A;  2HI7 A;  1IYH A;  4I5Q A;  1XIY A;  5IMZ A;  2OE0 A;  2C3T A;  1PRX A;  1LU4 A;  2GGT A;  2FUG 2;  3LXZ A;  2MMN A;  3FKF A;  3P90 A;  2OE1 A;  1SK0 A;  1X5C A;  1F3A A;  1F9M A;  4L0U A;  3K8N A;  3LFL A;  4OD7 A;  4MF7 A;  3MAK A;  1TI1 A;  1TRU A;  4LLR A;  3HVN A;  2AYT A;  3D4M A;  1DBY A;  1V2A A;  4DSQ A;  3FZ4 A;  4G2E A;  3FK8 A;  2V6K A;  1SYX A;  5D9V A;  4EXJ A;  4V1A g;  2RUF A;  2ZUP A;  3R3E A;  1JHB A;  1M9B A;  2NTO A;  3HHV A;  3FHK A;  3KTB A;  2N5A A;  2QA1 A;  3WT2 A;  1GSQ A;  4ZIJ A;  1AIU A;  1MEK A;  2HRK A;  1AC1 A;  2F8F A;  4BIK A;  4XS4 A;  1ACV A;  2QSI A;  1ZCP A;  1PX6 A;  1SYR A;  3CBU A;  4ZL9 A;  1X5E A;  1EGR A;  4KDX A;  4KE3 A;  1A24 A;  2CQ9 A;  5ECL B;  5GZZ B;  2M72 A;  1OKT A;  5A4V A;  3EIN A;  2BJX A;  4JED A;  4A5P A;  3G7I A;  1JZW A;  1A2M A;  2LJR A;  1SJI A;  4XRA A;  1V9W A;  1FG4 A;  2JZS A;  2H0H A;  5DQY A;  4X0X A;  1BQ7 A;  4DSR A;  1I9D A;  5ELG A;  3EPT A;  5DQS A;  2QGV A;  1FVJ A;  3DVX A;  3BCK A;  2LTK A;  3US3 A;  1A8L A;  4O92 A;  3IXR A;  2R6K A;  5E59 A;  3FR9 A;  4MZB A;  1SKR B;  3GN3 A;  2H0I A;  1EEM A;  4EC0 A;  2I81 A;  2JAC A;  4N30 A;  3KXO A;  2X4A A;  2NDO A;  1JLW A;  2A2S A;  3TOU A;  5CRD A;  2XHF A;  4FYB A;  1AUC A;  5HR2 A;  4MJE A;  3FW2 A;  1AAZ A;  4YH2 A;  4AF2 A;  4IVF A;  4DVC A;  3WGE A;  3M0F A;  6GSU A;  2OKA A;  2HZE A;  2FGX A;  1XXU A;  5KOX A;  4IW9 A;  3LJR A;  5DBQ A;  2IL3 A;  1M2D A;  2L59 A;  3D21 A;  4L5L A;  3ERG A;  5KN0 A;  3C71 A;  3HXS A;  3UBK A;  3GKM A;  1SJZ A;  1B9Y C;  4Z7X A;  4TVE A;  4WEY A;  3IR4 A;  3S9F A;  5HR3 A;  3KIJ A;  3UOM A;  3TB2 A;  3ERF A;  2M46 A;  2DIZ A;  2R0G A;  2C4J A;  2LNS A;  1G7O A;  1CQG A;  3GIX A;  2REM A;  1XWG A;  1NM3 A;  2P0G A;  2X8G A;  2RM6 A;  3KH7 A;  5ECM B;  5IMA A;  2AV4 A;  2WGR A;  3D0Z A;  5G2Z A;  5L71 A;  1YJ6 A;  5IMC A;  1SKW B;  4J57 E;  2CVK A;  4GXZ A;  5BMU A;  3EE2 A;  3TDG A;  2TRC P;  2OBI A;  4EL1 A;  2O89 A;  1JLV A;  3ZL5 A;  5H5Q A;  3PGT A;  4D73 A;  1T7P B;  4ZB6 A;  1AQW A;  4MJB A;  4GQC A;  2HSY A;  3QFA C;  5D9T A;  4G9H A;  2F51 A;  2IWT A;  2C3Q A;  5CRE A;  4J56 E;  4XS4 B;  5CO3 A;  1UVZ A;  2D2Z A;  3GTU A;  3N9J A;  1G0T A;  1N8J A;  3HZ4 A;  1EZK A;  5CAX A;  5IOW A;  4JE1 A;  3GH6 A;  3EUR A;  4HJM A;  1K3Y A;  2FWG A;  1DSB A;  2MYG A;  4TXO A;  3EVI A;  5F05 A;  4LA1 A;  4OO5 A;  2IFQ A;  1S3C A;  1XVQ A;  3PIN A;  1TTZ A;  3GYK A;  2LJA A;  2DSA A;  4CW9 A;  2DJ3 A;  2HRA A;  2OBK A;  2H1B A;  4K6X A;  1U6T A;  4RUV A;  1WE0 A;  4YAV A;  3FZ5 A;  5HR0 A;  9GSS A;  3APS A;  3VWW A;  4K9Z A;  2GSR A;  5FHI A;  5ID2 A;  3LQ7 A;  4MJC A;  4K0N A;  4BWS A;  4ECI A;  1LJR A;  2VLU A;  4YKF A;  1OVN A;  3P7X A;  4ILF A;  4V1A p;  3EU3 A;  4KX4 A;  5IIZ A;  11GS A;  5F06 A;  2HZE B;  3QAG A;  5ECO B;  3PR8 A;  1MDK A;  4NHZ A;  1ERW A;  1FHE A;  3F8U A;  4MNN A;  3TKS E;  3TKQ A;  4GCI A;  2YWI A;  2VCW A;  2YP6 A;  3DVW A;  1EGO A;  3DXB A;  2LKU A;  2X8C A;  4LL4 B;  4MZW A;  2AHE A;  1PMT A;  3WGD A;  2IJY A;  2HXK A;  2M80 A;  2TIR A;  4O7H A;  2N5F A;  1PSQ A;  1TKD B;  1K0A A;  5AIS A;  2ALB A;  2A2R A;  3ZFB A;  1X5D A;  2XBI A;  2YZH A;  3ERW A;  1Q98 A;  3A5I A;  1B8X A;  3ED3 A;  1V98 A;  1RK4 A;  2GTU A;  2ZCT A;  3RPN A;  2CAQ A;  3KD0 A;  2A4V A;  4ZBA A;  5H5R A;  3D6I A;  1GRX A;  3QAW A;  1BX9 A;  3L78 A;  3VPT A;  4GF0 A;  1U87 A;  1GL8 A;  1K3L A;  1N2A A;  2JL4 A;  4Z2R A;  3GKX A;  3Q6O A;  1WIK A;  3IRA A;  5FWG A;  4WXT A;  3IHQ A;  4FYC A;  1QK8 A;  3KGK A;  3ME8 A;  2KLX A;  1B4Q A;  4Q5N A;  2F3M A;  4LMW A;  1K0D A;  3APO A;  2B7J A;  2HFD A;  2DC5 A;  1XZO A;  1TW9 A;  2X49 A;  