1A8YA

Crystal structure of calsequestrin from rabbit skeletal muscle sarcoplasmic reticulum at 2.4 a resolution
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
345
structure length
338
Chain Sequence
GLDFPEYDGVDRVINVNAKNYKNVFKKYEVLALLYHEPPEDDKASQRQFEMEELILELAAQVLEDKGVGFGLVDSEKDAAVAKKLGLTEEDSIYVFKEDEVIEYDGEFSADTLVEFLLDVLEDPVELIEGERELQAFENIEDEIKLIGYFKNKDSEHYKAFKEAAEEFHPYIPFFATFDSKVAKKLTLKLNEIDFYEAFMEEPVTIPDKPNSEEEIVNFVEEHRRSTLRKLKPESMYETWEDDMDGIHIVAFAEEADPDGYEFLEILKSVAQDNTDNPDLSIIWIDPDDFPLLVPYWEKTFDIDLSAPQIGVVNVTDADSVWMEPSAEELEDWLEDVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Calcium-binding protein
molecule keywords CALSEQUESTRIN
publication title Crystal structure of calsequestrin from rabbit skeletal muscle sarcoplasmic reticulum.
pubmed doi rcsb
total genus 87
structure length 338
sequence length 345
ec nomenclature
pdb deposition date 1998-03-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1a8yA03
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1a8yA01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1a8yA02
4ZBBA 2E0QA 2LJAA 4WF5A 2YWMA 5IIZA 4XS4B 4MJAA 2QGVA 4WBJA 4GQFA 3FY7A 3ME8A 2R5GA 3QFAC 5DJLA 5EL8A 3GN3A 2WGRA 2CX3A 4ID0A 4XS6A 2FD3A 3QAWA 5KN0A 1HNCA 3HY2A 5ECNB 2BTOT 4ECBA 2VCWA 17GSA 1GSDA 1B9XC 20GSA 1GUHA 1EP8A 3RBTA 3US3A 4TOPA 3IC4A 3KH7A 4POKA 2JSZA 3C7MA 5AN1A 5DJMA 1PKZA 2C0DA 4IVFA 4GSNA 1ERUA 4HQSA 5CO3A 4HU9A 2JZTA 4V2MA 4RI6A 1QGVA 2HRFA 2IFQA 1T1VA 4GRFA 1FG4A 2DIZA 5ECLB 2DJJA 1HNBA 1MDKA 2H76A 1N8JA 1IYIA 2XC2A 5A4WA 2LSTA 2ZCTA 2EC4A 3F0IA 5DQYA 4AF2A 2O87A 4MK3A 3P2AA 1YZXA 3CSIA 3FR9A 1SKSB 4CHSA 2J23A 1NW2A 4MABA 4XIHA 4RUVA 1T00A 4HEA2 5G1KA 4LL4B 2CV4A 3Q74A 1SL2B 5G30A 2PWJA 4BPYA 3UOMA 1U6TA 5D9VA 5ID2A 3EYTA 1SK0A 4EVMA 1OAZA 1MD3A 1JFUA 1GNEA 3PR8A 5G5EA 1AAZA 1A8LA 1JZDA 5EVOA 3D6IA 5GAPD 4FH8A 2WDUA 5HR2A 2WULA 5IQYA 5DAKB 1Z9HA 3FW2A 3L0HA 1QXHA 5AIXA 2G0FA 1OE8A 3HA9A 4NPBA 4Q5RA 1YKAA 3ZTLA 3LWAA 1PSQA 4O5RA 3W6GA 2PN8A 1BQ7A 1ERWA 5J41A 4G19A 2VL2C 4RI7A 5EPFA 2MMOA 2GLRA 3F4SA 4YQVA 2YOIA 1B4QA 4ZIJA 3D4MA 1G6YA 3M0FA 3BCIA 3MAKA 3GNJA 2OACA 3L9UA 2HZFA 4BA7A 1ZL9A 4TR0A 1J9BA 2K6VA 1K3YA 1W89A 4MA9A 4TRXA 1X9MB 3W8SA 1USBA 2RM5A 2PPTA 1A2MA 1K0BA 3UEMA 3F9UA 4AJ7A 2VD1A 2HFDA 1OC9A 4WEYA 3CRUA 5ECRB 3SWLA 2DIYA 3GX8A 2VLTA 3Q19A 5HFGA 5G31A 4ML1A 4WXTA 3KXOA 1JZRA 1K0CA 4I97A 3ZFLA 3H79A 2JACA 3KGKA 1YEPA 5IM9A 2P0GA 1V57A 4PQIA 3TKPA 4JU5A 3GX0A 12GSA 1TI3A 2IMEA 2PUKC 2H70A 4BVYA 2PERA 5D96A 3VPTA 4ECCA 4XRAA 4G2EA 3ZZXA 1AQVA 2CX4A 3GRXA 4IN0A 1A23A 2X8HA 3KJYA 3M9KA 1U88A 3VWXA 4ZL9A 1YY7A 2BMXA 9GSSA 3TJGA 4F2IA 2H6XA 2M72A 2YANA 3C1RA 2HXKA 1XVQA 1GL8A 2DLXA 3ERFA 2LRNA 1K0NA 2H74A 4PNFA 3APSA 1SKRB 1R4WA 1ZCPA 4K0NA 4IQAA 4JE1A 3QAVA 4L0UA 1F37A 1R7HA 3DWVA 4N11A 1PGTA 2FY6A 2WCIA 1WWJA 5CRHA 3TJBA 4TR1A 2FCHA 3HDCA 1VF2A 4L0WA 2VO4A 2B3SA 2GZYA 4ECJA 3EU3A 1BYEA 1EGOA 4GSSA 5C04A 5B6NA 3A2WA 5JCWA 4MJCA 4PURA 3O3TA 1GTUA 1N2AA 4KCAA 2K9FA 3J7Yb 1GH2A 1PRXA 2L4CA 1ZYEA 3QR6A 2IIYA 3KMNA 3VFIA 1TTZA 4HOJA 1M2DA 2OJLA 3FZAA 3BBYA 4BL7A 3LGCA 1GUMA 1BX9A 2H1GA 2YWNA 2DJ3A 3IHQA 1DSBA 1SD9A 4HJMA 4Z7XA 3WT1A 2DJ0A 4OD7A 5IMAA 4LL1B 2GDRA 3TKQA 1GULA 1KTEA 1QFNA 1FB0A 3UL3A 4IGJA 4MZBA 2PVQA 3VLNA 2GVPA 4XCSA 2JADA 4KSMA 1ILOA 2LJRA 1PN9A 1OC9B 1TRUA 6GSTA 4PXOA 4Q5NA 1JLWA 1VRSD 2K8VA 2QSIA 1GTBA 1DE1A 1TW9A 1ERVA 5GSSA 1UA5A 1V9WA 1CQHA 3BOAA 5B8BA 2GSSA 2I9HA 2AAWA 2N5FA 1SENA 3H8QA 1A2LA 2PVOC 3M1GA 1XW5A 2IPAA 1MDJA 4XHMA 4KNDA 3CYNA 4KDXA 2H0IA 1FHEA 2C80A 4YAPA 5F06A 2GS3A 5A4UA 1FOVA 1U87A 2EIOA 5G1LA 4KA0A 1FAAA 3F4TA 4JZQA 3FR3A 3HD5A 2K8SA 4F9ZA 2C3QA 3KTBA 4I2TA 4MCUA 3E9JB 4ULXA 2HYXA 3ZRDA 5ENUA 5B6MA 1IYHA 5G2ZA 2O8VB 1Z6MA 2J9HA 3ERWA 4KE3A 1GP1A 2H01A 5ECSA 2FLSA 2L59A 2GQKA 3U5RE 3WD6A 1XW6A 2VM2A 3V1WA 3I6AA 1XBSA 5CAXA 1M0UA 3WGXA 4Q5QA 1TK8B 4KGIA 4K0GA 1OKDA 2ES7A 4IW9A 1AC1A 1G7OA 3HHVA 4OMVA 2DJ2A 4ZBAA 2RM6A 4WKWA 2KHPA 2YWIA 5DAKA 5DBQA 1TP9A 3KCMA 3LXTA 4HS1A 4GTUA 3KIJA 5ECKB 3UJ1A 5F05A 4GSTA 4K1FA 5JWOB 2LQOA 2ON5A 3FK8A 4GWRA 3F4RA 5IPHA 3P8WA 4NV2A 2FA8A 4IJIA 3ZVJD 2AUVA 1URMA 1MEKA 3FZ9A 1WP0A 2YV9A 4QL7A 1YJ6A 3BJ5A 6GSYA 3A2XA 4D73A 2VCTA 4OO4A 3DYRA 1TRSA 5HR3A 5IO2A 2JZRA 4HQZA 1MD4A 1XCCA 1PD21 1RW1A 2WB9A 2TRCP 1TI1A 2NTOA 1GLQA 3GIXA 4HDEA 3CBUA 5HFIA 2P5RA 3IOSA 4K7IA 2YNXA 3CSHA 1MTCA 3TJKA 3IR4A 3GURA 1XPVA 3LYKA 2TRXA 4ZB8A 3KP9A 5ECOB 3CTGA 2L57A 4WBRD 2ZUPA 1HYUA 5L71A 1QUWA 3VI7A 1BG5A 4GXZA 4ZB6A 1K0AA 5DCHA 4K7NA 4ZXGA 1PQNA 1QQ2A 4V1Ap 2MBSA 3HVSA 4O7HA 2R4VA 1WRYA 4KW6A 3LFLA 3ZMLA 3HJMA 3APOA 5DALA 4RQXA 1OE7A 3K8NA 2YV7A 2G2QA 4O32A 4IBPA 3BD2A 4TR3A 2FGXA 2XPEA 1JZOA 3QAGA 4J2FA 3PH9A 1F3AA 4EE0A 2XHFA 4CW9A 2I81A 4EKZA 1O81A 5H5RA 1Z5YE 5F0GA 4DSQA 3VWVA 3DXBA 2REMA 2NDOA 5DDLA 1UN2A 2CVBA 3IRAA 3D21A 3IA1A 3IAS2 4F0CA 2IMDA 2H1AA 4PQHA 1TJDA 22GSA 3ZVJA 1ZGNA 4PQ1A 3QD9A 4MPGA 2DBCA 3QMXA 4PNGA 1TK5B 2LNSA 4MH3A 5KN1A 4EUYA 5KEJA 3ZYWA 2GT5A 3VPQA 1EZKA 2LUSA 3GH9A 5DQSA 3WGEA 5JCGA 3W8JA 1TXXA 2L5LA 5D9XA 4N0ZA 2P31A 1B8XA 1ZOFA 1AUCA 1X9SB 3ZFBA 2MMNA 4DEJA 4TW5A 4KAEA 5E4WA 4PGTA 3GUSA 4NHZA 1I5GA 4KH7A 3I43A 5AISA 1QK8A 3TOUA 4KX4A 1H4OA 1JZWA 2CZ2A 3EMXA 4D73B 2LJKA 3GTUB 4OFNA 1SJ6A 4ACSA 2LQQA 4MDCA 2A2SA 4J57E 7GSSA 2LV3A 4TN8A 3UBKA 3UAPA 3TKSA 3TUEA 1HQOA 1GLPA 3KEBA 4KB3A 2CVDA 3L9SA 5HR1A 3DD3A 1GUKA 4MF5A 4HZ4A 4F03A 3D0ZA 3HZ8A 1O73A 1R26A 1S3CA 1TK0B 1TRWA 2A4VA 2IL3A 5ELGA 3A3TA 5D9WA 2Z9SA 1PA3A 1A24A 1SJZA 3DIEA 3AY8A 2AJQB 5CNWA 2L6DA 1T3BA 5HFKA 5J4UA 1JHBA 1Z7PA 1PL1A 1T7PB 2FHEA 3NIVA 5J9CA 4ECIA 2HZEA 1GRXA 3EC3A 3GYKA 3C1SA 2YJHA 5AIVA 2JL4A 2GSQA 2RIIA 5C00A 5DALB 2RLIA 1B9YC 5DCGA 4K9ZA 1XOAA 2OE3A 2HLSA 4EDYA 2K18A 2YZHA 3FZ4A 2V41A 5CRDA 3WT2A 2C0GA 4P3YB 3KTLA 2LTKA 6GSUA 4F82A 4JR4A 4IELA 3GKKA 2FWHA 4XS1A 2WJUA 2H1DA 3RPPA 4EC0A 4L5OA 2B6MA 2L5OA 3UMAA 1A0FA 5F07A 4IP6A 4O92A 1M2BA 2JU5A 1O8WA 2LRCA 4NMUA 3DVXA 1Y6EA 4KCEA 3I69A 3L4NA 2CT6A 2KP1A 2E2GA 2QKEA 1BJXA 4WF4A 3KZQA 4MP4A 4GQCA 1V98A 5E59A 1GTAA 2WS2A 3UBLA 3LJRA 5ABRA 1LJRA 5D73A 1AIUA 1YF0A 1R5AA 6GSVA 3QOUA 4KDUA 2DJ1A 2IMKA 3MWHA 3I9V2 2H73A 4I2UA 1V58A 1THOA 3EURA 1FB6A 4PUAA 3IBHA 2H8LA 2LRTA 2I1UA 2OADA 2V6OA 3TRQA 1OKTA 4KDYA 4BWQA 2DMMA 4N30A 2XBIA 3E3EA 1LBKA 4Q5FA 3HZ4A 4F0BA 4WR4A 3GA4A 1XXUA 5FT3A 2GSRA 18GSA 3IAM2 3TOTA 1Z6NA 1UC7A 1W4VA 2HSYA 1EEJA 2R2JA 3LYPA 4K8MA 2V6KA 1EGRA 3MNGA 2H0HA 1E6BA 3M3MA 1TOFA 1XFLA 2VCXA 2YCDA 4ZILA 3HJPA 2A2RA 3C73A 2B7JA 1GTIA 4IQ1A 1X5CA 4K7OA 1M9BA 4E8HA 2X8GA 3FKFA 4YQMA 19GSA 1VGLA 2GQMA 3GSSA 3A2VA 2O89A 1THXA 2C3NA 2HZEB 2OKAA 3FR6A 1T4ZA 4AGSA 1YEXA 1WOUA 1WPIA 1G7EA 1NM3A 4K2DA 4EDZA 1O6JA 3S9FA 1XIYA 2AB6A 1GSYA 1GSFA 2NVLA 5ECHB 1SYRA 1PX6A 3HJOA 1AW9A 3ME7A 1SL0B 13GSA 3ZIVA 1F3BA 1S3AA 2C4JA 4QL9A 1BAYA 3D22A 4JR6A 3HYPA 3ISOA 2E2MA 3CTFA 4MPFA 2OE0A 4NXIA 1AQXA 2PMTA 3UVHA 1LU4A 3TRXA 2CVKA 1EV4A 4TXOA 3DGQA 2IN3A 1XW9A 5J9BA 1MDIA 4KSOA 1DUGA 3JCML 3Q18A 2MMAA 2RUEA 3O6TA 2VCVA 1V2AA 3G9BA 5G5FA 3G7YA 4OCFA 5HQPA 2H71A 1SK2A 4I6XA 2VIMA 4E8EA 3TKSE 2B1KA 2XPDA 1DBYA 4OFMA 2PBJA 5FHIA 2L6CA 4LMWA 4YQUA 2VCZA 3GKXA 4POMA 4IP1A 1KEBA 3IK7A 2ALBA 2LNTA 3R2QA 4AJ6A 2MYGA 2DSAA 4OCEA 3GMFA 2H19A 4POLA 1F6MC 2FNOA 1NHOA 1ON4A 2OBKA 2JZSA 2HT9A 1F2EA 4POBA 5JWQB 4EF0A 2D2ZA 5ELAA 5CRWA 2R37A 5DVBA 1RK4A 5IMCA 2B5EA 4I5QA 3GKMA 3H4KA 1AQWA 4H86A 1OC3A 1YQ1A 3ZIJA 3ZMKA 4PX1A 3GTUA 1EOGA 4X0XA 5D93A 5COHA 2FWFA 3DRNA 3WYWA 4DSSA 2IMFA 1SD8A 1NSWA 3GFKA 5LD0A 3LEFA 3L9VA 2DC5A 1WIKA 3IDVA 2E7PA 1O85A 3VURA 1X5DA 5IMVA 3KP8A 3TKSC 1E2YA 3ERGA 4YAVA 2CA8A 1U3AA 2OE1A 2VM1A 1TU7A 4PUFC 2O7KA 3OR5A 2OA7A 1GSEA 4NV5A 5KN3A 5ECQB 2JSYA 10GSA 1ERTA 4TXVA 3GSTA 1FO5A 2DJKA 1G0TA 1SYXA 3E0UA 11GSA 3IXRA 2KP2A 8GSSA 4OO5A 4G10A 5GZZB 1GNWA 3F6DA 2VCQA 1OVNA 1ZMAA 1A8YA 3ZL5A 2F8FA 4K6XA 1J0FA 4L8EA 4MF7A 3EINA 1SKWB 1XOBA 2YPMA 4ZL8A 2M46A 2H75A 2VD0A 4MLYA 4TXOB 5B7CA 3HVXA 3NOFA 2H30A 3CSJA 4JBBA 1Q4JA 2C0EA 2DMLA 1CQGA 3RPNA 2N5AA 4IHUA 3HCZA 4ISDA 4GF0A 1VF1A 4BWSA 1X0RA 3DKSA 3TB2A 1ABAA 1M99A 3EVIA 5H5QA 2MMZA 2FWEA 2BJXA 5KN2A 2C3TA 2EIQA 3FHKA 1OYJA 3GHAA 3FZ5A 2XBQA 1GSSA 5CRGA 3TRPA 4HZ2A 2O85A 3MSZA 5J5NA 2N5BA 2VLUA 4LA1A 2FUG2 2F3MA 2C0FA 4XRDA 3QDNA 5IMFA 3DVWA 3N9JA 1RQMA 4MZWA 1SK1A 2HNLA 2P5QA 1Z7RA 1Y25A 2GZPA 1F9MA 1ML6A 2H6ZA 4X1UA 2F8AA 4OFTA 2HE3A 1Q98A 1GSUA 1SJIA 3APQA 2V32A 4DSSB 2ON7A 3J7Yk 3LSZA 5ECPB 3FRCA 2IJYA 3ZITA 3L78A 3RDWA 3QPMA 2NBSA 2KLXA 2AYTA 2H66A 1J08A 1H75A 3D5JA 1A0RP 5IOXA 4YH2A 3EWLA 2B5XA 1I9DA 5CYYA 2L4QA 2YN1A 4CDOA 3ZREA 3RHCA 2C8UA 3UARA 1XWBA 3EMPA 3G7JA 1TDIA 2LKUA 2MBTA 1AXDA 4RQRA 4ZBDA 1Z3EA 4EL1A 4L5LA 4IJ3A 3F8UA 2VAFA 4NAXA 4BVXA 4IS0A 1TRVA 5CP1A 5D8IA 5B8AA 5A4VA 4TKYA 1WJKA 4I8BA 3HVVA 5GSTA 3TCOA 3IV4A 4V1Ag 3HKRA 3LXZA 1M9AA 3C71A 4ZB9A 2IFQB 1S3DA 3GV1A 2X99A 2KUCA 3CRTA 3P90A 4J56E 2HI7A 1SU9A 1HNAA 4FIWA 3M8NA 4MF6A 1XVWA 3BCKA 1WE0A 4NHWA 5IMZA 2IWTA 4N0VA 4FYCA 3VWUA 4OWYA 6GSSA 4LLRA 1UVZA 2VUPA 3KD0A 6GSXA 4WR5A 1BEDA 4MJEA 4FO5A 2IMIA 2MZCA 2QC7A 2FA4A 1XWKA 1K0OA 5INYA 1HD2A 4GCIA 3SBCA 1K3OA 3QFBC 1ACVA 1OC8A 2FWGA 4ZL7A 3WGDA 2H1BA 5ID2B 1GWCA 2GT6A 1M2AA 2C1YA 4N10A 3NZNA 3IE3A 1EWXA 4HU7A 1XWAA 2AV4A 2CAQA 3EE2A 1DE2A 4TVEA 3HXSA 4G9HA 1B4PA 2X64A 4XTSA 3C8EA 4X43A 1PX7A 3DEXA 2F51A 2GSTA 1JLVA 3VK9A 2GQLA 1R5PA 5JCUA 2VL2A 4DVCA 14GSA 1ST9A 2CZ3A 2H0GA 3LORA 3LQ7A 1EV9A 5F8BA 3G7IA 1YF1A 2M80A 3KH9A 4LMVA 3D4TA 4MZCA 2GTUA 4QQ7A 3O76A 1ZZYA 4NWYA 4V2NA 1TKDB 4MJBA 3EU4A 3TJJA 6GSWA 1FVJA 2TIRA 1C72A 2YZUA 2AHEA 2PU9C 3IK9A 1PL2A 4ILFA 3KMOA 4XS4A 4GLTA 3H1NA 5A5KA 1T8EB 1B48A 5IO0A 3RAZA 1WMJA 2WRTA 2R6KA 2H72A 1EEMA 1XZOA 2VLVA 4HUAA 2VL9A 3GKNA 4IKHA 2OBIA 2RUFA 1VF4A 2YJ7A 4ML6A 2ZNMA 3TKRA 2VOCA 3PGTA 16GSA 3Q6OA 3MDKA 2WFCA 4AJ8A 1O7UA 1A2JA 5IMDA 4FYUA 4DSRA 2PGTA 2YP6A 1VF3A 4TR4A 2H6YA 3F6FA 2GGTA 1K0DA 1V40A 3F3QA 3VI5A 1XWCA 2I4AA 3LG6A 3F3RA 3FYGA 2WZ9A 1GSQA 5JWRB 3F63A 1PMTA 3ZLPA 5IPGA 5ECIB 5FWGA 4HI7A 1YKCA 1NHYA 2NPBA 3TDGA 4JEDA 1U3IA 2B7KA 1O8XA 3KM6A 3ED3A 3CXGA 3H93A 3TGZA 2HRNA 4MMMA 3M9JA 4EO3A 5IOWA 2V2GA 2F9SA 3GL3A 2R3XA 1K3LA 1KBNA 3U6VA 5D9TA 3A5WA 2LEGA 5ECMB 5GAND 4FYBA 5LCZA 1QMVA 1ZYQB 3GL5A 2CQ9A 3CMIA 3GH6A 3N5OA 2YWOA 1EOHA 1TU8A 3UVTA 2LS5A 3QCPA 3UIWA 4TR1B 1SL1B 4MH2A 4HJ2A 1FW1A 1KNGA 2KOKA 1X5EA 3FEUA 3P7XA 1XWGA 4V2LA 5J3RA 5LNKe 3VWWA 3RHBA 1EP7A 1M7TA 4KUNA 2I3YA 3PINA 1PKWA 1FVKA 1X9WB 5AGYA 5HR0A 5EY6A 2B1LA 4WETA 2X8CA 2CAIA 1YDKA 2VL3A 1T4YA 4EXJA 1G6WA 2HSHA 3DMLA 2V1MA 2EIRA 2B5YA 1K0MA 5CREA 3IPZA 5H5SA 4JRRA 2GZZA 3TJFA
