1A8YA

Crystal structure of calsequestrin from rabbit skeletal muscle sarcoplasmic reticulum at 2.4 a resolution
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
345
structure length
338
Chain Sequence
GLDFPEYDGVDRVINVNAKNYKNVFKKYEVLALLYHEPPEDDKASQRQFEMEELILELAAQVLEDKGVGFGLVDSEKDAAVAKKLGLTEEDSIYVFKEDEVIEYDGEFSADTLVEFLLDVLEDPVELIEGERELQAFENIEDEIKLIGYFKNKDSEHYKAFKEAAEEFHPYIPFFATFDSKVAKKLTLKLNEIDFYEAFMEEPVTIPDKPNSEEEIVNFVEEHRRSTLRKLKPESMYETWEDDMDGIHIVAFAEEADPDGYEFLEILKSVAQDNTDNPDLSIIWIDPDDFPLLVPYWEKTFDIDLSAPQIGVVNVTDADSVWMEPSAEELEDWLEDVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CALSEQUESTRIN
publication title Crystal structure of calsequestrin from rabbit skeletal muscle sarcoplasmic reticulum.
pubmed doi rcsb
molecule tags Calcium-binding protein
total genus 87
structure length 338
sequence length 345
ec nomenclature
pdb deposition date 1998-03-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1a8yA03
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1a8yA01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1a8yA02
3C7MA 3BBYA 5AIVA 2MMNA 4TXOA 2C0GA 4J57E 1BYEA 2H8LA 2HRNA 5IMVA 1X5CA 4D73A 3HHVA 1GSUA 1ACVA 2M80A 5LCZA 2C80A 2DJ0A 4WEYA 1XPVA 3IAM2 3CXGA 4MJEA 1R7HA 3APQA 2H75A 3KMOA 4FYUA 4BWSA 2GLRA 4ZB8A 4TVEA 4CDOA 3TOUA 1F37A 5D9WA 1SJIA 4CW9A 1VRSD 2YN1A 4TR0A 2WULA 3BCIA 2P5QA 1Z3EA 1UVZA 2H66A 2N5BA 3APSA 2C3QA 4KSMA 3M8NA 1YZXA 1X0RA 2F51A 3WGEA 4G9HA 4O32A 5INYA 1CQGA 3C73A 3LXZA 3TUEA 2GSRA 1BJXA 3HY2A 1A0RP 3F63A 5D93A 2RUFA 5AN1A 4LL1B 1WMJA 3UJ1A 1SL2B 3M9JA 1NHYA 2H30A 1FAAA 3C1SA 4KAEA 3ERGA 2RIIA 1OC3A 2E7PA 5IMAA 3GKNA 4ZB9A 1A2MA 5ID2A 1SL0B 3F0IA 4AJ7A 5J9CA 5CO3A 2A4VA 1PRXA 2LV3A 3MWHA 2WB9A 4OFTA 4RI7A 2VO4A 6GSSA 2HYXA 4TRXA 4N10A 4NV2A 5HFGA 2FGXA 3CTFA 2CQ9A 2DJ2A 1TW9A 2IJYA 2C0DA 1EEMA 1YKAA 2AYTA 3G7JA 2VM2A 5FT3A 1U6TA 4POKA 2L6CA 1R26A 2IMIA 1GULA 1WPIA 1AAZA 2I3YA 1VF4A 2JSYA 2VUPA 3V1WA 5CNWA 3TJKA 2B6MA 1PKZA 3HYPA 3HVVA 1GLPA 2ON5A 2HNLA 4JRRA 3GFKA 2HZFA 3L78A 3WT2A 1ZYEA 2CVDA 5DALA 3P2AA 3GSTA 1YF0A 3EU3A 4WXTA 2O7KA 4N11A 2WGRA 3LYPA 1PA3A 3N5OA 4IELA 3RHBA 1G6YA 4JEDA 3D21A 1J9BA 4MH2A 5H5QA 4MF5A 1ZOFA 3E9JB 3GA4A 3QMXA 1GTBA 1A24A 5CRGA 3KCMA 1J0FA 2V6KA 1SJ6A 4MDCA 2X8CA 1GUHA 1USBA 3GV1A 4KCAA 4FYBA 1PX7A 4BVXA 2FY6A 1QGVA 3J7Yk 1Z9HA 4K9ZA 2H1DA 4IKHA 3DXBA 4TR3A 3HVXA 3UAPA 3DGQA 4OMVA 5IPHA 1T8EB 3TKPA 3IXRA 5CYYA 1W89A 5IPGA 5DJMA 5DJLA 1XW5A 1GSEA 4K6XA 2PBJA 1SKRB 1DSBA 4G2EA 5AISA 1M7TA 4AJ8A 4K0NA 2IFQA 3VURA 3Q74A 3DMLA 3VPTA 4Q5RA 4KSOA 1XW6A 2C4JA 2P31A 4O92A 5G2ZA 1DE2A 2PWJA 4GTUA 4ZBBA 2IPAA 4OCFA 3GUSA 1XVQA 1O81A 5CRHA 3KJYA 3TDGA 3TJGA 2C3TA 3GH9A 4HEA2 5AGYA 4MP4A 5J9BA 4ECIA 4PQ1A 1IYHA 2PGTA 2WRTA 2L5LA 5F06A 1HNBA 3TCOA 3F3QA 3D4TA 2RM6A 5DAKA 2I81A 4MZCA 1A23A 1THXA 5CREA 3IAS2 2VCWA 3BD2A 3F9UA 4Q5FA 3GN3A 2QC7A 5GSTA 3GMFA 2VLUA 1YDKA 4GXZA 3SWLA 1LBKA 12GSA 3UARA 3IE3A 4CHSA 5C00A 2DJ3A 2YV9A 1U3IA 1TRUA 2CAIA 2EIQA 4RI6A 5DAKB 2LRCA 5JCUA 1OAZA 10GSA 1MEKA 3O76A 1DUGA 4K7NA 5JCWA 1H75A 5IO2A 3TKRA 1PD21 2FA4A 3C71A 3LGCA 1A2JA 2VD0A 2J9HA 4PURA 3TRPA 1OC8A 4FIWA 4EVMA 1F3AA 2GT6A 4DSRA 4K1FA 5GAPD 1GSQA 1V98A 1NSWA 4MA9A 3CSHA 2GZPA 4OCEA 2YPMA 3A2VA 1TK5B 2XPDA 1GSFA 4EE0A 4HQSA 3QD9A 1B4PA 3F3RA 1DE1A 4G10A 1O73A 4MF7A 3LQ7A 4IP1A 4YQUA 2CV4A 2CAQA 3C8EA 1TDIA 2LRTA 3L9VA 4AJ6A 2VCZA 2TRCP 4MH3A 4ZIJA 1BQ7A 1AIUA 3F4TA 2OBKA 3GH6A 1ZGNA 1X5DA 2FHEA 2LEGA 2XC2A 3Q19A 3EE2A 1AQXA 3VWWA 4PUFC 5E59A 2H0IA 2KOKA 4L0UA 2LUSA 2HRFA 2LJRA 1OE8A 2R4VA 1M0UA 3WT1A 4QL7A 2CVKA 4L5LA 5F05A 2FA8A 1T4ZA 1T00A 1JZDA 1FW1A 5EPFA 4KB3A 2IIYA 4BVYA 4XS6A 3M1GA 5IOWA 2GVPA 3ZFBA 2DJ1A 1NM3A 4GSNA 4QQ7A 2FLSA 5J5NA 2R37A 6GSWA 3AY8A 4ZBAA 5HFKA 3OR5A 2JACA 2DJJA 2VCQA 1G7OA 1VGLA 5DVBA 3KH7A 1NW2A 2I9HA 2VLVA 2AHEA 5ECOB 3ZZXA 3CBUA 4HI7A 2DMMA 2GSTA 5KEJA 3UL3A 1ZYQB 1I9DA 4I97A 4JE1A 4NV5A 2AV4A 4K7IA 1OC9A 1OVNA 2HZEB 5F0GA 2KHPA 4ML6A 2GZZA 1B48A 1OE7A 3K8NA 4OFMA 3U5RE 4NXIA 2H74A 1JZWA 4DVCA 1QMVA 1S3DA 4O7HA 11GSA 1XW9A 3DYRA 1JHBA 4V2MA 4ZL9A 3H1NA 2B1KA 3LG6A 3LFLA 3TOTA 2K18A 3D0ZA 1W4VA 1TP9A 1PSQA 1K0NA 1XFLA 1SKSB 1UN2A 4X43A 1GRXA 3ERFA 4ID0A 4L0WA 4RUVA 2K8VA 1M99A 2V2GA 4AGSA 4E8HA 4KW6A 3GKXA 1AW9A 3NIVA 5KN3A 5IMDA 4DSSA 4MJBA 3L9SA 4EO3A 1HD2A 4TXOB 5IIZA 1QFNA 4OWYA 4Z7XA 1EV4A 1K3OA 2O8VB 3N9JA 1AQVA 4D73B 2DC5A 3TB2A 1GH2A 2AAWA 4KDXA 1A8YA 3CYNA 2MMAA 4QL9A 2LNTA 5DCGA 3O3TA 1GSYA 2BJXA 2REMA 2E2MA 3SBCA 1LU4A 1VF3A 4LLRA 4PNGA 3FR6A 2DIZA 2PMTA 5D73A 2GGTA 2R3XA 5IMFA 3APOA 16GSA 1GL8A 3HDCA 1VF1A 4I2UA 3GIXA 3CTGA 4YQVA 4N0VA 4EF0A 3L9UA 1V57A 4KDYA 5DBQA 2H72A 1TOFA 3ED3A 4GCIA 2M46A 4PXOA 3IDVA 2JADA 4IJIA 4Q5QA 2MZCA 5ECHB 2RM5A 3KMNA 1IYIA 3UMAA 5F07A 2FD3A 2XPEA 1TI3A 1K3LA 2HI7A 2IMFA 2FWEA 5IMZA 3CRUA 2ON7A 4HOJA 2F8FA 5J3RA 2J23A 5ID2B 2FWGA 4ECCA 1TI1A 2XBQA 5G5FA 1SK0A 2JSZA 5ABRA 3FZ4A 1KNGA 3A5WA 3D5JA 1J08A 3CMIA 4ZL8A 4Q5NA 1GUKA 1R5PA 3S9FA 2FWHA 3MDKA 2H76A 1ZZYA 4PGTA 3DD3A 1T7PB 5DQSA 1TRVA 1B9YC 4KA0A 2R2JA 3ZMKA 1ST9A 2ZCTA 5G31A 4K0GA 2FWFA 3RPNA 1TK8B 1K0OA 3H8QA 2XHFA 1MD3A 6GSYA 1C72A 2VL2A 13GSA 3CSJA 1XXUA 3HA9A 4EKZA 1AXDA 1AQWA 5D9TA 7GSSA 4MPFA 3VWXA 3HJPA 4POBA 3ZIVA 2WZ9A 5DALB 2VL2C 1TRWA 2HFDA 2O89A 2DBCA 3KTBA 1OKDA 4F82A 22GSA 3M0FA 18GSA 2WCIA 1F6MC 1EEJA 1JZRA 2YCDA 2K6VA 4FYCA 5IOXA 1XIYA 3GL3A 2BTOT 5GSSA 2B1LA 1M2BA 2O85A 17GSA 4IQAA 3R2QA 3UVHA 2ES7A 1TK0B 3KTLA 3HD5A 5FHIA 2HSYA 2WFCA 4PQHA 2VL9A 2OACA 2WDUA 3QOUA 5LD0A 2YOIA 5J4UA 1ERWA 3VFIA 1MDJA 1QUWA 4HJMA 3IK9A 3GKKA 4OO5A 1WIKA 3W8JA 3I69A 5G1KA 1KTEA 3IRAA 6GSTA 3HZ8A 1SKWB 3QFBC 2ALBA 2OKAA 1AC1A 3QR6A 3IPZA 4MLYA 4DEJA 1K0DA 1HQOA 5A5KA 2DIYA 2JZTA 2L59A 4X0XA 3TKSA 3FY7A 2IFQB 4NMUA 1DBYA 3QAVA 3NZNA 3EWLA 1XWBA 3TJFA 1QQ2A 3TJBA 3HVSA 2YANA 2YZUA 6GSUA 4MJAA 3TKSC 2JL4A 3QCPA 3C1RA 4HU7A 4LMVA 4I5QA 1XOBA 1EWXA 2YWNA 1M9BA 2B7JA 1NHOA 3KM6A 4YQMA 2LKUA 5CAXA 1A2LA 4F03A 1M9AA 1A0FA 2YWMA 5B7CA 4KH7A 1GNEA 5B6NA 2VCXA 1B4QA 5ECIB 1JLVA 4TOPA 3TJJA 3TKSE 5B8AA 4JU5A 2I1UA 2XBIA 2GSSA 3ERWA 5EY6A 2H6XA 3FW2A 1F9MA 3HKRA 1U87A 4TR1A 1Z5YE 2K8SA 1OKTA 4HS1A 3KXOA 3U6VA 1Z6NA 2DSAA 4PX1A 3VI7A 4F9ZA 3L0HA 2F8AA 1O8WA 2GQMA 1WRYA 4MK3A 2WS2A 1ABAA 4ZBDA 1X9MB 5CRDA 2C0EA 5HQPA 2NPBA 1TJDA 1FVJA 4TW5A 4V1Ag 4MCUA 5C04A 2HSHA 1N8JA 2JZRA 2L57A 1ILOA 1TTZA 2IMDA 1ERUA 4WF5A 4HZ4A 3F4SA 2X64A 4BWQA 5DCHA 3IV4A 3ZRDA 2G0FA 2H1GA 2PVOC 3DVWA 5ECSA 3IC4A 2LQQA 1SJZA 2YP6A 1SD8A 2TRXA 2NTOA 3FZAA 2CVBA 4HJ2A 1GUMA 2OADA 4TN8A 5J41A 1MDKA 3HJMA 2H6ZA 2PN8A 3ZTLA 4FO5A 2RLIA 3F6FA 3US3A 3GKMA 4J56E 5ECLB 1TKDB 5JWQB 4WR4A 3GTUA 3EU4A 2CX3A 1X9SB 4KDUA 4ILFA 4PQIA 2C8UA 3UEMA 4NHWA 1K3YA 2A2SA 1EV9A 1V9WA 2H0HA 3GURA 3UVTA 3LSZA 3IBHA 3ISOA 1GSSA 1F2EA 2GZYA 3F4RA 1A8LA 5JWRB 5HR0A 2AUVA 3MNGA 3RBTA 2KP2A 3GTUB 4IVFA 4HQZA 2VCVA 1ML6A 5B6MA 2PU9C 1FOVA 3Q18A 3FZ9A 4PUAA 2OBIA 3HXSA 4AF2A 1WP0A 2VLTA 1EP8A 1JLWA 4HDEA 4TR4A 5COHA 3RDWA 4H86A 1O8XA 1XVWA 4XHMA 2C1YA 3VPQA 5H5SA 3LYKA 2KLXA 1RW1A 5HR1A 2I4AA 1SU9A 2AB6A 1SK1A 2O87A 1Q4JA 3FZ5A 3TGZA 4EDYA 2CZ2A 1V40A 3MSZA 5A4VA 1GTAA 3P7XA 3LORA 2VCTA 1ON4A 2IN3A 1PL1A 2YWIA 4XIHA 3DWVA 4LA1A 1XOAA 1PGTA 2VIMA 1OC9B 2CT6A 4IHUA 3UBKA 2VM1A 4WETA 3KEBA 1SENA 2FUG2 2B5XA 3GX0A 4KUNA 4N0ZA 2OA7A 5E4WA 3GNJA 2V41A 3FR9A 4MPGA 3QAGA 3QFAC 2YV7A 4EC0A 3ZVJA 2E2GA 3EC3A 4LMWA 2H70A 2R5GA 1BEDA 1MDIA 1SYRA 4MZWA 4P3YB 1BAYA 4ULXA 1Z6MA 2LSTA 1CQHA 1F3BA 1T4YA 5ECPB 2H1BA 2DJKA 5GAND 1ERVA 2GQLA 3IHQA 3ME7A 3ZFLA 1E6BA 4KE3A 2H01A 1K0BA 1WJKA 2L5OA 1UC7A 1VF2A 2GTUA 1EZKA 3IA1A 5JWOB 3EYTA 4KGIA 4XCSA 2VD1A 3L4NA 5KN2A 4XTSA 3P8WA 1K0CA 4BL7A 1YEXA 2P0GA 5H5RA 1S3CA 3ZLPA 3NOFA 2NDOA 2VOCA 4DSSB 1RK4A 4I6XA 3M3MA 2OJLA 4IBPA 4YH2A 3LJRA 2QSIA 1JFUA 3ZL5A 1AUCA 4IQ1A 3FYGA 4NPBA 1K0MA 3MAKA 1GTUA 5IM9A 5IQYA 1EP7A 4JR6A 1TU7A 5D8IA 2HLSA 2LTKA 3UIWA 5D96A 1ERTA 1N2AA 1TXXA 2X99A 2H19A 3PR8A 3H4KA 4O5RA 4RQRA 4RQXA 1PQNA 4NHZA 3ZMLA 2B5EA 4WKWA 3TRQA 1EOGA 1GLQA 4IP6A 5A4UA 2JU5A 4IN0A 2OE0A 9GSSA 3LWAA 5IO0A 1B9XC 4KX4A 1GWCA 4K7OA 3FKFA 1FO5A 2G2QA 2PUKC 4F0BA 1PKWA 3P90A 5G30A 1JZOA 3E3EA 2MBSA 2LNSA 3W6GA 3O6TA 3J7Yb 1URMA 4ACSA 2Z9SA 5F8BA 5GZZB 1QK8A 3A3TA 3H79A 2HXKA 2H71A 4GQFA 14GSA 1UA5A 1M2AA 4WF4A 3FHKA 2JZSA 3EMPA 3UBLA 2LS5A 4IW9A 3LXTA 4JR4A 3VLNA 2YJ7A 1HNCA 4I2TA 3F8UA 3VWVA 5ELGA 4BA7A 2H73A 4JZQA 2DMLA 2PERA 2YZHA 4WR5A 3A2WA 3HZ4A 1YF1A 4LL4B 4EUYA 3QDNA 4FH8A 5FWGA 3RPPA 4JBBA 4TXVA 4I8BA 3M9KA 2MBTA 2K9FA 4ZB6A 1SD9A 3FEUA 3ZREA 4DSQA 5HR3A 2IMKA 2PPTA 3BJ5A 4XRAA 2N5AA 2X8HA 1SK2A 2FNOA 5DQYA 2C3NA 3ME8A 3D6IA 1LJRA 2MMZA 4BPYA 4NWYA 4PNFA 4MJCA 1V58A 3QAWA 1PX6A 2ZNMA 1BX9A 4KCEA 1X9WB 4N30A 5ECRB 5EVOA 3KP8A 1OYJA 2WJUA 4F2IA 1E2YA 5KN1A 2LJKA 1FHEA 4OO4A 2GS3A 3KZQA 1KBNA 1T1VA 3ZIJA 4POLA 3GYKA 2VAFA 5ENUA 4L8EA 3UOMA 4IJ3A 1XWCA 3GHAA 5AIXA 5ECKB 1FVKA 2LJAA 5B8BA 4OD7A 2EIOA 5ECMB 2GQKA 4K8MA 2F3MA 4ECJA 5JCGA 3IR4A 3RHCA 1MTCA 4MABA 1U3AA 2H0GA 3KD0A 5CP1A 4GWRA 2P5RA 1M2DA 3CSIA 1PN9A 2LQOA 3VI5A 3ZITA 3PINA 1Y25A 1O85A 1KEBA 2QGVA 19GSA 3CRTA 3EINA 2HT9A 20GSA 3ZYWA 3DIEA 2QKEA 5LNKe 4ECBA 1YQ1A 4GF0A 2X8GA 3A2XA 4ZXGA 2L4CA 5ECQB 3G7IA 4GQCA 3PGTA 4YAPA 1Z7RA 1I5GA 2R6KA 3IOSA 4V2NA 5D9VA 3IK7A 3WGXA 6GSVA 1V2AA 2OE1A 2KUCA 4EXJA 3EMXA 4ZILA 3I43A 2H1AA 2TIRA 4GRFA 1T3BA 3LEFA 3DKSA 4ML1A 1HNAA 3VWUA 2C0FA 2YWOA 1PMTA 4TR1B 3PH9A 3FK8A 6GSXA 2D2ZA 4GSSA 8GSSA 2AJQB 2IWTA 5G1LA 2MYGA 1RQMA 4EL1A 3I6AA 5A4WA 4WBJA 1YJ6A 3TKQA 2V6OA 2NVLA 1BG5A 2N5FA 2VL3A 2YNXA 4YAVA 4HZ2A 4ISDA 3BCKA 2L6DA 4XS1A 1PL2A 4XS4A 2V1MA 1QXHA 1WE0A 4L5OA 1XWKA 1S3AA 3GRXA 2EC4A 3ZVJD 4J2FA 5ECNB 3KP9A 1ZCPA 3KGKA 2V32A 4GLTA 4IS0A 3TRXA 1SL1B 2E0QA 2L4QA 1GTIA 2OE3A 4MF6A 4EDZA 1Q98A 4V1Ap 4XS4B 2ZUPA 2H6YA 1TRSA 1XCCA 1EGRA 5HR2A 3BOAA 3G7YA 4TKYA 1X5EA 3DVXA 3EURA 3WGDA 4MMMA 3G9BA 1B8XA 3FR3A 3KH9A 3FRCA 1Y6EA 4MZBA 2EIRA 1O7UA 3GL5A 4F0CA 2CZ3A 5EL8A 1K0AA 3WYWA 1YY7A 3DEXA 3EVIA 2FCHA 4V2LA 3I9V2 4G19A 1WWJA 1G0TA 3W8SA 3E0UA 3D22A 2NBSA 4E8EA 1GSDA 5G5EA 5DDLA 1GP1A 1R5AA 4XRDA 2DLXA 3RAZA 1FG4A 1YEPA 3GSSA 2IL3A 2MMOA 5KN0A 2M72A 4GSTA 1U88A 3Q6OA 2HE3A 5HFIA 4WBRD 5L71A 2GSQA 2B3SA 3GX8A 2HZEA 2IMEA 3WD6A 2CX4A 1ZL9A 2YJHA 3D4MA 4POMA 1MD4A 1Z7PA 1XBSA 3VK9A 3KIJA 2A2RA 4KNDA 2B7KA 1SYXA 4HUAA 1XWGA 1GNWA 1YKCA 1G6WA 5ELAA 2F9SA 4NAXA 3HJOA 2BMXA 4ZL7A 1HYUA 3H93A 1XZOA 1TU8A 3HCZA 4HU9A 4X1UA 1ZMAA 3QPMA 1EOHA 1O6JA 1FB6A 2KP1A 2B5YA 1WOUA 2PVQA 4K2DA 1R4WA 5IMCA 2CA8A 1EGOA 2RUEA 4OFNA 1H4OA 3DRNA 1FB0A 3F6DA 5CRWA 1THOA 2GDRA 1XWAA 5D9XA 4IGJA 3JCML 2GT5A 1G7EA 2LRNA