5DJL A;  2DKI A;  3VWV A;  6GSS A;  3GMF A;  2H01 A;  2HRF A;  3CSH A;  2PWJ A;  1XW6 A;  1XWK A;  5ABR A;  1F2E A;  2CVB A;  2YV7 A;  1R5A A;  2FA8 A;  2V6O A;  2IPA A;  4BVY B;  3L0H A;  3M8N A;  3IE3 A;  1X9S B;  1YKA A;  3M3M A;  1AW9 A;  3EWL A;  5CNW A;  2VUP A;  1FAA A;  3KCM A;  1URM A;  3O6T A;  4GRF A;  4K0G A;  3J7Y k;  3O76 A;  1GTU A;  5GST A;  1WPI A;  1JZO A;  1BYE A;  5A4W A;  3FEU A;  1THO A;  2H1D A;  1AQV A;  2FWE A;  6GST A;  4TOP A;  4HEA 2;  1PGT A;  1QUW A;  5ID2 B;  2BTO T;  4TW5 A;  6GSX A;  2LJK A;  4JRR A;  2AB6 A;  1ABA A;  1I5G A;  2I9H A;  2WDU A;  2YWM A;  3QOU A;  3TGZ A;  4BPY A;  2VL3 A;  2LRT A;  2FNO A;  4HS1 A;  1R26 A;  5DAK A;  1A23 A;  3NZN A;  3G7J A;  2AJQ B;  4TR1 A;  4MK3 A;  4K8M A;  4GTU A;  1YY7 A;  4MH2 A;  5H5S A;  5JWO B;  1TU8 A;  2OAD A;  4ISD A;  4BL7 A;  3C73 A;  4K2D A;  2KP1 A;  4PNG A;  4POB A;  3DRN A;  2RII A;  1ZMA A;  2HT9 A;  4Q5F A;  5IPG A;  1GTB A;  5G1L A;  1Q4J A;  5EY6 A;  3DYR A;  3ZFL A;  2B6M A;  3HJM A;  4XRD A;  1VF4 A;  1TI3 A;  2L4C A;  3APQ A;  2P5Q A;  4OO4 A;  1M99 A;  2MMA A;  4NV5 A;  4G19 A;  2VM2 A;  1YEX A;  1EP7 A;  3D5J A;  3UAP A;  3L9U A;  3TUE A;  3O3T A;  2LUS A;  1XVW A;  2XC2 A;  3KEB A;  10GS A;  3TKS C;  2FA4 A;  1ZL9 A;  2H6Z A;  1M3I A;  2H6Y A;  2H71 A;  1XWC A;  3QDN A;  4IN0 A;  3BD2 A;  2CV4 A;  3TOT A;  2XPE A;  4IKH A;  1EOG A;  3G9B A;  2IMI A;  3L9S A;  4DSS A;  1EWX A;  1JFU A;  5F8B A;  3D22 A;  4N0Z A;  2GLR A;  4ZIL A;  6GSW A;  2LRN A;  2E2G A;  4BVX A;  4F2I A;  3RBT A;  2L6D A;  1V58 A;  5EL8 A;  2OJL A;  3TRQ A;  2GST A;  4ML6 A;  4YKG A;  1M2B A;  4NXI A;  1KBN A;  3UJ1 A;  4PGT A;  4QL9 A;  2LV3 A;  2DIY A;  1A2L A;  3IOS A;  1SEN A;  3M9K A;  4E8H A;  1GUK A;  3FYG A;  4HUA A;  2CA8 A;  5INY A;  1O81 A;  2PMT A;  4ID0 A;  4KW6 A;  2F9S A;  4CY6 A;  19GS A;  4V2N A;  1VF3 A;  2PUK C;  1NHY A;  4EO3 A;  1K0N A;  2B5Y A;  4QL7 A;  2E0Q A;  2CVD A;  1M0U A;  1QFN A;  3RAZ A;  3IC8 A;  3VFI A;  2OA7 A;  5IO0 A;  1TP9 A;  2K18 A;  4K7I A;  2H6X A;  1GWC A;  1O73 A;  1OC3 A;  5IPH A;  1PKW A;  2JU5 A;  1ML6 A;  1SD9 A;  2C1Y A;  4JR6 A;  1TRS A;  3Q74 A;  3LYK A;  1Y6E A;  2G0F A;  1VRS D;  4EIQ A;  2L57 A;  2JSY A;  2WS2 A;  1PX7 A;  2VAF A;  2IMK A;  1YDK A;  2HLS A;  1U88 A;  2GZZ A;  2IME A;  3LYP A;  5D9W A;  4GSN A;  1XBS A;  5ECR B;  3A2V A;  4WR5 A;  4JU5 A;  5DCG A;  4F0B A;  1PA3 A;  4EE0 A;  2PBJ A;  1A0R P;  2KHP A;  2RUE A;  1GTA A;  2IMD A;  3TJG A;  4IS0 A;  3TKS A;  1V57 A;  4FYU A;  20GS A;  4ECB A;  1GNW A;  2X99 A;  5J3R A;  1W4V A;  1UN2 A;  2JZT A;  3A5W A;  5B8A A;  4IP1 A;  4ZB9 A;  4EKZ A;  4HQS A;  1BAY A;  1ZGN A;  3TJK A;  2PN8 A;  5J4U A;  3J7Y b;  2C0D A;  22GS A;  5DAL A;  4JR4 A;  2XBQ A;  2LNT A;  2B1K A;  1GLP A;  4AJ6 A;  3I43 A;  1UA5 A;  2BMX A;  3I6A A;  5DDL A;  2YV9 A;  3ZMK A;  12GS A;  1ST9 A;  2V32 A;  3EYT A;  4MPG A;  3VUR A;  3M1G A;  1C72 A;  4KCE A;  1VF1 A;  2H74 A;  3HVS A;  3Q19 A;  4IGJ A;  1G6W A;  1J0F A;  4JBB A;  1RW1 A;  1EP8 A;  1GNE A;  4BVX B;  2PGT A;  3DD3 A;  4PX1 A;  2DJJ A;  5J41 A;  2GQL A;  1TK8 B;  3TJF A;  1YQ1 A;  2WRT A;  3GV1 A;  4OFT A;  5IMV A;  5IOX A;  2MBT A;  3WT1 A;  4TR3 A;  2GSQ A;  2YJH A;  4V2M A;  2C8U A;  5EVO A;  3FR6 A;  1ZYQ B;  4OFN A;  2V1M A;  1HNC A;  4XHM A;  1T4Y A;  1YF1 A;  1T4Z A;  2PER A;  3FY7 A;  5C04 A;  2HRN A;  1O7U A;  2FLS A;  2YWO A;  5EPF A;  1JZD A;  1GTI A;  1FO5 A;  2C3N A;  3R2Q A;  2H76 A;  2O7K A;  4WKW A;  2L4Q A;  4O5R A;  1SU9 A;  1TXX A;  3HJP A;  2YZU A;  3DWV A;  2IMF A;  4PUF C;  1XCC A;  3WYW A;  3F3R A;  1PD2 1;  4FH8 A;  1H4O A;  3LOR A;  1K3O A;  3ZIV A;  2DJ0 