chains in the Genus database with same CATH superfamily
4ZBBA 2E0QA 2LJAA 4WF5A 2YWMA 5IIZA 4XS4B 4MJAA 2QGVA 4WBJA 4GQFA 3FY7A 3ME8A 2R5GA 3QFAC 5DJLA 5BRTA 5EL8A 3GN3A 2WGRA 2CX3A 4ID0A 4XS6A 2FD3A 3QAWA 5KN0A 1HNCA 3HY2A 5ECNB 2A4HA 2BTOT 4ECBA 2VCWA 17GSA 1GSDA 1B9XC 20GSA 1GUHA 1EP8A 3RBTA 3US3A 4TOPA 3IC4A 3KH7A 4POKA 2JSZA 3C7MA 5AN1A 5DJMA 1PKZA 2C0DA 4IVFA 4GSNA 1ERUA 4HQSA 5CO3A 4HU9A 2JZTA 4V2MA 4RI6A 1QGVA 2HRFA 2IFQA 1T1VA 4GRFA 1FG4A 2DIZA 5ECLB 2DJJA 1HNBA 1MDKA 2H76A 1N8JA 1IYIA 2XC2A 5A4WA 2LSTA 2ZCTA 2EC4A 3F0IA 5DQYA 4AF2A 2O87A 4MK3A 3P2AA 1YZXA 3CSIA 3FR9A 1SKSB 4CHSA 2J23A 1NW2A 4ICYA 4MABA 4XIHA 4RUVA 1T00A 4HEA2 5G1KA 4LL4B 2CV4A 3Q74A 1SL2B 5G30A 2PWJA 4BPYA 3UOMA 4MNNA 1U6TA 5D9VA 5ID2A 3PPUA 3EYTA 1SK0A 4EVMA 1OAZA 1MD3A 1JFUA 1GNEA 3PR8A 5G5EA 1AAZA 1A8LA 1JZDA 5EVOA 3D6IA 5GAPD 4FH8A 2WDUA 5HR2A 2WULA 5IQYA 5DAKB 1Z9HA 3FW2A 3L0HA 1QXHA 5AIXA 2G0FA 1OE8A 3HA9A 4NPBA 4Q5RA 1YKAA 3ZTLA 3LWAA 1PSQA 4O5RA 3W6GA 2PN8A 1BQ7A 1ERWA 5J41A 4G19A 2VL2C 4RI7A 5EPFA 2MMOA 2GLRA 3F4SA 4YQVA 1FOHA 2YOIA 1B4QA 4ZIJA 3D4MA 1G6YA 3M0FA 3BCIA 3MAKA 3GNJA 2OACA 3L9UA 2HZFA 4BA7A 1ZL9A 4TR0A 1J9BA 2K6VA 1K3YA 1W89A 4MA9A 4TRXA 1X9MB 3W8SA 1USBA 2RM5A 2PPTA 1A2MA 1K0BA 3UEMA 3F9UA 4AJ7A 2VD1A 4G0LA 4BIKA 2HFDA 1OC9A 4WEYA 3CRUA 5ECRB 3SWLA 1S3RA 2DIYA 3GX8A 2VLTA 3Q19A 5HFGA 5G31A 4ML1A 4WXTA 4G0KA 3KXOA 1JZRA 1XG8A 1K0CA 4I97A 3ZFLA 3H79A 2JACA 3KGKA 4PTSA 1YEPA 5IM9A 2P0GA 1V57A 4PQIA 3TKPA 4JU5A 2HSMA 3GX0A 12GSA 1TI3A 2IMEA 2PUKC 2H70A 4BVYA 2PERA 3EPTA 5D96A 3VPTA 4ECCA 4XRAA 4G2EA 3ZZXA 1AQVA 2CX4A 3GRXA 4IN0A 1A23A 2X8HA 3KJYA 3M9KA 1U88A 3VWXA 4ZL9A 1YY7A 2BMXA 3MIXA 9GSSA 3TJGA 4F2IA 2H6XA 2M72A 2YANA 3C1RA 2HXKA 1XVQA 1GL8A 2DLXA 3ERFA 2LRNA 1K0NA 2H74A 4PNFA 3APSA 1SKRB 1R4WA 1ZCPA 4K0NA 4IQAA 4JE1A 3QAVA 4L0UA 1F37A 1R7HA 3DWVA 4N11A 1PGTA 2FY6A 2WCIA 1WWJA 5CRHA 3TJBA 4TR1A 2FCHA 3HDCA 1VF2A 4L0WA 2VO4A 2B3SA 2GZYA 4ECJA 3EU3A 1BYEA 1EGOA 4GSSA 5C04A 5B6NA 3A2WA 5JCWA 4MJCA 4PURA 3O3TA 1GTUA 1N2AA 4KCAA 2K9FA 3J7Yb 1GH2A 1PRXA 2L4CA 1ZYEA 3QR6A 2IIYA 3KMNA 3VFIA 1TTZA 4HOJA 1M2DA 2OJLA 3FZAA 3BBYA 4BL7A 3LGCA 1GUMA 1BX9A 3IC8A 2H1GA 2YWNA 2DJ3A 3IHQA 1DSBA 1SD9A 4HJMA 4Z7XA 3WT1A 2DJ0A 4OD7A 5IMAA 4LL1B 2GDRA 4O5UA 3R3EA 3TKQA 1GULA 1KTEA 1QFNA 1FB0A 4YKFA 3UL3A 4IGJA 4MZBA 2PVQA 3VLNA 2GVPA 4XCSA 2JADA 4KSMA 1ILOA 2LJRA 1PN9A 1OC9B 1TRUA 6GSTA 4PXOA 4Q5NA 1JLWA 4KF9A 1VRSD 2K8VA 2QSIA 1GTBA 1DE1A 1TW9A 1ERVA 5GSSA 1UA5A 1V9WA 1CQHA 3BOAA 5B8BA 2GSSA 2I9HA 2AAWA 2N5FA 1SENA 3H8QA 1A2LA 2PVOC 2DKHA 3M1GA 1XW5A 2IPAA 1MDJA 4XHMA 4KNDA 4BVYB 3CYNA 4KDXA 2H0IA 1FHEA 4CY6A 2C80A 4YAPA 5F06A 2GS3A 2QA1A 5A4UA 1FOVA 1U87A 2EIOA 5G1LA 4KA0A 1FAAA 3F4TA 4JZQA 3FR3A 3HD5A 2K8SA 4F9ZA 5KOXA 2C3QA 3KTBA 4I2TA 4MCUA 3E9JB 4ULXA 2HYXA 3ZRDA 5ENUA 5B6MA 1IYHA 5G2ZA 2O8VB 1Z6MA 2J9HA 3ERWA 4KE3A 1GP1A 2H01A 5ECSA 2FLSA 2L59A 2GQKA 3U5RE 3WD6A 1XW6A 2VM2A 3V1WA 3I6AA 1XBSA 5CAXA 1M0UA 3WGXA 4Q5QA 1TK8B 4KGIA 4K0GA 1OKDA 2ES7A 4IW9A 1AC1A 1G7OA 3HHVA 4OMVA 2DJ2A 4ZBAA 2RM6A 4WKWA 2KHPA 2YWIA 5DAKA 5DBQA 1TP9A 3KCMA 3LXTA 4HS1A 4GTUA 3KIJA 5ECKB 3UJ1A 5F05A 4GSTA 4K1FA 4CY8A 5JWOB 2LQOA 2ON5A 3FK8A 4GWRA 3F4RA 5IPHA 3P8WA 4NV2A 2FA8A 4IJIA 3ZVJD 2AUVA 1URMA 1MEKA 3FZ9A 1WP0A 2YV9A 4QL7A 1YJ6A 3BJ5A 6GSYA 3A2XA 4D73A 2VCTA 4OO4A 3DYRA 1TRSA 5HR3A 5IO2A 2JZRA 4HQZA 1MD4A 1XCCA 1PD21 1RW1A 2WB9A 2TRCP 1TI1A 2NTOA 1GLQA 3GIXA 4HDEA 3CBUA 3LW9A 5HFIA 2P5RA 3IOSA 4K7IA 2YNXA 3CSHA 1MTCA 3TJKA 3IR4A 3GURA 1XPVA 3LYKA 2TRXA 4ZB8A 3KP9A 1ZYPA 5ECOB 2X4AA 3CTGA 2L57A 4WBRD 4HSCX 2ZUPA 1HYUA 5L71A 1QUWA 3VI7A 1BG5A 4GXZA 4ZB6A 1K0AA 4K5RA 5DCHA 4O5QA 4K7NA 4ZXGA 1PQNA 1QQ2A 4V1Ap 2MBSA 3HVSA 4O7HA 2R4VA 1WRYA 4KW6A 3LFLA 3ZMLA 3HJMA 3APOA 5DALA 4RQXA 1OE7A 3K8NA 2YV7A 2G2QA 4O32A 4EIQA 4IBPA 3BD2A 4TR3A 2FGXA 2XPEA 1JZOA 3QAGA 4J2FA 3PH9A 1F3AA 4EE0A 2XHFA 4CW9A 2I81A 4EKZA 1O81A 5H5RA 1Z5YE 5F0GA 4DSQA 3VWVA 3DXBA 2REMA 2NDOA 5DDLA 1UN2A 2CVBA 3IRAA 3D21A 3IA1A 3IAS2 4F0CA 2IMDA 2H1AA 4PQHA 1TJDA 22GSA 3ZVJA 1ZGNA 4PQ1A 3QD9A 4MPGA 2DBCA 1M3IA 3QMXA 4PNGA 1TK5B 2LNSA 4MH3A 5KN1A 4EUYA 5KEJA 3ZYWA 2GT5A 3VPQA 1EZKA 2LUSA 3GH9A 5DQSA 3WGEA 5JCGA 3W8JA 1TXXA 2L5LA 5D9XA 4N0ZA 2P31A 2X49A 1B8XA 1ZOFA 1AUCA 1X9SB 3ZFBA 2MMNA 4DEJA 4TW5A 4KAEA 5E4WA 4PGTA 3GUSA 4NHZA 1I5GA 4KH7A 3I43A 5AISA 1QK8A 3TOUA 4KX4A 1H4OA 1JZWA 2CZ2A 3EMXA 4D73B 2LJKA 3GTUB 4OFNA 1SJ6A 4ACSA 2LQQA 4MDCA 2A2SA 4J57E 7GSSA 2LV3A 2R0PA 4TN8A 3UBKA 3UAPA 3TKSA 3TUEA 1HQOA 1GLPA 3KEBA 4KB3A 2CVDA 3L9SA 5HR1A 3DD3A 1GUKA 3A5IA 4MF5A 4HZ4A 4F03A 3D0ZA 3HZ8A 1O73A 1R26A 1S3CA 1TK0B 1TRWA 4X4JA 2A4VA 2IL3A 5ELGA 3A3TA 5D9WA 2Z9SA 1PA3A 1A24A 1SJZA 3DIEA 3AY8A 2AJQB 5CNWA 2L6DA 1T3BA 5HFKA 5J4UA 1JHBA 1Z7PA 1PL1A 1T7PB 2FHEA 3NIVA 5J9CA 4ECIA 2HZEA 1GRXA 3EC3A 4FQUA 3GYKA 3C1SA 2YJHA 5AIVA 2JL4A 2GSQA 2RIIA 5C00A 5DALB 2RLIA 1B9YC 5DCGA 4K9ZA 1XOAA 2OE3A 2HLSA 4EDYA 2K18A 2YZHA 3FZ4A 2V41A 5CRDA 3WT2A 2C0GA 4P3YB 3KTLA 2LTKA 6GSUA 4F82A 4JR4A 4IELA 3GKKA 2FWHA 4XS1A 2WJUA 2H1DA 3RPPA 4EC0A 4L5OA 4Z2RA 2B6MA 2HRAA 2L5OA 3UMAA 1A0FA 5F07A 4IP6A 4O92A 1M2BA 2JU5A 1O8WA 2LRCA 4NMUA 3DVXA 1Y6EA 4KCEA 3I69A 4Z2TA 3L4NA 2CT6A 2KP1A 2E2GA 2QKEA 1BJXA 4WF4A 3KZQA 4MP4A 4GQCA 1V98A 5E59A 1GTAA 2WS2A 3UBLA 3LJRA 5ABRA 1LJRA 5D73A 1AIUA 1YF0A 1R5AA 6GSVA 3QOUA 4KDUA 2DJ1A 2IMKA 3MWHA 3I9V2 2H73A 4I2UA 1V58A 3IHGA 1THOA 3EURA 1FB6A 4PUAA 3IBHA 2H8LA 2LRTA 2I1UA 2OADA 1PFOA 2V6OA 3TRQA 1OKTA 4KDYA 4BWQA 2DMMA 4N30A 2XBIA 3E3EA 1LBKA 4Q5FA 3HZ4A 4F0BA 4WR4A 3GA4A 1XXUA 5FT3A 2GSRA 18GSA 3IAM2 3TOTA 1Z6NA 1UC7A 1W4VA 2HSYA 1EEJA 2R2JA 3LYPA 4K8MA 2V6KA 1EGRA 3MNGA 2H0HA 2R0GA 1E6BA 3M3MA 1TOFA 1XFLA 2VCXA 2YCDA 4ZILA 3HJPA 2A2PA 2A2RA 3C73A 2B7JA 1GTIA 5BMUA 4IQ1A 1X5CA 4K7OA 1M9BA 4E8HA 2X8GA 3FKFA 4YQMA 19GSA 1VGLA 2GQMA 3GSSA 3A2VA 2O89A 1THXA 2C3NA 2HZEB 2OKAA 3FR6A 1T4ZA 4AGSA 1YEXA 1WOUA 1WPIA 1G7EA 1NM3A 4K2DA 4EDZA 1O6JA 3S9FA 1XIYA 2AB6A 1GSYA 1GSFA 2NVLA 5ECHB 4Z2UA 1SYRA 1PX6A 3HJOA 1AW9A 3ME7A 1SL0B 2DKIA 13GSA 5KOWA 3ZIVA 1F3BA 1S3AA 2C4JA 4QL9A 1BAYA 3D22A 4JR6A 3HYPA 3ISOA 2E2MA 3CTFA 4MPFA 2OE0A 4NXIA 1AQXA 2PMTA 1M3JA 3UVHA 1LU4A 3TRXA 2CVKA 1EV4A 4TXOA 3DGQA 2IN3A 1XW9A 5J9BA 1MDIA 4KSOA 1DUGA 3JCML 3Q18A 2MMAA 2RUEA 3O6TA 2VCVA 1V2AA 3G9BA 5G5FA 3G7YA 4OCFA 5HQPA 2H71A 1SK2A 4I6XA 2VIMA 4E8EA 3TKSE 2B1KA 2XPDA 1DBYA 4OFMA 2PBJA 5FHIA 2L6CA 4LMWA 4YQUA 2VCZA 3GKXA 4POMA 4IP1A 1KEBA 3IK7A 2ALBA 2LNTA 3R2QA 4AJ6A 2MYGA 2DSAA 4OCEA 3GMFA 2H19A 4POLA 1F6MC 2FNOA 1NHOA 1ON4A 2OBKA 2JZSA 2HT9A 1F2EA 4POBA 5JWQB 4EF0A 2D2ZA 5ELAA 5CRWA 2R37A 5DVBA 1RK4A 5IMCA 2B5EA 4I5QA 3GKMA 3H4KA 1AQWA 4H86A 1OC3A 1YQ1A 3ZIJA 3ZMKA 4PX1A 3GTUA 1EOGA 4X0XA 5D93A 5COHA 2FWFA 3DRNA 3WYWA 4DSSA 2IMFA 1SD8A 1NSWA 3GFKA 5LD0A 3LEFA 3L9VA 2DC5A 1WIKA 3IDVA 2E7PA 1O85A 3VURA 1PN0A 1X5DA 5IMVA 3KP8A 3TKSC 2R0CA 1E2YA 3ERGA 4YAVA 2CA8A 1U3AA 2OE1A 2VM1A 1TU7A 4PUFC 2O7KA 3OR5A 2OA7A 1GSEA 4NV5A 5KN3A 5ECQB 2JSYA 10GSA 1ERTA 4TXVA 3GSTA 1FO5A 2DJKA 1G0TA 1SYXA 3E0UA 11GSA 3IXRA 2KP2A 8GSSA 4OO5A 4G10A 5GZZB 1GNWA 3F6DA 2VCQA 1OVNA 1ZMAA 1A8YA 3ZL5A 2F8FA 3CQFA 4K6XA 1J0FA 4L8EA 4MF7A 3EINA 1SKWB 1XOBA 2YPMA 4ZL8A 2M46A 2H75A 2VD0A 4MLYA 4TXOB 5B7CA 3HVXA 3NOFA 2H30A 3CSJA 4JBBA 1Q4JA 2C0EA 2DMLA 1CQGA 3RPNA 2N5AA 4IHUA 3HCZA 4ISDA 4GF0A 1VF1A 4BWSA 1X0RA 3DKSA 3TB2A 1ABAA 1M99A 3EVIA 5H5QA 2MMZA 2FWEA 2BJXA 5KN2A 2C3TA 2EIQA 3HVNA 3FHKA 1OYJA 3GHAA 3FZ5A 2XBQA 1GSSA 5CRGA 3TRPA 4HZ2A 2O85A 3MSZA 5J5NA 2N5BA 2VLUA 4LA1A 2FUG2 2F3MA 2C0FA 4XRDA 3QDNA 5IMFA 3DVWA 2UZ8A 3N9JA 1RQMA 4MZWA 1SK1A 2HNLA 2P5QA 1Z7RA 1Y25A 2GZPA 1F9MA 1ML6A 2H6ZA 4X1UA 2F8AA 4OFTA 2HE3A 1Q98A 1GSUA 1SJIA 3APQA 2V32A 4DSSB 2ON7A 3J7Yk 4USSA 3LSZA 5ECPB 3FRCA 2IJYA 3ZITA 3L78A 3RDWA 3QPMA 2NBSA 2KLXA 2AYTA 2H66A 1J08A 1H75A 3D5JA 1A0RP 5IOXA 4YH2A 3EWLA 2B5XA 1I9DA 5CYYA 2L4QA 2YN1A 4CDOA 3ZREA 3RHCA 2C8UA 3UARA 1XWBA 3EMPA 3G7JA 4K2XA 1TDIA 2LKUA 2MBTA 1AXDA 4RQRA 4ZBDA 1Z3EA 4EL1A 4L5LA 4IJ3A 3F8UA 2VAFA 4NAXA 4BVXA 4IS0A 1TRVA 5CP1A 5D8IA 5B8AA 5A4VA 