chains in the Genus database with same CATH superfamily
3C7MA 3BBYA 5AIVA 2MMNA 4TXOA 2C0GA 4J57E 1BYEA 2H8LA 2HRNA 5IMVA 1X5CA 4D73A 3HHVA 1GSUA 1ACVA 2M80A 5LCZA 2C80A 2DJ0A 4WEYA 1XPVA 3IAM2 3CXGA 4MJEA 1R7HA 1S3RA 3APQA 2H75A 3KMOA 4FYUA 4BWSA 2GLRA 4ZB8A 4TVEA 4CDOA 3TOUA 1F37A 5D9WA 1SJIA 4CW9A 1VRSD 2YN1A 4TR0A 2WULA 3BCIA 2P5QA 1Z3EA 1UVZA 2H66A 2N5BA 3APSA 2C3QA 4KSMA 3M8NA 4Z2RA 2HRKA 1YZXA 1X0RA 2F51A 3WGEA 4G9HA 4O32A 5INYA 1CQGA 3C73A 3LXZA 2X49A 3TUEA 2A4HA 2GSRA 1BJXA 3HY2A 1A0RP 3F63A 5D93A 2RUFA 5AN1A 4LL1B 1WMJA 3UJ1A 1SL2B 3M9JA 1NHYA 2H30A 1FAAA 3C1SA 4KAEA 3ERGA 2RIIA 1OC3A 2E7PA 5IMAA 3GKNA 4ZB9A 1A2MA 5ID2A 1SL0B 3F0IA 4AJ7A 5J9CA 2QA2A 5CO3A 2A4VA 2X4AA 1PRXA 2LV3A 3MWHA 2WB9A 4OFTA 4RI7A 2VO4A 6GSSA 2HYXA 4TRXA 4N10A 4NV2A 5HFGA 2FGXA 3CTFA 2CQ9A 2DJ2A 1TW9A 2IJYA 2C0DA 1EEMA 1YKAA 2AYTA 3G7JA 2VM2A 5FT3A 1U6TA 4POKA 2L6CA 1R26A 2IMIA 4PTSA 1GULA 1WPIA 1AAZA 2I3YA 1VF4A 2JSYA 2VUPA 3V1WA 5CNWA 3TJKA 2B6MA 1PKZA 3HVNA 3HYPA 3HVVA 1GLPA 2ON5A 2HNLA 4JRRA 3GFKA 2HZFA 3L78A 4O5UA 3WT2A 1ZYEA 2CVDA 5DALA 3P2AA 3GSTA 1YF0A 3EU3A 4WXTA 2O7KA 4N11A 2WGRA 3LYPA 1PA3A 3N5OA 4IELA 3RHBA 1G6YA 4JEDA 3D21A 1J9BA 4MH2A 5H5QA 4MF5A 1ZOFA 3E9JB 3GA4A 3QMXA 1GTBA 1A24A 5CRGA 3KCMA 1J0FA 2V6KA 1SJ6A 4MDCA 2X8CA 1GUHA 1USBA 3GV1A 4KCAA 4FYBA 1PX7A 2DKIA 4BVXA 2FY6A 1QGVA 2R0GA 3J7Yk 1Z9HA 4K9ZA 2H1DA 4IKHA 3DXBA 4TR3A 3HVXA 3UAPA 3DGQA 4OMVA 5IPHA 1T8EB 3TKPA 3IXRA 5CYYA 1W89A 5IPGA 5DJMA 5DJLA 1XW5A 4BVXB 1GSEA 4K6XA 2PBJA 1SKRB 1DSBA 4G2EA 5AISA 1M7TA 4BIKA 4AJ8A 4K0NA 1PFOA 2IFQA 3VURA 3Q74A 3DMLA 3VPTA 4Q5RA 4KSOA 1XW6A 2C4JA 2P31A 4X4JA 4O92A 5G2ZA 1DE2A 2PWJA 4GTUA 4ZBBA 2IPAA 4OCFA 3GUSA 1XVQA 1O81A 5CRHA 3KJYA 3TDGA 3TJGA 2C3TA 3GH9A 4HEA2 5AGYA 4MP4A 4K5SA 5J9BA 4ECIA 4PQ1A 1IYHA 2PGTA 2WRTA 2L5LA 5F06A 1HNBA 3TCOA 3F3QA 3D4TA 2RM6A 5DAKA 2I81A 4MZCA 1A23A 1THXA 5CREA 3IAS2 2VCWA 3BD2A 3F9UA 4Q5FA 3GN3A 2QC7A 5GSTA 3GMFA 2VLUA 1YDKA 4GXZA 3SWLA 1LBKA 12GSA 3UARA 3IE3A 4CHSA 5C00A 2DJ3A 2YV9A 1U3IA 1TRUA 2CAIA 2EIQA 4RI6A 5DAKB 2LRCA 5JCUA 1OAZA 10GSA 1MEKA 3O76A 1DUGA 4K7NA 5JCWA 1H75A 5IO2A 3TKRA 1PD21 2FA4A 3C71A 3LGCA 1A2JA 2VD0A 2J9HA 4PURA 3TRPA 1OC8A 4FIWA 4EVMA 1F3AA 2GT6A 4DSRA 4K1FA 5GAPD 1GSQA 1V98A 1FOHA 1NSWA 4MA9A 3CSHA 2GZPA 4OCEA 2YPMA 3A2VA 1TK5B 2XPDA 1GSFA 4EE0A 4HQSA 3QD9A 1B4PA 3F3RA 1DE1A 4G10A 1O73A 4MF7A 3LQ7A 4IP1A 4YQUA 2CV4A 2CAQA 3C8EA 1TDIA 2LRTA 3L9VA 4AJ6A 4G0LA 2VCZA 2TRCP 4MH3A 4ZIJA 4K5RA 1BQ7A 1AIUA 2QA1A 3F4TA 2OBKA 3GH6A 1ZGNA 1X5DA 2FHEA 2LEGA 2XC2A 3Q19A 3EE2A 1AQXA 3VWWA 4PUFC 5E59A 2H0IA 2KOKA 4L0UA 2LUSA 3FMWA 2HRFA 2LJRA 1OE8A 2R4VA 1M0UA 3WT1A 4QL7A 2CVKA 4L5LA 5F05A 2FA8A 1T4ZA 1T00A 1JZDA 1FW1A 5EPFA 4KB3A 2IIYA 4BVYA 4XS6A 3M1GA 5IOWA 2GVPA 3ZFBA 2DJ1A 1NM3A 4GSNA 4QQ7A 2FLSA 5J5NA 2R37A 6GSWA 3AY8A 4ZBAA 5HFKA 3OR5A 2JACA 2DJJA 2VCQA 1G7OA 1VGLA 5DVBA 3KH7A 1NW2A 2I9HA 2VLVA 2AHEA 5ECOB 3ZZXA 4CY6A 3IHGA 3CBUA 4HI7A 2DMMA 2GSTA 5KEJA 4G0KA 3UL3A 1ZYQB 1I9DA 3PPUA 4I97A 4JE1A 4NV5A 2AV4A 4K7IA 1OC9A 1OVNA 2HZEB 5F0GA 2KHPA 4ML6A 2GZZA 1B48A 1OE7A 3K8NA 4OFMA 3U5RE 4NXIA 2H74A 1JZWA 4DVCA 1QMVA 1S3DA 1XG8A 4O7HA 11GSA 1XW9A 3DYRA 1JHBA 4V2MA 4ZL9A 3H1NA 2B1KA 3LG6A 3LFLA 3TOTA 2K18A 3D0ZA 1W4VA 1TP9A 1PSQA 1K0NA 1XFLA 1SKSB 1UN2A 4X43A 5KOWA 1GRXA 3ERFA 4ID0A 4L0WA 4RUVA 2K8VA 1M99A 2V2GA 4AGSA 4E8HA 4KW6A 3GKXA 1AW9A 3NIVA 5KN3A 5IMDA 4DSSA 4MJBA 3L9SA 4EO3A 1HD2A 4TXOB 5IIZA 1QFNA 4OWYA 4Z7XA 1EV4A 1K3OA 2O8VB 3N9JA 1AQVA 4D73B 2DC5A 3TB2A 1GH2A 2AAWA 4KDXA 1A8YA 3CYNA 2MMAA 4QL9A 3A5IA 2LNTA 5DCGA 3O3TA 1GSYA 2BJXA 2REMA 2E2MA 3SBCA 1LU4A 1VF3A 4LLRA 4PNGA 3FR6A 2DIZA 2PMTA 5D73A 2GGTA 2R3XA 5IMFA 3APOA 16GSA 1GL8A 3HDCA 1ZYPA 1VF1A 4I2UA 3GIXA 3CQFA 3CTGA 4YQVA 4N0VA 4EF0A 3L9UA 1V57A 4KDYA 5DBQA 1PN0A 2H72A 1TOFA 3ED3A 4GCIA 2M46A 4PXOA 3IDVA 2JADA 4IJIA 4Q5QA 2MZCA 5ECHB 2RM5A 3KMNA 1IYIA 3UMAA 5F07A 2FD3A 2XPEA 1TI3A 1K3LA 2HI7A 2IMFA 2FWEA 2HRAA 5IMZA 3CRUA 2ON7A 4HOJA 2F8FA 5J3RA 2J23A 5ID2B 2FWGA 4ECCA 1TI1A 2XBQA 5G5FA 1SK0A 2JSZA 5ABRA 3FZ4A 1KNGA 3A5WA 3D5JA 1J08A 3CMIA 4ZL8A 4Q5NA 1GUKA 1R5PA 3S9FA 2FWHA 3MDKA 2H76A 1ZZYA 4PGTA 3DD3A 1T7PB 5DQSA 1TRVA 1B9YC 4KA0A 2R2JA 3ZMKA 1ST9A 2ZCTA 5G31A 4K0GA 2FWFA 3RPNA 1TK8B 1K0OA 4O5QA 3H8QA 3R3EA 2XHFA 1MD3A 6GSYA 1C72A 2VL2A 13GSA 3CSJA 1XXUA 3HA9A 4EKZA 1AXDA 4EIPA 1AQWA 5D9TA 7GSSA 4MPFA 3VWXA 3HJPA 4POBA 3ZIVA 2WZ9A 5DALB 2VL2C 1TRWA 2HFDA 2O89A 2DBCA 3KTBA 1OKDA 4F82A 4YKGA 22GSA 3M0FA 18GSA 2WCIA 1F6MC 1EEJA 1JZRA 2YCDA 2K6VA 4FYCA 5IOXA 1XIYA 3GL3A 2BTOT 5GSSA 2B1LA 1M2BA 2O85A 17GSA 4IQAA 3R2QA 3UVHA 2ES7A 1TK0B 3KTLA 3HD5A 3MIXA 5FHIA 2HSYA 2WFCA 4PQHA 2VL9A 2OACA 2WDUA 4YKFA 3QOUA 5LD0A 2YOIA 5J4UA 1ERWA 3VFIA 1MDJA 1QUWA 4HJMA 3IK9A 3GKKA 4OO5A 1WIKA 3W8JA 3I69A 5G1KA 1KTEA 3IRAA 6GSTA 3HZ8A 1SKWB 3QFBC 2ALBA 2OKAA 1AC1A 3QR6A 3IPZA 4MLYA 4DEJA 1K0DA 1HQOA 5A5KA 2DIYA 2JZTA 2L59A 4X0XA 3TKSA 3FY7A 2R0PA 2IFQB 4NMUA 1DBYA 3QAVA 3NZNA 3EWLA 1XWBA 3TJFA 1QQ2A 3TJBA 3HVSA 2YANA 2YZUA 6GSUA 4MJAA 3TKSC 2JL4A 3QCPA 3C1RA 4HU7A 4LMVA 4I5QA 1XOBA 1EWXA 2YWNA 1M9BA 2B7JA 1NHOA 3KM6A 4YQMA 2LKUA 5CAXA 1A2LA 4F03A 1M9AA 1A0FA 2YWMA 5B7CA 4KH7A 1GNEA 5B6NA 2VCXA 1B4QA 5ECIB 1JLVA 4TOPA 3TJJA 3TKSE 5B8AA 4JU5A 2I1UA 2XBIA 2GSSA 3ERWA 5EY6A 2H6XA 3FW2A 1F9MA 3HKRA 1U87A 4TR1A 1Z5YE 2K8SA 1OKTA 4HS1A 3KXOA 3U6VA 1Z6NA 2DSAA 4PX1A 3VI7A 4F9ZA 3L0HA 2F8AA 1O8WA 2GQMA 1WRYA 4MK3A 2WS2A 1ABAA 4ZBDA 1X9MB 5CRDA 2C0EA 5HQPA 3EPTA 2NPBA 1TJDA 1FVJA 4TW5A 4V1Ag 4MCUA 5C04A 2HSHA 1N8JA 2JZRA 2L57A 1ILOA 1TTZA 2IMDA 1ERUA 4WF5A 4HZ4A 3F4SA 2X64A 4BWQA 5DCHA 3IV4A 3ZRDA 2G0FA 2H1GA 2PVOC 3DVWA 4G0IA 5ECSA 3IC4A 2LQQA 1SJZA 2YP6A 1SD8A 2TRXA 2NTOA 3FZAA 2CVBA 4HJ2A 1GUMA 2OADA 4TN8A 5J41A 1MDKA 3HJMA 2H6ZA 2PN8A 3ZTLA 4FO5A 2RLIA 3F6FA 3US3A 3GKMA 4J56E 5ECLB 1TKDB 5JWQB 4WR4A 3GTUA 3EU4A 2CX3A 1X9SB 4KDUA 4ILFA 4PQIA 2C8UA 3UEMA 4NHWA 1K3YA 2A2SA 1EV9A 1V9WA 2H0HA 3GURA 3UVTA 3LSZA 3IBHA 3ISOA 1GSSA 4EIQA 1F2EA 2GZYA 3F4RA 1A8LA 5JWRB 5HR0A 2AUVA 3MNGA 3RBTA 2KP2A 3GTUB 4IVFA 4HQZA 2VCVA 1ML6A 5B6MA 2PU9C 1FOVA 3Q18A 3FZ9A 4PUAA 2OBIA 3HXSA 4AF2A 4BVYB 1WP0A 2VLTA 1EP8A 1JLWA 4HDEA 4TR4A 5COHA 3RDWA 4H86A 1O8XA 1XVWA 4XHMA 2C1YA 3VPQA 5H5SA 5BMUA 3LYKA 2KLXA 1RW1A 5HR1A 2I4AA 1SU9A 2AB6A 1SK1A 2O87A 1Q4JA 3FZ5A 3TGZA 4EDYA 2CZ2A 1V40A 3MSZA 5A4VA 1GTAA 1ZYNA 3P7XA 3LORA 2VCTA 1ON4A 2IN3A 1PL1A 2YWIA 4XIHA 3DWVA 4LA1A 1XOAA 1PGTA 2VIMA 1OC9B 2CT6A 4IHUA 3UBKA 2VM1A 4WETA 3KEBA 1SENA 2FUG2 2B5XA 3GX0A 4KUNA 4N0ZA 2OA7A 5E4WA 3GNJA 2V41A 3FR9A 4MPGA 4HSCX 4Z2UA 3QAGA 3QFAC 2YV7A 4EC0A 3ZVJA 2E2GA 3EC3A 4LMWA 2H70A 2R5GA 1BEDA 1MDIA 1SYRA 4MZWA 4P3YB 1BAYA 4ULXA 1Z6MA 2LSTA 1CQHA 1F3BA 1T4YA 5ECPB 2H1BA 2DJKA 5GAND 1ERVA 2GQLA 3IHQA 3ME7A 3ZFLA 1E6BA 4KE3A 2H01A 1K0BA 1WJKA 2L5OA 1UC7A 1VF2A 2GTUA 4CY8A 1EZKA 3IA1A 5JWOB 3EYTA 4KGIA 4XCSA 2VD1A 3L4NA 5KN2A 4XTSA 3P8WA 1K0CA 4BL7A 1YEXA 2P0GA 5H5RA 1S3CA 3ZLPA 3NOFA 2NDOA 2VOCA 4DSSB 1RK4A 4I6XA 3M3MA 2OJLA 4IBPA 4YH2A 3LJRA 2QSIA 1JFUA 3ZL5A 1AUCA 4IQ1A 3FYGA 4NPBA 1K0MA 3MAKA 1GTUA 5IM9A 4BL7B 5IQYA 1EP7A 4JR6A 1TU7A 5D8IA 2HLSA 2LTKA 3UIWA 5D96A 1ERTA 1N2AA 1TXXA 2X99A 2H19A 3PR8A 3H4KA 4O5RA 4RQRA 4RQXA 4USSA 1PQNA 4NHZA 3ZMLA 2B5EA 4WKWA 4Z2TA 3TRQA 1EOGA 1GLQA 4IP6A 5A4UA 2JU5A 4IN0A 2OE0A 9GSSA 3LWAA 5IO0A 1B9XC 4KX4A 1GWCA 4K7OA 3FKFA 1FO5A 3LW9A 2G2QA 2PUKC 4F0BA 1PKWA 4KF9A 3P90A 5BRTA 5G30A 1JZOA 3E3EA 2MBSA 2LNSA 4MNNA 3W6GA 3O6TA 3J7Yb 1URMA 4ACSA 2Z9SA 5F8BA 5GZZB 1QK8A 3A3TA 3H79A 2HXKA 3IC8A 2H71A 4GQFA 14GSA 1UA5A 1M2AA 4WF4A 3FHKA 2JZSA 3EMPA 3UBLA 2LS5A 4IW9A 3LXTA 4JR4A 3VLNA 2YJ7A 1HNCA 4I2TA 3F8UA 3VWVA 2HSMA 5ELGA 1M3JA 4BA7A 2H73A 4JZQA 2DMLA 2PERA 2YZHA 4WR5A 3A2WA 3HZ4A 1YF1A 4LL4B 4EUYA 3QDNA 4FH8A 4K2XA 5FWGA 3RPPA 4JBBA 4TXVA 4I8BA 3M9KA 2MBTA 2K9FA 4ZB6A 1SD9A 3FEUA 3ZREA 4DSQA 5HR3A 2IMKA 2PPTA 3BJ5A 4XRAA 4FQUA 2N5AA 2X8HA 1SK2A 2FNOA 5DQYA 2C3NA 3ME8A 3D6IA 1LJRA 2MMZA 4BPYA 4NWYA 4PNFA 4MJCA 1V58A 3QAWA 1PX6A 2ZNMA 1BX9A 4KCEA 1X9WB 4N30A 5ECRB 5EVOA 3KP8A 1OYJA 2WJUA 4F2IA 