A;  8GSS A;  1T1V A;  1HYU A;  2H75 A;  4KAE A;  2VL9 A;  1WP0 A;  1ZZY A;  7GSS A;  1S3R A;  3QFB C;  1AXD A;  3VWU A;  3IHG A;  3H93 A;  2P31 A;  3ZYW A;  2I4A A;  5ECP B;  2KP2 A;  2CZ3 A;  3HY2 A;  2DBC A;  5F0G A;  4MA9 A;  4KDU A;  1M7T A;  2R37 A;  4GWR A;  5DCH A;  2GQM A;  1X9M B;  4Q5R A;  2YN1 A;  3IAM 2;  4ZL7 A;  3BCI A;  4ACS A;  2ES7 A;  3GKK A;  3E3E A;  3HCZ A;  1OC8 A;  2DML A;  4LMV A;  1AQX A;  4HJ2 A;  3M9J A;  3OR5 A;  4CHS A;  3DEX A;  2VCQ A;  3GHA A;  5LD0 A;  3ZLP A;  1VGL A;  3CRT A;  4I2U A;  1K0C A;  1OC9 A;  3CXG A;  2YAN A;  1THX A;  2R4V A;  5AGY A;  1ERU A;  3IK7 A;  1SJ6 A;  3EMX A;  2WZ9 A;  4LL1 B;  2GQK A;  1ON4 A;  4IHU A;  4XIH A;  3VWX A;  1T00 A;  2LEG A;  3UBL A;  4FIW A;  5J5N A;  1A0F A;  4D73 B;  2N5B A;  3CYN A;  3FZA A;  2H66 A;  2J23 A;  5G31 A;  3TKR A;  1FOH A;  3GL3 A;  4YAP A;  1O85 A;  1XFL A;  1SL1 B;  1YEP A;  4MF5 A;  1K0O A;  1GSY A;  1F6M C;  1LBK A;  2KUC A;  1OE7 A;  2QA2 A;  3MYD A;  3GTU B;  1OE8 A;  3C8E A;  1EOH A;  4EDY A;  3ZIJ A;  2L5L A;  2H1A A;  5IQY A;  1IYI A;  2MMO A;  1GP1 A;  3CTF A;  3GUS A;  3GH9 A;  2VD1 A;  4Q5Q A;  4TXO B;  1KNG A;  3UAR A;  3QR6 A;  2VLT A;  4KH7 A;  2IFQ B;  3U6V A;  5KN2 A;  3A3T A;  1XPV A;  5ENU A;  1OKD A;  4HDE A;  4GQF A;  4ECJ A;  4PNF A;  4IBP A;  3PPU A;  4POL A;  4KUN A;  1XW9 A;  2Z9S A;  5B6M A;  1HQO A;  1ERT A;  2VM1 A;  1TRW A;  4KGI A;  3P8W A;  1OAZ A;  4PXO A;  1WMJ A;  2VL2 C;  5IMF A;  1TU7 A;  1VF2 A;  4F82 A;  1DE1 A;  3HYP A;  2LST A;  4KSM A;  2P5R A;  6GSY A;  4ZB8 A;  3SBC A;  4Z2T A;  1PL1 A;  2J9H A;  5G1K A;  2CT6 A;  2WFC A;  3KP9 A;  4MZC A;  4ULX A;  5JCG A;  1GUL A;  1R4W A;  4KND A;  2HZF A;  5ECS A;  3HZ8 A;  4FO5 A;  3IK9 A;  3PH9 A;  4X1U A;  3TJB A;  3W8S A;  2UZ8 A;  3H8Q A;  2H19 A;  5KN3 A;  4BA7 A;  5HFK A;  4Z2U A;  3F9U A;  2H72 A;  3P2A A;  3DKS A;  2C0F A;  1F3B A;  2OE3 A;  4EUY A;  17GS A;  2JZR A;  3CQF A;  4WBJ A;  1GH2 A;  3IV4 A;  2FWH A;  3W6G A;  3ZRE A;  4G0L A;  4G0K A;  2VO4 A;  5JCW A;  2EIQ A;  4NV2 A;  3BOA A;  6GSV A;  5GAN D;  1Y25 A;  1WJK A;  4K2X A;  3ME7 A;  4XCS A;  1PFO A;  4TR4 A;  3VLN A;  3EU4 A;  1OC9 B;  3D4T A;  3ZIT A;  3ZRD A;  5JCU A;  2B5X A;  1B48 A;  1TJD A;  2GDR A;  4OMV A;  3C1R A;  4USS A;  4V2L A;  3KMO A;  4G10 A;  3BBY A;  1Z7R A;  2ON7 A;  5HR1 A;  2R0C A;  5HFI A;  1KTE A;  3F6D A;  4IJ3 A;  3HD5 A;  5D73 A;  2EIR A;  3C1S A;  3UVT A;  2DJK A;  5ELA A;  4I8B A;  1QQ2 A;  2MMZ A;  5IM9 A;  2DKH A;  1U3A A;  2GT5 A;  1YZX A;  2K6V A;  4WBR D;  4JZQ A;  1NW2 A;  4NAX A;  4OCE A;  1NSW A;  2VOC A;  4PQI A;  5ECQ B;  1ZYE A;  4RQR A;  2VLV A;  3HJO A;  5COH A;  3L9V A;  2A2P A;  4KCA A;  2VL2 A;  1GSS A;  2MZC A;  1TOF A;  3IA1 A;  4MDC A;  2B1L A;  4EF0 A;  2R5G A;  4MP4 A;  2FD3 A;  1A8Y A;  3GST A;  2GZP A;  3UMA A;  5FT3 A;  5B7C A;  5G5F A;  2PU9 C;  1QGV A;  4F0C A;  4NPB A;  5CP1 A;  1XW5 A;  2XPD A;  4XTS A;  3TJJ A;  2F8A A;  4MF6 A;  2E7P A;  2IN3 A;  4MAB A;  4HQZ A;  1Z6M A;  4AJ7 A;  2GZY A;  3GUR A;  3TKP A;  3TRX A;  5AIX A;  3VPQ A;  3H1N A;  1WOU A;  1GLQ A;  2FCH A;  3IDV A;  1BED A;  1QMV A;  4KSO A;  4H86 A;  3UEM A;  2G2Q A;  4ZBB A;  3KMN A;  4XS6 A;  3SWL A;  4I2T A;  2FWF A;  2JSZ A;  5KOW A;  2HE3 A;  2H70 A;  3F63 A;  4MMM A;  5DAK B;  1ZYN A;  2K8S A;  3MDK A;  3QCP A;  3ZVJ D;  4KF9 A;  2VCT A;  1FVK A;  2C80 A;  4E8E A;  5B8B A;  3EC3 A;  4TR1 B;  5ECK B;  5BRT A;  3WGX A;  2FHE A;  3RHB A;  1PKZ A;  4BL7 B;  2B7K A;  2X64 A;  4HOJ A;  3TCO A;  1X0R A;  2WJU A;  4IQA A;  1U3I A;  3KH9 A;  1H75 A;  1S3A A;  3F4S A;  1K0M A;  2A4H A;  2R3X A;  4TKY A;  5KN1 A;  5IO2 A;  3FMW A;  