4TKYA 1WJKA 4I8BA 3HVVA 5GSTA 3TCOA 3IV4A 4V1Ag 3HKRA 3LXZA 1M9AA 3C71A 4ZB9A 2IFQB 1S3DA 3GV1A 2X99A 2KUCA 3CRTA 3P90A 4J56E 2HI7A 1SU9A 1HNAA 4FIWA 3M8NA 4MF6A 1XVWA 3BCKA 1WE0A 4NHWA 5IMZA 2IWTA 4N0VA 4FYCA 3VWUA 4OWYA 6GSSA 4LLRA 1UVZA 2VUPA 3KD0A 6GSXA 4WR5A 1ZYNA 1BEDA 4MJEA 4FO5A 2IMIA 2MZCA 2QC7A 2FA4A 1XWKA 1K0OA 5INYA 1HD2A 4GCIA 3SBCA 1K3OA 3QFBC 1ACVA 1OC8A 2FWGA 4ZL7A 3WGDA 2H1BA 5ID2B 1GWCA 2GT6A 1M2AA 2C1YA 4N10A 3NZNA 3IE3A 1EWXA 4HU7A 1XWAA 2AV4A 2CAQA 3EE2A 1DE2A 4TVEA 3MYDA 3HXSA 4G9HA 1B4PA 2X64A 4XTSA 3C8EA 4X43A 1PX7A 3DEXA 2F51A 2HRKA 2GSTA 1JLVA 3VK9A 2GQLA 1R5PA 3FMWA 5JCUA 2VL2A 4DVCA 14GSA 1ST9A 2QA2A 2CZ3A 2H0GA 3LORA 3LQ7A 1EV9A 5F8BA 3G7IA 1YF1A 2M80A 3KH9A 4LMVA 3D4TA 4MZCA 2GTUA 4G0IA 4QQ7A 3O76A 1ZZYA 4NWYA 4V2NA 1TKDB 4MJBA 3EU4A 3TJJA 6GSWA 1FVJA 2TIRA 1C72A 2YZUA 2AHEA 2PU9C 3IK9A 1PL2A 4ILFA 3KMOA 4XS4A 4GLTA 3H1NA 5A5KA 1T8EB 1B48A 5IO0A 3RAZA 4BVXB 1WMJA 2WRTA 2R6KA 2H72A 1EEMA 1XZOA 2VLVA 4HUAA 2VL9A 3GKNA 4IKHA 2OBIA 2RUFA 1VF4A 2YJ7A 4ML6A 2ZNMA 3TKRA 2VOCA 3PGTA 16GSA 3Q6OA 3MDKA 2WFCA 4AJ8A 1O7UA 1A2JA 5IMDA 4FYUA 4DSRA 2PGTA 2YP6A 1VF3A 4TR4A 2H6YA 3F6FA 2GGTA 1K0DA 1V40A 3F3QA 3VI5A 1XWCA 2I4AA 3LG6A 3F3RA 3FYGA 2WZ9A 1GSQA 5JWRB 3F63A 1PMTA 3ZLPA 5IPGA 5ECIB 4A5PA 5FWGA 4HI7A 1YKCA 1NHYA 2NPBA 3TDGA 4JEDA 1U3IA 2B7KA 1O8XA 3KM6A 3ED3A 3CXGA 3H93A 3TGZA 2HRNA 4MMMA 3M9JA 4EO3A 5IOWA 2V2GA 2F9SA 3GL3A 2R3XA 1K3LA 1KBNA 3U6VA 5D9TA 3A5WA 2LEGA 4EIPA 5ECMB 5GAND 4FYBA 5LCZA 1QMVA 1ZYQB 3GL5A 2CQ9A 4K5SA 3CMIA 3GH6A 3N5OA 2YWOA 1EOHA 1TU8A 3UVTA 2LS5A 3QCPA 3UIWA 4TR1B 1SL1B 4MH2A 4HJ2A 1FW1A 1KNGA 2KOKA 1X5EA 3FEUA 3P7XA 1XWGA 4V2LA 5J3RA 5LNKe 3VWWA 3RHBA 1EP7A 1M7TA 4KUNA 2I3YA 3PINA 1PKWA 1FVKA 1X9WB 5AGYA 5HR0A 5EY6A 2B1LA 4WETA 2X8CA 2CAIA 4BL7B 1YDKA 2VL3A 1T4YA 4EXJA 1G6WA 2HSHA 3DMLA 2V1MA 2EIRA 2B5YA 1K0MA 5CREA 4YKGA 3IPZA 5H5SA 4JRRA 2GZZA 3TJFA
chains in the Genus database with same CATH topology
4ZBBA 2E0QA 2LJAA 4WF5A 2YWMA 5IIZA 4XS4B 4MJAA 2QGVA 4WBJA 4GQFA 3FY7A 3ME8A 2R5GA 3QFAC 5DJLA 5BRTA 5EL8A 3GN3A 2WGRA 2CX3A 4ID0A 4XS6A 2FD3A 3QAWA 5KN0A 1HNCA 3HY2A 5ECNB 2A4HA 2BTOT 4ECBA 2VCWA 17GSA 1GSDA 1B9XC 20GSA 1GUHA 1EP8A 3RBTA 3US3A 4TOPA 3IC4A 3KH7A 4POKA 2JSZA 3C7MA 5AN1A 5DJMA 1PKZA 2C0DA 4IVFA 4GSNA 1ERUA 4HQSA 5CO3A 4HU9A 2JZTA 4V2MA 4RI6A 1QGVA 2HRFA 2IFQA 1T1VA 4GRFA 1FG4A 2DIZA 5ECLB 2DJJA 1HNBA 1MDKA 2H76A 1N8JA 1IYIA 2XC2A 5A4WA 2LSTA 2ZCTA 2EC4A 3F0IA 5DQYA 4AF2A 2O87A 4MK3A 3P2AA 1YZXA 3CSIA 3FR9A 1SKSB 4CHSA 2J23A 1NW2A 4ICYA 4MABA 4XIHA 4RUVA 1T00A 4HEA2 5G1KA 4LL4B 2CV4A 3Q74A 1SL2B 5G30A 2PWJA 4BPYA 3UOMA 4MNNA 1U6TA 5D9VA 5ID2A 3PPUA 3EYTA 1SK0A 4EVMA 1OAZA 1MD3A 1JFUA 1GNEA 3PR8A 5G5EA 1AAZA 1A8LA 1JZDA 5EVOA 3D6IA 5GAPD 4FH8A 2WDUA 5HR2A 2WULA 5IQYA 5DAKB 1Z9HA 3FW2A 3L0HA 1QXHA 5AIXA 2G0FA 1OE8A 3HA9A 4NPBA 4Q5RA 1YKAA 3ZTLA 3LWAA 1PSQA 4O5RA 3W6GA 2PN8A 1BQ7A 1ERWA 5J41A 4G19A 2VL2C 4RI7A 5EPFA 2MMOA 2GLRA 3F4SA 4YQVA 1FOHA 2YOIA 1B4QA 4ZIJA 3D4MA 1G6YA 3M0FA 3BCIA 3MAKA 3GNJA 2OACA 3L9UA 2HZFA 4BA7A 1ZL9A 4TR0A 1J9BA 2K6VA 1K3YA 1W89A 4MA9A 4TRXA 1X9MB 3W8SA 1USBA 2RM5A 2PPTA 1A2MA 1K0BA 3UEMA 3F9UA 4AJ7A 2VD1A 4G0LA 2HFDA 1OC9A 4WEYA 3CRUA 5ECRB 3SWLA 2DIYA 3GX8A 2VLTA 3Q19A 5HFGA 5G31A 4ML1A 4WXTA 4G0KA 3KXOA 1JZRA 1K0CA 4I97A 3ZFLA 3H79A 2JACA 3KGKA 4PTSA 1YEPA 5IM9A 2P0GA 1V57A 4PQIA 3TKPA 4JU5A 2HSMA 3GX0A 12GSA 1TI3A 2IMEA 2PUKC 2H70A 4BVYA 2PERA 3EPTA 5D96A 3VPTA 4ECCA 4XRAA 4G2EA 3ZZXA 1AQVA 2CX4A 3GRXA 4IN0A 1A23A 2X8HA 3KJYA 3M9KA 1U88A 3VWXA 4ZL9A 1YY7A 2BMXA 3MIXA 9GSSA 3TJGA 4F2IA 2H6XA 2M72A 2YANA 3C1RA 2HXKA 1XVQA 1GL8A 2DLXA 3ERFA 2LRNA 1K0NA 2H74A 4PNFA 3APSA 1SKRB 1R4WA 1ZCPA 4K0NA 4IQAA 4JE1A 3QAVA 4L0UA 1F37A 1R7HA 3DWVA 4N11A 1PGTA 2FY6A 2WCIA 1WWJA 5CRHA 3TJBA 4TR1A 2FCHA 3HDCA 1VF2A 4L0WA 2VO4A 2B3SA 2GZYA 4ECJA 3EU3A 1BYEA 1EGOA 4GSSA 5C04A 5B6NA 3A2WA 5JCWA 4MJCA 4PURA 3O3TA 1GTUA 1N2AA 4KCAA 2K9FA 3J7Yb 1GH2A 1PRXA 2L4CA 1ZYEA 3QR6A 2IIYA 3KMNA 3VFIA 1TTZA 4HOJA 1M2DA 2OJLA 3FZAA 3BBYA 4BL7A 3LGCA 1GUMA 1BX9A 3IC8A 2H1GA 2YWNA 2DJ3A 3IHQA 1DSBA 1SD9A 4HJMA 4Z7XA 3WT1A 2DJ0A 4OD7A 5IMAA 4LL1B 2GDRA 4O5UA 3R3EA 3TKQA 1GULA 1KTEA 1QFNA 1FB0A 4YKFA 3UL3A 4IGJA 4MZBA 2PVQA 3VLNA 2GVPA 4XCSA 2JADA 4KSMA 1ILOA 2LJRA 1PN9A 1OC9B 1TRUA 6GSTA 4PXOA 4Q5NA 1JLWA 4KF9A 1VRSD 2K8VA 2QSIA 1GTBA 1DE1A 1TW9A 1ERVA 5GSSA 1UA5A 1V9WA 1CQHA 3BOAA 5B8BA 2GSSA 2I9HA 2AAWA 2N5FA 1SENA 3H8QA 1A2LA 2PVOC 2DKHA 3M1GA 1XW5A 2IPAA 1MDJA 4XHMA 4KNDA 4BVYB 3CYNA 4KDXA 2H0IA 1FHEA 4CY6A 2C80A 4YAPA 5F06A 2GS3A 2QA1A 5A4UA 1FOVA 1U87A 2EIOA 5G1LA 4KA0A 1FAAA 3F4TA 4JZQA 3FR3A 3HD5A 2K8SA 4F9ZA 5KOXA 2C3QA 3KTBA 4I2TA 4MCUA 3E9JB 4ULXA 2HYXA 3ZRDA 5ENUA 5B6MA 1IYHA 5G2ZA 2O8VB 1Z6MA 2J9HA 3ERWA 4KE3A 1GP1A 2H01A 5ECSA 2FLSA 2L59A 2GQKA 3U5RE 3WD6A 1XW6A 2VM2A 3V1WA 3I6AA 1XBSA 5CAXA 1M0UA 3WGXA 4Q5QA 1TK8B 4KGIA 4K0GA 1OKDA 2ES7A 4IW9A 1AC1A 1G7OA 3HHVA 4OMVA 2DJ2A 4ZBAA 2RM6A 4WKWA 2KHPA 2YWIA 5DAKA 5DBQA 1TP9A 3KCMA 3LXTA 4HS1A 4GTUA 3KIJA 5ECKB 3UJ1A 5F05A 4GSTA 4K1FA 4CY8A 5JWOB 2LQOA 2ON5A 3FK8A 4GWRA 3F4RA 5IPHA 3P8WA 4NV2A 2FA8A 4IJIA 3ZVJD 2AUVA 1URMA 1MEKA 3FZ9A 1WP0A 2YV9A 4QL7A 1YJ6A 3BJ5A 6GSYA 3A2XA 4D73A 2VCTA 4OO4A 3DYRA 1TRSA 5HR3A 5IO2A 2JZRA 4HQZA 1MD4A 1XCCA 1PD21 1RW1A 2WB9A 2TRCP 1TI1A 2NTOA 1GLQA 3GIXA 4HDEA 3CBUA 3LW9A 5HFIA 2P5RA 3IOSA 4K7IA 2YNXA 3CSHA 1MTCA 3TJKA 3IR4A 3GURA 1XPVA 3LYKA 2TRXA 4ZB8A 3KP9A 1ZYPA 5ECOB 2X4AA 3CTGA 2L57A 4WBRD 2ZUPA 1HYUA 5L71A 1QUWA 3VI7A 1BG5A 4GXZA 4ZB6A 1K0AA 4K5RA 5DCHA 4O5QA 4K7NA 4ZXGA 1PQNA 1QQ2A 4V1Ap 2MBSA 3HVSA 4O7HA 2R4VA 1WRYA 4KW6A 3LFLA 3ZMLA 3HJMA 3APOA 5DALA 4RQXA 1OE7A 3K8NA 2YV7A 2G2QA 4O32A 4EIQA 4IBPA 3BD2A 4TR3A 2FGXA 2XPEA 1JZOA 3QAGA 4J2FA 3PH9A 1F3AA 4EE0A 2XHFA 4CW9A 2I81A 4EKZA 1O81A 5H5RA 1Z5YE 5F0GA 4DSQA 3VWVA 3DXBA 2REMA 2NDOA 5DDLA 1UN2A 2CVBA 3IRAA 3D21A 3IA1A 3IAS2 4F0CA 2IMDA 2H1AA 4PQHA 1TJDA 22GSA 3ZVJA 1ZGNA 4PQ1A 3QD9A 4MPGA 2DBCA 3QMXA 4PNGA 1TK5B 2LNSA 4MH3A 5KN1A 4EUYA 5KEJA 3ZYWA 2GT5A 3VPQA 1EZKA 2LUSA 3GH9A 5DQSA 3WGEA 5JCGA 3W8JA 1TXXA 2L5LA 5D9XA 4N0ZA 2P31A 2X49A 1B8XA 1ZOFA 1AUCA 1X9SB 3ZFBA 2MMNA 4DEJA 4TW5A 4KAEA 5E4WA 4PGTA 3GUSA 4NHZA 1I5GA 4KH7A 3I43A 5AISA 1QK8A 3TOUA 4KX4A 1H4OA 1JZWA 2CZ2A 3EMXA 4D73B 2LJKA 3GTUB 4OFNA 1SJ6A 4ACSA 2LQQA 4MDCA 2A2SA 4J57E 7GSSA 2LV3A 2R0PA 4TN8A 3UBKA 3UAPA 3TKSA 3TUEA 1HQOA 1GLPA 3KEBA 4KB3A 2CVDA 3L9SA 5HR1A 3DD3A 1GUKA 3A5IA 4MF5A 4HZ4A 4F03A 3D0ZA 3HZ8A 1O73A 1R26A 1S3CA 1TK0B 1TRWA 4X4JA 2A4VA 2IL3A 5ELGA 3A3TA 5D9WA 2Z9SA 1PA3A 1A24A 1SJZA 3DIEA 3AY8A 2AJQB 5CNWA 2L6DA 1T3BA 5HFKA 5J4UA 1JHBA 1Z7PA 1PL1A 1T7PB 2FHEA 3NIVA 5J9CA 4ECIA 2HZEA 1GRXA 3EC3A 4FQUA 3GYKA 3C1SA 2YJHA 5AIVA 2JL4A 2GSQA 2RIIA 5C00A 5DALB 2RLIA 1B9YC 5DCGA 4K9ZA 1XOAA 2OE3A 2HLSA 4EDYA 2K18A 2YZHA 3FZ4A 2V41A 5CRDA 3WT2A 2C0GA 4P3YB 3KTLA 2LTKA 6GSUA 4F82A 4JR4A 4IELA 3GKKA 2FWHA 4XS1A 2WJUA 2H1DA 3RPPA 4EC0A 4L5OA 4Z2RA 2B6MA 2HRAA 2L5OA 3UMAA 1A0FA 5F07A 4IP6A 4O92A 1M2BA 2JU5A 1O8WA 2LRCA 4NMUA 3DVXA 1Y6EA 4KCEA 3I69A 4Z2TA 3L4NA 2CT6A 2KP1A 2E2GA 2QKEA 1BJXA 4WF4A 3KZQA 4MP4A 4GQCA 1V98A 5E59A 1GTAA 2WS2A 3UBLA 3LJRA 5ABRA 1LJRA 5D73A 1AIUA 1YF0A 1R5AA 6GSVA 3QOUA 4KDUA 2DJ1A 2IMKA 3MWHA 3I9V2 2H73A 4I2UA 1V58A 3IHGA 1THOA 3EURA 1FB6A 4PUAA 3IBHA 2H8LA 2LRTA 2I1UA 2OADA 2V6OA 3TRQA 1OKTA 4KDYA 4BWQA 2DMMA 4N30A 2XBIA 3E3EA 1LBKA 4Q5FA 3HZ4A 4F0BA 4WR4A 3GA4A 1XXUA 5FT3A 2GSRA 18GSA 3IAM2 3TOTA 1Z6NA 1UC7A 1W4VA 2HSYA 1EEJA 2R2JA 3LYPA 4K8MA 2V6KA 1EGRA 3MNGA 2H0HA 2R0GA 1E6BA 3M3MA 1TOFA 1XFLA 2VCXA 2YCDA 4ZILA 3HJPA 2A2PA 2A2RA 3C73A 2B7JA 1GTIA 5BMUA 4IQ1A 1X5CA 4K7OA 1M9BA 4E8HA 2X8GA 3FKFA 4YQMA 19GSA 1VGLA 2GQMA 3GSSA 3A2VA 2O89A 1THXA 2C3NA 2HZEB 2OKAA 3FR6A 1T4ZA 4AGSA 1YEXA 1WOUA 1WPIA 1G7EA 1NM3A 4K2DA 4EDZA 1O6JA 3S9FA 1XIYA 2AB6A 1GSYA 1GSFA 2NVLA 5ECHB 4Z2UA 1SYRA 1PX6A 3HJOA 1AW9A 3ME7A 1SL0B 2DKIA 13GSA 5KOWA 3ZIVA 1F3BA 1S3AA 2C4JA 4QL9A 1BAYA 3D22A 4JR6A 3HYPA 3ISOA 2E2MA 3CTFA 4MPFA 2OE0A 4NXIA 1AQXA 2PMTA 3UVHA 1LU4A 3TRXA 2CVKA 1EV4A 4TXOA 3DGQA 2IN3A 1XW9A 5J9BA 1MDIA 4KSOA 1DUGA 3JCML 3Q18A 2MMAA 2RUEA 3O6TA 2VCVA 1V2AA 3G9BA 5G5FA 3G7YA 4OCFA 5HQPA 2H71A 1SK2A 4I6XA 2VIMA 4E8EA 3TKSE 2B1KA 2XPDA 1DBYA 4OFMA 2PBJA 5FHIA 2L6CA 4LMWA 4YQUA 2VCZA 3GKXA 4POMA 4IP1A 1KEBA 3IK7A 2ALBA 2LNTA 3R2QA 4AJ6A 2MYGA 2DSAA 4OCEA 3GMFA 2H19A 4POLA 1F6MC 2FNOA 1NHOA 1ON4A 2OBKA 2JZSA 2HT9A 1F2EA 4POBA 5JWQB 4EF0A 2D2ZA 5ELAA 5CRWA 2R37A 5DVBA 1RK4A 5IMCA 2B5EA 4I5QA 3GKMA 3H4KA 1AQWA 4H86A 1OC3A 1YQ1A 3ZIJA 3ZMKA 4PX1A 3GTUA 1EOGA 4X0XA 5D93A 5COHA 2FWFA 3DRNA 3WYWA 4DSSA 2IMFA 1SD8A 1NSWA 3GFKA 5LD0A 3LEFA 3L9VA 2DC5A 1WIKA 3IDVA 2E7PA 1O85A 3VURA 1PN0A 1X5DA 5IMVA 3KP8A 3TKSC 2R0CA 1E2YA 3ERGA 4YAVA 2CA8A 1U3AA 2OE1A 2VM1A 1TU7A 4PUFC 2O7KA 3OR5A 2OA7A 1GSEA 4NV5A 5KN3A 5ECQB 2JSYA 10GSA 1ERTA 4TXVA 3GSTA 1FO5A 2DJKA 1G0TA 1SYXA 3E0UA 11GSA 3IXRA 2KP2A 8GSSA 4OO5A 4G10A 5GZZB 1GNWA 3F6DA 2VCQA 1OVNA 1ZMAA 1A8YA 3ZL5A 2F8FA 4K6XA 1J0FA 4L8EA 4MF7A 3EINA 1SKWB 1XOBA 2YPMA 4ZL8A 2M46A 2H75A 2VD0A 4MLYA 4TXOB 5B7CA 3HVXA 3NOFA 2H30A 3CSJA 4JBBA 1Q4JA 2C0EA 2DMLA 1CQGA 3RPNA 2N5AA 4IHUA 3HCZA 4ISDA 4GF0A 1VF1A 4BWSA 1X0RA 3DKSA 3TB2A 1ABAA 1M99A 3EVIA 5H5QA 2MMZA 2FWEA 2BJXA 5KN2A 2C3TA 2EIQA 3FHKA 1OYJA 3GHAA 3FZ5A 2XBQA 1GSSA 5CRGA 