1E2YA 5KN1A 2LJKA 1FHEA 4OO4A 2GS3A 3KZQA 1KBNA 1T1VA 3ZIJA 4POLA 3GYKA 2VAFA 5ENUA 4L8EA 3UOMA 4IJ3A 1XWCA 3GHAA 5AIXA 5ECKB 1FVKA 2LJAA 5B8BA 4OD7A 2EIOA 5ECMB 2GQKA 4K8MA 2F3MA 4ECJA 5JCGA 3IR4A 3RHCA 1MTCA 4MABA 1U3AA 2H0GA 3KD0A 5CP1A 4GWRA 2P5RA 1M2DA 2A2PA 3CSIA 2UZ8A 1PN9A 2LQOA 3VI5A 3ZITA 3PINA 1Y25A 1O85A 1KEBA 2QGVA 19GSA 3CRTA 3EINA 1M3IA 2HT9A 20GSA 3ZYWA 3DIEA 2QKEA 5LNKe 4ECBA 1YQ1A 4GF0A 2X8GA 3A2XA 4ZXGA 2L4CA 5ECQB 3G7IA 4GQCA 3PGTA 4YAPA 1Z7RA 1I5GA 2R6KA 3IOSA 4V2NA 5D9VA 3IK7A 3WGXA 6GSVA 1V2AA 2OE1A 2KUCA 4EXJA 3EMXA 4ZILA 3I43A 2H1AA 2TIRA 4GRFA 1T3BA 3LEFA 3DKSA 4ML1A 1HNAA 3VWUA 2C0FA 2YWOA 1PMTA 4TR1B 3PH9A 3FK8A 6GSXA 2D2ZA 4GSSA 8GSSA 2AJQB 2IWTA 5G1LA 2MYGA 1RQMA 4EL1A 3I6AA 5A4WA 4WBJA 1YJ6A 3TKQA 2V6OA 2NVLA 1BG5A 2N5FA 2VL3A 2YNXA 3MYDA 4YAVA 4HZ2A 4ISDA 3BCKA 2L6DA 4XS1A 1PL2A 4XS4A 2V1MA 1QXHA 1WE0A 2R0CA 4L5OA 1XWKA 1S3AA 3GRXA 2EC4A 3ZVJD 4J2FA 5ECNB 3KP9A 1ZCPA 3KGKA 2V32A 4GLTA 4IS0A 2DKHA 3TRXA 1SL1B 2E0QA 2L4QA 1GTIA 2OE3A 4MF6A 4EDZA 1Q98A 4V1Ap 4XS4B 2ZUPA 2H6YA 1TRSA 1XCCA 1EGRA 5HR2A 3BOAA 3G7YA 4TKYA 1X5EA 3DVXA 3EURA 3WGDA 4MMMA 3G9BA 1B8XA 3FR3A 3KH9A 3FRCA 1Y6EA 4MZBA 2EIRA 1O7UA 3GL5A 4F0CA 2CZ3A 1K0AA 5EL8A 3WYWA 1YY7A 3DEXA 3EVIA 2FCHA 4V2LA 3I9V2 4G19A 1WWJA 1G0TA 3W8SA 3E0UA 3D22A 2NBSA 4E8EA 1GSDA 4A5PA 5G5EA 5DDLA 1GP1A 1R5AA 4XRDA 2DLXA 3RAZA 1FG4A 1YEPA 3GSSA 2IL3A 2MMOA 5KN0A 2M72A 4GSTA 1U88A 3Q6OA 2HE3A 5HFIA 4WBRD 5L71A 2GSQA 2B3SA 3GX8A 2HZEA 2IMEA 3WD6A 2CX4A 1ZL9A 2YJHA 3D4MA 4POMA 1MD4A 1Z7PA 1XBSA 3VK9A 5KOXA 3KIJA 2A2RA 4KNDA 2B7KA 1SYXA 4HUAA 1XWGA 1GNWA 1YKCA 1G6WA 5ELAA 2F9SA 4NAXA 3HJOA 2BMXA 4ZL7A 1HYUA 3H93A 1XZOA 1TU8A 3HCZA 4HU9A 4X1UA 4ICYA 1ZMAA 3QPMA 1EOHA 1O6JA 1FB6A 2KP1A 2B5YA 1WOUA 2PVQA 4K2DA 1R4WA 5IMCA 2CA8A 1EGOA 2RUEA 4OFNA 1H4OA 3DRNA 1FB0A 3F6DA 5CRWA 1THOA 2GDRA 1XWAA 5D9XA 4IGJA 3JCML 2GT5A 1G7EA 2LRNA
chains in the Genus database with same CATH topology
3C7MA 3BBYA 5AIVA 2MMNA 4TXOA 2C0GA 4J57E 1BYEA 2H8LA 2HRNA 5IMVA 1X5CA 4D73A 3HHVA 1GSUA 1ACVA 2M80A 5LCZA 2C80A 2DJ0A 4WEYA 1XPVA 3IAM2 3CXGA 4MJEA 1R7HA 3APQA 2H75A 3KMOA 4FYUA 4BWSA 2GLRA 4ZB8A 4TVEA 4CDOA 3TOUA 1F37A 5D9WA 1SJIA 4CW9A 1VRSD 2YN1A 4TR0A 2WULA 3BCIA 2P5QA 1Z3EA 1UVZA 2H66A 2N5BA 3APSA 2C3QA 4KSMA 3M8NA 4Z2RA 2HRKA 1YZXA 1X0RA 2F51A 3WGEA 4G9HA 4O32A 5INYA 1CQGA 3C73A 3LXZA 2X49A 3TUEA 2A4HA 2GSRA 1BJXA 3HY2A 1A0RP 3F63A 5D93A 2RUFA 5AN1A 4LL1B 1WMJA 3UJ1A 1SL2B 3M9JA 1NHYA 2H30A 1FAAA 3C1SA 4KAEA 3ERGA 2RIIA 1OC3A 2E7PA 5IMAA 3GKNA 4ZB9A 1A2MA 5ID2A 1SL0B 3F0IA 4AJ7A 5J9CA 2QA2A 5CO3A 2A4VA 2X4AA 1PRXA 2LV3A 3MWHA 2WB9A 4OFTA 4RI7A 2VO4A 6GSSA 2HYXA 4TRXA 4N10A 4NV2A 5HFGA 2FGXA 3CTFA 2CQ9A 2DJ2A 1TW9A 2IJYA 2C0DA 1EEMA 1YKAA 2AYTA 3G7JA 2VM2A 5FT3A 1U6TA 4POKA 2L6CA 1R26A 2IMIA 4PTSA 1GULA 1WPIA 1AAZA 2I3YA 1VF4A 2JSYA 2VUPA 3V1WA 5CNWA 3TJKA 2B6MA 1PKZA 3HYPA 3HVVA 1GLPA 2ON5A 2HNLA 4JRRA 3GFKA 2HZFA 3L78A 4O5UA 3WT2A 1ZYEA 2CVDA 5DALA 3P2AA 3GSTA 1YF0A 3EU3A 4WXTA 2O7KA 4N11A 2WGRA 3LYPA 1PA3A 3N5OA 4IELA 3RHBA 1G6YA 4JEDA 3D21A 1J9BA 4MH2A 5H5QA 4MF5A 1ZOFA 3E9JB 3GA4A 3QMXA 1GTBA 1A24A 5CRGA 3KCMA 1J0FA 2V6KA 1SJ6A 4MDCA 2X8CA 1GUHA 1USBA 3GV1A 4KCAA 4FYBA 1PX7A 2DKIA 4BVXA 2FY6A 1QGVA 2R0GA 3J7Yk 1Z9HA 4K9ZA 2H1DA 4IKHA 3DXBA 4TR3A 3HVXA 3UAPA 3DGQA 4OMVA 5IPHA 1T8EB 3TKPA 3IXRA 5CYYA 1W89A 5IPGA 5DJMA 5DJLA 1XW5A 4BVXB 1GSEA 4K6XA 2PBJA 1SKRB 1DSBA 4G2EA 5AISA 1M7TA 4AJ8A 4K0NA 2IFQA 3VURA 3Q74A 3DMLA 3VPTA 4Q5RA 4KSOA 1XW6A 2C4JA 2P31A 4X4JA 4O92A 5G2ZA 1DE2A 2PWJA 4GTUA 4ZBBA 2IPAA 4OCFA 3GUSA 1XVQA 1O81A 5CRHA 3KJYA 3TDGA 3TJGA 2C3TA 3GH9A 4HEA2 5AGYA 4MP4A 4K5SA 5J9BA 4ECIA 4PQ1A 1IYHA 2PGTA 2WRTA 2L5LA 5F06A 1HNBA 3TCOA 3F3QA 3D4TA 2RM6A 5DAKA 2I81A 4MZCA 1A23A 1THXA 5CREA 3IAS2 2VCWA 3BD2A 3F9UA 4Q5FA 3GN3A 2QC7A 5GSTA 3GMFA 2VLUA 1YDKA 4GXZA 3SWLA 1LBKA 12GSA 3UARA 3IE3A 4CHSA 5C00A 2DJ3A 2YV9A 1U3IA 1TRUA 2CAIA 2EIQA 4RI6A 5DAKB 2LRCA 5JCUA 1OAZA 10GSA 1MEKA 3O76A 1DUGA 4K7NA 5JCWA 1H75A 5IO2A 3TKRA 1PD21 2FA4A 3C71A 3LGCA 1A2JA 2VD0A 2J9HA 4PURA 3TRPA 1OC8A 4FIWA 4EVMA 1F3AA 2GT6A 4DSRA 4K1FA 5GAPD 1GSQA 1V98A 1FOHA 1NSWA 4MA9A 3CSHA 2GZPA 4OCEA 2YPMA 3A2VA 1TK5B 2XPDA 1GSFA 4EE0A 4HQSA 3QD9A 1B4PA 3F3RA 1DE1A 4G10A 1O73A 4MF7A 3LQ7A 4IP1A 4YQUA 2CV4A 2CAQA 3C8EA 1TDIA 2LRTA 3L9VA 4AJ6A 4G0LA 2VCZA 2TRCP 4MH3A 4ZIJA 4K5RA 1BQ7A 1AIUA 2QA1A 3F4TA 2OBKA 3GH6A 1ZGNA 1X5DA 2FHEA 2LEGA 2XC2A 3Q19A 3EE2A 1AQXA 3VWWA 4PUFC 5E59A 2H0IA 2KOKA 4L0UA 2LUSA 3FMWA 2HRFA 2LJRA 1OE8A 2R4VA 1M0UA 3WT1A 4QL7A 2CVKA 4L5LA 5F05A 2FA8A 1T4ZA 1T00A 1JZDA 1FW1A 5EPFA 4KB3A 2IIYA 4BVYA 4XS6A 3M1GA 5IOWA 2GVPA 3ZFBA 2DJ1A 1NM3A 4GSNA 4QQ7A 2FLSA 5J5NA 2R37A 6GSWA 3AY8A 4ZBAA 5HFKA 3OR5A 2JACA 2DJJA 2VCQA 1G7OA 1VGLA 5DVBA 3KH7A 1NW2A 2I9HA 2VLVA 2AHEA 5ECOB 3ZZXA 4CY6A 3IHGA 3CBUA 4HI7A 2DMMA 2GSTA 5KEJA 4G0KA 3UL3A 1ZYQB 1I9DA 3PPUA 4I97A 4JE1A 4NV5A 2AV4A 4K7IA 1OC9A 1OVNA 2HZEB 5F0GA 2KHPA 4ML6A 2GZZA 1B48A 1OE7A 3K8NA 4OFMA 3U5RE 4NXIA 2H74A 1JZWA 4DVCA 1QMVA 1S3DA 4O7HA 11GSA 1XW9A 3DYRA 1JHBA 4V2MA 4ZL9A 3H1NA 2B1KA 3LG6A 3LFLA 3TOTA 2K18A 3D0ZA 1W4VA 1TP9A 1PSQA 1K0NA 1XFLA 1SKSB 1UN2A 4X43A 5KOWA 1GRXA 3ERFA 4ID0A 4L0WA 4RUVA 2K8VA 1M99A 2V2GA 4AGSA 4E8HA 4KW6A 3GKXA 1AW9A 3NIVA 5KN3A 5IMDA 4DSSA 4MJBA 3L9SA 4EO3A 1HD2A 4TXOB 5IIZA 1QFNA 4OWYA 4Z7XA 1EV4A 1K3OA 2O8VB 3N9JA 1AQVA 4D73B 2DC5A 3TB2A 1GH2A 2AAWA 4KDXA 1A8YA 3CYNA 2MMAA 4QL9A 3A5IA 2LNTA 5DCGA 3O3TA 1GSYA 2BJXA 2REMA 2E2MA 3SBCA 1LU4A 1VF3A 4LLRA 4PNGA 3FR6A 2DIZA 2PMTA 5D73A 2GGTA 2R3XA 5IMFA 3APOA 16GSA 1GL8A 3HDCA 1ZYPA 1VF1A 4I2UA 3GIXA 3CTGA 4YQVA 4N0VA 4EF0A 3L9UA 1V57A 4KDYA 5DBQA 1PN0A 2H72A 1TOFA 3ED3A 4GCIA 2M46A 4PXOA 3IDVA 2JADA 4IJIA 4Q5QA 2MZCA 5ECHB 2RM5A 3KMNA 1IYIA 3UMAA 5F07A 2FD3A 2XPEA 1TI3A 1K3LA 2HI7A 2IMFA 2FWEA 2HRAA 5IMZA 3CRUA 2ON7A 4HOJA 2F8FA 5J3RA 2J23A 5ID2B 2FWGA 4ECCA 1TI1A 2XBQA 5G5FA 1SK0A 2JSZA 5ABRA 3FZ4A 1KNGA 3A5WA 3D5JA 1J08A 3CMIA 4ZL8A 4Q5NA 1GUKA 1R5PA 3S9FA 2FWHA 3MDKA 2H76A 1ZZYA 4PGTA 3DD3A 1T7PB 5DQSA 1TRVA 1B9YC 4KA0A 2R2JA 3ZMKA 1ST9A 2ZCTA 5G31A 4K0GA 2FWFA 3RPNA 1TK8B 1K0OA 4O5QA 3H8QA 3R3EA 2XHFA 1MD3A 6GSYA 1C72A 2VL2A 13GSA 3CSJA 1XXUA 3HA9A 4EKZA 1AXDA 4EIPA 1AQWA 5D9TA 7GSSA 4MPFA 3VWXA 3HJPA 4POBA 3ZIVA 2WZ9A 5DALB 2VL2C 1TRWA 2HFDA 2O89A 2DBCA 3KTBA 1OKDA 4F82A 4YKGA 22GSA 3M0FA 18GSA 2WCIA 1F6MC 1EEJA 1JZRA 2YCDA 2K6VA 4FYCA 5IOXA 1XIYA 3GL3A 2BTOT 5GSSA 2B1LA 1M2BA 2O85A 17GSA 4IQAA 3R2QA 3UVHA 2ES7A 1TK0B 3KTLA 3HD5A 3MIXA 5FHIA 2HSYA 2WFCA 4PQHA 2VL9A 2OACA 2WDUA 4YKFA 3QOUA 5LD0A 2YOIA 5J4UA 1ERWA 3VFIA 1MDJA 1QUWA 4HJMA 3IK9A 3GKKA 4OO5A 1WIKA 3W8JA 3I69A 5G1KA 1KTEA 3IRAA 6GSTA 3HZ8A 1SKWB 3QFBC 2ALBA 2OKAA 1AC1A 3QR6A 3IPZA 4MLYA 4DEJA 1K0DA 1HQOA 5A5KA 2DIYA 2JZTA 2L59A 4X0XA 3TKSA 3FY7A 2R0PA 2IFQB 4NMUA 1DBYA 3QAVA 3NZNA 3EWLA 1XWBA 3TJFA 1QQ2A 3TJBA 3HVSA 2YANA 2YZUA 6GSUA 4MJAA 3TKSC 2JL4A 3QCPA 3C1RA 4HU7A 4LMVA 4I5QA 1XOBA 1EWXA 2YWNA 1M9BA 2B7JA 1NHOA 3KM6A 4YQMA 2LKUA 5CAXA 1A2LA 4F03A 1M9AA 1A0FA 2YWMA 5B7CA 4KH7A 1GNEA 5B6NA 2VCXA 1B4QA 5ECIB 1JLVA 4TOPA 3TJJA 3TKSE 5B8AA 4JU5A 2I1UA 2XBIA 2GSSA 3ERWA 5EY6A 2H6XA 3FW2A 1F9MA 3HKRA 1U87A 4TR1A 1Z5YE 2K8SA 1OKTA 4HS1A 3KXOA 3U6VA 1Z6NA 2DSAA 4PX1A 3VI7A 4F9ZA 3L0HA 2F8AA 1O8WA 2GQMA 1WRYA 4MK3A 2WS2A 1ABAA 4ZBDA 1X9MB 5CRDA 2C0EA 5HQPA 3EPTA 2NPBA 1TJDA 1FVJA 4TW5A 4V1Ag 4MCUA 5C04A 2HSHA 1N8JA 2JZRA 2L57A 1ILOA 1TTZA 2IMDA 1ERUA 4WF5A 4HZ4A 3F4SA 2X64A 4BWQA 5DCHA 3IV4A 3ZRDA 2G0FA 2H1GA 2PVOC 3DVWA 4G0IA 5ECSA 3IC4A 2LQQA 1SJZA 2YP6A 1SD8A 2TRXA 2NTOA 3FZAA 2CVBA 4HJ2A 1GUMA 2OADA 4TN8A 5J41A 1MDKA 3HJMA 2H6ZA 2PN8A 3ZTLA 4FO5A 2RLIA 3F6FA 3US3A 3GKMA 4J56E 5ECLB 1TKDB 5JWQB 4WR4A 3GTUA 3EU4A 2CX3A 1X9SB 4KDUA 4ILFA 4PQIA 2C8UA 3UEMA 4NHWA 1K3YA 2A2SA 1EV9A 1V9WA 2H0HA 3GURA 3UVTA 3LSZA 3IBHA 3ISOA 1GSSA 4EIQA 1F2EA 2GZYA 3F4RA 1A8LA 5JWRB 5HR0A 2AUVA 3MNGA 3RBTA 2KP2A 3GTUB 4IVFA 4HQZA 2VCVA 1ML6A 5B6MA 2PU9C 1FOVA 3Q18A 3FZ9A 4PUAA 2OBIA 3HXSA 4AF2A 4BVYB 1WP0A 2VLTA 1EP8A 1JLWA 4HDEA 4TR4A 5COHA 3RDWA 4H86A 1O8XA 1XVWA 4XHMA 2C1YA 3VPQA 5H5SA 5BMUA 3LYKA 2KLXA 1RW1A 5HR1A 2I4AA 1SU9A 2AB6A 1SK1A 2O87A 1Q4JA 3FZ5A 3TGZA 4EDYA 2CZ2A 1V40A 3MSZA 5A4VA 1GTAA 1ZYNA 3P7XA 3LORA 2VCTA 1ON4A 2IN3A 1PL1A 2YWIA 4XIHA 3DWVA 4LA1A 1XOAA 1PGTA 2VIMA 1OC9B 2CT6A 4IHUA 3UBKA 2VM1A 4WETA 3KEBA 1SENA 2FUG2 2B5XA 3GX0A 4KUNA 4N0ZA 2OA7A 5E4WA 3GNJA 2V41A 3FR9A 4MPGA 4Z2UA 3QAGA 3QFAC 2YV7A 4EC0A 3ZVJA 2E2GA 3EC3A 4LMWA 2H70A 2R5GA 1BEDA 1MDIA 1SYRA 4MZWA 4P3YB 1BAYA 4ULXA 1Z6MA 2LSTA 1CQHA 1F3BA 1T4YA 5ECPB 2H1BA 2DJKA 5GAND 1ERVA 2GQLA 3IHQA 3ME7A 3ZFLA 1E6BA 4KE3A 2H01A 1K0BA 1WJKA 2L5OA 1UC7A 1VF2A 2GTUA 4CY8A 1EZKA 3IA1A 5JWOB 3EYTA 4KGIA 4XCSA 2VD1A 3L4NA 5KN2A 4XTSA 3P8WA 1K0CA 4BL7A 1YEXA 2P0GA 5H5RA 1S3CA 3ZLPA 3NOFA 2NDOA 2VOCA 4DSSB 1RK4A 4I6XA 3M3MA 2OJLA 4IBPA 4YH2A 3LJRA 2QSIA 1JFUA 3ZL5A 1AUCA 4IQ1A 3FYGA 4NPBA 1K0MA 3MAKA 1GTUA 5IM9A 4BL7B 5IQYA 1EP7A 4JR6A 1TU7A 5D8IA 2HLSA 2LTKA 3UIWA 5D96A 1ERTA 1N2AA 1TXXA 2X99A 2H19A 3PR8A 3H4KA 4O5RA 4RQRA 4RQXA 4USSA 1PQNA 4NHZA 3ZMLA 2B5EA 4WKWA 4Z2TA 3TRQA 1EOGA 1GLQA 4IP6A 5A4UA 2JU5A 4IN0A 2OE0A 9GSSA 3LWAA 5IO0A 1B9XC 4KX4A 1GWCA 4K7OA 3FKFA 1FO5A 3LW9A 2G2QA 2PUKC 4F0BA 1PKWA 4KF9A 3P90A 5BRTA 5G30A 1JZOA 3E3EA 2MBSA 2LNSA 4MNNA 3W6GA 