1O8W A;  3DML A;  4TR0 A;  2EIO A;  2GVP A;  1MD4 A;  1O8X A;  3FR3 A;  3RPP A;  4WF5 A;  3IPZ A;  4CY8 A;  3KJY A;  1SK1 A;  3EMP A;  2LS5 A;  3TRP A;  2R2J A;  2VCV A;  4KA0 A;  4OCF A;  5B6N A;  1F37 A;  3QMX A;  3UL3 A;  3CRU A;  1FB0 A;  1ZOF A;  5AIV A;  1O6J A;  3GSS A;  3NIV A;  4IJI A;  4ZXG A;  1TK0 B;  4L8E A;  1MTC A;  3HA9 A;  3LWA A;  2HSH A;  2AUV A;  3IAS 2;  1TDI A;  4CDO A;  4YQV A;  1Z5Y E;  3JCM L;  2HSM A;  1HNA A;  4MJA A;  1ERV A;  1QXH A;  3C7M A;  5LCZ A;  4DSS B;  1PN9 A;  4WF4 A;  2H30 A;  4OWY A;  2E2M A;  1MDI A;  2WUL A;  3LGC A;  3ZZX A;  1E6B A;  2YNX A;  4J2F A;  1RQM A;  1XOB A;  4X43 A;  5HFG A;  5CRG A;  4IEL A;  2YCD A;  4EDZ A;  3W8J A;  3NOF A;  2R0P A;  1S3D A;  3MNG A;  1EEJ A;  3UVH A;  1HD2 A;  1TRV A;  3GL5 A;  2MBS A;  1HNB A;  5KEJ A;  1FB6 A;  2LQQ A;  4I97 A;  1EV9 A;  3BJ5 A;  3MWH A;  1X9W B;  2LRC A;  2H1G A;  1USB A;  4NMU A;  4O5Q A;  5JWQ B;  4HSC X;  4PTS A;  4PQ1 A;  1YKC A;  4K7N A;  2HYX A;  4F9Z A;  1W89 A;  3CSJ A;  4RI6 A;  2PPT A;  4XS1 A;  3LSZ A;  5ECH B;  2EC4 A;  1DE2 A;  4BVY A;  5CYY A;  1GUM A;  2DJ2 A;  2YPM A;  5CRW A;  1PL2 A;  4PUR A;  2FY6 A;  1R5P A;  3KTL A;  3CSI A;  4G0I A;  1XG8 A;  2H73 A;  4QQ7 A;  3ZML A;  2K9F A;  4MLY A;  2CX4 A;  3DGQ A;  2VD0 A;  1K0B A;  18GS A;  5IMD A;  2X8H A;  4L0W A;  1J08 A;  1JZR A;  2LQO A;  2IIY A;  4ZBD A;  1KEB A;  5D8I A;  3ZVJ A;  4ZL8 A;  1TK5 B;  4TN8 A;  3VI7 A;  2V41 A;  1OYJ A;  3I69 A;  3U5R E;  4K7O A;  5A5K A;  1EV4 A;  4HZ4 A;  1V40 A;  4HU7 A;  2QKE A;  3DIE A;  2B3S A;  3ISO A;  3L4N A;  2JAD A;  2CZ2 A;  1MD3 A;  4YQU A;  2WB9 A;  3RDW A;  1M9A A;  5AN1 A;  1J9B A;  4YQM A;  5ECN B;  1ILO A;  4POK A;  5G5E A;  3GX0 A;  3KM6 A;  3KZQ A;  5A4U A;  3IC4 A;  3A2W A;  1WRY A;  4O32 A;  3F3Q A;  4GST A;  2O8V B;  4ECC A;  3GKN A;  3ZTL A;  4PQH A;  5D93 A;  3E9J B;  4O5U A;  2GSS A;  2O87 A;  2DMM A;  2RLI A;  3LG6 A;  1B4P A;  4BWQ A;  5HQP A;  4OFM A;  4GLT A;  1YF0 A;  1E2Y A;  1XOA A;  4EVM A;  1DUG A;  1M2A A;  2ON5 A;  2CAI A;  3GX8 A;  4X4J A;  2K8V A;  5DJM A;  4TXV A;  5DAL B;  1NHO A;  3LW9 A;  3GNJ A;  2DLX A;  1T3B A;  3F4R A;  4RI7 A;  3LEF A;  4EIP A;  4I6X A;  2KOK A;  1T8E B;  1FW1 A;  3A2X A;  1GSE A;  3QAV A;  4IP6 A;  3F4T A;  4WR4 A;  1FOV A;  3CTG A;  4ICY A;  2I1U A;  2YJ7 A;  1Z3E A;  4PUA A;  3HKR A;  2L5O A;  3GFK A;  2V2G A;  3H79 A;  2HNL A;  1G6Y A;  2GS3 A;  2WCI A;  1PQN A;  16GS A;  3QPM A;  4ML1 A;  5F07 A;  3WD6 A;  5LNK e;  2VCX A;  3IBH A;  2DJ1 A;  3CMI A;  3F0I A;  2VIM A;  3G7Y A;  1G7E A;  4K5R A;  4HU9 A;  2CX3 A;  1GUH A;  4POM A;  2NBS A;  3HVV A;  5C00 A;  1UC7 A;  1Z9H A;  1SL0 B;  5ECI B;  4KDY A;  5D9X A;  2YOI A;  1Z6N A;  2AAW A;  13GS A;  1XWB A;  2PVQ A;  14GS A;  3I9V 2;  3Q18 A;  3AY8 A;  1M3J A;  4KB3 A;  3QD9 A;  5J9C A;  1PN0 A;  2QC7 A;  4AJ8 A;  4K1F A;  1WWJ A;  4NHW A;  3LXT A;  1Z7P A;  1A2J A;  4MH3 A;  1GSF A;  4NWY A;  3HVX A;  5GAP D;  5CRH A;  3E0U A;  4AGS A;  3F6F A;  3FZ9 A;  2B5E A;  4GSS A;  2C0G A;  4HI7 A;  3VK9 A;  1SL2 B;  3FRC A;  3HDC A;  2H8L A;  5G30 A;  3GRX A;  3RHC A;  2VCZ A;  1SKS B;  5D96 A;  4F03 A;  2NPB A;  5J9B A;  1MDJ A;  1B9X C;  4HZ2 A;  1SK2 A;  4L5O A;  4MPF A;  4RQX A;  4WET A;  4K5S A;  5GSS A;  2ZNM A;  4P3Y B;  2RM5 A;  1BJX A;  1GSU A;  2PVO C;  3KP8 A;  1CQH A;  4DEJ A;  2H0G A;  2O85 A;  3H4K A;  3VI5 A;  1GSD A;  3V1W A;  1R7H A;  1BG5 A;  4N10 A;  2OAC A;  4N0V A;  4TRX A;  4N11 A;  1XWA A;  2C0E A;  2I3Y A;  3MSZ A;  5E4W A;  3N5O A;  3UIW A;  4IQ1 A;  4MCU A;  3GA4 A;  5DVB A;  4FQU A;  1ZYP A;  2TRX A;  2L6C A;  3MIX A;  5JWR B;  2YWN A; 