3TRPA 4HZ2A 2O85A 3MSZA 5J5NA 2N5BA 2VLUA 4LA1A 2FUG2 2F3MA 2C0FA 4XRDA 3QDNA 5IMFA 3DVWA 2UZ8A 3N9JA 1RQMA 4MZWA 1SK1A 2HNLA 2P5QA 1Z7RA 1Y25A 2GZPA 1F9MA 1ML6A 2H6ZA 4X1UA 2F8AA 4OFTA 2HE3A 1Q98A 1GSUA 1SJIA 3APQA 2V32A 4DSSB 2ON7A 3J7Yk 4USSA 3LSZA 5ECPB 3FRCA 2IJYA 3ZITA 3L78A 3RDWA 3QPMA 2NBSA 2KLXA 2AYTA 2H66A 1J08A 1H75A 3D5JA 1A0RP 5IOXA 4YH2A 3EWLA 2B5XA 1I9DA 5CYYA 2L4QA 2YN1A 4CDOA 3ZREA 3RHCA 2C8UA 3UARA 1XWBA 3EMPA 3G7JA 4K2XA 1TDIA 2LKUA 2MBTA 1AXDA 4RQRA 4ZBDA 1Z3EA 4EL1A 4L5LA 4IJ3A 3F8UA 2VAFA 4NAXA 4BVXA 4IS0A 1TRVA 5CP1A 5D8IA 5B8AA 5A4VA 4TKYA 1WJKA 4I8BA 3HVVA 5GSTA 3TCOA 3IV4A 4V1Ag 3HKRA 3LXZA 1M9AA 3C71A 4ZB9A 2IFQB 1S3DA 3GV1A 2X99A 2KUCA 3CRTA 3P90A 4J56E 2HI7A 1SU9A 1HNAA 4FIWA 3M8NA 4MF6A 1XVWA 3BCKA 1WE0A 4NHWA 5IMZA 2IWTA 4N0VA 4FYCA 3VWUA 4OWYA 6GSSA 4LLRA 1UVZA 2VUPA 3KD0A 6GSXA 4WR5A 1ZYNA 1BEDA 4MJEA 4FO5A 2IMIA 2MZCA 2QC7A 2FA4A 1XWKA 1K0OA 5INYA 1HD2A 4GCIA 3SBCA 1K3OA 3QFBC 1ACVA 1OC8A 2FWGA 4ZL7A 3WGDA 2H1BA 5ID2B 1GWCA 2GT6A 1M2AA 2C1YA 4N10A 3NZNA 3IE3A 1EWXA 4HU7A 1XWAA 2AV4A 2CAQA 3EE2A 1DE2A 4TVEA 3MYDA 3HXSA 4G9HA 1B4PA 2X64A 4XTSA 3C8EA 4X43A 1PX7A 3DEXA 2F51A 2HRKA 2GSTA 1JLVA 3VK9A 2GQLA 1R5PA 3FMWA 5JCUA 2VL2A 4DVCA 14GSA 1ST9A 2QA2A 2CZ3A 2H0GA 3LORA 3LQ7A 1EV9A 5F8BA 3G7IA 1YF1A 2M80A 3KH9A 4LMVA 3D4TA 4MZCA 2GTUA 4G0IA 4QQ7A 3O76A 1ZZYA 4NWYA 4V2NA 1TKDB 4MJBA 3EU4A 3TJJA 6GSWA 1FVJA 2TIRA 1C72A 2YZUA 2AHEA 2PU9C 3IK9A 1PL2A 4ILFA 3KMOA 4XS4A 4GLTA 3H1NA 5A5KA 1T8EB 1B48A 5IO0A 3RAZA 4BVXB 1WMJA 2WRTA 2R6KA 2H72A 1EEMA 1XZOA 2VLVA 4HUAA 2VL9A 3GKNA 4IKHA 2OBIA 2RUFA 1VF4A 2YJ7A 4ML6A 2ZNMA 3TKRA 2VOCA 3PGTA 16GSA 3Q6OA 3MDKA 2WFCA 4AJ8A 1O7UA 1A2JA 5IMDA 4FYUA 4DSRA 2PGTA 2YP6A 1VF3A 4TR4A 2H6YA 3F6FA 2GGTA 1K0DA 1V40A 3F3QA 3VI5A 1XWCA 2I4AA 3LG6A 3F3RA 3FYGA 2WZ9A 1GSQA 5JWRB 3F63A 1PMTA 3ZLPA 5IPGA 5ECIB 4A5PA 5FWGA 4HI7A 1YKCA 1NHYA 2NPBA 3TDGA 4JEDA 1U3IA 2B7KA 1O8XA 3KM6A 3ED3A 3CXGA 3H93A 3TGZA 2HRNA 4MMMA 3M9JA 4EO3A 5IOWA 2V2GA 2F9SA 3GL3A 2R3XA 1K3LA 1KBNA 3U6VA 5D9TA 3A5WA 2LEGA 4EIPA 5ECMB 5GAND 4FYBA 5LCZA 1QMVA 1ZYQB 3GL5A 2CQ9A 4K5SA 3CMIA 3GH6A 3N5OA 2YWOA 1EOHA 1TU8A 3UVTA 2LS5A 3QCPA 3UIWA 4TR1B 1SL1B 4MH2A 4HJ2A 1FW1A 1KNGA 2KOKA 1X5EA 3FEUA 3P7XA 1XWGA 4V2LA 5J3RA 5LNKe 3VWWA 3RHBA 1EP7A 1M7TA 4KUNA 2I3YA 3PINA 1PKWA 1FVKA 1X9WB 5AGYA 5HR0A 5EY6A 2B1LA 4WETA 2X8CA 2CAIA 4BL7B 1YDKA 2VL3A 1T4YA 4EXJA 1G6WA 2HSHA 3DMLA 2V1MA 2EIRA 2B5YA 1K0MA 5CREA 4YKGA 3IPZA 5H5SA 4JRRA 2GZZA 3TJFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZBB A;  2E0Q A;  2LJA A;  4WF5 A;  2YWM A;  5IIZ A;  4XS4 B;  4MJA A;  2QGV A;  4WBJ A;  4GQF A;  3FY7 A;  3ME8 A;  2R5G A;  3QFA C;  5DJL A;  5EL8 A;  3GN3 A;  2WGR A;  2CX3 A;  4ID0 A;  4XS6 A;  2FD3 A;  3QAW A;  5KN0 A;  1HNC A;  3HY2 A;  5ECN B;  2BTO T;  4ECB A;  2VCW A;  17GS A;  1GSD A;  1B9X C;  20GS A;  1GUH A;  1EP8 A;  3RBT A;  3US3 A;  4TOP A;  3IC4 A;  3KH7 A;  4POK A;  2JSZ A;  3C7M A;  5AN1 A;  5DJM A;  1PKZ A;  2C0D A;  4IVF A;  4GSN A;  1ERU A;  4HQS A;  5CO3 A;  4HU9 A;  2JZT A;  4V2M A;  4RI6 A;  1QGV A;  2HRF A;  2IFQ A;  1T1V A;  4GRF A;  1FG4 A;  2DIZ A;  5ECL B;  2DJJ A;  1HNB A;  1MDK A;  2H76 A;  1N8J A;  1IYI A;  2XC2 A;  5A4W A;  2LST A;  2ZCT A;  2EC4 A;  3F0I A;  5DQY A;  4AF2 A;  2O87 A;  4MK3 A;  3P2A A;  1YZX A;  3CSI A;  3FR9 A;  1SKS B;  4CHS A;  2J23 A;  1NW2 A;  4MAB A;  4XIH A;  4RUV A;  1T00 A;  4HEA 2;  5G1K A;  4LL4 B;  2CV4 A;  3Q74 A;  1SL2 B;  5G30 A;  2PWJ A;  4BPY A;  3UOM A;  1U6T A;  5D9V A;  5ID2 A;  3EYT A;  1SK0 A;  4EVM A;  1OAZ A;  1MD3 A;  1JFU A;  1GNE A;  3PR8 A;  5G5E A;  1AAZ A;  1A8L A;  1JZD A;  5EVO A;  3D6I A;  5GAP D;  4FH8 A;  2WDU A;  5HR2 A;  2WUL A;  5IQY A;  5DAK B;  1Z9H A;  3FW2 A;  3L0H A;  1QXH A;  5AIX A;  2G0F A;  1OE8 A;  3HA9 A;  4NPB A;  4Q5R A;  1YKA A;  3ZTL A;  3LWA A;  1PSQ A;  4O5R A;  3W6G A;  2PN8 A;  1BQ7 A;  1ERW A;  5J41 A;  4G19 A;  2VL2 C;  4RI7 A;  5EPF A;  2MMO A;  2GLR A;  3F4S A;  4YQV A;  2YOI A;  1B4Q A;  4ZIJ A;  3D4M A;  1G6Y A;  3M0F A;  3BCI A;  3MAK A;  3GNJ A;  2OAC A;  3L9U A;  2HZF A;  4BA7 A;  1ZL9 A;  4TR0 A;  1J9B A;  2K6V A;  1K3Y A;  1W89 A;  4MA9 A;  4TRX A;  1X9M B;  3W8S A;  1USB A;  2RM5 A;  2PPT A;  1A2M A;  1K0B A;  3UEM A;  3F9U A;  4AJ7 A;  2VD1 A;  2HFD A;  1OC9 A;  4WEY A;  3CRU A;  5ECR B;  3SWL A;  2DIY A;  3GX8 A;  2VLT A;  3Q19 A;  5HFG A;  5G31 A;  4ML1 A;  4WXT A;  3KXO A;  1JZR A;  1K0C A;  4I97 A;  3ZFL A;  3H79 A;  2JAC A;  3KGK A;  1YEP A;  5IM9 A;  2P0G A;  1V57 A;  4PQI A;  3TKP A;  4JU5 A;  3GX0 A;  12GS A;  1TI3 A;  2IME A;  2PUK C;  2H70 A;  4BVY A;  2PER A;  5D96 A;  3VPT A;  4ECC A;  4XRA A;  4G2E A;  3ZZX A;  1AQV A;  2CX4 A;  3GRX A;  4IN0 A;  1A23 A;  2X8H A;  3KJY A;  3M9K A;  1U88 A;  3VWX A;  4ZL9 A;  1YY7 A;  2BMX A;  9GSS A;  3TJG A;  4F2I A;  2H6X A;  2M72 A;  2YAN A;  3C1R A;  2HXK A;  1XVQ A;  1GL8 A;  2DLX A;  3ERF A;  2LRN A;  1K0N A;  2H74 A;  4PNF A;  3APS A;  1SKR B;  1R4W A;  1ZCP A;  4K0N A;  4IQA A;  4JE1 A;  3QAV A;  4L0U A;  1F37 A;  1R7H A;  3DWV A;  4N11 A;  1PGT A;  2FY6 A;  2WCI A;  1WWJ A;  5CRH A;  3TJB A;  4TR1 A;  2FCH A;  3HDC A;  1VF2 A;  4L0W A;  2VO4 A;  2B3S A;  2GZY A;  4ECJ A;  3EU3 A;  1BYE A;  1EGO A;  4GSS A;  5C04 A;  5B6N A;  3A2W A;  5JCW A;  4MJC A;  4PUR A;  3O3T A;  1GTU A;  1N2A A;  4KCA A;  2K9F A;  3J7Y b;  1GH2 A;  1PRX A;  2L4C A;  1ZYE A;  3QR6 A;  2IIY A;  3KMN A;  3VFI A;  1TTZ A;  4HOJ A;  1M2D A;  2OJL A;  3FZA A;  3BBY A;  4BL7 A;  3LGC A;  1GUM A;  1BX9 A;  2H1G A;  2YWN A;  2DJ3 A;  3IHQ A;  1DSB A;  1SD9 A;  4HJM A;  4Z7X A;  3WT1 A;  2DJ0 A;  4OD7 A;  5IMA A;  4LL1 B;  2GDR A;  3TKQ A;  1GUL A;  1KTE A;  1QFN A;  1FB0 A;  3UL3 A;  4IGJ A;  4MZB A;  2PVQ A;  3VLN A;  2GVP A;  4XCS A;  2JAD A;  4KSM A;  1ILO A;  2LJR A;  1PN9 A;  1OC9 B;  1TRU A;  6GST A;  4PXO A;  4Q5N A;  1JLW A;  1VRS D;  2K8V A;  2QSI A;  1GTB A;  1DE1 A;  1TW9 A;  1ERV A;  5GSS A;  1UA5 A;  1V9W A;  1CQH A;  3BOA A;  5B8B A;  2GSS A;  2I9H A;  2AAW A;  2N5F A;  1SEN A;  3H8Q A;  1A2L A;  2PVO C;  3M1G A;  1XW5 A;  2IPA A;  1MDJ A;  4XHM A;  4KND A;  3CYN A;  4KDX A;  2H0I A;  1FHE A;  2C80 A;  4YAP A;  5F06 A;  2GS3 A;  5A4U A;  1FOV A;  1U87 A;  2EIO A;  5G1L A;  4KA0 A;  1FAA A;  3F4T A;  4JZQ A;  3FR3 A;  3HD5 A;  2K8S A;  4F9Z A;  2C3Q A;  3KTB A;  4I2T A;  4MCU A;  3E9J B;  4ULX A;  2HYX A;  3ZRD A;  5ENU A;  5B6M A;  1IYH A;  5G2Z A;  2O8V B;  1Z6M A;  2J9H A;  3ERW A;  4KE3 A;  1GP1 A;  2H01 A;  5ECS A;  2FLS A;  2L59 A;  2GQK A;  3U5R E;  3WD6 A;  1XW6 A;  2VM2 A;  3V1W A;  3I6A A;  1XBS A;  5CAX A;  1M0U A;  3WGX A;  4Q5Q A;  1TK8 B;  4KGI A;  4K0G A;  1OKD A;  2ES7 A;  4IW9 A;  1AC1 A;  1G7O A;  3HHV A;  4OMV A;  2DJ2 A;  4ZBA A;  2RM6 A;  4WKW A;  2KHP A;  2YWI A;  5DAK A;  5DBQ A;  1TP9 A;  3KCM A;  3LXT A;  4HS1 A;  4GTU A;  3KIJ A;  5ECK B;  3UJ1 A;  5F05 A;  4GST A;  4K1F A;  5JWO B;  2LQO A;  2ON5 A;  3FK8 A;  4GWR A;  3F4R A;  5IPH A;  3P8W A;  4NV2 A;  2FA8 A;  4IJI A;  3ZVJ D;  2AUV A;  1URM A;  1MEK A;  3FZ9 A;  1WP0 A;  2YV9 A;  4QL7 A;  1YJ6 A;  3BJ5 A;  6GSY A;  3A2X A;  4D73 A;  2VCT A;  4OO4 A;  3DYR A;  1TRS A;  5HR3 A;  5IO2 A;  2JZR A;  4HQZ A;  1MD4 A;  1XCC A;  1PD2 1;  1RW1 A;  2WB9 A;  2TRC P;  1TI1 A;  2NTO A;  1GLQ A;  3GIX A;  4HDE A;  3CBU A;  5HFI A;  2P5R A;  3IOS A;  4K7I A;  2YNX A;  3CSH A;  1MTC A;  3TJK A;  3IR4 A;  3GUR A;  1XPV A;  3LYK A;  2TRX A;  4ZB8 A;  3KP9 A;  5ECO B;  3CTG A;  2L57 A;  4WBR D;  2ZUP A;  1HYU A;  5L71 A;  1QUW A;  3VI7 A;  1BG5 A;  4GXZ A;  4ZB6 A;  1K0A A;  5DCH A;  4K7N A;  4ZXG A;  1PQN A;  1QQ2 A;  4V1A p;  2MBS A;  3HVS A;  4O7H A;  2R4V A;  1WRY A;  4KW6 A;  3LFL A;  3ZML A;  3HJM A;  3APO A;  5DAL A;  4RQX A;  1OE7 A;  3K8N A;  2YV7 A;  2G2Q A;  4O32 A;  4IBP A;  3BD2 A;  4TR3 A;  2FGX A;  2XPE A;  1JZO A;  3QAG A;  4J2F A;  3PH9 A;  1F3A A;  4EE0 A;  2XHF A;  4CW9 A;  2I81 A;  4EKZ A;  1O81 A;  5H5R A;  1Z5Y E;  5F0G A;  4DSQ A;  3VWV A;  3DXB A;  2REM A;  2NDO A;  5DDL A;  1UN2 A;  2CVB A;  3IRA A;  3D21 A;  3IA1 A;  3IAS 2;  4F0C A;  2IMD A;  2H1A A;  4PQH A;  1TJD A;  22GS A;  3ZVJ A;  1ZGN A;  4PQ1 A;  3QD9 A;  4MPG A;  2DBC A;  3QMX A;  4PNG A;  1TK5 B;  2LNS A;  4MH3 A;  5KN1 A;  4EUY A;  5KEJ A;  3ZYW A;  2GT5 A;  3VPQ A;  1EZK A;  2LUS A;  3GH9 A;  5DQS A;  3WGE A;  5JCG A;  3W8J A;  1TXX A;  2L5L A;  5D9X A;  4N0Z A;  2P31 A;  1B8X A;  1ZOF A;  1AUC A;  1X9S B;  3ZFB A;  2MMN A;  4DEJ A;  4TW5 A;  4KAE A;  5E4W A;  4PGT A;  3GUS A;  4NHZ A;  1I5G A;  4KH7 A;  3I43 A;  5AIS A;  1QK8 A;  3TOU A;  4KX4 A;  1H4O A;  1JZW A;  2CZ2 A;  3EMX A;  4D73 B;  2LJK A;  3GTU B;  4OFN A;  1SJ6 A;  4ACS A;  2LQQ A;  4MDC A;  2A2S A;  4J57 E;  7GSS A;  2LV3 A;  4TN8 A;  3UBK A;  3UAP A;  3TKS A;  3TUE A;  1HQO A;  1GLP A;  3KEB A;  4KB3 A;  2CVD A;  3L9S A;  5HR1 A;  3DD3 A;  1GUK A;  4MF5 A;  4HZ4 A;  4F03 A;  3D0Z A;  3HZ8 A;  1O73 A;  1R26 A;  1S3C A;  1TK0 B;  1TRW A;  2A4V A;  2IL3 A;  5ELG A;  3A3T A;  5D9W A;  2Z9S A;  1PA3 A;  1A24 A;  1SJZ A;  3DIE A;  3AY8 A;  2AJQ B;  5CNW A;  2L6D A;  1T3B A;  5HFK A;  5J4U A;  1JHB A;  1Z7P A;  1PL1 A;  1T7P B;  2FHE A;  3NIV A;  5J9C A;  4ECI A;  2HZE A;  