3O6TA 3J7Yb 1URMA 4ACSA 2Z9SA 5F8BA 5GZZB 1QK8A 3A3TA 3H79A 2HXKA 3IC8A 2H71A 4GQFA 14GSA 1UA5A 1M2AA 4WF4A 3FHKA 2JZSA 3EMPA 3UBLA 2LS5A 4IW9A 3LXTA 4JR4A 3VLNA 2YJ7A 1HNCA 4I2TA 3F8UA 3VWVA 2HSMA 5ELGA 4BA7A 2H73A 4JZQA 2DMLA 2PERA 2YZHA 4WR5A 3A2WA 3HZ4A 1YF1A 4LL4B 4EUYA 3QDNA 4FH8A 4K2XA 5FWGA 3RPPA 4JBBA 4TXVA 4I8BA 3M9KA 2MBTA 2K9FA 4ZB6A 1SD9A 3FEUA 3ZREA 4DSQA 5HR3A 2IMKA 2PPTA 3BJ5A 4XRAA 4FQUA 2N5AA 2X8HA 1SK2A 2FNOA 5DQYA 2C3NA 3ME8A 3D6IA 1LJRA 2MMZA 4BPYA 4NWYA 4PNFA 4MJCA 1V58A 3QAWA 1PX6A 2ZNMA 1BX9A 4KCEA 1X9WB 4N30A 5ECRB 5EVOA 3KP8A 1OYJA 2WJUA 4F2IA 1E2YA 5KN1A 2LJKA 1FHEA 4OO4A 2GS3A 3KZQA 1KBNA 1T1VA 3ZIJA 4POLA 3GYKA 2VAFA 5ENUA 4L8EA 3UOMA 4IJ3A 1XWCA 3GHAA 5AIXA 5ECKB 1FVKA 2LJAA 5B8BA 4OD7A 2EIOA 5ECMB 2GQKA 4K8MA 2F3MA 4ECJA 5JCGA 3IR4A 3RHCA 1MTCA 4MABA 1U3AA 2H0GA 3KD0A 5CP1A 4GWRA 2P5RA 1M2DA 2A2PA 3CSIA 2UZ8A 1PN9A 2LQOA 3VI5A 3ZITA 3PINA 1Y25A 1O85A 1KEBA 2QGVA 19GSA 3CRTA 3EINA 2HT9A 20GSA 3ZYWA 3DIEA 2QKEA 5LNKe 4ECBA 1YQ1A 4GF0A 2X8GA 3A2XA 4ZXGA 2L4CA 5ECQB 3G7IA 4GQCA 3PGTA 4YAPA 1Z7RA 1I5GA 2R6KA 3IOSA 4V2NA 5D9VA 3IK7A 3WGXA 6GSVA 1V2AA 2OE1A 2KUCA 4EXJA 3EMXA 4ZILA 3I43A 2H1AA 2TIRA 4GRFA 1T3BA 3LEFA 3DKSA 4ML1A 1HNAA 3VWUA 2C0FA 2YWOA 1PMTA 4TR1B 3PH9A 3FK8A 6GSXA 2D2ZA 4GSSA 8GSSA 2AJQB 2IWTA 5G1LA 2MYGA 1RQMA 4EL1A 3I6AA 5A4WA 4WBJA 1YJ6A 3TKQA 2V6OA 2NVLA 1BG5A 2N5FA 2VL3A 2YNXA 3MYDA 4YAVA 4HZ2A 4ISDA 3BCKA 2L6DA 4XS1A 1PL2A 4XS4A 2V1MA 1QXHA 1WE0A 2R0CA 4L5OA 1XWKA 1S3AA 3GRXA 2EC4A 3ZVJD 4J2FA 5ECNB 3KP9A 1ZCPA 3KGKA 2V32A 4GLTA 4IS0A 2DKHA 3TRXA 1SL1B 2E0QA 2L4QA 1GTIA 2OE3A 4MF6A 4EDZA 1Q98A 4V1Ap 4XS4B 2ZUPA 2H6YA 1TRSA 1XCCA 1EGRA 5HR2A 3BOAA 3G7YA 4TKYA 1X5EA 3DVXA 3EURA 3WGDA 4MMMA 3G9BA 1B8XA 3FR3A 3KH9A 3FRCA 1Y6EA 4MZBA 2EIRA 1O7UA 3GL5A 4F0CA 2CZ3A 1K0AA 5EL8A 3WYWA 1YY7A 3DEXA 3EVIA 2FCHA 4V2LA 3I9V2 4G19A 1WWJA 1G0TA 3W8SA 3E0UA 3D22A 2NBSA 4E8EA 1GSDA 4A5PA 5G5EA 5DDLA 1GP1A 1R5AA 4XRDA 2DLXA 3RAZA 1FG4A 1YEPA 3GSSA 2IL3A 2MMOA 5KN0A 2M72A 4GSTA 1U88A 3Q6OA 2HE3A 5HFIA 4WBRD 5L71A 2GSQA 2B3SA 3GX8A 2HZEA 2IMEA 3WD6A 2CX4A 1ZL9A 2YJHA 3D4MA 4POMA 1MD4A 1Z7PA 1XBSA 3VK9A 5KOXA 3KIJA 2A2RA 4KNDA 2B7KA 1SYXA 4HUAA 1XWGA 1GNWA 1YKCA 1G6WA 5ELAA 2F9SA 4NAXA 3HJOA 2BMXA 4ZL7A 1HYUA 3H93A 1XZOA 1TU8A 3HCZA 4HU9A 4X1UA 4ICYA 1ZMAA 3QPMA 1EOHA 1O6JA 1FB6A 2KP1A 2B5YA 1WOUA 2PVQA 4K2DA 1R4WA 5IMCA 2CA8A 1EGOA 2RUEA 4OFNA 1H4OA 3DRNA 1FB0A 3F6DA 5CRWA 1THOA 2GDRA 1XWAA 5D9XA 4IGJA 3JCML 2GT5A 1G7EA 2LRNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C7M A;  3BBY A;  5AIV A;  2MMN A;  4TXO A;  2C0G A;  4J57 E;  1BYE A;  2H8L A;  2HRN A;  5IMV A;  1X5C A;  4D73 A;  3HHV A;  1GSU A;  1ACV A;  2M80 A;  5LCZ A;  2C80 A;  2DJ0 A;  4WEY A;  1XPV A;  3IAM 2;  3CXG A;  4MJE A;  1R7H A;  3APQ A;  2H75 A;  3KMO A;  4FYU A;  4BWS A;  2GLR A;  4ZB8 A;  4TVE A;  4CDO A;  3TOU A;  1F37 A;  5D9W A;  1SJI A;  4CW9 A;  1VRS D;  2YN1 A;  4TR0 A;  2WUL A;  3BCI A;  2P5Q A;  1Z3E A;  1UVZ A;  2H66 A;  2N5B A;  3APS A;  2C3Q A;  4KSM A;  3M8N A;  1YZX A;  1X0R A;  2F51 A;  3WGE A;  4G9H A;  4O32 A;  5INY A;  1CQG A;  3C73 A;  3LXZ A;  3TUE A;  2GSR A;  1BJX A;  3HY2 A;  1A0R P;  3F63 A;  5D93 A;  2RUF A;  5AN1 A;  4LL1 B;  1WMJ A;  3UJ1 A;  1SL2 B;  3M9J A;  1NHY A;  2H30 A;  1FAA A;  3C1S A;  4KAE A;  3ERG A;  2RII A;  1OC3 A;  2E7P A;  5IMA A;  3GKN A;  4ZB9 A;  1A2M A;  5ID2 A;  1SL0 B;  3F0I A;  4AJ7 A;  5J9C A;  5CO3 A;  2A4V A;  1PRX A;  2LV3 A;  3MWH A;  2WB9 A;  4OFT A;  4RI7 A;  2VO4 A;  6GSS A;  2HYX A;  4TRX A;  4N10 A;  4NV2 A;  5HFG A;  2FGX A;  3CTF A;  2CQ9 A;  2DJ2 A;  1TW9 A;  2IJY A;  2C0D A;  1EEM A;  1YKA A;  2AYT A;  3G7J A;  2VM2 A;  5FT3 A;  1U6T A;  4POK A;  2L6C A;  1R26 A;  2IMI A;  1GUL A;  1WPI A;  1AAZ A;  2I3Y A;  1VF4 A;  2JSY A;  2VUP A;  3V1W A;  5CNW A;  3TJK A;  2B6M A;  1PKZ A;  3HYP A;  3HVV A;  1GLP A;  2ON5 A;  2HNL A;  4JRR A;  3GFK A;  2HZF A;  3L78 A;  3WT2 A;  1ZYE A;  2CVD A;  5DAL A;  3P2A A;  3GST A;  1YF0 A;  3EU3 A;  4WXT A;  2O7K A;  4N11 A;  2WGR A;  3LYP A;  1PA3 A;  3N5O A;  4IEL A;  3RHB A;  1G6Y A;  4JED A;  3D21 A;  1J9B A;  4MH2 A;  5H5Q A;  4MF5 A;  1ZOF A;  3E9J B;  3GA4 A;  3QMX A;  1GTB A;  1A24 A;  5CRG A;  3KCM A;  1J0F A;  2V6K A;  1SJ6 A;  4MDC A;  2X8C A;  1GUH A;  1USB A;  3GV1 A;  4KCA A;  4FYB A;  1PX7 A;  4BVX A;  2FY6 A;  1QGV A;  3J7Y k;  1Z9H A;  4K9Z A;  2H1D A;  4IKH A;  3DXB A;  4TR3 A;  3HVX A;  3UAP A;  3DGQ A;  4OMV A;  5IPH A;  1T8E B;  3TKP A;  3IXR A;  5CYY A;  1W89 A;  5IPG A;  5DJM A;  5DJL A;  1XW5 A;  1GSE A;  4K6X A;  2PBJ A;  1SKR B;  1DSB A;  4G2E A;  5AIS A;  1M7T A;  4AJ8 A;  4K0N A;  2IFQ A;  3VUR A;  3Q74 A;  3DML A;  3VPT A;  4Q5R A;  4KSO A;  1XW6 A;  2C4J A;  2P31 A;  4O92 A;  5G2Z A;  1DE2 A;  2PWJ A;  4GTU A;  4ZBB A;  2IPA A;  4OCF A;  3GUS A;  1XVQ A;  1O81 A;  5CRH A;  3KJY A;  3TDG A;  3TJG A;  2C3T A;  3GH9 A;  4HEA 2;  5AGY A;  4MP4 A;  5J9B A;  4ECI A;  4PQ1 A;  1IYH A;  2PGT A;  2WRT A;  2L5L A;  5F06 A;  1HNB A;  3TCO A;  3F3Q A;  3D4T A;  2RM6 A;  5DAK A;  2I81 A;  4MZC A;  1A23 A;  1THX A;  5CRE A;  3IAS 2;  2VCW A;  3BD2 A;  3F9U A;  4Q5F A;  3GN3 A;  2QC7 A;  5GST A;  3GMF A;  2VLU A;  1YDK A;  4GXZ A;  3SWL A;  1LBK A;  12GS A;  3UAR A;  3IE3 A;  4CHS A;  5C00 A;  2DJ3 A;  2YV9 A;  1U3I A;  1TRU A;  2CAI A;  2EIQ A;  4RI6 A;  5DAK B;  2LRC A;  5JCU A;  1OAZ A;  10GS A;  1MEK A;  3O76 A;  1DUG A;  4K7N A;  5JCW A;  1H75 A;  5IO2 A;  3TKR A;  1PD2 1;  2FA4 A;  3C71 A;  3LGC A;  1A2J A;  2VD0 A;  2J9H A;  4PUR A;  3TRP A;  1OC8 A;  4FIW A;  4EVM A;  1F3A A;  2GT6 A;  4DSR A;  4K1F A;  5GAP D;  1GSQ A;  1V98 A;  1NSW A;  4MA9 A;  3CSH A;  2GZP A;  4OCE A;  2YPM A;  3A2V A;  1TK5 B;  2XPD A;  1GSF A;  4EE0 A;  4HQS A;  3QD9 A;  1B4P A;  3F3R A;  1DE1 A;  4G10 A;  1O73 A;  4MF7 A;  3LQ7 A;  4IP1 A;  4YQU A;  2CV4 A;  2CAQ A;  3C8E A;  1TDI A;  2LRT A;  3L9V A;  4AJ6 A;  2VCZ A;  2TRC P;  4MH3 A;  4ZIJ A;  1BQ7 A;  1AIU A;  3F4T A;  2OBK A;  3GH6 A;  1ZGN A;  1X5D A;  2FHE A;  2LEG A;  2XC2 A;  3Q19 A;  3EE2 A;  1AQX A;  3VWW A;  4PUF C;  5E59 A;  2H0I A;  2KOK A;  4L0U A;  2LUS A;  2HRF A;  2LJR A;  1OE8 A;  2R4V A;  1M0U A;  3WT1 A;  4QL7 A;  2CVK A;  4L5L A;  5F05 A;  2FA8 A;  1T4Z A;  1T00 A;  1JZD A;  1FW1 A;  5EPF A;  4KB3 A;  2IIY A;  4BVY A;  4XS6 A;  3M1G A;  5IOW A;  2GVP A;  3ZFB A;  2DJ1 A;  1NM3 A;  4GSN A;  4QQ7 A;  2FLS A;  5J5N A;  2R37 A;  6GSW A;  3AY8 A;  4ZBA A;  5HFK A;  3OR5 A;  2JAC A;  2DJJ A;  2VCQ A;  1G7O A;  1VGL A;  5DVB A;  3KH7 A;  1NW2 A;  2I9H A;  2VLV A;  2AHE A;  5ECO B;  3ZZX A;  3CBU A;  4HI7 A;  2DMM A;  2GST A;  5KEJ A;  3UL3 A;  1ZYQ B;  1I9D A;  4I97 A;  4JE1 A;  4NV5 A;  2AV4 A;  4K7I A;  1OC9 A;  1OVN A;  2HZE B;  5F0G A;  2KHP A;  4ML6 A;  2GZZ A;  1B48 A;  1OE7 A;  3K8N A;  4OFM A;  3U5R E;  4NXI A;  2H74 A;  1JZW A;  4DVC A;  1QMV A;  1S3D A;  4O7H A;  11GS A;  1XW9 A;  3DYR A;  1JHB A;  4V2M A;  4ZL9 A;  3H1N A;  2B1K A;  3LG6 A;  3LFL A;  3TOT A;  2K18 A;  3D0Z A;  1W4V A;  1TP9 A;  1PSQ A;  1K0N A;  1XFL A;  1SKS B;  1UN2 A;  4X43 A;  1GRX A;  3ERF A;  4ID0 A;  4L0W A;  4RUV A;  2K8V A;  1M99 A;  2V2G A;  4AGS A;  4E8H A;  4KW6 A;  3GKX A;  1AW9 A;  3NIV A;  5KN3 A;  5IMD A;  4DSS A;  4MJB A;  3L9S A;  4EO3 A;  1HD2 A;  4TXO B;  5IIZ A;  1QFN A;  4OWY A;  4Z7X A;  1EV4 A;  1K3O A;  2O8V B;  3N9J A;  1AQV A;  4D73 B;  2DC5 A;  3TB2 A;  1GH2 A;  2AAW A;  4KDX A;  1A8Y A;  3CYN A;  2MMA A;  4QL9 A;  2LNT A;  5DCG A;  3O3T A;  1GSY A;  2BJX A;  2REM A;  2E2M A;  3SBC A;  1LU4 A;  1VF3 A;  4LLR A;  4PNG A;  3FR6 A;  2DIZ A;  2PMT A;  5D73 A;  2GGT A;  2R3X A;  5IMF A;  3APO A;  16GS A;  1GL8 A;  3HDC A;  1VF1 A;  4I2U A;  3GIX A;  3CTG A;  4YQV A;  4N0V A;  4EF0 A;  3L9U A;  1V57 A;  4KDY A;  5DBQ A;  2H72 A;  1TOF A;  3ED3 A;  4GCI A;  2M46 A;  4PXO A;  3IDV A;  2JAD A;  4IJI A;  4Q5Q A;  2MZC A;  5ECH B;  2RM5 A;  3KMN A;  1IYI A;  3UMA A;  5F07 A;  2FD3 A;  2XPE A;  1TI3 A;  1K3L A;  2HI7 A;  2IMF A;  2FWE A;  5IMZ A;  3CRU A;  2ON7 A;  4HOJ A;  2F8F A;  5J3R A;  2J23 A;  5ID2 B;  2FWG A;  4ECC A;  1TI1 A;  2XBQ A;  5G5F A;  1SK0 A;  2JSZ A;  5ABR A;  3FZ4 A;  1KNG A;  3A5W A;  3D5J A;  1J08 A;  3CMI A;  4ZL8 A;  4Q5N A;  1GUK A;  1R5P A;  3S9F A;  2FWH A;  3MDK A;  2H76 A;  1ZZY A;  4PGT A;  3DD3 A;  1T7P B;  5DQS A;  1TRV A;  1B9Y C;  4KA0 A;  2R2J A;  3ZMK A;  1ST9 A;  2ZCT A;  5G31 A;  4K0G A;  2FWF A;  3RPN A;  1TK8 B;  1K0O A;  3H8Q A;  2XHF A;  1MD3 A;  6GSY A;  1C72 A;  2VL2 A;  13GS A;  3CSJ A;  1XXU A;  3HA9 A;  4EKZ A;  1AXD A;  1AQW A;  5D9T A;  7GSS A;  4MPF A;  3VWX A;  3HJP A;  4POB A;  3ZIV A;  2WZ9 A;  5DAL B;  2VL2 C;  1TRW A;  2HFD A;  2O89 A;  2DBC A;  3KTB A;  1OKD A;  4F82 A;  22GS A;  3M0F A;  18GS A;  2WCI A;  1F6M C;  1EEJ A;  1JZR A;  2YCD A;  2K6V A;  4FYC A;  5IOX A;  1XIY A;  3GL3 A;  2BTO T;  5GSS A;  2B1L A;  1M2B A;  2O85 A;  17GS A;  4IQA A;  3R2Q A;  3UVH A;  2ES7 A;  1TK0 B;  3KTL A;  3HD5 A;  5FHI A;  2HSY A;  2WFC A;  4PQH A;  2VL9 A;  2OAC A;  2WDU A;  3QOU A;  5LD0 A;  2YOI A;  5J4U A;  1ERW A;  3VFI A;  1MDJ A;  1QUW A;  4HJM A;  3IK9 A;  3GKK A;  4OO5 A;  1WIK A;  3W8J A;  3I69 A;  5G1K A;  1KTE A;  3IRA A;  6GST