#chains in the Genus database with same CATH homology
 2GT6 A;  1SD8 A;  2NVL A;  2HI7 A;  1IYH A;  4I5Q A;  1XIY A;  5IMZ A;  2OE0 A;  2C3T A;  1PRX A;  1LU4 A;  2GGT A;  2FUG 2;  3LXZ A;  2MMN A;  3FKF A;  3P90 A;  2OE1 A;  1SK0 A;  1X5C A;  1F3A A;  1F9M A;  4L0U A;  3K8N A;  3LFL A;  4OD7 A;  4MF7 A;  3MAK A;  1TI1 A;  1TRU A;  4LLR A;  2AYT A;  3D4M A;  1DBY A;  1V2A A;  4DSQ A;  3FZ4 A;  4G2E A;  3FK8 A;  2V6K A;  1SYX A;  5D9V A;  4EXJ A;  4V1A g;  2RUF A;  2ZUP A;  3R3E A;  1JHB A;  1M9B A;  2NTO A;  3HHV A;  3FHK A;  3KTB A;  2N5A A;  2QA1 A;  3WT2 A;  1GSQ A;  4ZIJ A;  1AIU A;  1MEK A;  2HRK A;  1AC1 A;  2F8F A;  4XS4 A;  1ACV A;  2QSI A;  1ZCP A;  1PX6 A;  1SYR A;  3CBU A;  4ZL9 A;  1X5E A;  1EGR A;  4KDX A;  4KE3 A;  1A24 A;  2CQ9 A;  5ECL B;  5GZZ B;  2M72 A;  1OKT A;  5A4V A;  3EIN A;  2BJX A;  4JED A;  4A5P A;  3G7I A;  1JZW A;  1A2M A;  2LJR A;  1SJI A;  4XRA A;  1V9W A;  1FG4 A;  2JZS A;  2H0H A;  5DQY A;  4X0X A;  1BQ7 A;  4DSR A;  1I9D A;  5ELG A;  3EPT A;  5DQS A;  2QGV A;  1FVJ A;  3DVX A;  3BCK A;  2LTK A;  3US3 A;  1A8L A;  4O92 A;  3IXR A;  2R6K A;  5E59 A;  3FR9 A;  4MZB A;  1SKR B;  3GN3 A;  2H0I A;  1EEM A;  4EC0 A;  2I81 A;  2JAC A;  4N30 A;  3KXO A;  2X4A A;  2NDO A;  1JLW A;  2A2S A;  3TOU A;  5CRD A;  2XHF A;  4FYB A;  1AUC A;  5HR2 A;  4MJE A;  3FW2 A;  1AAZ A;  4YH2 A;  4AF2 A;  4IVF A;  4DVC A;  3WGE A;  3M0F A;  6GSU A;  2OKA A;  2HZE A;  2FGX A;  1XXU A;  5KOX A;  4IW9 A;  3LJR A;  5DBQ A;  2IL3 A;  1M2D A;  2L59 A;  3D21 A;  4L5L A;  3ERG A;  5KN0 A;  3C71 A;  3HXS A;  3UBK A;  3GKM A;  1SJZ A;  1B9Y C;  4Z7X A;  4TVE A;  4WEY A;  3IR4 A;  3S9F A;  5HR3 A;  3KIJ A;  3UOM A;  3TB2 A;  3ERF A;  2M46 A;  2DIZ A;  2R0G A;  2C4J A;  2LNS A;  1G7O A;  1CQG A;  3GIX A;  2REM A;  1XWG A;  1NM3 A;  2P0G A;  2X8G A;  2RM6 A;  3KH7 A;  5ECM B;  5IMA A;  2AV4 A;  2WGR A;  3D0Z A;  5G2Z A;  5L71 A;  1YJ6 A;  5IMC A;  1SKW B;  4J57 E;  2CVK A;  4GXZ A;  5BMU A;  3EE2 A;  3TDG A;  2TRC P;  2OBI A;  4EL1 A;  2O89 A;  1JLV A;  3ZL5 A;  5H5Q A;  3PGT A;  4D73 A;  1T7P B;  4ZB6 A;  1AQW A;  4MJB A;  4GQC A;  2HSY A;  3QFA C;  5D9T A;  4G9H A;  2F51 A;  2IWT A;  2C3Q A;  5CRE A;  4J56 E;  4XS4 B;  5CO3 A;  1UVZ A;  2D2Z A;  3GTU A;  3N9J A;  1G0T A;  1N8J A;  3HZ4 A;  1EZK A;  5CAX A;  5IOW A;  4JE1 A;  3GH6 A;  3EUR A;  4HJM A;  1K3Y A;  2FWG A;  1DSB A;  2MYG A;  4TXO A;  3EVI A;  5F05 A;  4LA1 A;  4OO5 A;  2IFQ A;  1S3C A;  1XVQ A;  3PIN A;  1TTZ A;  3GYK A;  2LJA A;  2DSA A;  4CW9 A;  2DJ3 A;  2HRA A;  2OBK A;  2H1B A;  4K6X A;  1U6T A;  4RUV A;  1WE0 A;  4YAV A;  3FZ5 A;  5HR0 A;  9GSS A;  3APS A;  3VWW A;  4K9Z A;  2GSR A;  5FHI A;  5ID2 A;  3LQ7 A;  4MJC A;  4K0N A;  4BWS A;  4ECI A;  1LJR A;  2VLU A;  4YKF A;  1OVN A;  3P7X A;  4ILF A;  4V1A p;  3EU3 A;  4KX4 A;  5IIZ A;  11GS A;  5F06 A;  2HZE B;  3QAG A;  5ECO B;  3PR8 A;  1MDK A;  4NHZ A;  1ERW A;  1FHE A;  3F8U A;  4MNN A;  3TKS E;  3TKQ A;  4GCI A;  2YWI A;  2VCW A;  2YP6 A;  3DVW A;  1EGO A;  3DXB A;  2LKU A;  2X8C A;  4LL4 B;  4MZW A;  2AHE A;  1PMT A;  3WGD A;  2IJY A;  2HXK A;  2M80 A;  2TIR A;  4O7H A;  2N5F A;  1PSQ A;  1TKD B;  1K0A A;  5AIS A;  2ALB A;  2A2R A;  3ZFB A;  1X5D A;  2XBI A;  2YZH A;  3ERW A;  1Q98 A;  3A5I A;  1B8X A;  3ED3 A;  1V98 A;  1RK4 A;  2GTU A;  2ZCT A;  3RPN A;  2CAQ A;  3KD0 A;  2A4V A;  4ZBA A;  5H5R A;  3D6I A;  1GRX A;  3QAW A;  1BX9 A;  3L78 A;  3VPT A;  4GF0 A;  1U87 A;  1GL8 A;  1K3L A;  1N2A A;  2JL4 A;  4Z2R A;  3GKX A;  3Q6O A;  1WIK A;  3IRA A;  5FWG A;  4WXT A;  3IHQ A;  4FYC A;  1QK8 A;  3KGK A;  3ME8 A;  2KLX A;  1B4Q A;  4Q5N A;  2F3M A;  4LMW A;  1K0D A;  3APO A;  2B7J A;  2HFD A;  