1GRX A;  3EC3 A;  3GYK A;  3C1S A;  2YJH A;  5AIV A;  2JL4 A;  2GSQ A;  2RII A;  5C00 A;  5DAL B;  2RLI A;  1B9Y C;  5DCG A;  4K9Z A;  1XOA A;  2OE3 A;  2HLS A;  4EDY A;  2K18 A;  2YZH A;  3FZ4 A;  2V41 A;  5CRD A;  3WT2 A;  2C0G A;  4P3Y B;  3KTL A;  2LTK A;  6GSU A;  4F82 A;  4JR4 A;  4IEL A;  3GKK A;  2FWH A;  4XS1 A;  2WJU A;  2H1D A;  3RPP A;  4EC0 A;  4L5O A;  2B6M A;  2L5O A;  3UMA A;  1A0F A;  5F07 A;  4IP6 A;  4O92 A;  1M2B A;  2JU5 A;  1O8W A;  2LRC A;  4NMU A;  3DVX A;  1Y6E A;  4KCE A;  3I69 A;  3L4N A;  2CT6 A;  2KP1 A;  2E2G A;  2QKE A;  1BJX A;  4WF4 A;  3KZQ A;  4MP4 A;  4GQC A;  1V98 A;  5E59 A;  1GTA A;  2WS2 A;  3UBL A;  3LJR A;  5ABR A;  1LJR A;  5D73 A;  1AIU A;  1YF0 A;  1R5A A;  6GSV A;  3QOU A;  4KDU A;  2DJ1 A;  2IMK A;  3MWH A;  3I9V 2;  2H73 A;  4I2U A;  1V58 A;  1THO A;  3EUR A;  1FB6 A;  4PUA A;  3IBH A;  2H8L A;  2LRT A;  2I1U A;  2OAD A;  2V6O A;  3TRQ A;  1OKT A;  4KDY A;  4BWQ A;  2DMM A;  4N30 A;  2XBI A;  3E3E A;  1LBK A;  4Q5F A;  3HZ4 A;  4F0B A;  4WR4 A;  3GA4 A;  1XXU A;  5FT3 A;  2GSR A;  18GS A;  3IAM 2;  3TOT A;  1Z6N A;  1UC7 A;  1W4V A;  2HSY A;  1EEJ A;  2R2J A;  3LYP A;  4K8M A;  2V6K A;  1EGR A;  3MNG A;  2H0H A;  1E6B A;  3M3M A;  1TOF A;  1XFL A;  2VCX A;  2YCD A;  4ZIL A;  3HJP A;  2A2R A;  3C73 A;  2B7J A;  1GTI A;  4IQ1 A;  1X5C A;  4K7O A;  1M9B A;  4E8H A;  2X8G A;  3FKF A;  4YQM A;  19GS A;  1VGL A;  2GQM A;  3GSS A;  3A2V A;  2O89 A;  1THX A;  2C3N A;  2HZE B;  2OKA A;  3FR6 A;  1T4Z A;  4AGS A;  1YEX A;  1WOU A;  1WPI A;  1G7E A;  1NM3 A;  4K2D A;  4EDZ A;  1O6J A;  3S9F A;  1XIY A;  2AB6 A;  1GSY A;  1GSF A;  2NVL A;  5ECH B;  1SYR A;  1PX6 A;  3HJO A;  1AW9 A;  3ME7 A;  1SL0 B;  13GS A;  3ZIV A;  1F3B A;  1S3A A;  2C4J A;  4QL9 A;  1BAY A;  3D22 A;  4JR6 A;  3HYP A;  3ISO A;  2E2M A;  3CTF A;  4MPF A;  2OE0 A;  4NXI A;  1AQX A;  2PMT A;  3UVH A;  1LU4 A;  3TRX A;  2CVK A;  1EV4 A;  4TXO A;  3DGQ A;  2IN3 A;  1XW9 A;  5J9B A;  1MDI A;  4KSO A;  1DUG A;  3JCM L;  3Q18 A;  2MMA A;  2RUE A;  3O6T A;  2VCV A;  1V2A A;  3G9B A;  5G5F A;  3G7Y A;  4OCF A;  5HQP A;  2H71 A;  1SK2 A;  4I6X A;  2VIM A;  4E8E A;  3TKS E;  2B1K A;  2XPD A;  1DBY A;  4OFM A;  2PBJ A;  5FHI A;  2L6C A;  4LMW A;  4YQU A;  2VCZ A;  3GKX A;  4POM A;  4IP1 A;  1KEB A;  3IK7 A;  2ALB A;  2LNT A;  3R2Q A;  4AJ6 A;  2MYG A;  2DSA A;  4OCE A;  3GMF A;  2H19 A;  4POL A;  1F6M C;  2FNO A;  1NHO A;  1ON4 A;  2OBK A;  2JZS A;  2HT9 A;  1F2E A;  4POB A;  5JWQ B;  4EF0 A;  2D2Z A;  5ELA A;  5CRW A;  2R37 A;  5DVB A;  1RK4 A;  5IMC A;  2B5E A;  4I5Q A;  3GKM A;  3H4K A;  1AQW A;  4H86 A;  1OC3 A;  1YQ1 A;  3ZIJ A;  3ZMK A;  4PX1 A;  3GTU A;  1EOG A;  4X0X A;  5D93 A;  5COH A;  2FWF A;  3DRN A;  3WYW A;  4DSS A;  2IMF A;  1SD8 A;  1NSW A;  3GFK A;  5LD0 A;  3LEF A;  3L9V A;  2DC5 A;  1WIK A;  3IDV A;  2E7P A;  1O85 A;  3VUR A;  1X5D A;  5IMV A;  3KP8 A;  3TKS C;  1E2Y A;  3ERG A;  4YAV A;  2CA8 A;  1U3A A;  2OE1 A;  2VM1 A;  1TU7 A;  4PUF C;  2O7K A;  3OR5 A;  2OA7 A;  1GSE A;  4NV5 A;  5KN3 A;  5ECQ B;  2JSY A;  10GS A;  1ERT A;  4TXV A;  3GST A;  1FO5 A;  2DJK A;  1G0T A;  1SYX A;  3E0U A;  11GS A;  3IXR A;  2KP2 A;  8GSS A;  4OO5 A;  4G10 A;  5GZZ B;  1GNW A;  3F6D A;  2VCQ A;  1OVN A;  1ZMA A;  1A8Y A;  3ZL5 A;  2F8F A;  4K6X A;  1J0F A;  4L8E A;  4MF7 A;  3EIN A;  1SKW B;  1XOB A;  2YPM A;  4ZL8 A;  2M46 A;  2H75 A;  2VD0 A;  4MLY A;  4TXO B;  5B7C A;  3HVX A;  3NOF A;  2H30 A;  3CSJ A;  4JBB A;  1Q4J A;  2C0E A;  2DML A;  1CQG A;  3RPN A;  2N5A A;  4IHU A;  3HCZ A;  4ISD A;  4GF0 A;  1VF1 A;  4BWS A;  1X0R A;  3DKS A;  3TB2 A;  1ABA A;  1M99 A;  3EVI A;  5H5Q A;  2MMZ A;  2FWE A;  2BJX A;  5KN2 A;  2C3T A;  2EIQ A;  3FHK A;  1OYJ A;  3GHA A;  3FZ5 A;  2XBQ A;  1GSS A;  5CRG A;  3TRP A;  4HZ2 A;  2O85 A;  3MSZ A;  5J5N A;  2N5B A;  2VLU A;  4LA1 A;  2FUG 2;  2F3M A;  2C0F A;  4XRD A;  3QDN A;  5IMF A;  3DVW A;  3N9J A;  1RQM A;  4MZW A;  1SK1 A;  2HNL A;  2P5Q A;  1Z7R A;  1Y25 A;  2GZP A;  1F9M A;  1ML6 A;  2H6Z A;  4X1U A;  2F8A A;  4OFT A;  2HE3 A;  1Q98 A;  1GSU A;  1SJI A;  3APQ A;  2V32 A;  4DSS B;  2ON7 A;  3J7Y k;  3LSZ A;  5ECP B;  3FRC A;  2IJY A;  3ZIT A;  3L78 A;  3RDW A;  3QPM A;  2NBS A;  2KLX A;  2AYT A;  2H66 A;  1J08 A;  1H75 A;  3D5J A;  1A0R P;  5IOX A;  4YH2 A;  3EWL A;  2B5X A;  1I9D A;  5CYY A;  2L4Q A;  2YN1 A;  4CDO A;  3ZRE A;  3RHC A;  2C8U A;  3UAR A;  1XWB A;  3EMP A;  3G7J A;  1TDI A;  2LKU A;  2MBT A;  1AXD A;  4RQR A;  4ZBD A;  1Z3E A;  4EL1 A;  4L5L A;  4IJ3 A;  3F8U A;  2VAF A;  4NAX A;  4BVX A;  4IS0 A;  1TRV A;  5CP1 A;  5D8I A;  5B8A A;  5A4V A;  4TKY A;  1WJK A;  4I8B A;  3HVV A;  5GST A;  3TCO A;  3IV4 A;  4V1A g;  3HKR A;  3LXZ A;  1M9A A;  3C71 A;  4ZB9 A;  2IFQ B;  1S3D A;  3GV1 A;  2X99 A;  2KUC A;  3CRT A;  3P90 A;  4J56 E;  2HI7 A;  1SU9 A;  1HNA A;  4FIW A;  3M8N A;  4MF6 A;  1XVW A;  3BCK A;  1WE0 A;  4NHW A;  5IMZ A;  2IWT A;  4N0V A;  4FYC A;  3VWU A;  4OWY A;  6GSS A;  4LLR A;  1UVZ A;  2VUP A;  3KD0 A;  6GSX A;  4WR5 A;  1BED A;  4MJE A;  4FO5 A;  2IMI A;  2MZC A;  2QC7 A;  2FA4 A;  1XWK A;  1K0O A;  5INY A;  1HD2 A;  4GCI A;  3SBC A;  1K3O A;  3QFB C;  1ACV A;  1OC8 A;  2FWG A;  4ZL7 A;  3WGD A;  2H1B A;  5ID2 B;  1GWC A;  2GT6 A;  1M2A A;  2C1Y A;  4N10 A;  3NZN A;  3IE3 A;  1EWX A;  4HU7 A;  1XWA A;  2AV4 A;  2CAQ A;  3EE2 A;  1DE2 A;  4TVE A;  3HXS A;  4G9H A;  1B4P A;  2X64 A;  4XTS A;  3C8E A;  4X43 A;  1PX7 A;  3DEX A;  2F51 A;  2GST A;  1JLV A;  3VK9 A;  2GQL A;  1R5P A;  5JCU A;  2VL2 A;  4DVC A;  14GS A;  1ST9 A;  2CZ3 A;  2H0G A;  3LOR A;  3LQ7 A;  1EV9 A;  5F8B A;  3G7I A;  1YF1 A;  2M80 A;  3KH9 A;  4LMV A;  3D4T A;  4MZC A;  2GTU A;  4QQ7 A;  3O76 A;  1ZZY A;  4NWY A;  4V2N A;  1TKD B;  4MJB A;  3EU4 A;  3TJJ A;  6GSW A;  1FVJ A;  2TIR A;  1C72 A;  2YZU A;  2AHE A;  2PU9 C;  3IK9 A;  1PL2 A;  4ILF A;  3KMO A;  4XS4 A;  4GLT A;  3H1N A;  5A5K A;  1T8E B;  1B48 A;  5IO0 A;  3RAZ A;  1WMJ A;  2WRT A;  2R6K A;  2H72 A;  1EEM A;  1XZO A;  2VLV A;  4HUA A;  2VL9 A;  3GKN A;  4IKH A;  2OBI A;  2RUF A;  1VF4 A;  2YJ7 A;  4ML6 A;  2ZNM A;  3TKR A;  2VOC A;  3PGT A;  16GS A;  3Q6O A;  3MDK A;  2WFC A;  4AJ8 A;  1O7U A;  1A2J A;  5IMD A;  4FYU A;  4DSR A;  2PGT A;  2YP6 A;  1VF3 A;  4TR4 A;  2H6Y A;  3F6F A;  2GGT A;  1K0D A;  1V40 A;  3F3Q A;  3VI5 A;  1XWC A;  2I4A A;  3LG6 A;  3F3R A;  3FYG A;  2WZ9 A;  1GSQ A;  5JWR B;  3F63 A;  1PMT A;  3ZLP A;  5IPG A;  5ECI B;  5FWG A;  4HI7 A;  1YKC A;  1NHY A;  2NPB A;  3TDG A;  4JED A;  1U3I A;  2B7K A;  1O8X A;  3KM6 A;  3ED3 A;  3CXG A;  3H93 A;  3TGZ A;  2HRN A;  4MMM A;  3M9J A;  4EO3 A;  5IOW A;  2V2G A;  2F9S A;  3GL3 A;  2R3X A;  1K3L A;  1KBN A;  3U6V A;  5D9T A;  3A5W A;  2LEG A;  5ECM B;  5GAN D;  4FYB A;  5LCZ A;  1QMV A;  1ZYQ B;  3GL5 A;  2CQ9 A;  3CMI A;  3GH6 A;  3N5O A;  2YWO A;  1EOH A;  1TU8 A;  3UVT A;  2LS5 A;  3QCP A;  3UIW A;  4TR1 B;  1SL1 B;  4MH2 A;  4HJ2 A;  1FW1 A;  1KNG A;  2KOK A;  1X5E A;  3FEU A;  3P7X A;  1XWG A;  4V2L A;  5J3R A;  5LNK e;  3VWW A;  3RHB A;  1EP7 A;  1M7T A;  4KUN A;  2I3Y A;  3PIN A;  1PKW A;  1FVK A;  1X9W B;  5AGY A;  5HR0 A;  5EY6 A;  2B1L A;  4WET A;  2X8C A;  2CAI A;  1YDK A;  2VL3 A;  1T4Y A;  4EXJ A;  1G6W A;  2HSH A;  3DML A;  2V1M A;  2EIR A;  2B5Y A;  1K0M A;  5CRE A;  3IPZ A;  5H5S A;  4JRR A;  2GZZ A;  3TJF A; 
#chains in the Genus database with same CATH topology
 4ZBB A;  2E0Q A;  2LJA A;  4WF5 A;  2YWM A;  5IIZ A;  4XS4 B;  4MJA A;  2QGV A;  4WBJ A;  4GQF A;  3FY7 A;  3ME8 A;  2R5G A;  3QFA C;  5DJL A;  5BRT A;  5EL8 A;  3GN3 A;  2WGR A;  2CX3 A;  4ID0 A;  4XS6 A;  2FD3 A;  3QAW A;  5KN0 A;  1HNC A;  3HY2 A;  5ECN B;  2A4H A;  2BTO T;  4ECB A;  2VCW A;  17GS A;  1GSD A;  1B9X C;  20GS A;  1GUH A;  1EP8 A;  3RBT A;  3US3 A;  4TOP A;  3IC4 A;  3KH7 A;  4POK A;  2JSZ A;  3C7M A;  5AN1 A;  5DJM A;  1PKZ A;  2C0D A;  4IVF A;  4GSN A;  1ERU A;  4HQS A;  5CO3 A;  4HU9 A;  2JZT A;  4V2M A;  4RI6 A;  1QGV A;  2HRF A;  2IFQ A;  1T1V A;  4GRF A;  1FG4 A;  2DIZ A;  5ECL B;  2DJJ A;  1HNB A;  1MDK A;  2H76 A;  1N8J A;  1IYI A;  2XC2 A;  5A4W A;  2LST A;  2ZCT A;  2EC4 A;  3F0I A;  5DQY A;  4AF2 A;  2O87 A;  4MK3 A;  3P2A A;  1YZX A;  3CSI A;  3FR9 A;  1SKS B;  4CHS A;  2J23 A;  1NW2 A;  4ICY A;  4MAB A;  4XIH A;  4RUV A;  1T00 A;  4HEA 2;  5G1K A;  4LL4 B;  2CV4 A;  3Q74 A;  1SL2 B;  5G30 A;  2PWJ A;  4BPY A;  3UOM A;  4MNN A;  1U6T A;  5D9V A;  5ID2 A;  3PPU A;  3EYT A;  1SK0 A;  4EVM A;  1OAZ A;  1MD3 A;  1JFU A;  1GNE A;  3PR8 A;  5G5E A;  1AAZ A;  1A8L A;  1JZD A;  5EVO A;  3D6I A;  5GAP D;  4FH8 A;  2WDU A;  5HR2 A;  2WUL A;  5IQY A;  5DAK B;  1Z9H A;  3FW2 A;  3L0H A;  1QXH A;  5AIX A;  2G0F A;  1OE8 A;  3HA9 A;  4NPB A;  4Q5R A;  1YKA A;  3ZTL A;  3LWA A;  1PSQ A;  4O5R A;  3W6G A;  2PN8 A;  1BQ7 A;  1ERW A;  5J41 A;  4G19 A;  2VL2 C;  4RI7 A;  5EPF A;  2MMO A;  2GLR A;  3F4S A;  4YQV A;  1FOH A;  2YOI A;  1B4Q A;  4ZIJ A;  3D4M A;  1G6Y A;  3M0F A;  3BCI A;  3MAK A;  3GNJ A;  2OAC A;  3L9U A;  2HZF A;  4BA7 A;  1ZL9 A;  4TR0 A;  1J9B A;  2K6V A;  1K3Y A;  1W89 A;  4MA9 A;  4TRX A;  1X9M B;  3W8S A;  1USB A;  2RM5 A;  2PPT A;  1A2M A;  1K0B A;  3UEM A;  3F9U A;  