A;  3HZ8 A;  1SKW B;  3QFB C;  2ALB A;  2OKA A;  1AC1 A;  3QR6 A;  3IPZ A;  4MLY A;  4DEJ A;  1K0D A;  1HQO A;  5A5K A;  2DIY A;  2JZT A;  2L59 A;  4X0X A;  3TKS A;  3FY7 A;  2IFQ B;  4NMU A;  1DBY A;  3QAV A;  3NZN A;  3EWL A;  1XWB A;  3TJF A;  1QQ2 A;  3TJB A;  3HVS A;  2YAN A;  2YZU A;  6GSU A;  4MJA A;  3TKS C;  2JL4 A;  3QCP A;  3C1R A;  4HU7 A;  4LMV A;  4I5Q A;  1XOB A;  1EWX A;  2YWN A;  1M9B A;  2B7J A;  1NHO A;  3KM6 A;  4YQM A;  2LKU A;  5CAX A;  1A2L A;  4F03 A;  1M9A A;  1A0F A;  2YWM A;  5B7C A;  4KH7 A;  1GNE A;  5B6N A;  2VCX A;  1B4Q A;  5ECI B;  1JLV A;  4TOP A;  3TJJ A;  3TKS E;  5B8A A;  4JU5 A;  2I1U A;  2XBI A;  2GSS A;  3ERW A;  5EY6 A;  2H6X A;  3FW2 A;  1F9M A;  3HKR A;  1U87 A;  4TR1 A;  1Z5Y E;  2K8S A;  1OKT A;  4HS1 A;  3KXO A;  3U6V A;  1Z6N A;  2DSA A;  4PX1 A;  3VI7 A;  4F9Z A;  3L0H A;  2F8A A;  1O8W A;  2GQM A;  1WRY A;  4MK3 A;  2WS2 A;  1ABA A;  4ZBD A;  1X9M B;  5CRD A;  2C0E A;  5HQP A;  2NPB A;  1TJD A;  1FVJ A;  4TW5 A;  4V1A g;  4MCU A;  5C04 A;  2HSH A;  1N8J A;  2JZR A;  2L57 A;  1ILO A;  1TTZ A;  2IMD A;  1ERU A;  4WF5 A;  4HZ4 A;  3F4S A;  2X64 A;  4BWQ A;  5DCH A;  3IV4 A;  3ZRD A;  2G0F A;  2H1G A;  2PVO C;  3DVW A;  5ECS A;  3IC4 A;  2LQQ A;  1SJZ A;  2YP6 A;  1SD8 A;  2TRX A;  2NTO A;  3FZA A;  2CVB A;  4HJ2 A;  1GUM A;  2OAD A;  4TN8 A;  5J41 A;  1MDK A;  3HJM A;  2H6Z A;  2PN8 A;  3ZTL A;  4FO5 A;  2RLI A;  3F6F A;  3US3 A;  3GKM A;  4J56 E;  5ECL B;  1TKD B;  5JWQ B;  4WR4 A;  3GTU A;  3EU4 A;  2CX3 A;  1X9S B;  4KDU A;  4ILF A;  4PQI A;  2C8U A;  3UEM A;  4NHW A;  1K3Y A;  2A2S A;  1EV9 A;  1V9W A;  2H0H A;  3GUR A;  3UVT A;  3LSZ A;  3IBH A;  3ISO A;  1GSS A;  1F2E A;  2GZY A;  3F4R A;  1A8L A;  5JWR B;  5HR0 A;  2AUV A;  3MNG A;  3RBT A;  2KP2 A;  3GTU B;  4IVF A;  4HQZ A;  2VCV A;  1ML6 A;  5B6M A;  2PU9 C;  1FOV A;  3Q18 A;  3FZ9 A;  4PUA A;  2OBI A;  3HXS A;  4AF2 A;  1WP0 A;  2VLT A;  1EP8 A;  1JLW A;  4HDE A;  4TR4 A;  5COH A;  3RDW A;  4H86 A;  1O8X A;  1XVW A;  4XHM A;  2C1Y A;  3VPQ A;  5H5S A;  3LYK A;  2KLX A;  1RW1 A;  5HR1 A;  2I4A A;  1SU9 A;  2AB6 A;  1SK1 A;  2O87 A;  1Q4J A;  3FZ5 A;  3TGZ A;  4EDY A;  2CZ2 A;  1V40 A;  3MSZ A;  5A4V A;  1GTA A;  3P7X A;  3LOR A;  2VCT A;  1ON4 A;  2IN3 A;  1PL1 A;  2YWI A;  4XIH A;  3DWV A;  4LA1 A;  1XOA A;  1PGT A;  2VIM A;  1OC9 B;  2CT6 A;  4IHU A;  3UBK A;  2VM1 A;  4WET A;  3KEB A;  1SEN A;  2FUG 2;  2B5X A;  3GX0 A;  4KUN A;  4N0Z A;  2OA7 A;  5E4W A;  3GNJ A;  2V41 A;  3FR9 A;  4MPG A;  3QAG A;  3QFA C;  2YV7 A;  4EC0 A;  3ZVJ A;  2E2G A;  3EC3 A;  4LMW A;  2H70 A;  2R5G A;  1BED A;  1MDI A;  1SYR A;  4MZW A;  4P3Y B;  1BAY A;  4ULX A;  1Z6M A;  2LST A;  1CQH A;  1F3B A;  1T4Y A;  5ECP B;  2H1B A;  2DJK A;  5GAN D;  1ERV A;  2GQL A;  3IHQ A;  3ME7 A;  3ZFL A;  1E6B A;  4KE3 A;  2H01 A;  1K0B A;  1WJK A;  2L5O A;  1UC7 A;  1VF2 A;  2GTU A;  1EZK A;  3IA1 A;  5JWO B;  3EYT A;  4KGI A;  4XCS A;  2VD1 A;  3L4N A;  5KN2 A;  4XTS A;  3P8W A;  1K0C A;  4BL7 A;  1YEX A;  2P0G A;  5H5R A;  1S3C A;  3ZLP A;  3NOF A;  2NDO A;  2VOC A;  4DSS B;  1RK4 A;  4I6X A;  3M3M A;  2OJL A;  4IBP A;  4YH2 A;  3LJR A;  2QSI A;  1JFU A;  3ZL5 A;  1AUC A;  4IQ1 A;  3FYG A;  4NPB A;  1K0M A;  3MAK A;  1GTU A;  5IM9 A;  5IQY A;  1EP7 A;  4JR6 A;  1TU7 A;  5D8I A;  2HLS A;  2LTK A;  3UIW A;  5D96 A;  1ERT A;  1N2A A;  1TXX A;  2X99 A;  2H19 A;  3PR8 A;  3H4K A;  4O5R A;  4RQR A;  4RQX A;  1PQN A;  4NHZ A;  3ZML A;  2B5E A;  4WKW A;  3TRQ A;  1EOG A;  1GLQ A;  4IP6 A;  5A4U A;  2JU5 A;  4IN0 A;  2OE0 A;  9GSS A;  3LWA A;  5IO0 A;  1B9X C;  4KX4 A;  1GWC A;  4K7O A;  3FKF A;  1FO5 A;  2G2Q A;  2PUK C;  4F0B A;  1PKW A;  3P90 A;  5G30 A;  1JZO A;  3E3E A;  2MBS A;  2LNS A;  3W6G A;  3O6T A;  3J7Y b;  1URM A;  4ACS A;  2Z9S A;  5F8B A;  5GZZ B;  1QK8 A;  3A3T A;  3H79 A;  2HXK A;  2H71 A;  4GQF A;  14GS A;  1UA5 A;  1M2A A;  4WF4 A;  3FHK A;  2JZS A;  3EMP A;  3UBL A;  2LS5 A;  4IW9 A;  3LXT A;  4JR4 A;  3VLN A;  2YJ7 A;  1HNC A;  4I2T A;  3F8U A;  3VWV A;  5ELG A;  4BA7 A;  2H73 A;  4JZQ A;  2DML A;  2PER A;  2YZH A;  4WR5 A;  3A2W A;  3HZ4 A;  1YF1 A;  4LL4 B;  4EUY A;  3QDN A;  4FH8 A;  5FWG A;  3RPP A;  4JBB A;  4TXV A;  4I8B A;  3M9K A;  2MBT A;  2K9F A;  4ZB6 A;  1SD9 A;  3FEU A;  3ZRE A;  4DSQ A;  5HR3 A;  2IMK A;  2PPT A;  3BJ5 A;  4XRA A;  2N5A A;  2X8H A;  1SK2 A;  2FNO A;  5DQY A;  2C3N A;  3ME8 A;  3D6I A;  1LJR A;  2MMZ A;  4BPY A;  4NWY A;  4PNF A;  4MJC A;  1V58 A;  3QAW A;  1PX6 A;  2ZNM A;  1BX9 A;  4KCE A;  1X9W B;  4N30 A;  5ECR B;  5EVO A;  3KP8 A;  1OYJ A;  2WJU A;  4F2I A;  1E2Y A;  5KN1 A;  2LJK A;  1FHE A;  4OO4 A;  2GS3 A;  3KZQ A;  1KBN A;  1T1V A;  3ZIJ A;  4POL A;  3GYK A;  2VAF A;  5ENU A;  4L8E A;  3UOM A;  4IJ3 A;  1XWC A;  3GHA A;  5AIX A;  5ECK B;  1FVK A;  2LJA A;  5B8B A;  4OD7 A;  2EIO A;  5ECM B;  2GQK A;  4K8M A;  2F3M A;  4ECJ A;  5JCG A;  3IR4 A;  3RHC A;  1MTC A;  4MAB A;  1U3A A;  2H0G A;  3KD0 A;  5CP1 A;  4GWR A;  2P5R A;  1M2D A;  3CSI A;  1PN9 A;  2LQO A;  3VI5 A;  3ZIT A;  3PIN A;  1Y25 A;  1O85 A;  1KEB A;  2QGV A;  19GS A;  3CRT A;  3EIN A;  2HT9 A;  20GS A;  3ZYW A;  3DIE A;  2QKE A;  5LNK e;  4ECB A;  1YQ1 A;  4GF0 A;  2X8G A;  3A2X A;  4ZXG A;  2L4C A;  5ECQ B;  3G7I A;  4GQC A;  3PGT A;  4YAP A;  1Z7R A;  1I5G A;  2R6K A;  3IOS A;  4V2N A;  5D9V A;  3IK7 A;  3WGX A;  6GSV A;  1V2A A;  2OE1 A;  2KUC A;  4EXJ A;  3EMX A;  4ZIL A;  3I43 A;  2H1A A;  2TIR A;  4GRF A;  1T3B A;  3LEF A;  3DKS A;  4ML1 A;  1HNA A;  3VWU A;  2C0F A;  2YWO A;  1PMT A;  4TR1 B;  3PH9 A;  3FK8 A;  6GSX A;  2D2Z A;  4GSS A;  8GSS A;  2AJQ B;  2IWT A;  5G1L A;  2MYG A;  1RQM A;  4EL1 A;  3I6A A;  5A4W A;  4WBJ A;  1YJ6 A;  3TKQ A;  2V6O A;  2NVL A;  1BG5 A;  2N5F A;  2VL3 A;  2YNX A;  4YAV A;  4HZ2 A;  4ISD A;  3BCK A;  2L6D A;  4XS1 A;  1PL2 A;  4XS4 A;  2V1M A;  1QXH A;  1WE0 A;  4L5O A;  1XWK A;  1S3A A;  3GRX A;  2EC4 A;  3ZVJ D;  4J2F A;  5ECN B;  3KP9 A;  1ZCP A;  3KGK A;  2V32 A;  4GLT A;  4IS0 A;  3TRX A;  1SL1 B;  2E0Q A;  2L4Q A;  1GTI A;  2OE3 A;  4MF6 A;  4EDZ A;  1Q98 A;  4V1A p;  4XS4 B;  2ZUP A;  2H6Y A;  1TRS A;  1XCC A;  1EGR A;  5HR2 A;  3BOA A;  3G7Y A;  4TKY A;  1X5E A;  3DVX A;  3EUR A;  3WGD A;  4MMM A;  3G9B A;  1B8X A;  3FR3 A;  3KH9 A;  3FRC A;  1Y6E A;  4MZB A;  2EIR A;  1O7U A;  3GL5 A;  4F0C A;  2CZ3 A;  5EL8 A;  1K0A A;  3WYW A;  1YY7 A;  3DEX A;  3EVI A;  2FCH A;  4V2L A;  3I9V 2;  4G19 A;  1WWJ A;  1G0T A;  3W8S A;  3E0U A;  3D22 A;  2NBS A;  4E8E A;  1GSD A;  5G5E A;  5DDL A;  1GP1 A;  1R5A A;  4XRD A;  2DLX A;  3RAZ A;  1FG4 A;  1YEP A;  3GSS A;  2IL3 A;  2MMO A;  5KN0 A;  2M72 A;  4GST A;  1U88 A;  3Q6O A;  2HE3 A;  5HFI A;  4WBR D;  5L71 A;  2GSQ A;  2B3S A;  3GX8 A;  2HZE A;  2IME A;  3WD6 A;  2CX4 A;  1ZL9 A;  2YJH A;  3D4M A;  4POM A;  1MD4 A;  1Z7P A;  1XBS A;  3VK9 A;  3KIJ A;  2A2R A;  4KND A;  2B7K A;  1SYX A;  4HUA A;  1XWG A;  1GNW A;  1YKC A;  1G6W A;  5ELA A;  2F9S A;  4NAX A;  3HJO A;  2BMX A;  4ZL7 A;  1HYU A;  3H93 A;  1XZO A;  1TU8 A;  3HCZ A;  4HU9 A;  4X1U A;  1ZMA A;  3QPM A;  1EOH A;  1O6J A;  1FB6 A;  2KP1 A;  2B5Y A;  1WOU A;  2PVQ A;  4K2D A;  1R4W A;  5IMC A;  2CA8 A;  1EGO A;  2RUE A;  4OFN A;  1H4O A;  3DRN A;  1FB0 A;  3F6D A;  5CRW A;  1THO A;  2GDR A;  1XWA A;  5D9X A;  4IGJ A;  3JCM L;  2GT5 A;  1G7E A;  2LRN A; 
#chains in the Genus database with same CATH topology
 3C7M A;  3BBY A;  5AIV A;  2MMN A;  4TXO A;  2C0G A;  4J57 E;  1BYE A;  2H8L A;  2HRN A;  5IMV A;  1X5C A;  4D73 A;  3HHV A;  1GSU A;  1ACV A;  2M80 A;  5LCZ A;  2C80 A;  2DJ0 A;  4WEY A;  1XPV A;  3IAM 2;  3CXG A;  4MJE A;  1R7H A;  1S3R A;  3APQ A;  2H75 A;  3KMO A;  4FYU A;  4BWS A;  2GLR A;  4ZB8 A;  4TVE A;  4CDO A;  3TOU A;  1F37 A;  5D9W A;  1SJI A;  4CW9 A;  1VRS D;  2YN1 A;  4TR0 A;  2WUL A;  3BCI A;  2P5Q A;  1Z3E A;  1UVZ A;  2H66 A;  2N5B A;  3APS A;  2C3Q A;  4KSM A;  3M8N A;  4Z2R A;  2HRK A;  1YZX A;  1X0R A;  2F51 A;  3WGE A;  4G9H A;  4O32 A;  5INY A;  1CQG A;  3C73 A;  3LXZ A;  2X49 A;  3TUE A;  2A4H A;  2GSR A;  1BJX A;  3HY2 A;  1A0R P;  3F63 A;  5D93 A;  2RUF A;  5AN1 A;  4LL1 B;  1WMJ A;  3UJ1 A;  1SL2 B;  3M9J A;  1NHY A;  2H30 A;  1FAA A;  3C1S A;  4KAE A;  3ERG A;  2RII A;  1OC3 A;  2E7P A;  5IMA A;  3GKN A;  4ZB9 A;  1A2M A;  5ID2 A;  1SL0 B;  3F0I A;  4AJ7 A;  5J9C A;  2QA2 A;  5CO3 A;  2A4V A;  2X4A A;  1PRX A;  2LV3 A;  3MWH A;  2WB9 A;  4OFT A;  4RI7 A;  2VO4 A;  6GSS A;  2HYX A;  4TRX A;  4N10 A;  4NV2 A;  5HFG A;  2FGX A;  3CTF A;  2CQ9 A;  2DJ2 A;  1TW9 A;  2IJY A;  2C0D A;  1EEM A;  1YKA A;  2AYT A;  3G7J A;  2VM2 A;  5FT3 A;  1U6T A;  4POK A;  2L6C A;  1R26 A;  2IMI A;  4PTS A;  1GUL A;  1WPI A;  1AAZ A;  2I3Y A;  1VF4 A;  2JSY A;  2VUP A;  3V1W A;  5CNW A;  3TJK A;  2B6M A;  1PKZ A;  3HVN A;  3HYP A;  3HVV A;  1GLP A;  2ON5 A;  2HNL A;  4JRR A;  3GFK A;  2HZF A;  3L78 A;  4O5U A;  3WT2 A;  1ZYE A;  2CVD A;  5DAL A;  3P2A A;  3GST A;  1YF0 A;  3EU3 A;  4WXT A;  2O7K A;  4N11 A;  2WGR A;  3LYP A;  1PA3 A;  3N5O A;  4IEL A;  3RHB A;  1G6Y A;  4JED A;  3D21 A;  1J9B A;  4MH2 A;  5H5Q A;  4MF5 A;  1ZOF A;  3E9J B;  3GA4 A;  3QMX A;  1GTB A;  1A24 A;  5CRG A;  3KCM A;  