2DC5 A;  1XZO A;  1TW9 A;  2X49 A;  5DJL A;  2DKI A;  3VWV A;  6GSS A;  3GMF A;  2H01 A;  2HRF A;  3CSH A;  2PWJ A;  1XW6 A;  1XWK A;  5ABR A;  1F2E A;  2CVB A;  2YV7 A;  1R5A A;  2FA8 A;  2V6O A;  2IPA A;  4BVY B;  3L0H A;  3M8N A;  3IE3 A;  1X9S B;  1YKA A;  3M3M A;  1AW9 A;  3EWL A;  5CNW A;  2VUP A;  1FAA A;  3KCM A;  1URM A;  3O6T A;  4GRF A;  4K0G A;  3J7Y k;  3O76 A;  1GTU A;  5GST A;  1WPI A;  1JZO A;  1BYE A;  5A4W A;  3FEU A;  1THO A;  2H1D A;  1AQV A;  2FWE A;  6GST A;  4TOP A;  4HEA 2;  1PGT A;  1QUW A;  5ID2 B;  2BTO T;  4TW5 A;  6GSX A;  2LJK A;  4JRR A;  2AB6 A;  1ABA A;  1I5G A;  2I9H A;  2WDU A;  2YWM A;  3QOU A;  3TGZ A;  4BPY A;  2VL3 A;  2LRT A;  2FNO A;  4HS1 A;  1R26 A;  5DAK A;  1A23 A;  3NZN A;  3G7J A;  2AJQ B;  4TR1 A;  4MK3 A;  4K8M A;  4GTU A;  1YY7 A;  4MH2 A;  5H5S A;  5JWO B;  1TU8 A;  2OAD A;  4ISD A;  4BL7 A;  3C73 A;  4K2D A;  2KP1 A;  4PNG A;  4POB A;  3DRN A;  2RII A;  1ZMA A;  2HT9 A;  4Q5F A;  5IPG A;  1GTB A;  5G1L A;  1Q4J A;  5EY6 A;  3DYR A;  3ZFL A;  2B6M A;  3HJM A;  4XRD A;  1VF4 A;  1TI3 A;  2L4C A;  3APQ A;  2P5Q A;  4OO4 A;  1M99 A;  2MMA A;  4NV5 A;  4G19 A;  2VM2 A;  1YEX A;  1EP7 A;  3D5J A;  3UAP A;  3L9U A;  3TUE A;  3O3T A;  2LUS A;  1XVW A;  2XC2 A;  3KEB A;  10GS A;  3TKS C;  2FA4 A;  1ZL9 A;  2H6Z A;  2H6Y A;  2H71 A;  1XWC A;  3QDN A;  4IN0 A;  3BD2 A;  2CV4 A;  3TOT A;  2XPE A;  4IKH A;  1EOG A;  3G9B A;  2IMI A;  3L9S A;  4DSS A;  1EWX A;  1JFU A;  5F8B A;  3D22 A;  4N0Z A;  2GLR A;  4ZIL A;  6GSW A;  2LRN A;  2E2G A;  4BVX A;  4F2I A;  3RBT A;  2L6D A;  1V58 A;  5EL8 A;  2OJL A;  3TRQ A;  2GST A;  4ML6 A;  4YKG A;  1M2B A;  4NXI A;  1KBN A;  3UJ1 A;  4PGT A;  4QL9 A;  2LV3 A;  2DIY A;  1A2L A;  3IOS A;  1SEN A;  3M9K A;  4E8H A;  1GUK A;  3FYG A;  4HUA A;  2CA8 A;  5INY A;  1O81 A;  2PMT A;  4ID0 A;  4KW6 A;  2F9S A;  4CY6 A;  19GS A;  4V2N A;  1VF3 A;  2PUK C;  1NHY A;  4EO3 A;  1K0N A;  2B5Y A;  4QL7 A;  2E0Q A;  2CVD A;  1M0U A;  1QFN A;  3RAZ A;  3IC8 A;  3VFI A;  2OA7 A;  5IO0 A;  1TP9 A;  2K18 A;  4K7I A;  2H6X A;  1GWC A;  1O73 A;  1OC3 A;  5IPH A;  1PKW A;  2JU5 A;  1ML6 A;  1SD9 A;  2C1Y A;  4JR6 A;  1TRS A;  3Q74 A;  3LYK A;  1Y6E A;  2G0F A;  1VRS D;  4EIQ A;  2L57 A;  2JSY A;  2WS2 A;  1PX7 A;  2VAF A;  2IMK A;  1YDK A;  2HLS A;  1U88 A;  2GZZ A;  2IME A;  3LYP A;  5D9W A;  4GSN A;  1XBS A;  5ECR B;  3A2V A;  4WR5 A;  4JU5 A;  5DCG A;  4F0B A;  1PA3 A;  4EE0 A;  2PBJ A;  1A0R P;  2KHP A;  2RUE A;  1GTA A;  2IMD A;  3TJG A;  4IS0 A;  3TKS A;  1V57 A;  4FYU A;  20GS A;  4ECB A;  1GNW A;  2X99 A;  5J3R A;  1W4V A;  1UN2 A;  2JZT A;  3A5W A;  5B8A A;  4IP1 A;  4ZB9 A;  4EKZ A;  4HQS A;  1BAY A;  1ZGN A;  3TJK A;  2PN8 A;  5J4U A;  3J7Y b;  2C0D A;  22GS A;  5DAL A;  4JR4 A;  2XBQ A;  2LNT A;  2B1K A;  1GLP A;  4AJ6 A;  3I43 A;  1UA5 A;  2BMX A;  3I6A A;  5DDL A;  2YV9 A;  3ZMK A;  12GS A;  1ST9 A;  2V32 A;  3EYT A;  4MPG A;  3VUR A;  3M1G A;  1C72 A;  4KCE A;  1VF1 A;  2H74 A;  3HVS A;  3Q19 A;  4IGJ A;  1G6W A;  1J0F A;  4JBB A;  1RW1 A;  1EP8 A;  1GNE A;  4BVX B;  2PGT A;  3DD3 A;  4PX1 A;  2DJJ A;  5J41 A;  2GQL A;  1TK8 B;  3TJF A;  1YQ1 A;  2WRT A;  3GV1 A;  4OFT A;  5IMV A;  5IOX A;  2MBT A;  3WT1 A;  4TR3 A;  2GSQ A;  2YJH A;  4V2M A;  2C8U A;  5EVO A;  3FR6 A;  1ZYQ B;  4OFN A;  2V1M A;  1HNC A;  4XHM A;  1T4Y A;  1YF1 A;  1T4Z A;  2PER A;  3FY7 A;  5C04 A;  2HRN A;  1O7U A;  2FLS A;  2YWO A;  5EPF A;  1JZD A;  1GTI A;  1FO5 A;  2C3N A;  3R2Q A;  2H76 A;  2O7K A;  4WKW A;  2L4Q A;  4O5R A;  1SU9 A;  1TXX A;  3HJP A;  2YZU A;  3DWV A;  2IMF A;  4PUF C;  1XCC A;  3WYW A;  3F3R A;  1PD2 1;  4FH8 A;  1H4O A;  3LOR