4AJ7 A;  2VD1 A;  4G0L A;  4BIK A;  2HFD A;  1OC9 A;  4WEY A;  3CRU A;  5ECR B;  3SWL A;  1S3R A;  2DIY A;  3GX8 A;  2VLT A;  3Q19 A;  5HFG A;  5G31 A;  4ML1 A;  4WXT A;  4G0K A;  3KXO A;  1JZR A;  1XG8 A;  1K0C A;  4I97 A;  3ZFL A;  3H79 A;  2JAC A;  3KGK A;  4PTS A;  1YEP A;  5IM9 A;  2P0G A;  1V57 A;  4PQI A;  3TKP A;  4JU5 A;  2HSM A;  3GX0 A;  12GS A;  1TI3 A;  2IME A;  2PUK C;  2H70 A;  4BVY A;  2PER A;  3EPT A;  5D96 A;  3VPT A;  4ECC A;  4XRA A;  4G2E A;  3ZZX A;  1AQV A;  2CX4 A;  3GRX A;  4IN0 A;  1A23 A;  2X8H A;  3KJY A;  3M9K A;  1U88 A;  3VWX A;  4ZL9 A;  1YY7 A;  2BMX A;  3MIX A;  9GSS A;  3TJG A;  4F2I A;  2H6X A;  2M72 A;  2YAN A;  3C1R A;  2HXK A;  1XVQ A;  1GL8 A;  2DLX A;  3ERF A;  2LRN A;  1K0N A;  2H74 A;  4PNF A;  3APS A;  1SKR B;  1R4W A;  1ZCP A;  4K0N A;  4IQA A;  4JE1 A;  3QAV A;  4L0U A;  1F37 A;  1R7H A;  3DWV A;  4N11 A;  1PGT A;  2FY6 A;  2WCI A;  1WWJ A;  5CRH A;  3TJB A;  4TR1 A;  2FCH A;  3HDC A;  1VF2 A;  4L0W A;  2VO4 A;  2B3S A;  2GZY A;  4ECJ A;  3EU3 A;  1BYE A;  1EGO A;  4GSS A;  5C04 A;  5B6N A;  3A2W A;  5JCW A;  4MJC A;  4PUR A;  3O3T A;  1GTU A;  1N2A A;  4KCA A;  2K9F A;  3J7Y b;  1GH2 A;  1PRX A;  2L4C A;  1ZYE A;  3QR6 A;  2IIY A;  3KMN A;  3VFI A;  1TTZ A;  4HOJ A;  1M2D A;  2OJL A;  3FZA A;  3BBY A;  4BL7 A;  3LGC A;  1GUM A;  1BX9 A;  3IC8 A;  2H1G A;  2YWN A;  2DJ3 A;  3IHQ A;  1DSB A;  1SD9 A;  4HJM A;  4Z7X A;  3WT1 A;  2DJ0 A;  4OD7 A;  5IMA A;  4LL1 B;  2GDR A;  4O5U A;  3R3E A;  3TKQ A;  1GUL A;  1KTE A;  1QFN A;  1FB0 A;  4YKF A;  3UL3 A;  4IGJ A;  4MZB A;  2PVQ A;  3VLN A;  2GVP A;  4XCS A;  2JAD A;  4KSM A;  1ILO A;  2LJR A;  1PN9 A;  1OC9 B;  1TRU A;  6GST A;  4PXO A;  4Q5N A;  1JLW A;  4KF9 A;  1VRS D;  2K8V A;  2QSI A;  1GTB A;  1DE1 A;  1TW9 A;  1ERV A;  5GSS A;  1UA5 A;  1V9W A;  1CQH A;  3BOA A;  5B8B A;  2GSS A;  2I9H A;  2AAW A;  2N5F A;  1SEN A;  3H8Q A;  1A2L A;  2PVO C;  2DKH A;  3M1G A;  1XW5 A;  2IPA A;  1MDJ A;  4XHM A;  4KND A;  4BVY B;  3CYN A;  4KDX A;  2H0I A;  1FHE A;  4CY6 A;  2C80 A;  4YAP A;  5F06 A;  2GS3 A;  2QA1 A;  5A4U A;  1FOV A;  1U87 A;  2EIO A;  5G1L A;  4KA0 A;  1FAA A;  3F4T A;  4JZQ A;  3FR3 A;  3HD5 A;  2K8S A;  4F9Z A;  5KOX A;  2C3Q A;  3KTB A;  4I2T A;  4MCU A;  3E9J B;  4ULX A;  2HYX A;  3ZRD A;  5ENU A;  5B6M A;  1IYH A;  5G2Z A;  2O8V B;  1Z6M A;  2J9H A;  3ERW A;  4KE3 A;  1GP1 A;  2H01 A;  5ECS A;  2FLS A;  2L59 A;  2GQK A;  3U5R E;  3WD6 A;  1XW6 A;  2VM2 A;  3V1W A;  3I6A A;  1XBS A;  5CAX A;  1M0U A;  3WGX A;  4Q5Q A;  1TK8 B;  4KGI A;  4K0G A;  1OKD A;  2ES7 A;  4IW9 A;  1AC1 A;  1G7O A;  3HHV A;  4OMV A;  2DJ2 A;  4ZBA A;  2RM6 A;  4WKW A;  2KHP A;  2YWI A;  5DAK A;  5DBQ A;  1TP9 A;  3KCM A;  3LXT A;  4HS1 A;  4GTU A;  3KIJ A;  5ECK B;  3UJ1 A;  5F05 A;  4GST A;  4K1F A;  4CY8 A;  5JWO B;  2LQO A;  2ON5 A;  3FK8 A;  4GWR A;  3F4R A;  5IPH A;  3P8W A;  4NV2 A;  2FA8 A;  4IJI A;  3ZVJ D;  2AUV A;  1URM A;  1MEK A;  3FZ9 A;  1WP0 A;  2YV9 A;  4QL7 A;  1YJ6 A;  3BJ5 A;  6GSY A;  3A2X A;  4D73 A;  2VCT A;  4OO4 A;  3DYR A;  1TRS A;  5HR3 A;  5IO2 A;  2JZR A;  4HQZ A;  1MD4 A;  1XCC A;  1PD2 1;  1RW1 A;  2WB9 A;  2TRC P;  1TI1 A;  2NTO A;  1GLQ A;  3GIX A;  4HDE A;  3CBU A;  3LW9 A;  5HFI A;  2P5R A;  3IOS A;  4K7I A;  2YNX A;  3CSH A;  1MTC A;  3TJK A;  3IR4 A;  3GUR A;  1XPV A;  3LYK A;  2TRX A;  4ZB8 A;  3KP9 A;  1ZYP A;  5ECO B;  2X4A A;  3CTG A;  2L57 A;  4WBR D;  4HSC X;  2ZUP A;  1HYU A;  5L71 A;  1QUW A;  3VI7 A;  1BG5 A;  4GXZ A;  4ZB6 A;  1K0A A;  4K5R A;  5DCH A;  4O5Q A;  4K7N A;  4ZXG A;  1PQN A;  1QQ2 A;  4V1A p;  2MBS A;  3HVS A;  4O7H A;  2R4V A;  1WRY A;  4KW6 A;  3LFL A;  3ZML A;  3HJM A;  3APO A;  5DAL A;  4RQX A;  1OE7 A;  3K8N A;  2YV7 A;  2G2Q A;  4O32 A;  4EIQ A;  4IBP A;  3BD2 A;  4TR3 A;  2FGX A;  2XPE A;  1JZO A;  3QAG A;  4J2F A;  3PH9 A;  1F3A A;  4EE0 A;  2XHF A;  4CW9 A;  2I81 A;  4EKZ A;  1O81 A;  5H5R A;  1Z5Y E;  5F0G A;  4DSQ A;  3VWV A;  3DXB A;  2REM A;  2NDO A;  5DDL A;  1UN2 A;  2CVB A;  3IRA A;  3D21 A;  3IA1 A;  3IAS 2;  4F0C A;  2IMD A;  2H1A A;  4PQH A;  1TJD A;  22GS A;  3ZVJ A;  1ZGN A;  4PQ1 A;  3QD9 A;  4MPG A;  2DBC A;  1M3I A;  3QMX A;  4PNG A;  1TK5 B;  2LNS A;  4MH3 A;  5KN1 A;  4EUY A;  5KEJ A;  3ZYW A;  2GT5 A;  3VPQ A;  1EZK A;  2LUS A;  3GH9 A;  5DQS A;  3WGE A;  5JCG A;  3W8J A;  1TXX A;  2L5L A;  5D9X A;  4N0Z A;  2P31 A;  2X49 A;  1B8X A;  1ZOF A;  1AUC A;  1X9S B;  3ZFB A;  2MMN A;  4DEJ A;  4TW5 A;  4KAE A;  5E4W A;  4PGT A;  3GUS A;  4NHZ A;  1I5G A;  4KH7 A;  3I43 A;  5AIS A;  1QK8 A;  3TOU A;  4KX4 A;  1H4O A;  1JZW A;  2CZ2 A;  3EMX A;  4D73 B;  2LJK A;  3GTU B;  4OFN A;  1SJ6 A;  4ACS A;  2LQQ A;  4MDC A;  2A2S A;  4J57 E;  7GSS A;  2LV3 A;  2R0P A;  4TN8 A;  3UBK A;  3UAP A;  3TKS A;  3TUE A;  1HQO A;  1GLP A;  3KEB A;  4KB3 A;  2CVD A;  3L9S A;  5HR1 A;  3DD3 A;  1GUK A;  3A5I A;  4MF5 A;  4HZ4 A;  4F03 A;  3D0Z A;  3HZ8 A;  1O73 A;  1R26 A;  1S3C A;  1TK0 B;  1TRW A;  4X4J A;  2A4V A;  2IL3 A;  5ELG A;  3A3T A;  5D9W A;  2Z9S A;  1PA3 A;  1A24 A;  1SJZ A;  3DIE A;  3AY8 A;  2AJQ B;  5CNW A;  2L6D A;  1T3B A;  5HFK A;  5J4U A;  1JHB A;  1Z7P A;  1PL1 A;  1T7P B;  2FHE A;  3NIV A;  5J9C A;  4ECI A;  2HZE A;  1GRX A;  3EC3 A;  4FQU A;  3GYK A;  3C1S A;  2YJH A;  5AIV A;  2JL4 A;  2GSQ A;  2RII A;  5C00 A;  5DAL B;  2RLI A;  1B9Y C;  5DCG A;  4K9Z A;  1XOA A;  2OE3 A;  2HLS A;  4EDY A;  2K18 A;  2YZH A;  3FZ4 A;  2V41 A;  5CRD A;  3WT2 A;  2C0G A;  4P3Y B;  3KTL A;  2LTK A;  6GSU A;  4F82 A;  4JR4 A;  4IEL A;  3GKK A;  2FWH A;  4XS1 A;  2WJU A;  2H1D A;  3RPP A;  4EC0 A;  4L5O A;  4Z2R A;  2B6M A;  2HRA A;  2L5O A;  3UMA A;  1A0F A;  5F07 A;  4IP6 A;  4O92 A;  1M2B A;  2JU5 A;  1O8W A;  2LRC A;  4NMU A;  3DVX A;  1Y6E A;  4KCE A;  3I69 A;  4Z2T A;  3L4N A;  2CT6 A;  2KP1 A;  2E2G A;  2QKE A;  1BJX A;  4WF4 A;  3KZQ A;  4MP4 A;  4GQC A;  1V98 A;  5E59 A;  1GTA A;  2WS2 A;  3UBL A;  3LJR A;  5ABR A;  1LJR A;  5D73 A;  1AIU A;  1YF0 A;  1R5A A;  6GSV A;  3QOU A;  4KDU A;  2DJ1 A;  2IMK A;  3MWH A;  3I9V 2;  2H73 A;  4I2U A;  1V58 A;  3IHG A;  1THO A;  3EUR A;  1FB6 A;  4PUA A;  3IBH A;  2H8L A;  2LRT A;  2I1U A;  2OAD A;  1PFO A;  2V6O A;  3TRQ A;  1OKT A;  4KDY A;  4BWQ A;  2DMM A;  4N30 A;  2XBI A;  3E3E A;  1LBK A;  4Q5F A;  3HZ4 A;  4F0B A;  4WR4 A;  3GA4 A;  1XXU A;  5FT3 A;  2GSR A;  18GS A;  3IAM 2;  3TOT A;  1Z6N A;  1UC7 A;  1W4V A;  2HSY A;  1EEJ A;  2R2J A;  3LYP A;  4K8M A;  2V6K A;  1EGR A;  3MNG A;  2H0H A;  2R0G A;  1E6B A;  3M3M A;  1TOF A;  1XFL A;  2VCX A;  2YCD A;  4ZIL A;  3HJP A;  2A2P A;  2A2R A;  3C73 A;  2B7J A;  1GTI A;  5BMU A;  4IQ1 A;  1X5C A;  4K7O A;  1M9B A;  4E8H A;  2X8G A;  3FKF A;  4YQM A;  19GS A;  1VGL A;  2GQM A;  3GSS A;  3A2V A;  2O89 A;  1THX A;  2C3N A;  2HZE B;  2OKA A;  3FR6 A;  1T4Z A;  4AGS A;  1YEX A;  1WOU A;  1WPI A;  1G7E A;  1NM3 A;  4K2D A;  4EDZ A;  1O6J A;  3S9F A;  1XIY A;  2AB6 A;  1GSY A;  1GSF A;  2NVL A;  5ECH B;  4Z2U A;  1SYR A;  1PX6 A;  3HJO A;  1AW9 A;  3ME7 A;  1SL0 B;  2DKI A;  13GS A;  5KOW A;  3ZIV A;  1F3B A;  1S3A A;  2C4J A;  4QL9 A;  1BAY A;  3D22 A;  4JR6 A;  3HYP A;  3ISO A;  2E2M A;  3CTF A;  4MPF A;  2OE0 A;  4NXI A;  1AQX A;  2PMT A;  1M3J A;  3UVH A;  1LU4 A;  3TRX A;  2CVK A;  1EV4 A;  4TXO A;  3DGQ A;  2IN3 A;  1XW9 A;  5J9B A;  1MDI A;  4KSO A;  1DUG A;  3JCM L;  3Q18 A;  2MMA A;  2RUE A;  3O6T A;  2VCV A;  1V2A A;  3G9B A;  5G5F A;  3G7Y A;  4OCF A;  5HQP A;  2H71 A;  1SK2 A;  4I6X A;  2VIM A;  4E8E A;  3TKS E;  2B1K A;  2XPD A;  1DBY A;  4OFM A;  2PBJ A;  5FHI A;  2L6C A;  4LMW A;  4YQU A;  2VCZ A;  3GKX A;  4POM A;  4IP1 A;  1KEB A;  3IK7 A;  2ALB A;  2LNT A;  3R2Q A;  4AJ6 A;  2MYG A;  2DSA A;  4OCE A;  3GMF A;  2H19 A;  4POL A;  1F6M C;  2FNO A;  1NHO A;  1ON4 A;  2OBK A;  2JZS A;  2HT9 A;  1F2E A;  4POB A;  5JWQ B;  4EF0 A;  2D2Z A;  5ELA A;  5CRW A;  2R37 A;  5DVB A;  1RK4 A;  5IMC A;  2B5E A;  4I5Q A;  3GKM A;  3H4K A;  1AQW A;  4H86 A;  1OC3 A;  1YQ1 A;  3ZIJ A;  3ZMK A;  4PX1 A;  3GTU A;  1EOG A;  4X0X A;  5D93 A;  5COH A;  2FWF A;  3DRN A;  3WYW A;  4DSS A;  2IMF A;  1SD8 A;  1NSW A;  3GFK A;  5LD0 A;  3LEF A;  3L9V A;  2DC5 A;  1WIK A;  3IDV A;  2E7P A;  1O85 A;  3VUR A;  1PN0 A;  1X5D A;  5IMV A;  3KP8 A;  3TKS C;  2R0C A;  1E2Y A;  3ERG A;  4YAV A;  2CA8 A;  1U3A A;  2OE1 A;  2VM1 A;  1TU7 A;  4PUF C;  2O7K A;  3OR5 A;  2OA7 A;  1GSE A;  4NV5 A;  5KN3 A;  5ECQ B;  2JSY A;  10GS A;  1ERT A;  4TXV A;  3GST A;  1FO5 A;  2DJK A;  1G0T A;  1SYX A;  3E0U A;  11GS A;  3IXR A;  2KP2 A;  8GSS A;  4OO5 A;  4G10 A;  5GZZ B;  1GNW A;  3F6D A;  2VCQ A;  1OVN A;  1ZMA A;  1A8Y A;  3ZL5 A;  2F8F A;  3CQF A;  4K6X A;  1J0F A;  4L8E A;  4MF7 A;  3EIN A;  1SKW B;  1XOB A;  2YPM A;  4ZL8 A;  2M46 A;  2H75 A;  2VD0 A;  4MLY A;  4TXO B;  5B7C A;  3HVX A;  3NOF A;  2H30 A;  3CSJ A;  4JBB A;  1Q4J A;  2C0E A;  2DML A;  1CQG A;  3RPN A;  2N5A A;  4IHU A;  3HCZ A;  4ISD A;  4GF0 A;  1VF1 A;  4BWS A;  1X0R A;  3DKS A;  3TB2 A;  1ABA A;  1M99 A;  3EVI A;  5H5Q A;  2MMZ A;  2FWE A;  2BJX A;  5KN2 A;  2C3T A;  2EIQ A;  3HVN A;  3FHK A;  1OYJ A;  3GHA A;  3FZ5 A;  2XBQ A;  1GSS A;  5CRG A;  3TRP A;  4HZ2 A;  