1J0F A;  2V6K A;  1SJ6 A;  4MDC A;  2X8C A;  1GUH A;  1USB A;  3GV1 A;  4KCA A;  4FYB A;  1PX7 A;  2DKI A;  4BVX A;  2FY6 A;  1QGV A;  2R0G A;  3J7Y k;  1Z9H A;  4K9Z A;  2H1D A;  4IKH A;  3DXB A;  4TR3 A;  3HVX A;  3UAP A;  3DGQ A;  4OMV A;  5IPH A;  1T8E B;  3TKP A;  3IXR A;  5CYY A;  1W89 A;  5IPG A;  5DJM A;  5DJL A;  1XW5 A;  4BVX B;  1GSE A;  4K6X A;  2PBJ A;  1SKR B;  1DSB A;  4G2E A;  5AIS A;  1M7T A;  4BIK A;  4AJ8 A;  4K0N A;  1PFO A;  2IFQ A;  3VUR A;  3Q74 A;  3DML A;  3VPT A;  4Q5R A;  4KSO A;  1XW6 A;  2C4J A;  2P31 A;  4X4J A;  4O92 A;  5G2Z A;  1DE2 A;  2PWJ A;  4GTU A;  4ZBB A;  2IPA A;  4OCF A;  3GUS A;  1XVQ A;  1O81 A;  5CRH A;  3KJY A;  3TDG A;  3TJG A;  2C3T A;  3GH9 A;  4HEA 2;  5AGY A;  4MP4 A;  4K5S A;  5J9B A;  4ECI A;  4PQ1 A;  1IYH A;  2PGT A;  2WRT A;  2L5L A;  5F06 A;  1HNB A;  3TCO A;  3F3Q A;  3D4T A;  2RM6 A;  5DAK A;  2I81 A;  4MZC A;  1A23 A;  1THX A;  5CRE A;  3IAS 2;  2VCW A;  3BD2 A;  3F9U A;  4Q5F A;  3GN3 A;  2QC7 A;  5GST A;  3GMF A;  2VLU A;  1YDK A;  4GXZ A;  3SWL A;  1LBK A;  12GS A;  3UAR A;  3IE3 A;  4CHS A;  5C00 A;  2DJ3 A;  2YV9 A;  1U3I A;  1TRU A;  2CAI A;  2EIQ A;  4RI6 A;  5DAK B;  2LRC A;  5JCU A;  1OAZ A;  10GS A;  1MEK A;  3O76 A;  1DUG A;  4K7N A;  5JCW A;  1H75 A;  5IO2 A;  3TKR A;  1PD2 1;  2FA4 A;  3C71 A;  3LGC A;  1A2J A;  2VD0 A;  2J9H A;  4PUR A;  3TRP A;  1OC8 A;  4FIW A;  4EVM A;  1F3A A;  2GT6 A;  4DSR A;  4K1F A;  5GAP D;  1GSQ A;  1V98 A;  1FOH A;  1NSW A;  4MA9 A;  3CSH A;  2GZP A;  4OCE A;  2YPM A;  3A2V A;  1TK5 B;  2XPD A;  1GSF A;  4EE0 A;  4HQS A;  3QD9 A;  1B4P A;  3F3R A;  1DE1 A;  4G10 A;  1O73 A;  4MF7 A;  3LQ7 A;  4IP1 A;  4YQU A;  2CV4 A;  2CAQ A;  3C8E A;  1TDI A;  2LRT A;  3L9V A;  4AJ6 A;  4G0L A;  2VCZ A;  2TRC P;  4MH3 A;  4ZIJ A;  4K5R A;  1BQ7 A;  1AIU A;  2QA1 A;  3F4T A;  2OBK A;  3GH6 A;  1ZGN A;  1X5D A;  2FHE A;  2LEG A;  2XC2 A;  3Q19 A;  3EE2 A;  1AQX A;  3VWW A;  4PUF C;  5E59 A;  2H0I A;  2KOK A;  4L0U A;  2LUS A;  3FMW A;  2HRF A;  2LJR A;  1OE8 A;  2R4V A;  1M0U A;  3WT1 A;  4QL7 A;  2CVK A;  4L5L A;  5F05 A;  2FA8 A;  1T4Z A;  1T00 A;  1JZD A;  1FW1 A;  5EPF A;  4KB3 A;  2IIY A;  4BVY A;  4XS6 A;  3M1G A;  5IOW A;  2GVP A;  3ZFB A;  2DJ1 A;  1NM3 A;  4GSN A;  4QQ7 A;  2FLS A;  5J5N A;  2R37 A;  6GSW A;  3AY8 A;  4ZBA A;  5HFK A;  3OR5 A;  2JAC A;  2DJJ A;  2VCQ A;  1G7O A;  1VGL A;  5DVB A;  3KH7 A;  1NW2 A;  2I9H A;  2VLV A;  2AHE A;  5ECO B;  3ZZX A;  4CY6 A;  3IHG A;  3CBU A;  4HI7 A;  2DMM A;  2GST A;  5KEJ A;  4G0K A;  3UL3 A;  1ZYQ B;  1I9D A;  3PPU A;  4I97 A;  4JE1 A;  4NV5 A;  2AV4 A;  4K7I A;  1OC9 A;  1OVN A;  2HZE B;  5F0G A;  2KHP A;  4ML6 A;  2GZZ A;  1B48 A;  1OE7 A;  3K8N A;  4OFM A;  3U5R E;  4NXI A;  2H74 A;  1JZW A;  4DVC A;  1QMV A;  1S3D A;  1XG8 A;  4O7H A;  11GS A;  1XW9 A;  3DYR A;  1JHB A;  4V2M A;  4ZL9 A;  3H1N A;  2B1K A;  3LG6 A;  3LFL A;  3TOT A;  2K18 A;  3D0Z A;  1W4V A;  1TP9 A;  1PSQ A;  1K0N A;  1XFL A;  1SKS B;  1UN2 A;  4X43 A;  5KOW A;  1GRX A;  3ERF A;  4ID0 A;  4L0W A;  4RUV A;  2K8V A;  1M99 A;  2V2G A;  4AGS A;  4E8H A;  4KW6 A;  3GKX A;  1AW9 A;  3NIV A;  5KN3 A;  5IMD A;  4DSS A;  4MJB A;  3L9S A;  4EO3 A;  1HD2 A;  4TXO B;  5IIZ A;  1QFN A;  4OWY A;  4Z7X A;  1EV4 A;  1K3O A;  2O8V B;  3N9J A;  1AQV A;  4D73 B;  2DC5 A;  3TB2 A;  1GH2 A;  2AAW A;  4KDX A;  1A8Y A;  3CYN A;  2MMA A;  4QL9 A;  3A5I A;  2LNT A;  5DCG A;  3O3T A;  1GSY A;  2BJX A;  2REM A;  2E2M A;  3SBC A;  1LU4 A;  1VF3 A;  4LLR A;  4PNG A;  3FR6 A;  2DIZ A;  2PMT A;  5D73 A;  2GGT A;  2R3X A;  5IMF A;  3APO A;  16GS A;  1GL8 A;  3HDC A;  1ZYP A;  1VF1 A;  4I2U A;  3GIX A;  3CQF A;  3CTG A;  4YQV A;  4N0V A;  4EF0 A;  3L9U A;  1V57 A;  4KDY A;  5DBQ A;  1PN0 A;  2H72 A;  1TOF A;  3ED3 A;  4GCI A;  2M46 A;  4PXO A;  3IDV A;  2JAD A;  4IJI A;  4Q5Q A;  2MZC A;  5ECH B;  2RM5 A;  3KMN A;  1IYI A;  3UMA A;  5F07 A;  2FD3 A;  2XPE A;  1TI3 A;  1K3L A;  2HI7 A;  2IMF A;  2FWE A;  2HRA A;  5IMZ A;  3CRU A;  2ON7 A;  4HOJ A;  2F8F A;  5J3R A;  2J23 A;  5ID2 B;  2FWG A;  4ECC A;  1TI1 A;  2XBQ A;  5G5F A;  1SK0 A;  2JSZ A;  5ABR A;  3FZ4 A;  1KNG A;  3A5W A;  3D5J A;  1J08 A;  3CMI A;  4ZL8 A;  4Q5N A;  1GUK A;  1R5P A;  3S9F A;  2FWH A;  3MDK A;  2H76 A;  1ZZY A;  4PGT A;  3DD3 A;  1T7P B;  5DQS A;  1TRV A;  1B9Y C;  4KA0 A;  2R2J A;  3ZMK A;  1ST9 A;  2ZCT A;  5G31 A;  4K0G A;  2FWF A;  3RPN A;  1TK8 B;  1K0O A;  4O5Q A;  3H8Q A;  3R3E A;  2XHF A;  1MD3 A;  6GSY A;  1C72 A;  2VL2 A;  13GS A;  3CSJ A;  1XXU A;  3HA9 A;  4EKZ A;  1AXD A;  4EIP A;  1AQW A;  5D9T A;  7GSS A;  4MPF A;  3VWX A;  3HJP A;  4POB A;  3ZIV A;  2WZ9 A;  5DAL B;  2VL2 C;  1TRW A;  2HFD A;  2O89 A;  2DBC A;  3KTB A;  1OKD A;  4F82 A;  4YKG A;  22GS A;  3M0F A;  18GS A;  2WCI A;  1F6M C;  1EEJ A;  1JZR A;  2YCD A;  2K6V A;  4FYC A;  5IOX A;  1XIY A;  3GL3 A;  2BTO T;  5GSS A;  2B1L A;  1M2B A;  2O85 A;  17GS A;  4IQA A;  3R2Q A;  3UVH A;  2ES7 A;  1TK0 B;  3KTL A;  3HD5 A;  3MIX A;  5FHI A;  2HSY A;  2WFC A;  4PQH A;  2VL9 A;  2OAC A;  2WDU A;  4YKF A;  3QOU A;  5LD0 A;  2YOI A;  5J4U A;  1ERW A;  3VFI A;  1MDJ A;  1QUW A;  4HJM A;  3IK9 A;  3GKK A;  4OO5 A;  1WIK A;  3W8J A;  3I69 A;  5G1K A;  1KTE A;  3IRA A;  6GST A;  3HZ8 A;  1SKW B;  3QFB C;  2ALB A;  2OKA A;  1AC1 A;  3QR6 A;  3IPZ A;  4MLY A;  4DEJ A;  1K0D A;  1HQO A;  5A5K A;  2DIY A;  2JZT A;  2L59 A;  4X0X A;  3TKS A;  3FY7 A;  2R0P A;  2IFQ B;  4NMU A;  1DBY A;  3QAV A;  3NZN A;  3EWL A;  1XWB A;  3TJF A;  1QQ2 A;  3TJB A;  3HVS A;  2YAN A;  2YZU A;  6GSU A;  4MJA A;  3TKS C;  2JL4 A;  3QCP A;  3C1R A;  4HU7 A;  4LMV A;  4I5Q A;  1XOB A;  1EWX A;  2YWN A;  1M9B A;  2B7J A;  1NHO A;  3KM6 A;  4YQM A;  2LKU A;  5CAX A;  1A2L A;  4F03 A;  1M9A A;  1A0F A;  2YWM A;  5B7C A;  4KH7 A;  1GNE A;  5B6N A;  2VCX A;  1B4Q A;  5ECI B;  1JLV A;  4TOP A;  3TJJ A;  3TKS E;  5B8A A;  4JU5 A;  2I1U A;  2XBI A;  2GSS A;  3ERW A;  5EY6 A;  2H6X A;  3FW2 A;  1F9M A;  3HKR A;  1U87 A;  4TR1 A;  1Z5Y E;  2K8S A;  1OKT A;  4HS1 A;  3KXO A;  3U6V A;  1Z6N A;  2DSA A;  4PX1 A;  3VI7 A;  4F9Z A;  3L0H A;  2F8A A;  1O8W A;  2GQM A;  1WRY A;  4MK3 A;  2WS2 A;  1ABA A;  4ZBD A;  1X9M B;  5CRD A;  2C0E A;  5HQP A;  3EPT A;  2NPB A;  1TJD A;  1FVJ A;  4TW5 A;  4V1A g;  4MCU A;  5C04 A;  2HSH A;  1N8J A;  2JZR A;  2L57 A;  1ILO A;  1TTZ A;  2IMD A;  1ERU A;  4WF5 A;  4HZ4 A;  3F4S A;  2X64 A;  4BWQ A;  5DCH A;  3IV4 A;  3ZRD A;  2G0F A;  2H1G A;  2PVO C;  3DVW A;  4G0I A;  5ECS A;  3IC4 A;  2LQQ A;  1SJZ A;  2YP6 A;  1SD8 A;  2TRX A;  2NTO A;  3FZA A;  2CVB A;  4HJ2 A;  1GUM A;  2OAD A;  4TN8 A;  5J41 A;  1MDK A;  3HJM A;  2H6Z A;  2PN8 A;  3ZTL A;  4FO5 A;  2RLI A;  3F6F A;  3US3 A;  3GKM A;  4J56 E;  5ECL B;  1TKD B;  5JWQ B;  4WR4 A;  3GTU A;  3EU4 A;  2CX3 A;  1X9S B;  4KDU A;  4ILF A;  4PQI A;  2C8U A;  3UEM A;  4NHW A;  1K3Y A;  2A2S A;  1EV9 A;  1V9W A;  2H0H A;  3GUR A;  3UVT A;  3LSZ A;  3IBH A;  3ISO A;  1GSS A;  4EIQ A;  1F2E A;  2GZY A;  3F4R A;  1A8L A;  5JWR B;  5HR0 A;  2AUV A;  3MNG A;  3RBT A;  2KP2 A;  3GTU B;  4IVF A;  4HQZ A;  2VCV A;  1ML6 A;  5B6M A;  2PU9 C;  1FOV A;  3Q18 A;  3FZ9 A;  4PUA A;  2OBI A;  3HXS A;  4AF2 A;  4BVY B;  1WP0 A;  2VLT A;  1EP8 A;  1JLW A;  4HDE A;  4TR4 A;  5COH A;  3RDW A;  4H86 A;  1O8X A;  1XVW A;  4XHM A;  2C1Y A;  3VPQ A;  5H5S A;  5BMU A;  3LYK A;  2KLX A;  1RW1 A;  5HR1 A;  2I4A A;  1SU9 A;  2AB6 A;  1SK1 A;  2O87 A;  1Q4J A;  3FZ5 A;  3TGZ A;  4EDY A;  2CZ2 A;  1V40 A;  3MSZ A;  5A4V A;  1GTA A;  1ZYN A;  3P7X A;  3LOR A;  2VCT A;  1ON4 A;  2IN3 A;  1PL1 A;  2YWI A;  4XIH A;  3DWV A;  4LA1 A;  1XOA A;  1PGT A;  2VIM A;  1OC9 B;  2CT6 A;  4IHU A;  3UBK A;  2VM1 A;  4WET A;  3KEB A;  1SEN A;  2FUG 2;  2B5X A;  3GX0 A;  4KUN A;  4N0Z A;  2OA7 A;  5E4W A;  3GNJ A;  2V41 A;  3FR9 A;  4MPG A;  4HSC X;  4Z2U A;  3QAG A;  3QFA C;  2YV7 A;  4EC0 A;  3ZVJ A;  2E2G A;  3EC3 A;  4LMW A;  2H70 A;  2R5G A;  1BED A;  1MDI A;  1SYR A;  4MZW A;  4P3Y B;  1BAY A;  4ULX A;  1Z6M A;  2LST A;  1CQH A;  1F3B A;  1T4Y A;  5ECP B;  2H1B A;  2DJK A;  5GAN D;  1ERV A;  2GQL A;  3IHQ A;  3ME7 A;  3ZFL A;  1E6B A;  4KE3 A;  2H01 A;  1K0B A;  1WJK A;  2L5O A;  1UC7 A;  1VF2 A;  2GTU A;  4CY8 A;  1EZK A;  3IA1 A;  5JWO B;  3EYT A;  4KGI A;  4XCS A;  2VD1 A;  3L4N A;  5KN2 A;  4XTS A;  3P8W A;  1K0C A;  4BL7 A;  1YEX A;  2P0G A;  5H5R A;  1S3C A;  3ZLP A;  3NOF A;  2NDO A;  2VOC A;  4DSS B;  1RK4 A;  4I6X A;  3M3M A;  2OJL A;  4IBP A;  4YH2 A;  3LJR A;  2QSI A;  1JFU A;  3ZL5 A;  1AUC A;  4IQ1 A;  3FYG A;  4NPB A;  1K0M A;  3MAK A;  1GTU A;  5IM9 A;  4BL7 B;  5IQY A;  1EP7 A;  4JR6 A;  1TU7 A;  5D8I A;  2HLS A;  2LTK A;  3UIW A;  5D96 A;  1ERT A;  1N2A A;  1TXX A;  2X99 A;  2H19 A;  3PR8 A;  3H4K A;  4O5R A;  4RQR A;  4RQX A;  4USS A;  1PQN A;  4NHZ A;  3ZML A;  2B5E A;  4WKW A;  4Z2T A;  3TRQ A;  1EOG A;  1GLQ A;  4IP6 A;  5A4U A;  2JU5 A;  4IN0 A;  2OE0 A;  9GSS A;  3LWA A;  5IO0 A;  1B9X C;  4KX4 A;  1GWC A;  4K7O A;  3FKF A;  1FO5 A;  3LW9 A;  2G2Q A;  2PUK C;  4F0B A;  1PKW A;  4KF9 A;  3P90 A;  5BRT A;  5G30 A;  1JZO A;  3E3E A;  2MBS A;  2LNS A;  4MNN A;  3W6G A;  3O6T A;  3J7Y b;  1URM A;  4ACS A;  