A;  1K3O A;  3ZIV A;  2DJ0 A;  8GSS A;  1T1V A;  1HYU A;  2H75 A;  4KAE A;  2VL9 A;  1WP0 A;  1ZZY A;  7GSS A;  3QFB C;  1AXD A;  3VWU A;  3IHG A;  3H93 A;  2P31 A;  3ZYW A;  2I4A A;  5ECP B;  2KP2 A;  2CZ3 A;  3HY2 A;  2DBC A;  5F0G A;  4MA9 A;  4KDU A;  1M7T A;  2R37 A;  4GWR A;  5DCH A;  2GQM A;  1X9M B;  4Q5R A;  2YN1 A;  3IAM 2;  4ZL7 A;  3BCI A;  4ACS A;  2ES7 A;  3GKK A;  3E3E A;  3HCZ A;  1OC8 A;  2DML A;  4LMV A;  1AQX A;  4HJ2 A;  3M9J A;  3OR5 A;  4CHS A;  3DEX A;  2VCQ A;  3GHA A;  5LD0 A;  3ZLP A;  1VGL A;  3CRT A;  4I2U A;  1K0C A;  1OC9 A;  3CXG A;  2YAN A;  1THX A;  2R4V A;  5AGY A;  1ERU A;  3IK7 A;  1SJ6 A;  3EMX A;  2WZ9 A;  4LL1 B;  2GQK A;  1ON4 A;  4IHU A;  4XIH A;  3VWX A;  1T00 A;  2LEG A;  3UBL A;  4FIW A;  5J5N A;  1A0F A;  4D73 B;  2N5B A;  3CYN A;  3FZA A;  2H66 A;  2J23 A;  5G31 A;  3TKR A;  1FOH A;  3GL3 A;  4YAP A;  1O85 A;  1XFL A;  1SL1 B;  1YEP A;  4MF5 A;  1K0O A;  1GSY A;  1F6M C;  1LBK A;  2KUC A;  1OE7 A;  2QA2 A;  3MYD A;  3GTU B;  1OE8 A;  3C8E A;  1EOH A;  4EDY A;  3ZIJ A;  2L5L A;  2H1A A;  5IQY A;  1IYI A;  2MMO A;  1GP1 A;  3CTF A;  3GUS A;  3GH9 A;  2VD1 A;  4Q5Q A;  4TXO B;  1KNG A;  3UAR A;  3QR6 A;  2VLT A;  4KH7 A;  2IFQ B;  3U6V A;  5KN2 A;  3A3T A;  1XPV A;  5ENU A;  1OKD A;  4HDE A;  4GQF A;  4ECJ A;  4PNF A;  4IBP A;  3PPU A;  4POL A;  4KUN A;  1XW9 A;  2Z9S A;  5B6M A;  1HQO A;  1ERT A;  2VM1 A;  1TRW A;  4KGI A;  3P8W A;  1OAZ A;  4PXO A;  1WMJ A;  2VL2 C;  5IMF A;  1TU7 A;  1VF2 A;  4F82 A;  1DE1 A;  3HYP A;  2LST A;  4KSM A;  2P5R A;  6GSY A;  4ZB8 A;  3SBC A;  4Z2T A;  1PL1 A;  2J9H A;  5G1K A;  2CT6 A;  2WFC A;  3KP9 A;  4MZC A;  4ULX A;  5JCG A;  1GUL A;  1R4W A;  4KND A;  2HZF A;  5ECS A;  3HZ8 A;  4FO5 A;  3IK9 A;  3PH9 A;  4X1U A;  3TJB A;  3W8S A;  2UZ8 A;  3H8Q A;  2H19 A;  5KN3 A;  4BA7 A;  5HFK A;  4Z2U A;  3F9U A;  2H72 A;  3P2A A;  3DKS A;  2C0F A;  1F3B A;  2OE3 A;  4EUY A;  17GS A;  2JZR A;  4WBJ A;  1GH2 A;  3IV4 A;  2FWH A;  3W6G A;  3ZRE A;  4G0L A;  4G0K A;  2VO4 A;  5JCW A;  2EIQ A;  4NV2 A;  3BOA A;  6GSV A;  5GAN D;  1Y25 A;  1WJK A;  4K2X A;  3ME7 A;  4XCS A;  4TR4 A;  3VLN A;  3EU4 A;  1OC9 B;  3D4T A;  3ZIT A;  3ZRD A;  5JCU A;  2B5X A;  1B48 A;  1TJD A;  2GDR A;  4OMV A;  3C1R A;  4USS A;  4V2L A;  3KMO A;  4G10 A;  3BBY A;  1Z7R A;  2ON7 A;  5HR1 A;  2R0C A;  5HFI A;  1KTE A;  3F6D A;  4IJ3 A;  3HD5 A;  5D73 A;  2EIR A;  3C1S A;  3UVT A;  2DJK A;  5ELA A;  4I8B A;  1QQ2 A;  2MMZ A;  5IM9 A;  2DKH A;  1U3A A;  2GT5 A;  1YZX A;  2K6V A;  4WBR D;  4JZQ A;  1NW2 A;  4NAX A;  4OCE A;  1NSW A;  2VOC A;  4PQI A;  5ECQ B;  1ZYE A;  4RQR A;  2VLV A;  3HJO A;  5COH A;  3L9V A;  2A2P A;  4KCA A;  2VL2 A;  1GSS A;  2MZC A;  1TOF A;  3IA1 A;  4MDC A;  2B1L A;  4EF0 A;  2R5G A;  4MP4 A;  2FD3 A;  1A8Y A;  3GST A;  2GZP A;  3UMA A;  5FT3 A;  5B7C A;  5G5F A;  2PU9 C;  1QGV A;  4F0C A;  4NPB A;  5CP1 A;  1XW5 A;  2XPD A;  4XTS A;  3TJJ A;  2F8A A;  4MF6 A;  2E7P A;  2IN3 A;  4MAB A;  4HQZ A;  1Z6M A;  4AJ7 A;  2GZY A;  3GUR A;  3TKP A;  3TRX A;  5AIX A;  3VPQ A;  3H1N A;  1WOU A;  1GLQ A;  2FCH A;  3IDV A;  1BED A;  1QMV A;  4KSO A;  4H86 A;  3UEM A;  2G2Q A;  4ZBB A;  3KMN A;  4XS6 A;  3SWL A;  4I2T A;  2FWF A;  2JSZ A;  5KOW A;  2HE3 A;  2H70 A;  3F63 A;  4MMM A;  5DAK B;  1ZYN A;  2K8S A;  3MDK A;  3QCP A;  3ZVJ D;  4KF9 A;  2VCT A;  1FVK A;  2C80 A;  4E8E A;  5B8B A;  3EC3 A;  4TR1 B;  5ECK B;  5BRT A;  3WGX A;  2FHE A;  3RHB A;  1PKZ A;  4BL7 B;  2B7K A;  2X64 A;  4HOJ A;  3TCO A;  1X0R A;  2WJU A;  4IQA A;  1U3I A;  3KH9 A;  1H75 A;  1S3A A;  3F4S A;  1K0M A;  2A4H A;  2R3X A;  4TKY A;  5KN1 A;  5IO2 A;  3FMW A;  