2O85 A;  3MSZ A;  5J5N A;  2N5B A;  2VLU A;  4LA1 A;  2FUG 2;  2F3M A;  2C0F A;  4XRD A;  3QDN A;  5IMF A;  3DVW A;  2UZ8 A;  3N9J A;  1RQM A;  4MZW A;  1SK1 A;  2HNL A;  2P5Q A;  1Z7R A;  1Y25 A;  2GZP A;  1F9M A;  1ML6 A;  2H6Z A;  4X1U A;  2F8A A;  4OFT A;  2HE3 A;  1Q98 A;  1GSU A;  1SJI A;  3APQ A;  2V32 A;  4DSS B;  2ON7 A;  3J7Y k;  4USS A;  3LSZ A;  5ECP B;  3FRC A;  2IJY A;  3ZIT A;  3L78 A;  3RDW A;  3QPM A;  2NBS A;  2KLX A;  2AYT A;  2H66 A;  1J08 A;  1H75 A;  3D5J A;  1A0R P;  5IOX A;  4YH2 A;  3EWL A;  2B5X A;  1I9D A;  5CYY A;  2L4Q A;  2YN1 A;  4CDO A;  3ZRE A;  3RHC A;  2C8U A;  3UAR A;  1XWB A;  3EMP A;  3G7J A;  4K2X A;  1TDI A;  2LKU A;  2MBT A;  1AXD A;  4RQR A;  4ZBD A;  1Z3E A;  4EL1 A;  4L5L A;  4IJ3 A;  3F8U A;  2VAF A;  4NAX A;  4BVX A;  4IS0 A;  1TRV A;  5CP1 A;  5D8I A;  5B8A A;  5A4V A;  4TKY A;  1WJK A;  4I8B A;  3HVV A;  5GST A;  3TCO A;  3IV4 A;  4V1A g;  3HKR A;  3LXZ A;  1M9A A;  3C71 A;  4ZB9 A;  2IFQ B;  1S3D A;  3GV1 A;  2X99 A;  2KUC A;  3CRT A;  3P90 A;  4J56 E;  2HI7 A;  1SU9 A;  1HNA A;  4FIW A;  3M8N A;  4MF6 A;  1XVW A;  3BCK A;  1WE0 A;  4NHW A;  5IMZ A;  2IWT A;  4N0V A;  4FYC A;  3VWU A;  4OWY A;  6GSS A;  4LLR A;  1UVZ A;  2VUP A;  3KD0 A;  6GSX A;  4WR5 A;  1ZYN A;  1BED A;  4MJE A;  4FO5 A;  2IMI A;  2MZC A;  2QC7 A;  2FA4 A;  1XWK A;  1K0O A;  5INY A;  1HD2 A;  4GCI A;  3SBC A;  1K3O A;  3QFB C;  1ACV A;  1OC8 A;  2FWG A;  4ZL7 A;  3WGD A;  2H1B A;  5ID2 B;  1GWC A;  2GT6 A;  1M2A A;  2C1Y A;  4N10 A;  3NZN A;  3IE3 A;  1EWX A;  4HU7 A;  1XWA A;  2AV4 A;  2CAQ A;  3EE2 A;  1DE2 A;  4TVE A;  3MYD A;  3HXS A;  4G9H A;  1B4P A;  2X64 A;  4XTS A;  3C8E A;  4X43 A;  1PX7 A;  3DEX A;  2F51 A;  2HRK A;  2GST A;  1JLV A;  3VK9 A;  2GQL A;  1R5P A;  3FMW A;  5JCU A;  2VL2 A;  4DVC A;  14GS A;  1ST9 A;  2QA2 A;  2CZ3 A;  2H0G A;  3LOR A;  3LQ7 A;  1EV9 A;  5F8B A;  3G7I A;  1YF1 A;  2M80 A;  3KH9 A;  4LMV A;  3D4T A;  4MZC A;  2GTU A;  4G0I A;  4QQ7 A;  3O76 A;  1ZZY A;  4NWY A;  4V2N A;  1TKD B;  4MJB A;  3EU4 A;  3TJJ A;  6GSW A;  1FVJ A;  2TIR A;  1C72 A;  2YZU A;  2AHE A;  2PU9 C;  3IK9 A;  1PL2 A;  4ILF A;  3KMO A;  4XS4 A;  4GLT A;  3H1N A;  5A5K A;  1T8E B;  1B48 A;  5IO0 A;  3RAZ A;  4BVX B;  1WMJ A;  2WRT A;  2R6K A;  2H72 A;  1EEM A;  1XZO A;  2VLV A;  4HUA A;  2VL9 A;  3GKN A;  4IKH A;  2OBI A;  2RUF A;  1VF4 A;  2YJ7 A;  4ML6 A;  2ZNM A;  3TKR A;  2VOC A;  3PGT A;  16GS A;  3Q6O A;  3MDK A;  2WFC A;  4AJ8 A;  1O7U A;  1A2J A;  5IMD A;  4FYU A;  4DSR A;  2PGT A;  2YP6 A;  1VF3 A;  4TR4 A;  2H6Y A;  3F6F A;  2GGT A;  1K0D A;  1V40 A;  3F3Q A;  3VI5 A;  1XWC A;  2I4A A;  3LG6 A;  3F3R A;  3FYG A;  2WZ9 A;  1GSQ A;  5JWR B;  3F63 A;  1PMT A;  3ZLP A;  5IPG A;  5ECI B;  4A5P A;  5FWG A;  4HI7 A;  1YKC A;  1NHY A;  2NPB A;  3TDG A;  4JED A;  1U3I A;  2B7K A;  1O8X A;  3KM6 A;  3ED3 A;  3CXG A;  3H93 A;  3TGZ A;  2HRN A;  4MMM A;  3M9J A;  4EO3 A;  5IOW A;  2V2G A;  2F9S A;  3GL3 A;  2R3X A;  1K3L A;  1KBN A;  3U6V A;  5D9T A;  3A5W A;  2LEG A;  4EIP A;  5ECM B;  5GAN D;  4FYB A;  5LCZ A;  1QMV A;  1ZYQ B;  3GL5 A;  2CQ9 A;  4K5S A;  3CMI A;  3GH6 A;  3N5O A;  2YWO A;  1EOH A;  1TU8 A;  3UVT A;  2LS5 A;  3QCP A;  3UIW A;  4TR1 B;  1SL1 B;  4MH2 A;  4HJ2 A;  1FW1 A;  1KNG A;  2KOK A;  1X5E A;  3FEU A;  3P7X A;  1XWG A;  4V2L A;  5J3R A;  5LNK e;  3VWW A;  3RHB A;  1EP7 A;  1M7T A;  4KUN A;  2I3Y A;  3PIN A;  1PKW A;  1FVK A;  1X9W B;  5AGY A;  5HR0 A;  5EY6 A;  2B1L A;  4WET A;  2X8C A;  2CAI A;  4BL7 B;  1YDK A;  2VL3 A;  1T4Y A;  4EXJ A;  1G6W A;  2HSH A;  3DML A;  2V1M A;  2EIR A;  2B5Y A;  1K0M A;  5CRE A;  4YKG A;  3IPZ A;  5H5S A;  4JRR A;  2GZZ A;  3TJF A; 
#chains in the Genus database with same CATH homology
 4ZBB A;  2E0Q A;  2LJA A;  4WF5 A;  2YWM A;  5IIZ A;  4XS4 B;  4MJA A;  2QGV A;  4WBJ A;  4GQF A;  3FY7 A;  3ME8 A;  2R5G A;  3QFA C;  5DJL A;  5BRT A;  5EL8 A;  3GN3 A;  2WGR A;  2CX3 A;  4ID0 A;  4XS6 A;  2FD3 A;  3QAW A;  5KN0 A;  1HNC A;  3HY2 A;  5ECN B;  2A4H A;  2BTO T;  4ECB A;  2VCW A;  17GS A;  1GSD A;  1B9X C;  20GS A;  1GUH A;  1EP8 A;  3RBT A;  3US3 A;  4TOP A;  3IC4 A;  3KH7 A;  4POK A;  2JSZ A;  3C7M A;  5AN1 A;  5DJM A;  1PKZ A;  2C0D A;  4IVF A;  4GSN A;  1ERU A;  4HQS A;  5CO3 A;  4HU9 A;  2JZT A;  4V2M A;  4RI6 A;  1QGV A;  2HRF A;  2IFQ A;  1T1V A;  4GRF A;  1FG4 A;  2DIZ A;  5ECL B;  2DJJ A;  1HNB A;  1MDK A;  2H76 A;  1N8J A;  1IYI A;  2XC2 A;  5A4W A;  2LST A;  2ZCT A;  2EC4 A;  3F0I A;  5DQY A;  4AF2 A;  2O87 A;  4MK3 A;  3P2A A;  1YZX A;  3CSI A;  3FR9 A;  1SKS B;  4CHS A;  2J23 A;  1NW2 A;  4ICY A;  4MAB A;  4XIH A;  4RUV A;  1T00 A;  4HEA 2;  5G1K A;  4LL4 B;  2CV4 A;  3Q74 A;  1SL2 B;  5G30 A;  2PWJ A;  4BPY A;  3UOM A;  4MNN A;  1U6T A;  5D9V A;  5ID2 A;  3PPU A;  3EYT A;  1SK0 A;  4EVM A;  1OAZ A;  1MD3 A;  1JFU A;  1GNE A;  3PR8 A;  5G5E A;  1AAZ A;  1A8L A;  1JZD A;  5EVO A;  3D6I A;  5GAP D;  4FH8 A;  2WDU A;  5HR2 A;  2WUL A;  5IQY A;  5DAK B;  1Z9H A;  3FW2 A;  3L0H A;  1QXH A;  5AIX A;  2G0F A;  1OE8 A;  3HA9 A;  4NPB A;  4Q5R A;  1YKA A;  3ZTL A;  3LWA A;  1PSQ A;  4O5R A;  3W6G A;  2PN8 A;  1BQ7 A;  1ERW A;  5J41 A;  4G19 A;  2VL2 C;  4RI7 A;  5EPF A;  2MMO A;  2GLR A;  3F4S A;  4YQV A;  1FOH A;  2YOI A;  1B4Q A;  4ZIJ A;  3D4M A;  1G6Y A;  3M0F A;  3BCI A;  3MAK A;  3GNJ A;  2OAC A;  3L9U A;  2HZF A;  4BA7 A;  1ZL9 A;  4TR0 A;  1J9B A;  2K6V A;  1K3Y A;  1W89 A;  4MA9 A;  4TRX A;  1X9M B;  3W8S A;  1USB A;  2RM5 A;  2PPT A;  1A2M A;  1K0B A;  3UEM A;  3F9U A;  4AJ7 A;  2VD1 A;  4G0L A;  2HFD A;  1OC9 A;  4WEY A;  3CRU A;  5ECR B;  3SWL A;  2DIY A;  3GX8 A;  2VLT A;  3Q19 A;  5HFG A;  5G31 A;  4ML1 A;  4WXT A;  4G0K A;  3KXO A;  1JZR A;  1K0C A;  4I97 A;  3ZFL A;  3H79 A;  2JAC A;  3KGK A;  4PTS A;  1YEP A;  5IM9 A;  2P0G A;  1V57 A;  4PQI A;  3TKP A;  4JU5 A;  2HSM A;  3GX0 A;  12GS A;  1TI3 A;  2IME A;  2PUK C;  2H70 A;  4BVY A;  2PER A;  3EPT A;  5D96 A;  3VPT A;  4ECC A;  4XRA A;  4G2E A;  3ZZX A;  1AQV A;  2CX4 A;  3GRX A;  4IN0 A;  1A23 A;  2X8H A;  3KJY A;  3M9K A;  1U88 A;  3VWX A;  4ZL9 A;  1YY7 A;  2BMX A;  3MIX A;  9GSS A;  3TJG A;  4F2I A;  2H6X A;  2M72 A;  2YAN A;  3C1R A;  2HXK A;  1XVQ A;  1GL8 A;  2DLX A;  3ERF A;  2LRN A;  1K0N A;  2H74 A;  4PNF A;  3APS A;  1SKR B;  1R4W A;  1ZCP A;  4K0N A;  4IQA A;  4JE1 A;  3QAV A;  4L0U A;  1F37 A;  1R7H A;  3DWV A;  4N11 A;  1PGT A;  2FY6 A;  2WCI A;  1WWJ A;  5CRH A;  3TJB A;  4TR1 A;  2FCH A;  3HDC A;  1VF2 A;  4L0W A;  2VO4 A;  2B3S A;  2GZY A;  4ECJ A;  3EU3 A;  1BYE A;  1EGO A;  4GSS A;  5C04 A;  5B6N A;  3A2W A;  5JCW A;  4MJC A;  4PUR A;  3O3T A;  1GTU A;  1N2A A;  4KCA A;  2K9F A;  3J7Y b;  1GH2 A;  1PRX A;  2L4C A;  1ZYE A;  3QR6 A;  2IIY A;  3KMN A;  3VFI A;  1TTZ A;  4HOJ A;  1M2D A;  2OJL A;  3FZA A;  3BBY A;  4BL7 A;  3LGC A;  1GUM A;  1BX9 A;  3IC8 A;  2H1G A;  2YWN A;  2DJ3 A;  3IHQ A;  1DSB A;  1SD9 A;  4HJM A;  4Z7X A;  3WT1 A;  2DJ0 A;  4OD7 A;  5IMA A;  4LL1 B;  2GDR A;  4O5U A;  3R3E A;  3TKQ A;  1GUL A;  1KTE A;  1QFN A;  1FB0 A;  4YKF A;  3UL3 A;  4IGJ A;  4MZB A;  2PVQ A;  3VLN A;  2GVP A;  4XCS A;  2JAD A;  4KSM A;  1ILO A;  2LJR A;  1PN9 A;  1OC9 B;  1TRU A;  6GST A;  4PXO A;  4Q5N A;  1JLW A;  4KF9 A;  1VRS D;  2K8V A;  2QSI A;  1GTB A;  1DE1 A;  1TW9 A;  1ERV A;  5GSS A;  1UA5 A;  1V9W A;  1CQH A;  3BOA A;  5B8B A;  2GSS A;  2I9H A;  2AAW A;  2N5F A;  1SEN A;  3H8Q A;  1A2L A;  2PVO C;  2DKH A;  3M1G A;  1XW5 A;  2IPA A;  1MDJ A;  4XHM A;  4KND A;  4BVY B;  3CYN A;  4KDX A;  2H0I A;  1FHE A;  4CY6 A;  2C80 A;  4YAP A;  5F06 A;  2GS3 A;  2QA1 A;  5A4U A;  1FOV A;  1U87 A;  2EIO A;  5G1L A;  4KA0 A;  1FAA A;  3F4T A;  4JZQ A;  3FR3 A;  3HD5 A;  2K8S A;  4F9Z A;  5KOX A;  2C3Q A;  3KTB A;  4I2T A;  4MCU A;  3E9J B;  4ULX A;  2HYX A;  3ZRD A;  5ENU A;  5B6M A;  1IYH A;  5G2Z A;  2O8V B;  1Z6M A;  2J9H A;  3ERW A;  4KE3 A;  1GP1 A;  2H01 A;  5ECS A;  2FLS A;  2L59 A;  2GQK A;  3U5R E;  3WD6 A;  1XW6 A;  2VM2 A;  3V1W A;  3I6A A;  1XBS A;  5CAX A;  1M0U A;  3WGX A;  4Q5Q A;  1TK8 B;  4KGI A;  4K0G A;  1OKD A;  2ES7 A;  4IW9 A;  1AC1 A;  1G7O A;  3HHV A;  4OMV A;  2DJ2 A;  4ZBA A;  2RM6 A;  4WKW A;  2KHP A;  2YWI A;  5DAK A;  5DBQ A;  1TP9 A;  3KCM A;  3LXT A;  4HS1 A;  4GTU A;  3KIJ A;  5ECK B;  3UJ1 A;  5F05 A;  4GST A;  4K1F A;  4CY8 A;  5JWO B;  2LQO A;  2ON5 A;  3FK8 A;  4GWR A;  3F4R A;  5IPH A;  3P8W A;  4NV2 A;  2FA8 A;  4IJI A;  3ZVJ D;  2AUV A;  1URM A;  1MEK A;  3FZ9 A;  1WP0 A;  2YV9 A;  4QL7 A;  1YJ6 A;  3BJ5 A;  6GSY A;  3A2X A;  4D73 A;  2VCT A;  4OO4 A;  3DYR A;  1TRS A;  5HR3 A;  5IO2 A;  2JZR A;  4HQZ A;  1MD4 A;  1XCC A;  1PD2 1;  1RW1 A;  2WB9 A;  2TRC P;  1TI1 A;  2NTO A;  1GLQ A;  3GIX A;  4HDE A;  3CBU A;  3LW9 A;  5HFI A;  2P5R A;  3IOS A;  4K7I A;  2YNX A;  3CSH A;  1MTC A;  3TJK A;  3IR4 A;  3GUR A;  1XPV A;  3LYK A;  2TRX A;  4ZB8 A;  3KP9 A;  1ZYP A;  5ECO B;  2X4A A;  3CTG A;  2L57 A;  4WBR D;  2ZUP A;  1HYU A;  5L71 A;  1QUW A;  3VI7 A;  1BG5 A;  4GXZ A;  4ZB6 A;  1K0A A;  4K5R A;  5DCH A;  4O5Q A;  4K7N A;  4ZXG A;  1PQN A;  1QQ2 A;  4V1A p;  2MBS A;  3HVS A;  4O7H A;  2R4V A;  1WRY A;  4KW6 A;  3LFL A;  3ZML A;  3HJM A;  3APO