2Z9S A;  5F8B A;  5GZZ B;  1QK8 A;  3A3T A;  3H79 A;  2HXK A;  3IC8 A;  2H71 A;  4GQF A;  14GS A;  1UA5 A;  1M2A A;  4WF4 A;  3FHK A;  2JZS A;  3EMP A;  3UBL A;  2LS5 A;  4IW9 A;  3LXT A;  4JR4 A;  3VLN A;  2YJ7 A;  1HNC A;  4I2T A;  3F8U A;  3VWV A;  2HSM A;  5ELG A;  1M3J A;  4BA7 A;  2H73 A;  4JZQ A;  2DML A;  2PER A;  2YZH A;  4WR5 A;  3A2W A;  3HZ4 A;  1YF1 A;  4LL4 B;  4EUY A;  3QDN A;  4FH8 A;  4K2X A;  5FWG A;  3RPP A;  4JBB A;  4TXV A;  4I8B A;  3M9K A;  2MBT A;  2K9F A;  4ZB6 A;  1SD9 A;  3FEU A;  3ZRE A;  4DSQ A;  5HR3 A;  2IMK A;  2PPT A;  3BJ5 A;  4XRA A;  4FQU A;  2N5A A;  2X8H A;  1SK2 A;  2FNO A;  5DQY A;  2C3N A;  3ME8 A;  3D6I A;  1LJR A;  2MMZ A;  4BPY A;  4NWY A;  4PNF A;  4MJC A;  1V58 A;  3QAW A;  1PX6 A;  2ZNM A;  1BX9 A;  4KCE A;  1X9W B;  4N30 A;  5ECR B;  5EVO A;  3KP8 A;  1OYJ A;  2WJU A;  4F2I A;  1E2Y A;  5KN1 A;  2LJK A;  1FHE A;  4OO4 A;  2GS3 A;  3KZQ A;  1KBN A;  1T1V A;  3ZIJ A;  4POL A;  3GYK A;  2VAF A;  5ENU A;  4L8E A;  3UOM A;  4IJ3 A;  1XWC A;  3GHA A;  5AIX A;  5ECK B;  1FVK A;  2LJA A;  5B8B A;  4OD7 A;  2EIO A;  5ECM B;  2GQK A;  4K8M A;  2F3M A;  4ECJ A;  5JCG A;  3IR4 A;  3RHC A;  1MTC A;  4MAB A;  1U3A A;  2H0G A;  3KD0 A;  5CP1 A;  4GWR A;  2P5R A;  1M2D A;  2A2P A;  3CSI A;  2UZ8 A;  1PN9 A;  2LQO A;  3VI5 A;  3ZIT A;  3PIN A;  1Y25 A;  1O85 A;  1KEB A;  2QGV A;  19GS A;  3CRT A;  3EIN A;  1M3I A;  2HT9 A;  20GS A;  3ZYW A;  3DIE A;  2QKE A;  5LNK e;  4ECB A;  1YQ1 A;  4GF0 A;  2X8G A;  3A2X A;  4ZXG A;  2L4C A;  5ECQ B;  3G7I A;  4GQC A;  3PGT A;  4YAP A;  1Z7R A;  1I5G A;  2R6K A;  3IOS A;  4V2N A;  5D9V A;  3IK7 A;  3WGX A;  6GSV A;  1V2A A;  2OE1 A;  2KUC A;  4EXJ A;  3EMX A;  4ZIL A;  3I43 A;  2H1A A;  2TIR A;  4GRF A;  1T3B A;  3LEF A;  3DKS A;  4ML1 A;  1HNA A;  3VWU A;  2C0F A;  2YWO A;  1PMT A;  4TR1 B;  3PH9 A;  3FK8 A;  6GSX A;  2D2Z A;  4GSS A;  8GSS A;  2AJQ B;  2IWT A;  5G1L A;  2MYG A;  1RQM A;  4EL1 A;  3I6A A;  5A4W A;  4WBJ A;  1YJ6 A;  3TKQ A;  2V6O A;  2NVL A;  1BG5 A;  2N5F A;  2VL3 A;  2YNX A;  3MYD A;  4YAV A;  4HZ2 A;  4ISD A;  3BCK A;  2L6D A;  4XS1 A;  1PL2 A;  4XS4 A;  2V1M A;  1QXH A;  1WE0 A;  2R0C A;  4L5O A;  1XWK A;  1S3A A;  3GRX A;  2EC4 A;  3ZVJ D;  4J2F A;  5ECN B;  3KP9 A;  1ZCP A;  3KGK A;  2V32 A;  4GLT A;  4IS0 A;  2DKH A;  3TRX A;  1SL1 B;  2E0Q A;  2L4Q A;  1GTI A;  2OE3 A;  4MF6 A;  4EDZ A;  1Q98 A;  4V1A p;  4XS4 B;  2ZUP A;  2H6Y A;  1TRS A;  1XCC A;  1EGR A;  5HR2 A;  3BOA A;  3G7Y A;  4TKY A;  1X5E A;  3DVX A;  3EUR A;  3WGD A;  4MMM A;  3G9B A;  1B8X A;  3FR3 A;  3KH9 A;  3FRC A;  1Y6E A;  4MZB A;  2EIR A;  1O7U A;  3GL5 A;  4F0C A;  2CZ3 A;  1K0A A;  5EL8 A;  3WYW A;  1YY7 A;  3DEX A;  3EVI A;  2FCH A;  4V2L A;  3I9V 2;  4G19 A;  1WWJ A;  1G0T A;  3W8S A;  3E0U A;  3D22 A;  2NBS A;  4E8E A;  1GSD A;  4A5P A;  5G5E A;  5DDL A;  1GP1 A;  1R5A A;  4XRD A;  2DLX A;  3RAZ A;  1FG4 A;  1YEP A;  3GSS A;  2IL3 A;  2MMO A;  5KN0 A;  2M72 A;  4GST A;  1U88 A;  3Q6O A;  2HE3 A;  5HFI A;  4WBR D;  5L71 A;  2GSQ A;  2B3S A;  3GX8 A;  2HZE A;  2IME A;  3WD6 A;  2CX4 A;  1ZL9 A;  2YJH A;  3D4M A;  4POM A;  1MD4 A;  1Z7P A;  1XBS A;  3VK9 A;  5KOX A;  3KIJ A;  2A2R A;  4KND A;  2B7K A;  1SYX A;  4HUA A;  1XWG A;  1GNW A;  1YKC A;  1G6W A;  5ELA A;  2F9S A;  4NAX A;  3HJO A;  2BMX A;  4ZL7 A;  1HYU A;  3H93 A;  1XZO A;  1TU8 A;  3HCZ A;  4HU9 A;  4X1U A;  4ICY A;  1ZMA A;  3QPM A;  1EOH A;  1O6J A;  1FB6 A;  2KP1 A;  2B5Y A;  1WOU A;  2PVQ A;  4K2D A;  1R4W A;  5IMC A;  2CA8 A;  1EGO A;  2RUE A;  4OFN A;  1H4O A;  3DRN A;  1FB0 A;  3F6D A;  5CRW A;  1THO A;  2GDR A;  1XWA A;  5D9X A;  4IGJ A;  3JCM L;  2GT5 A;  1G7E A;  2LRN A; 
#chains in the Genus database with same CATH homology
 3C7M A;  3BBY A;  5AIV A;  2MMN A;  4TXO A;  2C0G A;  4J57 E;  1BYE A;  2H8L A;  2HRN A;  5IMV A;  1X5C A;  4D73 A;  3HHV A;  1GSU A;  1ACV A;  2M80 A;  5LCZ A;  2C80 A;  2DJ0 A;  4WEY A;  1XPV A;  3IAM 2;  3CXG A;  4MJE A;  1R7H A;  3APQ A;  2H75 A;  3KMO A;  4FYU A;  4BWS A;  2GLR A;  4ZB8 A;  4TVE A;  4CDO A;  3TOU A;  1F37 A;  5D9W A;  1SJI A;  4CW9 A;  1VRS D;  2YN1 A;  4TR0 A;  2WUL A;  3BCI A;  2P5Q A;  1Z3E A;  1UVZ A;  2H66 A;  2N5B A;  3APS A;  2C3Q A;  4KSM A;  3M8N A;  4Z2R A;  2HRK A;  1YZX A;  1X0R A;  2F51 A;  3WGE A;  4G9H A;  4O32 A;  5INY A;  1CQG A;  3C73 A;  3LXZ A;  2X49 A;  3TUE A;  2A4H A;  2GSR A;  1BJX A;  3HY2 A;  1A0R P;  3F63 A;  5D93 A;  2RUF A;  5AN1 A;  4LL1 B;  1WMJ A;  3UJ1 A;  1SL2 B;  3M9J A;  1NHY A;  2H30 A;  1FAA A;  3C1S A;  4KAE A;  3ERG A;  2RII A;  1OC3 A;  2E7P A;  5IMA A;  3GKN A;  4ZB9 A;  1A2M A;  5ID2 A;  1SL0 B;  3F0I A;  4AJ7 A;  5J9C A;  2QA2 A;  5CO3 A;  2A4V A;  2X4A A;  1PRX A;  2LV3 A;  3MWH A;  2WB9 A;  4OFT A;  4RI7 A;  2VO4 A;  6GSS A;  2HYX A;  4TRX A;  4N10 A;  4NV2 A;  5HFG A;  2FGX A;  3CTF A;  2CQ9 A;  2DJ2 A;  1TW9 A;  2IJY A;  2C0D A;  1EEM A;  1YKA A;  2AYT A;  3G7J A;  2VM2 A;  5FT3 A;  1U6T A;  4POK A;  2L6C A;  1R26 A;  2IMI A;  4PTS A;  1GUL A;  1WPI A;  1AAZ A;  2I3Y A;  1VF4 A;  2JSY A;  2VUP A;  3V1W A;  5CNW A;  3TJK A;  2B6M A;  1PKZ A;  3HYP A;  3HVV A;  1GLP A;  2ON5 A;  2HNL A;  4JRR A;  3GFK A;  2HZF A;  3L78 A;  4O5U A;  3WT2 A;  1ZYE A;  2CVD A;  5DAL A;  3P2A A;  3GST A;  1YF0 A;  3EU3 A;  4WXT A;  2O7K A;  4N11 A;  2WGR A;  3LYP A;  1PA3 A;  3N5O A;  4IEL A;  3RHB A;  1G6Y A;  4JED A;  3D21 A;  1J9B A;  4MH2 A;  5H5Q A;  4MF5 A;  1ZOF A;  3E9J B;  3GA4 A;  3QMX A;  1GTB A;  1A24 A;  5CRG A;  3KCM A;  1J0F A;  2V6K A;  1SJ6 A;  4MDC A;  2X8C A;  1GUH A;  1USB A;  3GV1 A;  4KCA A;  4FYB A;  1PX7 A;  2DKI A;  4BVX A;  2FY6 A;  1QGV A;  2R0G A;  3J7Y k;  1Z9H A;  4K9Z A;  2H1D A;  4IKH A;  3DXB A;  4TR3 A;  3HVX A;  3UAP A;  3DGQ A;  4OMV A;  5IPH A;  1T8E B;  3TKP A;  3IXR A;  5CYY A;  1W89 A;  5IPG A;  5DJM A;  5DJL A;  1XW5 A;  4BVX B;  1GSE A;  4K6X A;  2PBJ A;  1SKR B;  1DSB A;  4G2E A;  5AIS A;  1M7T A;  4AJ8 A;  4K0N A;  2IFQ A;  3VUR A;  3Q74 A;  3DML A;  3VPT A;  4Q5R A;  4KSO A;  1XW6 A;  2C4J A;  2P31 A;  4X4J A;  4O92 A;  5G2Z A;  1DE2 A;  2PWJ A;  4GTU A;  4ZBB A;  2IPA A;  4OCF A;  3GUS A;  1XVQ A;  1O81 A;  5CRH A;  3KJY A;  3TDG A;  3TJG A;  2C3T A;  3GH9 A;  4HEA 2;  5AGY A;  4MP4 A;  4K5S A;  5J9B A;  4ECI A;  4PQ1 A;  1IYH A;  2PGT A;  2WRT A;  2L5L A;  5F06 A;  1HNB A;  3TCO A;  3F3Q A;  3D4T A;  2RM6 A;  5DAK A;  2I81 A;  4MZC A;  1A23 A;  1THX A;  5CRE A;  3IAS 2;  2VCW A;  3BD2 A;  3F9U A;  4Q5F A;  3GN3 A;  2QC7 A;  5GST A;  3GMF A;  2VLU A;  1YDK A;  4GXZ A;  3SWL A;  1LBK A;  12GS A;  3UAR A;  3IE3 A;  4CHS A;  5C00 A;  2DJ3 A;  2YV9 A;  1U3I A;  1TRU A;  2CAI A;  2EIQ A;  4RI6 A;  5DAK B;  2LRC A;  5JCU A;  1OAZ A;  10GS A;  1MEK A;  3O76 A;  1DUG A;  4K7N A;  5JCW A;  1H75 A;  5IO2 A;  3TKR A;  1PD2 1;  2FA4 A;  3C71 A;  3LGC A;  1A2J A;  2VD0 A;  2J9H A;  4PUR A;  3TRP A;  1OC8 A;  4FIW A;  4EVM A;  1F3A A;  2GT6 A;  4DSR A;  4K1F A;  5GAP D;  1GSQ A;  1V98 A;  1FOH A;  1NSW A;  4MA9 A;  3CSH A;  2GZP A;  4OCE A;  2YPM A;  3A2V A;  1TK5 B;  2XPD A;  1GSF A;  4EE0 A;  4HQS A;  3QD9 A;  1B4P A;  3F3R A;  1DE1 A;  4G10 A;  1O73 A;  4MF7 A;  3LQ7 A;  4IP1 A;  4YQU A;  2CV4 A;  2CAQ A;  3C8E A;  1TDI A;  2LRT A;  3L9V A;  4AJ6 A;  4G0L A;  2VCZ A;  2TRC P;  4MH3 A;  4ZIJ A;  4K5R A;  1BQ7 A;  1AIU A;  2QA1 A;  3F4T A;  2OBK A;  3GH6 A;  1ZGN A;  1X5D A;  2FHE A;  2LEG A;  2XC2 A;  3Q19 A;  3EE2 A;  1AQX A;  3VWW A;  4PUF C;  5E59 A;  2H0I A;  2KOK A;  4L0U A;  2LUS A;  3FMW A;  2HRF A;  2LJR A;  1OE8 A;  2R4V A;  1M0U A;  3WT1 A;  4QL7 A;  2CVK A;  4L5L A;  5F05 A;  2FA8 A;  1T4Z A;  1T00 A;  1JZD A;  1FW1 A;  5EPF A;  4KB3 A;  2IIY A;  4BVY A;  4XS6 A;  3M1G A;  5IOW A;  2GVP A;  3ZFB A;  2DJ1 A;  1NM3 A;  4GSN A;  4QQ7 A;  2FLS A;  5J5N A;  2R37 A;  6GSW A;  3AY8 A;  4ZBA A;  5HFK A;  3OR5 A;  2JAC A;  2DJJ A;  2VCQ A;  1G7O A;  1VGL A;  5DVB A;  3KH7 A;  1NW2 A;  2I9H A;  2VLV A;  2AHE A;  5ECO B;  3ZZX A;  4CY6 A;  3IHG A;  3CBU A;  4HI7 A;  2DMM A;  2GST A;  5KEJ A;  4G0K A;  3UL3 A;  1ZYQ B;  1I9D A;  3PPU A;  4I97 A;  4JE1 A;  4NV5 A;  2AV4 A;  4K7I A;  1OC9 A;  1OVN A;  2HZE B;  5F0G A;  2KHP A;  4ML6 A;  2GZZ A;  1B48 A;  1OE7 A;  3K8N A;  4OFM A;  3U5R E;  4NXI A;  2H74 A;  1JZW A;  4DVC A;  1QMV A;  1S3D A;  4O7H A;  11GS A;  1XW9 A;  3DYR A;  1JHB A;  4V2M A;  4ZL9 A;  3H1N A;  2B1K A;  3LG6 A;  3LFL A;  3TOT A;  2K18 A;  3D0Z A;  1W4V A;  1TP9 A;  1PSQ A;  1K0N A;  1XFL A;  1SKS B;  1UN2 A;  4X43 A;  5KOW A;  1GRX A;  3ERF A;  4ID0 A;  4L0W A;  4RUV A;  2K8V A;  1M99 A;  2V2G A;  4AGS A;  4E8H A;  4KW6 A;  3GKX A;  1AW9 A;  3NIV A;  5KN3 A;  5IMD A;  4DSS A;  4MJB A;  3L9S A;  4EO3 A;  1HD2 A;  4TXO B;  5IIZ A;  1QFN A;  4OWY A;  4Z7X A;  1EV4 A;  1K3O A;  2O8V B;  3N9J A;  1AQV A;  4D73 B;  2DC5 A;  3TB2 A;  1GH2 A;  2AAW A;  4KDX A;  1A8Y A;  3CYN A;  2MMA A;  4QL9 A;  3A5I A;  2LNT A;  5DCG A;  3O3T A;  1GSY A;  2BJX A;  2REM A;  2E2M A;  3SBC A;  1LU4 A;  1VF3 A;  4LLR A;  4PNG A;  3FR6 A;  2DIZ A;  2PMT A;  5D73 A;  2GGT A;  2R3X A;  5IMF A;  3APO A;  16GS A;  1GL8 A;  3HDC A;  1ZYP A;  1VF1 A;  4I2U A;  3GIX A;  3CTG A;  4YQV A;  4N0V A;  4EF0 A;  3L9U A;  