1O8W A;  3DML A;  4TR0 A;  2EIO A;  2GVP A;  1MD4 A;  1O8X A;  3FR3 A;  3RPP A;  4WF5 A;  3IPZ A;  4CY8 A;  3KJY A;  1SK1 A;  3EMP A;  2LS5 A;  3TRP A;  2R2J A;  2VCV A;  4KA0 A;  4OCF A;  5B6N A;  1F37 A;  3QMX A;  3UL3 A;  3CRU A;  1FB0 A;  1ZOF A;  5AIV A;  1O6J A;  3GSS A;  3NIV A;  4IJI A;  4ZXG A;  1TK0 B;  4L8E A;  1MTC A;  3HA9 A;  3LWA A;  2HSH A;  2AUV A;  3IAS 2;  1TDI A;  4CDO A;  4YQV A;  1Z5Y E;  3JCM L;  2HSM A;  1HNA A;  4MJA A;  1ERV A;  1QXH A;  3C7M A;  5LCZ A;  4DSS B;  1PN9 A;  4WF4 A;  2H30 A;  4OWY A;  2E2M A;  1MDI A;  2WUL A;  3LGC A;  3ZZX A;  1E6B A;  2YNX A;  4J2F A;  1RQM A;  1XOB A;  4X43 A;  5HFG A;  5CRG A;  4IEL A;  2YCD A;  4EDZ A;  3W8J A;  3NOF A;  2R0P A;  1S3D A;  3MNG A;  1EEJ A;  3UVH A;  1HD2 A;  1TRV A;  3GL5 A;  2MBS A;  1HNB A;  5KEJ A;  1FB6 A;  2LQQ A;  4I97 A;  1EV9 A;  3BJ5 A;  3MWH A;  1X9W B;  2LRC A;  2H1G A;  1USB A;  4NMU A;  4O5Q A;  5JWQ B;  4PTS A;  4PQ1 A;  1YKC A;  4K7N A;  2HYX A;  4F9Z A;  1W89 A;  3CSJ A;  4RI6 A;  2PPT A;  4XS1 A;  3LSZ A;  5ECH B;  2EC4 A;  1DE2 A;  4BVY A;  5CYY A;  1GUM A;  2DJ2 A;  2YPM A;  5CRW A;  1PL2 A;  4PUR A;  2FY6 A;  1R5P A;  3KTL A;  3CSI A;  4G0I A;  2H73 A;  4QQ7 A;  3ZML A;  2K9F A;  4MLY A;  2CX4 A;  3DGQ A;  2VD0 A;  1K0B A;  18GS A;  5IMD A;  2X8H A;  4L0W A;  1J08 A;  1JZR A;  2LQO A;  2IIY A;  4ZBD A;  1KEB A;  5D8I A;  3ZVJ A;  4ZL8 A;  1TK5 B;  4TN8 A;  3VI7 A;  2V41 A;  1OYJ A;  3I69 A;  3U5R E;  4K7O A;  5A5K A;  1EV4 A;  4HZ4 A;  1V40 A;  4HU7 A;  2QKE A;  3DIE A;  2B3S A;  3ISO A;  3L4N A;  2JAD A;  2CZ2 A;  1MD3 A;  4YQU A;  2WB9 A;  3RDW A;  1M9A A;  5AN1 A;  1J9B A;  4YQM A;  5ECN B;  1ILO A;  4POK A;  5G5E A;  3GX0 A;  3KM6 A;  3KZQ A;  5A4U A;  3IC4 A;  3A2W A;  1WRY A;  4O32 A;  3F3Q A;  4GST A;  2O8V B;  4ECC A;  3GKN A;  3ZTL A;  4PQH A;  5D93 A;  3E9J B;  4O5U A;  2GSS A;  2O87 A;  2DMM A;  2RLI A;  3LG6 A;  1B4P A;  4BWQ A;  5HQP A;  4OFM A;  4GLT A;  1YF0 A;  1E2Y A;  1XOA A;  4EVM A;  1DUG A;  1M2A A;  2ON5 A;  2CAI A;  3GX8 A;  4X4J A;  2K8V A;  5DJM A;  4TXV A;  5DAL B;  1NHO A;  3LW9 A;  3GNJ A;  2DLX A;  1T3B A;  3F4R A;  4RI7 A;  3LEF A;  4EIP A;  4I6X A;  2KOK A;  1T8E B;  1FW1 A;  3A2X A;  1GSE A;  3QAV A;  4IP6 A;  3F4T A;  4WR4 A;  1FOV A;  3CTG A;  4ICY A;  2I1U A;  2YJ7 A;  1Z3E A;  4PUA A;  3HKR A;  2L5O A;  3GFK A;  2V2G A;  3H79 A;  2HNL A;  1G6Y A;  2GS3 A;  2WCI A;  1PQN A;  16GS A;  3QPM A;  4ML1 A;  5F07 A;  3WD6 A;  5LNK e;  2VCX A;  3IBH A;  2DJ1 A;  3CMI A;  3F0I A;  2VIM A;  3G7Y A;  1G7E A;  4K5R A;  4HU9 A;  2CX3 A;  1GUH A;  4POM A;  2NBS A;  3HVV A;  5C00 A;  1UC7 A;  1Z9H A;  1SL0 B;  5ECI B;  4KDY A;  5D9X A;  2YOI A;  1Z6N A;  2AAW A;  13GS A;  1XWB A;  2PVQ A;  14GS A;  3I9V 2;  3Q18 A;  3AY8 A;  4KB3 A;  3QD9 A;  5J9C A;  1PN0 A;  2QC7 A;  4AJ8 A;  4K1F A;  1WWJ A;  4NHW A;  3LXT A;  1Z7P A;  1A2J A;  4MH3 A;  1GSF A;  4NWY A;  3HVX A;  5GAP D;  5CRH A;  3E0U A;  4AGS A;  3F6F A;  3FZ9 A;  2B5E A;  4GSS A;  2C0G A;  4HI7 A;  3VK9 A;  1SL2 B;  3FRC A;  3HDC A;  2H8L A;  5G30 A;  3GRX A;  3RHC A;  2VCZ A;  1SKS B;  5D96 A;  4F03 A;  2NPB A;  5J9B A;  1MDJ A;  1B9X C;  4HZ2 A;  1SK2 A;  4L5O A;  4MPF A;  4RQX A;  4WET A;  4K5S A;  5GSS A;  2ZNM A;  4P3Y B;  2RM5 A;  1BJX A;  1GSU A;  2PVO C;  3KP8 A;  1CQH A;  4DEJ A;  2H0G A;  2O85 A;  3H4K A;  3VI5 A;  1GSD A;  3V1W A;  1R7H A;  1BG5 A;  4N10 A;  2OAC A;  4N0V A;  4TRX A;  4N11 A;  1XWA A;  2C0E A;  2I3Y A;  3MSZ A;  5E4W A;  3N5O A;  3UIW A;  4IQ1 A;  4MCU A;  3GA4 A;  5DVB A;  4FQU A;  1ZYP A;  2TRX A;  2L6C A;  3MIX A;  5JWR B;  2YWN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...