A;  5DAL A;  4RQX A;  1OE7 A;  3K8N A;  2YV7 A;  2G2Q A;  4O32 A;  4EIQ A;  4IBP A;  3BD2 A;  4TR3 A;  2FGX A;  2XPE A;  1JZO A;  3QAG A;  4J2F A;  3PH9 A;  1F3A A;  4EE0 A;  2XHF A;  4CW9 A;  2I81 A;  4EKZ A;  1O81 A;  5H5R A;  1Z5Y E;  5F0G A;  4DSQ A;  3VWV A;  3DXB A;  2REM A;  2NDO A;  5DDL A;  1UN2 A;  2CVB A;  3IRA A;  3D21 A;  3IA1 A;  3IAS 2;  4F0C A;  2IMD A;  2H1A A;  4PQH A;  1TJD A;  22GS A;  3ZVJ A;  1ZGN A;  4PQ1 A;  3QD9 A;  4MPG A;  2DBC A;  3QMX A;  4PNG A;  1TK5 B;  2LNS A;  4MH3 A;  5KN1 A;  4EUY A;  5KEJ A;  3ZYW A;  2GT5 A;  3VPQ A;  1EZK A;  2LUS A;  3GH9 A;  5DQS A;  3WGE A;  5JCG A;  3W8J A;  1TXX A;  2L5L A;  5D9X A;  4N0Z A;  2P31 A;  2X49 A;  1B8X A;  1ZOF A;  1AUC A;  1X9S B;  3ZFB A;  2MMN A;  4DEJ A;  4TW5 A;  4KAE A;  5E4W A;  4PGT A;  3GUS A;  4NHZ A;  1I5G A;  4KH7 A;  3I43 A;  5AIS A;  1QK8 A;  3TOU A;  4KX4 A;  1H4O A;  1JZW A;  2CZ2 A;  3EMX A;  4D73 B;  2LJK A;  3GTU B;  4OFN A;  1SJ6 A;  4ACS A;  2LQQ A;  4MDC A;  2A2S A;  4J57 E;  7GSS A;  2LV3 A;  2R0P A;  4TN8 A;  3UBK A;  3UAP A;  3TKS A;  3TUE A;  1HQO A;  1GLP A;  3KEB A;  4KB3 A;  2CVD A;  3L9S A;  5HR1 A;  3DD3 A;  1GUK A;  3A5I A;  4MF5 A;  4HZ4 A;  4F03 A;  3D0Z A;  3HZ8 A;  1O73 A;  1R26 A;  1S3C A;  1TK0 B;  1TRW A;  4X4J A;  2A4V A;  2IL3 A;  5ELG A;  3A3T A;  5D9W A;  2Z9S A;  1PA3 A;  1A24 A;  1SJZ A;  3DIE A;  3AY8 A;  2AJQ B;  5CNW A;  2L6D A;  1T3B A;  5HFK A;  5J4U A;  1JHB A;  1Z7P A;  1PL1 A;  1T7P B;  2FHE A;  3NIV A;  5J9C A;  4ECI A;  2HZE A;  1GRX A;  3EC3 A;  4FQU A;  3GYK A;  3C1S A;  2YJH A;  5AIV A;  2JL4 A;  2GSQ A;  2RII A;  5C00 A;  5DAL B;  2RLI A;  1B9Y C;  5DCG A;  4K9Z A;  1XOA A;  2OE3 A;  2HLS A;  4EDY A;  2K18 A;  2YZH A;  3FZ4 A;  2V41 A;  5CRD A;  3WT2 A;  2C0G A;  4P3Y B;  3KTL A;  2LTK A;  6GSU A;  4F82 A;  4JR4 A;  4IEL A;  3GKK A;  2FWH A;  4XS1 A;  2WJU A;  2H1D A;  3RPP A;  4EC0 A;  4L5O A;  4Z2R A;  2B6M A;  2HRA A;  2L5O A;  3UMA A;  1A0F A;  5F07 A;  4IP6 A;  4O92 A;  1M2B A;  2JU5 A;  1O8W A;  2LRC A;  4NMU A;  3DVX A;  1Y6E A;  4KCE A;  3I69 A;  4Z2T A;  3L4N A;  2CT6 A;  2KP1 A;  2E2G A;  2QKE A;  1BJX A;  4WF4 A;  3KZQ A;  4MP4 A;  4GQC A;  1V98 A;  5E59 A;  1GTA A;  2WS2 A;  3UBL A;  3LJR A;  5ABR A;  1LJR A;  5D73 A;  1AIU A;  1YF0 A;  1R5A A;  6GSV A;  3QOU A;  4KDU A;  2DJ1 A;  2IMK A;  3MWH A;  3I9V 2;  2H73 A;  4I2U A;  1V58 A;  3IHG A;  1THO A;  3EUR A;  1FB6 A;  4PUA A;  3IBH A;  2H8L A;  2LRT A;  2I1U A;  2OAD A;  2V6O A;  3TRQ A;  1OKT A;  4KDY A;  4BWQ A;  2DMM A;  4N30 A;  2XBI A;  3E3E A;  1LBK A;  4Q5F A;  3HZ4 A;  4F0B A;  4WR4 A;  3GA4 A;  1XXU A;  5FT3 A;  2GSR A;  18GS A;  3IAM 2;  3TOT A;  1Z6N A;  1UC7 A;  1W4V A;  2HSY A;  1EEJ A;  2R2J A;  3LYP A;  4K8M A;  2V6K A;  1EGR A;  3MNG A;  2H0H A;  2R0G A;  1E6B A;  3M3M A;  1TOF A;  1XFL A;  2VCX A;  2YCD A;  4ZIL A;  3HJP A;  2A2P A;  2A2R A;  3C73 A;  2B7J A;  1GTI A;  5BMU A;  4IQ1 A;  1X5C A;  4K7O A;  1M9B A;  4E8H A;  2X8G A;  3FKF A;  4YQM A;  19GS A;  1VGL A;  2GQM A;  3GSS A;  3A2V A;  2O89 A;  1THX A;  2C3N A;  2HZE B;  2OKA A;  3FR6 A;  1T4Z A;  4AGS A;  1YEX A;  1WOU A;  1WPI A;  1G7E A;  1NM3 A;  4K2D A;  4EDZ A;  1O6J A;  3S9F A;  1XIY A;  2AB6 A;  1GSY A;  1GSF A;  2NVL A;  5ECH B;  4Z2U A;  1SYR A;  1PX6 A;  3HJO A;  1AW9 A;  3ME7 A;  1SL0 B;  2DKI A;  13GS A;  5KOW A;  3ZIV A;  1F3B A;  1S3A A;  2C4J A;  4QL9 A;  1BAY A;  3D22 A;  4JR6 A;  3HYP A;  3ISO A;  2E2M A;  3CTF A;  4MPF A;  2OE0 A;  4NXI A;  1AQX A;  2PMT A;  3UVH A;  1LU4 A;  3TRX A;  2CVK A;  1EV4 A;  4TXO A;  3DGQ A;  2IN3 A;  1XW9 A;  5J9B A;  1MDI A;  4KSO A;  1DUG A;  3JCM L;  3Q18 A;  2MMA A;  2RUE A;  3O6T A;  2VCV A;  1V2A A;  3G9B A;  5G5F A;  3G7Y A;  4OCF A;  5HQP A;  2H71 A;  1SK2 A;  4I6X A;  2VIM A;  4E8E A;  3TKS E;  2B1K A;  2XPD A;  1DBY A;  4OFM A;  2PBJ A;  5FHI A;  2L6C A;  4LMW A;  4YQU A;  2VCZ A;  3GKX A;  4POM A;  4IP1 A;  1KEB A;  3IK7 A;  2ALB A;  2LNT A;  3R2Q A;  4AJ6 A;  2MYG A;  2DSA A;  4OCE A;  3GMF A;  2H19 A;  4POL A;  1F6M C;  2FNO A;  1NHO A;  1ON4 A;  2OBK A;  2JZS A;  2HT9 A;  1F2E A;  4POB A;  5JWQ B;  4EF0 A;  2D2Z A;  5ELA A;  5CRW A;  2R37 A;  5DVB A;  1RK4 A;  5IMC A;  2B5E A;  4I5Q A;  3GKM A;  3H4K A;  1AQW A;  4H86 A;  1OC3 A;  1YQ1 A;  3ZIJ A;  3ZMK A;  4PX1 A;  3GTU A;  1EOG A;  4X0X A;  5D93 A;  5COH A;  2FWF A;  3DRN A;  3WYW A;  4DSS A;  2IMF A;  1SD8 A;  1NSW A;  3GFK A;  5LD0 A;  3LEF A;  3L9V A;  2DC5 A;  1WIK A;  3IDV A;  2E7P A;  1O85 A;  3VUR A;  1PN0 A;  1X5D A;  5IMV A;  3KP8 A;  3TKS C;  2R0C A;  1E2Y A;  3ERG A;  4YAV A;  2CA8 A;  1U3A A;  2OE1 A;  2VM1 A;  1TU7 A;  4PUF C;  2O7K A;  3OR5 A;  2OA7 A;  1GSE A;  4NV5 A;  5KN3 A;  5ECQ B;  2JSY A;  10GS A;  1ERT A;  4TXV A;  3GST A;  1FO5 A;  2DJK A;  1G0T A;  1SYX A;  3E0U A;  11GS A;  3IXR A;  2KP2 A;  8GSS A;  4OO5 A;  4G10 A;  5GZZ B;  1GNW A;  3F6D A;  2VCQ A;  1OVN A;  1ZMA A;  1A8Y A;  3ZL5 A;  2F8F A;  4K6X A;  1J0F A;  4L8E A;  4MF7 A;  3EIN A;  1SKW B;  1XOB A;  2YPM A;  4ZL8 A;  2M46 A;  2H75 A;  2VD0 A;  4MLY A;  4TXO B;  5B7C A;  3HVX A;  3NOF A;  2H30 A;  3CSJ A;  4JBB A;  1Q4J A;  2C0E A;  2DML A;  1CQG A;  3RPN A;  2N5A A;  4IHU A;  3HCZ A;  4ISD A;  4GF0 A;  1VF1 A;  4BWS A;  1X0R A;  3DKS A;  3TB2 A;  1ABA A;  1M99 A;  3EVI A;  5H5Q A;  2MMZ A;  2FWE A;  2BJX A;  5KN2 A;  2C3T A;  2EIQ A;  3FHK A;  1OYJ A;  3GHA A;  3FZ5 A;  2XBQ A;  1GSS A;  5CRG A;  3TRP A;  4HZ2 A;  2O85 A;  3MSZ A;  5J5N A;  2N5B A;  2VLU A;  4LA1 A;  2FUG 2;  2F3M A;  2C0F A;  4XRD A;  3QDN A;  5IMF A;  3DVW A;  2UZ8 A;  3N9J A;  1RQM A;  4MZW A;  1SK1 A;  2HNL A;  2P5Q A;  1Z7R A;  1Y25 A;  2GZP A;  1F9M A;  1ML6 A;  2H6Z A;  4X1U A;  2F8A A;  4OFT A;  2HE3 A;  1Q98 A;  1GSU A;  1SJI A;  3APQ A;  2V32 A;  4DSS B;  2ON7 A;  3J7Y k;  4USS A;  3LSZ A;  5ECP B;  3FRC A;  2IJY A;  3ZIT A;  3L78 A;  3RDW A;  3QPM A;  2NBS A;  2KLX A;  2AYT A;  2H66 A;  1J08 A;  1H75 A;  3D5J A;  1A0R P;  5IOX A;  4YH2 A;  3EWL A;  2B5X A;  1I9D A;  5CYY A;  2L4Q A;  2YN1 A;  4CDO A;  3ZRE A;  3RHC A;  2C8U A;  3UAR A;  1XWB A;  3EMP A;  3G7J A;  4K2X A;  1TDI A;  2LKU A;  2MBT A;  1AXD A;  4RQR A;  4ZBD A;  1Z3E A;  4EL1 A;  4L5L A;  4IJ3 A;  3F8U A;  2VAF A;  4NAX A;  4BVX A;  4IS0 A;  1TRV A;  5CP1 A;  5D8I A;  5B8A A;  5A4V A;  4TKY A;  1WJK A;  4I8B A;  3HVV A;  5GST A;  3TCO A;  3IV4 A;  4V1A g;  3HKR A;  3LXZ A;  1M9A A;  3C71 A;  4ZB9 A;  2IFQ B;  1S3D A;  3GV1 A;  2X99 A;  2KUC A;  3CRT A;  3P90 A;  4J56 E;  2HI7 A;  1SU9 A;  1HNA A;  4FIW A;  3M8N A;  4MF6 A;  1XVW A;  3BCK A;  1WE0 A;  4NHW A;  5IMZ A;  2IWT A;  4N0V A;  4FYC A;  3VWU A;  4OWY A;  6GSS A;  4LLR A;  1UVZ A;  2VUP A;  3KD0 A;  6GSX A;  4WR5 A;  1ZYN A;  1BED A;  4MJE A;  4FO5 A;  2IMI A;  2MZC A;  2QC7 A;  2FA4 A;  1XWK A;  1K0O A;  5INY A;  1HD2 A;  4GCI A;  3SBC A;  1K3O A;  3QFB C;  1ACV A;  1OC8 A;  2FWG A;  4ZL7 A;  3WGD A;  2H1B A;  5ID2 B;  1GWC A;  2GT6 A;  1M2A A;  2C1Y A;  4N10 A;  3NZN A;  3IE3 A;  1EWX A;  4HU7 A;  1XWA A;  2AV4 A;  2CAQ A;  3EE2 A;  1DE2 A;  4TVE A;  3MYD A;  3HXS A;  4G9H A;  1B4P A;  2X64 A;  4XTS A;  3C8E A;  4X43 A;  1PX7 A;  3DEX A;  2F51 A;  2HRK A;  2GST A;  1JLV A;  3VK9 A;  2GQL A;  1R5P A;  3FMW A;  5JCU A;  2VL2 A;  4DVC A;  14GS A;  1ST9 A;  2QA2 A;  2CZ3 A;  2H0G A;  3LOR A;  3LQ7 A;  1EV9 A;  5F8B A;  3G7I A;  1YF1 A;  2M80 A;  3KH9 A;  4LMV A;  3D4T A;  4MZC A;  2GTU A;  4G0I A;  4QQ7 A;  3O76 A;  1ZZY A;  4NWY A;  4V2N A;  1TKD B;  4MJB A;  3EU4 A;  3TJJ A;  6GSW A;  1FVJ A;  2TIR A;  1C72 A;  2YZU A;  2AHE A;  2PU9 C;  3IK9 A;  1PL2 A;  4ILF A;  3KMO A;  4XS4 A;  4GLT A;  3H1N A;  5A5K A;  1T8E B;  1B48 A;  5IO0 A;  3RAZ A;  4BVX B;  1WMJ A;  2WRT A;  2R6K A;  2H72 A;  1EEM A;  1XZO A;  2VLV A;  4HUA A;  2VL9 A;  3GKN A;  4IKH A;  2OBI A;  2RUF A;  1VF4 A;  2YJ7 A;  4ML6 A;  2ZNM A;  3TKR A;  2VOC A;  3PGT A;  16GS A;  3Q6O A;  3MDK A;  2WFC A;  4AJ8 A;  1O7U A;  1A2J A;  5IMD A;  4FYU A;  4DSR A;  2PGT A;  2YP6 A;  1VF3 A;  4TR4 A;  2H6Y A;  3F6F A;  2GGT A;  1K0D A;  1V40 A;  3F3Q A;  3VI5 A;  1XWC A;  2I4A A;  3LG6 A;  3F3R A;  3FYG A;  2WZ9 A;  1GSQ A;  5JWR B;  3F63 A;  1PMT A;  3ZLP A;  5IPG A;  5ECI B;  4A5P A;  5FWG A;  4HI7 A;  1YKC A;  1NHY A;  2NPB A;  3TDG A;  4JED A;  1U3I A;  2B7K A;  1O8X A;  3KM6 A;  3ED3 A;  3CXG A;  3H93 A;  3TGZ A;  2HRN A;  4MMM A;  3M9J A;  4EO3 A;  5IOW A;  2V2G A;  2F9S A;  3GL3 A;  2R3X A;  1K3L A;  1KBN A;  3U6V A;  5D9T A;  3A5W A;  2LEG A;  4EIP A;  5ECM B;  5GAN D;  4FYB A;  5LCZ A;  1QMV A;  1ZYQ B;  3GL5 A;  2CQ9 A;  4K5S A;  3CMI A;  3GH6 A;  3N5O A;  2YWO A;  1EOH A;  1TU8 A;  3UVT A;  2LS5 A;  3QCP A;  3UIW A;  4TR1 B;  1SL1 B;  4MH2 A;  4HJ2 A;  1FW1 A;  1KNG A;  2KOK A;  1X5E A;  3FEU A;  3P7X A;  1XWG A;  4V2L A;  5J3R A;  5LNK e;  3VWW A;  3RHB A;  1EP7 A;  1M7T A;  4KUN A;  2I3Y A;  3PIN A;  1PKW A;  1FVK A;  1X9W B;  5AGY A;  5HR0 A;  5EY6 A;  2B1L A;  4WET A;  2X8C A;  2CAI A;  4BL7 B;  1YDK A;  2VL3 A;  1T4Y A;  4EXJ A;  1G6W A;  2HSH A;  3DML A;  2V1M A;  2EIR A;  2B5Y A;  1K0M A;  5CRE A;  4YKG A;  3IPZ A;  5H5S A;  4JRR A;  2GZZ A;  3TJF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...