1V57 A;  4KDY A;  5DBQ A;  1PN0 A;  2H72 A;  1TOF A;  3ED3 A;  4GCI A;  2M46 A;  4PXO A;  3IDV A;  2JAD A;  4IJI A;  4Q5Q A;  2MZC A;  5ECH B;  2RM5 A;  3KMN A;  1IYI A;  3UMA A;  5F07 A;  2FD3 A;  2XPE A;  1TI3 A;  1K3L A;  2HI7 A;  2IMF A;  2FWE A;  2HRA A;  5IMZ A;  3CRU A;  2ON7 A;  4HOJ A;  2F8F A;  5J3R A;  2J23 A;  5ID2 B;  2FWG A;  4ECC A;  1TI1 A;  2XBQ A;  5G5F A;  1SK0 A;  2JSZ A;  5ABR A;  3FZ4 A;  1KNG A;  3A5W A;  3D5J A;  1J08 A;  3CMI A;  4ZL8 A;  4Q5N A;  1GUK A;  1R5P A;  3S9F A;  2FWH A;  3MDK A;  2H76 A;  1ZZY A;  4PGT A;  3DD3 A;  1T7P B;  5DQS A;  1TRV A;  1B9Y C;  4KA0 A;  2R2J A;  3ZMK A;  1ST9 A;  2ZCT A;  5G31 A;  4K0G A;  2FWF A;  3RPN A;  1TK8 B;  1K0O A;  4O5Q A;  3H8Q A;  3R3E A;  2XHF A;  1MD3 A;  6GSY A;  1C72 A;  2VL2 A;  13GS A;  3CSJ A;  1XXU A;  3HA9 A;  4EKZ A;  1AXD A;  4EIP A;  1AQW A;  5D9T A;  7GSS A;  4MPF A;  3VWX A;  3HJP A;  4POB A;  3ZIV A;  2WZ9 A;  5DAL B;  2VL2 C;  1TRW A;  2HFD A;  2O89 A;  2DBC A;  3KTB A;  1OKD A;  4F82 A;  4YKG A;  22GS A;  3M0F A;  18GS A;  2WCI A;  1F6M C;  1EEJ A;  1JZR A;  2YCD A;  2K6V A;  4FYC A;  5IOX A;  1XIY A;  3GL3 A;  2BTO T;  5GSS A;  2B1L A;  1M2B A;  2O85 A;  17GS A;  4IQA A;  3R2Q A;  3UVH A;  2ES7 A;  1TK0 B;  3KTL A;  3HD5 A;  3MIX A;  5FHI A;  2HSY A;  2WFC A;  4PQH A;  2VL9 A;  2OAC A;  2WDU A;  4YKF A;  3QOU A;  5LD0 A;  2YOI A;  5J4U A;  1ERW A;  3VFI A;  1MDJ A;  1QUW A;  4HJM A;  3IK9 A;  3GKK A;  4OO5 A;  1WIK A;  3W8J A;  3I69 A;  5G1K A;  1KTE A;  3IRA A;  6GST A;  3HZ8 A;  1SKW B;  3QFB C;  2ALB A;  2OKA A;  1AC1 A;  3QR6 A;  3IPZ A;  4MLY A;  4DEJ A;  1K0D A;  1HQO A;  5A5K A;  2DIY A;  2JZT A;  2L59 A;  4X0X A;  3TKS A;  3FY7 A;  2R0P A;  2IFQ B;  4NMU A;  1DBY A;  3QAV A;  3NZN A;  3EWL A;  1XWB A;  3TJF A;  1QQ2 A;  3TJB A;  3HVS A;  2YAN A;  2YZU A;  6GSU A;  4MJA A;  3TKS C;  2JL4 A;  3QCP A;  3C1R A;  4HU7 A;  4LMV A;  4I5Q A;  1XOB A;  1EWX A;  2YWN A;  1M9B A;  2B7J A;  1NHO A;  3KM6 A;  4YQM A;  2LKU A;  5CAX A;  1A2L A;  4F03 A;  1M9A A;  1A0F A;  2YWM A;  5B7C A;  4KH7 A;  1GNE A;  5B6N A;  2VCX A;  1B4Q A;  5ECI B;  1JLV A;  4TOP A;  3TJJ A;  3TKS E;  5B8A A;  4JU5 A;  2I1U A;  2XBI A;  2GSS A;  3ERW A;  5EY6 A;  2H6X A;  3FW2 A;  1F9M A;  3HKR A;  1U87 A;  4TR1 A;  1Z5Y E;  2K8S A;  1OKT A;  4HS1 A;  3KXO A;  3U6V A;  1Z6N A;  2DSA A;  4PX1 A;  3VI7 A;  4F9Z A;  3L0H A;  2F8A A;  1O8W A;  2GQM A;  1WRY A;  4MK3 A;  2WS2 A;  1ABA A;  4ZBD A;  1X9M B;  5CRD A;  2C0E A;  5HQP A;  3EPT A;  2NPB A;  1TJD A;  1FVJ A;  4TW5 A;  4V1A g;  4MCU A;  5C04 A;  2HSH A;  1N8J A;  2JZR A;  2L57 A;  1ILO A;  1TTZ A;  2IMD A;  1ERU A;  4WF5 A;  4HZ4 A;  3F4S A;  2X64 A;  4BWQ A;  5DCH A;  3IV4 A;  3ZRD A;  2G0F A;  2H1G A;  2PVO C;  3DVW A;  4G0I A;  5ECS A;  3IC4 A;  2LQQ A;  1SJZ A;  2YP6 A;  1SD8 A;  2TRX A;  2NTO A;  3FZA A;  2CVB A;  4HJ2 A;  1GUM A;  2OAD A;  4TN8 A;  5J41 A;  1MDK A;  3HJM A;  2H6Z A;  2PN8 A;  3ZTL A;  4FO5 A;  2RLI A;  3F6F A;  3US3 A;  3GKM A;  4J56 E;  5ECL B;  1TKD B;  5JWQ B;  4WR4 A;  3GTU A;  3EU4 A;  2CX3 A;  1X9S B;  4KDU A;  4ILF A;  4PQI A;  2C8U A;  3UEM A;  4NHW A;  1K3Y A;  2A2S A;  1EV9 A;  1V9W A;  2H0H A;  3GUR A;  3UVT A;  3LSZ A;  3IBH A;  3ISO A;  1GSS A;  4EIQ A;  1F2E A;  2GZY A;  3F4R A;  1A8L A;  5JWR B;  5HR0 A;  2AUV A;  3MNG A;  3RBT A;  2KP2 A;  3GTU B;  4IVF A;  4HQZ A;  2VCV A;  1ML6 A;  5B6M A;  2PU9 C;  1FOV A;  3Q18 A;  3FZ9 A;  4PUA A;  2OBI A;  3HXS A;  4AF2 A;  4BVY B;  1WP0 A;  2VLT A;  1EP8 A;  1JLW A;  4HDE A;  4TR4 A;  5COH A;  3RDW A;  4H86 A;  1O8X A;  1XVW A;  4XHM A;  2C1Y A;  3VPQ A;  5H5S A;  5BMU A;  3LYK A;  2KLX A;  1RW1 A;  5HR1 A;  2I4A A;  1SU9 A;  2AB6 A;  1SK1 A;  2O87 A;  1Q4J A;  3FZ5 A;  3TGZ A;  4EDY A;  2CZ2 A;  1V40 A;  3MSZ A;  5A4V A;  1GTA A;  1ZYN A;  3P7X A;  3LOR A;  2VCT A;  1ON4 A;  2IN3 A;  1PL1 A;  2YWI A;  4XIH A;  3DWV A;  4LA1 A;  1XOA A;  1PGT A;  2VIM A;  1OC9 B;  2CT6 A;  4IHU A;  3UBK A;  2VM1 A;  4WET A;  3KEB A;  1SEN A;  2FUG 2;  2B5X A;  3GX0 A;  4KUN A;  4N0Z A;  2OA7 A;  5E4W A;  3GNJ A;  2V41 A;  3FR9 A;  4MPG A;  4Z2U A;  3QAG A;  3QFA C;  2YV7 A;  4EC0 A;  3ZVJ A;  2E2G A;  3EC3 A;  4LMW A;  2H70 A;  2R5G A;  1BED A;  1MDI A;  1SYR A;  4MZW A;  4P3Y B;  1BAY A;  4ULX A;  1Z6M A;  2LST A;  1CQH A;  1F3B A;  1T4Y A;  5ECP B;  2H1B A;  2DJK A;  5GAN D;  1ERV A;  2GQL A;  3IHQ A;  3ME7 A;  3ZFL A;  1E6B A;  4KE3 A;  2H01 A;  1K0B A;  1WJK A;  2L5O A;  1UC7 A;  1VF2 A;  2GTU A;  4CY8 A;  1EZK A;  3IA1 A;  5JWO B;  3EYT A;  4KGI A;  4XCS A;  2VD1 A;  3L4N A;  5KN2 A;  4XTS A;  3P8W A;  1K0C A;  4BL7 A;  1YEX A;  2P0G A;  5H5R A;  1S3C A;  3ZLP A;  3NOF A;  2NDO A;  2VOC A;  4DSS B;  1RK4 A;  4I6X A;  3M3M A;  2OJL A;  4IBP A;  4YH2 A;  3LJR A;  2QSI A;  1JFU A;  3ZL5 A;  1AUC A;  4IQ1 A;  3FYG A;  4NPB A;  1K0M A;  3MAK A;  1GTU A;  5IM9 A;  4BL7 B;  5IQY A;  1EP7 A;  4JR6 A;  1TU7 A;  5D8I A;  2HLS A;  2LTK A;  3UIW A;  5D96 A;  1ERT A;  1N2A A;  1TXX A;  2X99 A;  2H19 A;  3PR8 A;  3H4K A;  4O5R A;  4RQR A;  4RQX A;  4USS A;  1PQN A;  4NHZ A;  3ZML A;  2B5E A;  4WKW A;  4Z2T A;  3TRQ A;  1EOG A;  1GLQ A;  4IP6 A;  5A4U A;  2JU5 A;  4IN0 A;  2OE0 A;  9GSS A;  3LWA A;  5IO0 A;  1B9X C;  4KX4 A;  1GWC A;  4K7O A;  3FKF A;  1FO5 A;  3LW9 A;  2G2Q A;  2PUK C;  4F0B A;  1PKW A;  4KF9 A;  3P90 A;  5BRT A;  5G30 A;  1JZO A;  3E3E A;  2MBS A;  2LNS A;  4MNN A;  3W6G A;  3O6T A;  3J7Y b;  1URM A;  4ACS A;  2Z9S A;  5F8B A;  5GZZ B;  1QK8 A;  3A3T A;  3H79 A;  2HXK A;  3IC8 A;  2H71 A;  4GQF A;  14GS A;  1UA5 A;  1M2A A;  4WF4 A;  3FHK A;  2JZS A;  3EMP A;  3UBL A;  2LS5 A;  4IW9 A;  3LXT A;  4JR4 A;  3VLN A;  2YJ7 A;  1HNC A;  4I2T A;  3F8U A;  3VWV A;  2HSM A;  5ELG A;  4BA7 A;  2H73 A;  4JZQ A;  2DML A;  2PER A;  2YZH A;  4WR5 A;  3A2W A;  3HZ4 A;  1YF1 A;  4LL4 B;  4EUY A;  3QDN A;  4FH8 A;  4K2X A;  5FWG A;  3RPP A;  4JBB A;  4TXV A;  4I8B A;  3M9K A;  2MBT A;  2K9F A;  4ZB6 A;  1SD9 A;  3FEU A;  3ZRE A;  4DSQ A;  5HR3 A;  2IMK A;  2PPT A;  3BJ5 A;  4XRA A;  4FQU A;  2N5A A;  2X8H A;  1SK2 A;  2FNO A;  5DQY A;  2C3N A;  3ME8 A;  3D6I A;  1LJR A;  2MMZ A;  4BPY A;  4NWY A;  4PNF A;  4MJC A;  1V58 A;  3QAW A;  1PX6 A;  2ZNM A;  1BX9 A;  4KCE A;  1X9W B;  4N30 A;  5ECR B;  5EVO A;  3KP8 A;  1OYJ A;  2WJU A;  4F2I A;  1E2Y A;  5KN1 A;  2LJK A;  1FHE A;  4OO4 A;  2GS3 A;  3KZQ A;  1KBN A;  1T1V A;  3ZIJ A;  4POL A;  3GYK A;  2VAF A;  5ENU A;  4L8E A;  3UOM A;  4IJ3 A;  1XWC A;  3GHA A;  5AIX A;  5ECK B;  1FVK A;  2LJA A;  5B8B A;  4OD7 A;  2EIO A;  5ECM B;  2GQK A;  4K8M A;  2F3M A;  4ECJ A;  5JCG A;  3IR4 A;  3RHC A;  1MTC A;  4MAB A;  1U3A A;  2H0G A;  3KD0 A;  5CP1 A;  4GWR A;  2P5R A;  1M2D A;  2A2P A;  3CSI A;  2UZ8 A;  1PN9 A;  2LQO A;  3VI5 A;  3ZIT A;  3PIN A;  1Y25 A;  1O85 A;  1KEB A;  2QGV A;  19GS A;  3CRT A;  3EIN A;  2HT9 A;  20GS A;  3ZYW A;  3DIE A;  2QKE A;  5LNK e;  4ECB A;  1YQ1 A;  4GF0 A;  2X8G A;  3A2X A;  4ZXG A;  2L4C A;  5ECQ B;  3G7I A;  4GQC A;  3PGT A;  4YAP A;  1Z7R A;  1I5G A;  2R6K A;  3IOS A;  4V2N A;  5D9V A;  3IK7 A;  3WGX A;  6GSV A;  1V2A A;  2OE1 A;  2KUC A;  4EXJ A;  3EMX A;  4ZIL A;  3I43 A;  2H1A A;  2TIR A;  4GRF A;  1T3B A;  3LEF A;  3DKS A;  4ML1 A;  1HNA A;  3VWU A;  2C0F A;  2YWO A;  1PMT A;  4TR1 B;  3PH9 A;  3FK8 A;  6GSX A;  2D2Z A;  4GSS A;  8GSS A;  2AJQ B;  2IWT A;  5G1L A;  2MYG A;  1RQM A;  4EL1 A;  3I6A A;  5A4W A;  4WBJ A;  1YJ6 A;  3TKQ A;  2V6O A;  2NVL A;  1BG5 A;  2N5F A;  2VL3 A;  2YNX A;  3MYD A;  4YAV A;  4HZ2 A;  4ISD A;  3BCK A;  2L6D A;  4XS1 A;  1PL2 A;  4XS4 A;  2V1M A;  1QXH A;  1WE0 A;  2R0C A;  4L5O A;  1XWK A;  1S3A A;  3GRX A;  2EC4 A;  3ZVJ D;  4J2F A;  5ECN B;  3KP9 A;  1ZCP A;  3KGK A;  2V32 A;  4GLT A;  4IS0 A;  2DKH A;  3TRX A;  1SL1 B;  2E0Q A;  2L4Q A;  1GTI A;  2OE3 A;  4MF6 A;  4EDZ A;  1Q98 A;  4V1A p;  4XS4 B;  2ZUP A;  2H6Y A;  1TRS A;  1XCC A;  1EGR A;  5HR2 A;  3BOA A;  3G7Y A;  4TKY A;  1X5E A;  3DVX A;  3EUR A;  3WGD A;  4MMM A;  3G9B A;  1B8X A;  3FR3 A;  3KH9 A;  3FRC A;  1Y6E A;  4MZB A;  2EIR A;  1O7U A;  3GL5 A;  4F0C A;  2CZ3 A;  1K0A A;  5EL8 A;  3WYW A;  1YY7 A;  3DEX A;  3EVI A;  2FCH A;  4V2L A;  3I9V 2;  4G19 A;  1WWJ A;  1G0T A;  3W8S A;  3E0U A;  3D22 A;  2NBS A;  4E8E A;  1GSD A;  4A5P A;  5G5E A;  5DDL A;  1GP1 A;  1R5A A;  4XRD A;  2DLX A;  3RAZ A;  1FG4 A;  1YEP A;  3GSS A;  2IL3 A;  2MMO A;  5KN0 A;  2M72 A;  4GST A;  1U88 A;  3Q6O A;  2HE3 A;  5HFI A;  4WBR D;  5L71 A;  2GSQ A;  2B3S A;  3GX8 A;  2HZE A;  2IME A;  3WD6 A;  2CX4 A;  1ZL9 A;  2YJH A;  3D4M A;  4POM A;  1MD4 A;  1Z7P A;  1XBS A;  3VK9 A;  5KOX A;  3KIJ A;  2A2R A;  4KND A;  2B7K A;  1SYX A;  4HUA A;  1XWG A;  1GNW A;  1YKC A;  1G6W A;  5ELA A;  2F9S A;  4NAX A;  3HJO A;  2BMX A;  4ZL7 A;  1HYU A;  3H93 A;  1XZO A;  1TU8 A;  3HCZ A;  4HU9 A;  4X1U A;  4ICY A;  1ZMA A;  3QPM A;  1EOH A;  1O6J A;  1FB6 A;  2KP1 A;  2B5Y A;  1WOU A;  2PVQ A;  4K2D A;  1R4W A;  5IMC A;  2CA8 A;  1EGO A;  2RUE A;  4OFN A;  1H4O A;  3DRN A;  1FB0 A;  3F6D A;  5CRW A;  1THO A;  2GDR A;  1XWA A;  5D9X A;  4IGJ A;  3JCM L;  2GT5 A;  1G7E A;  2LRN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...